BYKdb

Dataset for cluster tad of phylum firmicutes

[Download (right click)] [Edit] [Sequences] [Repertoires]

460 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


G9RSY8      --------------------------MKEEYETI---DLLEILRLLKKNLLVILAVTILL
C4Z673      ---------------------MQEKSKETENIEI---DLREIFGVLIHRLWIIVVAALVC
C6CW36      ------------------------------------MEIKQYFRIVLKKWWLILILVLLA
A8SQS9      -MNSNRVETTERDTGTQPSALSAYKAAEGEENEI---DLLDMGMALLEKLPYIILCFLVG
D5HFS3      -MNSNKKMAAVQDETTQIAAVNTYKNTEDDENEI---DLLDMGMALLEKLPYIILCFLIG
G0LYN8      ----------------------------MMDQTV---SFGFFIRLVRKYWLTIVSFTVAG
F6ITB3      ----------------------------MMDQAV---SFDFFIRLVRKYWRAIIGFTVAG
G0M1Y0      ----------------------------MMDQAV---SFDFFIRLVRKYWRAIIGFTVAG
D7VC12      ----------------------------MMDQAV---SFDFFIRLIRKYWRAIVSFTLVG
F9UMZ5      ----------------------------MMDQAV---SFDFFIRLVRKYWRAIVSFTVVG
B9Y883      -------------------------MYENDEIEI---DLSRVFEIIKKYFKPFALIILAA
H7F1R6      -----------------------------MEETM---NVKRLWGLLKKNKWLIFMSTCVC
H7F570      -----------------------------MEDNL---NVKQLRNLVKKNKWILLACVSIS
A5Z5P8      ---------------MKQQVEKIKINEKEDEVEI---NLLDLFNYYRKKILFIIAGFLIG
C6LCS6      ---------------------MEENTSYTNEIEF---DLKAIFTAVRDRIFLLILVAAAG
A7VF43      MSTENKRVSESDTAKEEKNNYIRVVQAEEDDKEI---DLVDLGYALMDKLHFIVLSFLLG
C6CSC7      -----------------------------MSEEL---DLREYFLIVRKRLLLIVIFVLVC
C6CS79      -----------------------------MSSQL---DLKEIVWLIRKKLWLVVLVTVLG
F5LM70      -----------------------------MSIDF---EIKRYLAVLRKRLWLILLIVAAG
H6LKR9      ---------------------------MNKTGEV---DLKELFRIVLKKWWLIILLTIVG
F5LE49      -------------------------------MES---GLNQYIQILRKRIWLIIITVFVV
F3AHH1      ---------------------MEMNQPKDNEIQI---NVREIFFALLSKMGVILLSGVLL
H1LCW2      -----------------------------MENYL---DLRQILGIIRKHIIFIMISFILC
I5AV00      -----------------------MDNRKNAQIEI---DLGAIMHLLFTKLPVIVITSAIF
H6NE44      ------------------------------------MEVKHYLQILRRYIWLILGVTLIT
F4BS20      -----------------------------MMNTI---GMVDIFKMLKKRWWVIVLLSLIG
E0RZL4      ---------------------------MNNRDDVLEINLGELFAVLMGRAFLIISAGIFF
C0CK72      ----------------------METEHLNDELEI---DLIDLLLYLKRKIWLLLLGLLAG
D9S1J8      -----------------------MEEINIYEEEI---SLREIISVLKKRLRLITVVVAIC
C2EFR7      -----------------------MDNIKKEYREL---DLFEIFQMLLRHWWIILLSGLLC
Q1WTC7      -----------------------MDNIKKEYREL---DLFEIFQMLLRHWWIILLSGLLC
B0P2G1      ----------------------MYELENDDEIEI---DLRELFLALKKKIVWILLTAIVF
D4MW28      ----------------------MYELENDDEIEI---DLRELFLALKKKIVWILLTAIVF
E5VMX9      ----------------------MYELENDDEIEI---DLREMFLALKKKIVWILLTAIVF
F2I6Z8      --------------------------------------MASFFRGLKRQWLFIFLGILLG
E6U7N3      --------------------MNETNEPTSYDQEL---DLGRLLLILKRGWLPILLASFLG
C4Z8M6      ------------MRGYVMEREQDFDN----EIEI---DLKDLFLEIISYWQWIILVTIAT
