BYKdb

Dataset for cluster orphancd of phylum gemmatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

43 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      ------------------------------------------------------------
A0A143BIC3      ---------------------MSGQQIQPVSPRDVALEPYQDGAPPADWGGGQEAAPEPK
A0A2V7HBX4      -----------------MRVRSLQPDYPLAPHHPGSIPTAEWTPARPRSEDFEDAEGIPW
A0A2V7SVD5      ------------------------------------------------------------
A0A1Q7JIY3      -----------------------MISDNLPAIRARAAPVSPRRAPPSLAAAEEETG-LDW
A0A0S7Z9Q9      -------------SDEQFALPAAPSDGPGGEIQLRDAAAAAAAPPVWDEGFYPPSDDGDG
A0A2V7GP46      ------------------------------------------------------------
A0A2V7H298      ------------------------------------------------------------
A0A2V7N2D0      --------------MATDLPVGPQGGDTVPLGHGRTRGGRGTSLGYRLPPSGDTPPEEEW
A0A2V7NMY2      ------------------------------------------------------------
A0A651HVY0      ------------------------------------------------------------
A0A2V7RBS9      ------------------------------------------------------------
A0A2V7MB00      ------------------------------------------------------------
A0A2V7PL95      -----------------------MTMDNLPTRFEEPTAPAWQASGTGYAVGRAAAGESDW
A0A2V7T7Z8      ------------------------------------MAGAPRAGGA-----PPPSAEGDW
A0A2V7ILF0      MGARCAPRPSFPYRTPATMPSDQPLQPVISLGRLEPAKSAGSALPSRALQPALPPS-ADW
A0A2V7SCT4      MRGSCKTVGAV----SDLLRGQAMISDNLPAIRARAAPVSPRRAPPSLAAAEEETG-LDW
A0A2V7Q893      -----MTTGGL----ATLLDTTK---------SQRLPTVGDRKAAERRARPTPPDG-GDW
A0A2V7QPQ4      MATFDSPSSGL----PQL---SH---------PRRTAPLGPYDAAHGPAQMEPDPGVVDW
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      ------------------------------------------------------------
A0A143BIC3      GPSLGRYLAAINRFKWLIMLLGIVGAGAGYMATTFIE---PEFEVRATILLEQGTGISNG
A0A2V7HBX4      ----SRYVDAIRRHVLLIVGLAAVGSVLGVVAARRVR---PIYEAQATVWISTTPSSALQ
A0A2V7SVD5      --------------------------------------VEPSYEARAKVWIMSPKPTNGP
A0A1Q7JIY3      ----RRSAIALSRFKWVVLLTVVLGTAAGVAATRFVR---PEFVAQATVWVDVPDRRGAA
A0A0S7Z9Q9      GIDFRRYLVSILRHKWLVASSLLVGVVGSVFVWSRTA---VTYTAEGNLWIEAEARTAAD
A0A2V7GP46      ------------------------------------------------------------
A0A2V7H298      ------------------------------------------------------------
A0A2V7N2D0      ----RGYFGSIKRWKRLVIIVTLAGTALGVVATKLVVPSLPFYAATANIWIDGSGHRPDR
A0A2V7NMY2      ----------------MVLAVTLLGTAAGVVAAAKFVG--PRYLARARLWVGAAEPNPNA
A0A651HVY0      ----------------MMAAAVVLGLGAGYVVAQSQV---PRFSTQALIQVGEPQRQQA-
A0A2V7RBS9      -----------------------------------MLP--PRYLVQATIWIQSSEARGTP
A0A2V7MB00      ----------------------------------------------------DQASRSEQ
A0A2V7PL95      LDEIGRYLRAVRRHKWLVLGTTLLCAGAGIVLARVKLQ--PTFIARASVWIQVPSAHVAR
A0A2V7T7Z8      LADARRYLIAIQRYRWMVFGLSALGLLVGFAFAGVVLA--PGYAARASLWIHGPAGQEG-
A0A2V7ILF0      ----RRYLVAIRRYKWIVLAGSLLGGGAGFAAGRYLGS--E-YTARATIWIDVPDPRNRE
A0A2V7SCT4      ----RRSAIALSRFKWVVLLTVVLGTAAGVAATRFVRP--E-FVAQATVWVDVPDRRGAA
A0A2V7Q893      IGEAQRYLRSVRRHKWLVLSLTLFATAAGVELSMYALP--PNYAARATVWIQVPARQARD
A0A2V7QPQ4      ----RRVFAALLRFKWVVVLVTVLGTAGGVVLSRVIKI--P-YTTHATVWVDVPDVRAHD
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      ----IRGPNAESMF------------------------GVPLEGPTGPDASLFDNFERTE
A0A143BIC3      GQSRG--PIQADEL-LQASGWQDLLRSFAIADPVVNSLALFVTPSAAGDSTLFRSFRVSE
A0A2V7HBX4      TG-----PIRQQQL-LTTGSWVELLRSFAIVDPIVRDLKLNVSYKQPSDSVLFRNFEWTP
A0A2V7SVD5      QPTG---PIRAEEL-LPQSSWAELFQSFAITDSVVAKRGLAATPEDAKDRPAFMRFATSE
A0A1Q7JIY3      DRSG---PLRPEQL-LDAESWVDLLKSYVVLDQVAREQRLYMGLKTPQDSAVFTSFQVAE
A0A0S7Z9Q9      LG-----PNEPSGL-LQDNAWVELLESFQVLDTVAVRERLFLRVPADYEP-AFQRFSLAD
A0A2V7GP46      ------------------ESWIDLLRSYAVLDRVARDLRLFLQLPKGPDP-ALRSFNVAD
A0A2V7H298      ---------------------MDLLQSYAVLDDVVRGQRLYLHAKVPGDSDILATLRIKD
A0A2V7N2D0      DQ-ATPGPIHSGQL-LGASGWVNLARSYVVLDSVARGMRLYLGWDSEQDSAALASLELKP
A0A2V7NMY2      LR-GTTPPPGAERL-LGVAAWVDFVRSDAVLDTVVRDVRLYLDPKTPLDGTALLRFGLKD
A0A651HVY0      GV-T---AIETGVR-FSPASWANLMRSNRVLERVVDDLNLFVWAQPPATPDAFLHAAVVG
A0A2V7RBS9      DR-G---PIGANQL-LAPTAWGDLLKSYVVLDAVARERRLYLQARP-RDLPALAGFAVAD
A0A2V7MB00      DR-G---PIQQGELFGSATGWLDLLRSHVVLDDVVRQWRLYLRPKSADDNAALATLTVTG
A0A2V7PL95      EP-G---PIWSGQL-PISSGWEELVRTNIVLEDVVRRRRLYLDYKNAADSDLFATFDIKQ
A0A2V7T7Z8      EP-G---PLWSGRL-PISAGWSDLVRTNIVLDDVVRGERLYLTNNPASDT-VLATFAINQ
A0A2V7ILF0      E--G---PLWTGQL-RISSGWTDLLETSAVLESVVRERRLYLSLDDPADSAALRSFRIKG
A0A2V7SCT4      DRSG---PLRPEQL-LDAESWVDLLKSYVVLDQVAREQRLYLGLKTPQDSAVFTSFQVAE
A0A2V7Q893      E--G---PIWSGHL-PISSGWIDLIRTNIVLEDVARRERLYLTTDA-GDAAPLTTLAIKE
A0A2V7QPQ4      E--G---PIQTAGL-VGASGWVDLLKSNAVLEDVVRRQRLYLALDSPDDTGAVKSLGVKE
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      TI--RSGSYLLAVNEDSRRWELT------HQGSQQKE------------TGVVGDS----
A0A143BIC3      QVPLRPGAYILKL--TGQTYTLE------TSGGLQVE------------QGAVGDS----
A0A2V7HBX4      AT--RSGAYLLKIDGAGPKYMLS------TAKGVFIE------------SGAIGDS----
