BYKdb

Dataset for cluster orphancd of phylum gemmatimonadetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

73 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A838QE65      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A848XMZ8      ------------------------------------------------------------
A0A7W0GXF9      ------------------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A7V9Q9B6      ------------------------------------------------------------
A0A2N1WA66      ------------------------------------------------------------
A0A7W0W3K6      ------------------------------------------------------------
A0A2V7HBX4      ----------------MRVRSLQPDYPLAPHHPGSIPTAEWTPARPRSEDFEDAEGIPWS
A0A7V9B8V3      --------------------MTSPIFERGGNLPAPSNHSAVGPVFSPGAAPGAARMSPVT
A0A2V7SVD5      ------------------------------------------------------------
A0A838W0N8      ---------------------------------------------------------MVR
A0A143BIC3      ----------------MSGQQIQPVSPRDVALEPYQDGAPPADWGGGQEAAPEPKGPSLG
A0A1Q7JIY3      -----------------------MISDNLPAIRARAAPVSPRRAPPSLAAAEEETGLDWR
A0A0S7Z9Q9      --------SDEQFALPAAPSDGPGGEIQLRDAAAAAAAPPVWDEGFYPPSDDGDGGIDFR
A0A2V7GP46      ------------------------------------------------------------
A0A7Y3I9U8      ------------------------------------------------------------
A0A2V7H298      ------------------------------------------------------------
A0A2V7N2D0      -------------MATDLPVGPQGGDTVPLGHGRTRGGRGTSLGYRLPPSGDTPPEEEWR
A0A5Q4DA46      -------------MSDRSLPSGDPNGSQRDLPAEYYPAPAPAPAPAGWGGDEEEQGLDWR
A0A848X7K9      ----------MPDNKMIPTNPAYGDRAPLPAEQHHPPAPAYGQDPYYPDLEPEMEGLDWR
A0A838NSD4      ---------------------MSDLVPYSVQGGRATPESGEVARGFDALPPSVTESVGIR
A0A7Y2HRX9      ------------MSERLPTLRDNNPLPAAEVYPPQTSDEAWADAGDEGAAFGTGSTFSLR
A0A7Y2ZG71      ------------MSERLPTLRDNNPLPAAEVYPPQTSDEAWADAGDEGAAFGTGSTFSLR
A0A7Y2JRQ8      ---------------MDESPTQQNLPDLPAPHGVPEVSPSLPADLAPPAYADEEFSIDWG
A0A849GUH2      -----------------MSENLPTPIDQGVPAQGSEAEIPAFDSPFTLRDFDGEDGNFLK
A0A2V7ILF0      MGARCAPRPSFPYRTPATMPSDQPLQPVISLGRLEPAKSAGSALPSRALQPALPPSADWR
A0A2V7NMY2      ------------------------------------------------------------
A0A848XNR9      --------------MNEIRPFEPSAPNGNPQGPGSAITPYGAGPQLDVHGEDEGSGISLD
A0A7Y3MWW4      --------------MNEIRPYEASPPDGNAHVPVTAIAPYGAGPQLDVSGEEEGGGISLH
A0A848XTP5      --------------MNEIRPYEASPPDGNAHVPVTAIAPYGAGPQLDVSGEEEGGGISLH
A0A7V9PGU7      ------------------------------------------------------------
A0A651HVY0      ------------------------------------------------------------
A0A7W0WKA3      ------------------------------------------------------------
A0A2V7SCT4      MRGSCKTVGAVSDLLRGQAMISDNLPAIRARAAPVSPRRAPPSLAAAEEETGLDW----R
A0A7W1PM85      ------------------------------------------------------------
A0A2V7RBS9      ------------------------------------------------------------
A0A2V7Q893      ---------MTTGGLATLLDTTKSQRLPTVGDRKAAERRARPTPPDGGD-----WIGEAQ
A0A2V7QPQ4      -----------MATFDSPSSGLPQLSHPRRTAPLGPYDAAHGPAQMEPDPGVVDW----R
A0A2V7MB00      ------------------------------------------------------------
A0A2V7T7Z8      -------------------------------MAGAPRAGGAPPPSAEGD-----WLADAR
A0A2V7PL95      ---------------MTMDNLPTRFEEPTAPAWQASGTGYAVGRAAAGESD---WLDEIG
A0A2V7R2W8      ---------------MAGDSLMPSRSTAPLAVTNEPEQPQQPE-----------W----L
A0A7Y5K3R5      ---------------MTDDV-----QNQATAAARTPIRPIGPADGASGERSGIPW----G
A0A843T0L2      ------------------------------------------------------------
A0A6J4N058      ------------------------------------------------------------
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A7V8VQ50      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A7X5WBX7      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A800FAC6      ------------------------------------------------------------
                                                                            

A0A838QE65      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A848XMZ8      ------------------------------------------------------------
A0A7W0GXF9      ------------------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A7V9Q9B6      ------------------------------------------------------------
A0A2N1WA66      ---------------------------------------------IRGPNAESMFGVPLE
A0A7W0W3K6      ---------------------------------------------------------MPS
A0A2V7HBX4      RYVDAIRRHVLLIVGLAAVGSVLGVVAARR-VR--PIYEAQATVWI----STTPSSALQT
A0A7V9B8V3      RFIAALKRFKWLVLAMIAVGLVGGILATRM-LP--PKYAVSSPLAL------ENRANNDA
A0A2V7SVD5      -------------------------------VE--PSYEARAKVWI--MSPKPTNGPQPT
A0A838W0N8      RITSSIWRYKWLVALAILLGGAVGFLASRHFVQ--PQYVAKSRLWV----ELPSREAATQ
A0A143BIC3      RYLAAINRFKWLIMLLGIVGAGAGYMATTF-IE--PEFEVRATILLEQGTGISNGGQSR-
A0A1Q7JIY3      RSAIALSRFKWVVLLTVVLGTAAGVAATRF-VR--PEFVAQATVWV--DVPDRRGAADRS
A0A0S7Z9Q9      RYLVSILRHKWLVASSLLVGVVGSVFVWSR-TA--VTYTAEGNLWI----EAEARTAADL
A0A2V7GP46      ------------------------------------------------------------
A0A7Y3I9U8      ------------------------------------------------------------
A0A2V7H298      ------------------------------------------------------------
A0A2V7N2D0      GYFGSIKRWKRLVIIVTLAGTALGVVATKLVVPSLPFYAATANIWIDGSGHRPDRDQATP
A0A5Q4DA46      RYVAAIVRNKWLVLAGLVVGLGAGFLVRQV-TS--PVYSVSSTVLL---ESTDRGTAGDA
A0A848X7K9      RYVHSLVRYKWLIVVALLLGAGASYWVYQT-TP--VEYRAQGTLWI-------EDDGGRF
A0A838NSD4      EYLATVRRHLWLVLLIFAAVVAYTWNSVRQ-AP--AIYRSVSTVRLVDERRAMTGEGGQY
A0A7Y2HRX9      RVVLALRRYWWLVVLAGGLGLVGGVYSTTL-VQ--PQYEATGTIWL----ETTSQAEEAQ
A0A7Y2ZG71      RVVLALRRYWWLVVLAGGLGLVGGVYSTTL-VQ--PQYEATGTIWL----ETTSQAEEAQ
A0A7Y2JRQ8      RYIAALQRYKWMILGLTVLGTVGAVFGSRF-IN--PDYAASAKIWI-------EPDPGRS
A0A849GUH2      SLIPALKRYWWVLGLGVALGAGAAFVAFGQ-VS--PTYQAEGAIWI----TTEDRQADMT
A0A2V7ILF0      RYLVAIRRYKWIVLAGSLLGGGAGFAAGRY-LG--SEYTARATIWI--DVPDPRNREE--
A0A2V7NMY2      -----------MVLAVTLLGTAAGVVAAAKFVG--PRYLARARLWVGAAEPNPNALRGTT
A0A848XNR9      TYKRALKRHAGVVALFVGLGGLASVAVWRF-VE--PEFVARGSLWV--DKSNQTEDIPN-
A0A7Y3MWW4      AYRRALKRHAWVIVLCAGLGGVASLAVWRF-VE--PEFVARGSLWI--DKSNQTEDVAA-
A0A848XTP5      AYRRALKRHAWVIVLCAGLGGVASLAVWRF-VE--PEFVARGSLWI--DKSNQTEDVAA-
A0A7V9PGU7      ---------------------------------------VQATVWI--EPPSERPNS---
A0A651HVY0      -----------MMAAAVVLGLGAGYVVAQS-QV--PRFSTQALIQV--GEPQRQQAGVT-
A0A7W0WKA3      --------------MVCVVAVAAAVAYYTSRQT--PVFEASTTLRIRTREPN---LPDIY
A0A2V7SCT4      RSAIALSRFKWVVLLTVVLGTAAGVAATRF-VR--PEFVAQATVWV--DVPDRRGAADRS
A0A7W1PM85      ---------------MTACGAALGLFLASR-EP--TTYKASAMLRLAGERQTLTGVAEE-
A0A2V7RBS9      ------------------------------MLP--PRYLVQATIWI--QSSEARGTPDR-
A0A2V7Q893      RYLRSVRRHKWLVLSLTLFATAAGVELSMYALP--PNYAARATVWI--QVPA-RQARDE-
A0A2V7QPQ4      RVFAALLRFKWVVVLVTVLGTAGGVVLSRV-IK--IPYTTHATVWV--DVPD-VRAHDE-
A0A2V7MB00      -------------------------------------------------DQASRSEQDR-
A0A2V7T7Z8      RYLIAIQRYRWMVFGLSALGLLVGFAFAGVVLA--PGYAARASLWI--HGPA-GQEGEP-
A0A2V7PL95      RYLRAVRRHKWLVLGTTLLCAGAGIVLARVKLQ--PTFIARASVWI--QVPSAHVAREP-
A0A2V7R2W8      RYLSAVRRFGWLVVAVTLAVTGLGVVAAVL-MP--PSYVAQAIVWI--RVPN-KEPRNE-
A0A7Y5K3R5      RYVAAVKRRRVLVAGIVVGALAIGALATRF-FR--PTYEVHSTIWL--ATGS-NAAPVD-
A0A843T0L2      ------------------------------------------------------------
A0A6J4N058      ------------------------------------------------------------
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A7V8VQ50      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A7X5WBX7      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A800FAC6      ------------------------------------------------------------
                                                                            

A0A838QE65      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A848XMZ8      ------------------------------------------------------------
A0A7W0GXF9      ------------------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      ------------------------------------------------------------
A0A2V7NW82      -------------------------------------------------------MA---
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A7V9Q9B6      ------------------------------------------------------------
A0A2N1WA66      GPTGPDASL---------------------------------------------------
A0A7W0W3K6      GKIQTE---------IEVLRSRQLTEYVVRLLHLEAAIGPS--------------PEARR
A0A2V7HBX4      GPIRQQQLL-TTGSWVELLRSFAIVDPIVRDLKLNVSYKQPS-------------DS--V
A0A7V9B8V3      GPIEGNEIF-TSGQWVELLSMPTVMNPVVRDRQLYLTGPNPSRLDEAALEGPSGPDA--Y
A0A2V7SVD5      GPIRAEELL-PQSSWAELFQSFAITDSVVAKRGLAATPEDAK-------------DR--P
A0A838W0N8      GPIQTGQIL-SPAAWIDLLSANAVLDPVVHDLRLHVRTESRT-------------DS--A
A0A143BIC3      GPIQADELL-QASGWQDLLRSFAIADPVVNSLALFVTPSAAG-------------DS--T
A0A1Q7JIY3      GPLRPEQLL-DAESWVDLLKSYVVLDQVAREQRLYMGLKTPQ-------------DS--A
A0A0S7Z9Q9      GPNEPSGLL-QDNAWVELLESFQVLDTVAVRERLFLRVPADYE------------PA---
A0A2V7GP46      ------------ESWIDLLRSYAVLDRVARDLRLFLQLPKGPD------------PA---
A0A7Y3I9U8      ------------------------MDEMDLHVSVAWDGIPARP------------SE--A
A0A2V7H298      ---------------MDLLQSYAVLDDVVRGQRLYLHAKVPG-------------DS--D
A0A2V7N2D0      GPIHSGQLL-GASGWVNLARSYVVLDSVARGMRLYLGWDSEQ-------------DS--A
A0A5Q4DA46      APIRPSQLL-TNTGWMDLLRSYIVLDPVVDNLRLYVTPADPA-------------HA--P
A0A848X7K9      QPLQQDGAF-ESTSWIELLRSFSVLDSVVVEQRMHISAPREHG------------TH---
A0A838NSD4      DPTISRGSD-VLESQVQVLRSRAVAAVAVDLKGLRLIPAPGYR------------FV--M
A0A7Y2HRX9      GPIQTAELF-QGYSWQELLLTGLVLDPVVIAQRLYLSAPSGTR------------ED---
A0A7Y2ZG71      GPIQTAELF-QGYSWQELLLTGLVLDPVVIAQRLYLSAPSGTR------------ED---
A0A7Y2JRQ8      GPIRAPELL-SDWAWTELISTSVVLDSAALKAKLYLQTTPE--------------DE--P
A0A849GUH2      GPITQGGLL-ESGSWVELLTSYEVLDPVVLQERLYLSYQPE--------------DS--L
A0A2V7ILF0      GPLWTGQLR-ISSGWTDLLETSAVLESVVRERRLYLSLDDPA-------------DS--A
A0A2V7NMY2      PPPGAERLL-GVAAWVDFVRSDAVLDTVVRDVRLYLDPKTPL-------------DG--T
A0A848XNR9      GPISSPAPL-EERSWVDLIRSRAVLDSVVLSERLYLRTQTP------------------E
A0A7Y3MWW4      GPISSPAPL-EERSWVDLLRSRAVLDSVVLSERLYLRTQTP------------------G
A0A848XTP5      GPISSPAPL-EERSWVDLLRSRAVLDSVVLSERLYLRTQTP------------------G
A0A7V9PGU7      GPVRPEELL-RAQAWVQLLYQFQVLDSVIQKERLYIDYA----------------PKYAG
A0A651HVY0      -AIETGVRF-SPASWANLMRSNRVLERVVDDLNLFVWAQPPA-------------TP--D
A0A7W0WKA3      RTISTGVAGGELATEIAVLGSRALKEDAAGLLGLQLAVVEPAR------------VARGD
A0A2V7SCT4      GPLRPEQLL-DAESWVDLLKSYVVLDQVAREQRLYLGLKTPQ-------------DS--A
A0A7W1PM85      AAPSLGRTADPMLSIIELLRSRTVAGVVVDSLGLQLVSQTPEF------------MV--E
A0A2V7RBS9      GPIGANQLL-APTAWGDLLKSYVVLDAVARERRLYLQ-ARPR-------------DL--P
A0A2V7Q893      GPIWSGHLP-ISSGWIDLIRTNIVLEDVARRERLYLT-TDAG-------------DA--A
A0A2V7QPQ4      GPIQTAGLV-GASGWVDLLKSNAVLEDVVRRQRLYLALDSPD-------------DT--G
A0A2V7MB00      GPIQQGELFGSATGWLDLLRSHVVLDDVVRQWRLYLRPKSAD-------------DN--A
A0A2V7T7Z8      GPLWSGRLP-ISAGWSDLVRTNIVLDDVVRGERLYLT-NNPA-------------SD--T
A0A2V7PL95      GPIWSGQLP-ISSGWEELVRTNIVLEDVVRRRRLYLDYKNAA-------------DS--D
A0A2V7R2W8      GPIWQGQLP-ISSGWMELLQSYAVLDYAVRSRRLYLHPGLPG-------------DS--D
A0A7Y5K3R5      GRRGNDRLL-AAPAWGEVLHSYSVLDPVVDRLSLFVTPKSPA-------------DS--A
A0A843T0L2      ------------------------------------------------------------
A0A6J4N058      ------------------------------------------------------------
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A7V8VQ50      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A7X5WBX7      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A800FAC6      ------------------------------------------------------------
                                                                            