D4JMC3      ----------------MENNEPIRDQ----EIEI---DLLALFHELVKHWKALVASMVLL
D6E0V3      ----------------MENNEPIRDQ----EIEI---DLLALFHELVKHWKALVASMVLL
E3GPC7      ------------------------------MEEI---SLHDILDMLKENWKFIVILTLCF
A6BIG6      -------------MSQDNNIIVLNQEADEEEISV---NIAELIHVLCSKIHIIVLSAILT
C2CI43      ----------------------------MNEQEI---DLIELSKKLVKHLPMIFLFAIVI
D4RX68      ------------------MMEKLENKNKNDEI-----DLMKILRMLASKWMFIVITAVVL
D4J4T5      ------------------MEKKRNDN---EEMEI---DLLELLMVMKKHLSAILLAGIVG
I5ASF9      ------------MEERAAVIQNLNLQDDGGEMEL---DLVELLYEIRKKIWYVILFALIG
C0C0F9      ----------------MNQNSVANREFENDEINI---DLTELFLAVWSKIHLVILAGIFM
B6W7H3      ----------------------------MDEREI---DLLELAKKLRQHLFSILCLAVIF
C7RGH5      ----------------------------MNEQEI---DLIELSKKIGKHLPMIIIFSIIV
F0GT82      ----------------------------MNEKEIYLIDLVDLIKKVFKHLFLIIILTILF
F3AH93      ------------------MEKKMEEQ------SI---DLIEIFYVLKQKILWILAAGLLF
B0GAL4      ------------------MGKNYDND----EMEI---DLLELFYVLKSKILAILGVGLLF
G1WUK1      ------------------MGKNYDND----EMEI---DLLELFYVLKSKILAILGVGLLF
D4M2S1      ------------------MGKTHDDD----EVEI---DLRELFYALKKRILVILAAILAG
E7GL80      ------------------MEKITHQHLDDDEIVI---DFRELFYEFKRRIWWILLAAVLG
G5F9E3      ------------------MEKITHQHLDDDEIVI---DFRELFYEFKRRIWWILLAAVLG
D4CG07      ------------------MEKNRYEE----NDEI---DLLELFYELKKKLWLIILAAIIG
D4MP31      ------------------MEKNRYEE----NDEI---DLLELFYELKKKLWLIILAAIIG
G5HNC6      ------------------MENKLYEDRDENEIEI---DVMELLYVFKKKAWIIILAAIAG
A8RK86      ------------------MEKRYRED----DMEI---DLLELLFEFKKRAWVIILAAVLG
G5HTB1      ------------------MENNIYEDRNENEIEI---DVLELLFVFKKKAWVIILAALAG
A8RSL0      ------------------MEKTYDDD----EIEI---DLLELLGEFRRKIWIILGTIILF
C5EN02      ------------------MEKTYEDD----EIEI---DLLELLGEFRRKIWIILGVIVLF
G5HG46      ------------------MEKNFDDD----EIEI---DLLELLREFRRRIWIILGVIVLF
E7GL39      ------------------MEKVYQDD----EIEI---DLRELLFEMKKKIWFIIAGLLIG
E7GL56      ------------------MEKMYTEDKE--EIEI---DLRELLFELKKRLWLILVALFLG
G5F9B0      ------------------MEKMYTEDKE--EIEI---DLRELLFELKKRLWLILVALFLG
D3AC81      -----------------------MGTNQDDEIEI---DLKELFYVIKRKLWIILLTGIVG
D3AE79      -----------------------MKDTRDDEIEI---DLLQLFWVMKRRLWIMILAVVVG
D4YF14      -----------------------------MEKEY---ELYDLWLLFKKYFIRILNMTIIG
B1YMM6      -----------------------------MNETI---SLQELFSTLRKSLWRILALTIVA
D4LG05      ----------------------MNQKDMNDEMEI---DLLDLAYMLMDHWHHLLLCLLAG
D4LTH3      ----------------------MNQKEQNEEMEI---DLLDLAYMLLDNWHYLLICLLAG
F3ATF6      -----------------------MEKTHDEEMAI---DLWELISALKKRALIILAACLLG
E0I7B6      ---------------------------------M---ELKEYIQTVMKRKWLIISIVLVA
C9LAS2      --------------------MMENT--REDELEI---DLKQIFYVLKEKILVILAVGLLF