A0A2V7SVD5      RP--IIGDYSLRVDAKGQRYTLT-----RKADGTVVD------------TGTVGDS----
A0A1Q7JIY3      DY--RPGDYRLAVQGDGRGYDLA------TADGVPLE------------RGAVGDS----
A0A0S7Z9Q9      EV--GFGTYVLRVSESGADFVLT------TDDGTLVQ------------QAAFGVP----
A0A2V7GP46      QF--RPGAYRLTTD-AARAYVLA------KVDGGVLE------------RGTVGDS----
A0A2V7H298      HV--APGKYRLVVEDTGDAPHFT---LYNARSKAPVQ------------TGVAGDS----
A0A2V7N2D0      QF--RSGEYRLQVDSSGRRFRLL------TAQGGEVQ------------HGIAGDS----
A0A2V7NMY2      QV--LPGRYRLEVDRDGAGFTLF------SAQGGVVQ------------HGERGDS----
A0A651HVY0      TI--RRGGYIVRVDEAGRTVSLL------DEEERVLESHELASLLPVSSEDSLGDPETED
A0A2V7RBS9      QF--TPGRYHLTIDHDGQTFHLQ------REDGTELE------------QGAVGSP----
A0A2V7MB00      EI--RPGRYRLLLDREGKAF-----RLLDVAEQQVLQ------------EGSWGDP----
A0A2V7PL95      RV--RPGAYRLVVNDSGNGLTLSFKRLLFPSARNVLE------------RPAVGDS----
A0A2V7T7Z8      QV--RPGRYRLVVDNGGTAFTLR------DAAGRVLD------------RGAVGDS----
A0A2V7ILF0      QV--RPGTFAFSVAELDPTFTLS------SEDGVH-E------------QGSLGDS----
A0A2V7SCT4      DY--RPGDYRLAVQGDGRGYDLA------TADGVPLE------------RGAVGDS----
A0A2V7Q893      RV--RPGTYRLAVDTTGTAFTLS------DAAGAVLD------------RGAVGDS----
A0A2V7QPQ4      RV--QPGAYRLVVTAQGGRFLLL------DGHGVTLQ------------QGAVGDS----
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      --------VGRAFGFRWAPNLGGGRRGRSFRFDILTPQEVADDIRGKLRPDLERM---NA
A0A143BIC3      --------VGTRVGFMWQPTSQALAGRKDVGFNVQTPREASIALIKKLKMNLAN----GS
A0A2V7HBX4      --------IGRKAGMNWLPDARFLGRGRAIEFGVTSPRN-------------------VS
A0A2V7SVD5      --------IGRTVGFRWAPTPQMLKPGRTYNFNVVTPRDASTALLAKLKPPPAV--APNS
A0A1Q7JIY3      --------VGARLGFRWVPPAGALPSGRTIDFSLTTLRDAARWLGDALGVQMDP----NG
A0A0S7Z9Q9      --------IGENVGFRWNPAPGSFPPEAVVRFRVLTARDAGQQLRDQLQTQIDR----AG
A0A2V7GP46      --------IGRGIGFLWAPPAESLPPGHTVEFRLQTAREAALYLSDALDARMDY----NG
A0A2V7H298      --------VGPDMGLAWVPPRAVLAGPREVDFTLDPPYEAALGLARNLKVAADL----DG
A0A2V7N2D0      --------IGGAVGFVWVPPASAFTPRRTIRFSVSSPYDAATNLAQRLQVELDP----DG
A0A2V7NMY2      --------VGPALGFAWVPGAAVLTPGRRIEFTLLTPHDAAELLASQLQVTTDP----EG
A0A651HVY0      GTGEDPVMLGESVGVNLNLAPAALEPGAELRFTLQPRRDAARNLAQGLMVQPSQ----SA
A0A2V7RBS9      --------VGRTLGFIWTPTTAVLTPGREVRFVVSPLRDAAKKLADNLNVTLDL----SG
A0A2V7MB00      --------VGGVLGVSWTPPTNAVRPGGSVDFTLATISEAAVELSEQLRIRAGQ----EG
A0A2V7PL95      --------VGVAQGFAWVPRAGALRPRRKVEFTVAGPSDAAKALGRALKMAADP----DA
A0A2V7T7Z8      --------VGARLGFVWVPSPGTLHAGETVAFTLITPSAAAAWLTRELKVSPDP----DG
A0A2V7ILF0      --------VGADLGFLWAPAPDAVAPGHKIVFTVAAPSDAAKLLAKALVVKSDL----DD
A0A2V7SCT4      --------VGARLGFRWVPPAGALPSGRTIDFSLTTLRDAARWLGDALGVQMDP----NG
A0A2V7Q893      --------IGAPLGLAWVAPAGMLRAGDVVNFTVTTPAEAATRLRRELKVSSDV----DG
A0A2V7QPQ4      --------VGPALGLAWVPAASALRPGRTIAFALATPPSVAAGLADQLRVQTDMMEGKVG
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      RFLRLNYEGQNAERAAATLNAIVAQFVTQAAALKNRNLSAEAAVLDTQLTRARDRLNTAQ
A0A143BIC3      SFLFLNLTGNDAPRTAATLNAWVEQFVVVATALKKKNVTSVAAILEGQREFAAKSLNEAE
A0A2V7HBX4      QFLKITLSGADPRRTARTVNAWAEQLVNSSGDLKTRHLFEFKKILGDQLALAEAQLRTSE
A0A2V7SVD5      NFMNVTLVDNDAVEAAATLNTWLTEFDSTALWLKRRNVSEYSKLLEVQRQYANDKLKDAE
A0A1Q7JIY3      NFLKVDLRGKDPRRISVILNAVTQRYVQVAAELKRQKGTELTKALEEQLNTAHTNLQQAE
A0A0S7Z9Q9      NFIRLTLSGPNPEKIASILNAVMDRHVTIAAELKRNKLDQTLIVLEEQLTQAEAQLQRSE
A0A2V7GP46      NFLKIELRGGDPARITRILNAVAERYVEVAAELKRGRLTELTGIIGDQVRTAKQSLDSAE
A0A2V7H298      NFLRMELGGHDPAQIAATVNAVAERFVAVAAGLKRDNLTELTRILGDQLAQAQANLRQAE
A0A2V7N2D0      NFLQISLRGSDPAYIAATVNAVATRFVDVATDLKGKRLSELTKILATQLEHAQANLRSAE
A0A2V7NMY2      TFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGEQVRHAQASLTAAE
A0A651HVY0      -FMVVGMQGQDPWWIAQIVNAVTESFLAEATELARAQSDELSQTLQEQLATTQRALSQAE
A0A2V7RBS9      NFLRVALTSPNGTDAAATVNAVADRYVAVATDMKRVKVTELSRLLNEQLQAAEANLHKAE
A0A2V7MB00      NFVRIARRSPNPDQATGIANSVADRFVAAAADLKRQRLTELTAILQDQLDHAQTNLRTAE
A0A2V7PL95      NFLRLELGGPDPVAVTATVNAIAERFVAAAADLKRDNLVQLTGILDNQLDRAQATLRDAE
A0A2V7T7Z8      NFIQLELYGPDASRTTAIVNAVAARVVAVAADLKRANLTQLNAVLGGQMRRAEADLRSAE
A0A2V7ILF0      NFIQLELRGSSPTGVAGIVNAVADRFEALATELKRRKLTELTGILSEQLKQAQGKLAEAE
A0A2V7SCT4      NFLKVDLRGKDPRRISVILNAVTQRYVQVAAELKRQKGTELTKALEEQLNTAHTNLQQAE
A0A2V7Q893      NFLRIELAGPDAAAVTGTVNAVATRFVATAADLKRDNLTQLTGVLAAQLEQEETKLRSAE
A0A2V7QPQ4      NFISFELRGTSADTITAVVNAIADRFVLVATDLRREKLSALVKILGDQVQNAQLNLTRAE
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      --MRLELTGTSPTAIAGTLNAVLQRYVDVAAELKRAKLTELTHILNEQLSTAARHLHDTE
A0A2V7L8K7      ------------------------------------------------------LLADAR
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ----------------------------------MACPRSDTRILGDQLEHARANLRDAE
A0A2V7JF48      -----------------------------------QQSTRRREFLESQLKVNDSLLADAR
A0A534A9Q9      ---------------------------------------------ESQLKVNDSLLADAR
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      AALESFKVSVVTLPREDV-------------------PVPAGLQSSTPSVFGNFIRQRNE
A0A143BIC3      GALESFRVRTVTEPTERQ-------------------TITPGIELTTNPVFDNYFRDKVL
A0A2V7HBX4      NELEHFRVSTITLPSGVA-------------------ASAGPGVTQGDPVVASYFQQKVA