A0A838QE65      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A848XMZ8      ------------------------------------------------------------
A0A7W0GXF9      ------------------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A7V9Q9B6      ------------------------------------------------------------
A0A2N1WA66      -FDNFERTETI--RSGSYLLAVNEDSRR--WELTH------QGSQQKE------------
A0A7W0W3K6      AVQVLSVPADV--SDGDFGLTKNNDGS---FILKD-------------------------
A0A2V7HBX4      LFRNFEWTPAT--RSGAYLLKIDGAGPK--YMLST------AKGVFIE------------
A0A7V9B8V3      LLRNFNWTERT--APGTYVIEFSSDGKR--YTLTKPSS---ADNSTRE------------
A0A2V7SVD5      AFMRFATSERP--IIGDYSLRVDAKGQR--YTLTRK-----ADGTVVD------------
A0A838W0N8      ALASLQVEEEL--SPGDYRFQVDPAGNA--FTLST------AGGDVVQ------------
A0A143BIC3      LFRSFRVSEQVPLRPGAYILKLTGQT----YTLET------SGGLQVE------------
A0A1Q7JIY3      VFTSFQVAEDY--RPGDYRLAVQGDGRG--YDLAT------ADGVPLE------------
A0A0S7Z9Q9      -FQRFSLADEV--GFGTYVLRVSESGAD--FVLTT------DDGTLVQ------------
A0A2V7GP46      -LRSFNVADQF--RPGAYRLTTDAARA---YVLAK------VDGGVLE------------
A0A7Y3I9U8      FPQHFDASAAA--PPGVFWLRRGDGGSVGLFSE--------SAGFPMA------------
A0A2V7H298      ILATLRIKDHV--APGKYRLVVEDTGDAPHFTLYNA-----RSKAPVQ------------
A0A2V7N2D0      ALASLELKPQF--RSGEYRLQVDSSGRR--FRLLT------AQGGEVQ------------
A0A5Q4DA46      LFEDFSVGNEV--FSASYEIGRDASGGD--LLLFD------SDGNVLE------------
A0A848X7K9      -FASLKITDRL--EAGAFELRIDANGTD--FTLTTPEE---EGGDVLE------------
A0A838NSD4      EIGAIRVSDSV--TADSVILQFGHTTFT--VQTP-------DNQGTAP------------
A0A7Y2HRX9      -MSQLFLQDGT--QFGSYVLSVDDAGEE--FVLAT------AEGVEVD------------
A0A7Y2ZG71      -MSQLFLQDGT--QFGSYVLSVDDAGEE--FVLAT------AEGVEVD------------
A0A7Y2JRQ8      LFETFELAEDF--TAGRYSLDITPDGRQ--YLLR-------DEDATIE------------
A0A849GUH2      AFRGFALDSMF--APGDYELEVGENGRD--FSLLT------AEGRVID------------
A0A2V7ILF0      ALRSFRIKGQV--RPGTFAFSVAELDPT--FTLS-------SEDGVHE------------
A0A2V7NMY2      ALLRFGLKDQV--LPGRYRLEVDRDGAG--FTLFS------AQGGVVQ------------
A0A848XNR9      SVATLTVDDDY--RPGNYRLVLRGGQAT--LSAVGD-----SLRHVVP------------
A0A7Y3MWW4      PVLNLAVDQDY--RPGDYRLVLRGGQTT--LVALGD-----SLRHVVP------------
A0A848XTP5      PVRNLAVDQDY--RPGDYRLVLRGGQTT--LVALGD-----SLRHVVP------------
A0A7V9PGU7      LFKDFSVGRQF--RYGGYELKLDDAHRN--WTLKT------KEGISLE------------
A0A651HVY0      AFLHAAVVGTI--RRGGYIVRVDEAGRT--VSLLD------EEERVLESHELASLLPVSS
A0A7W0WKA3      LVRGVSVSPAA--AAGEYQLLRRPDGRF--TVFVAD-----SARRISL------------
A0A2V7SCT4      VFTSFQVAEDY--RPGDYRLAVQGDGRG--YDLAT------ADGVPLE------------
A0A7W1PM85      DLAGVRVDPRA--AGDSVLVVFQQD----------------RLSARRG------------
A0A2V7RBS9      ALAGFAVADQF--TPGRYHLTIDHDGQT--FHLQR------EDGTELE------------
A0A2V7Q893      PLTTLAIKERV--RPGTYRLAVDTTGTA--FTLSD------AAGAVLD------------
A0A2V7QPQ4      AVKSLGVKERV--QPGAYRLVVTAQGGR--FLLLD------GHGVTLQ------------
A0A2V7MB00      ALATLTVTGEI--RPGRYRLLLDREGKA--FRLLDV-----AEQQVLQ------------
A0A2V7T7Z8      VLATFAINQQV--RPGRYRLVVDNGGTA--FTLRD------AAGRVLD------------
A0A2V7PL95      LFATFDIKQRV--RPGAYRLVVNDSGNG--LTLSFKRLLFPSARNVLE------------
A0A2V7R2W8      VLGTLAIKEHV--LPGEYRLVVDDTAPR--FALFAV-----SSLDPVA------------
A0A7Y5K3R5      AVASFHASPAI--AAGKYSLRVSADGRS--WTLEDE-----HG-KTVD------------
A0A843T0L2      -----------------------------------------ETRAAYGEPIGNANVRFAM
A0A6J4N058      ------------------------------------------------------------
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A7V8VQ50      ------------------------------------------------------------
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A7X5WBX7      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A800FAC6      ------------------------------------------------------------
                                                                            

A0A838QE65      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A848XMZ8      ------------------------------------------------------------
A0A7W0GXF9      ------------------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A7V9Q9B6      ------------------------------------------------------------
A0A2N1WA66      TGVVGDS------------VGRAFGFRWAPNLGGGRRG-RSFRFDILTPQEVADDIRGKL
A0A7W0W3K6      EGDSPRKNVPATVRVGTPFTAGGASLVLTPDASRAP---NEITVRFQSFHSAVDGIRSRL
A0A2V7HBX4      SGAIGDS------------IGRKAGMNWLPDARFLGRG-RAIEFGVTSPR----------
A0A7V9B8V3      MGAVGDS------------VGRRFGFEWVPNPNRRAFG-QSYRFSVLTLDEVGNELKTRV
A0A2V7SVD5      TGTVGDS------------IGRTVGFRWAPTPQMLKPG-RTYNFNVVTPRDASTALLAKL
A0A838W0N8      QGRQGEV------------VGRGLGFSWVPDSGVFSPG-REIEFALRRPHDVSSWIASQI
A0A143BIC3      QGAVGDS------------VGTRVGFMWQPTSQALAGR-KDVGFNVQTPREASIALIKKL
A0A1Q7JIY3      RGAVGDS------------VGARLGFRWVPPAGALPSG-RTIDFSLTTLRDAARWLGDAL
A0A0S7Z9Q9      QAAFGVP------------IGENVGFRWNPAPGSFPPE-AVVRFRVLTARDAGQQLRDQL
A0A2V7GP46      RGTVGDS------------IGRGIGFLWAPPAESLPPG-HTVEFRLQTAREAALYLSDAL
A0A7Y3I9U8      MADAGDT-------------LRTGGLSLLPPAGT---GWSQIRLEMASFPAAVQEVLERV
A0A2V7H298      TGVAGDS------------VGPDMGLAWVPPRAVLAGP-REVDFTLDPPYEAALGLARNL
A0A2V7N2D0      HGIAGDS------------IGGAVGFVWVPPASAFTPR-RTIRFSVSSPYDAATNLAQRL
A0A5Q4DA46      RAAPGQP------------IGAERGIEWTPPAGAIEAG-QRIAFRVTRPREVARGLLADL
A0A848X7K9      RGQLGEA------------VGASLGFDWRPPVGAFAAG-EVIPFSVRRPRDVSGTLAGRL
A0A838NSD4      YGSAAEV------------DGISITVAKPPTI-------ARTVFRVASREEAIGHALGGF
A0A7Y2HRX9      RGAVGTP------------VGQEVGIRWRPGRDVLTPG-RVMRFTLLNERWVTGTLGERL
A0A7Y2ZG71      RGAVGTP------------VGQEVGIRWRPGRDVLTPG-RVMRFTLLNELWVTGTLGQRL
A0A7Y2JRQ8      SGTPGDS------------IGSTAGFIWAPPAESLGRN-RSVTFTVTRPRAVAAAIRGGL
A0A849GUH2      SGRLGGR------------VGEDLGFIWSPDPAVLTAN-RGFLFSVITPRDAARSLASRL
A0A2V7ILF0      QGSLGDS------------VGADLGFLWAPAPDAVAPG-HKIVFTVAAPSDAAKLLAKAL
A0A2V7NMY2      HGERGDS------------VGPALGFAWVPGAAVLTPG-RRIEFTLLTPHDAAELLASQL
A0A848XNR9      ---AGDS------------VGAPFGIRWAPQPGSLDGE-STVDFSLVSLVDASRELGDLM
A0A7Y3MWW4      ---AGDS------------VGALFGIRWAPSEASLDGQ-STVDFSLVSLVDASRELDALL
A0A848XTP5      ---AGDS------------VGALFGIRWAPSEASLDGQ-STVDFSLVSLVDASRELDALL
A0A7V9PGU7      SGRVGAP------------IGAKQGFAWQPPPAAFAGA-KKIKFTVLTPREASVDLQKRI
A0A651HVY0      EDSLGDPETEDGTGEDPVMLGESVGVNLNLAPAALEPG-AELRFTLQPRRDAARNLAQGL
A0A7W0WKA3      SGPDGRV------------HVPGVTFVLTPVAARY----GELRVSVSSLPDAVDRLQAVA
A0A2V7SCT4      RGAVGDS------------VGARLGFRWVPPAGALPSG-RTIDFSLTTLRDAARWLGDAL
A0A7W1PM85      ERAVTAA------------YGQPVNLGVVQFAVRSRPAVETATFGIRSREAAIDALLAGL
A0A2V7RBS9      QGAVGSP------------VGRTLGFIWTPTTAVLTPG-REVRFVVSPLRDAAKKLADNL
A0A2V7Q893      RGAVGDS------------IGAPLGLAWVAPAGMLRAG-DVVNFTVTTPAEAATRLRREL
A0A2V7QPQ4      QGAVGDS------------VGPALGLAWVPAASALRPG-RTIAFALATPPSVAAGLADQL
A0A2V7MB00      EGSWGDP------------VGGVLGVSWTPPTNAVRPG-GSVDFTLATISEAAVELSEQL
A0A2V7T7Z8      RGAVGDS------------VGARLGFVWVPSPGTLHAG-ETVAFTLITPSAAAAWLTREL
A0A2V7PL95      RPAVGDS------------VGVAQGFAWVPRAGALRPR-RKVEFTVAGPSDAAKALGRAL
A0A2V7R2W8      RGGAGDS------------VAPDLGLAWVPPAAALAPG-REVTFTLDAPYEATLKLADQL
A0A7Y5K3R5      RGAVGDS------------VGRAAGFRWAPRQPALGRD-RAIAFIVVEPRQAAMKLRNRL
A0A843T0L2      PAPPEGI--------------------------------EVAELAVLPREEAIDRFHENL
A0A6J4N058      ------------------------------------------------------------
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      ------------------------------------------------------------
A0A7V8VQ50      -------------------------------------------------------LTRQM
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ------------------------------------------------------------
A0A2V7JF48      ------------------------------------------------------------
A0A534A9Q9      ------------------------------------------------------------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A7X5WBX7      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A800FAC6      ------------------------------------------------------------
                                                                            

A0A838QE65      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A848XMZ8      ------------------------------------------------------------
A0A7W0GXF9      ------------------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A7V9Q9B6      ------------------------------------------------------------
A0A2N1WA66      RPDLE---RMNARFLRLNYEGQNAERAAATLNAIVAQFVTQAAALKNRNLSAEAAVLDTQ
A0A7W0W3K6      TVSRP---NRDAQIVVVRYEDPDPAVAAAVPNFLLEEFIRYKASTNRTEATSTVGFLRDQ
A0A2V7HBX4      ---------NVSQFLKITLSGADPRRTARTVNAWAEQLVNSSGDLKTRHLFEFKKILGDQ
A0A7V9B8V3      KSDMR---GIRAAFLWLSLDGRDPEKTAGTLNAVANQFVKEAAILKKKQISEQSAVLDTQ
A0A2V7SVD5      KPPPA--VAPNSNFMNVTLVDNDAVEAAATLNTWLTEFDSTALWLKRRNVSEYSKLLEVQ
A0A838W0N8      RSTSP---VRGGNFILLEITGDNPVWLAAVLNGVANQFVEVAADLKRAQSEELTRLLEEQ
A0A143BIC3      KMNLA----NGSSFLFLNLTGNDAPRTAATLNAWVEQFVVVATALKKKNVTSVAAILEGQ
A0A1Q7JIY3      GVQMD----PNGNFLKVDLRGKDPRRISVILNAVTQRYVQVAAELKRQKGTELTKALEEQ
A0A0S7Z9Q9      QTQID----RAGNFIRLTLSGPNPEKIASILNAVMDRHVTIAAELKRNKLDQTLIVLEEQ
A0A2V7GP46      DARMD----YNGNFLKIELRGGDPARITRILNAVAERYVEVAAELKRGRLTELTGIIGDQ
A0A7Y3I9U8      AVRTD----PAVDLIEVSCTAHDPAEAQSLCDGIAAQYIQLRTVLQRAEASSTARFLGEQ
A0A2V7H298      KVAAD----LDGNFLRMELGGHDPAQIAATVNAVAERFVAVAAGLKRDNLTELTRILGDQ
A0A2V7N2D0      QVELD----PDGNFLQISLRGSDPAYIAATVNAVATRFVDVATDLKGKRLSELTKILATQ
A0A5Q4DA46      DVRIQ------GTFMTVGMSGTDPVRTTRVLNGILDRFAIVAEDLKRAKFEELQAILEEQ
A0A848X7K9      DTGMD----RAGNFLEIRYTDTSAGRAARIVNALMERHVAVAEELRQGRLRQRLMILEEQ
A0A838NSD4      SAVSR----AKTDILDLVYTGGEPWEVTRIANAMAEAFQVYDASNAQQLSRRRRVFLEGQ
A0A7Y2HRX9      TSRMD----QEGNVLHMNLLGPDPEEVTATLNAVMRQFETVAASLKRLSLDDRTEALKEQ
A0A7Y2ZG71      TSRMD----QEGNVLHMNLLGPDPEEVTATLNAVMRQFETVAASLKRLSLDDRTEALKEQ
A0A7Y2JRQ8      NPRLT----GDRNFLDLSFTGKDPKLAAKTLNAVVDQFISVAAEQKRRKLSAQLEALEEQ
A0A849GUH2      REGSI--LDRQGNFLRLELRGKDPGRLASVLNAVMERHVDVAADLKRAKLDELTGILKDQ
A0A2V7ILF0      VVKSD----LDDNFIQLELRGSSPTGVAGIVNAVADRFEALATELKRRKLTELTGILSEQ
A0A2V7NMY2      QVTTD----PEGTFVTVQLTGTDPQLTAAIVKGVADRTVAVAADLRRHKVAALADILGEQ
A0A848XNR9      ITTTD----LSNSFIWVELAGKDARKIASTVNSVMDRQVRLASELKQQMHEDQTAILEAQ
A0A7Y3MWW4      TTTTD----LSNSFIWVELSGKDAGKIAATVNSVMDRQVRLASELKQQMHEDQTEILEVQ
A0A848XTP5      TTTTD----LSNSFIWVELSGKDAGKIAATVNSVMDRQVRLASELKQQMHEDQTEILEVQ
A0A7V9PGU7      TTNMA----ENGNFLRINLSGDDPAKLTSTLNTLTTQFVTVAASMKKYKLSETTKILAYQ
A0A651HVY0      MVQPS-----QSAFMVVGMQGQDPWWIAQIVNAVTESFLAEATELARAQSDELSQTLQEQ
A0A7W0WKA3      VSQLS----REANILTLSYSDTDSLIAAQIPNLIAAQYLARRQAIEKAEAGSAARFLREQ
A0A2V7SCT4      GVQMD----PNGNFLKVDLRGKDPRRISVILNAVTQRYVQVAAELKRQKGTELTKALEEQ
A0A7W1PM85      LVSRR----ELTDVIDVGFVAQDPRAAQRIVNSAVHAFQMLNVQWARERSRRRGEFLEEQ
A0A2V7RBS9      NVTLD----LSGNFLRVALTSPNGTDAAATVNAVADRYVAVATDMKRVKVTELSRLLNEQ
A0A2V7Q893      KVSSD----VDGNFLRIELAGPDAAAVTGTVNAVATRFVATAADLKRDNLTQLTGVLAAQ
A0A2V7QPQ4      RVQTDMMEGKVGNFISFELRGTSADTITAVVNAIADRFVLVATDLRREKLSALVKILGDQ
A0A2V7MB00      RIRAG----QEGNFVRIARRSPNPDQATGIANSVADRFVAAAADLKRQRLTELTAILQDQ
A0A2V7T7Z8      KVSPD----PDGNFIQLELYGPDASRTTAIVNAVAARVVAVAADLKRANLTQLNAVLGGQ
A0A2V7PL95      KMAAD----PDANFLRLELGGPDPVAVTATVNAIAERFVAAAADLKRDNLVQLTGILDNQ
A0A2V7R2W8      KVSAD----LDGNFLHMQLGGRDPVAIAATVNTVAERFVAVAAGLKRDNLGELTGILGAQ
A0A7Y5K3R5      EIGFP-----DTSFISVRLSGPRPARDARILNEIGRQFVATASGLIRGNQAQSAQQLAQQ
A0A843T0L2      NATVR----EATNVIDVTYTDPDQGWAQRIVNTTVDVFRETSASTAQQQARRRRIFLEEQ
A0A6J4N058      ------------------------------------------------------------
A0A1G0LV28      ------------------------------------------------------------
A0A1Q7E008      --------------MRLELTGTSPTAIAGTLNAVLQRYVDVAAELKRAKLTELTHILNEQ
A0A7V8VQ50      RTTVD----QTVNFISIEFTGRDPQRAAATANSIAERFVEVAAELKRAQLEELTEILQEQ
A0A2V7L8K7      ------------------------------------------------------------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      ----------------------------------------------MACPRSDTRILGDQ
A0A2V7JF48      -----------------------------------------------QQSTRRREFLESQ
A0A534A9Q9      ---------------------------------------------------------ESQ
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A7X5WBX7      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A800FAC6      ------------------------------------------------------------
                                                                            

