BYKdb

Dataset for cluster orphancd of phylum gemmatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

44 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      ------------------------------------------------------------
A0A143BIC3      --------------------MSGQQIQPVSPRDVALEPYQDGAPPADWGGGQEAAPEPKG
A0A2V7HBX4      ----------------MRVRSLQPDYPLAPHHPGSIPTAEWTPARPRSEDFEDAEGIPWS
A0A2V7SVD5      ------------------------------------------------------------
A0A1Q7JIY3      -----------------------MISDNLPAIRARAAPVSPRRAPPSLAAAEEETGLDWR
A0A0S7Z9Q9      ------------SDEQFALPAAPSDGPGGEIQLRDAAAAAAAPPVWDEGFYPPSDDGDGG
A0A2V7GP46      ------------------------------------------------------------
A0A2V7H298      ------------------------------------------------------------
A0A2V7N2D0      -------------MATDLPVGPQGGDTVPLGHGRTRGGRGTSLGYRLPPSGDTPPEEEWR
A0A2V7ILF0      MGARCAPRPSFPYRTPATMPSDQPLQPVISLGRLEPAKSAGSALPSRALQPALPPSADWR
A0A2V7NMY2      ------------------------------------------------------------
A0A651HVY0      ------------------------------------------------------------
A0A2V7SCT4      ----MRGSCKTVGAVSDLLRGQAMISDNLPAIRARAAPVSPRRAPPSLAAAEEETGLDWR
A0A2V7RBS9      ------------------------------------------------------------
A0A2V7Q893      ---------MTTGGLATLLDTTK---------SQRLPTVGDRKAAERRARPTPPDGGDWI
A0A2V7QPQ4      ----MATFDSPSSGLPQLSHPRR---------TAPLGPYDAAHGPAQMEP--DPGVVDWR
A0A2V7MB00      ------------------------------------------------------------
A0A2V7T7Z8      ------------MAGA---PRAG---------GAPP----------------PSAEGDWL
A0A2V7PL95      ------------MTMDNL-PTRF---------EEPTAPAWQASGTGYAVGRAAAGESDWL
A0A2V7R2W8      ------------MAGDSLMPSRS---------TAPLAVTNEPE---------QPQQPEWL
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      ------------------------------------------------------------
A0A143BIC3      PSLGRYLAAINRFKWLIMLLGIVGAGAGYMATTFIE---PEFEVRATILLEQGTGISNGG
A0A2V7HBX4      ----RYVDAIRRHVLLIVGLAAVGSVLGVVAARRVR---PIYEAQATVWIST----TPSS
A0A2V7SVD5      -------------------------------------VEPSYEARAKVWIMS--PKPTNG
A0A1Q7JIY3      ----RSAIALSRFKWVVLLTVVLGTAAGVAATRFVR---PEFVAQATVWVDV--PDRRGA
A0A0S7Z9Q9      IDFRRYLVSILRHKWLVASSLLVGVVGSVFVWSRTA---VTYTAEGNLWIEA---EARTA
A0A2V7GP46      ------------------------------------------------------------
A0A2V7H298      ------------------------------------------------------------
A0A2V7N2D0      ----GYFGSIKRWKRLVIIVTLAGTALGVVATKLVVPSLPFYAATANIWIDGSGHRPDRD
A0A2V7ILF0      ----RYLVAIRRYKWIVLAGSLLGGGAGFAAGRY-LG--SEYTARATIWIDV--PDPR-N
A0A2V7NMY2      ---------------MVLAVTLLGTAAGVVAAAKFVG--PRYLARARLWVGAAEPNPNAL
A0A651HVY0      ---------------MMAAAVVLGLGAGYVVAQSQV---PRFSTQALIQVGE--PQRQQA
A0A2V7SCT4      ----RSAIALSRFKWVVLLTVVLGTAAGVAATRF-VR--PEFVAQATVWVDV--PDRRGA
A0A2V7RBS9      ----------------------------------MLP--PRYLVQATIWIQS--SEARGT
A0A2V7Q893      GEAQRYLRSVRRHKWLVLSLTLFATAAGVELSMYALP--PNYAARATVWIQV--PARQ-A
A0A2V7QPQ4      ----RVFAALLRFKWVVVLVTVLGTAGGVVLSRVIKI--P-YTTHATVWVDV--PDVR-A
A0A2V7MB00      ---------------------------------------------------D--QASRSE
A0A2V7T7Z8      ADARRYLIAIQRYRWMVFGLSALGLLVGFAFAGVVLA--PGYAARASLWIHG--PAGQ-E
A0A2V7PL95      DEIGRYLRAVRRHKWLVLGTTLLCAGAGIVLARVKLQ--PTFIARASVWIQV--PSAHVA
A0A2V7R2W8      ----RYLSAVRRFGWLVVAVTLAVTGLGVV-AAVLMP--PSYVAQAIVWIRV--PNKE-P
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      --IRGPNAESMF------------------------GVPLEGPTGPDASLFDNFERTETI
A0A143BIC3      QSR-GPIQADEL-LQASGWQDLLRSFAIADPVVNSLALFVTPSAAGDSTLFRSFRVSEQV
A0A2V7HBX4      ALQTGPIRQQQL-LTTGSWVELLRSFAIVDPIVRDLKLNVSYKQPSDSVLFRNFEWTPAT
A0A2V7SVD5      PQPTGPIRAEEL-LPQSSWAELFQSFAITDSVVAKRGLAATPEDAKDRPAFMRFATSERP
A0A1Q7JIY3      ADRSGPLRPEQL-LDAESWVDLLKSYVVLDQVAREQRLYMGLKTPQDSAVFTSFQVAEDY
A0A0S7Z9Q9      ADL-GPNEPSGL-LQDNAWVELLESFQVLDTVAVRERLFLRVPADYEP-AFQRFSLADEV
A0A2V7GP46      ----------------ESWIDLLRSYAVLDRVARDLRLFLQLPKGPDP-ALRSFNVADQF
A0A2V7H298      -------------------MDLLQSYAVLDDVVRGQRLYLHAKVPGDSDILATLRIKDHV
A0A2V7N2D0      QATPGPIHSGQL-LGASGWVNLARSYVVLDSVARGMRLYLGWDSEQDSAALASLELKPQF
A0A2V7ILF0      REE-GPLWTGQL-RISSGWTDLLETSAVLESVVRERRLYLSLDDPADSAALRSFRIKGQV
A0A2V7NMY2      RGTTPPPGAERL-LGVAAWVDFVRSDAVLDTVVRDVRLYLDPKTPLDGTALLRFGLKDQV
A0A651HVY0      GVT--AIETGVR-FSPASWANLMRSNRVLERVVDDLNLFVWAQPPATPDAFLHAAVVGTI
A0A2V7SCT4      ADRSGPLRPEQL-LDAESWVDLLKSYVVLDQVAREQRLYLGLKTPQDSAVFTSFQVAEDY
A0A2V7RBS9      PDR-GPIGANQL-LAPTAWGDLLKSYVVLDAVARERRLYLQ-ARPRDLPALAGFAVADQF
A0A2V7Q893      RDE-GPIWSGHL-PISSGWIDLIRTNIVLEDVARRERLYLT-TDAGDAAPLTTLAIKERV
A0A2V7QPQ4      HDE-GPIQTAGL-VGASGWVDLLKSNAVLEDVVRRQRLYLALDSPDDTGAVKSLGVKERV
A0A2V7MB00      QDR-GPIQQGELFGSATGWLDLLRSHVVLDDVVRQWRLYLRPKSADDNAALATLTVTGEI
A0A2V7T7Z8      GEP-GPLWSGRL-PISAGWSDLVRTNIVLDDVVRGERLYLT-NNPASDTVLATFAINQQV
A0A2V7PL95      REP-GPIWSGQL-PISSGWEELVRTNIVLEDVVRRRRLYLDYKNAADSDLFATFDIKQRV
A0A2V7R2W8      RNE-GPIWQGQL-PISSGWMELLQSYAVLDYAVRSRRLYLHPGLPGDSDVLGTLAIKEHV
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      --RSGSYLLAVNEDSRRWELT------HQGSQQKE------------TGVVGDS------
A0A143BIC3      PLRPGAYILKL--TGQTYTLE------TSGGLQVE------------QGAVGDS------
A0A2V7HBX4      --RSGAYLLKIDGAGPKYMLS------TAKGVFIE------------SGAIGDS------