A0A2V7SVD5      LRLEGFRTRTITMPSEAT-------------------IVTPGLQETRDPVFRSFFEKKLE
A0A1Q7JIY3      AALQTVRAQTITLPSDRP-------------------LTSAPGPERRDPVFTNFFDMQIE
A0A0S7Z9Q9      RSLEEFRVSTISLPTDQS------------------MPIAPGLQITRDPTFGNFFDMRVR
A0A2V7GP46      GDLESFRRRTITLPPDAV---------------------AAGGDTPRDPVLGDFFEQQVQ
A0A2V7H298      ASLKSFRVGAVTTVAAGA------------------GSVTESSQYPRDPMFAGLVDLKVN
A0A2V7N2D0      SALRSFQIRTATVLPGSAIIPPEALAPGANTPPQRRPPVSDLVGQSRDPVFANFLDTRVA
A0A2V7NMY2      LALKSFRVRAAGVLPAGV------------------AAP------PPSPAFTNAFELRVA
A0A651HVY0      AELEAFESAMASNV-----------------------ELSAQWSGSDPAAASGLVDLRTE
A0A2V7RBS9      RALEDFRVRTIMLPAEPV------------------AGTA-----TRTSPVSEFLTRRVQ
A0A2V7MB00      AALTAFRVRNAVRPSEGP------------------AQGPDGRRITADPTYASYIDLQVS
A0A2V7PL95      AALKTFRVRAVTQFADGA------------------GSVTPNLRYPQDPVFAGLLDMKVE
A0A2V7T7Z8      GALQRFRMQAATQLADGS------------------GSVTANFSAPTDPRFARLLDVKSR
A0A2V7ILF0      AALKRFRVTAVTQFAEGT------------------AAVTPNLERTQDPGFAGLLELKVS
A0A2V7SCT4      AALQTVRAQTITLPSDRP------------------LT-SAPGPERRDPVFTNFFDMQIE
A0A2V7Q893      GALQRFRVTAVTEYGDGA------------------APVTSNMRSPQDPVFAGLLEVKVR
A0A2V7QPQ4      QRLRDFRVHSVTLLTGTP------------------APLLVPAPQGRDPAAANFFEMKVS
A0A1G0LV28      --MQAYQESQSTTDLSAE-----------------EVSLV-----------NTIQDLDRE
A0A1Q7E008      GALEGFRVRTITLPSEQA-----------------TPLAP-GLEATRDPVFKNFFEMRIE
A0A2V7L8K7      QAVTAFRQRAGTYGSREA-----------------LAREQ-----------AGLAGVELQ
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      AAMTRFRVRTATHPTQGA-----------------VPSAEGRPPAATDPAVAGYLDLQVT
A0A2V7JF48      QAVTAFRQRAGTYGSREA-----------------LAREQ-----------AGLAGVELQ
A0A534A9Q9      QAVTAFRQRAGTYGSREA-----------------LAREQ-----------AGLAGVELQ
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      VDSLRREQTELREALAQARSGEL-A-IDRFLNIGAVTRAP---ELT-QVLTELGEAERQR
A0A143BIC3      ADGYQRDREALERILNAGKQGAP-ITREAVLSVPSVNTDPAAENLR-KVLAEQADREFNL
A0A2V7HBX4      LDEIRSERQALERMVSEAKGGPI-NPQDFLQLPTILNNAP---QLR-SAIEELSLRQATL
A0A2V7SVD5      SSDLRQYADALARAMTAGPAAPE-A-ISAIPGLLTQAGAK---DLS-ILLDELTKRQGEL
A0A1Q7JIY3      RDQLRRDREAIERLLADARASAL-P-ADALSLIGSVQHSA---ELS-QALKELTDKQATL
A0A0S7Z9Q9      LDELQQDRRRLQAVIDDFGQRDV-R-IEALELIPATAGSS---ELR-RILDELVDARSEL
A0A2V7GP46      RQQAARDRAALTRVLAQPADSGL---ASALEVIGAVQHSP---ELK-DALQELTTKQAAL
A0A2V7H298      LDEVRRDRTAIERLLAPSTDPTVEVPVDALSMVGSVQRST---ELV-QGLRDLTSKQAEL
A0A2V7N2D0      LEQLKRDRAAIERVLAQTADSGL-A-VDALELVGSVERSS---ELT-DALKELVGKRADL
A0A2V7NMY2      VDQLGRDRQAIDRVLAQQPDSGL-S-VDALAAIDAVQKSP---ELT-QALKELTDKQAEL
A0A651HVY0      LDQLSRDRENLTRTLGEAERAGT-LRVQALEAIPSVRESS---ELM-GVLEQITERRAEV
A0A2V7RBS9      EDQLRRDQDALAQLLAQGPDSLG-F-SERLAAIGAVQGSA---DLT-RALSELTTKRADR
A0A2V7MB00      LDELKRDRAAIAQLLTRSADSGV-A-VDRLAMIGSVQRSS---ELT-AALKELTDRQAEL
A0A2V7PL95      REGLVRDREAINRLLAKPD-SGV-A-VDALAMIASVQKST---ELS-QALRDLTAREAEL
A0A2V7T7Z8      RTQLLRDREAINRILARSSGSGP-V-VDALATIGAVAGST---ELS-RALGELTQKQAML
A0A2V7ILF0      REQVRRDRDALRRVLAQARDSGL-S-VDALGMIGAVQRSL---ELS-EALKGLTAKQAEL
A0A2V7SCT4      RDQLRRDREAIERLLADARASAL-P-ADALSLIGSVQHSA---ELS-QALKELTDKQATL
A0A2V7Q893      RGELLRDQAAIKRILAQPPESGL-I-VDALATIGSVERST---ELS-QALRDLTAKQAVL
A0A2V7QPQ4      SEELRIDRTALARVLAEGADSGP-S-TDALEMIPSVQQSS---VLT-QALGELTEKQATL
A0A1G0LV28      KQRILLDLQTLESSIRPGSD----MTIETLNGLAAVPGISGNPAMTFQIQALLRLYDDRR
A0A1Q7E008      REQLRRDREAIERVLAEVADAEVAAQGLEVIGV-----VQRSAELT-QAQRELTTKQADL
A0A2V7L8K7      RQQLEAERRTDESLLAALRDRDSSVSRRALQTALATPGVAASPSVT-QLSTQLYQYERAR
A0A2V7JCT0      --QLEAERRTDESLLAALRDRDSSVSRKALQTALATPGVAASPSVM-QLSTQLYQYERAR
A0A534A8D8      --------------------------------------MAASPSVM-QLSTQLYQYERAR
A0A1Q7DXW6      VAQLAHDREAIGRVLAQGADSGVLTDALAMITA-----VQRSAELT-EALKELTAKQAEL
A0A2V7JF48      RQQLEAERRTDESLLAALRDRDSSVSRRALQTALATPGVAASPSVT-QLSTQLYQYERAR
A0A534A9Q9      RQQLEAERRTDESLLAALRDRDSSVSRRALQTALATPGVAASPSVT-QLSTQLYQYERAR
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      -------------------------------------------------------KQAEL
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      RTLLLTLMAEHDSVRAVTAKIDELRIGTLPTYVQSVLNRLAREQARLETQIQAAQRDLAG
A0A143BIC3      RRLRESYTDEYQKVKDEQAALQTLRTVSVPGALDAYLGQLQLREKALVATIDRSSKDLRN
A0A2V7HBX4      RTEQQFLTDANPRIRQLAEAVRVLERETIPQITVAVLNSLKAREPELDTRISVGSQELRG
A0A2V7SVD5      RDAQKVYTDEFSKVKDLQKQIADLRARAIPAAARNFLAQLRSRENSLNAQLAATSEEIRT
A0A1Q7JIY3      RGLQYRYQDDYAPVQRLKAEIADLENRTIPTLARTLVAQLAARETEVGRQVNATSHELRQ
A0A0S7Z9Q9      RALRDRYSDDYPPIQDLLNQIESIETTAIPRVVLGIMRELEDQEAELSARLATAQAELQA
A0A2V7GP46      RTLRYHYTEAYPPLARKAAEVATLERQTIPTLVRSLIDELGTRMAELDRRIGSASQELRR
A0A2V7H298      RALRAHYTDANPPVRRLASEVDELAHRTVPALAASLVAELRVRESELVQRVDAASSSIQK
A0A2V7N2D0      RALRYRYTETNPEVRRVAGEIGTLERQTIPALTRQLLGELRRREAELVRQVEWASADLRQ
A0A2V7NMY2      RALRYTYTDQHFPVQQLADAVATLDRRTIPGMLRALRNNLAARERDLGQRVDSTVRYLSN
A0A651HVY0      RSLLVRYTEDHPSVLEGRAELRELEQEAIPALADELLAELDVRVSDLQARADARSDDLRA