F7K8E8      --------------MENTKGMEKDTVQQTDEIEI---DLWEICLVLIHNLALIISVGIMA
F7K9V0      --------------------MEENTMQQTDEIEI---DLWEICLVLVHNLALIVSVGIMT
F7KL97      --------------------MEENTIRQTDEIEI---DLWEICLVLIHNLALIVSVGIMV
D3FZP5      -----------------------------MEETI---SLRELYETLKKRIIMIITITVLA
C0ZHV9      -----------------------------MNEEL---NLREILLMLLKRWKLILLITSLC
D7WMM9      -----------------------------MKETI---TLQDMLKIVRENFLFIISFTLFA
A8U9F5      -----------------------------MEEEI---SLSELFATLKKRLTLIVSLGLIG
F4BSE0      -----------------------------MEEEI---SLSELFATLKKRLSMVVSLSLIG
E7RDR2      -----------------------------MEETI---SLQDLFKTLKKRAGLIALMTILA
I0JRK5      -----------------------------MEETI---SLKEIFEVLKKRLLLIIGLAAGA
G2TR26      -----------------------------MEDTI---SLKELMQVLRKRLSMIALITLGA
D5DBK2      -----------------------------MEETI---SLRVFFQVLRKRLWLIALITVIA
D5DY80      -----------------------------MEETI---SLRELFAVLRKRLWLIVLITIVA
A7Z9K1      -----------------------------MGEST---SIKEIFAILRKRLLFILIITAAA
I2CB17      -----------------------------MGEST---SIKEIFAILRKRLLFILIITAAA
I2HW54      -----------------------------MGEST---SIKEIFAILRKRLLFILIITAAA
G4P1M8      -----------------------------MGEST---SLKEILSTLTKRILLIMIVTAAA
E0TTZ7      -----------------------------MGEST---SLKEILSTLTKRILLIMIVTAAA
G4EQF2      -----------------------------MGEST---SLKEILSTLTKRILLIMIVTAAA
P96715      -----------------------------MGEST---SLKEILSTLTKRILLIMIVTAAA
I0F9R7      -----------------------------MGEST---SLKEILSTLTKRILLIMIVTAAA
G9QKR5      -----------------------------MEETI---SLRDLMETLKKRLRLIVLITVLA
B5UQ74      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGA
B7HFH2      -----------------------------MEETI---SLKELFHILRKRLGMILIIAFGA
Q72XH7      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGV
C2V4M3      -------------------------MEELMEETI---SLKELFHILRKRLAMILVIAFGA
C2YZB3      -------------------------MEELMEETI---SLKELFHILKKRLAMILVIAFGA
C2P8H2      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGA
C2Y451      -----------------------------MEETI---SLKELFHILRKRLAMILVIAFGA
C3EBC1      -------------------------MEELMEETI---SLKELFHILKKRLAMILVIAFGA
C3H980      -------------------------MEELMEETI---SLKELFHILKKRLAMILVIAFGA
C2PN23      -------------------------MEELMEETI---SLKELFHILKKRLAMILAITLIV
B9IRQ7      -----------------------------MEETI---SLKELFLILKKRLAMILIIAFGA
A0RL71      -----------------MLCANFRKLEELMEETI---SLKELFHILKKRLAMILVIAFGA
C2XJI0      -------------------------MEELMEETI---SLKELFHILKKRLAMILVIAFGA
Q3EV65      -------------------------MEELMEETI---SLKELFHIFKKRLAMILVIAFGA
C2T8T7      -------------------------MEELMEETI---SLKELFHILKKRLAMILVIAFGA
C2RG50      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGA
Q814Y9      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGA
B3ZRD5      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGA
