BYKdb

Dataset for cluster tadcd of phylum kiritimatiellaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2E0R8R5      MEHVDMQANESSQKTPSLEDEGIDLVELFGVLFARKILIISITLIFAIGALLYVIFATPI
A0A2E3TL68      -----------MIEENNENKNNPHFLDYWRVLRSRKELILAITFIVVLTGTIYTLLLPNV
A0A6C2U5Z6      -----------MSTETAQQSSTLHFLDYWRVIRSRKEIVLAVAILVVLTGTVYTLMLPNI
A0A2E1U4L9      -----------MNNEANQQPSSLHFLDYWRVISSRKELILAVAFLVVLTGTVYTLLLPNI
A0A1Z9TC99      -----------MNDQSDQQSNSLHFLDYWRVISSRKELVLAVAFLVVLTGTVYTLLLPNI
A0A2E1U172      -----------MNDQSEQQGSTLHFLDYWRVISSRKELVLAVAFLVVLTGTVYTLLLPNI
A0A520SZH7      -----------MNDQSEQQGSTLHFLDYWRVISSRKELVLAVAFLVVLTGTVYTLLLPNI
A0A6P1MB10      ------------MNENQSKETTLHFLDYWRVIRSRKEIVLAVLFLVVITGTVYTFTLPKI
A0A0G3EFP6      ------MDQPNPNQQQKDSDGGLHFLDYWRVIRARKEIILAVALLVVLVGTAYTFTLPRI
A0A2E0R7L7      -----------MNNKADQETSSVHFLDYWRVISSRKELILAIAFLVVLTGTVYTXLLPSI
A0A6C2UMK3      -----------MTNENEQQGSTLHFLDYWRVIRSRKEIVLAVAILVVLTGTVYTLMLPNI
                                  .     ::: : *: :** ::::: ::..: .  *.   . :

A0A2E0R8R5      YKATAMVQVEESGPSMPGFDDMAGMFEETSKSV---TEIELLKSRRVIGEAVDALKLDIV
A0A2E3TL68      FSSSSRISVSEDKPEINPFQA-ELMY-ERYDPYYLKTQFEILQSKPILNEVIYRLNLQE-
A0A6C2U5Z6      YRSQVRISVYEDSPEINPFAG-QQIYGTSYNPYFLRTQFEIIQSKPILYEVVTRLNLQQ-
A0A2E1U4L9      YASSSRILVSEDSPEINPFAV-QQNYMSTYNPYFLRTQFEILTSKPILNEVIYRLNLQS-
A0A1Z9TC99      YAASSRISVSEDMPEINPFAV-QQNYMTSYNPYFLKTQFEILTSKPILNEVINRLNLQV-
A0A2E1U172      YASSARISVSEDSPEINPFAV-QQNYMTPYNPYFLKTQFEILTSKPILNEVINRLSLQV-
A0A520SZH7      YASSARISVSEDSPEINPFAV-QQNYMTSYNPYFLKTQFEILTSKPILNEVINRLSLQV-
A0A6P1MB10      YAAEARIEVNNDNVNLDPFSY-SPMDGSRYDPYFLRTQYEIIKSKPILYEVINRLNLQE-
A0A0G3EFP6      YRSTATIKVNNEGTDVDVFRN--EGGRSLYNPYFLRTQQRIISSRPVLYEVIERLNLRK-
A0A2E0R7L7      YASSSRIMVSEDTPEINPFAS--QQNYMMYNPYFLRTQFEILTSKPILNEVIHRLNLQN-
A0A6C2UMK3      YAASARILVSEDAPEINPFGAGGQSYYTSYNPYFLRTQFEVLQSKPMLYEVINRLNFQE-
                : :   : * :.  .:  *           ..    *:  :: *. :: *.:  *.:   