A0A2V7RBS9      RALLYRYTDDHPAVRRVTTDIDELEHQTIPGLIRGLLAELGTQRRGLASQLETGGRELQG
A0A2V7MB00      RALRFRYADTHPPVRRLALQVDTLSRRVIPGLARTLMAGLAAREQVLAQQRDSIARDLRT
A0A2V7PL95      RALRARYTDATPNVRRLAGEVAALEHRTIPAMAAALTQELAVRAGELEHLVDSAAGGLRR
A0A2V7T7Z8      RTLQVRYTAESPLVRRLTGEVATLEQATIPELAAGLARELERQAAELERQANATARDLRR
A0A2V7ILF0      RAVRFRYTDATPAVRHLAEEVKLLERQTIPRLATALMNELAVRESEVGRDVDSASGNLRR
A0A2V7SCT4      RGLQYRYQDDYAPVQRLKAEIADLENRTIPTLARTLVAQLAARETEVGRQVNATSHELRQ
A0A2V7Q893      RALQARYTAEAPVVRRVAAEVATLERQTIPMLATALAREMGLRAAELEHRADSVARDLRR
A0A2V7QPQ4      RALGYRYTAGLPQVKRLAVEITQLERQTIPTMVRALIAQLGAREAAVTQRIDSAAGGLRQ
A0A1G0LV28      TMMAEGQRESNPQVTALDSRIQTVSRALNDAAAATVRGLRQQIAALERNIAQLRERL-ST
A0A1Q7E008      RALRYRYTDEHAAVRRLAVEIETLERRTIPALTRALLSQIVTREQVLDSLVHSAGRELQQ
A0A2V7L8K7      DSLASR-STSHPDLPRLNQLIGSTEADLLHAVQGGIQSAMTSLEGRITAMNDLRARQ-QQ
A0A2V7JCT0      DSLASR-STSHPDLPRLNQLVSSTEADLLHAVQGGVQSAIASLEGRITAMNDLRARQ-QQ
A0A534A8D8      DSLASR-STSHPDLPRLNQLVSSTEADLLHAVQGGVQSAIASLEGRITAMNDLRARQ-QQ
A0A1Q7DXW6      RALRFRYADTHPPVRRLAAQVDTLQRRIIPQLARTLMAGMAARERDLQVRVDSVSRDLRR
A0A2V7JF48      DSLASR-STSHPDLPRLNHLIGSTEADLLHAVQGGIQSAMASLEGRITAMNDLRARQ-QQ
A0A534A9Q9      DSLASR-STSHPDLPRLNHLIGSTEADLLHAVQGGIQSAMASLEGRITAMNDLRARQ-QQ
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      -------------------AILDADKEGYLRSARALIQTLTGRTRSLTDAIAQTADSLRA
A0A2V7HL73      ------------------------MRDRVSAIT------LTSDGETLGTTVKPDVVETTV
A0A2V7K2H8      -------------MRRLATDIDVLQRQAIPGLARALHADLGARAQTLATEISAGGRELQA
A0A2V7EK09      -------------MQRLAEQIATLQRQAIPTLTRALVSELAAREAEFGRRVAADSRNLRE
A0A2V7QD43      RALRYKYSDQYPLVQRRLSDVATLERQTIPTLARRLLAELSGREAELGRRVAEDTRSIQA
                                                                            

A0A1V4RFS5      --------------------------------------------MLLERSKSPNA-----
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      IPQRAIQ-EQEYLRELEIADLQYRDLQQRFENSRLQEASSLPDLSVLDRAFPPSQPEKNR
A0A143BIC3      IPARTIE-EQRLKRQVEVSDAMYRNLNLKAAEAKLAEAATIPDVSILDPAVAPLRPTKNT
A0A2V7HBX4      IPARATE-EARLVRQVAATENLYNSLKARYEEVSLAEVQTAPDLSVLDTAVAPTLPTSND
A0A2V7SVD5      IPTRSIE-EQRLRREQAMYEGMYTNLSARYADARLAESSAMPDITILDRAAPANGVVTFR
A0A1Q7JIY3      IPPRALE-EERLRRSLTLAEELYTTLQRRYEEAQVSERTIVPDLRILDAAVVPRRPVKNT
A0A0S7Z9Q9      IPPRTIE-EQRLSRQVATNTDLYNQVRGRVESARLAAASSIPDVRILDPARVPNQPSDDE
A0A2V7GP46      IPARSVE-EARLRRSVTIADNLYTSLQQNYEAARLAEASSIPDIRIFDKAVVPLQPVKNS
A0A2V7H298      IPPLAVE-ESRLQRGVTLAEQTVTNLQARYEEARLAEISAIADVRLLDRAVEPQVPVGHM
A0A2V7N2D0      LPSLAID-ELRLQRDVVDAEQLFANIQQRSEEARLAEASSIPDVRILDAAVEPRQPFMDA
A0A2V7NMY2      IPPLLFE-QTRLEREVQVAGQLYASLQQRYDEARVAEASALPDVRILDAPVQPYQPIGSV
A0A651HVY0      IPGQALT-RARLRREVSQAEALFEDVNRRYAAARLAALSTAPDLQIVDRAEPPSRADGDR
A0A2V7RBS9      IPQRAIE-DARLRRDVSIAENLFTSVQQRYSEARLAEASSIADVRVLDAAVAPETPVKNT
A0A2V7MB00      APPVALS-EIRLARDQANAEQLFSNLQHRYQEARLAEVSTLPDVRILERAVRPSRPASNT
A0A2V7PL95      VPPLAVE-ETRLQREVTMAEQAVVNLQQRHEEARLATVSSLPDVKLVDPATEPQEPATNW
A0A2V7T7Z8      IPPLAVE-QAALQRAVTSKEQVVADLRRKYDKVRLAVTSSIPDLELVDPAVEPQEPSDNW
A0A2V7ILF0      VSPLAVE-EAALQRDVTSAEQLVTNIRQRYEEARLADVSSIPDVRILDRAAVPFLPTFNL
A0A2V7SCT4      IPPRALE-EERLRRSLTLAEELYTTLQRRYEEAQVSERTIVPDLRILDAAVVPRRPVKNT
A0A2V7Q893      IPPLAAE-ENRLQRDVTQSAQAVANLQRRYEEARLAETSSIPDVRLVDPALEPQEPTENW
A0A2V7QPQ4      IPPLAIE-DARLDRDVTIAAQLFANIQQRYAEAQLADVSSIPEVRILDRAPHPDTPLFNI
A0A1G0LV28      FPGKQTQ-FAQLRLETELQNDTYKYLLSQLEAARISAGTIAPYIEVVESATVSYR-LGMS
A0A1Q7E008      IPLRAVE-EARLRREVSIAENLYTTLQQRYEEARLAEASTIPDVRVLDAAVAPHQPIKNT
A0A2V7L8K7      LSTTEEE-EARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIA
A0A2V7JCT0      LSTSEEE-EARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIG
A0A534A8D8      LSTSEEE-EARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIG
A0A1Q7DXW6      APPVDLE-GVRLERDELNASQLFSNLQQRYEEARLAEVSSLPDMRILERASKPDKPVSQL
A0A2V7JF48      LSTTEEE-EARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIA
A0A534A9Q9      LSTTEEE-EARLTERVDNAQKVADELRVEYQKAKIAEAVTVGQVEIVDHAALPAKPAGIA
A0A2V7NW82      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7EJU4      --QRAVE-EARLRREVTIAENLYTTLQQRYEEARLAEASTIPDVRVLDTAVVPHQPIKNQ
A0A2V7J5T6      ---------------------------QRFDQSRLAAEATVPDVRILDPAIVPQRPIKNT
A0A2V7KN28      --------------------QTYTALQQRFDQARLAAEATVPDVRILDPAMVPQRPVKNT
A0A257SFA4      IPPRATE-EARLMRRVALATSLFNTLQQRYDETRIAQATDVSDVRILDPAGVPPWPTKNT
A0A2V7HL73      LAAAPQDATSRAGQDAARRGGIVLPRAPGSVDPQVERSRGRRPRTTIAHRLQDERPSNEV
A0A2V7K2H8      IPQRSIE-EGRLRRDVSIAENLYASVQQRYNEARLGEASTVADVQVLDAAVSPQEAAKNT
A0A2V7EK09      IPARAIE-EARLRRAAGLAETLYTTLQQRYQEARVEVASSVPDVRVLDAAAVPQRAVKNR
A0A2V7QD43      VPPRAID-EARLQRQVTLAENLFTSLQKNYDEARLAEESAVPDARILDHAVVPQDPVRNT
                                                                            

A0A1V4RFS5      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A2N1WA66      KSVIIALGTLLGLGAGIGLAFLLDLTDKRFRYADQITAGLGISILGAVPEIRRAKGET--
A0A143BIC3      APVIIFAAVAAMLGLGVVLAILLDQVDKRFRYPEQATDDLGLFVLGVVPVIHSKGKR---
