BYKdb

Dataset for cluster tadcd of phylum kiritimatiellaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

10 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2E0R8R5      MEHVDMQANESSQKTPSLEDEGIDLVELFGVLFARKILIISITLIFAIGALLYVIFATPI
A0A2E3TL68      -----------MIEENNENKNNPHFLDYWRVLRSRKELILAITFIVVLTGTIYTLLLPNV
A0A6C2U5Z6      -----------MSTETAQQSSTLHFLDYWRVIRSRKEIVLAVAILVVLTGTVYTLMLPNI
A0A2E1U4L9      -----------MNNEANQQPSSLHFLDYWRVISSRKELILAVAFLVVLTGTVYTLLLPNI
A0A1Z9TC99      -----------MNDQSDQQSNSLHFLDYWRVISSRKELVLAVAFLVVLTGTVYTLLLPNI
A0A2E1U172      -----------MNDQSEQQGSTLHFLDYWRVISSRKELVLAVAFLVVLTGTVYTLLLPNI
A0A520SZH7      -----------MNDQSEQQGSTLHFLDYWRVISSRKELVLAVAFLVVLTGTVYTLLLPNI
A0A0G3EFP6      ------MDQPNPNQQQKDSDGGLHFLDYWRVIRARKEIILAVALLVVLVGTAYTFTLPRI
A0A2E0R7L7      -----------MNNKADQETSSVHFLDYWRVISSRKELILAIAFLVVLTGTVYTXLLPSI
A0A6C2UMK3      -----------MTNENEQQGSTLHFLDYWRVIRSRKEIVLAVAILVVLTGTVYTLMLPNI
                                  .     ::: : *: :** ::::::::..: .  *.   . :

A0A2E0R8R5      YKATAMVQVEESGPSMPGFDDMAGMFEETSKSV---TEIELLKSRRVIGEAVDALKLDIV
A0A2E3TL68      FSSSSRISVSEDKPEINPFQA-ELMY-ERYDPYYLKTQFEILQSKPILNEVIYRLNLQE-
A0A6C2U5Z6      YRSQVRISVYEDSPEINPFAG-QQIYGTSYNPYFLRTQFEIIQSKPILYEVVTRLNLQQ-
A0A2E1U4L9      YASSSRILVSEDSPEINPFAV-QQNYMSTYNPYFLRTQFEILTSKPILNEVIYRLNLQS-
A0A1Z9TC99      YAASSRISVSEDMPEINPFAV-QQNYMTSYNPYFLKTQFEILTSKPILNEVINRLNLQV-
A0A2E1U172      YASSARISVSEDSPEINPFAV-QQNYMTPYNPYFLKTQFEILTSKPILNEVINRLSLQV-
A0A520SZH7      YASSARISVSEDSPEINPFAV-QQNYMTSYNPYFLKTQFEILTSKPILNEVINRLSLQV-
A0A0G3EFP6      YRSTATIKVNNEGTDVDVFRN--EGGRSLYNPYFLRTQQRIISSRPVLYEVIERLNLRK-
A0A2E0R7L7      YASSSRIMVSEDTPEINPFAS--QQNYMMYNPYFLRTQFEILTSKPILNEVIHRLNLQN-
A0A6C2UMK3      YAASARILVSEDAPEINPFGAGGQSYYTSYNPYFLRTQFEVLQSKPMLYEVINRLNFQE-
                : :   : * :. ..:  *           ..    *:  :: *. :: *.:  *.:   

A0A2E0R8R5      AKPNLFPAVGGKFYRDHKPATDGALASAKLGAITYAWGGEQIEVFRLELPGYLMNEPLTL
A0A2E3TL68      -----------------------------------KWGKD----------G-SLSREVAY
A0A6C2U5Z6      -----------------------------------EWGKE----------GEKLPREVAY
A0A2E1U4L9      -----------------------------------EWGKN----------NEILKRDIAL
A0A1Z9TC99      -----------------------------------EWGQD----------GQTLSRDVAL
A0A2E1U172      -----------------------------------EWGKN----------GETLSRDVAL
A0A520SZH7      -----------------------------------EWGKN----------GETLSRDVAL
A0A0G3EFP6      -----------------------------------VWGNE----------DRKIPEDVAL
A0A2E0R7L7      -----------------------------------EWGKD----------GKVLTRDVAL
A0A6C2UMK3      -----------------------------------EWGKA----------GEKLPRDVAY
                                                    **            .  :   :: 