A0A838QE65      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A848XMZ8      ------------------------------------------------------------
A0A7W0GXF9      ------------------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A7V9Q9B6      ------------------------------------------------------------
A0A2N1WA66      LTRARDRLNTAQAALESFKVSVVTLPRED-------------------VPVPAGLQSSTP
A0A7W0W3K6      VASYDKQLKGAEGALGGFREQEHVVSIGD----------------------------EAS
A0A2V7HBX4      LALAEAQLRTSENELEHFRVSTITLPSGV-------------------AASAGPGVTQGD
A0A7V9B8V3      LIAARKRLHAADIALSTFRVNNITKPKDD-------------------VPVTAGLQQTQP
A0A2V7SVD5      RQYANDKLKDAELRLEGFRTRTITMPSEA-------------------TIVTPGLQETRD
A0A838W0N8      LQVAAQNLRAAEGSLQGFRVSTATAPTDR------------------VIAAPPGLDATTG
A0A143BIC3      REFAAKSLNEAEGALESFRVRTVTEPTER-------------------QTITPGIELTTN
A0A1Q7JIY3      LNTAHTNLQQAEAALQTVRAQTITLPSDR-------------------PLTSAPGPERRD
A0A0S7Z9Q9      LTQAEAQLQRSERSLEEFRVSTISLPTDQ------------------SMPIAPGLQITRD
A0A2V7GP46      VRTAKQSLDSAEGDLESFRRRTITLPPDA---------------------VAAGGDTPRD
A0A7Y3I9U8      VDVVRGHLAAVEDSLEQFASRNRIVALEE----------------------------QAS
A0A2V7H298      LAQAQANLRQAEASLKSFRVGAVTTVAAG------------------AGSVTESSQYPRD
A0A2V7N2D0      LEHAQANLRSAESALRSFQIRTATVLPGSAIIPPEALAPGANTPPQRRPPVSDLVGQSRD
A0A5Q4DA46      LDYAAQNLQQAEYALEGFKVRTISLPSEQ------------------GMPVAGGTQQTTN
A0A848X7K9      LRITESQLFAAEQAYEVFRVNTITTPTVG-------------------GGAAGGLSQNTN
A0A838NSD4      LRQTDSMLSRASGAYSSYRSNRQVFSSTG----------------------------KAS
A0A7Y2HRX9      LDRAQLEVDSAEFALEAFKIATITLPGEE-----------------RTAPVAPGVTETRD
A0A7Y2ZG71      LDRAQLEVDSAEFALEAFKIATITLPGEE-----------------RTAPVAPGVTETRD
A0A7Y2JRQ8      VDLAATDLRNKENRLESFRVRTITLPNEG-------------------VPVAAGLQSTQP
A0A849GUH2      LGTVEENLRQAEQSLESYQVRTITLPSEE------------------TSPVVPGLEQTTQ
A0A2V7ILF0      LKQAQGKLAEAEAALKRFRVTAVTQFAEG------------------TAAVTPNLERTQD
A0A2V7NMY2      VRHAQASLTAAELALKSFRVRAAGVLPAG------------------VAAPPP------S
A0A848XNR9      LAVAQEEMTQAEAELERFRIATITLPGDV-------------------SPVAPGLTITRD
A0A7Y3MWW4      LAVAQEEMTQAEAQLERFRIATITLPGDV-------------------SPVAPGLTMTRD
A0A848XTP5      LAVAQEEMTQAEAQLERFRIATITLPGDV-------------------SPVAPGLTMTRD
A0A7V9PGU7      VDTVAEQLRTAEGRLEGYKTRIITEPTAA-------------------TAIAPGITTTQP
A0A651HVY0      LATTQRALSQAEAELEAFESAMASN-----------------------VELSAQWSGSDP
A0A7W0WKA3      LHRVSSELARAEDRFRGFRERERLL----------------------------DPAVETS
A0A2V7SCT4      LNTAHTNLQQAEAALQTVRAQTITLPSDR------------------PLTSAPGPE-RRD
A0A7W1PM85      LAQTDSMLERAQASLSSFRSRQQLASSQD----------------------------KLH
A0A2V7RBS9      LQAAEANLHKAERALEDFRVRTIMLPAEP------------------VAGTA-----TRT
A0A2V7Q893      LEQEETKLRSAEGALQRFRVTAVTEYGDG------------------AAPVTSNMRSPQD
A0A2V7QPQ4      VQNAQLNLTRAEQRLRDFRVHSVTLLTGT------------------PAPLLVPAPQGRD
A0A2V7MB00      LDHAQTNLRTAEAALTAFRVRNAVRPSEG------------------PAQGPDGRRITAD
A0A2V7T7Z8      MRRAEADLRSAEGALQRFRMQAATQLADG------------------SGSVTANFSAPTD
A0A2V7PL95      LDRAQATLRDAEAALKTFRVRAVTQFADG------------------AGSVTPNLRYPQD
A0A2V7R2W8      LAQGQAALRSAEDALRAFRVGAVTTLAEG------------------AGSVAQNTQYQRD
A0A7Y5K3R5      LGQAESALRSSEEALRNYRTGTVGLPSQD------------------DPSVA-----LRD
A0A843T0L2      LTQTDSALALAQLALTEFQRREGVASSQE-----------------KLAAQQ--------
A0A6J4N058      ------------------------------------------------------------
A0A1G0LV28      --------------MQAYQESQSTTDLSA-----------------EEVSLV--------
A0A1Q7E008      LSTAARHLHDTEGALEGFRVRTITLPSEQ------------------ATPLAPGLEATRD
A0A7V8VQ50      LHYAEGNLRDAEVGLENFRVTTATLPSDR-----------------DAYPVFPGQQ--RD
A0A2V7L8K7      ------LLADARQAVTAFRQRAGTYGSRE-----------------ALAREQ--------
A0A2V7JCT0      ------------------------------------------------------------
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      LEHARANLRDAEAAMTRFRVRTATHPTQG-----------------AVPSAEGRPPAATD
A0A2V7JF48      LKVNDSLLADARQAVTAFRQRAGTYGSRE-----------------ALAREQ--------
A0A534A9Q9      LKVNDSLLADARQAVTAFRQRAGTYGSRE-----------------ALAREQ--------
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A7X5WBX7      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A800FAC6      ------------------------------------------------------------
                                                                            

A0A838QE65      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A848XMZ8      ------------------------------------------------------------
A0A7W0GXF9      ------------------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A7V9Q9B6      ------------------------------------------------------------
A0A2N1WA66      SVFGNFIRQRNEVDSLRREQTELREALAQ-----ARSGE-------------LAIDRFLN
A0A7W0W3K6      AQVKRMAALQAERDQLQGERDALASTLRG-----ATGGG--------------NAKDIAA
A0A2V7HBX4      PVVASYFQQKVALDEIRSERQALERMVSE-----AKGGP-------------INPQDFLQ
A0A7V9B8V3      TVITNYFLQRTVADSLKRDRAELQRVVGR-----ATRGE-------------LAVDQLVG
A0A2V7SVD5      PVFRSFFEKKLESSDLRQYADALARAMTA-----GPAAP----------------EAISA
A0A838W0N8      PAYSGFFGMQMQRDQLRQDREAIQRALSR-----SAGGE-------------LSVAALEV
A0A143BIC3      PVFDNYFRDKVLADGYQRDREALERILN------AGKQG-------------APITREAV
A0A1Q7JIY3      PVFTNFFDMQIERDQLRRDREAIERLLAD-----ARASA-------------LPADALSL
A0A0S7Z9Q9      PTFGNFFDMRVRLDELQQDRRRLQAVIDD-----FGQRD-------------VRIEALEL
A0A2V7GP46      PVLGDFFEQQVQRQQAARDRAALTRVLAQ-----PADSG--------------LASALEV
A0A7Y3I9U8      EEVRRLAELDAERQAIEDERTALSGLVGRVERTPLAPAGRLAAGGGGGTPGSARYRDLAS
A0A2V7H298      PMFAGLVDLKVNLDEVRRDRTAIERLLAPST---DPTVE-------------VPVDALSM
A0A2V7N2D0      PVFANFLDTRVALEQLKRDRAAIERVLAQ-----TADSG-------------LAVDALEL
A0A5Q4DA46      PVFQNFFNLRVEQDEARRDQSALNRAMARS----QQEGR-------------LATEALEV
A0A848X7K9      PVFENFLENRIRQSEIADTRARLGGVLSTF----EETSE-------------VRIEALEM
A0A838NSD4      AQEAGLIDIDMRRAELDAEKRTYETLLARAEGS-GENMG-------------PNLRVLVS
A0A7Y2HRX9      PVFGNFFNMQVNLDDLRRDRARVADILA------TPGEE-------------IPVTQLEL
A0A7Y2ZG71      PVFGNFFNMQVNLDDLRRDRARVAGILT------DPGEE-------------IPVTQLEL
A0A7Y2JRQ8      TVMSNFFQQRLALDALQQDRRALEAALAR-----ASSSS-------------VTVDAFQS
A0A849GUH2      TVFSEFFGLRLTQEELQRHRRRLASALEQ-----ARTSG-------------VRVEVFEM
A0A2V7ILF0      PGFAGLLELKVSREQVRRDRDALRRVLAQ-----ARDSG-------------LSVDALGM
A0A2V7NMY2      PAFTNAFELRVAVDQLGRDRQAIDRVLAQ-----QPDSG-------------LSVDALAA
A0A848XNR9      PVFNDFFERRLTVERLTSDRNRLATELAA-----MAESG-------------VRIERLES
A0A7Y3MWW4      PVFNDFFERRLTVERLSSDRNRLASELAA-----MSESG-------------VRIERLES
A0A848XTP5      PVFNDFFERRLTVERLSSDRNRLASELAA-----MSESG-------------VRIERLES
A0A7V9PGU7      TVMTQYFNEKLQAEALRRDREALDAIVQR-----SRSGT-------------LAVDEFQT
A0A651HVY0      AAASGLVDLRTELDQLSRDRENLTRTLGEA----ERAGT-------------LRVQALEA
A0A7W0WKA3      SEVARLIAKESERAGLEAERRALTQSLAEIESA-GSGSG-------------SLSTSRRL
A0A2V7SCT4      PVFTNFFDMQIERDQLRRDREAIERLLAD-----ARASA-------------LPADALSL
A0A7W1PM85      AEQSALLTLDARREELDADRRTFGALLQRLKTNDEASRQ-------------EALRALAT
A0A2V7RBS9      SPVSEFLTRRVQEDQLRRDQDALAQLLAQ-----GPDSL-------------GFSERLAA
A0A2V7Q893      PVFAGLLEVKVRRGELLRDQAAIKRILAQ-----PPESG-------------LIVDALAT
A0A2V7QPQ4      PAAANFFEMKVSSEELRIDRTALARVLAE-----GADSG-------------PSTDALEM
A0A2V7MB00      PTYASYIDLQVSLDELKRDRAAIAQLLTR-----SADSG-------------VAVDRLAM
A0A2V7T7Z8      PRFARLLDVKSRRTQLLRDREAINRILAR-----SSGSG-------------PVVDALAT
A0A2V7PL95      PVFAGLLDMKVEREGLVRDREAINRLLAK-----P-DSG-------------VAVDALAM
A0A2V7R2W8      PLFAGLVEMKVSLDEVRRDRAAIDRLLRQ-----GIDSG-------------VSVDALAM
A0A7Y5K3R5      PSFAALFDQRAELDSVRADRQALERVLGG-----GGGTG-------------PRIDPAAL
A0A843T0L2      ---VGLMELDVRREELDADRRVLRSLLTGLLNQDWAGSR---------------LGSLIS
A0A6J4N058      ---------ELQQAEVRADREMYQRLLSGLQQQGSPGGQ-------------AGIRTIVS
A0A1G0LV28      ---NTIQDLDREKQRILLDLQTLESSIRPGSD----MTI-------------ETLNGLAA
A0A1Q7E008      PVFKNFFEMRIEREQLRRDREAIERVLAEVADAEVAAQG-------------LEVIGV--
A0A7V8VQ50      PAISSFFEMRTEREQLRQDREAIQRAIAAGQRSGMGLNA-------------LEVVPS--
A0A2V7L8K7      ---AGLAGVELQRQQLEAERRTDESLLAALRDRDSSVSR-------------RALQTALA
A0A2V7JCT0      --------------QLEAERRTDESLLAALRDRDSSVSR-------------KALQTALA
A0A534A8D8      ------------------------------------------------------------
A0A1Q7DXW6      PAVAGYLDLQVTVAQLAHDREAIGRVLAQGADSGVLTDA-------------LAMITA--
A0A2V7JF48      ---AGLAGVELQRQQLEAERRTDESLLAALRDRDSSVSR-------------RALQTALA
A0A534A9Q9      ---AGLAGVELQRQQLEAERRTDESLLAALRDRDSSVSR-------------RALQTALA
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A7X5WBX7      ------------------------------------------------------------
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ------------------------------------------------------------
A0A2V7K2H8      ------------------------------------------------------------
A0A2V7EK09      ------------------------------------------------------------
A0A2V7QD43      ------------------------------------------------------------
A0A2V7HL73      ------------------------------------------------------------
A0A800FAC6      ------------------------------------------------------------
                                                                            

A0A838QE65      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A848XMZ8      ------------------------------------------------------------
A0A7W0GXF9      ------------------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A7V9Q9B6      ------------------------------------------------------------
A0A2N1WA66      IG--AVTRAP---ELTQVLTELGEAERQRRTL------L---LTLMAEHDSVRAVTAKID
A0A7W0W3K6      FP--SFIANR---GMQDILQNLAKLEDDRAQL------L---VRRNPENADVVALTERIN
A0A2V7HBX4      LP--TILNNA--PQLRSAIEELSLRQATLRTE------Q---QFLTDANPRIRQLAEAVR
A0A7V9B8V3      IG--AVQRSP---NLSSVISQLQTLEQTRRSLLIPAPGQ---LARTDSHPEVIELNRQIN
A0A2V7SVD5      IP--GLLTQAGAKDLSILLDELTKRQGELRDA------Q---KVYTDEFSKVKDLQKQIA
A0A838W0N8      VP--AVRASS---ELTRALGELTAKRAELRAM------Q---NQFTDEYVPVQRLAQEVA
A0A143BIC3      LSVPSVNTDPAAENLRKVLAEQADREFNLRRL------R---ESYTDEYQKVKDEQAALQ
A0A1Q7JIY3      IG--SVQHSA---ELSQALKELTDKQATLRGL------Q---YRYQDDYAPVQRLKAEIA
A0A0S7Z9Q9      IP--ATAGSS---ELRRILDELVDARSELRAL------R---DRYSDDYPPIQDLLNQIE
A0A2V7GP46      IG--AVQHSP---ELKDALQELTTKQAALRTL------R---YHYTEAYPPLARKAAEVA
A0A7Y3I9U8      FP--TFLQQG---PVSQLVSTLVELENERGAL------L---RRRTDSSPDVVALDTRIA
A0A2V7H298      VG--SVQRST---ELVQGLRDLTSKQAELRAL------R---AHYTDANPPVRRLASEVD
A0A2V7N2D0      VG--SVERSS---ELTDALKELVGKRADLRAL------R---YRYTETNPEVRRVAGEIG
A0A5Q4DA46      IP--SVREST---DLVRALSLASEKRAEVRAL------S---LRYHEDWPEVQALRRDIV
A0A848X7K9      IP--ETANSS---ELRRAIDDLIDARAQRRAL------S---DRYTPDHPAVQDLEVQIE
A0A838NSD4      SP--GIASNA---VVQQLYSQLTNYEKQRDDL------IS--AGSAPTNPDVMTVNALIP
A0A7Y2HRX9      IP--SVQGSS---ELGAVFQEYNNRKATLRAY------L---ERYTEEYPPVQQEMQAIE
A0A7Y2ZG71      IP--SVQGSS---ELGAVFQEYNNRKATLRAY------L---ERYTEEYPPVQQEMQAIE
A0A7Y2JRQ8      IP--KVQSSP---ELSAALRDLAAEEAQLRTD------L---FVYTEDHRLIQDRRERIR
A0A849GUH2      IP--PVQAST---PLMGALSQLNEARAELRVL------R---ERYTDEYGPVADLIGRVE
A0A2V7ILF0      IG--AVQRSL---ELSEALKGLTAKQAELRAV------R---FRYTDATPAVRHLAEEVK
A0A2V7NMY2      ID--AVQKSP---ELTQALKELTDKQAELRAL------R---YTYTDQHFPVQQLADAVA
A0A848XNR9      IE--TAQLAS---ELTLALGDLTTVRNDLRQL------R---LQYTDDYPPVQDLIQRVG
A0A7Y3MWW4      IE--TVQLAS---ELTLALGDLTTARNELRQM------R---LQYMDEYPPLQDLILRVA
A0A848XTP5      IE--TVQLAS---ELTLALGDLTTARNELRQM------R---LQYMDEYPPLQDLILRVA
A0A7V9PGU7      VT--VVQQAP---DLAGALSELAKYEQEARAL------G---FRYTPESKQVQDVQEKIR
A0A651HVY0      IP--SVRESS---ELMGVLEQITERRAEVRSL------L---VRYTEDHPSVLEGRAELR
A0A7W0WKA3      SALPILLRNE---ATSTLLSALMTAESEKAAM----------ISATATDPDMLVLTAKIE
A0A2V7SCT4      IG--SVQHSA---ELSQALKELTDKQATLRGL------Q---YRYQDDYAPVQRLKAEIA
A0A7W1PM85      SP--AMADNP---AIGGLYQQLLKYQIRIDSM------TTGPWRSSPNNPDLIQVKALAS
A0A2V7RBS9      IG--AVQGSA---DLTRALSELTTKRADRRAL------L---YRYTDDHPAVRRVTTDID
A0A2V7Q893      IG--SVERST---ELSQALRDLTAKQAVLRAL------Q---ARYTAEAPVVRRVAAEVA
A0A2V7QPQ4      IP--SVQQSS---VLTQALGELTEKQATLRAL------G---YRYTAGLPQVKRLAVEIT
A0A2V7MB00      IG--SVQRSS---ELTAALKELTDRQAELRAL------R---FRYADTHPPVRRLALQVD
A0A2V7T7Z8      IG--AVAGST---ELSRALGELTQKQAMLRTL------Q---VRYTAESPLVRRLTGEVA
A0A2V7PL95      IA--SVQKST---ELSQALRDLTAREAELRAL------R---ARYTDATPNVRRLAGEVA
A0A2V7R2W8      VG--AVQRST---ELVQALRDLTAKQAELRAL------R---GHYTDDNPPVRRAAAEAE
A0A7Y5K3R5      LAIPSARSAP---ELSAAIADLTKAQSQLATL------R---RTYTDEYKAVQDARADIA
A0A843T0L2      NPGVAQNPVVA-ALFAQVARLEISRDS-LTTG------D---WGNAPSNPDVQRLNLMID
A0A6J4N058      APGIASNAVVS-QLYAQLVQYETVRDTLLAG------------GRSRVSPEVERADNLIT
A0A1G0LV28      VPGISGNPAMTFQIQALLRLYDDRRTM-MAE------------GQRESNPQVTALDSRIQ
A0A1Q7E008      ---VQRSAELT-QAQRELTTKQADLRA-LRY------------RYTDEHAAVRRLAVEIE
A0A7V8VQ50      ---AQASTELR-TALGELTSKRAELRA-LQY------------RYTDEYPPVQQLQEEIA
A0A2V7L8K7      TPGVAASPSVT-QLSTQLYQYERARDS-LAS------------R-STSHPDLPRLNQLIG
A0A2V7JCT0      TPGVAASPSVM-QLSTQLYQYERARDS-LAS------------R-STSHPDLPRLNQLVS
A0A534A8D8      ---MAASPSVM-QLSTQLYQYERARDS-LAS------------R-STSHPDLPRLNQLVS
A0A1Q7DXW6      ---VQRSAELT-EALKELTAKQAELRA-LRF------------RYADTHPPVRRLAAQVD
A0A2V7JF48      TPGVAASPSVT-QLSTQLYQYERARDS-LAS------------R-STSHPDLPRLNHLIG
A0A534A9Q9      TPGVAASPSVT-QLSTQLYQYERARDS-LAS------------R-STSHPDLPRLNHLIG
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7EJU4      ------------------------------------------------------------
A0A7X5WBX7      -------------------------------------------------------MQSLV
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      ---------------------------------------------------------AIL
A0A2V7K2H8      ---------------------------------------------------MRRLATDID
A0A2V7EK09      ---------------------------------------------------MQRLAEQIA
A0A2V7QD43      ------------------------KQAELRAL------R---YKYSDQYPLVQRRLSDVA
A0A2V7HL73      --------------------------------------------------MRDRVSAITL
A0A800FAC6      -------------------------------------------MKGEIVELRSQLVAAAG
                                                                            