Q6HB08      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGA
C2NQN7      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGA
C3GRR1      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGA
C2ULR7      -------------------------MEELMEETI---SLKELFHILKKRLAMILVIAFGA
C3GBJ9      -------------------------MEELMEETI---SLKELFHILKKRLAMILVIAFGA
C2WVG7      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGA
B7IQS9      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGA
A9VRC4      -----------------------------MEETI---SLKELFYILKKRLAMILVIAFGA
C2MTG4      -------------------------MEELMEETI---SLKELFHILKKRLAMILVIAFGA
B7HXB5      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGV
C2SBU5      -------------------------MEELMEETI---SLKELFHILKKRLAMILVIAFGV
C2SSX9      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGA
G9QCG2      -----------------------------MEETI---SLKELFHILKKRLAMILVIAFGA
Q2BFS6      -----------------------------MEETI---SLKELFQTLRKRLGLILSIAFVA
I3EBB4      -----------------------------MEETI---SLRELFMTLRKRLSLILIVTLMS
A4ITF4      -----------------------------MEETI---SLRELFETLRKRLWLIVLITALA
C5D962      -----------------------------MEETI---SLRELFETLRKRLMLIVLITALA
G8MZ94      -----------------------------MEETI---SLRELFDTLRKRLWLIVLITALA
Q5KUM4      -----------------------------MEETI---SLRELFDTLRKRLWLIVLITALA
D4YHG8      ---------------------MLEEDEMNDTQEI---SLIEILNILTANIWKIISTTVIG
F7V793      ----------MNQENNTFDKQKERRLHSSEQTEI---DLGELFFCFLTRWKVLVLAFVIG
H4GK02      ---------------------------METSNTI---DLRRLVKILRKNLLMLIVWTLGL
F6IR92      ---------------------------MEQIITF---DF--MVKLVRHYWKVLLSLTLLG
G0M0G0      ---------------------------MEQIITF---DF--MVKLVRHYWKVLLSLTLLG
D7VBW5      ---------------------------MEQVITF---DF--IVKLIRQYWKVLLSLMILG
F9UQ55      ---------------------------MEQVITF---DF--IVKLIRQYWKVLLSLMILG
G2KUP2      -------------------------------MSF---SF--LGLIIKRHLKLILSSIVFF
G8PE07      -----------------------MET--EQQISI---GQ--VLSTLRRHIGLIAASTVIV
E0NHP5      -----------------------METAETQQISI---GQ--ILAILRKHIGLIFASTFII
Q03GL9      -----------------------MESVESQQISI---GQ--ILSILRKHIGLIFASTFIV
F3Y921      -----------------------------MEETI---SIQEIIKTIKSHIGFIFVCAILG
G4L593      -----------------------------MEETI---SLSEIFDVLKKYWTTILTSLFAG
E6LD65      -----------------------------MEKTY---TVKQLLDMFKKHIQLILTCMFAG
C9ALZ8      -----------------------------MEETI---SLKEIFETLRKHVITILISMFAG
C9BUG6      -----------------------------MEETI---SLKEIFETLRKHLVIIIISMFAG
Q3XYS7      -----------------------------MEETI---NFKEIFETLRKHLLTIIISMFAG
C9B453      -----------------------------MEETI---SLKEIFGTLRKHLATIIISMFAG
D4RJF5      -----------------------------MEETI---SLKEIFETLRKHLVTIIISMFAG
C8ZXT8      -----------------------------MEETI---SLKEIFDILRKHLAAIFISLFAG