A0A2V7SVD5      --IIGDYSLRVDAKGQRYTLTR-----KADGTVVD------------TGTVGDS------
A0A1Q7JIY3      --RPGDYRLAVQGDGRGYDLA------TADGVPLE------------RGAVGDS------
A0A0S7Z9Q9      --GFGTYVLRVSESGADFVLT------TDDGTLVQ------------QAAFGVP------
A0A2V7GP46      --RPGAYRLTTD-AARAYVLA------KVDGGVLE------------RGTVGDS------
A0A2V7H298      --APGKYRLVVEDTGDAPHFTLYN---ARSKAPVQ------------TGVAGDS------
A0A2V7N2D0      --RSGEYRLQVDSSGRRFRLL------TAQGGEVQ------------HGIAGDS------
A0A2V7ILF0      --RPGTFAFSVAELDPTFTL-------SSEDGVHE------------QGSLGDS------
A0A2V7NMY2      --LPGRYRLEVDRDGAGFTLF------SAQGGVVQ------------HGERGDS------
A0A651HVY0      --RRGGYIVRVDEAGRTVSLL------DEEERVLESHELASLLPVSSEDSLGDPETEDGT
A0A2V7SCT4      --RPGDYRLAVQGDGRGYDLA------TADGVPLE------------RGAVGDS------
A0A2V7RBS9      --TPGRYHLTIDHDGQTFHLQ------REDGTELE------------QGAVGSP------
A0A2V7Q893      --RPGTYRLAVDTTGTAFTLS------DAAGAVLD------------RGAVGDS------
A0A2V7QPQ4      --QPGAYRLVVTAQGGRFLLL------DGHGVTLQ------------QGAVGDS------
A0A2V7MB00      --RPGRYRLLLDREGKAFRL-----LDVAEQQVLQ------------EGSWGDP------
A0A2V7T7Z8      --RPGRYRLVVDNGGTAFTLR------DAAGRVLD------------RGAVGDS------
A0A2V7PL95      --RPGAYRLVVNDSGNGLTLSFKRLLFPSARNVLE------------RPAVGDS------
A0A2V7R2W8      --LPGEYRLVVDDTAPRFALFAVSSLDPVARG-----------------GAGDS------
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      ------VGRAFGFRWAPNLGGGRRGRSFRFDILTPQEVADDIRGKLRPDLE---RMNARF
A0A143BIC3      ------VGTRVGFMWQPTSQALAGRKDVGFNVQTPREASIALIKKLKMNLA----NGSSF
A0A2V7HBX4      ------IGRKAGMNWLPDARFLGRGRAIEFGVTSPRNVS-------------------QF
A0A2V7SVD5      ------IGRTVGFRWAPTPQMLKPGRTYNFNVVTPRDASTALLAKLKPPPA--VAPNSNF
A0A1Q7JIY3      ------VGARLGFRWVPPAGALPSGRTIDFSLTTLRDAARWLGDALGVQMD----PNGNF
A0A0S7Z9Q9      ------IGENVGFRWNPAPGSFPPEAVVRFRVLTARDAGQQLRDQLQTQID----RAGNF
A0A2V7GP46      ------IGRGIGFLWAPPAESLPPGHTVEFRLQTAREAALYLSDALDARMD----YNGNF
A0A2V7H298      ------VGPDMGLAWVPPRAVLAGPREVDFTLDPPYEAALGLARNLKVAAD----LDGNF
A0A2V7N2D0      ------IGGAVGFVWVPPASAFTPRRTIRFSVSSPYDAATNLAQRLQVELD----PDGNF
A0A2V7ILF0      ------VGADLGFLWAPAPDAVAPGHKIVFTVAAPSDAAKLLAKALVVKSD----LDDNF
A0A2V7NMY2      ------VGPALGFAWVPGAAVLTPGRRIEFTLLTPHDAAELLASQLQVTTD----PEGTF
A0A651HVY0      GEDPVMLGESVGVNLNLAPAALEPGAELRFTLQPRRDAARNLAQGLMVQPS-----QSAF
A0A2V7SCT4      ------VGARLGFRWVPPAGALPSGRTIDFSLTTLRDAARWLGDALGVQMD----PNGNF
A0A2V7RBS9      ------VGRTLGFIWTPTTAVLTPGREVRFVVSPLRDAAKKLADNLNVTLD----LSGNF
A0A2V7Q893      ------IGAPLGLAWVAPAGMLRAGDVVNFTVTTPAEAATRLRRELKVSSD----VDGNF
A0A2V7QPQ4      ------VGPALGLAWVPAASALRPGRTIAFALATPPSVAAGLADQLRVQTDMMEGKVGNF
A0A2V7MB00      ------VGGVLGVSWTPPTNAVRPGGSVDFTLATISEAAVELSEQLRIRAG----QEGNF
A0A2V7T7Z8      ------VGARLGFVWVPSPGTLHAGETVAFTLITPSAAAAWLTRELKVSPD----PDGNF
A0A2V7PL95      ------VGVAQGFAWVPRAGALRPRRKVEFTVAGPSDAAKALGRALKMAAD----PDANF
A0A2V7R2W8      ------VAPDLGLAWVPPAAALAPGREVTFTLDAPYEATLKLADQLKVSAD----LDGNF
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      LRLNYEGQNAERAAATLNAIVAQFVTQAAALKNRNLSAEAAVLDTQLTRARDRLNTAQAA
A0A143BIC3      LFLNLTGNDAPRTAATLNAWVEQFVVVATALKKKNVTSVAAILEGQREFAAKSLNEAEGA
A0A2V7HBX4      LKITLSGADPRRTARTVNAWAEQLVNSSGDLKTRHLFEFKKILGDQLALAEAQLRTSENE
A0A2V7SVD5      MNVTLVDNDAVEAAATLNTWLTEFDSTALWLKRRNVSEYSKLLEVQRQYANDKLKDAELR
A0A1Q7JIY3      LKVDLRGKDPRRISVILNAVTQRYVQVAAELKRQKGTELTKALEEQLNTAHTNLQQAEAA
A0A0S7Z9Q9      IRLTLSGPNPEKIASILNAVMDRHVTIAAELKRNKLDQTLIVLEEQLTQAEAQLQRSERS
A0A2V7GP46      LKIELRGGDPARITRILNAVAERYVEVAAELKRGRLTELTGIIGDQVRTAKQSLDSAEGD
A0A2V7H298      LRMELGGHDPAQIAATVNAVAERFVAVAAGLKRDNLTELTRILGDQLAQAQANLRQAEAS
A0A2V7N2D0      LQISLRGSDPAYIAATVNAVATRFVDVATDLKGKRLSELTKILATQLEHAQANLRSAESA
A0A2V7ILF0      IQLELRGSSPTGVAGIVNAVADRFEALATELKRRKLTELTGILSEQLKQAQGKLAEAEAA
A0A2V7NMY2      VTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGEQVRHAQASLTAAELA
A0A651HVY0      MVVGMQGQDPWWIAQIVNAVTESFLAEATELARAQSDELSQTLQEQLATTQRALSQAEAE
A0A2V7SCT4      LKVDLRGKDPRRISVILNAVTQRYVQVAAELKRQKGTELTKALEEQLNTAHTNLQQAEAA
A0A2V7RBS9      LRVALTSPNGTDAAATVNAVADRYVAVATDMKRVKVTELSRLLNEQLQAAEANLHKAERA
A0A2V7Q893      LRIELAGPDAAAVTGTVNAVATRFVATAADLKRDNLTQLTGVLAAQLEQEETKLRSAEGA
A0A2V7QPQ4      ISFELRGTSADTITAVVNAIADRFVLVATDLRREKLSALVKILGDQVQNAQLNLTRAEQR
A0A2V7MB00      VRIARRSPNPDQATGIANSVADRFVAAAADLKRQRLTELTAILQDQLDHAQTNLRTAEAA
A0A2V7T7Z8      IQLELYGPDASRTTAIVNAVAARVVAVAADLKRANLTQLNAVLGGQMRRAEADLRSAEGA
A0A2V7PL95      LRLELGGPDPVAVTATVNAIAERFVAAAADLKRDNLVQLTGILDNQLDRAQATLRDAEAA
A0A2V7R2W8      LHMQLGGRDPVAIAATVNTVAERFVAVAAGLKRDNLGELTGILGAQLAQGQAALRSAEDA
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      MRLELTGTSPTAIAGTLNAVLQRYVDVAAELKRAKLTELTHILNEQLSTAARHLHDTEGA
A0A2V7L8K7      ----------------------------------------------------LLADARQA
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      --------------------------------MACPRSDTRILGDQLEHARANLRDAEAA
A0A2V7JF48      ---------------------------------QQSTRRREFLESQLKVNDSLLADARQA
A0A534A9Q9      -------------------------------------------ESQLKVNDSLLADARQA
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      LESFKVSVVTLPREDV-------------------PVPAGLQSSTPSVFGNFIRQRNEVD