A0A2E0R8R5      AKPNLFPAVGGKFYRDHKPATDGALASAKLGAITYAWGGEQIEVFRLELPGYLMNEPLTL
A0A2E3TL68      -----------------------------------KWGKD----------G-SLSREVAY
A0A6C2U5Z6      -----------------------------------EWGKE----------GEKLPREVAY
A0A2E1U4L9      -----------------------------------EWGKN----------NEILKRDIAL
A0A1Z9TC99      -----------------------------------EWGQD----------GQTLSRDVAL
A0A2E1U172      -----------------------------------EWGKN----------GETLSRDVAL
A0A520SZH7      -----------------------------------EWGKN----------GETLSRDVAL
A0A6P1MB10      -----------------------------------AWGKD----------GQNVPKEKAY
A0A0G3EFP6      -----------------------------------VWGNE----------DRKIPEDVAL
A0A2E0R7L7      -----------------------------------EWGKD----------GKVLTRDVAL
A0A6C2UMK3      -----------------------------------EWGKA----------GEKLPRDVAY
                                                    **            .  :    : 

A0A2E0R8R5      RVEENNQITLQHKKSILLQGTVGQDLVANGVALSVRDLSARPGTEFTLMRQDRFQTILKL
A0A2E3TL68      KILKNSLSIFQQ------------------------------------------------
A0A6C2U5Z6      KILANSVNVIQQ------------------------------------------------
A0A2E1U4L9      KILKNSISVFQQ------------------------------------------------
A0A1Z9TC99      KILKNSVSVFQQ------------------------------------------------
A0A2E1U172      KILKNSVSVFQQ------------------------------------------------
A0A520SZH7      KILKNSVSVFQQ------------------------------------------------
A0A6P1MB10      KILFSSLDVAQS------------------------------------------------
A0A0G3EFP6      NILRRSINLSAA------------------------------------------------
A0A2E0R7L7      KILRNSVSVFQQ------------------------------------------------
A0A6C2UMK3      KILKNSISVFQQ------------------------------------------------
                .:   .                                                      

A0A2E0R8R5      QQGIGASEKGKDSGIILLSYQSENPQLAKEILDQIAEIYVRQNVERNSAEAQKSLDFLKV
A0A2E3TL68      ----------RDTSLIVINVKRNNPNEAAEIANEIAQVYRDSRIELVTKNTRNALDKIDE
A0A6C2U5Z6      ----------RDTTLIVISVNRDNPDEAADIANELAEVYRDSRLDVALRDAKGAIDKIEQ
A0A2E1U4L9      ----------RDTSLIVINVKRDNPDEAADIANEIAQVYRDSRLELASKSAREAIDKIEE
A0A1Z9TC99      ----------RDTSLIVINVKRDNPDEAADIANEIAEVYRDSRLDLASRDARIAIDKIEE
A0A2E1U172      ----------RDTSLIVINVKRDNPNEAADIANEIAEVYRDSRLDLASKDARTAIDKIEE
A0A520SZH7      ----------RDTSLIVINVKRDNPNEAADIANEIAEVYRDSRIDLASKVARTAIDKIEE
A0A6P1MB10      ----------RDTSLIALRARRQDPREAMRIANTLADVYRDQRLDLKYKEMTRSIDALRR
A0A0G3EFP6      ----------PDTSLISIIAEREKPEEAARIANQVAEVYRDMRRDVKRKEMRNAIEELRT
A0A2E0R7L7      ----------RDTSLIVINVKRDNPNEAADIANEIAQVYRDSRLDLASKNARGAIDKIEE
A0A6C2UMK3      ----------RDTSLIVISVKRDNPNEAAKIANEISEVYRDSRLDLAYNGARIAIDKIAE
                           *: :* :    :.*  *  * : ::::*   . :        ::: :  