A0A2V7HBX4      APRLLLLAVVASMGLAVGIALIRDRLDRRFRYPEQATRELGLSVAGTVPKFKANHRGE--
A0A2V7SVD5      DLKIIGTAILIALGLGLGLSVMLDRLDHKFRHLAQVNADLGLAVLGTVPQIAQPPRR---
A0A1Q7JIY3      APRLILLAFCGSFGLAVVGAIMLDRIDPRVRYPEQVSHELGLPILGAVPHL---------
A0A0S7Z9Q9      RMLRAGLVFFGCFGLGLLGAVLLDRVDARFRFASDVGRVIGLDILGSIPRIESANGR---
A0A2V7GP46      APRLLLLGFLGGLGLALAGVVLLDRFDPRVRYPEQVSHDLGLPILGAVPHLKARTGGQ--
A0A2V7H298      RAILIFLAFWGGLGVGVAGAVLLDRTDRKVHYPEHVTRAMGLSILGAVPHVDWRNG----
A0A2V7N2D0      APFLLLLSVVGSLGAGVLAAVLRDRVDPKLRDPAHVTQEMGLPILGAVPHLNAANGKGAR
A0A2V7NMY2      APFLVIMAFLASAGLGVLGAVVIDTLDPRFRDPGHVTQGLGLRILGALPHLSRA------
A0A651HVY0      RLMMALVTLFGFVGAGGLGAILMDLRDKRVRSPSDVETGLGLPILGALPHLATRGGR---
A0A2V7RBS9      AVRLLIMGLFAGLGLGVVGAVVIDRFDPRVRYPAQVTTDMGLRILGALPHVKKRAGA---
A0A2V7MB00      APLLIIAAFLTSFGVGVAGAVVRDRADPTVRRPDQITSAMGLPILGAVPHVRQTAPRREP
A0A2V7PL95      APLVIGLALIVGLGAGVTGAVVLDRTDRRVQYPEDVTSTMGLNILGVVPHLGRNG---HA
A0A2V7T7Z8      APVIVMFCAITCFGAGACGAILLDRTDRRVHDPDDVAHKMGLKVLGVLPHFDSPPPPLWA
A0A2V7ILF0      LPVLVVLGLMGGFGAGGGAAVLLDHLDRKVREPDEVTRVMGLPILGAVPHLKQRRNG---
A0A2V7SCT4      APRLILLAFCGSFGLAVVGAIMLDRIDPRVRYPEQVSHELGLPILGAVPHLKD-------
A0A2V7Q893      APVLVLFTMISGLGAGVGSAVVLDYRDRRVHDPEDFTRTIGLKILGVVPHLERKGRN---
A0A2V7QPQ4      AAVLIVLAFVGSGVAGVLGVVALDHLDSRVRHPDQVTRAMGLTILGAVPHVGQ--RN---
A0A1G0LV28      TRNKVVLGALVGLFLGVLAAFFLEYLDQTIKTAQDVERVLDVPVLGLIPLESRQQLLAGN
A0A1Q7E008      APRLILLGLFGGLGLSLMGAVLIDRFDRRFRYPQQATGDMGLTILGAVPRLRYG--RRG-
A0A2V7L8K7      LPEQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVE-QLGMSVIGVITHLDRDGPETG-
A0A2V7JCT0      LPEQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVE-QLGMSVIGVITHLDRDGAETG-
A0A534A8D8      LPEQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVE-QLGMSVIGVITHLDRDGAETG-
A0A1Q7DXW6      APILIVLSFLGSLSVGTLAAMTLDRMDRKVRTAEHVSLAMGLPILGAVPHVHRNGKKRN-
A0A2V7JF48      LPEQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVE-QLGMSVIGVITHLDRDGPETG-
A0A534A9Q9      LPEQIALGLLLGLMLGSGGAFLAERLGSTIAQRVQVE-QLGMSVIGVITHLDRDGPETG-
A0A2V7NW82      ---------MAGLGLGLLGAVLIDRFDPRLRHPDQVTYGMGLRILGVLPHVRD------R
A0A2V7Q431      ---------------------FLADHLNRSVHRREDVAHLGLPVLGVVPHAKG-------
A0A2V7IEC4      ---------------------------------------MGLAILGAVPHLRTLPHAGRH
A0A1Q6WKV1      ---------------------------------------------------MG--GGGGG
A0A2V7N4E0      ---------------------------------------MGLAILGALPHFAG--RGDGN
A0A2V7EJU4      APRLILLGLFGGLGLSLMGAVMLDRLDRHFRYPQQVTGEMGLAILGAVPRIKRGRRAVDP
A0A2V7J5T6      TPRLLLMGFVFGLGLGMVGAIVLDRVDPRVRYPEQVSRDLGLPILGAVPHLR-------T
A0A2V7KN28      APRLLLMGLLAGLGLGVLGAILLDRADPSVRYPEQVSRDLGLPIIGAVPHLRAKDPAEVV
A0A257SFA4      APRLLLLAVLGGFGLASLGSVLMDRWDPRFQYPEQVSRDMGIAILGTIPHVRTARDGTLG
A0A2V7HL73      FCHLSREGSPVSKFLKALERAEQQRALGRHPAPSEAASERGLAVPETAPPRPPRASHELA
A0A2V7K2H8      ASRLVAFGFVVGLSLGMVAAVVVDRLDPRVHHPDQVTEQMGLSIIGVLPHVRDRRAG---
A0A2V7EK09      APQVILFAFFGSLGLAMIGAVLVDRGDPRVRYPYQVSREMGLTILGAVPHLRLTGVPGRH
A0A2V7QD43      APRVVFLGFAASLALGLCGAVVLDRIDPKLRYPDQVSRGLGIPILGAVPHLRNLPRGGRG
                                                                            

A0A1V4RFS5      ----------------------------------EAIRDLRTSLSFSRPEQGIK-SLLVT
A0A1Q6ZF81      ------------------------------------------------------MVLTIS
A0A524QR19      -----------------------------------------------------------T
A0A2N1WA66      ---------------PSAEEASQVI---------EAFRTIRLNLMHTVAREKGF-AITIT
A0A143BIC3      ---------------GKTDEAAQVV---------ESFRTIRMNVRYAADPSRPL-TMTIT
A0A2V7HBX4      ---------------FQIAMMSQAV---------ESFRTLRLALRYDFPTDAPI-VVGVS
A0A2V7SVD5      ---------------AKPEDAAEVI---------ESFRGIRLRLQYAYSANQPL-VCGVT
A0A1Q7JIY3      ---------------KDAAEPAEVV---------EALRGLCLNLVHAHGAAGPL-LVTIT
A0A0S7Z9Q9      ---------------RGVLNAAQAL---------EAFRELRIHVSFAYGSAGPI-TLAVT
A0A2V7GP46      ---------------LTREQRVQLV---------EAMRGVCLGVSYTYGAAGPV-VVAVS
A0A2V7H298      ---------------NRDAAATQVI---------ESLRGVRLNVVHRHGTAGPV-RLTVT
A0A2V7N2D0      GLNG-----------GGAGAAGPVI---------EALRGIRLSLVHAYGTAGPL-LVTIT
A0A2V7NMY2      ---------------GNGEGTAQAI---------EAMRTVRVKLQHASNGGNPL-LLTVT
A0A651HVY0      ---------------VRAKDQNQAV---------EAFRSIRLGLTYAYGTASPM-VLTIS
A0A2V7RBS9      ---------------SDDESGALVI---------ETMRGVRLSLIHAYGTAGPL-VVTIT
A0A2V7MB00      LGKHRGPE-------ADADDGARAV---------EALRGIRLNVHHAAGAVGPL-LATIT
A0A2V7PL95      ---------------KHHEGVLQVL---------EAVRAIRLNVLHAHG-VGPA-IVTVT
A0A2V7T7Z8      ---------------ARSEGGVKLI---------EAMRGIHVNVLHSHG-VGPA-IMTVT
A0A2V7ILF0      ---------------SVHEGGLPII---------EAIRGIRLSVQYAHGAAGPL-VCTIT
A0A2V7SCT4      -----------------AAEPAEVV---------EALRGLCLNLVHAHGAAGPL-LVTIT
A0A2V7Q893      ---------------RAPEDALHVL---------EAMRGTCLNVLHAHGT-GPV-IVTVT
A0A2V7QPQ4      ---------------GKGDQVAPVI---------EALRAIRLRVVHAHGSAGPI-AVTIS
A0A1G0LV28      GHHGRRRYAIPLVSLVSPDDP--SS---------EAYRALRTNVTFVNAEQRSLRVICVT
A0A1Q7E008      ---------------IDPDDLTQVI---------EALRTVRLNVAHAYGAAGPM-VVTIT