A0A143BIC3      LESFRVRTVTEPTERQ-------------------TITPGIELTTNPVFDNYFRDKVLAD
A0A2V7HBX4      LEHFRVSTITLPSGVA-------------------ASAGPGVTQGDPVVASYFQQKVALD
A0A2V7SVD5      LEGFRTRTITMPSEAT-------------------IVTPGLQETRDPVFRSFFEKKLESS
A0A1Q7JIY3      LQTVRAQTITLPSDRP-------------------LTSAPGPERRDPVFTNFFDMQIERD
A0A0S7Z9Q9      LEEFRVSTISLPTDQS------------------MPIAPGLQITRDPTFGNFFDMRVRLD
A0A2V7GP46      LESFRRRTITLPPDAV---------------------AAGGDTPRDPVLGDFFEQQVQRQ
A0A2V7H298      LKSFRVGAVTTVAAGA------------------GSVTESSQYPRDPMFAGLVDLKVNLD
A0A2V7N2D0      LRSFQIRTATVLPGSAIIPPEALAPGANTPPQRRPPVSDLVGQSRDPVFANFLDTRVALE
A0A2V7ILF0      LKRFRVTAVTQFAEGT------------------AAVTPNLERTQDPGFAGLLELKVSRE
A0A2V7NMY2      LKSFRVRAAGVLPAGV------------------AAPPPS------PAFTNAFELRVAVD
A0A651HVY0      LEAFESAMASNV-----------------------ELSAQWSGSDPAAASGLVDLRTELD
A0A2V7SCT4      LQTVRAQTITLPSDRP------------------LTSAPG-PERRDPVFTNFFDMQIERD
A0A2V7RBS9      LEDFRVRTIMLPAEPV------------------AGTAT-----RTSPVSEFLTRRVQED
A0A2V7Q893      LQRFRVTAVTEYGDGA------------------APVTSNMRSPQDPVFAGLLEVKVRRG
A0A2V7QPQ4      LRDFRVHSVTLLTGTP------------------APLLVPAPQGRDPAAANFFEMKVSSE
A0A2V7MB00      LTAFRVRNAVRPSEGP------------------AQGPDGRRITADPTYASYIDLQVSLD
A0A2V7T7Z8      LQRFRMQAATQLADGS------------------GSVTANFSAPTDPRFARLLDVKSRRT
A0A2V7PL95      LKTFRVRAVTQFADGA------------------GSVTPNLRYPQDPVFAGLLDMKVERE
A0A2V7R2W8      LRAFRVGAVTTLAEGA------------------GSVAQNTQYQRDPLFAGLVEMKVSLD
A0A1G0LV28      MQAYQESQSTTDLSAE-----------------EVSLV-----------NTIQDLDREKQ
A0A1Q7E008      LEGFRVRTITLPSEQA-----------------TPLAP-GLEATRDPVFKNFFEMRIERE
A0A2V7L8K7      VTAFRQRAGTYGSREA-----------------LAREQ-----------AGLAGVELQRQ
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      MTRFRVRTATHPTQGA-----------------VPSAEGRPPAATDPAVAGYLDLQVTVA
A0A2V7JF48      VTAFRQRAGTYGSREA-----------------LAREQ-----------AGLAGVELQRQ
A0A534A9Q9      VTAFRQRAGTYGSREA-----------------LAREQ-----------AGLAGVELQRQ
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      SLRREQTELREALAQARSGE--LAIDRFLNIGAVTRAP---ELT-QVLTELGEAERQRRT
A0A143BIC3      GYQRDREALERILNAGKQGAP-ITREAVLSVPSVNTDPAAENLR-KVLAEQADREFNLRR
A0A2V7HBX4      EIRSERQALERMVSEAKGGPI-NPQDFLQLPTILNNAP---QLR-SAIEELSLRQATLRT
A0A2V7SVD5      DLRQYADALARAMTAGPAAP--EAISAIPGLLTQAGAK---DLS-ILLDELTKRQGELRD
A0A1Q7JIY3      QLRRDREAIERLLADARASA--LPADALSLIGSVQHSA---ELS-QALKELTDKQATLRG
A0A0S7Z9Q9      ELQQDRRRLQAVIDDFGQRD--VRIEALELIPATAGSS---ELR-RILDELVDARSELRA
A0A2V7GP46      QAARDRAALTRVLAQPADSG---LASALEVIGAVQHSP---ELK-DALQELTTKQAALRT
A0A2V7H298      EVRRDRTAIERLLAPSTDPTVEVPVDALSMVGSVQRST---ELV-QGLRDLTSKQAELRA
A0A2V7N2D0      QLKRDRAAIERVLAQTADSG--LAVDALELVGSVERSS---ELT-DALKELVGKRADLRA
A0A2V7ILF0      QVRRDRDALRRVLAQARDSG--LSVDALGMIGAVQRSL---ELS-EALKGLTAKQAELRA
A0A2V7NMY2      QLGRDRQAIDRVLAQQPDSG--LSVDALAAIDAVQKSP---ELT-QALKELTDKQAELRA
A0A651HVY0      QLSRDRENLTRTLGEAERAGT-LRVQALEAIPSVRESS---ELM-GVLEQITERRAEVRS
A0A2V7SCT4      QLRRDREAIERLLADARASA--LPADALSLIGSVQHSA---ELS-QALKELTDKQATLRG
A0A2V7RBS9      QLRRDQDALAQLLAQGPDSL--GFSERLAAIGAVQGSA---DLT-RALSELTTKRADRRA
A0A2V7Q893      ELLRDQAAIKRILAQPPESG--LIVDALATIGSVERST---ELS-QALRDLTAKQAVLRA
A0A2V7QPQ4      ELRIDRTALARVLAEGADSG--PSTDALEMIPSVQQSS---VLT-QALGELTEKQATLRA
A0A2V7MB00      ELKRDRAAIAQLLTRSADSG--VAVDRLAMIGSVQRSS---ELT-AALKELTDRQAELRA
A0A2V7T7Z8      QLLRDREAINRILARSSGSG--PVVDALATIGAVAGST---ELS-RALGELTQKQAMLRT
A0A2V7PL95      GLVRDREAINRLLAKP-DSG--VAVDALAMIASVQKST---ELS-QALRDLTAREAELRA
A0A2V7R2W8      EVRRDRAAIDRLLRQGIDSG--VSVDALAMVGAVQRST---ELV-QALRDLTAKQAELRA
A0A1G0LV28      RILLDLQTLESSIRPGSD----MTIETLNGLAAVPGISGNPAMTFQIQALLRLYDDRRTM
A0A1Q7E008      QLRRDREAIERVLAEVADAEVAAQGLEVIGV-----VQRSAELT-QAQRELTTKQADLRA
A0A2V7L8K7      QLEAERRTDESLLAALRDRDSSVSRRALQTALATPGVAASPSVT-QLSTQLYQYERARDS
A0A2V7JCT0      QLEAERRTDESLLAALRDRDSSVSRKALQTALATPGVAASPSVM-QLSTQLYQYERARDS
A0A534A8D8      ------------------------------------MAASPSVM-QLSTQLYQYERARDS
A0A1Q7DXW6      QLAHDREAIGRVLAQGADSGVLTDALAMITA-----VQRSAELT-EALKELTAKQAELRA
A0A2V7JF48      QLEAERRTDESLLAALRDRDSSVSRRALQTALATPGVAASPSVT-QLSTQLYQYERARDS
A0A534A9Q9      QLEAERRTDESLLAALRDRDSSVSRRALQTALATPGVAASPSVT-QLSTQLYQYERARDS
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      -----------------------------------------------------KQAELRA
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      LLLTLMAEHDSVRAVTAKIDELRIGTLPTYVQSVLNRLAREQARLETQIQAAQRDLAGIP
A0A143BIC3      LRESYTDEYQKVKDEQAALQTLRTVSVPGALDAYLGQLQLREKALVATIDRSSKDLRNIP
A0A2V7HBX4      EQQFLTDANPRIRQLAEAVRVLERETIPQITVAVLNSLKAREPELDTRISVGSQELRGIP
A0A2V7SVD5      AQKVYTDEFSKVKDLQKQIADLRARAIPAAARNFLAQLRSRENSLNAQLAATSEEIRTIP
A0A1Q7JIY3      LQYRYQDDYAPVQRLKAEIADLENRTIPTLARTLVAQLAARETEVGRQVNATSHELRQIP
A0A0S7Z9Q9      LRDRYSDDYPPIQDLLNQIESIETTAIPRVVLGIMRELEDQEAELSARLATAQAELQAIP
A0A2V7GP46      LRYHYTEAYPPLARKAAEVATLERQTIPTLVRSLIDELGTRMAELDRRIGSASQELRRIP
A0A2V7H298      LRAHYTDANPPVRRLASEVDELAHRTVPALAASLVAELRVRESELVQRVDAASSSIQKIP
A0A2V7N2D0      LRYRYTETNPEVRRVAGEIGTLERQTIPALTRQLLGELRRREAELVRQVEWASADLRQLP
A0A2V7ILF0      VRFRYTDATPAVRHLAEEVKLLERQTIPRLATALMNELAVRESEVGRDVDSASGNLRRVS