A0A2E0R8R5      QLPEVKKQLEEAEQKFNDYQIRQKSVDI-----------------------------SLE
A0A2E3TL68      SISQQRIRVDEAEENIQKIREELDIAVV--GGE-GQFDVGEVRMQTLERDRLAAQREMVE
A0A6C2U5Z6      AVKDQLLRVEDAEDKVQNLRTTLDIAVM--GGE-GSIDVDEIRLQQMEGDRLAAQSEMLD
A0A2E1U4L9      SLTEQRQRVANAEENIQKIREDLNIAVV--GGE-GQFDVGEVRMQQLEGDRLFAQREMVE
A0A1Z9TC99      SLSEQRQRVADAEENIQQIREDLNIAVV--GGE-GQFDVGEVRMQQLEGDRLFAQREMVE
A0A2E1U172      SLSEQRQRVADAEENIQQIREDLNIAVV--GGE-GQFDVGEVRMQQLEGDRLFAQREMVE
A0A520SZH7      SLSEQRQRVADAEENIQQIREDLNIAVV--GGE-GQFDVGEVRMQQLEGDRLFAQREMVE
A0A6P1MB10      ELENQQEKVDTAEQQVEELREKLGITVLSEGVDGGSASIEKLRLQQLEGDRVSARVDMLV
A0A0G3EFP6      QLQKQQTKVDEAEQEMERIRQELDVTFV--GNEQSGVSVDKMRLQQLEGDRIQARVEMLV
A0A2E0R7L7      SLTEQRQRVASAEENIQKIREDLNIAVV--GGE-GQFDVGEVRMQQLEGDRLFAQREMVE
A0A6C2UMK3      AMKSQRERVDAAEQVVEDLRKELDIAVI--GGE-GNVDVTDVRLQQLEGDRLAAQREMVD
                 : .   .:  **: .:  .     . :                              : 

A0A2E0R8R5      TQGVLEQIVELETK---------------------LQELELRRLEMSRRFKREHP-----
A0A2E3TL68      KKGLLDILNNIGDEDLAEQASFITFDQFVVDIVRSMELLEVELSALDADFGKNHPEVKRL
A0A6C2U5Z6      KESLIKTLESLKDEDLIEQASYITFDQIVVSTVQQIQDIDVQLSSLDADFGVNHPEVKRY
A0A2E1U4L9      KEGLLRILEDLNDKDLLERASYITFDQFVMNTIQQIQDIEVNLSSVQADYGDNHPEVKRL
A0A1Z9TC99      KEGLLKILENLDDKDLLEQASYITFDQSVMNTIQQIQDVEVQLSSVQEDYGDNHPEVKRL
A0A2E1U172      KEGLLKILENLNDKDLLERASYITFDQSVMNTIQQIQDVEVQLSSVQADYGDNHPEVKRL
A0A520SZH7      KEGLLKILENLNDKDLLERASYITFDQSVMNTIQQIQDVEVQLSSVQADYGDNHPEVKRL
A0A6P1MB10      QKARYEQLEAMSNDDLLTASAYLASDPFVESMRTEIKNLDVQLSSLLENYGVNHPEVKQA
A0A0G3EFP6      RKARFEQMQALEGPELLNASEYVVKDPNLSDLRKQILDTDVSLSLMSENYGQNHPEVKRL
A0A2E0R7L7      KEGLLRILEDLNDKDLLERASYITFDQFVMNTIQQIQDIEVNLSSVQADYGNNHPEVKRL
A0A6C2UMK3      KEVQLNILKDLGDKDLSEQASYITFDQFVMSTMQQIQDINVQLSSLNADYGENHPEVQRT
                 :     :  :                        :   ::    :   :  :**     

A0A2E0R8R5      -----------------LYQGVVEQIKLVKEQKDVL-----TTRVTDLPETQQELLRYTR
A0A2E3TL68      VFQKNSLEKNLKQRLDALRNGLQTEYSIAKSKFDGLDQVLKSVRSDSIETQGAKYRPYRN
A0A6C2U5Z6      ALQKSKLEETLKQRLRALRNGLQTDYILAKSRFESLDKALAGVRSTSIESQGEKYRPFRI
A0A2E1U4L9      KSQIVTLEETLKKRLSALRNGLDTEYIIAKNNFESLDKVLASVRTDTIESQGAKFRPYRN
A0A1Z9TC99      KSQIITLEGTLKKRLNGLRNGLETEYIIAKNNFESLDKVLASVRTDTIESQGAKFRPYRN
A0A2E1U172      KSQIATLEGTLTRRLNGLRNGLETEYVIAKNNFESLDKVLASVRTDTIESQGTKFRPYRN
A0A520SZH7      KSQIATLEGTLTRRLNGLRNGLETEYVIAKNNFESLDKVLASVRTDTIESQGTKFRPYRN
A0A6P1MB10      KAARDELMGKLAQALDGIKKGVKAQYVISKSKFDALEEELRGAQSEDRQSQREKLLPFNK
A0A0G3EFP6      RAAREELMGKLEEALDGLIKGLKADYEVARANYEALEKELAGIREEERQTQRESLLPFNK
A0A2E0R7L7      RSQIVTLEETLKKRLTALRNGLDTEYIIAKNNFESLDKVLASVRTDTIESQGAKFRPYRN
A0A6C2UMK3      RMQRDTLEATLTNHIKALRNGLETEYLRAKSNFEHLGAILASVRSTNIESQGAKFRPFRN
                                 : :*:  :    . . : *       .         .   :  