A0A838QE65      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A848XMZ8      ------------------------------------------------------------
A0A7W0GXF9      ------------------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      ------------------------------------------------------------
A0A2V7NW82      ------------------------------------------------------------
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A7V9Q9B6      ------------------------------------------------------------
A0A2N1WA66      ELRI---GTLPTYVQSVLNRLAREQARLETQIQAAQR---DLAGIPQRAIQEQEYLRELE
A0A7W0W3K6      ALNS---QMVQT-AQAYLNGLNSKLLSLNTSMKSFGA---EIEKIPAREIEFARLLRQQT
A0A2V7HBX4      VLER---ETIPQITVAVLNSLKAREPELDTRISVGSQ---ELRGIPARATEEARLVRQVA
A0A7V9B8V3      ELRT---TTLPAYAGAVLRRLDEDLADIEGRIRTATS---ELRDIPTRSMQEDNLRREFK
A0A2V7SVD5      DLRA---RAIPAAARNFLAQLRSRENSLNAQLAATSE---EIRTIPTRSIEEQRLRREQA
A0A838W0N8      VLEQ---QVIPRLASGVVNELRVREREAEGRLQVAAG---EMREIPARSIEEGRLERDVS
A0A143BIC3      TLRT---VSVPGALDAYLGQLQLREKALVATIDRSSK---DLRNIPARTIEEQRLKRQVE
A0A1Q7JIY3      DLEN---RTIPTLARTLVAQLAARETEVGRQVNATSH---ELRQIPPRALEEERLRRSLT
A0A0S7Z9Q9      SIET---TAIPRVVLGIMRELEDQEAELSARLATAQA---ELQAIPPRTIEEQRLSRQVA
A0A2V7GP46      TLER---QTIPTLVRSLIDELGTRMAELDRRIGSASQ---ELRRIPARSVEEARLRRSVT
A0A7Y3I9U8      EVEN---Q-LGDFARTYLDNLDSRSRTLSASLDASHD---RLDALPTQQVAYARLERQAS
A0A2V7H298      ELAH---RTVPALAASLVAELRVRESELVQRVDAASS---SIQKIPPLAVEESRLQRGVT
A0A2V7N2D0      TLER---QTIPALTRQLLGELRRREAELVRQVEWASA---DLRQLPSLAIDELRLQRDVV
A0A5Q4DA46      ELEQ---QTIPALVGTLQSEMQARESEIERFVGRASS---ELQQIPPRVVEEARLTREYQ
A0A848X7K9      SIET----SIANSVQGIASELGTTEQSLSSRVASQSA---ELREIPPVAIEERRLARSVQ
A0A838NSD4      ETSA---RIISAVRSQIVS-IQARVDALDRLRASGAS---QIAAAPAAEVEEMQLNQQVE
A0A7Y2HRX9      GLES---NTIPRQLGNLVAALDTRIGELDTRIEGTSR---ELRAIPTRTIQEARLQRSFD
A0A7Y2ZG71      GLES---NTIPRQLGNLVAALDTRIGELDTRIEGTSR---ELRAIPTRTIQEARLQRSFD
A0A7Y2JRQ8      ILRS---ETIPQLGQSLVSEIGVQESALQEQIGTASQ---ELQQIPRRTIQEQRLTREKL
A0A849GUH2      GLEQ---VTIPALGETLLAEVTARENDMAELIGSRAS---ELSQIPPRAIEEARRERQYQ
A0A2V7ILF0      LLER---QTIPRLATALMNELAVRESEVGRDVDSASG---NLRRVSPLAVEEAALQRDVT
A0A2V7NMY2      TLDR---RTIPGMLRALRNNLAARERDLGQRVDSTVR---YLSNIPPLLFEQTRLEREVQ
A0A848XNR9      LLET---VTIPGMVRSLVDELDSRLSYLGSRLDLTES---ELSRIPSRTIEEARLQRRVT
A0A7Y3MWW4      QLET---VTIPGMVGSLVAELDSRLSYLGNRLDLTES---ELSRIPSRTIEEARLQRRVT
A0A848XTP5      QLET---VTIPGMVGSLVAELDSRLSYLGNRLDLTES---ELSRIPSRTIEEARLQRRVT
A0A7V9PGU7      TLRL---QTIPGYALALSGALRTKEAEMNGHIAKASR---ELQQIPGRTMNEQRFEREFQ
A0A651HVY0      ELEQ---EAIPALADELLAELDVRVSDLQARADARSD---DLRAIPGQALTRARLRREVS
A0A7W0WKA3      ALED---Q-LRAVTRTHLQNLGNQVSSLDSTLGMFGR---ELSAIPRRHLEYARLERNVT
A0A2V7SCT4      DLEN---RTIPTLARTLVAQLAARETEVGRQVNATSH---ELRQIPPRALEEERLRRSLT
A0A7W1PM85      STQD---QLVQAVSSHI-GALDARVDALGALRQRTGA---SMSLLPAMAEEEMRLTRRVD
A0A2V7RBS9      ELEH---QTIPGLIRGLLAELGTQRRGLASQLETGGR---ELQGIPQRAIEDARLRRDVS
A0A2V7Q893      TLER---QTIPMLATALAREMGLRAAELEHRADSVAR---DLRRIPPLAAEENRLQRDVT
A0A2V7QPQ4      QLER---QTIPTMVRALIAQLGAREAAVTQRIDSAAG---GLRQIPPLAIEDARLDRDVT
A0A2V7MB00      TLSR---RVIPGLARTLMAGLAAREQVLAQQRDSIAR---DLRTAPPVALSEIRLARDQA
A0A2V7T7Z8      TLEQ---ATIPELAAGLARELERQAAELERQANATAR---DLRRIPPLAVEQAALQRAVT
A0A2V7PL95      ALEH---RTIPAMAAALTQELAVRAGELEHLVDSAAG---GLRRVPPLAVEETRLQREVT
A0A2V7R2W8      ALGR---RTIPALASSLAAELRVRETELAERVATAST---GLQQVPPLAVEEARLQRNVT
A0A7Y5K3R5      RIEQ---QTLPTLAQGVLDRLRNRERALDTRVAQSSG---ALRAVPSRAIDQQRLQRDVQ
A0A843T0L2      STRT-------RLVAAVESHAEVLDARVAALDDLRARNLAELQALPVSGAEEVRLVQQVE
A0A6J4N058      ATES-------KLVSAVRSHIASLDARLAAIDGLVARSSAEIRSAPVAQAEETRLLRHVE
A0A1G0LV28      TVSRALNDAAAATVRGLRQQIAALERNIAQLRE-------RLSTFPGKQTQFAQLRLETE
A0A1Q7E008      TLER---RTIPALTRALLSQIVTREQVLDSLVHSAGR---ELQQIPLRAVEEARLRREVS
A0A7V8VQ50      RLER---QTIPSVASSVVGQLAAREGELQARVESASS---ELRQIPTRTIEEARLVRRVS
A0A2V7L8K7      STEA---DLLHAVQGGIQSAMTSLEGRITAMNDLRAR---Q-QQLSTTEEEEARLTERVD
A0A2V7JCT0      STEA---DLLHAVQGGVQSAIASLEGRITAMNDLRAR---Q-QQLSTSEEEEARLTERVD
A0A534A8D8      STEA---DLLHAVQGGVQSAIASLEGRITAMNDLRAR---Q-QQLSTSEEEEARLTERVD
A0A1Q7DXW6      TLQR---RIIPQLARTLMAGMAARERDLQVRVDSVSR---DLRRAPPVDLEGVRLERDEL
A0A2V7JF48      STEA---DLLHAVQGGIQSAMASLEGRITAMNDLRAR---Q-QQLSTTEEEEARLTERVD
A0A534A9Q9      STEA---DLLHAVQGGIQSAMASLEGRITAMNDLRAR---Q-QQLSTTEEEEARLTERVD
A0A2V7J5T6      ------------------------------------------------------------
A0A2V7EJU4      ----------------------------------------------QRAVEEARLRREVT
A0A7X5WBX7      DQTL---GKLRTAIAAHVTSLDTQIRALDQSHGRLAA---EINQLPDIEAEETQKTRQVQ
A0A2V7KN28      ------------------------------------------------------------
A0A257SFA4      DADK---EGYLRSARALIQTLTGRTRSLTDAIAQTAD---SLRAIPPRATEEARLMRRVA
A0A2V7K2H8      VLQR---QAIPGLARALHADLGARAQTLATEISAGGR---ELQAIPQRSIEEGRLRRDVS
A0A2V7EK09      TLQR---QAIPTLTRALVSELAAREAEFGRRVAADSR---NLREIPARAIEEARLRRAAG
A0A2V7QD43      TLER---QTIPTLARRLLAELSGREAELGRRVAEDTR---SIQAVPPRAIDEARLQRQVT
A0A2V7HL73      TSDG---ETLGTTVKPDVVETTVLAAAPQ--------------DATSRAGQDAARRGGIV
A0A800FAC6      ASLS---QVQGSLAQLQSREDTLQAQRAQFPELESQL---LDLEATTRTNLEVHQ---FI
                                                                            

A0A838QE65      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A848XMZ8      -----------------------------------------------------------T
A0A7W0GXF9      ------------------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      ------------------------------------------------------------
A0A2V7NW82      ---------------------------------------------------------GLG
A0A2V7IEC4      ------------------------------------------------------------
A0A1Q6WKV1      ------------------------------------------------------------
A0A2V7N4E0      ------------------------------------------------------------
A0A2V7Q431      ------------------------------------------------------------
A0A7V9Q9B6      ------------------------------------------------------------
A0A2N1WA66      IADLQYRDLQQRFENSRLQEASS-LPDLSVLDRAFPPSQPEKNRK-SVIIALGTLL-GLG
A0A7W0W3K6      ILEQISTLLQTRLKEAEIKEAVQ-PGDVRVIDRALIPGGPSSPKP-VKNLVFGTIL-GVF
A0A2V7HBX4      ATENLYNSLKARYEEVSLAEVQT-APDLSVLDTAVAPTLPTSNDA-PRLLLLAVVA-SMG
A0A7V9B8V3      IAESQYNDLTMRYENSRLQEASS-LADVRIINRAVPPVRPTKNRK-PIIIALGVLI-GLG
A0A2V7SVD5      MYEGMYTNLSARYADARLAESSA-MPDITILDRAAPANGVVTFRD-LKIIGTAILI-ALG
A0A838W0N8      ISSQLFTTLQQRFETARLAAIST-VPDIRVLDPAQVPSWPVNGAE-RSRLFLMILGLSIG
A0A143BIC3      VSDAMYRNLNLKAAEAKLAEAAT-IPDVSILDPAVAPLRPTKNTA-PVIIFAAVAA-MLG
A0A1Q7JIY3      LAEELYTTLQRRYEEAQVSERTI-VPDLRILDAAVVPRRPVKNTA-PRLILLAFCG-SFG
A0A0S7Z9Q9      TNTDLYNQVRGRVESARLAAASS-IPDVRILDPARVPNQPSDDER-MLRAGLVFFG-CFG
A0A2V7GP46      IADNLYTSLQQNYEAARLAEASS-IPDIRIFDKAVVPLQPVKNSA-PRLLLLGFLG-GLG
A0A7Y3I9U8      LLGELFGFLETRRREAEVAEKVE-LPSVRILDHASEPIEPTSPSW-STSLLAALFL-GLG
A0A2V7H298      LAEQTVTNLQARYEEARLAEISA-IADVRLLDRAVEPQVPVGHMR-AILIFLAFWG-GLG
A0A2V7N2D0      DAEQLFANIQQRSEEARLAEASS-IPDVRILDAAVEPRQPFMDAA-PFLLLLSVVG-SLG
A0A5Q4DA46      SAENLFRDLQGRFENARLGAVST-VPDVRILVRAQVPEFPSSDPR-NQFGLMAILA-GLA
A0A848X7K9      ITEELHNDLRSRVEEAQVATASS-IPEVKVLDEAQVPSQPLADNR-LRLVFMIMAG-CLG
A0A838NSD4      TIRKMADQLQGDLQRAKMGEAVE-AGRVEIVELRDTPGYMIPNGS-RRRLGLGIVL-GLI
A0A7Y2HRX9      IASQQYQDVRQRYERARLAAASS-VPDVRILDEAVVPQFPAEDSR-LPLAMMIFGG-LLA
A0A7Y2ZG71      IASQQYQDVRQRYERARLAAASS-VPDVRILDEAVVPQFPAEDSR-LPLAMMIFGG-LLA
A0A7Y2JRQ8      SAEVLFQQLQNNFEQTRFALAST-IPDVRLLDPAVPPRGPTSNTA-PQIWFLGFLG-SLG
A0A849GUH2      IANDLYIDLSQRYSTANLAAASS-IPDVRILDRAIVPQVPSGDQR-IQFALIAFLI-PVA
A0A2V7ILF0      SAEQLVTNIRQRYEEARLADVSS-IPDVRILDRAAVPFLPTFNLL-PVLVVLGLMG-GFG
A0A2V7NMY2      VAGQLYASLQQRYDEARVAEASA-LPDVRILDAPVQPYQPIGSVA-PFLVIMAFLA-SAG
A0A848XNR9      LAEELYSNLLRRYEQAQLAAATSGIPEVRVLDRATVPQVPLLDER-LQFVLLALGG-FAA
A0A7Y3MWW4      LAEELYGNLLRRYEQAQLAAATSGIPEVRVLDRATVPQVPLIDER-LQLVLLALGG-FTA
A0A848XTP5      LAEELYGNLLRRYEQAQLAAATSGIPEVRVLDRATVPQVPLIDER-LQLVLLALGG-FTA
A0A7V9PGU7      QLASLYSDVAVRYQQAKLAEASA-VPDVRILDAAVQPQRPSRNSA-PAIIAIAFAG-GMA
A0A651HVY0      QAEALFEDVNRRYAAARLAALST-APDLQIVDRAEPPSRADGDRR-LMMALVTLFG-FVG
A0A7W0WKA3      SLESVYNLLQTRLNEAEIAEAVT-DASVQVVDSALIPSAPSSPRP-LVNLAAGVAV-GLM
A0A2V7SCT4      LAEELYTTLQRRYEEAQVSERTI-VPDLRILDAAVVPRRPVKNTA-PRLILLAFCG-SFG
A0A7W1PM85      ALARMSDELRADFQRARMATAVE-AGDIDVVALAPLPSTPLLDGG-ALKVALGLFL-GLG
A0A2V7RBS9      IAENLFTSVQQRYSEARLAEASS-IADVRVLDAAVAPETPVKNTA-VRLLIMGLFA-GLG
A0A2V7Q893      QSAQAVANLQRRYEEARLAETSS-IPDVRLVDPALEPQEPTENWA-PVLVLFTMIS-GLG
A0A2V7QPQ4      IAAQLFANIQQRYAEAQLADVSS-IPEVRILDRAPHPDTPLFNIA-AVLIVLAFVG-SGV
A0A2V7MB00      NAEQLFSNLQHRYQEARLAEVST-LPDVRILERAVRPSRPASNTA-PLLIIAAFLT-SFG
A0A2V7T7Z8      SKEQVVADLRRKYDKVRLAVTSS-IPDLELVDPAVEPQEPSDNWA-PVIVMFCAIT-CFG
A0A2V7PL95      MAEQAVVNLQQRHEEARLATVSS-LPDVKLVDPATEPQEPATNWA-PLVIGLALIV-GLG
A0A2V7R2W8      LAEQAVTNLQQRYEEARLAEVSS-IPDVRLLDRAIAPHRPVGHIG-AILIALAMVG-GLG
A0A7Y5K3R5      VNASLYNAIRGQYDAARLSELSA-VPGVAVLDSAVAPLEPVTNTV-PGILLAALLA-GAA
A0A843T0L2      GISKVTDQLREEYQRARIAEAVE-AGQVEVMDLATIPRDPLPGRR-ASMLALALVL-GLM
A0A6J4N058      VLQQMANQLREEHQRARIAEAVE-AGQVEIVDQAEVPDAPLGSGR-RSRLVLGLLL-GLM
A0A1G0LV28      LQNDTYKYLLSQLEAARISAGTI-APYIEVVESATVSYR-LGMST-RNKVVLGALV-GLF
A0A1Q7E008      IAENLYTTLQQRYEEARLAEAST-IPDVRVLDAAVAPHQPIKNTA-PRLILLGLFG-GLG
A0A7V8VQ50      VAENLYTNLRQRFEESRLAAASA-IPDVRVLDRATAPRQPVNDAQRQRMMLMALLG-SVG
A0A2V7L8K7      NAQKVADELRVEYQKAKIAEAVT-VGQVEIVDHAALPAKPAGIAL-PEQIALGLLL-GLM
A0A2V7JCT0      NAQKVADELRVEYQKAKIAEAVT-VGQVEIVDHAALPAKPAGIGL-PEQIALGLLL-GLM
A0A534A8D8      NAQKVADELRVEYQKAKIAEAVT-VGQVEIVDHAALPAKPAGIGL-PEQIALGLLL-GLM
A0A1Q7DXW6      NASQLFSNLQQRYEEARLAEVSS-LPDMRILERASKPDKPVSQLA-PILIVLSFLG-SLS
A0A2V7JF48      NAQKVADELRVEYQKAKIAEAVT-VGQVEIVDHAALPAKPAGIAL-PEQIALGLLL-GLM
A0A534A9Q9      NAQKVADELRVEYQKAKIAEAVT-VGQVEIVDHAALPAKPAGIAL-PEQIALGLLL-GLM
A0A2V7J5T6      ----------QRFDQSRLAAEAT-VPDVRILDPAIVPQRPIKNTT-PRLLLMGFVF-GLG
A0A2V7EJU4      IAENLYTTLQQRYEEARLAEAST-IPDVRVLDTAVVPHQPIKNQA-PRLILLGLFG-GLG
A0A7X5WBX7      TLQAMVDNLRLEHQRARIQEAVQ-AGRVDIVDLAPRPYLPVGMGT-RFKLFVGLML-GLM
A0A2V7KN28      ---QTYTALQQRFDQARLAAEAT-VPDVRILDPAMVPQRPVKNTA-PRLLLMGLLA-GLG
A0A257SFA4      LATSLFNTLQQRYDETRIAQATD-VSDVRILDPAGVPPWPTKNTA-PRLLLLAVLG-GFG
A0A2V7K2H8      IAENLYASVQQRYNEARLGEAST-VADVQVLDAAVSPQEAAKNTA-SRLVAFGFVV-GLS
A0A2V7EK09      LAETLYTTLQQRYQEARVEVASS-VPDVRVLDAAAVPQRAVKNRA-PQVILFAFFG-SLG
A0A2V7QD43      LAENLFTSLQKNYDEARLAEESA-VPDARILDHAVVPQDPVRNTA-PRVVFLGFAA-SLA
A0A2V7HL73      LPR------APGSVDPQVERSRG-RRPRTTIAHRLQDERPSNEVF-CHLSREGSPV-SKF
A0A800FAC6      LSQLYQAQITGGATAPYVDILDP-ANGASAVGGGGNVTVLLGALL-GLIMGVGASF---F
                                                                            