A0A2V7L8K7      ---------------MKSPDA--VV---------EAFRGLRLSLVNEYGAPGPL-VITVT
A0A2V7JCT0      ---------------MKSPDA--VV---------EAFRGLRLSLVNEYGAPGPL-VITVT
A0A534A8D8      ---------------MKSPDA--VV---------EAFRGLRLSLVNEYGAPGPL-VITVT
A0A1Q7DXW6      ---------------SQDEDSQPAV---------EAMRGIRLNVQHAYGAAGPL-LLTVT
A0A2V7JF48      ---------------MKSPDA--VV---------EAFRGLRLSLVNEYGAPGPL-VITVT
A0A534A9Q9      ---------------MKSPDA--VV---------EAFRGLRLSLVNEYGAPGPL-VITVT
A0A2V7NW82      RVG------------QDDEHVIQLV---------EAVRSVRLSLAHAYGAAGPM-VVTLT
A0A2V7Q431      ---------------GSNEDAAPIV---------EAMRGIRFNVLHAYGAAGPA-MFTIT
A0A2V7IEC4      GRG------------RVPEDVNQVV---------EALRGVCLNLVYAHGGRAPL-LVTVT
A0A1Q6WKV1      KSA------------RPHEGVAELV---------EALRGTCLNLVYAYGAAGPM-LVTIT
A0A2V7N4E0      GAG------------RTPEDIAQVV---------EALRGVCLNVVHAYGAAGPL-IVAIT
A0A2V7EJU4      EDA------------RQVI---------------EALRTVRLNLTHAYGAAGPL-LVTIT
A0A2V7J5T6      KEP------------AEVV---------------EALRGLRLNVAHEFG-AGPV-VFTVT
A0A2V7KN28      ----------------------------------EALRGVRLSLANEHGP-GPL-LVTVT
A0A257SFA4      DPA------------FR-----------------EAMRGVRMNIAFAYGAAGPV-TLTVT
A0A2V7HL73      REV------------PNGLEEHLVSLLAPRSFEAEQYRTLRHLIEQLHKSTGLS-VVAIS
A0A2V7K2H8      -----------------PDDQQVAHAI-------EAMRSIRLSLTHAHGAAGPM-LVTIS
A0A2V7EK09      GNE------------RSPED--IAAVV-------EGLRGICLNLVYAHGATVPL-LVTIT
A0A2V7QD43      SGA------------RVPDD--VNEVV-------EALRGVCLNLVYAHGGRAPL-LVTIT
                                                                           :

A0A1V4RFS5      SSGPREGKSSVSANLAVAEAEAGK-KVILVDCDLRRPTVNKTFGFKRKPG---FTELISG
A0A1Q6ZF81      SPGSGDGKSFLSANLGLTFADGGH-KTLLIDGDIRRGVLHRRFKGNRQPG---LVDYLLG
A0A524QR19      SPAEGEGKTFVAANLANAFADLGR-KTILIDGDTRRGDLHHILERDRKPG---LTDFLMN
A0A2N1WA66      SAMPGDGKSLVSSNLALSFAEAGF-KTLLIDGDTRRGELHRTFGVERRPG---LLDHLAE
A0A143BIC3      SPGPNDGKSLISSNLALSFAESGA-RTLLIDGDIRRGELAKTFQITSKPG---LVEYLDG
A0A2V7HBX4      SPAAGDGKSLVSSNLALAFASAGS-RTLLIDGDVRCGGLHNTFEIPVTPG---LVDYLNG
A0A2V7SVD5      SPEQGDGKSLVASNLALAFAEAGY-RTLLIDADTRRGSLHDVFGAQRRPG---LIEVLSG
A0A1Q7JIY3      SPGAGDGKSFLASNLALTFADGGH-RTLLVDGDLRRGLLHRRFNANRKPG---LIEFLHG
A0A0S7Z9Q9      SPAPNEGKSMISSNLAVAFSEVGR-RTLLIDGDTRRGDAHRLLGRERSPG---LIDHLRG
A0A2V7GP46      SPGPGDGKSFITANLAVTFADAGR-RTLLVDGDLRRGAQHRLFGADRRPG---LTDALRG
A0A2V7H298      SPGKSDGKSFVASNLALAFADAGY-RTLLVDGDVRRGRLHHTLSAARRPG---LTELLEG
A0A2V7N2D0      SPGSGEGKSFVAANIALAFADAGH-RTLLIDGDIRRGQLHRVLNAARVPG---LTNGLTE
A0A2V7NMY2      SPGVGEGKSLVSANLALAFAYAGL-RTVVIDGDIRRGALHRLLRGSRRPG---LTDHLTG
A0A651HVY0      SPAPGDGKSFTTSNLGLSFAELGR-RTVVVDGDVRKGTQHTHLGVDRTPG---LTDYLTG
A0A2V7RBS9      SPGPGDGKSFVSANLALACAQAGQ-RTLLIDGDTRRGALHRVLGAVRRPG---LTDFLAG
A0A2V7MB00      SAGRGEGKSFVSANLAYAFSAVGF-RTLLIDGDVRLGALHRPLRGARRPG---LTDVLAG
A0A2V7PL95      SPGRADGKSFLASNLAVAFADAGY-RTLLIDGDIRCGTLHRVLKRPRRPG---LTDVLAG
A0A2V7T7Z8      SPGRADGKSFVAAYLATAFADAGY-RTLLIDGDVRCGVLHRAVKLLRRPG---LTDLLGG
A0A2V7ILF0      SPGRSDGKSFLASNLALGLADAGL-RTVLIDGDIRRGALHRVLAVARKPG---LTDVLAG
A0A2V7SCT4      SPGAGDGKSFLASNLALTFADGGH-RTLLVDGDLRRGLLHRRFNANRKPG---LIEFLHG
A0A2V7Q893      SPGRADGKSFVASNLAVAFADGGY-RTLLVDGDVRCGTLHRTLKLARRPG---LTDLLQG
A0A2V7QPQ4      SPGRSDGKSLIASNLALAFADSGY-RTLLVDGDVRRGALHRVLKTARKPG---LTELLAG
A0A1G0LV28      SPGPGEGKSTTAANLAITLAQQGS-ATLLVDADLRRPLVHRAFNLVQEPG---LTDVLVG
A0A1Q7E008      SPGPGDGKSFLAANLARSFADSGR-RTLLIDGDGRRGVLHRVLKVVRKPG---LIDYLAG
A0A2V7L8K7      SPGSGDGKSFVSSNLSLAFAYAKQ-RTLLVDADLRRGALHRVLNLRRQPG---LTDFLAG
A0A2V7JCT0      SPGSGDGKSFVSSNLSLAFAYAKQ-RTLLVDADLRRGALHRVLNLRRQPG---LTDFLAG
A0A534A8D8      SPGSGDGKSFVSSNLSLAFAYAKQ-RTLLVDADLRRGALHRVLNLRRQPG---LTDFLAG
A0A1Q7DXW6      SPGRGEGKSFVTANLALAFADVGY-RTLLIDGDVRLGALHHAVRAQRRPG---LTDVLAN
A0A2V7JF48      SPGSGDGKSFVSSNLSLAFAYAKQ-RTLLVDADLRRGALHRVLNLRRQPG---LTDFLAG
A0A534A9Q9      SPGSGDGKSFVSSNLSLAFAYAKQ-RTLLVDADLRRGALHRVLNLRRQPG---LTDFLAG
A0A2V7NW82      SPGVGDGKSFLSANLALAFAEAGH-RTLLVDGDVRRGALHRALHATRQPG---LTDFLAG
A0A2V7Q431      SPGSREGKSFVASNVALAFADAGH-RTLLIDGDMRRGSLYRILNTRRKPG---LTDVLHD
A0A2V7IEC4      SPGAGDGKSFLAANLAHTFADGGH-RALLIDADIRRGVLHRRLNARRRPG---LSDFLRG
A0A1Q6WKV1      SPGPGDGKSFLAANLALTFAEGGH-RTLLVDADIRRGVLHRRLTARRRPG---LTDCLRG
A0A2V7N4E0      SPGPGDGKSFLAANLAHTFAEGGH-RTLLVDGDIRRGVLHRRLSARRRPG---LTDYLRG
A0A2V7EJU4      SPGPGDGKSFVSGNLARAFADAGQ-RTLLIDGDSRRGVLHRLFKGLRKPG---LTDYLTG
A0A2V7J5T6      SPEPGDGKSFVSANLALTFADGGH-RTLLIDGDIRRGVLHRRFKCNRQPG---LVDFIQG
A0A2V7KN28      SPGPGDGKSFLSANLALTFADAGQ-RTLLVDGDIRRGVLHRRFKANRQPG---LVDFLRT
A0A257SFA4      SPGSADGKSFVALWLARAFGEAGR-RTVIVDADVRRGALHRRCDLLRKPG---LTDLLKG
A0A2V7HL73      SPGVADGKTTTAINLAGALAQASDARVLLVDVDLRGGALAARLGIDERAGRGLVDAILNA
A0A2V7K2H8      SPGVGDGKSFVSANLALAFAEAGR-RTLLIDGDVRRGSLHRAVRARRQPG---LTDFLAG
A0A2V7EK09      SPEPGDGKSFLSANIAHTFAQGGH-RTLLIDGDIRRGVLHRRLNGRRRPG---LTDFLQG
A0A2V7QD43      SPGAGDGKSFISANLAHTFADGGH-RTLLIDADIRRGVLHRRLSVRRRPG---LSDFLRG
                *.   :**:  :  :.   .      .:::* * *             .*   .   :  