A0A2E0R8R5      ---DVQVSSEIYTMLLGKAQELDIMRAGTVGNVRIVDHAAVDLQHPIKPRKSLLVVLITL
A0A2E3TL68      ALADLETERFIYNQLLAKHRQEIITMQLPRNPVNIIDVAEANLR-PVSPNLFINVLISIF
A0A6C2U5Z6      ALAELETERFIYNQLMSKHRQEIITLEVPGNPVEIIDVAEPNRR-PVSPNLFMNVLLSIF
A0A2E1U4L9      ALADLETERFIYNQLMSKHRQEIITLQVPQNPVDIIDVAEPNMQ-PVSPNLFLNVLLSIF
A0A1Z9TC99      ALADLETERFIYNQLMSKHRQEIITLQVPRNPVDVIDIAEPNMR-PVSPNLFLNVLLSIF
A0A2E1U172      ALADLETERFIYNQLMSKHRQEIITLQVPRNPVDVIDIAEPNAR-PVSPNLFLNVLLSIF
A0A520SZH7      ALADLETERFIYNQLMSKHRQEIITLQVPRNPVDVIDIAEPDAR-PVSPNLFLNVLLSIF
A0A6P1MB10      AQRELDLQRSLLDALKARLAQEGITLKVPRTPVEIVDAAEESNR-PVSPNLFLNMLLSIF
A0A0G3EFP6      ARRNLEIQRSILDALKARVTQEGITLEIPRTAVEVIEPAEPGSS-PVSPNLFLNVLMSVF
A0A2E0R7L7      ALADLETERFIYNQLMAKHRQEIITLQIPRNPVDIIDVAEPNMQ-PVSPNLFLNVLMSIF
A0A6C2UMK3      AQADLESERFIYTQLKAKHRQEIITLEVPSNPVEIIDVAEPENR-PVSPNLFMNVLLSIF
                   ::: .  :   * ..  :  *    .   * ::: *      *:.*.  : :::  :

A0A2E0R8R5      LGFGLACAYVLIVRAIHRGLEDPSEVEA-IGMPVYATIPQSDKLLKNSKSKADKGKRTSR
A0A2E3TL68      AGLGAGIGLAYFIEYLDTSVKTVEDVENKLKLKVLGLVPQKVRPLIE-------------
A0A6C2U5Z6      VGLGAGVGLAYFIEYLDTSIKTADDVERILGLPVLGLIPQKVRPLIE-------------
A0A2E1U4L9      VGLGAGVGLAYFIEYLDTSVKSADDLENQLKLKVLGLVPQKVRPLIE-------------
A0A1Z9TC99      VGLGAGVGLAYFIEYLDRSIKSADDIENLLKLKVLGLVPQKVRPLIE-------------
A0A2E1U172      VGLGAGVGLAYFIEYLDRSIKSADDIENQLKLKVLGLVPQKVRPLIE-------------
A0A520SZH7      VGLGAGVGLAYFIEYLDRSIKSADDIENQLKLKVLGLVPQKVRPLIE-------------
A0A6P1MB10      VGLGAGVGLAYFIEYLDTSIKTADDVERWVDLPVLGLIPQKVRPLIE-------------
A0A0G3EFP6      LGLGAGVGLAYFIEYLDTSIKTADDVERYLSLPVLGLVPQKVRPMIE-------------
A0A2E0R7L7      VGLGAGVGLAYFIEYLDTSVKNADDIENQLQLKVLGLVPQKVRPLIE-------------
A0A6C2UMK3      VGLGAGVGLAYFIEYLDTSIKTADDVERLLGLPVLGLIPQKVRPLVE-------------
                 *:* . . . ::  :  .::  .::*  : : * . :**. . : :             