A0A838QE65      ---------------------------TLR------------------------------
A0A1Q6ZF81      -----------------------------M------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ------------------------------------------------------------
A0A848XMZ8      GGALAGYLREDSDTTIRERDDVESLS-QAPVLALVPHMKRPGPACEIARISTSQYGESAP
A0A7W0GXF9      ------------------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      -----------------------MKN-GKAVIGRERKLLANGA------------GERRG
A0A2V7NW82      LGLLGAVLIDRFDPRLRHPDQVTYGM-GLRILGVLPHVRD------------------RR
A0A2V7IEC4      -------------------------M-GLAILGAVPHLRTLPH------------AGRHG
A0A1Q6WKV1      --------------------------------------MG--G------------GGGGK
A0A2V7N4E0      -------------------------M-GLAILGALPHFAG--R------------GDGNG
A0A2V7Q431      ------FLADHLNRSVHRREDVAH-L-GLPVLGVVPHAKG-------------------G
A0A7V9Q9B6      ------------------PDEVTYGM-GLSILGVVPNVKQ-------------------V
A0A2N1WA66      AGIGLAFLLDLTDKRFRYADQITAGL-GISILGAVP-----------------------E
A0A7W0W3K6      AGLTAALIREMMDKKIRTKEDVQSVTGGLPILGAIPRLVPMAVPRLAHENGNGSENGKKK
A0A2V7HBX4      LAVGIALIRDRLDRRFRYPEQATREL-GLSVAGTVP-----------------------K
A0A7V9B8V3      LGIALAFVLDLTDKRFRYMDQVSSGL-GLTILGVIP-----------------------E
A0A2V7SVD5      LGLGLSVMLDRLDHKFRHLAQVNADL-GLAVLGTVP------------------------
A0A838W0N8      LAVGVPVLLDRVDPRLRYPEQVSGDM-GLAILGAVP---------------------HVG
A0A143BIC3      LGVVLAILLDQVDKRFRYPEQATDDL-GLFVLGVVP------------------------
A0A1Q7JIY3      LAVVGAIMLDRIDPRVRYPEQVSHEL-GLPILGAVP------------------------
A0A0S7Z9Q9      LGLLGAVLLDRVDARFRFASDVGRVI-GLDILGSIP------------------------
A0A2V7GP46      LALAGVVLLDRFDPRVRYPEQVSHDL-GLPILGAVP-----------------------H
A0A7Y3I9U8      GGLALAFYQEFTDSRVRDRREVELGT-GLSVIGIIPSLPRAGAVFEGQIIRGRVPRGGAS
A0A2V7H298      VGVAGAVLLDRTDRKVHYPEHVTRAM-GLSILGAVP------------------------
A0A2V7N2D0      AGVLAAVLRDRVDPKLRDPAHVTQEM-GLPILGAVP-------------------HLNAA
A0A5Q4DA46      LGLVGAIVRDRMDPVLRRPDQVSGDL-GLPILATIP---------------------HVR
A0A848X7K9      AAVLGAVLLDQTDAKFRYASDIGKEM-GLDILGSIP------------------------
A0A838NSD4      FGVGAAVLMDTLNVSIRRRSDVERVL-RVPGLAVIP-----------KLGPWASPRGRIA
A0A7Y2HRX9      VGVAGAVFLDRSDDRFRYPEDVSVGL-GLEILGTIP------------------------
A0A7Y2ZG71      VGVAGAVFLDRSDDRFRYPEDVSVGL-GLEILGTIP------------------------
A0A7Y2JRQ8      GGILLALLLDRLDRRVRYPDQVTREL-GLTILGAIP-----------------------A
A0A849GUH2      VGFLLVMLLDRMDTKLRDPAQISNQL-GLDWLATIP-----------------------R
A0A2V7ILF0      AGGGAAVLLDHLDRKVREPDEVTRVM-GLPILGAVP-----------H------------
A0A2V7NMY2      LGVLGAVVIDTLDPRFRDPGHVTQGL-GLRILGALP-----------HLSR---------
A0A848XNR9      AGVLMAIMMDRLDPRIRYASEVTSEV-GLGILGVIP------------------------
A0A7Y3MWW4      AGVLMAIMMDRLDPRIRYASEVTSEV-GLGILGVIP------------------------
A0A848XTP5      AGVLMAIMMDRLDPRIRYASEVTSEV-GLGILGVIP------------------------
A0A7V9PGU7      LAIGIAILLDRLDKRLRYPDQVTREL-GLSILGAIP-----------------------A
A0A651HVY0      AGGLGAILMDLRDKRVRSPSDVETGL-GLPILGALP-----------H----------LA
A0A7W0WKA3      LGVGLACIREYRDGSVHSRRDVVVAT-GVPVIGLIP-----------RIPKARGRIALIT
A0A2V7SCT4      LAVVGAIMLDRIDPRVRYPEQVSHEL-GLPILGAVP-----------H------------
A0A7W1PM85      LGLIIAYILEALNTSVRRPEDLEAVL-HVPGLAVIPRITDGSRSAQSHFRRLLGSGKSAR
A0A2V7RBS9      LGVVGAVVIDRFDPRVRYPAQVTTDM-GLRILGALP-----------H----------VK
A0A2V7Q893      AGVGSAVVLDYRDRRVHDPEDFTRTI-GLKILGVVP-----------H----------LE
A0A2V7QPQ4      AGVLGVVALDHLDSRVRHPDQVTRAM-GLTILGAVP-----------H----------VG
A0A2V7MB00      VGVAGAVVRDRADPTVRRPDQITSAM-GLPILGAVP-----------HVRQTAPRREPLG
A0A2V7T7Z8      AGACGAILLDRTDRRVHDPDDVAHKM-GLKVLGVLP-----------H----------FD
A0A2V7PL95      AGVTGAVVLDRTDRRVQYPEDVTSTM-GLNILGVVP-----------H----------LG
A0A2V7R2W8      LGMTGAVVLDSTDRRVRHPDDVTRAM-GLAILGAVP-----------H----------VD
A0A7Y5K3R5      LALATALLLDATDRRLWYPEQVE-AL-GYEIIGAVP-----------R----------AP
A0A843T0L2      LGSGGAFLIENLNTSIRGKQDLE-GL-HITNLAVIPSFASRTQLERRLRLPTWILPPT--
A0A6J4N058      LGSGAAVLREQANTAIRLPNELEELL-EVTSLGVVPRLIEGGPRGRRLKWLR--------
A0A1G0LV28      LGVLAAFFLEYLDQTIKTAQDVERVL-DVPVLGLIPLESRQQLLAGNGHHGRRRYAIPLV
A0A1Q7E008      LSLMGAVLIDRFDRRFRYPQQATGDM-GLTILGAVPRLRYG--RRG--------------
A0A7V8VQ50      LAVFGAILLDRMDSRLRYPEQVTHGM-GLPILGAVPQLQTD--KGR--------------
A0A2V7L8K7      LGSGGAFLAERLGSTIAQRVQVE-QL-GMSVIGVITHLDRDGPETG--------------
A0A2V7JCT0      LGSGGAFLAERLGSTIAQRVQVE-QL-GMSVIGVITHLDRDGAETG--------------
A0A534A8D8      LGSGGAFLAERLGSTIAQRVQVE-QL-GMSVIGVITHLDRDGAETG--------------
A0A1Q7DXW6      VGTLAAMTLDRMDRKVRTAEHVSLAM-GLPILGAVPHVHRNGKKRN--------------
A0A2V7JF48      LGSGGAFLAERLGSTIAQRVQVE-QL-GMSVIGVITHLDRDGPETG--------------
A0A534A9Q9      LGSGGAFLAERLGSTIAQRVQVE-QL-GMSVIGVITHLDRDGPETG--------------
A0A2V7J5T6      LGMVGAIVLDRVDPRVRYPEQVSRDL-GLPILGAVPHL----------------------
A0A2V7EJU4      LSLMGAVMLDRLDRHFRYPQQVTGEM-GLAILGAVPRI---KRG----------------
A0A7X5WBX7      LGVGTAFGRELMNRSIRGREQLEEIA-PVPGLAVIPRLVPASNG----------------
A0A2V7KN28      LGVLGAILLDRADPSVRYPEQVSRDL-GLPIIGAVPHLRAKDPA----------------
A0A257SFA4      LASLGSVLMDRWDPRFQYPEQVSRDM-GIAILGTIPHVRTARDG----------------
A0A2V7K2H8      LGMVAAVVVDRLDPRVHHPDQVTEQM-GLSIIGVLPHVRDRRAG----------------
A0A2V7EK09      LAMIGAVLVDRGDPRVRYPYQVSREM-GLTILGAVPHLRLTGVP----------------
A0A2V7QD43      LGLCGAVVLDRIDPKLRYPDQVSRGL-GIPILGAVPHLRNLPRG----------------
A0A2V7HL73      LKALERAEQQRALGRHPAPSEAASER-GLAVPETAPPRPPRASH----------------
A0A800FAC6      LEYLDRTVR--------TSSDVESLL-GMPVLGVIPTLRRLDDD----------------
                                                                            

A0A838QE65      ------------------------------------------------------------
A0A1Q6ZF81      ------------------------------------------------------------
A0A524QR19      ------------------------------------------------------------
A0A1V4RFS5      ---MLLERSKSP------------------------------------------------
A0A848XMZ8      VAKPRKRAESVV------------------------------------------------
A0A7W0GXF9      ---MAGNQTFSI------------------------------------------------
A0A7Y5K1X2      ------------------------------------------------------------
A0A838H971      SLADYTPAGGDP------------------------------------------------
A0A2V7NW82      --VGQDDEHVIQ------------------------------------------------
A0A2V7IEC4      --RGRVPEDVNQ------------------------------------------------
A0A1Q6WKV1      --SARPHEGVAE------------------------------------------------
A0A2V7N4E0      --AGRTPEDIAQ------------------------------------------------
A0A2V7Q431      --SN---EDAAP------------------------------------------------
A0A7V9Q9B6      --GNLTDEASAQ------------------------------------------------
A0A2N1WA66      IRRAKGETPSAEEASQ--------------------------------------------
A0A7W0W3K6      LAKPSGPANGRALIPLKPSHDV--------------------------------------
A0A2V7HBX4      FKANHRGEFQIAMMSQ--------------------------------------------
A0A7V9B8V3      IRRAKGQAASSEEAAQ--------------------------------------------
A0A2V7SVD5      QIAQPPRRAKPEDAAE--------------------------------------------
A0A838W0N8      GAGETGKRVKRDPTTD--------------------------------------------
A0A143BIC3      VIHSKGKRGKTDEAAQ--------------------------------------------
A0A1Q7JIY3      ------HLKDAAEPAE--------------------------------------------
A0A0S7Z9Q9      RIESANGRRGVLNAAQ--------------------------------------------
A0A2V7GP46      LKARTGGQLTREQRVQ--------------------------------------------
A0A7Y3I9U8      ARREEV------------------------------------------------------
A0A2V7H298      -HVDWRNGNRDAAATQ--------------------------------------------
A0A2V7N2D0      NGKGARGLNGGGAGAAGP------------------------------------------
A0A5Q4DA46      SRNGRLRPEDHEQ-----------------------------------------------
A0A848X7K9      RLQSGRSQRDILNAAQ--------------------------------------------
A0A838NSD4      RALPRRSQNSSTSGAQGAQELVTVSSVRSS------------------------------
A0A7Y2HRX9      -RVLPKGAGFD-------------------------------------------------
A0A7Y2ZG71      -RVLPKGAGFD-------------------------------------------------
A0A7Y2JRQ8      IRKVKAGKRDTEEASQ--------------------------------------------
A0A849GUH2      YRRGTVGTDNSEQ-----------------------------------------------
A0A2V7ILF0      -LKQRRNGSVHEGGLP--------------------------------------------
A0A2V7NMY2      -------AGNGEGTAQ--------------------------------------------
A0A848XNR9      -RVVTEGRGAEQSANA--------------------------------------------
A0A7Y3MWW4      -RVVTEGRGAEDSANA--------------------------------------------
A0A848XTP5      -RVVTEGRGAEDSANA--------------------------------------------
A0A7V9PGU7      IRKVDVNSRDPEEAAQ--------------------------------------------
A0A651HVY0      TRGGRVRAKDQNQ-----------------------------------------------
A0A7W0WKA3      GRRKIKHARSPMALAVANGRHENERIFTFLSAGAPPPDPVPPVAEPLRREPMATGLELTA
A0A2V7SCT4      -------LKDAAEPAE--------------------------------------------
A0A7W1PM85      QAVGS-PLTGNQTFSI--------------------------------------------
A0A2V7RBS9      KRAGA---SDDESGAL--------------------------------------------
A0A2V7Q893      -RKGR--NRAPEDALH--------------------------------------------
A0A2V7QPQ4      QRNGK-----GDQVAP--------------------------------------------
A0A2V7MB00      KHRGP--EADADDGAR--------------------------------------------
A0A2V7T7Z8      SPPPPLWAARSEGGVK--------------------------------------------
A0A2V7PL95      -RNGH--AKHHEGVLQ--------------------------------------------
A0A2V7R2W8      WRNGK--RD--AAVAQ--------------------------------------------
A0A7Y5K3R5      EAKRE--MDDPVAAAQ--------------------------------------------
A0A843T0L2      --GNGHTPVTGELRELITVSELKSS-----------------------------------
A0A6J4N058      --RRPADPAGVRAAGLVMVHAPKST-----------------------------------
A0A1G0LV28      SLVSPDDP--S-------------------------------------------------
A0A1Q7E008      --IDPDDLTQV-------------------------------------------------
A0A7V8VQ50      --LKQESTAQI-------------------------------------------------
A0A2V7L8K7      --MKSPDA--V-------------------------------------------------
A0A2V7JCT0      --MKSPDA--V-------------------------------------------------
A0A534A8D8      --MKSPDA--V-------------------------------------------------
A0A1Q7DXW6      --SQDEDSQPA-------------------------------------------------
A0A2V7JF48      --MKSPDA--V-------------------------------------------------
A0A534A9Q9      --MKSPDA--V-------------------------------------------------
A0A2V7J5T6      ----------RTKEPAEVV-----------------------------------------
A0A2V7EJU4      --RRAVDP----EDARQVI-----------------------------------------
A0A7X5WBX7      --RLRLRPGRKERDEAVAA-----------------------------------------
A0A2V7KN28      --EVV-------------------------------------------------------
A0A257SFA4      --TLGDPAFR--------------------------------------------------
A0A2V7K2H8      ----------PDDQQVAHAI----------------------------------------
A0A2V7EK09      --GRHGNERSPED--IAAVV----------------------------------------
A0A2V7QD43      --GRGSGARVPDD--VNEVV----------------------------------------
A0A2V7HL73      --ELAREVPNGLEEHLVSLLAPRSF-----------------------------------
A0A800FAC6      --PEGAAALAGRGRPLVVAMDPLDP-----------------------------------
                                                                            