A0A1V4RFS5      KATIDEVVKKT-EVEGLFVICSGHIPHNPAEMVETAVKKGVFSQIAEACDMLIIDTPPAA
A0A1Q6ZF81      DAGHDAIVQKT-AYPRLSLIGCGTRTQRAPEVLGSPAMNRLLAELRGRYDVIVVDSPPLA
A0A524QR19      GKSHQ-IVQNT-DNPRLHFVGFGSKTSSSPELLTSPQMGSFLAGLKRRYEVIIIDSPPMA
A0A2N1WA66      QVPIADALHPT-NHPRLTVLTGGSRHRNGPELLGSAAMRELMDQLQKEYDVILVDSPPLG
A0A143BIC3      TALIAEVLHPVQSHPNLTVMPGGARRRRAPELLATPRLNQLINQMAAEYDVVIVDSPPLG
A0A2V7HBX4      HAAVDSIVRST-TSENLFLIPRGTRGNRAPELLVSELMSALVHAMRLQFDVVIIDSPPLV
A0A2V7SVD5      EVTRAEVMHPT-TQERLSLLPCGGRRTTNPELIASPALPRLLSELVGEFSVIIVDGPPLS
A0A1Q7JIY3      DAAREQIVQPT-SYPWLYLIGCGTRTNRAPELLGSAAMGQLVAALRQEYDVILIDSPPLG
A0A0S7Z9Q9      ETGQD-IIQAT-DHPNLDFIGCGSRGVSTPELLASPRMAYFIGTLKRTYDVIIIDCPPLA
A0A2V7GP46      EVPLEAGLRPT-GYDALTLLPCGVRTSDAPELLGSAKMPELLARLRGDYDVILVDSPPLG
A0A2V7H298      SAPQDAAVQAT-RYKNLSFISCGLRSHAGPALLSSVAMARLLDALRASYEAIIVDSPPLA
A0A2V7N2D0      GTPLDAILQTT-PYPRLSFIGCGPRTPLGPELLGSGEMARLFASLRPRFEVILVDSPPLS
A0A2V7NMY2      RAPLEKVLQTT-PYKCLSFIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAPLA
A0A651HVY0      EVELDDILQGT-RHPALSVIPYGSVVQNAPEFMVSGRMQDLLARLKADFDVILVDSPPLG
A0A2V7RBS9      HVSFEGLIQTL-KFGSLQFIGGGSRIRESPELLGSPRMVELLVRLRAMYPVIIVDSPPLG
A0A2V7MB00      SIPPELAVQNT-PHERLSFIGAGSRMHRGPELLCSDAMPRLLATFRSSYDVILVDSAPLA
A0A2V7PL95      NATTAQAIQQT-TYRTLSFIASGTRTHGGPALINSAALPRLLAELRPYHDAIIVDSSPLS
A0A2V7T7Z8      EAIEAQVVQRT-RQGGLWFIGCGTRTRAAPTLVGSGALPRALARLRPNYDAIIIDSSPLA
A0A2V7ILF0      KATVDEVVRAT-AFPRVSFVPCGTRRFSGPELLGSPAMRALLANLRGRFDAVLVDSPPLD
A0A2V7SCT4      DAAREQIVQPT-SYPWLYLIGCGTRTNRAPELLGSAAMGQLVAALRQEYDVILIDSPPLG
A0A2V7Q893      RAGQEQVVQPS-AYGTLSFLGCGSRTHDGPALVSSAALPRALAGLRSSYDVIIVDSSPLA
A0A2V7QPQ4      TASREEAVRAT-AYPSLWFIGCGARSQQGPERLTSAPMVRLLADLRPAFDVILVDSPPLA
A0A1G0LV28      SSQLREAVRPN-VIPKLDVLPAGALPPNPSELLGSEAMRRLMEQLRTHYDIIIFDSPPTL
A0A1Q7E008      AVPFATIVQQT-DHAKLWFVGSGTRKQDVPELLASPAMARFLVSARADYQVILVDSPPLG
A0A2V7L8K7      DVSRAPVVQTT-SHPCLDFIASGTRRRDAPELMGSPAMADLVTTLRSTYDVIVLDTAPLG
A0A2V7JCT0      DVSRAPVVQTT-SHPCLDFIASGTRRRDAPELLGSAAMTDLVTSLRSTYEVIVVDTAPLG
A0A534A8D8      DVSRAPVVQTT-SHPCLDFIASGTRRRDAPELLGSAAMTDLVTSLRSTYEVIVVDTAPLG
A0A1Q7DXW6      RATPDQAVQRT-EHRQLWFIGAGSRMHRGPELLCSAGVPRLITAMRGGYDVILVDSAPLA
A0A2V7JF48      DVSRAPVVQTT-SHPCLDFIASGTRRRDAPELMGSPAMADLVTTLRSTYDVIVLDTAPLG
A0A534A9Q9      DVSRAPVVQTT-SHPCLDFIASGTRRRDAPELMGSPAMADLVTTLRSTYDVIVLDTAPLG
A0A2V7NW82      RAPLEAIVQET-TSPSLHFIGSGTRHRDAPELLGSPPMVELLTRLRTSHRVILVDSPPLG
A0A2V7Q431      EVSAEDVIQPT-RYPPLFFVGCGTRTPDAPELLGSEAMSRFIAGVRESFSAIVIDSPPLG
A0A2V7IEC4      ETPLDSIVQAT-PYPSLSLIGCGTRAYNAPELLGSPPMSELVNGMRSGYDVILIDSPPLA
A0A1Q6WKV1      EVPFEAILQQT-AYPLLTLVGCGTRVHNAPELLSSEAMAQLVTRVRPDYDVILMDSPPLA
A0A2V7N4E0      EVPLEAILQPT-GCHTLTLIGCGTRAHNAPELLGSQAMGELITGWRASYDVILIDTPPLG
A0A2V7EJU4      VVPLEAVVQPT-DHATLWFIGSGSRKQDAPELLGAPTMAQLLASARASYQVILIDSSPLG
A0A2V7J5T6      HAPRDQIVQET-PYPRLSIIGCGTRTQRAPEVLGSPAMADLFTELREQYDVIVVDSPPLT
A0A2V7KN28      EAGQGDIVQRT-AYPRLAFIGCGTRTQRAPEVLGSPAMAQLIAELRGQHDVILIDSPPLT
A0A257SFA4      DVPLERVVRAT-GMPGLDLITSGTRMDDGPELLAGPAMRSLVGDLRARFDVVVFDSPPLS
A0A2V7HL73      ELTLEAVVEVR-PDLNLTILPAGRLPRAPFEVLKSPRVEELLAEARRRYDYIVLDTPPLV
A0A2V7K2H8      RAPFEATVQGT-PYPDLQFIGAGTRFRDSPELLGSGAMSELLARLRASWSVILVDSPPLG
A0A2V7EK09      ETSLDTIVQAT-PYPAFSLIGCGVRAYNGPELLGSAAMSQLLTTLRSSYDVILIDSPPLA
A0A2V7QD43      EAQLDVIVQAT-QFPALSLIGCGTRAYNAPELLGSPAMTSLVNGLRGSYDVVLIDSPPLA
                       :        . .:  *         :        .         ::.* .*  

A0A1V4RFS5      VVTDAVVIAPAVDSVILVVRSGKIQKKVVQGVWQKLLRSGGHLSGAVINGFDPIRTYTSY
A0A1Q6ZF81      AGVDSFIIGTVTGSLLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDVPRGAAYGYY
A0A524QR19      AGSDAYILGAHAGSVLTVLRSGTTNKDMAAAQMESFLRLPVRLLGAVLNDFTPQLGQGYY
A0A2N1WA66      AGIDPFLLGTLTGHLMLVVRAGETNREFTEAKLQIIDQLPIRLVGAVLNDIRTSM--NEY
A0A143BIC3      AGFDAYALATATGNMALVMRAGVTDRKMAAAKMQVVDTLPVRVMGAVLNGIKMT---GAY
A0A2V7HBX4      AGMDAYALGAAAGSMLIVLRPAVTDRKLASAKLEVLDRLPIRILGAVLNAVPDG---GAY
A0A2V7SVD5      AG----------ENTLMILRHSKTDMRMAKTKLALLRRLPLRTVGVVLNDVKAM---GDY
A0A1Q7JIY3      AGVDPFILGTVTGNVLLVLRTGYSHRDAAGAKLEVLNRLPVRTLGAVLNDVPRGAAYGYY
A0A0S7Z9Q9      SGGDPLILGSLTGNLAVVIRTGATEKALAQAKIDQLSRLPIRILGAILNDVSAHD--TYH
A0A2V7GP46      AGIDPFVLGTLTGNLLLVLRTGVSHREVMAAKLEVLRRLPVRLLGAVLNDVPPG---AAY
A0A2V7H298      AGADGLALATVTGSLVLVLRTGVSDRELTETKLGALHHLPVRVLGAVLNDVRPG---GAY
A0A2V7N2D0      VGVDPYILGTLTGNLLLVLRSGVTDRELAATKLDALDRLPIRLLGAVLNDIRQD---GAY
A0A2V7NMY2      AGADPYTMASLTTNLLMVLRAGVTDLELAQAKLESFEDLPVRVVGTVLNDVQPK---GAY
A0A651HVY0      AASDPLILGTLTGSMLLVLRNGATNTDQAAAILQNLHRYPIRVVGAVLNDVPSR---GEY
A0A2V7RBS9      AGVDPYTLGTMTGAMMLVLRTGATNLDLARTKVAMLENLPIRVVGAVLNDVRLG---QMY
A0A2V7MB00      AGVDPYALGAATGNVLLVLRTGVTDRGLAEAKVEMLHRLPLRVLGAIMNDVRPG---TAY
A0A2V7PL95      AGADAFALGTAAGSMVLVLRTGVSDRALMQTKLGVLDHLPIRVLGAVLNGVVPG---GVY
A0A2V7T7Z8      AGADALALGTAAGSLLLVLRTGVSDGALARVKLYDIRRLPIRVLGAVVNGVRLR---RGS
A0A2V7ILF0      AGVDAYLLGTLTANLLLVLRTGVTDRELAAAKLGVLDRLPVRVLGAVLNDVEPR---GAY
A0A2V7SCT4      AGVDPFILGTVTGNVLLVLRTGYSHRDAAGAKLEVLNRLPVRTLGAVLNDVPRGAAYGYY