A0A2E0R8R5      RVEENNQITLQHKKSILLQGTVGQDLVANGVALSVRDLSARPGTEFTLMRQDRFQTILKL
A0A2E3TL68      KILKNSLSIFQQ------------------------------------------------
A0A6C2U5Z6      KILANSVNVIQQ------------------------------------------------
A0A2E1U4L9      KILKNSISVFQQ------------------------------------------------
A0A1Z9TC99      KILKNSVSVFQQ------------------------------------------------
A0A2E1U172      KILKNSVSVFQQ------------------------------------------------
A0A520SZH7      KILKNSVSVFQQ------------------------------------------------
A0A0G3EFP6      NILRRSINLSAA------------------------------------------------
A0A2E0R7L7      KILRNSVSVFQQ------------------------------------------------
A0A6C2UMK3      KILKNSISVFQQ------------------------------------------------
                .:  ..                                                      

A0A2E0R8R5      QQGIGASEKGKDSGIILLSYQSENPQLAKEILDQIAEIYVRQNVERNSAEAQKSLDFLKV
A0A2E3TL68      ----------RDTSLIVINVKRNNPNEAAEIANEIAQVYRDSRIELVTKNTRNALDKIDE
A0A6C2U5Z6      ----------RDTTLIVISVNRDNPDEAADIANELAEVYRDSRLDVALRDAKGAIDKIEQ
A0A2E1U4L9      ----------RDTSLIVINVKRDNPDEAADIANEIAQVYRDSRLELASKSAREAIDKIEE
A0A1Z9TC99      ----------RDTSLIVINVKRDNPDEAADIANEIAEVYRDSRLDLASRDARIAIDKIEE
A0A2E1U172      ----------RDTSLIVINVKRDNPNEAADIANEIAEVYRDSRLDLASKDARTAIDKIEE
A0A520SZH7      ----------RDTSLIVINVKRDNPNEAADIANEIAEVYRDSRIDLASKVARTAIDKIEE
A0A0G3EFP6      ----------PDTSLISIIAEREKPEEAARIANQVAEVYRDMRRDVKRKEMRNAIEELRT
A0A2E0R7L7      ----------RDTSLIVINVKRDNPNEAADIANEIAQVYRDSRLDLASKNARGAIDKIEE
A0A6C2UMK3      ----------RDTSLIVISVKRDNPNEAAKIANEISEVYRDSRLDLAYNGARIAIDKIAE
                           *: :* :  : ::*: *  * ::::::*   . :      . ::: :  

A0A2E0R8R5      QLPEVKKQLEEAE-------------------QKFNDYQIRQKSVDIS--------LETQ
A0A2E3TL68      SISQQRIRVDEAEENIQKIREELDIAVVGGE-GQFDVGEVRMQTLERDRLAAQREMVEKK
A0A6C2U5Z6      AVKDQLLRVEDAEDKVQNLRTTLDIAVMGGE-GSIDVDEIRLQQMEGDRLAAQSEMLDKE
A0A2E1U4L9      SLTEQRQRVANAEENIQKIREDLNIAVVGGE-GQFDVGEVRMQQLEGDRLFAQREMVEKE
A0A1Z9TC99      SLSEQRQRVADAEENIQQIREDLNIAVVGGE-GQFDVGEVRMQQLEGDRLFAQREMVEKE
A0A2E1U172      SLSEQRQRVADAEENIQQIREDLNIAVVGGE-GQFDVGEVRMQQLEGDRLFAQREMVEKE
A0A520SZH7      SLSEQRQRVADAEENIQQIREDLNIAVVGGE-GQFDVGEVRMQQLEGDRLFAQREMVEKE
A0A0G3EFP6      QLQKQQTKVDEAEQEMERIRQELDVTFVGNEQSGVSVDKMRLQQLEGDRIQARVEMLVRK
A0A2E0R7L7      SLTEQRQRVASAEENIQKIREDLNIAVVGGE-GQFDVGEVRMQQLEGDRLFAQREMVEKE
A0A6C2UMK3      AMKSQRERVDAAEQVVEDLRKELDIAVIGGE-GNVDVTDVRLQQLEGDRLAAQREMVDKE
                 : .   .:  **                     ..  .:* : :: .        :  :