A0A838QE65      ----------------------------------TVVITSASPGEGKTTTAANLAVSFAQ
A0A1Q6ZF81      ----------------------------------VLTISSPGSGDGKSFLSANLGLTFAD
A0A524QR19      --------------------------------------TSPAEGEGKTFVAANLANAFAD
A0A1V4RFS5      ------NAEAIRDLRTSLSFSR--PEQGIK----SLLVTSSGPREGKSSVSANLAVAEAE
A0A848XMZ8      ------VLEAFRNVVGDIRY-L--EPHSPGKRLRTLAVVSAMRGDGKTFCACNLAIAHTT
A0A7W0GXF9      ------GIEAFRNLRTSLIWSD--GGEALK----TLVVTSAAPGEGKTLTAANLAVTLAY
A0A7Y5K1X2      --------------------AR--AQSRAR----TLVLTSPGPADGKSTTVANLAITFAQ
A0A838H971      ------TVEAFRSLGADLSF-L--GQGSPSGEARLIVFTSPWRGEGKTFSAVNFAATRAL
A0A2V7NW82      ------LVEAVRSVRLSLAHAY--GAAGPM----VVTLTSPGVGDGKSFLSANLALAFAE
A0A2V7IEC4      ------VVEALRGVCLNLVYAH--GGRAPL----LVTVTSPGAGDGKSFLAANLAHTFAD
A0A1Q6WKV1      ------LVEALRGTCLNLVYAY--GAAGPM----LVTITSPGPGDGKSFLAANLALTFAE
A0A2V7N4E0      ------VVEALRGVCLNVVHAY--GAAGPL----IVAITSPGPGDGKSFLAANLAHTFAE
A0A2V7Q431      ------IVEAMRGIRFNVLHAY--GAAGPA----MFTITSPGSREGKSFVASNVALAFAD
A0A7V9Q9B6      ------AAEAFREIRMNLVYAH--GAAGPV----MLTVTSPGSGDGKSFLTSNLALAFSD
A0A2N1WA66      ------VIEAFRTIRLNLMHTV--AREKGF----AITITSAMPGDGKSLVSSNLALSFAE
A0A7W0W3K6      ------SAEAYRALRTNITFAA--ADHANQ----VLVLTSALPGDGKSTSSANLAVTLAQ
A0A2V7HBX4      ------AVESFRTLRLALRYDF--PTDAPI----VVGVSSPAAGDGKSLVSSNLALAFAS
A0A7V9B8V3      ------VIESFRTVRLNLLHMV--PDATSI----ALTVTSPMPGDGKSLISSNLAFSFAE
A0A2V7SVD5      ------VIESFRGIRLRLQYAY--SANQPL----VCGVTSPEQGDGKSLVASNLALAFAE
A0A838W0N8      ------AVEAFREIRLNVAHAY--GTAGPL----LTTITSPGVGDGKSFVSCNLALAFAD
A0A143BIC3      ------VVESFRTIRMNVRYAA--DPSRPL----TMTITSPGPNDGKSLISSNLALSFAE
A0A1Q7JIY3      ------VVEALRGLCLNLVHAH--GAAGPL----LVTITSPGAGDGKSFLASNLALTFAD
A0A0S7Z9Q9      ------ALEAFRELRIHVSFAY--GSAGPI----TLAVTSPAPNEGKSMISSNLAVAFSE
A0A2V7GP46      ------LVEAMRGVCLGVSYTY--GAAGPV----VVAVSSPGPGDGKSFITANLAVTFAD
A0A7Y3I9U8      ------VREAFRGLLTDLEFIQRPGAAGPL---RTLAVVSAGPGEGKTFTSSNIALARAS
A0A2V7H298      ------VIESLRGVRLNVVHRH--GTAGPV----RLTVTSPGKSDGKSFVASNLALAFAD
A0A2V7N2D0      ------VIEALRGIRLSLVHAY--GTAGPL----LVTITSPGSGEGKSFVAANIALAFAD
A0A5Q4DA46      ------VVEAFRSLRLALAYGR--RGAGPL----VLTISSPGVGDGKSFTTSNLALACAE
A0A848X7K9      ------ALEAFRELRMHVDFAY--GAAGPI----TVAVTSPAAGEGKSLISSNLAVSFAE
A0A838NSD4      ------GAEAYRTLRTNLMFSQ--ALQALR----TLVITSASPGEGKTTTAANLAVSFAQ
A0A7Y2HRX9      ------VQEAFRELRLRLMYAH--GSAGPL----MVAISSPGPEEGKTFIASNLALSFAE
A0A7Y2ZG71      ------VQEAFRELRLRLMYAH--GSAGPL----MVAISSPGPEEGKTFIASNLALSFAE
A0A7Y2JRQ8      ------VVEAFRTIRLNLAHSY--GAAGPV----LLTVSSPGPGDGKSLVSANLALSFAE
A0A849GUH2      ------IREAFRDLRMKIDYAF--GATRPL----ILSITSPSEGEGKTFVAANLANAFAD
A0A2V7ILF0      ------IIEAIRGIRLSVQYAH--GAAGPL----VCTITSPGRSDGKSFLASNLALGLAD
A0A2V7NMY2      ------AIEAMRTVRVKLQHAS--NGGNPL----LLTVTSPGVGEGKSLVSANLALAFAY
A0A848XNR9      ------TVEAFRDLRLNLSYAY--GSAGPI----ALTVTSPDPSDGKSFIAANMAMAFAQ
A0A7Y3MWW4      ------TVEAFRDLRLNLSYAY--GSAGPI----ALTVTSPDPSDGKSFISANLAMAFAQ
A0A848XTP5      ------TVEAFRDLRLNLSYAY--GSAGPI----ALTVTSPDPSDGKSFISANLAMAFAQ
A0A7V9PGU7      ------VVEAFRTIRMNLAHSY--GAAGPV----MLTVSSPAPGDGKSLVASNLALSFAE
A0A651HVY0      ------AVEAFRSIRLGLTYAY--GTASPM----VLTISSPAPGDGKSFTTSNLGLSFAE
A0A7W0WKA3      SRWTNIVAEAYSLLLTNVAFAR--TSPPVK----IVAITSPLAEEGKTTCAVNLSITLAL
A0A2V7SCT4      ------VVEALRGLCLNLVHAH--GAAGPL----LVTITSPGAGDGKSFLASNLALTFAD
A0A7W1PM85      ------GIEAFRNLRTSLIWSD--GGETLR----SLVVTSAAPGEGKTMTAANLAVTLAY
A0A2V7RBS9      ------VIETMRGVRLSLIHAY--GTAGPL----VVTITSPGPGDGKSFVSANLALACAQ
A0A2V7Q893      ------VLEAMRGTCLNVLHAH---GTGPV----IVTVTSPGRADGKSFVASNLAVAFAD
A0A2V7QPQ4      ------VIEALRAIRLRVVHAH--GSAGPI----AVTISSPGRSDGKSLIASNLALAFAD
A0A2V7MB00      ------AVEALRGIRLNVHHAA--GAVGPL----LATITSAGRGEGKSFVSANLAYAFSA
A0A2V7T7Z8      ------LIEAMRGIHVNVLHSH---GVGPA----IMTVTSPGRADGKSFVAAYLATAFAD
A0A2V7PL95      ------VLEAVRAIRLNVLHAH---GVGPA----IVTVTSPGRADGKSFLASNLAVAFAD
A0A2V7R2W8      ------VIEALRGIRLNVVHRH--GSAGPV----RLTITSPGKSDGKSFVASNLALAFAD
A0A7Y5K3R5      ------VAESMRSLRLNVLNAM--LGARPV----ALSVLSAEIGDGKSFVATQLARSFAQ
A0A843T0L2      ------ASEAYRTLRTNLIFSQ--AVQTLH----RVVVTSSAPAEGKTTTVANLGVAFAQ
A0A6J4N058      ------GAEAIRTLRTNLLFSQ--LVHRLK----LLAVTSSGPAEGKSLTSANLAAAFAQ
A0A1G0LV28      -------SEAYRALRTNVTFVN--AEQRSL---RVICVTSPGPGEGKSTTAANLAITLAQ
A0A1Q7E008      -------IEALRTVRLNVAHAY--GAAGPM----VVTITSPGPGDGKSFLAANLARSFAD
A0A7V8VQ50      -------VEAFREIRLGLMHAY--GSAGPL----MLTITSPNAGDGKSFISSNLALAFAD
A0A2V7L8K7      -------VEAFRGLRLSLVNEY--GAPGPL----VITVTSPGSGDGKSFVSSNLSLAFAY
A0A2V7JCT0      -------VEAFRGLRLSLVNEY--GAPGPL----VITVTSPGSGDGKSFVSSNLSLAFAY
A0A534A8D8      -------VEAFRGLRLSLVNEY--GAPGPL----VITVTSPGSGDGKSFVSSNLSLAFAY
A0A1Q7DXW6      -------VEAMRGIRLNVQHAY--GAAGPL----LLTVTSPGRGEGKSFVTANLALAFAD
A0A2V7JF48      -------VEAFRGLRLSLVNEY--GAPGPL----VITVTSPGSGDGKSFVSSNLSLAFAY
A0A534A9Q9      -------VEAFRGLRLSLVNEY--GAPGPL----VITVTSPGSGDGKSFVSSNLSLAFAY
A0A2V7J5T6      --------EALRGLRLNVAHEF--G-AGPV----VFTVTSPEPGDGKSFVSANLALTFAD
A0A2V7EJU4      --------EALRTVRLNLTHAY--GAAGPL----LVTITSPGPGDGKSFVSGNLARAFAD
A0A7X5WBX7      --------EAYRILNANLQVTA--GDVGFR----TVVVTSAVPAEGKTTTATNLARLLAE
A0A2V7KN28      --------EALRGVRLSLANEH--G-PGPL----LVTVTSPGPGDGKSFLSANLALTFAD
A0A257SFA4      --------EAMRGVRMNIAFAY--GAAGPV----TLTVTSPGSADGKSFVALWLARAFGE
A0A2V7K2H8      --------EAMRSIRLSLTHAH--GAAGPM----LVTISSPGVGDGKSFVSANLALAFAE
A0A2V7EK09      --------EGLRGICLNLVYAH--GATVPL----LVTITSPEPGDGKSFLSANIAHTFAQ
A0A2V7QD43      --------EALRGVCLNLVYAH--GGRAPL----LVTITSPGAGDGKSFISANLAHTFAD
A0A2V7HL73      ------EAEQYRTLR-HLIEQL--HKSTGL---SVVAISSPGVADGKTTTAINLAGALAQ
A0A800FAC6      ------AAEAYRNLRMNFLFMS--SDDDPI---RTVLFSSPGPSEGKSTTAVNFAVMLAQ
                                                       *.   :**:     ..     

A0A838QE65      QGM-RVLLVDCDLRRARL--HKLFDL-PREPGLTELIL-----GNGDVE----QL---SR
A0A1Q6ZF81      GGH-KTLLIDGDIRRGVL--HRRFKG-NRQPGLVDYLL-----GDAGHD----AI---VQ
A0A524QR19      LGR-KTILIDGDTRRGDL--HHILER-DRKPGLTDFLM-----NGKSHQ-----I---VQ
A0A1V4RFS5      AGK-KVILVDCDLRRPTV--NKTFGF-KRKPGFTELIS-----GKATID----EVVK--K
A0A848XMZ8      LGA-NTLLVDTDLRAKGV--SRFFEIEPQDPGLTDALA-----GHVEWR----PTIQAWS
A0A7W0GXF9      DGL-RVLLVDCDIRRPRV--HGLFHL-PRAPGLMELLTASGEPGGAPPP----PAIR--E
A0A7Y5K1X2      QGQ-RTLLIDGDLRRAVL--DKTFSV-PRTPGLTELIV-----GVSPLA----DAVH--E
A0A838H971      QGI-RTLLIDADLRAGSA--SSTLGL-GRGPGLTDVLS-----GQARLL----DVVRMVK
A0A2V7NW82      AGH-RTLLVDGDVRRGAL--HRALHA-TRQPGLTDFLA-----GRAPLE----AIVQ--E
A0A2V7IEC4      GGH-RALLIDADIRRGVL--HRRLNA-RRRPGLSDFLR-----GETPLD----SIVQ--A
A0A1Q6WKV1      GGH-RTLLVDADIRRGVL--HRRLTA-RRRPGLTDCLR-----GEVPFE----AILQ--Q
A0A2V7N4E0      GGH-RTLLVDGDIRRGVL--HRRLSA-RRRPGLTDYLR-----GEVPLE----AILQ--P
A0A2V7Q431      AGH-RTLLIDGDMRRGSL--YRILNT-RRKPGLTDVLH-----DEVSAE----DVIQ--P
A0A7V9Q9B6      QGY-RTLIIDADVRRGVL--HRTMGC-ERVPGLTDYLA-----GHASLN----DVLR--P
A0A2N1WA66      AGF-KTLLIDGDTRRGEL--HRTFGV-ERRPGLLDHLA-----EQVPIA----DA---LH
A0A7W0W3K6      QGV-RTLLVDADLRKGVL--HSFFEC-QREPGLTQVLI-----GEKTLA----EA---IQ
A0A2V7HBX4      AGS-RTLLIDGDVRCGGL--HNTFEI-PVTPGLVDYLN-----GHAAVD----SI---VR
A0A7V9B8V3      AGY-RTLLVDGDTRRGEL--HRTLGV-ERIPGLLDHLA-----DGAVVD----TI---LR
A0A2V7SVD5      AGY-RTLLIDADTRRGSL--HDVFGA-QRRPGLIEVLS-----GEVTRA----EV---MH
A0A838W0N8      LGH-RTLLIDGDIRRGQV--HHLLGA-VRMPGLTDYLS-----GTASTE----EI---VQ
A0A143BIC3      SGA-RTLLIDGDIRRGEL--AKTFQI-TSKPGLVEYLD-----GTALIA----EV---LH
A0A1Q7JIY3      GGH-RTLLVDGDLRRGLL--HRRFNA-NRKPGLIEFLH-----GDAARE----QI---VQ
A0A0S7Z9Q9      VGR-RTLLIDGDTRRGDA--HRLLGR-ERSPGLIDHLR-----GETGQ-----DI---IQ
A0A2V7GP46      AGR-RTLLVDGDLRRGAQ--HRLFGA-DRRPGLTDALR-----GEVPLE----AG---LR
A0A7Y3I9U8      VGA-NTLLLDADMRAGGV--SEFFGI-PSLTGLTEVLT-----GEVAME----DV---VR
A0A2V7H298      AGY-RTLLVDGDVRRGRL--HHTLSA-ARRPGLTELLE-----GSAPQD----AA---VQ
A0A2V7N2D0      AGH-RTLLIDGDIRRGQL--HRVLNA-ARVPGLTNGLT-----EGTPLD----AI---LQ
A0A5Q4DA46      LGH-RTLVIDGDVRRGTL--HTLFNL-SRRPGLTDFLA-----GEAELE----AV---VQ
A0A848X7K9      VGR-RTLLIDGDTRRGDA--HRLLGL-SQSPGLIDHLK-----GTARE-----DV---IQ
A0A838NSD4      QGM-RVLLIDCDLRRARL--HKIFGL-PREPGLTDLVL-----GTTNEE----EA---TR
A0A7Y2HRX9      TGR-RTLLIDADTRRGDL--HHILGV-NRKPGLVDYLS-----GGRAD-----GL---IQ
A0A7Y2ZG71      TGR-RTLLIDADTRRGDL--HHILGV-NRKPGLVDYLS-----GGRAD-----GL---IQ
A0A7Y2JRQ8      AGY-KTLLLDGDIRRGEL--HRMFGL-NRQPGLLDFLT-----QEATLD----EV---LK
A0A849GUH2      LGR-KTVIVDGDTRRGDL--HHILER-DRKPGLTDFLM-----NGKSH-----QV---VQ
A0A2V7ILF0      AGL-RTVLIDGDIRRGAL--HRVLAV-ARKPGLTDVLA-----GKATVD----EV---VR
A0A2V7NMY2      AGL-RTVVIDGDIRRGAL--HRLLRG-SRRPGLTDHLT-----GRAPLE----KV---LQ
A0A848XNR9      FGR-RTLVVDADTRRGDI--HEALGV-SRRPGLTDYLA-----GSASLD----EI---IQ
A0A7Y3MWW4      FGR-RTLVIDADTRRGDI--HEALGV-SRRPGLTDYLA-----GSASLD----EI---IQ
A0A848XTP5      FGR-RTLVIDADTRRGDI--HEALGV-SRRPGLTDYLA-----GSASLD----EI---IQ
A0A7V9PGU7      AGY-KTLLIDGDVRRGEL--HRMFGT-DRRPGLLDFLL-----GTATLA----EV---TR
A0A651HVY0      LGR-RTVVVDGDVRKGTQ--HTHLGV-DRTPGLTDYLT-----GEVELD----DI---LQ
A0A7W0WKA3      RGS-KVLLVDADLRRGVV--HTTLGA-DRVPGLSEVLS-----RSLPEL----EA---IH
A0A2V7SCT4      GGH-RTLLVDGDLRRGLL--HRRFNA-NRKPGLIEFLH-----GDAARE----QI---VQ
A0A7W1PM85      DGL-RVLLVDCDIRRPRI--HGLFQL-PRAPGLMELLR-----ASTDPDAPPIEA---IR
A0A2V7RBS9      AGQ-RTLLIDGDTRRGAL--HRVLGA-VRRPGLTDFLA-----GHVSFE----GL---IQ
A0A2V7Q893      GGY-RTLLVDGDVRCGTL--HRTLKL-ARRPGLTDLLQ-----GRAGQE----QV---VQ
A0A2V7QPQ4      SGY-RTLLVDGDVRRGAL--HRVLKT-ARKPGLTELLA-----GTASRE----EA---VR
A0A2V7MB00      VGF-RTLLIDGDVRLGAL--HRPLRG-ARRPGLTDVLA-----GSIPPE----LA---VQ
A0A2V7T7Z8      AGY-RTLLIDGDVRCGVL--HRAVKL-LRRPGLTDLLG-----GEAIEA----QV---VQ
A0A2V7PL95      AGY-RTLLIDGDIRCGTL--HRVLKR-PRRPGLTDVLA-----GNATTA----QA---IQ
A0A2V7R2W8      TGL-RTLLVDGDVRRGRL--HRTLGA-ARRPGLTDLLE-----GSVGWD----QV---VQ
A0A7Y5K3R5      AGH-RTVLVDGDIRRGVA--DQAFHL-TRTPGLTDHLA-----GKVSLD----EA---TR
A0A843T0L2      QGL-RVLIVDCDLRKARL--HELFDL-AREPGLTQLVL-----GHADIE----GV---LH
A0A6J4N058      QGM-RVLLVDCDLRRPVQ--HTIFGL-SQEPGITNVLL-----GQVAIS----QA---AR
A0A1G0LV28      QGS-ATLLVDADLRRPLV--HRAFNL-VQEPGLTDVLV-----GSSQLR----EA---VR
A0A1Q7E008      SGR-RTLLIDGDGRRGVL--HRVLKV-VRKPGLIDYLA-----GAVPFA----TI---VQ
A0A7V8VQ50      LGY-RTLLIDGDIRKGGL--HRLFER-IRRPGLTDFLA-----GRVPFA----QI---VQ
A0A2V7L8K7      AKQ-RTLLVDADLRRGAL--HRVLNL-RRQPGLTDFLA-----GDVSRA----PV---VQ
A0A2V7JCT0      AKQ-RTLLVDADLRRGAL--HRVLNL-RRQPGLTDFLA-----GDVSRA----PV---VQ
A0A534A8D8      AKQ-RTLLVDADLRRGAL--HRVLNL-RRQPGLTDFLA-----GDVSRA----PV---VQ
A0A1Q7DXW6      VGY-RTLLIDGDVRLGAL--HHAVRA-QRRPGLTDVLA-----NRATPD----QA---VQ
A0A2V7JF48      AKQ-RTLLVDADLRRGAL--HRVLNL-RRQPGLTDFLA-----GDVSRA----PV---VQ
A0A534A9Q9      AKQ-RTLLVDADLRRGAL--HRVLNL-RRQPGLTDFLA-----GDVSRA----PV---VQ
A0A2V7J5T6      GGH-RTLLIDGDIRRGVL--HRRFKC-NRQPGLVDFIQ-----GHAPRD----QI---VQ
A0A2V7EJU4      AGQ-RTLLIDGDSRRGVL--HRLFKG-LRKPGLTDYLT-----GVVPLE----AV---VQ
A0A7X5WBX7      HGE-RVLLVDADLRVGEL--HKEFQV-ARKPGLAELLA-----GTAPVQ----GV---IR
A0A2V7KN28      AGQ-RTLLVDGDIRRGVL--HRRFKA-NRQPGLVDFLR-----TEAGQG----DI---VQ
A0A257SFA4      AGR-RTVIVDADVRRGAL--HRRCDL-LRKPGLTDLLK-----GDVPLE----RV---VR
A0A2V7K2H8      AGR-RTLLIDGDVRRGSL--HRAVRA-RRQPGLTDFLA-----GRAPFE----AT---VQ
A0A2V7EK09      GGH-RTLLIDGDIRRGVL--HRRLNG-RRRPGLTDFLQ-----GETSLD----TI---VQ
A0A2V7QD43      GGH-RTLLIDADIRRGVL--HRRLSV-RRRPGLSDFLR-----GEAQLD----VI---VQ
A0A2V7HL73      ASDARVLLVDVDLRGGALAARLGIDE-RAGRGLVDAIL-----NAELTL----EAVVEVR
A0A800FAC6      LGQ-RVLLIDADLRRPSL--HRALDL-LREPGLTNLLI-----GEAKPR----EA---IR
                     .:::* * *                 *: : :                       