A0A2V7Q893      AGTDAFALGTATGTLLLVLRTGVSDGGLAQAKLQVMNHLPIRVLGAVLNDVRRD---RLY
A0A2V7QPQ4      AGADAFALGTMTGAMLLVLRTGFSDREQAEAKLDVLARLPIRVLGAVLNDVRLG---GEY
A0A1G0LV28      AVTDATVLGASSDAVILVLRAGETEEIAAQRALEQLRRVQARVAGSVLNGVEKDRD-RYY
A0A1Q7E008      AGVDPFVLGTFTGSLVLVLRSGTTNRELAQAKLDVLDRLPVRVLGAVLNDVEPHGV---Y
A0A2V7L8K7      AGVDALVLAKLAGNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLNDVRDESE---Y
A0A2V7JCT0      AGVDALVLAKLARNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLNDVRDESE---Y
A0A534A8D8      AGVDALVLAKLARNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLNDVRDESE---Y
A0A1Q7DXW6      AGVDPYALGTVTGSMLLVLRTGVSDRAIAEAKVAVLQRLPIRVLGAVLNDVPPGTA---Y
A0A2V7JF48      AGVDALVLAKLAGNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLNDVRDESE---Y
A0A534A9Q9      AGVDALVLAKLAGNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLNDVRDESE---Y
A0A2V7NW82      SGVDPLTLGTLTGSLLLVLRAGASNLDLTRTKLALLELLPIRLLGVVLNDVPAAGA---Y
A0A2V7Q431      AGVDAYALGAVTGNVVLVLRLGTTDRETTEAKLDLLDRLPVRLLGTVLNDVPEHSA---Y
A0A2V7IEC4      AGVDPLILGTLTGTLVLVLRTGYSHRDVAAAKLEVLQRLPVRLLGAILNDVPAGGA---Y
A0A1Q6WKV1      GGVDPFILGTLTGSLLLVLRTGHSHRDMAAAKLEMLHRLPVRLLGAVLNDVPAEAG---Y
A0A2V7N4E0      GGVDPLILGTLTGNLLLVLRTGCSDRDVMAAKLEVLGRLPIRVLGAVLNDVPPGAA---Y
A0A2V7EJU4      AGVDPFLLGTLTGSLLIVLRSGTTDRELAHANLDVLGRLPIRVLGAVLNDVEPRGAYRYY
A0A2V7J5T6      AGVDPFVLGTVTGALLVVLRTGKSHRGITGAKLEVLERLPIRLLGAVLNDVPRGAAYGYY
A0A2V7KN28      AGVDPFILGTVTGSLLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLNDVPRGAAYGYY
A0A257SFA4      AGIDPFVLASLSANMLLVIRTGLSVRELTYTKLEALNRLPIRLLGAVLNDVPDTAP---F
A0A2V7HL73      SFPDCRVIEKCVDGFLIAVAAHKTSRKLLEEALNVTER--AKIVGFVFNGDDRHLS---R
A0A2V7K2H8      SGVDPYTLGTLTSNMLLVLRTDATDLSLARTKLSVLDHLPIRLLGVVVNDVRPGGV---Y
A0A2V7EK09      AGVDPLILGMLTQSLALVLRTGYSRREVAASKLEALQRLPLRLLGAILNDVPPRGG---Y
A0A2V7QD43      AGVDPLILSTLTGTLALVLRTGYSHRDVAAAKLEVLQRLPVRMLGAVLNDVPAGGA---Y
                                  :                      .  * :.*           

A0A1V4RFS5      TYYTY---KYQYYYEEQSE------------------------------
A0A1Q6ZF81      AYYSY---YLPGYEAVEES-------SGQASAPRVV-------------
A0A524QR19      RYYSH---YLPGYEASEEK-------EEEVG---VV-------------
A0A2N1WA66      SYYAY----SSGYAATDEA---ERTEARARPVVPTIPAEVGTRD-----
A0A143BIC3      QYYSY----YQDYAATDEE---PVARITDGTRGDGEMKQGGRS------
A0A2V7HBX4      RYYGA------DYSYKDEV---LKEPIADIATPKGLLVRS---------
A0A2V7SVD5      KYYGY----DTAYRALPEE---RAVATV---------------------
A0A1Q7JIY3      SYYSY---YLPGYEAVDED---DSLEAHSRPRVV---------------
A0A0S7Z9Q9      SYYAS---YLPSYEPVPEE---GDEVPTQILSGPSDRELDLEEEGARKG
A0A2V7GP46      QYYSY---YTPGYEATDEK---PARLTPSVG------------------
A0A2V7H298      RYYSY---YLEGYEVHDEP---AAAEVHVLRGPER--------------
A0A2V7N2D0      RCYSY---FPEGYELREEE---SAGQRKRILTAAQ--------------
A0A2V7NMY2      RYYAY---YVPGYETKEEA---DLGPEKPVLGVPSV-------------
A0A651HVY0      RYYGYTSGYEVGAGARADK---KDRKGSRLVGAGR--------------
A0A2V7RBS9      GEYYG---YMAGYGTTTED---GGTRIARRRLQGAL-------------
A0A2V7MB00      SYYSY---SLEGYEVWEED---PEGKVSKMLLSEESKPTGAGIP-----
A0A2V7PL95      RYYSY---YLEGYEA-KDE---PAGAAGQVLRAPE--------------
A0A2V7T7Z8      SQDAY---YLEGYEA-KDE---PESVGGPVVGASG--------------
A0A2V7ILF0      RYYSY---SLEGYELKEEQ---DPDDEGAAARVLVRSPK----------
A0A2V7SCT4      SYYSY---YLPGYEAVDED---DSLEAHSRPRVV---------------
A0A2V7Q893      RNYSY---YLEGYEAQDE----PDGARGQVLRAPV--------------
A0A2V7QPQ4      RYYSY---YMAGYEAEDEH---PAWDDRPVLQPSD--------------
A0A1G0LV28      NYYYY---KHHDDGERRDGPFATLRKRLLGVG-----------------
A0A1Q7E008      RYYTY----LSGYAAEDEP--RRTEGWALARRPRGAS------------
A0A2V7L8K7      RAYAY---YMDGYALTNEPLFRPLAGSKQGASSRPTR------------
A0A2V7JCT0      RAYAY---YMDGYALTNEPLFRPLAGNKQGVGSRPAR------------
A0A534A8D8      RAYAY---YMDGYALTNEPLFRPLAGNKQGVGSRPAR------------
A0A1Q7DXW6      SYYGY---SLAGYEMKEED-----PGGAAGEILLPERS-----------
A0A2V7JF48      RAYAY---YMDGYALTNEPLFRPLAGSKQGASSRPTR------------
A0A534A9Q9      RAYAY---YMDGYALTNEPLFRPLAGSKQGASSRPTR------------
A0A2V7NW82      RYYS----YLSGYEAADEPE------SVAVQRVRALL------------
A0A2V7Q431      APYSY---YMEGYAYEAERGREPRTLTGGRSRS----------------
A0A2V7IEC4      RYYSY---YLPGYEAADED-------SGSRR---VPV------------
A0A1Q6WKV1      RYYSY---YLPGYEATDEY-------PAGRK---LVV------------
A0A2V7N4E0      RYYSY---YLPGYEAVDED-------TGRNKRQPLVI------------
A0A2V7EJU4      S-------YLSGYAAEDEA-------SAPPQRWAVARRLPGASSPSA--
A0A2V7J5T6      AYYSY---YLPGYEAVEEA-------GTSGSQVV---------------
A0A2V7KN28      AYYSY---YLPGYEAVEET-------DGRRTSSPQVV------------
A0A257SFA4      AYYSN---YLPGYEAEAEH-------RDASATRATAAEAR---------
A0A2V7HL73      DSYGT---Y-ASTRSVDLG-------GGGWRRLVSSSSRTHRRQTASDH
A0A2V7K2H8      RYYSY---F-AGYGTRDEG-------VAIATHRVRGVL-----------
A0A2V7EK09      PYYSY---YLPGYEAVDEE-------SGRRSGPTGRPLVA---------
A0A2V7QD43      RYYSY---YLPGYEAMDEN-------SGSPRVPV---------------
                                                                 

© 1998-2020Legal notice