A0A2E0R8R5      GVLEQIVELETK---------------------LQELELRRLEMSRRFKREHP-------
A0A2E3TL68      GLLDILNNIGDEDLAEQASFITFDQFVVDIVRSMELLEVELSALDADFGKNHPEVKRLVF
A0A6C2U5Z6      SLIKTLESLKDEDLIEQASYITFDQIVVSTVQQIQDIDVQLSSLDADFGVNHPEVKRYAL
A0A2E1U4L9      GLLRILEDLNDKDLLERASYITFDQFVMNTIQQIQDIEVNLSSVQADYGDNHPEVKRLKS
A0A1Z9TC99      GLLKILENLDDKDLLEQASYITFDQSVMNTIQQIQDVEVQLSSVQEDYGDNHPEVKRLKS
A0A2E1U172      GLLKILENLNDKDLLERASYITFDQSVMNTIQQIQDVEVQLSSVQADYGDNHPEVKRLKS
A0A520SZH7      GLLKILENLNDKDLLERASYITFDQSVMNTIQQIQDVEVQLSSVQADYGDNHPEVKRLKS
A0A0G3EFP6      ARFEQMQALEGPELLNASEYVVKDPNLSDLRKQILDTDVSLSLMSENYGQNHPEVKRLRA
A0A2E0R7L7      GLLRILEDLNDKDLLERASYITFDQFVMNTIQQIQDIEVNLSSVQADYGNNHPEVKRLRS
A0A6C2UMK3      VQLNILKDLGDKDLSEQASYITFDQFVMSTMQQIQDINVQLSSLNADYGENHPEVQRTRM
                  :  :  :                        :   ::    :.  :  :**       

A0A2E0R8R5      ---------------LYQGVVEQIKLVKEQ----KDVLTTRVTDLPETQQELLRYTR---
A0A2E3TL68      QKNSLEKNLKQRLDALRNGLQTEYSIAKSKFDGLDQVLKSVRSDSIETQGAKYRPYRNAL
A0A6C2U5Z6      QKSKLEETLKQRLRALRNGLQTDYILAKSRFESLDKALAGVRSTSIESQGEKYRPFRIAL
A0A2E1U4L9      QIVTLEETLKKRLSALRNGLDTEYIIAKNNFESLDKVLASVRTDTIESQGAKFRPYRNAL
A0A1Z9TC99      QIITLEGTLKKRLNGLRNGLETEYIIAKNNFESLDKVLASVRTDTIESQGAKFRPYRNAL
A0A2E1U172      QIATLEGTLTRRLNGLRNGLETEYVIAKNNFESLDKVLASVRTDTIESQGTKFRPYRNAL
A0A520SZH7      QIATLEGTLTRRLNGLRNGLETEYVIAKNNFESLDKVLASVRTDTIESQGTKFRPYRNAL
A0A0G3EFP6      AREELMGKLEEALDGLIKGLKADYEVARANYEALEKELAGIREEERQTQRESLLPFNKAR
A0A2E0R7L7      QIVTLEETLKKRLTALRNGLDTEYIIAKNNFESLDKVLASVRTDTIESQGAKFRPYRNAL
A0A6C2UMK3      QRDTLEATLTNHIKALRNGLETEYLRAKSNFEHLGAILASVRSTNIESQGAKFRPFRNAQ
                               * :*:  :   .. .       *        ::*       .   

A0A2E0R8R5      -DVQVSSEIYTMLLGKAQELDIMRAGTVGNVRIVDHAAVDLQHPIKPRKSLLVVLITLLG
A0A2E3TL68      ADLETERFIYNQLLAKHRQEIITMQLPRNPVNIIDVAEANLR-PVSPNLFINVLISIFAG
A0A6C2U5Z6      AELETERFIYNQLMSKHRQEIITLEVPGNPVEIIDVAEPNRR-PVSPNLFMNVLLSIFVG
A0A2E1U4L9      ADLETERFIYNQLMSKHRQEIITLQVPQNPVDIIDVAEPNMQ-PVSPNLFLNVLLSIFVG
A0A1Z9TC99      ADLETERFIYNQLMSKHRQEIITLQVPRNPVDVIDIAEPNMR-PVSPNLFLNVLLSIFVG
A0A2E1U172      ADLETERFIYNQLMSKHRQEIITLQVPRNPVDVIDIAEPNAR-PVSPNLFLNVLLSIFVG
A0A520SZH7      ADLETERFIYNQLMSKHRQEIITLQVPRNPVDVIDIAEPDAR-PVSPNLFLNVLLSIFVG
A0A0G3EFP6      RNLEIQRSILDALKARVTQEGITLEIPRTAVEVIEPAEPGSS-PVSPNLFLNVLMSVFLG
A0A2E0R7L7      ADLETERFIYNQLMAKHRQEIITLQIPRNPVDIIDVAEPNMQ-PVSPNLFLNVLMSIFVG
A0A6C2UMK3      ADLESERFIYTQLKAKHRQEIITLEVPSNPVEIIDVAEPENR-PVSPNLFMNVLLSIFVG
                 ::: .  *   * ..  :  *    .   * ::: *      *:.*.  : *::  : *