F0EKB8      -----------------------------MEETI---SLKEIFAILRKHLAAIFISMFAG
C9A6V4      -----------------------------MEETI---SLKEIFAILRKHLAAIFISMFAG
C9CHY7      -----------------------------MEETI---SLKEIFAILRKHLAAIFISMFAG
D4JI68      ---------------------MEREQDFDNEIEI---DLKDLFLEIISYWQWIILVTIAT
D6E329      ---------------------MEREQDFDNEIEI---DLKDLFLEIISYWQWIILVTIAT
E6UHY5      ----------------------------MEGKEI---SIQEILGILLSHIRMIIVVTILA
E9SAU2      ----------------------------MEEKEI---SVQEILGILLAHIRLIVIVTVVA
F7K0U2      -----------------MNQNNTNMGMENDEITI---DLMDLFQVVFKKLHLVLLAGIIA
O06029      -------------------------MQETQEQTI---DLRGIFKIIRKRLGLILFSALIV
G8P3D6      -------------------------MQETQEQTI---DLRGIFKIIRKRLGLILFSALIV
A9QSJ3      -------------------------MQETQEQTI---DLRGIFKIIRKRLGLILFSALIV
F9VC43      -------------------------MQETQEQTI---DLRGIFKIIRKRLGLILFSALIV
G6FD41      -------------------------MQETQEQTI---DLRGIFKIIRKRLGLILFSALIV
G9M881      -------------------------MQETQEQTI---DLRGIFKIIRKRLGLILFSALIV
Q3ZK51      -------------------------MQETQEQTI---DLRGIFKIIRKRLGLILFSALIV
Q83VG0      -------------------------MQETQEQTI---DLRVIFKIIRKRLGLILFSALIV
C6LDI9      -MELINNNPGL----------------KNDEIRI---NLIELFYALLHKMKVIIFAVILG
G5F9H3      -------------MEKVYQ--------DDDEIEI---DLRELLFEMKKKIWFIIAGLLIG
C0CZV8      --------------METYMN-------DNEEIEI---DLFELFMELKRKIWVILGVAVLC
G5GFW1      -MNFRKGETAVSTGSSFYIPLEMVNNINEEEIQL---DIFEVLYALKKRFFLLLFSTILG
F8KGP2      ----------------------MNSSQQTANNTI---DLHRLMMLCRKHIKMLIIWTLLA
B3XL22      ----------------------MNSSQQTANNTI---DLHRLMMLCRKHIKMLIIWTLLA
F8DRU3      ----------------------MNSSQQTANNTI---DLHRLMMLCRKHIKMLIIWTLLA
C2EWM2      ------------------------------------------MEICRDHAKLFILWTVIM
D0DSJ3      ------------------------MESEKNTNAI---DLQHLWKLFVQHVRMILIWTVGL
B2GF32      ------------------------MESEKNTNAI---DLQHLWKLFVQHVRMILIWTVGL
C0WW25      ------------------------MESEKNTNAI---DLQHLWKLFVQHVRMILIWTVGL
F0K0J8      ---------------------MSAEQQNNEEVTI---DLRRLFILIKKHIISILIWMIGL
G6F8H0      ---------------------MSAEQQNNEEVTI---DLRRLFILIKKHIISILIWMIGL
F0HVF2      ---------------------MSAEQQNNEEVTI---DLRRLFILIRKHIISILIWMIGL
Q1G8E3      ---------------------MSAEQQNNEEVTI---DLRRLFILIKKHIISILIWMIGL
D6S4X3      ------------------------MEQIHENNTI---DLAQLLKLLRRHIGSLLIWSLGF
Q5FIC6      ----------------------MEQKQEQ-ENTI---DLTQLLRICRKHIWALILWSVGL
E4SMV6      ------------------------MEQKQ-ENTI---DLTQLLRICRKHIWALILWSVGL
F0TGY3      ----------------------MEQKQEQ-ENTI---DLTQLLRICRKHIWALILWSVGL
F2M2M7      ----------------------MEQKQEQ-ENTI---DLTQLLRICRKHIWALILWSVGL
A4ZGZ7      ----------------------MEQEQKQTDNTI---DLTQLLQLCRRHIWALILWSVGL
C2EPK4      ----------------------MEQEQKQTDNTI---DLTQLLQICRRHIWALILWSIGL
C7XKF2      ----------------------MEQEQKQTENTI---DLTQLLQICRRHIWALIIWSVGL