A0A2E0R8R5      DLLAVDHPTDLSVEALRGLRTSLHFAM-LDAKNNVIVISGPSPGIGKSFVSTNLGAVIAQ
A0A2E3TL68      -----EGPDSENAESYRVLKTNLDFSS-NHEVGGAYSVISAGAGEGKSTTVFNLAYVAAQ
A0A6C2U5Z6      -----EGPDSEHAEAYRVLRTNLAFTE-GGATHGAFSVLSGGAGEGKSTTVFNLAFVCAQ
A0A2E1U4L9      -----EGPDSENAESYRVMKTNLSFIA-NENEGMAHCVLSSGAGEGKSTTVFNLAYVAAQ
A0A1Z9TC99      -----EGPDSENAESYRVMKTNLQFTN-EQEEGLAHCVLSSGAGEGKSTTVFNLAYVAAQ
A0A2E1U172      -----EGPDSENAESYRVMKTNLAFMS-DSDEGVAHCVLSSGAGEGKSTTIFNLAYVAAQ
A0A520SZH7      -----EGPDSENAESYRVMKTNLAFMS-DSDEGVAHCVLSSGAGEGKSTTIFNLAYVAAQ
A0A6P1MB10      -----EGPDSDHAEGYRVLRTNMSFTDAGGPTKGAFAVLSGGAGEGKSTTAFNLAYVCAQ
A0A0G3EFP6      -----EGPDSEHAEAYRVLRTNLTFTN-EGQTKGTFLCTSGGAGEGKSTTIFNLAYICAQ
A0A2E0R7L7      -----EGPDSENAESYRVMKTNLSFTA-KENVGMAYCVLSSGAGEGKSTTVFNLAYVAAQ
A0A6C2UMK3      -----EGPDSEHAEAYRVLRTNLAFTE-GGSNRGAFCVLSGGAGEGKSTTVFNLAYVCAQ
                     : * .  .*. * :.*.: *         .    . ..* *** .  **. : **

A0A2E0R8R5      GGKKVLLIDGDMRRGDLQDHLGMSFDAGLTGYLSGQYALEEVVRTTVVEGLDIIPRGIVA
A0A2E3TL68      QGMKVLLMDADLRRPVQHIILGMSNRFGLTNVLLRDVPAEEAIKATSIPNLQFLPSGRLP
A0A6C2U5Z6      QGEKVLLVDADLRRPVQHTILGVSNRFGLTNVLLRDVPVEEAIKATSVPNLHFLPSGRLP
A0A2E1U4L9      QGVKVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAIKATSIPNLQFLPSGRLP
A0A1Z9TC99      QGQRVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAIKATSVPNLQFLPSGRLP
A0A2E1U172      QGQRVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAIKATSVPNLQFLPSGRLP
A0A520SZH7      QGQRVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAIKATSVPNLQFLPSGRLP
A0A6P1MB10      QGEKVLLVDADLRRPVQHTILGVSNRFGLTNVLLRDVPVEETIKTTSVPNLHFLPSGRLP
A0A0G3EFP6      RGEKVLLIDSDLRRPVQHRILDTDNRFGLTNVLLRDVPVEETIKPTSVPNLHFLPSGRLP
A0A2E0R7L7      QGSKVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAVKATSIPNLQFLPSGRLP
A0A6C2UMK3      QGEKVLLVDADLRRPVQHSILGVSNRFGLTNVLLRDVPVEEAIKATSVPNLHFLPSGRLP
                 * .***:*.*:**   :  *. .   ***. *  : . **.:..* : .* ::* * :.