A0A2V7NMY2      LRYTYTDQHFPVQQLADAVATLDRRTIPGMLRALRNNLAARERDLGQRVDSTVRYLSNIP
A0A651HVY0      LLVRYTEDHPSVLEGRAELRELEQEAIPALADELLAELDVRVSDLQARADARSDDLRAIP
A0A2V7SCT4      LQYRYQDDYAPVQRLKAEIADLENRTIPTLARTLVAQLAARETEVGRQVNATSHELRQIP
A0A2V7RBS9      LLYRYTDDHPAVRRVTTDIDELEHQTIPGLIRGLLAELGTQRRGLASQLETGGRELQGIP
A0A2V7Q893      LQARYTAEAPVVRRVAAEVATLERQTIPMLATALAREMGLRAAELEHRADSVARDLRRIP
A0A2V7QPQ4      LGYRYTAGLPQVKRLAVEITQLERQTIPTMVRALIAQLGAREAAVTQRIDSAAGGLRQIP
A0A2V7MB00      LRFRYADTHPPVRRLALQVDTLSRRVIPGLARTLMAGLAAREQVLAQQRDSIARDLRTAP
A0A2V7T7Z8      LQVRYTAESPLVRRLTGEVATLEQATIPELAAGLARELERQAAELERQANATARDLRRIP
A0A2V7PL95      LRARYTDATPNVRRLAGEVAALEHRTIPAMAAALTQELAVRAGELEHLVDSAAGGLRRVP
A0A2V7R2W8      LRGHYTDDNPPVRRAAAEAEALGRRTIPALASSLAAELRVRETELAERVATASTGLQQVP
A0A1G0LV28      MAEGQRESNPQVTALDSRIQTVSRALNDAAAATVRGLRQQIAALERNIAQLRERL-STFP
A0A1Q7E008      LRYRYTDEHAAVRRLAVEIETLERRTIPALTRALLSQIVTREQVLDSLVHSAGRELQQIP
A0A2V7L8K7      LASR-STSHPDLPRLNQLIGSTEADLLHAVQGGIQSAMTSLEGRITAMNDLRARQ-QQLS
A0A2V7JCT0      LASR-STSHPDLPRLNQLVSSTEADLLHAVQGGVQSAIASLEGRITAMNDLRARQ-QQLS
A0A534A8D8      LASR-STSHPDLPRLNQLVSSTEADLLHAVQGGVQSAIASLEGRITAMNDLRARQ-QQLS
A0A1Q7DXW6      LRFRYADTHPPVRRLAAQVDTLQRRIIPQLARTLMAGMAARERDLQVRVDSVSRDLRRAP
A0A2V7JF48      LASR-STSHPDLPRLNHLIGSTEADLLHAVQGGIQSAMASLEGRITAMNDLRARQ-QQLS
A0A534A9Q9      LASR-STSHPDLPRLNHLIGSTEADLLHAVQGGIQSAMASLEGRITAMNDLRARQ-QQLS
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      -----------------AILDADKEGYLRSARALIQTLTGRTRSLTDAIAQTADSLRAIP
A0A2V7HL73      ----------------------MRDRVSAIT------LTSDGETLGTTVKPDVVETTVLA
A0A2V7K2H8      -----------MRRLATDIDVLQRQAIPGLARALHADLGARAQTLATEISAGGRELQAIP
A0A2V7EK09      -----------MQRLAEQIATLQRQAIPTLTRALVSELAAREAEFGRRVAADSRNLREIP
A0A2V7QD43      LRYKYSDQYPLVQRRLSDVATLERQTIPTLARRLLAELSGREAELGRRVAEDTRSIQAVP
                                                                            

A0A1V4RFS5      ------------------------------------------MLLERSKSPNA-------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      QRAIQ-EQEYLRELEIADLQYRDLQQRFENSRLQEASSLPDLSVLDRAFPPSQPEKNRKS
A0A143BIC3      ARTIE-EQRLKRQVEVSDAMYRNLNLKAAEAKLAEAATIPDVSILDPAVAPLRPTKNTAP
A0A2V7HBX4      ARATE-EARLVRQVAATENLYNSLKARYEEVSLAEVQTAPDLSVLDTAVAPTLPTSNDAP
A0A2V7SVD5      TRSIE-EQRLRREQAMYEGMYTNLSARYADARLAESSAMPDITILDRAAPANGVVTFRDL
A0A1Q7JIY3      PRALE-EERLRRSLTLAEELYTTLQRRYEEAQVSERTIVPDLRILDAAVVPRRPVKNTAP
A0A0S7Z9Q9      PRTIE-EQRLSRQVATNTDLYNQVRGRVESARLAAASSIPDVRILDPARVPNQPSDDERM
A0A2V7GP46      ARSVE-EARLRRSVTIADNLYTSLQQNYEAARLAEASSIPDIRIFDKAVVPLQPVKNSAP
A0A2V7H298      PLAVE-ESRLQRGVTLAEQTVTNLQARYEEARLAEISAIADVRLLDRAVEPQVPVGHMRA
A0A2V7N2D0      SLAID-ELRLQRDVVDAEQLFANIQQRSEEARLAEASSIPDVRILDAAVEPRQPFMDAAP
A0A2V7ILF0      PLAVE-EAALQRDVTSAEQLVTNIRQRYEEARLADVSSIPDVRILDRAAVPFLPTFNLLP
A0A2V7NMY2      PLLFE-QTRLEREVQVAGQLYASLQQRYDEARVAEASALPDVRILDAPVQPYQPIGSVAP
A0A651HVY0      GQALT-RARLRREVSQAEALFEDVNRRYAAARLAALSTAPDLQIVDRAEPPSRADGDRRL
A0A2V7SCT4      PRALE-EERLRRSLTLAEELYTTLQRRYEEAQVSERTIVPDLRILDAAVVPRRPVKNTAP
A0A2V7RBS9      QRAIE-DARLRRDVSIAENLFTSVQQRYSEARLAEASSIADVRVLDAAVAPETPVKNTAV
A0A2V7Q893      PLAAE-ENRLQRDVTQSAQAVANLQRRYEEARLAETSSIPDVRLVDPALEPQEPTENWAP
A0A2V7QPQ4      PLAIE-DARLDRDVTIAAQLFANIQQRYAEAQLADVSSIPEVRILDRAPHPDTPLFNIAA
A0A2V7MB00      PVALS-EIRLARDQANAEQLFSNLQHRYQEARLAEVSTLPDVRILERAVRPSRPASNTAP
A0A2V7T7Z8      PLAVE-QAALQRAVTSKEQVVADLRRKYDKVRLAVTSSIPDLELVDPAVEPQEPSDNWAP
A0A2V7PL95      PLAVE-ETRLQREVTMAEQAVVNLQQRHEEARLATVSSLPDVKLVDPATEPQEPATNWAP
A0A2V7R2W8      PLAVE-EARLQRNVTLAEQAVTNLQQRYEEARLAEVSSIPDVRLLDRAIAPHRPVGHIGA
A0A1G0LV28      GKQTQ-FAQLRLETELQNDTYKYLLSQLEAARISAGTIAPYIEVVESATVSYR-LGMSTR
A0A1Q7E008      LRAVE-EARLRREVSIAENLYTTLQQRYEEARLAEASTIPDVRVLDAAVAPHQPIKNTAP
A0A2V7L8K7      TTEEE-EARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIALP
A0A2V7JCT0      TSEEE-EARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIGLP
A0A534A8D8      TSEEE-EARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIGLP
A0A1Q7DXW6      PVDLE-GVRLERDELNASQLFSNLQQRYEEARLAEVSSLPDMRILERASKPDKPVSQLAP
A0A2V7JF48      TTEEE-EARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIALP
A0A534A9Q9      TTEEE-EARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIALP
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      QRAVE-EARLRREVTIAENLYTTLQQRYEEARLAEASTIPDVRVLDTAVVPHQPIKNQAP
A0A2V7J5T6      -------------------------QRFDQSRLAAEATVPDVRILDPAIVPQRPIKNTTP
A0A2V7KN28      ------------------QTYTALQQRFDQARLAAEATVPDVRILDPAMVPQRPVKNTAP
A0A257SFA4      PRATE-EARLMRRVALATSLFNTLQQRYDETRIAQATDVSDVRILDPAGVPPWPTKNTAP
A0A2V7HL73      AAPQDATSRAGQDAARRGGIVLPRAPGSVDPQVERSRGRRPRTTIAHRLQDERPSNEVFC
A0A2V7K2H8      QRSIE-EGRLRRDVSIAENLYASVQQRYNEARLGEASTVADVQVLDAAVSPQEAAKNTAS
A0A2V7EK09      ARAIE-EARLRRAAGLAETLYTTLQQRYQEARVEVASSVPDVRVLDAAAVPQRAVKNRAP
A0A2V7QD43      PRAID-EARLQRQVTLAENLFTSLQKNYDEARLAEESAVPDARILDHAVVPQDPVRNTAP
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      VIIALGTLLGLGAGIGLAFLLDLTDKRFRYADQITAGLGISILGAVPE----------IR
A0A143BIC3      VIIFAAVAAMLGLGVVLAILLDQVDKRFRYPEQATDDLGLFVLGVVPV----------IH
A0A2V7HBX4      RLLLLAVVASMGLAVGIALIRDRLDRRFRYPEQATRELGLSVAGTVPK----------FK