A0A838QE65      --------TTDVTG----LYVMPAGQLPPNPAELLGSDATRRVLAGLAEAYDMIIIDTPP
A0A1Q6ZF81      --------KTAYPR----LSLIGCGTRTQRAPEVLGSPAMNRLLAELRGRYDVIVVDSPP
A0A524QR19      --------NTDNPR----LHFVGFGSKTSSSPELLTSPQMGSFLAGLKRRYEVIIIDSPP
A0A1V4RFS5      --------TEVEG-----LFVICSGHIPHNPAEMVETAVKKGVFSQIAEACDMLIIDTPP
A0A848XMZ8      --------ANRRAG----LHVMPSGTLAARAAEYISAGGFDRLVGQVTSRYDVVIFDTPP
A0A7W0GXF9      --------TSIAR-----LSVLPCGALPMNAANLLSSTRMRILLQELEEQYDIIVLDTPP
A0A7Y5K1X2      --------TSVEN-----LFVMGSGQLPPNPSELLGSERMREVIAEARESFDVILFDSPP
A0A838H971      --------VGDHR-----LAVAPAGALQADVGKLLLAEGLTEVLATATEHFEQVVIDTPP
A0A2V7NW82      --------TTSPS-----LHFIGSGTRHRDAPELLGSPPMVELLTRLRTSHRVILVDSPP
A0A2V7IEC4      --------TPYPS-----LSLIGCGTRAYNAPELLGSPPMSELVNGMRSGYDVILIDSPP
A0A1Q6WKV1      --------TAYPL-----LTLVGCGTRVHNAPELLSSEAMAQLVTRVRPDYDVILMDSPP
A0A2V7N4E0      --------TGCHT-----LTLIGCGTRAHNAPELLGSQAMGELITGWRASYDVILIDTPP
A0A2V7Q431      --------TRYPP-----LFFVGCGTRTPDAPELLGSEAMSRFIAGVRESFSAIVIDSPP
A0A7V9Q9B6      --------TQYPN-----VSLIPAGTRMKDGPELLGTERMAKLLLEMKTRFRAILVDSPP
A0A2N1WA66      --------PTNHPR----LTVLTGGSRHRNGPELLGSAAMRELMDQLQKEYDVILVDSPP
A0A7W0W3K6      --------PVSLGGTTDTLFLLTAGRFPPNPAELLGSERMSALVEEMRQAFQMIVFDTPP
A0A2V7HBX4      --------STTSEN----LFLIPRGTRGNRAPELLVSELMSALVHAMRLQFDVVIIDSPP
A0A7V9B8V3      --------PTSHPH----LTLMPGGSRHRNAPELMGSERMRKLIAAMRSRFDVIIVDSPP
A0A2V7SVD5      --------PTTQER----LSLLPCGGRRTTNPELIASPALPRLLSELVGEFSVIIVDGPP
A0A838W0N8      --------PTAYAS----LDMIAGGTRMQAGPELLGSAAMASLIRDLKSRYSVILIDSPP
A0A143BIC3      -------PVQSHPN----LTVMPGGARRRRAPELLATPRLNQLINQMAAEYDVVIVDSPP
A0A1Q7JIY3      --------PTSYPW----LYLIGCGTRTNRAPELLGSAAMGQLVAALRQEYDVILIDSPP
A0A0S7Z9Q9      --------ATDHPN----LDFIGCGSRGVSTPELLASPRMAYFIGTLKRTYDVIIIDCPP
A0A2V7GP46      --------PTGYDA----LTLLPCGVRTSDAPELLGSAKMPELLARLRGDYDVILVDSPP
A0A7Y3I9U8      LMRIEKAKDTSSGA----LAVVPAGRPTPRSAALLQGDAFRRILREAAQRYDMVVVDTPP
A0A2V7H298      --------ATRYKN----LSFISCGLRSHAGPALLSSVAMARLLDALRASYEAIIVDSPP
A0A2V7N2D0      --------TTPYPR----LSFIGCGPRTPLGPELLGSGEMARLFASLRPRFEVILVDSPP
A0A5Q4DA46      --------STEHDT----MWVIPSGSRLRDGPELLGTDRMIELLDDVRGRFDVILIDSPP
A0A848X7K9      --------KSEHDN----LDFIGCGPRGASTPELLASRRMAEFIGTLKQHYDVIIVDCPP
A0A838NSD4      --------LTTVTG----LYLLTSGGLPPNPSELLGGDKMRRALASLGEAYDLVVIDTPP
A0A7Y2HRX9      --------KTEYPN----LHVLGSGTRLARAPELLTGAQMQRMLGRLRSHYEVIIVDTPP
A0A7Y2ZG71      --------KTEYPN----LHVLGSGTRLARAPELLTGAQMQRLLGRLRSHYEVIIVDTPP
A0A7Y2JRQ8      --------PTTHRG----LTILPCGTRRHRGPEMLGSPPMTDLMAEVKSRFNAIVVDSPP
A0A849GUH2      --------NTDNPK----LHFIAFGSKTSTSPELLTSSGMQSLLAGLKRRYEVIILDSPP
A0A2V7ILF0      --------ATAFPR----VSFVPCGTRRFSGPELLGSPAMRALLANLRGRFDAVLVDSPP
A0A2V7NMY2      --------TTPYKC----LSFIGCGSRMHNSPELLSAATMVDLLAALRSRYDVVLVDTAP
A0A848XNR9      --------DTHQPG----LQIIASGSRQNNSPELLGSEVTAKLLAEMRTRYQVIIFDSPP
A0A7Y3MWW4      --------DTHQAG----LQIISSGSRHNNSPELLGSEVTAKLLAEMRTRYQVIIFDSPP
A0A848XTP5      --------DTHQAG----LQIISSGSRHNNSPELLGSEVTAKLLAEMRTRYQVIIFDSPP
A0A7V9PGU7      --------PASHRN----LTLIPCGTRHHHAPELLGSNAMRALLADVKTQYTAIIVDSPP
A0A651HVY0      --------GTRHPA----LSVIPYGSVVQNAPEFMVSGRMQDLLARLKADFDVILVDSPP
A0A7W0WKA3      --------SIKVGDHGGMLHFLTTGAIPSNPSALLESPGFSTLLGRLKEEYDTIILDCPP
A0A2V7SCT4      --------PTSYPW----LYLIGCGTRTNRAPELLGSAAMGQLVAALRQEYDVILIDSPP
A0A7W1PM85      --------ETPVSR----LSVLTCGALPVNASNLLSGTRMRVLLGELQEQFDIIVLDTPP
A0A2V7RBS9      --------TLKFGS----LQFIGGGSRIRESPELLGSPRMVELLVRLRAMYPVIIVDSPP
A0A2V7Q893      --------PSAYGT----LSFLGCGSRTHDGPALVSSAALPRALAGLRSSYDVIIVDSSP
A0A2V7QPQ4      --------ATAYPS----LWFIGCGARSQQGPERLTSAPMVRLLADLRPAFDVILVDSPP
A0A2V7MB00      --------NTPHER----LSFIGAGSRMHRGPELLCSDAMPRLLATFRSSYDVILVDSAP
A0A2V7T7Z8      --------RTRQGG----LWFIGCGTRTRAAPTLVGSGALPRALARLRPNYDAIIIDSSP
A0A2V7PL95      --------QTTYRT----LSFIASGTRTHGGPALINSAALPRLLAELRPYHDAIIVDSSP
A0A2V7R2W8      --------ATPYKN----LSFISCGLRSQAGPALLSSATMARLLDGVRTSYDAVVVDSPP
A0A7Y5K3R5      --------ATTYPN----LAVIPSGTRLHEGPELLSSAKLPALITALGARYEIIVVDTPP
A0A843T0L2      --------DTTVPG----LKIVTAGTLPPNPVELLGGKRMQEVLEELGRDFDMVLLDTPP
A0A6J4N058      --------TTAVPN----LWVLPSGSLPPNPSELLGGGAMDELLAVLEQGYDMVLIDTAP
A0A1G0LV28      --------PNVIPK----LDVLPAGALPPNPSELLGSEAMRRLMEQLRTHYDIIIFDSPP
A0A1Q7E008      --------QTDHAK----LWFVGSGTRKQDVPELLASPAMARFLVSARADYQVILVDSPP
A0A7V8VQ50      --------STASPS----LDLIACGTRMQDGPELLGTAAMSQMLVELRSRYEVILVDSPP
A0A2V7L8K7      --------TTSHPC----LDFIASGTRRRDAPELMGSPAMADLVTTLRSTYDVIVLDTAP
A0A2V7JCT0      --------TTSHPC----LDFIASGTRRRDAPELLGSAAMTDLVTSLRSTYEVIVVDTAP
A0A534A8D8      --------TTSHPC----LDFIASGTRRRDAPELLGSAAMTDLVTSLRSTYEVIVVDTAP
A0A1Q7DXW6      --------RTEHRQ----LWFIGAGSRMHRGPELLCSAGVPRLITAMRGGYDVILVDSAP
A0A2V7JF48      --------TTSHPC----LDFIASGTRRRDAPELMGSPAMADLVTTLRSTYDVIVLDTAP
A0A534A9Q9      --------TTSHPC----LDFIASGTRRRDAPELMGSPAMADLVTTLRSTYDVIVLDTAP
A0A2V7J5T6      --------ETPYPR----LSIIGCGTRTQRAPEVLGSPAMADLFTELREQYDVIVVDSPP
A0A2V7EJU4      --------PTDHAT----LWFIGSGSRKQDAPELLGAPTMAQLLASARASYQVILIDSSP
A0A7X5WBX7      --------ETNAPG----LHVIPRGTYQPDHGHALAPGRVLSILGELSSLYDSILLDTAP
A0A2V7KN28      --------RTAYPR----LAFIGCGTRTQRAPEVLGSPAMAQLIAELRGQHDVILIDSPP
A0A257SFA4      --------ATGMPG----LDLITSGTRMDDGPELLAGPAMRSLVGDLRARFDVVVFDSPP
A0A2V7K2H8      --------GTPYPD----LQFIGAGTRFRDSPELLGSGAMSELLARLRASWSVILVDSPP
A0A2V7EK09      --------ATPYPA----FSLIGCGVRAYNGPELLGSAAMSQLLTTLRSSYDVILIDSPP
A0A2V7QD43      --------ATQFPA----LSLIGCGTRAYNAPELLGSPAMTSLVNGLRGSYDVVLIDSPP
A0A2V7HL73      --------PDL--N----LTILPAGRLPRAPFEVLKSPRVEELLAEARRRYDYIVLDTPP
A0A800FAC6      --------PNVLPN----LDFLPSGPFPPNPSELLNTKTMVRLIEEFEGRYDQVIIDSPP
                                  . .   *         :        .         ::.* .*