E3R265      ----------------------MEQEQKQTENTI---DLTQLLQICRRHIWALIIWSVGL
D0DJG9      ----------------------MEQEQKQTENTI---DLTQLLQICRRHIWALIIWSVGL
D5GZJ9      ----------------------MEQEQKQTENTI---DLTQLLQICRRHIWALIIWSVGL
A8YX90      ----------------------MEQEQKQTDNTI---DLTQLLQLCRRHIWALILWSVGL
F0NWJ8      ----------------------MEQEQKQTDNTI---DLTQLLQLCRRHIWALILWSVGL
C2JZS0      -----------------------------MNEQI---NLSQLWDVLKKSFIAMILLGLIG
C1J9I2      -----------------------------MNEQI---DLAQLWNVFKRSFLAMIVFGIIG
Q58Z11      -----------------------------MNEQI---DLARLWNVFKHSFIVMILLGLLG
B1MZT2      -----------------------------MNNVL---ELRQLWDIIRKHFFAIFFMALIG
C2KHF2      -----------------------------MNNVL---ELRQLWHIIQKHFFAIIFMAIIG
Q03W94      -----------------------------MNNVL---ELRQLWQIIRKHFFSIVVMAIIG
G2Z8Q4      -----------------------------MEKTL---DIKYIGQFFKKYWYIIVAACVVG
D9ST43      ---------------------------MEEERAL---VLGDFIRIFKKQIKLILLITILS
H7F5T7      -----------------------------MSQKF---NLIEIWTILFRHKWSLIIMGILG
G9WIR0      -----------------------------MDTTI---SYQRLWELFKKNFFLLIISALVL
D3LB11      -----------------------------MDTTI---SYQRLWQLFKKNFFFMLVSALIF
A0NKF7      -----------------------------MDTAI---SYQRLWELFKKNFFFMLFSALFF
Q04DV7      -----------------------------MDTAI---SYQRLWELFKKNFFFMLFSALFF
F6BI63      ----------------------------MSEEEI---DLKEILEILRKRWWLILIITVAA
G2MWC1      ----------------------------MAEEEI---DLREIFLIMRKRAKVIVIITLLA
B0K4N2      ----------------------------MAEEEI---DLREIFLIIRKRTKMIVIITLLA
C7ISF8      ----------------------------MAEEEI---DLREIFLIIRKRTKMIVIITLLA
B0KAR6      ----------------MYTKERIKGGLKIAEEEI---DLREIFLIIRKRTKMIVIITLLA
E8UV30      ----------------MYTKERIKGGLKIAEEEI---DLREIFLIIRKRTKMIVIITLLA
C0GGR6      -----------------------------MEQEI---EIREIVAIVSKRWKAILALFIFA
A4J8V1      -------------------MNDDKIESRDDFEVI---DLRDIWRIIKKGKWILISLPLIA
C8VYQ7      ---------------------------------M---ELRDILGILKKGKWFLIILPIAA
C8W5K3      -------------------------------MEL---EIKDIIRILKKGKLLLLILPFIA
B1BNH4      ----------------------------MEENTI---SLQEIAYALKKRWKLIALITIAA
B1V1Z3      ----------------------------MEENTI---SLQEIAYALKKRWKLIALITIAA
B1R3V2      ----------------------------MEENTI---SLQEIAYALKKRWKLIALITIAA
Q0SVR9      ----------------------------MEENTI---SLQEIAYALKKRWKLIALITIAA
Q8XN47      ----------------------------MEENTI---SLQEIAYALKKRWKLIALITIAA
G7M0Q2      ----------------------------MNEDVI---RVQDLLKTLKKRWKLICIITIIT
G7M565      ----------------------------MNKDVI---KIEDIVNILIKRWKMILGITLIA
A6M2M0      ---------------------------MMNNDII---RIDEIANPIIKRWKMILLVTLVT
G7M1R8      ---------------------MNSEEIIKNEESI---RIEEIIDILMKRWKMIVSITLTA
Q4JZ56      ------------------------MN--NRIVDI---SLFDLLNVLWLRKWIIVFVSFVF
Q7X554      ---------------------------------------------------LVLFIAFYF