A0A2V7SVD5      KIIGTAILIALGLGLGLSVMLDRLDHKFRHLAQVNADLGLAVLGTVPQ----------IA
A0A1Q7JIY3      RLILLAFCGSFGLAVVGAIMLDRIDPRVRYPEQVSHELGLPILGAVPH------------
A0A0S7Z9Q9      LRAGLVFFGCFGLGLLGAVLLDRVDARFRFASDVGRVIGLDILGSIPR----------IE
A0A2V7GP46      RLLLLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDLGLPILGAVPH----------LK
A0A2V7H298      ILIFLAFWGGLGVGVAGAVLLDRTDRKVHYPEHVTRAMGLSILGAVPH----------VD
A0A2V7N2D0      FLLLLSVVGSLGAGVLAAVLRDRVDPKLRDPAHVTQEMGLPILGAVPH----------LN
A0A2V7ILF0      VLVVLGLMGGFGAGGGAAVLLDHLDRKVREPDEVTRVMGLPILGAVPH----------LK
A0A2V7NMY2      FLVIMAFLASAGLGVLGAVVIDTLDPRFRDPGHVTQGLGLRILGALPH----------LS
A0A651HVY0      MMALVTLFGFVGAGGLGAILMDLRDKRVRSPSDVETGLGLPILGALPH----------LA
A0A2V7SCT4      RLILLAFCGSFGLAVVGAIMLDRIDPRVRYPEQVSHELGLPILGAVPH------------
A0A2V7RBS9      RLLIMGLFAGLGLGVVGAVVIDRFDPRVRYPAQVTTDMGLRILGALPH----------VK
A0A2V7Q893      VLVLFTMISGLGAGVGSAVVLDYRDRRVHDPEDFTRTIGLKILGVVPH----------LE
A0A2V7QPQ4      VLIVLAFVGSGVAGVLGVVALDHLDSRVRHPDQVTRAMGLTILGAVPH----------VG
A0A2V7MB00      LLIIAAFLTSFGVGVAGAVVRDRADPTVRRPDQITSAMGLPILGAVPHVRQTAPRREPLG
A0A2V7T7Z8      VIVMFCAITCFGAGACGAILLDRTDRRVHDPDDVAHKMGLKVLGVLPH----------FD
A0A2V7PL95      LVIGLALIVGLGAGVTGAVVLDRTDRRVQYPEDVTSTMGLNILGVVPH----------LG
A0A2V7R2W8      ILIALAMVGGLGLGMTGAVVLDSTDRRVRHPDDVTRAMGLAILGAVPH----------VD
A0A1G0LV28      NKVVLGALVGLFLGVLAAFFLEYLDQTIKTAQDVERVLDVPVLGLIPL----------ES
A0A1Q7E008      RLILLGLFGGLGLSLMGAVLIDRFDRRFRYPQQATGDMGLTILGAVPR----------LR
A0A2V7L8K7      EQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVE-QLGMSVIGVITH----------LD
A0A2V7JCT0      EQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVE-QLGMSVIGVITH----------LD
A0A534A8D8      EQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVE-QLGMSVIGVITH----------LD
A0A1Q7DXW6      ILIVLSFLGSLSVGTLAAMTLDRMDRKVRTAEHVSLAMGLPILGAVPH----------VH
A0A2V7JF48      EQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVE-QLGMSVIGVITH----------LD
A0A534A9Q9      EQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVE-QLGMSVIGVITH----------LD
A0A2V7NW82      -------MAGLGLGLLGAVLIDRFDPRLRHPDQVTYGMGLRILGVLPH----------VR
A0A2V7Q431      -------------------FLADHLNRSVHRREDVAHLGLPVLGVVPH----------AK
A0A2V7IEC4      -------------------------------------MGLAILGAVPH----------LR
A0A1Q6WKV1      -----------------------------------------------------------M
A0A2V7N4E0      -------------------------------------MGLAILGALPH----------FA
A0A2V7EJU4      RLILLGLFGGLGLSLMGAVMLDRLDRHFRYPQQVTGEMGLAILGAVPR----------IK
A0A2V7J5T6      RLLLMGFVFGLGLGMVGAIVLDRVDPRVRYPEQVSRDLGLPILGAVPH----------LR
A0A2V7KN28      RLLLMGLLAGLGLGVLGAILLDRADPSVRYPEQVSRDLGLPIIGAVPH----------LR
A0A257SFA4      RLLLLAVLGGFGLASLGSVLMDRWDPRFQYPEQVSRDMGIAILGTIPH----------VR
A0A2V7HL73      HLSREGSPVSKFLKALERAEQQRALGRHPAPSEAASERGLAVPETAPP----------RP
A0A2V7K2H8      RLVAFGFVVGLSLGMVAAVVVDRLDPRVHHPDQVTEQMGLSIIGVLPH----------VR
A0A2V7EK09      QVILFAFFGSLGLAMIGAVLVDRGDPRVRYPYQVSREMGLTILGAVPH----------LR
A0A2V7QD43      RVVFLGFAASLALGLCGAVVLDRIDPKLRYPDQVSRGLGIPILGAVPH----------LR
                                                                            

A0A1V4RFS5      ----------------------------------------------EAIRDLRTSLSFSR
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      RAKG--ET---------------PSAEEAS----QVI---------EAFRTIRLNLMHTV
A0A143BIC3      SKGK---R---------------GKTDEAA----QVV---------ESFRTIRMNVRYAA
A0A2V7HBX4      ANHR---------------------GEFQIAMMSQAV---------ESFRTLRLALRYDF
A0A2V7SVD5      QPPR---R---------------AKPEDAA----EVI---------ESFRGIRLRLQYAY
A0A1Q7JIY3      -------L---------------KDAAEPA----EVV---------EALRGLCLNLVHAH
A0A0S7Z9Q9      SANG---R---------------RGVLNAA----QAL---------EAFRELRIHVSFAY
A0A2V7GP46      ARTG--GQ---------------LTREQRV----QLV---------EAMRGVCLGVSYTY
A0A2V7H298      WRNG-------------------NRDAAAT----QVI---------ESLRGVRLNVVHRH
A0A2V7N2D0      AANGKGAR---------------GLNGGGAGAAGPVI---------EALRGIRLSLVHAY
A0A2V7ILF0      QRRN---G---------------SVHEGGL----PII---------EAIRGIRLSVQYAH
A0A2V7NMY2      RAGN---------------------GEGTA----QAI---------EAMRTVRVKLQHAS
A0A651HVY0      TRGG---R---------------VRAKDQN----QAV---------EAFRSIRLGLTYAY
A0A2V7SCT4      -------L---------------KDAAEPA----EVV---------EALRGLCLNLVHAH
A0A2V7RBS9      KRAG---A---------------SDDESGA----LVI---------ETMRGVRLSLIHAY
A0A2V7Q893      RKGR---N---------------RAPEDAL----HVL---------EAMRGTCLNVLHAH
A0A2V7QPQ4      QRNG--------------------KGDQVA----PVI---------EALRAIRLRVVHAH
A0A2V7MB00      KHRG--PE---------------ADADDGA----RAV---------EALRGIRLNVHHAA
A0A2V7T7Z8      SPPPPLWA---------------ARSEGGV----KLI---------EAMRGIHVNVLHSH
A0A2V7PL95      -RNG--HA---------------KHHEGVL----QVL---------EAVRAIRLNVLHAH
A0A2V7R2W8      WRNG-------------------KRDAAVA----QVI---------EALRGIRLNVVHRH
A0A1G0LV28      RQQLLAGNGHHGRRRYAIPLVSLVSPDDP------SS---------EAYRALRTNVTFVN
A0A1Q7E008      YG--RRG----------------IDPDDLT----QVI---------EALRTVRLNVAHAY
A0A2V7L8K7      RDGPETG----------------MKSPDA------VV---------EAFRGLRLSLVNEY
A0A2V7JCT0      RDGAETG----------------MKSPDA------VV---------EAFRGLRLSLVNEY