A0A2E0R8R5      FGLACAYVLIVRAIHRGLEDPSEVEA-IGMPVYATIPQSDKLLKNSKSKADKGKRTSRDL
A0A2E3TL68      LGAGIGLAYFIEYLDTSVKTVEDVENKLKLKVLGLVPQKVRPLIE---------------
A0A6C2U5Z6      LGAGVGLAYFIEYLDTSIKTADDVERILGLPVLGLIPQKVRPLIE---------------
A0A2E1U4L9      LGAGVGLAYFIEYLDTSVKSADDLENQLKLKVLGLVPQKVRPLIE---------------
A0A1Z9TC99      LGAGVGLAYFIEYLDRSIKSADDIENLLKLKVLGLVPQKVRPLIE---------------
A0A2E1U172      LGAGVGLAYFIEYLDRSIKSADDIENQLKLKVLGLVPQKVRPLIE---------------
A0A520SZH7      LGAGVGLAYFIEYLDRSIKSADDIENQLKLKVLGLVPQKVRPLIE---------------
A0A0G3EFP6      LGAGVGLAYFIEYLDTSIKTADDVERYLSLPVLGLVPQKVRPMIE---------------
A0A2E0R7L7      LGAGVGLAYFIEYLDTSVKNADDIENQLQLKVLGLVPQKVRPLIE---------------
A0A6C2UMK3      LGAGVGLAYFIEYLDTSIKTADDVERLLGLPVLGLIPQKVRPLVE---------------
                :* . . . ::  :  .::  .::*  : : * . :**. . : :               

A0A2E0R8R5      LAVDHPTDLSVEALRGLRTSLHFAMLDAKNNVIVISGPSPGIGKSFVSTNLGAVIAQGGK
A0A2E3TL68      ---EGPDSENAESYRVLKTNLDFSSNHEVGGAYSVISAGAGEGKSTTVFNLAYVAAQQGM
A0A6C2U5Z6      ---EGPDSEHAEAYRVLRTNLAFTEGGATHGAFSVLSGGAGEGKSTTVFNLAFVCAQQGE
A0A2E1U4L9      ---EGPDSENAESYRVMKTNLSFIANENEGMAHCVLSSGAGEGKSTTVFNLAYVAAQQGV
A0A1Z9TC99      ---EGPDSENAESYRVMKTNLQFTNEQEEGLAHCVLSSGAGEGKSTTVFNLAYVAAQQGQ
A0A2E1U172      ---EGPDSENAESYRVMKTNLAFMSDSDEGVAHCVLSSGAGEGKSTTIFNLAYVAAQQGQ
A0A520SZH7      ---EGPDSENAESYRVMKTNLAFMSDSDEGVAHCVLSSGAGEGKSTTIFNLAYVAAQQGQ
A0A0G3EFP6      ---EGPDSEHAEAYRVLRTNLTFTNEGQTKGTFLCTSGGAGEGKSTTIFNLAYICAQRGE
A0A2E0R7L7      ---EGPDSENAESYRVMKTNLSFTAKENVGMAYCVLSSGAGEGKSTTVFNLAYVAAQQGS
A0A6C2UMK3      ---EGPDSEHAEAYRVLRTNLAFTEGGSNRGAFCVLSGGAGEGKSTTVFNLAYVCAQQGE
                   : * .  .*: * :.*.* *        .    . ..* *** .  **. : ** * 