A0A2E0R8R5      PNPSELLMHPRFSELINYASENYDLVIVDTPPVLAVTDPVIIASHAGATLLVARYGITHK
A0A2E3TL68      RASLGVLDPKKIRELINSLKSKYDLVLIDTPPVVGLSDASIIGKETDGSILVVQYRKYPL
A0A6C2U5Z6      RTSLGVLDPKRIGELIASLKTKYDVVLIDTPPLVGISDSSIIAKETDGAIIVVQYRKYPR
A0A2E1U4L9      RASLGVLDPRKIRELVQSLKSKYDLVFIDTPPIVGMSDANIIAKEVDSSILVVQYRKYPL
A0A1Z9TC99      RASLGVLDPKKIRELIQSLKMKYDLVFIDTPPVVGISDSSIIAKEADSSILVIQYRKYPI
A0A2E1U172      RASLGVLDPKKIRELIQSLKLKYDLVLIDTPPVVGISDSSIIAKEVDSSVLVIQYRKYPI
A0A520SZH7      RASLGVLDPKKIRELIQSLKLKYDLVLIDTPPVVGISDSSIIAKEVDSSVLVIQYRKYPI
A0A6P1MB10      RTSLGVLDPKRIGELVSSLKSKYDVVIFDTPPLVGISDSAVIAKEVDGIIMVVQYRKYPR
A0A0G3EFP6      RTSLGLLESQRMKELIHNLRSKFDVIFLDSPPVIGISDASILASAVDRVIMVCQYRKYPR
A0A2E0R7L7      RASLGVLDPKKISELVNSLKSKYDIVLIDTPPIVGISDANIIAKEVDSSILVVQYRKYPL
A0A6C2UMK3      RTSLGVLDPKRIGELISSLKSKYDIVLIDTPPLVGISDSSILAKEADGAILVVQYRKYPR
                  .  :*   .: **:     ::*:::.*:**::.::*. ::.. ..  ::* .*     

A0A2E0R8R5      KELEISQQRFEQNGVSVQGIVFNAVQKRGGKYGSYGYNNYE--YGNE-------------
A0A2E3TL68      DMINKAKLSLIAQDIDITGVVMNNINITRDDYYYYYHTYYSDYYGS--SDEETQEGSI--
A0A6C2U5Z6      EMLMKAKHMIEALGVSVVGAVLNNINVMRDDYYYYYHSYYSDYYHSS-QSDVMSDDNV--
A0A2E1U4L9      NMIRKAVETLQAQSIDIAGAVLNNINVMRDDYYYYYQSYYSDYYQR--DDDDAEADLI--
A0A1Z9TC99      DMLRKALASLQAQSINISGAVLNNINVMRDDYYYYYHSYYSDYYQQS-DEDNTEVQTV--
A0A2E1U172      DMLRKALASLQAQSINVAGAVLNNINVMRDDYYYYYHSYYSDYYQQN-DDDQAEAKTI--
A0A520SZH7      DMLRKALASLQAQSINVAGAVLNNINVMRDDYYYYYHSYYSDYYQQNDDDDQAEAKTI--
A0A6P1MB10      DMIIRAKQMLDTLGVEQVGVVLNNINIMRDDYYYYYHSYYSNYYYYRSDESLPAGSPEHS
A0A0G3EFP6      DMAMRAKQLLESSNARVSGVVLNNINVMRDDYYYYYHSYYYNYYYYRSGESAPQETETAE
A0A2E0R7L7      NMLRKAVSTLQAQSIEIAGAVLNNINVMHDDYYYYYHGYYSDYYH--RDDDEAEADLI--
A0A6C2UMK3      DMLIKAKSMMEALGVNAVGAVLNNINVMRDDYYYYYHSYYSDYYRSSQGSDGLGDDSV--
                .    :   :   .    * *:* ::   ..*  *    *   *                

A0A2E0R8R5      --
A0A2E3TL68      --
A0A6C2U5Z6      --
A0A2E1U4L9      --
A0A1Z9TC99      --
A0A2E1U172      --
A0A520SZH7      --
A0A6P1MB10      ES
A0A0G3EFP6      G-
A0A2E0R7L7      --
A0A6C2UMK3      --
                  

© 1998-2021Legal notice