A0A534A8D8      RDGAETG----------------MKSPDA------VV---------EAFRGLRLSLVNEY
A0A1Q7DXW6      RNGKKRN----------------SQDEDSQ----PAV---------EAMRGIRLNVQHAY
A0A2V7JF48      RDGPETG----------------MKSPDA------VV---------EAFRGLRLSLVNEY
A0A534A9Q9      RDGPETG----------------MKSPDA------VV---------EAFRGLRLSLVNEY
A0A2V7NW82      D------RRVG------------QDDEHVI----QLV---------EAVRSVRLSLAHAY
A0A2V7Q431      G----------------------GSNEDAA----PIV---------EAMRGIRFNVLHAY
A0A2V7IEC4      TLPHAGRHGRG------------RVPEDVN----QVV---------EALRGVCLNLVYAH
A0A1Q6WKV1      G--GGGGGKSA------------RPHEGVA----ELV---------EALRGTCLNLVYAY
A0A2V7N4E0      G--RGDGNGAG------------RTPEDIA----QVV---------EALRGVCLNVVHAY
A0A2V7EJU4      RGRRAVDPEDA------------RQVI-------------------EALRTVRLNLTHAY
A0A2V7J5T6      -------TKEP------------AEVV-------------------EALRGLRLNVAHEF
A0A2V7KN28      AKDPAEVV--------------------------------------EALRGVRLSLANEH
A0A257SFA4      TARDGTLGDPA------------FR---------------------EAMRGVRMNIAFAY
A0A2V7HL73      PRASHELAREV------------PNGLEEH----LVSLLAPRSFEAEQYRTLRHLIEQLH
A0A2V7K2H8      DRRAG--------------------PDDQQ----VAHAI-------EAMRSIRLSLTHAH
A0A2V7EK09      LTGVPGRHGNE------------RSPED------IAAVV-------EGLRGICLNLVYAH
A0A2V7QD43      NLPRGGRGSGA------------RVPDD------VNEVV-------EALRGVCLNLVYAH
                                                                            

A0A1V4RFS5      PEQGIK-SLLVTSSGPREGKSSVSANLAVAEAEAGK-KVILVDCDLRRPTVNKTFGFKRK
A0A1Q6ZF81      ------MVLTISSPGSGDGKSFLSANLGLTFADGGH-KTLLIDGDIRRGVLHRRFKGNRQ
A0A524QR19      -----------TSPAEGEGKTFVAANLANAFADLGR-KTILIDGDTRRGDLHHILERDRK
A0A2N1WA66      AREKGF-AITITSAMPGDGKSLVSSNLALSFAEAGF-KTLLIDGDTRRGELHRTFGVERR
A0A143BIC3      DPSRPL-TMTITSPGPNDGKSLISSNLALSFAESGA-RTLLIDGDIRRGELAKTFQITSK
A0A2V7HBX4      PTDAPI-VVGVSSPAAGDGKSLVSSNLALAFASAGS-RTLLIDGDVRCGGLHNTFEIPVT
A0A2V7SVD5      SANQPL-VCGVTSPEQGDGKSLVASNLALAFAEAGY-RTLLIDADTRRGSLHDVFGAQRR
A0A1Q7JIY3      GAAGPL-LVTITSPGAGDGKSFLASNLALTFADGGH-RTLLVDGDLRRGLLHRRFNANRK
A0A0S7Z9Q9      GSAGPI-TLAVTSPAPNEGKSMISSNLAVAFSEVGR-RTLLIDGDTRRGDAHRLLGRERS
A0A2V7GP46      GAAGPV-VVAVSSPGPGDGKSFITANLAVTFADAGR-RTLLVDGDLRRGAQHRLFGADRR
A0A2V7H298      GTAGPV-RLTVTSPGKSDGKSFVASNLALAFADAGY-RTLLVDGDVRRGRLHHTLSAARR
A0A2V7N2D0      GTAGPL-LVTITSPGSGEGKSFVAANIALAFADAGH-RTLLIDGDIRRGQLHRVLNAARV
A0A2V7ILF0      GAAGPL-VCTITSPGRSDGKSFLASNLALGLADAGL-RTVLIDGDIRRGALHRVLAVARK
A0A2V7NMY2      NGGNPL-LLTVTSPGVGEGKSLVSANLALAFAYAGL-RTVVIDGDIRRGALHRLLRGSRR
A0A651HVY0      GTASPM-VLTISSPAPGDGKSFTTSNLGLSFAELGR-RTVVVDGDVRKGTQHTHLGVDRT
A0A2V7SCT4      GAAGPL-LVTITSPGAGDGKSFLASNLALTFADGGH-RTLLVDGDLRRGLLHRRFNANRK
A0A2V7RBS9      GTAGPL-VVTITSPGPGDGKSFVSANLALACAQAGQ-RTLLIDGDTRRGALHRVLGAVRR
A0A2V7Q893      G-TGPV-IVTVTSPGRADGKSFVASNLAVAFADGGY-RTLLVDGDVRCGTLHRTLKLARR
A0A2V7QPQ4      GSAGPI-AVTISSPGRSDGKSLIASNLALAFADSGY-RTLLVDGDVRRGALHRVLKTARK
A0A2V7MB00      GAVGPL-LATITSAGRGEGKSFVSANLAYAFSAVGF-RTLLIDGDVRLGALHRPLRGARR
A0A2V7T7Z8      G-VGPA-IMTVTSPGRADGKSFVAAYLATAFADAGY-RTLLIDGDVRCGVLHRAVKLLRR
A0A2V7PL95      G-VGPA-IVTVTSPGRADGKSFLASNLAVAFADAGY-RTLLIDGDIRCGTLHRVLKRPRR
A0A2V7R2W8      GSAGPV-RLTITSPGKSDGKSFVASNLALAFADTGL-RTLLVDGDVRRGRLHRTLGAARR
A0A1G0LV28      AEQRSLRVICVTSPGPGEGKSTTAANLAITLAQQGS-ATLLVDADLRRPLVHRAFNLVQE
A0A1Q7E008      GAAGPM-VVTITSPGPGDGKSFLAANLARSFADSGR-RTLLIDGDGRRGVLHRVLKVVRK
A0A2V7L8K7      GAPGPL-VITVTSPGSGDGKSFVSSNLSLAFAYAKQ-RTLLVDADLRRGALHRVLNLRRQ
A0A2V7JCT0      GAPGPL-VITVTSPGSGDGKSFVSSNLSLAFAYAKQ-RTLLVDADLRRGALHRVLNLRRQ
A0A534A8D8      GAPGPL-VITVTSPGSGDGKSFVSSNLSLAFAYAKQ-RTLLVDADLRRGALHRVLNLRRQ
A0A1Q7DXW6      GAAGPL-LLTVTSPGRGEGKSFVTANLALAFADVGY-RTLLIDGDVRLGALHHAVRAQRR
A0A2V7JF48      GAPGPL-VITVTSPGSGDGKSFVSSNLSLAFAYAKQ-RTLLVDADLRRGALHRVLNLRRQ
A0A534A9Q9      GAPGPL-VITVTSPGSGDGKSFVSSNLSLAFAYAKQ-RTLLVDADLRRGALHRVLNLRRQ
A0A2V7NW82      GAAGPM-VVTLTSPGVGDGKSFLSANLALAFAEAGH-RTLLVDGDVRRGALHRALHATRQ
A0A2V7Q431      GAAGPA-MFTITSPGSREGKSFVASNVALAFADAGH-RTLLIDGDMRRGSLYRILNTRRK
A0A2V7IEC4      GGRAPL-LVTVTSPGAGDGKSFLAANLAHTFADGGH-RALLIDADIRRGVLHRRLNARRR
A0A1Q6WKV1      GAAGPM-LVTITSPGPGDGKSFLAANLALTFAEGGH-RTLLVDADIRRGVLHRRLTARRR
A0A2V7N4E0      GAAGPL-IVAITSPGPGDGKSFLAANLAHTFAEGGH-RTLLVDGDIRRGVLHRRLSARRR
A0A2V7EJU4      GAAGPL-LVTITSPGPGDGKSFVSGNLARAFADAGQ-RTLLIDGDSRRGVLHRLFKGLRK
A0A2V7J5T6      G-AGPV-VFTVTSPEPGDGKSFVSANLALTFADGGH-RTLLIDGDIRRGVLHRRFKCNRQ
A0A2V7KN28      GP-GPL-LVTVTSPGPGDGKSFLSANLALTFADAGQ-RTLLVDGDIRRGVLHRRFKANRQ
A0A257SFA4      GAAGPV-TLTVTSPGSADGKSFVALWLARAFGEAGR-RTVIVDADVRRGALHRRCDLLRK
A0A2V7HL73      KSTGLS-VVAISSPGVADGKTTTAINLAGALAQASDARVLLVDVDLRGGALAARLGIDER
A0A2V7K2H8      GAAGPM-LVTISSPGVGDGKSFVSANLALAFAEAGR-RTLLIDGDVRRGSLHRAVRARRQ
A0A2V7EK09      GATVPL-LVTITSPEPGDGKSFLSANIAHTFAQGGH-RTLLIDGDIRRGVLHRRLNGRRR
A0A2V7QD43      GGRAPL-LVTITSPGAGDGKSFISANLAHTFADGGH-RTLLIDADIRRGVLHRRLSVRRR
                           :*.   :**:  :  :.   .      .:::* * *             

A0A1V4RFS5      PG---FTELISGKATIDEVVKKT-EVEGLFVICSGHIPHNPAEMVETAVKKGVFSQIAEA
A0A1Q6ZF81      PG---LVDYLLGDAGHDAIVQKT-AYPRLSLIGCGTRTQRAPEVLGSPAMNRLLAELRGR
A0A524QR19      PG---LTDFLMNGKSHQ-IVQNT-DNPRLHFVGFGSKTSSSPELLTSPQMGSFLAGLKRR
A0A2N1WA66      PG---LLDHLAEQVPIADALHPT-NHPRLTVLTGGSRHRNGPELLGSAAMRELMDQLQKE