A0A2E0R8R5      KVLLIDGDMRRGDLQDHLGMSFDAGLTGYLSGQYALEEVVRTTVVEGLDIIPRGIVAPNP
A0A2E3TL68      KVLLMDADLRRPVQHIILGMSNRFGLTNVLLRDVPAEEAIKATSIPNLQFLPSGRLPRAS
A0A6C2U5Z6      KVLLVDADLRRPVQHTILGVSNRFGLTNVLLRDVPVEEAIKATSVPNLHFLPSGRLPRTS
A0A2E1U4L9      KVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAIKATSIPNLQFLPSGRLPRAS
A0A1Z9TC99      RVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAIKATSVPNLQFLPSGRLPRAS
A0A2E1U172      RVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAIKATSVPNLQFLPSGRLPRAS
A0A520SZH7      RVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAIKATSVPNLQFLPSGRLPRAS
A0A0G3EFP6      KVLLIDSDLRRPVQHRILDTDNRFGLTNVLLRDVPVEETIKPTSVPNLHFLPSGRLPRTS
A0A2E0R7L7      KVLLVDADLRRPVQHTILGMSNRFGLTNVLLRDVPVEEAVKATSIPNLQFLPSGRLPRAS
A0A6C2UMK3      KVLLVDADLRRPVQHSILGVSNRFGLTNVLLRDVPVEEAIKATSVPNLHFLPSGRLPRTS
                .***:*.*:**   :  *. .   ***. *  : . **.:..* : .* ::* * :.  .

A0A2E0R8R5      SELLMHPRFSELINYASENYDLVIVDTPPVLAVTDPVIIASHAGATLLVARYGITHKKEL
A0A2E3TL68      LGVLDPKKIRELINSLKSKYDLVLIDTPPVVGLSDASIIGKETDGSILVVQYRKYPLDMI
A0A6C2U5Z6      LGVLDPKRIGELIASLKTKYDVVLIDTPPLVGISDSSIIAKETDGAIIVVQYRKYPREML
A0A2E1U4L9      LGVLDPRKIRELVQSLKSKYDLVFIDTPPIVGMSDANIIAKEVDSSILVVQYRKYPLNMI
A0A1Z9TC99      LGVLDPKKIRELIQSLKMKYDLVFIDTPPVVGISDSSIIAKEADSSILVIQYRKYPIDML
A0A2E1U172      LGVLDPKKIRELIQSLKLKYDLVLIDTPPVVGISDSSIIAKEVDSSVLVIQYRKYPIDML
A0A520SZH7      LGVLDPKKIRELIQSLKLKYDLVLIDTPPVVGISDSSIIAKEVDSSVLVIQYRKYPIDML
A0A0G3EFP6      LGLLESQRMKELIHNLRSKFDVIFLDSPPVIGISDASILASAVDRVIMVCQYRKYPRDMA
A0A2E0R7L7      LGVLDPKKISELVNSLKSKYDIVLIDTPPIVGISDANIIAKEVDSSILVVQYRKYPLNML
A0A6C2UMK3      LGVLDPKRIGELISSLKSKYDIVLIDTPPLVGISDSSILAKEADGAILVVQYRKYPRDML
                  :*   .: **:     ::*::::*:**::.::*. *:.. ..  ::* .*     .  

A0A2E0R8R5      EISQQRFEQNGVSVQGIVFNAVQKRGGKYGSYGYNNYE--YGNE--------------
A0A2E3TL68      NKAKLSLIAQDIDITGVVMNNINITRDDYYYYYHTYYSDYYGS--SDEETQEGSI---
A0A6C2U5Z6      MKAKHMIEALGVSVVGAVLNNINVMRDDYYYYYHSYYSDYYHSS-QSDVMSDDNV---
A0A2E1U4L9      RKAVETLQAQSIDIAGAVLNNINVMRDDYYYYYQSYYSDYYQR--DDDDAEADLI---
A0A1Z9TC99      RKALASLQAQSINISGAVLNNINVMRDDYYYYYHSYYSDYYQQS-DEDNTEVQTV---
A0A2E1U172      RKALASLQAQSINVAGAVLNNINVMRDDYYYYYHSYYSDYYQQN-DDDQAEAKTI---
A0A520SZH7      RKALASLQAQSINVAGAVLNNINVMRDDYYYYYHSYYSDYYQQNDDDDQAEAKTI---
A0A0G3EFP6      MRAKQLLESSNARVSGVVLNNINVMRDDYYYYYHSYYYNYYYYRSGESAPQETETAEG
A0A2E0R7L7      RKAVSTLQAQSIEIAGAVLNNINVMHDDYYYYYHGYYSDYYH--RDDDEAEADLI---
A0A6C2UMK3      IKAKSMMEALGVNAVGAVLNNINVMRDDYYYYYHSYYSDYYRSSQGSDGLGDDSV---
                  :   :   .    * *:* ::   ..*  *    *   *                 

© 1998-2021Legal notice