A0A838QE65      LLAASDAAILATIADGVIVVLRAGATESAAAQQAMQQLNAVGARIVGAVLND----PDAQ
A0A1Q6ZF81      LAAGVDSFIIGTVTGSLLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPRG
A0A524QR19      MAAGSDAYILGAHAGSVLTVLRSGTTNKDMAAAQMESFLRLPVRLLGAVLND----FTPQ
A0A1V4RFS5      AAVVTDAVVIAPAVDSVILVVRSGKIQKKVVQGVWQKLLRSGGHLSGAVING----FD--
A0A848XMZ8      INLLTDGLVVASKADGVIVVTREGATSREDLAIALQRLERARAHVLGVVINGSK--LP--
A0A7W0GXF9      VLATADAGIVGSLTDGVLLVVRAGTTDRNAAQRAYQQLANVGARVVGTVLND--------
A0A7Y5K1X2      LLAVTDAAVLSTMVDGAILVVRMGTTSREAVRRAAAHLRAVHSRVLGAVLNDID--VT--
A0A838H971      LNIVSDAALFAARADVVLVVVRAGHTDREALDTTLGRLARVGARTVGIVLND----VK--
A0A2V7NW82      LGSGVDPLTLGTLTGSLLLVLRAGASNLDLTRTKLALLELLPIRLLGVVLND----VP--
A0A2V7IEC4      LAAGVDPLILGTLTGTLVLVLRTGYSHRDVAAAKLEVLQRLPVRLLGAILND----VP--
A0A1Q6WKV1      LAGGVDPFILGTLTGSLLLVLRTGHSHRDMAAAKLEMLHRLPVRLLGAVLND----VP--
A0A2V7N4E0      LGGGVDPLILGTLTGNLLLVLRTGCSDRDVMAAKLEVLGRLPIRVLGAVLND----VP--
A0A2V7Q431      LGAGVDAYALGAVTGNVVLVLRLGTTDRETTEAKLDLLDRLPVRLLGTVLND----VP--
A0A7V9Q9B6      LGAGVDAFGLGTLTRNLLLVLRTGTTDRALTTAKLGMVDRLPIRLLGAVLNG----TP--
A0A2N1WA66      LGAGIDPFLLGTLTGHLMLVVRAGETNREFTEAKLQIIDQLPIRLVGAVLND----IR--
A0A7W0W3K6      LTVVTDAAVLGTLADSTVLVARAGTTDKRALHHAAAQLYHLRVHVSGTIVND----FD--
A0A2V7HBX4      LVAGMDAYALGAAAGSMLIVLRPAVTDRKLASAKLEVLDRLPIRILGAVLNA----VP--
A0A7V9B8V3      LGAGIDPFVLGTVTGQLMLVVRAGETDRMFAEAKLQVVDQLPIRLVGAVLND----VQ--
A0A2V7SVD5      LSAGENT----------LMILRHSKTDMRMAKTKLALLRRLPLRTVGVVLND----VK--
A0A838W0N8      LGAGVDPFILSTLTGHTMLVLRNGRTDREFARTKLEMLDRLPIRLLGAVLND----VP--
A0A143BIC3      LGAGFDAYALATATGNMALVMRAGVTDRKMAAAKMQVVDTLPVRVMGAVLNG----IK--
A0A1Q7JIY3      LGAGVDPFILGTVTGNVLLVLRTGYSHRDAAGAKLEVLNRLPVRTLGAVLND----VP--
A0A0S7Z9Q9      LASGGDPLILGSLTGNLAVVIRTGATEKALAQAKIDQLSRLPIRILGAILND----VS--
A0A2V7GP46      LGAGIDPFVLGTLTGNLLLVLRTGVSHREVMAAKLEVLRRLPVRLLGAVLND----VP--
A0A7Y3I9U8      LNVLSDAMPVAAAVDGVLLVVRGGRTERDGLEMALHRLERAGAHVVGVVLND----SE--
A0A2V7H298      LAAGADGLALATVTGSLVLVLRTGVSDRELTETKLGALHHLPVRVLGAVLND----VR--
A0A2V7N2D0      LSVGVDPYILGTLTGNLLLVLRSGVTDRELAATKLDALDRLPIRLLGAVLND----IR--
A0A5Q4DA46      LGAAVDPYLLGTLSGSIMLVFRNGTTNQDVAVSRIEELKRLPVQIVGAVLND----VP--
A0A848X7K9      LAAGGDALILGTLTGNLAVVIRTGSTEKYLTQAKLAPIHRLPIRLLGAVLND----VD--
A0A838NSD4      LLAASDAAILATLADGVVLVLRAGQTENAAAQQAMQQLNAVGARVIGAVLND----PD--
A0A7Y2HRX9      MAAGADAFQIGLLTGAMAIVFRAGASDKALVEAKLRSLGDVPLRILGGILND----LS--
A0A7Y2ZG71      MAAGADAFQIGLLTGAMAIVFRAGASDKALVEAKLRSLGDVPLRILGGILND----LS--
A0A7Y2JRQ8      LGAGIDPFVLGTATGHMLLVLRSGETDRQMAEAKLRLMDRLPIRMLGAVLND----IE--
A0A849GUH2      MAAGSDAYVLGAHAGSVLTVLRSGTTNKDMASVQMESFLRLPVRLLGAVLND----FT--
A0A2V7ILF0      LDAGVDAYLLGTLTANLLLVLRTGVTDRELAAAKLGVLDRLPVRVLGAVLND----VE--
A0A2V7NMY2      LAAGADPYTMASLTTNLLMVLRAGVTDLELAQAKLESFEDLPVRVVGTVLND----VQ--
A0A848XNR9      LGAGSDALLLGAMTGALAVVLRSNQTNKEMAIRKLEQLSRLPVRVLGAILND----VA--
A0A7Y3MWW4      LGAGSDALLLGAMTGALAIVLRSNQTNKQMAVRKLEQLSKLPVRVLGAILND----VA--
A0A848XTP5      LGAGSDALLLGAMTGALAIVLRSNQTNKQMAVRKLEQLSKLPVRVLGAILND----VA--
A0A7V9PGU7      LGAGIDPFVLGTATGNIMLVLRSGETDRQMAEAKLKLLDRLPVRILGAVLND----IS--
A0A651HVY0      LGAASDPLILGTLTGSMLLVLRNGATNTDQAAAILQNLHRYPIRVVGAVLND----VP--
A0A7W0WKA3      VNIISDASVLGLNADTVLIVARSGVTGSAALSDAVDQLTRVGVPLLGVVLND----ID--
A0A2V7SCT4      LGAGVDPFILGTVTGNVLLVLRTGYSHRDAAGAKLEVLNRLPVRTLGAVLND----VP--
A0A7W1PM85      VLATADASIVASLTDGVLLVVRAGTTDRNAAQRAYQQLANVGARVVGTVLND----PG--
A0A2V7RBS9      LGAGVDPYTLGTMTGAMMLVLRTGATNLDLARTKVAMLENLPIRVVGAVLND----VR--
A0A2V7Q893      LAAGTDAFALGTATGTLLLVLRTGVSDGGLAQAKLQVMNHLPIRVLGAVLND----VR--
A0A2V7QPQ4      LAAGADAFALGTMTGAMLLVLRTGFSDREQAEAKLDVLARLPIRVLGAVLND----VR--
A0A2V7MB00      LAAGVDPYALGAATGNVLLVLRTGVTDRGLAEAKVEMLHRLPLRVLGAIMND----VR--
A0A2V7T7Z8      LAAGADALALGTAAGSLLLVLRTGVSDGALARVKLYDIRRLPIRVLGAVVNG----VR--
A0A2V7PL95      LSAGADAFALGTAAGSMVLVLRTGVSDRALMQTKLGVLDHLPIRVLGAVLNG----VV--
A0A2V7R2W8      LAAGADGLALATVTGSLVLVLRAGVSDRELTETKLGVLTHLPVRVLGAVLND----VR--
A0A7Y5K3R5      VGAGADAGCLASATRNALLVLRAGKTDRKAAKTRLAQFQRLPIHLLGVVLNA----IR--
A0A843T0L2      LLVAADSLVVSRGADGVLLVVRAGFTDRDQAQFALQQLHAVDARVVGAVLNDPDSKVE--
A0A6J4N058      LQAASDAAILGTRVDGVVVVVRAGDTDRSMAQRSVHQLRTLGARVIGAVLNDPDALVP--
A0A1G0LV28      TLAVTDATVLGASSDAVILVLRAGETEEIAAQRALEQLRRVQARVAGSVLNG----VE--
A0A1Q7E008      LGAGVDPFVLGTFTGSLVLVLRSGTTNRELAQAKLDVLDRLPVRVLGAVLND----VE--
A0A7V8VQ50      LGAGVDPFALGTLTGNLLLVLRSGSTDRTLAEAKLDLMDRLPVRILGAVLND----VE--
A0A2V7L8K7      LGAGVDALVLAKLAGNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLND----VR--
A0A2V7JCT0      LGAGVDALVLAKLARNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLND----VR--
A0A534A8D8      LGAGVDALVLAKLARNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLND----VR--
A0A1Q7DXW6      LAAGVDPYALGTVTGSMLLVLRTGVSDRAIAEAKVAVLQRLPIRVLGAVLND----VP--
A0A2V7JF48      LGAGVDALVLAKLAGNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLND----VR--
A0A534A9Q9      LGAGVDALVLAKLAGNLLMVLRLGRTDRVLAEAKLEILRRLPLRLLGAVLND----VR--
A0A2V7J5T6      LTAGVDPFVLGTVTGALLVVLRTGKSHRGITGAKLEVLERLPIRLLGAVLND----VPRG
A0A2V7EJU4      LGAGVDPFLLGTLTGSLLIVLRSGTTDRELAHANLDVLGRLPIRVLGAVLND----VEPR
A0A7X5WBX7      VLTVAEARIFAACAPAVLLVVRAGRTDRELVLRALQELESVGARVIGTVLNDSNAEIRET
A0A2V7KN28      LTAGVDPFILGTVTGSLLLVLRTGHSHRDITGAKLEVLDRLPIRLLGAVLND----VPRG
A0A257SFA4      LSAGIDPFVLASLSANMLLVIRTGLSVRELTYTKLEALNRLPIRLLGAVLND----VP--
A0A2V7K2H8      LGSGVDPYTLGTLTSNMLLVLRTDATDLSLARTKLSVLDHLPIRLLGVVVND----VR--
A0A2V7EK09      LAAGVDPLILGMLTQSLALVLRTGYSRREVAASKLEALQRLPLRLLGAILND----VP--
A0A2V7QD43      LAAGVDPLILSTLTGTLALVLRTGYSHRDVAAAKLEVLQRLPVRMLGAVLND----VP--
A0A2V7HL73      LVSFPDCRVIEKCVDGFLIAVAAHKTSRKLLEEALNVTER--AKIVGFVFNG----DDRH
A0A800FAC6      VLAVTDAAILAGHTDGVVMVLRSGETEQRAAERSVAQLRRLGVRVFGAVLNA----VSAA
                     :                                        * :.*         

A0A838QE65      VPR-YGAYYRY-----------DYAGSGR-------------------------------
A0A1Q6ZF81      AAYGYYAYYSY-----------YLPGYEAV--EESSGQASAPRVV---------------
A0A524QR19      LGQGYYRYYSH-----------YLPGYEAS--EEKEEEVG---VV---------------
A0A1V4RFS5      -PIRTYTSYTY-----------YTYKYQYY--YEEQSE----------------------
A0A848XMZ8      -GHTRSYYYPS-----------VYAH----------------------------------
A0A7W0GXF9      -PGGELAKEGD-----------YYYPYDYA--AQEQ------------------------
A0A7Y5K1X2      -TGGYYGGYGY-----------YYYAYQSH--EGDRDGRATPTTRDRVRKLMGLGHGDRG
A0A838H971      -SAATYGVYPY-----------GALETEAA--S---------------------------
A0A2V7NW82      -AAGAYRYYS------------YLSGYEAA--DEPE------------SVAVQRVRALL-
A0A2V7IEC4      -AGGAYRYYSY-----------YLPGYEAA--DEDS--------------GSRR---VPV
A0A1Q6WKV1      -AEAGYRYYSY-----------YLPGYEAT--DEYP--------------AGRK---LVV
A0A2V7N4E0      -PGAAYRYYSY-----------YLPGYEAV--DEDT--------------GRNKRQPLVI
A0A2V7Q431      -EHSAYAPYSY-----------YMEGYAYE--AERG--------REPRTLTGGRSRS---
A0A7V9Q9B6      -ADSTAYRYYS-----------YLPGYTVE--PEEEAAAAEAEVEETRQLEDGKVSEAGV
A0A2N1WA66      -TSMNEYSYYA-----------YSSGYAAT--DEAERTEARARPVVPTIPAEVGTRD---
A0A7W0W3K6      -PKQSGYGYEYGYG--------YAPGYSKY--GGAAYGHTP-------------------
A0A2V7HBX4      -DGGAYRY--------------YGADYSYK--DEVLKEPIADIATPKGLLVRS-------
A0A7V9B8V3      -TSLDEYKYYS-----------YSEGYGAV--DEIELTGGKKMIPTRAGEETATEEVER-
A0A2V7SVD5      -AMGDYKYYG------------YDTAYRAL--PEERAVATV-------------------
A0A838W0N8      -ASSSYRSYG------------YLPGYEAE--NEVEAGDEPMQLERV-------------
A0A143BIC3      -MTGAYQYYS------------YYQDYAAT--DEEPVARITDGTRGDGEMKQGGRS----
A0A1Q7JIY3      -RGAAYGYYSYYSY--------YLPGYEAV--DEDDSLEAHSRPRVV-------------
A0A0S7Z9Q9      -AHDTYHSYYAS----------YLPSYEPV--PEEGDEVPTQILSGPSDRELDLEEEGAR
A0A2V7GP46      -PGAAYQYYSY-----------YTPGYEAT--DEKPARLTPSVG----------------
A0A7Y3I9U8      -TPKRYGV--------------YNTAYALQ--P---------------------------
A0A2V7H298      -PGGAYRYYSY-----------YLEGYEVH--DE------PAAAEVHVLRGPER------
A0A2V7N2D0      -QDGAYRCYSY-----------FPEGYELR--EE-----ESAGQRKRILTAAQ-------
A0A5Q4DA46      -AGSAAYKSYA-----------YLPGYGVA--DEEPETREAPEGRRLVARAEA-------
A0A848X7K9      -PSDGYHQYYSS----------YLPGYEAGMVDEEEGALLSDGRG---------------
A0A838NSD4      -TK-VPQYGAY-----------YRYDYAGA--TE--------------------------
A0A7Y2HRX9      -SKMVKSYGYYSSY--------YLPGYEAE--DEQYAEDEEDTKALPAASAGAAD-----
A0A7Y2ZG71      -SKMVKSYGYYSSY--------YLPGYEAE--DEQYAEDEEDTKALPAASAGAAD-----
A0A7Y2JRQ8      -TRSGTYRYYS-----------YVYGYTAD--DEVVGQLPVGHGNGRDEGMDHDS-----
A0A849GUH2      -PQIGQGYYRYYSH--------YLPGYEAS--EEEEEVGAVQD-----------------
A0A2V7ILF0      -PRGAYRYYSY-----------SLEGYELK--EEQDPDDEGAAARVLVRSPK--------
A0A2V7NMY2      -PKGAYRYYAY-----------YVPGYETK--EEADLGPEKPVLGVPSV-----------
A0A848XNR9      -RTELERRHSY-----------YLAGYATS--EEDALVRTDSSIEEESPYELEHTR----
A0A7Y3MWW4      -RNELERRHGY-----------YLAGYGTS--EEDALLRPGSSTEEESPYTLEHAQ----
A0A848XTP5      -RNELERRHGY-----------YLAGYGTS--EEDALLRPGSSTEEESPYTLEHAQ----
A0A7V9PGU7      -ATDTAYKYYR-----------YVYGYTAD--EEPAAQLAGGPPEVGEVGEHG-------
A0A651HVY0      -SRGEYRYYGYTSG--------YEVGAGAR--AD-----KKDRKGSRLVGAGR-------
A0A7W0WKA3      -FKRDAVYDSSYRS--------YNASYEVS--ASEQTQ----------------------
A0A2V7SCT4      -RGAAYGYYSYYSY--------YLPGYEAV--DE------DDSLEAHSRPRVV-------
A0A7W1PM85      -GEVAKEGDYY-----------YPYDYAAQ--DQ--------------------------
A0A2V7RBS9      -LGQMYGEYYG-----------YMAGYGTT--TE----DGGTRIARRRLQGAL-------
A0A2V7Q893      -RDRLYRNYSY-----------YLEGYEAQ--DE------PDGARGQVLRAPV-------
A0A2V7QPQ4      -LGGEYRYYSY-----------YMAGYEAE--DE-----HPAWDDRPVLQPSD-------
A0A2V7MB00      -PGTAYSYYSY-----------SLEGYEVW--EE-----DPEGKVSKMLLSEESKPTGAG
A0A2V7T7Z8      -LRRGSSQDAY-----------YLEGYEAK--DE------PESVGGPVVGASG-------
A0A2V7PL95      -PGGVYRYYSY-----------YLEGYEAK--DE------PAGAAGQVLRAPE-------
A0A2V7R2W8      -PGGAYRYYSY-----------YLEGYEAH--DE------PDAAQARVLRGPVEEPVTR-
A0A7Y5K3R5      -AEGSFASYSYLPEYAVYAPRPYAEGAPVE--EERPLAVSRDGAPAAAAEGSSSRPSRRV
A0A843T0L2      -RHGGHYYADY-----------YKA-----------------------------------
A0A6J4N058      -SYGGYGGYGY-----------GY-GYGYG--HEKK------------------------
A0A1G0LV28      -KDRD-RYYNY-----------YY--YKHH--DDGERRDGPFATLRKRLLGVG-------
A0A1Q7E008      -PHGVYRYYTY------------LSGYAAE--DEP--RRTEGWALARRPRGAS-------
A0A7V8VQ50      -PRGVYRYYAY------------LAGYEAH--DE---RGVEPEEESKQLQGV--------
A0A2V7L8K7      -DESEYRAYAY-----------YMDGYALT--NEPLFRPLAGSKQGASSRPTR-------
A0A2V7JCT0      -DESEYRAYAY-----------YMDGYALT--NEPLFRPLAGNKQGVGSRPAR-------
A0A534A8D8      -DESEYRAYAY-----------YMDGYALT--NEPLFRPLAGNKQGVGSRPAR-------
A0A1Q7DXW6      -PGTAYSYYGY-----------SLAGYEMK--EED-----PGGAAGEILLPERS------
A0A2V7JF48      -DESEYRAYAY-----------YMDGYALT--NEPLFRPLAGSKQGASSRPTR-------
A0A534A9Q9      -DESEYRAYAY-----------YMDGYALT--NEPLFRPLAGSKQGASSRPTR-------
A0A2V7J5T6      AAYGYYAYYSY-----------YLPGYEAV--EEAGTSGSQVV-----------------
A0A2V7EJU4      GAYRYYS---------------YLSGYAAE--DEASAPPQRWAVARRLPGASSPSA----
A0A7X5WBX7      GAYG-YA---------------YMTSR---------------------------------
A0A2V7KN28      AAYGYYAYYSY-----------YLPGYEAV--EETDGRRTSSPQVV--------------
A0A257SFA4      -DTAPFAYYSN-----------YLPGYEAE--AEHRDASATRATAAEAR-----------
A0A2V7K2H8      -PGGVYRYYSY-----------F-AGYGTR--DEGVAIATHRVRGVL-------------
A0A2V7EK09      -PRGGYPYYSY-----------YLPGYEAV--DEESGRRSGPTGRPLVA-----------
A0A2V7QD43      -AGGAYRYYSY-----------YLPGYEAM--DENSGSPRVPV-----------------
A0A2V7HL73      LSRDSYGT--------------YASTRSVD--LGGGGWRRLVSSSSRTHRRQTASDH---
A0A800FAC6      SPDESYYLQYY-----------YSYTPAGT--EAQSGWQKLRAGMSMVKFFQ--------
                                                                            

A0A838QE65      ------
A0A1Q6ZF81      ------
A0A524QR19      ------
A0A1V4RFS5      ------
A0A848XMZ8      ------
A0A7W0GXF9      ------
A0A7Y5K1X2      ------
A0A838H971      ------
A0A2V7NW82      ------
A0A2V7IEC4      ------
A0A1Q6WKV1      ------
A0A2V7N4E0      ------
A0A2V7Q431      ------
A0A7V9Q9B6      ------
A0A2N1WA66      ------
A0A7W0W3K6      ------
A0A2V7HBX4      ------
A0A7V9B8V3      ------
A0A2V7SVD5      ------
A0A838W0N8      ------
A0A143BIC3      ------
A0A1Q7JIY3      ------
A0A0S7Z9Q9      KG----
A0A2V7GP46      ------
A0A7Y3I9U8      ------
A0A2V7H298      ------
A0A2V7N2D0      ------
A0A5Q4DA46      ------
A0A848X7K9      ------
A0A838NSD4      ------
A0A7Y2HRX9      ------
A0A7Y2ZG71      ------
A0A7Y2JRQ8      ------
A0A849GUH2      ------
A0A2V7ILF0      ------
A0A2V7NMY2      ------
A0A848XNR9      ------
A0A7Y3MWW4      ------
A0A848XTP5      ------
A0A7V9PGU7      ------
A0A651HVY0      ------
A0A7W0WKA3      ------
A0A2V7SCT4      ------
A0A7W1PM85      ------
A0A2V7RBS9      ------
A0A2V7Q893      ------
A0A2V7QPQ4      ------
A0A2V7MB00      IP----
A0A2V7T7Z8      ------
A0A2V7PL95      ------
A0A2V7R2W8      ------
A0A7Y5K3R5      RPENHW
A0A843T0L2      ------
A0A6J4N058      ------
A0A1G0LV28      ------
A0A1Q7E008      ------
A0A7V8VQ50      ------
A0A2V7L8K7      ------
A0A2V7JCT0      ------
A0A534A8D8      ------
A0A1Q7DXW6      ------
A0A2V7JF48      ------
A0A534A9Q9      ------
A0A2V7J5T6      ------
A0A2V7EJU4      ------
A0A7X5WBX7      ------
A0A2V7KN28      ------
A0A257SFA4      ------
A0A2V7K2H8      ------
A0A2V7EK09      ------
A0A2V7QD43      ------
A0A2V7HL73      ------
A0A800FAC6      ------
                      

© 1998-2022Legal notice