A0A143BIC3      PG---LVEYLDGTALIAEVLHPVQSHPNLTVMPGGARRRRAPELLATPRLNQLINQMAAE
A0A2V7HBX4      PG---LVDYLNGHAAVDSIVRST-TSENLFLIPRGTRGNRAPELLVSELMSALVHAMRLQ
A0A2V7SVD5      PG---LIEVLSGEVTRAEVMHPT-TQERLSLLPCGGRRTTNPELIASPALPRLLSELVGE
A0A1Q7JIY3      PG---LIEFLHGDAAREQIVQPT-SYPWLYLIGCGTRTNRAPELLGSAAMGQLVAALRQE
A0A0S7Z9Q9      PG---LIDHLRGETGQD-IIQAT-DHPNLDFIGCGSRGVSTPELLASPRMAYFIGTLKRT
A0A2V7GP46      PG---LTDALRGEVPLEAGLRPT-GYDALTLLPCGVRTSDAPELLGSAKMPELLARLRGD
A0A2V7H298      PG---LTELLEGSAPQDAAVQAT-RYKNLSFISCGLRSHAGPALLSSVAMARLLDALRAS
A0A2V7N2D0      PG---LTNGLTEGTPLDAILQTT-PYPRLSFIGCGPRTPLGPELLGSGEMARLFASLRPR
A0A2V7ILF0      PG---LTDVLAGKATVDEVVRAT-AFPRVSFVPCGTRRFSGPELLGSPAMRALLANLRGR
A0A2V7NMY2      PG---LTDHLTGRAPLEKVLQTT-PYKCLSFIGCGSRMHNSPELLSAATMVDLLAALRSR
A0A651HVY0      PG---LTDYLTGEVELDDILQGT-RHPALSVIPYGSVVQNAPEFMVSGRMQDLLARLKAD
A0A2V7SCT4      PG---LIEFLHGDAAREQIVQPT-SYPWLYLIGCGTRTNRAPELLGSAAMGQLVAALRQE
A0A2V7RBS9      PG---LTDFLAGHVSFEGLIQTL-KFGSLQFIGGGSRIRESPELLGSPRMVELLVRLRAM
A0A2V7Q893      PG---LTDLLQGRAGQEQVVQPS-AYGTLSFLGCGSRTHDGPALVSSAALPRALAGLRSS
A0A2V7QPQ4      PG---LTELLAGTASREEAVRAT-AYPSLWFIGCGARSQQGPERLTSAPMVRLLADLRPA
A0A2V7MB00      PG---LTDVLAGSIPPELAVQNT-PHERLSFIGAGSRMHRGPELLCSDAMPRLLATFRSS
A0A2V7T7Z8      PG---LTDLLGGEAIEAQVVQRT-RQGGLWFIGCGTRTRAAPTLVGSGALPRALARLRPN
A0A2V7PL95      PG---LTDVLAGNATTAQAIQQT-TYRTLSFIASGTRTHGGPALINSAALPRLLAELRPY
A0A2V7R2W8      PG---LTDLLEGSVGWDQVVQAT-PYKNLSFISCGLRSQAGPALLSSATMARLLDGVRTS
A0A1G0LV28      PG---LTDVLVGSSQLREAVRPN-VIPKLDVLPAGALPPNPSELLGSEAMRRLMEQLRTH
A0A1Q7E008      PG---LIDYLAGAVPFATIVQQT-DHAKLWFVGSGTRKQDVPELLASPAMARFLVSARAD
A0A2V7L8K7      PG---LTDFLAGDVSRAPVVQTT-SHPCLDFIASGTRRRDAPELMGSPAMADLVTTLRST
A0A2V7JCT0      PG---LTDFLAGDVSRAPVVQTT-SHPCLDFIASGTRRRDAPELLGSAAMTDLVTSLRST
A0A534A8D8      PG---LTDFLAGDVSRAPVVQTT-SHPCLDFIASGTRRRDAPELLGSAAMTDLVTSLRST
A0A1Q7DXW6      PG---LTDVLANRATPDQAVQRT-EHRQLWFIGAGSRMHRGPELLCSAGVPRLITAMRGG
A0A2V7JF48      PG---LTDFLAGDVSRAPVVQTT-SHPCLDFIASGTRRRDAPELMGSPAMADLVTTLRST
A0A534A9Q9      PG---LTDFLAGDVSRAPVVQTT-SHPCLDFIASGTRRRDAPELMGSPAMADLVTTLRST
A0A2V7NW82      PG---LTDFLAGRAPLEAIVQET-TSPSLHFIGSGTRHRDAPELLGSPPMVELLTRLRTS
A0A2V7Q431      PG---LTDVLHDEVSAEDVIQPT-RYPPLFFVGCGTRTPDAPELLGSEAMSRFIAGVRES
A0A2V7IEC4      PG---LSDFLRGETPLDSIVQAT-PYPSLSLIGCGTRAYNAPELLGSPPMSELVNGMRSG
A0A1Q6WKV1      PG---LTDCLRGEVPFEAILQQT-AYPLLTLVGCGTRVHNAPELLSSEAMAQLVTRVRPD
A0A2V7N4E0      PG---LTDYLRGEVPLEAILQPT-GCHTLTLIGCGTRAHNAPELLGSQAMGELITGWRAS
A0A2V7EJU4      PG---LTDYLTGVVPLEAVVQPT-DHATLWFIGSGSRKQDAPELLGAPTMAQLLASARAS
A0A2V7J5T6      PG---LVDFIQGHAPRDQIVQET-PYPRLSIIGCGTRTQRAPEVLGSPAMADLFTELREQ
A0A2V7KN28      PG---LVDFLRTEAGQGDIVQRT-AYPRLAFIGCGTRTQRAPEVLGSPAMAQLIAELRGQ
A0A257SFA4      PG---LTDLLKGDVPLERVVRAT-GMPGLDLITSGTRMDDGPELLAGPAMRSLVGDLRAR
A0A2V7HL73      AGRGLVDAILNAELTLEAVVEVR-PDLNLTILPAGRLPRAPFEVLKSPRVEELLAEARRR
A0A2V7K2H8      PG---LTDFLAGRAPFEATVQGT-PYPDLQFIGAGTRFRDSPELLGSGAMSELLARLRAS
A0A2V7EK09      PG---LTDFLQGETSLDTIVQAT-PYPAFSLIGCGVRAYNGPELLGSAAMSQLLTTLRSS
A0A2V7QD43      PG---LSDFLRGEAQLDVIVQAT-QFPALSLIGCGTRAYNAPELLGSPAMTSLVNGLRGS
                .*   .   :         :        . .:  *         :        .      

A0A1V4RFS5      CDMLIIDTPPAAVVTDAVVIAPAVDSVILVVRSGKIQKKVVQGVWQKLLRSGGHLSGAVI
A0A1Q6ZF81      YDVIVVDSPPLAAGVDSFIIGTVTGSLLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVL
A0A524QR19      YEVIIIDSPPMAAGSDAYILGAHAGSVLTVLRSGTTNKDMAAAQMESFLRLPVRLLGAVL
A0A2N1WA66      YDVILVDSPPLGAGIDPFLLGTLTGHLMLVVRAGETNREFTEAKLQIIDQLPIRLVGAVL
A0A143BIC3      YDVVIVDSPPLGAGFDAYALATATGNMALVMRAGVTDRKMAAAKMQVVDTLPVRVMGAVL
A0A2V7HBX4      FDVVIIDSPPLVAGMDAYALGAAAGSMLIVLRPAVTDRKLASAKLEVLDRLPIRILGAVL
A0A2V7SVD5      FSVIIVDGPPLSAG----------ENTLMILRHSKTDMRMAKTKLALLRRLPLRTVGVVL
A0A1Q7JIY3      YDVILIDSPPLGAGVDPFILGTVTGNVLLVLRTGYSHRDAAGAKLEVLNRLPVRTLGAVL
A0A0S7Z9Q9      YDVIIIDCPPLASGGDPLILGSLTGNLAVVIRTGATEKALAQAKIDQLSRLPIRILGAIL
A0A2V7GP46      YDVILVDSPPLGAGIDPFVLGTLTGNLLLVLRTGVSHREVMAAKLEVLRRLPVRLLGAVL
A0A2V7H298      YEAIIVDSPPLAAGADGLALATVTGSLVLVLRTGVSDRELTETKLGALHHLPVRVLGAVL
A0A2V7N2D0      FEVILVDSPPLSVGVDPYILGTLTGNLLLVLRSGVTDRELAATKLDALDRLPIRLLGAVL
A0A2V7ILF0      FDAVLVDSPPLDAGVDAYLLGTLTANLLLVLRTGVTDRELAAAKLGVLDRLPVRVLGAVL
A0A2V7NMY2      YDVVLVDTAPLAAGADPYTMASLTTNLLMVLRAGVTDLELAQAKLESFEDLPVRVVGTVL
A0A651HVY0      FDVILVDSPPLGAASDPLILGTLTGSMLLVLRNGATNTDQAAAILQNLHRYPIRVVGAVL
A0A2V7SCT4      YDVILIDSPPLGAGVDPFILGTVTGNVLLVLRTGYSHRDAAGAKLEVLNRLPVRTLGAVL
A0A2V7RBS9      YPVIIVDSPPLGAGVDPYTLGTMTGAMMLVLRTGATNLDLARTKVAMLENLPIRVVGAVL
A0A2V7Q893      YDVIIVDSSPLAAGTDAFALGTATGTLLLVLRTGVSDGGLAQAKLQVMNHLPIRVLGAVL
A0A2V7QPQ4      FDVILVDSPPLAAGADAFALGTMTGAMLLVLRTGFSDREQAEAKLDVLARLPIRVLGAVL
A0A2V7MB00      YDVILVDSAPLAAGVDPYALGAATGNVLLVLRTGVTDRGLAEAKVEMLHRLPLRVLGAIM
A0A2V7T7Z8      YDAIIIDSSPLAAGADALALGTAAGSLLLVLRTGVSDGALARVKLYDIRRLPIRVLGAVV
A0A2V7PL95      HDAIIVDSSPLSAGADAFALGTAAGSMVLVLRTGVSDRALMQTKLGVLDHLPIRVLGAVL
A0A2V7R2W8      YDAVVVDSPPLAAGADGLALATVTGSLVLVLRAGVSDRELTETKLGVLTHLPVRVLGAVL
A0A1G0LV28      YDIIIFDSPPTLAVTDATVLGASSDAVILVLRAGETEEIAAQRALEQLRRVQARVAGSVL
A0A1Q7E008      YQVILVDSPPLGAGVDPFVLGTFTGSLVLVLRSGTTNRELAQAKLDVLDRLPVRVLGAVL
A0A2V7L8K7      YDVIVLDTAPLGAGVDALVLAKLAGNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVL
A0A2V7JCT0      YEVIVVDTAPLGAGVDALVLAKLARNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVL
A0A534A8D8      YEVIVVDTAPLGAGVDALVLAKLARNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVL
A0A1Q7DXW6      YDVILVDSAPLAAGVDPYALGTVTGSMLLVLRTGVSDRAIAEAKVAVLQRLPIRVLGAVL
A0A2V7JF48      YDVIVLDTAPLGAGVDALVLAKLAGNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVL
A0A534A9Q9      YDVIVLDTAPLGAGVDALVLAKLAGNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVL
A0A2V7NW82      HRVILVDSPPLGSGVDPLTLGTLTGSLLLVLRAGASNLDLTRTKLALLELLPIRLLGVVL
A0A2V7Q431      FSAIVIDSPPLGAGVDAYALGAVTGNVVLVLRLGTTDRETTEAKLDLLDRLPVRLLGTVL
A0A2V7IEC4      YDVILIDSPPLAAGVDPLILGTLTGTLVLVLRTGYSHRDVAAAKLEVLQRLPVRLLGAIL
A0A1Q6WKV1      YDVILMDSPPLAGGVDPFILGTLTGSLLLVLRTGHSHRDMAAAKLEMLHRLPVRLLGAVL
A0A2V7N4E0      YDVILIDTPPLGGGVDPLILGTLTGNLLLVLRTGCSDRDVMAAKLEVLGRLPIRVLGAVL
A0A2V7EJU4      YQVILIDSSPLGAGVDPFLLGTLTGSLLIVLRSGTTDRELAHANLDVLGRLPIRVLGAVL
A0A2V7J5T6      YDVIVVDSPPLTAGVDPFVLGTVTGALLVVLRTGKSHRGITGAKLEVLERLPIRLLGAVL
A0A2V7KN28      HDVILIDSPPLTAGVDPFILGTVTGSLLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVL
A0A257SFA4      FDVVVFDSPPLSAGIDPFVLASLSANMLLVIRTGLSVRELTYTKLEALNRLPIRLLGAVL
A0A2V7HL73      YDYIVLDTPPLVSFPDCRVIEKCVDGFLIAVAAHKTSRKLLEEALNVTER--AKIVGFVF
A0A2V7K2H8      WSVILVDSPPLGSGVDPYTLGTLTSNMLLVLRTDATDLSLARTKLSVLDHLPIRLLGVVV
A0A2V7EK09      YDVILIDSPPLAAGVDPLILGMLTQSLALVLRTGYSRREVAASKLEALQRLPLRLLGAIL
A0A2V7QD43      YDVVLIDSPPLAAGVDPLILSTLTGTLALVLRTGYSHRDVAAAKLEVLQRLPVRMLGAVL
                   ::.* .*                    :                      .  * :.

A0A1V4RFS5      NGFDPIRTYTSYTYYTYKYQYYYEEQSE-------------------------------
A0A1Q6ZF81      NDVPRGAAYGYYAYYSYYLPGYEAVEE---------SSGQASAPRVV------------
A0A524QR19      NDFTPQLGQGYYRYYSHYLPGYEASEE---------KEEEVG---VV------------
A0A2N1WA66      NDIRTSMN--EYSYYA-YSSGYAATDE---------AERTEARARPVVPTIPAEVGTRD
A0A143BIC3      NGIKMTGA---YQYYSYY-QDYAATDE---EPVARITDGTRGDGEMKQGGRS-------
A0A2V7HBX4      NAVPDGGA------YRYYGADYSYKDEVLKEPIADIATPKGLLVRS-------------
A0A2V7SVD5      NDVKAMGD---YKYYG-YDTAYRALPE---------ERAVATV----------------
A0A1Q7JIY3      NDVPRGAAYGYYSYYSYYLPGYEAVDEDDSLEAHS-RPRVV------------------
A0A0S7Z9Q9      NDVSAHDT--YHSYYASYLPSYEPVPE---EGDEV-PTQILSGPSDRELDLEEEGARKG
A0A2V7GP46      NDVPPGAA---YQYYSYYTPGYEATDE---------KPARLTPSVG-------------
A0A2V7H298      NDVRPGGA---YRYYSYYLEGYEVHDE----PAAA-EVHVLRGPER-------------
A0A2V7N2D0      NDIRQDGA---YRCYSYFPEGYELREE---ESAGQ-RKRILTAAQ--------------
A0A2V7ILF0      NDVEPRGA---YRYYSYSLEGYELKEEQDPDDEGAAARVLVRSPK--------------
A0A2V7NMY2      NDVQPKGA---YRYYAYYVPGYETKEE---ADLGP-EKPVLGVPSV-------------
A0A651HVY0      NDVPSRGEYRYYGYTSGYEVGAGARAD---KKDRK-GSRLVGAGR--------------
A0A2V7SCT4      NDVPRGAAYGYYSYYSYYLPGYEAVDE---DDSLEAHSRPRVV----------------
A0A2V7RBS9      NDVRLGQM---YGEYYGYMAGYGTTTE---DGGTRIARRRLQGAL--------------
A0A2V7Q893      NDVRRDRL---YRNYSYYLEGYEA-QD---EPDGA-RGQVLRAPV--------------
A0A2V7QPQ4      NDVRLGGE---YRYYSYYMAGYEAEDE---HPAWD-DRPVLQPSD--------------
A0A2V7MB00      NDVRPGTA---YSYYSYSLEGYEVWEE---DPEGK-VSKMLLSEESKPTGAGIP-----
A0A2V7T7Z8      NGVRLRRG---SSQDAYYLEGYEA-KD---EPESV-GGPVVGASG--------------
A0A2V7PL95      NGVVPGGV---YRYYSYYLEGYEA-KD---EPAGA-AGQVLRAPE--------------
A0A2V7R2W8      NDVRPGGA---YRYYSYYLEGYEA-HD---EPDAA-QARVLRGPVEEPVTR--------
A0A1G0LV28      NGVEKDRD-RYYNYYYYKHHDDGERRDGPFATLRK-RLLGVG-----------------
A0A1Q7E008      NDVEPHGV---YRYYTY-LSGYAAEDEP--RRTEG-WALARRPRGAS------------
A0A2V7L8K7      NDVRDESE---YRAYAYYMDGYALTNEPLFRPLAG-SKQGASSRPTR------------
A0A2V7JCT0      NDVRDESE---YRAYAYYMDGYALTNEPLFRPLAG-NKQGVGSRPAR------------
A0A534A8D8      NDVRDESE---YRAYAYYMDGYALTNEPLFRPLAG-NKQGVGSRPAR------------
A0A1Q7DXW6      NDVPPGTA---YSYYGYSLAGYEMKEED-----PG-GAAGEILLPERS-----------
A0A2V7JF48      NDVRDESE---YRAYAYYMDGYALTNEPLFRPLAG-SKQGASSRPTR------------
A0A534A9Q9      NDVRDESE---YRAYAYYMDGYALTNEPLFRPLAG-SKQGASSRPTR------------
A0A2V7NW82      NDVPAAGA---YRYYS-YLSGYEAADEPE-------SVAVQRVRALL------------
A0A2V7Q431      NDVPEHSA---YAPYSYYMEGYAYEAERGREPRTL-TGGRSRS----------------
A0A2V7IEC4      NDVPAGGA---YRYYSYYLPGYEAADED--------SGSRR---VPV------------
A0A1Q6WKV1      NDVPAEAG---YRYYSYYLPGYEATDEY--------PAGRK---LVV------------
A0A2V7N4E0      NDVPPGAA---YRYYSYYLPGYEAVDED--------TGRNKRQPLVI------------
A0A2V7EJU4      NDVEPRGAYRYYS----YLSGYAAEDEA--------SAPPQRWAVARRLPGASSPSA--
A0A2V7J5T6      NDVPRGAAYGYYAYYSYYLPGYEAVEEA--------GTSGSQVV---------------
A0A2V7KN28      NDVPRGAAYGYYAYYSYYLPGYEAVEET--------DGRRTSSPQVV------------
A0A257SFA4      NDVPDTAP---FAYYSNYLPGYEAEAEH--------RDASATRATAAEAR---------
A0A2V7HL73      NGDDRHLS---RDSYGTY-ASTRSVDLG--------GGGWRRLVSSSSRTHRRQTASDH
A0A2V7K2H8      NDVRPGGV---YRYYSYF-AGYGTRDEG--------VAIATHRVRGVL-----------
A0A2V7EK09      NDVPPRGG---YPYYSYYLPGYEAVDEE--------SGRRSGPTGRPLVA---------
A0A2V7QD43      NDVPAGGA---YRYYSYYLPGYEAMDEN--------SGSPRVPV---------------
                *                                                          

© 1998-2021Legal notice