Q7X550      ---------------------------------------------------LILFTAFYV
Q7X562      ---------------------------------------------------LVLFTAFYF
Q7X556      ---------------------------------------------------LVLFTAFYV
Q7X552      ---------------------------------------------------LILFTAFYF
Q7X558      ---------------------------------------------------LILFTAFYF
C5NWJ9      ---------------------MDNQE--KDLIQL---DIMLLLRRIWEKKVLIVLVTLLF
F3A498      ---------------------MDNQE--KDLIQL---DIMLLLRRIWEKKILIVLVTLLF
Q9AHD3      ----------------------MMKE--QNTIEI---DVFQLVKSLWKRKLMILIVALVT
Q4K2E2      ----------------------MMKE--QNTMEI---DVIQLLNTLWKRKLIIALVAIVT
Q4K2F8      ----------------------MMKE--QNTMEI---DVFQLLNTLWKRKLIIALVAIVT
Q4K046      ----------------------MMKE--QNTTEI---DVFQLVKTLWKRKLMILLVALVT
Q4K0R8      ----------------------MMKE--QNTIEI---DVFQLLKTLWKRRLMILLVALVT
Q4JYY0      ----------------------MMKE--QNTIEI---DVFQLVKILWKRKLMILLVALVT
Q4JZW8      ----------------------MMKE--QNTIEI---DVFQLFKTLWKRKLMILLVALVT
I0J9C8      ----------------------MMKE--QNMIEI---DVFQLVKTLWKRKLMILIVALVT
Q4K0M4      ----------------------MMKE--QNTIEI---DVFQLFKTLWKRKLMILIVALVT
Q4JZS4      ----------------------MMKE--QNTIEI---DVFQLFKTLWKRKLMILLVALVT
Q4JZK2      ----------------------MMKE--QNMIEI---DVFQLFKTLWKRKLIILIVALVT
Q9AHA5      ----------------------MMKE--QNTIEI---DVFQLFKTLWKRKLMILLVALVT
Q9X9A0      ----------------------MMKE--QNTIEI---DVFQLFKTLWKRKLMILLVALVT
Q4JYK9      ----------------------MMKE--QNMIEI---DVFQLFKILWKRKLMILIVALVT
Q4K006      ----------------------MMKE--QNMIEI---DVFQLFKTLWKRKLMILLVALVT
Q4JZG8      ----------------------MMKE--QNTTEI---DVFQLVKTLWKRKLMILLVALVT
A6YIA7      ----------------------MMKE--QNTIEI---DVFQLFKTLWQRKLMILLVALVT
E5F5C4      ----------------------MMKE--QNTIEI---DVFQLFKTLWQRKLMILLVALVT
Q9AHB8      ----------------------MMKE--QNTIEI---DVFQLFKTLWQRKLMILLVALVT
Q4JZL8      ----------------------MMKE--QNTIEI---DVFQLFKTLWKRKLMILIVALVT
Q4K1B8      ----------------------MMKE--QNTIEI---DVFQLLKTLWKRKLMILIVALVT
Q8VU32      ----------------------MMKE--QNTIEI---DVFQVLKTLWKHKLIILLVALVT
D2ERX9      ----------------------MMKE--QNTIEI---DVFQLFKTLWKRKLIILLVALVT
G6C7Z0      ----------------------MMKE--QNTIEI---DVFQLLKTLWKRKLIILLVALVT
Q4K2A9      ----------------------MMKE--QNTIEI---DVFQLLKTLWKHKLIILLVALVT
D6ZQI7      ----------------------MMKE--QNTIEI---DVFQLLKTLWKHKLIILLVALVT
Q9ZFT9      ----------------------MMKE--QNTIEI---DVFQLLKTLWKHKLIILLVALVT
Q4K255      ----------------------MMKE--QNTIEI---DVFQSLKTLWKHKLIILLVALVT
F9HJP7      ----------------------MNQE--NQMVEI---DIVSLLKIIWQRKFFIVLTALMT
E8JWI4      ----------------------MNQE--NQMIEI---DVLSLLKTIWKRKFLIILTALLT
A8AZR4      ----------------------MNKE--NQLVEI---DVLSLIKTVWKRKFIILLTALVA
D0RXH3      ----------------------MNKE--NQLVEI---DVLSLIKTVWKRKFIILLTALVV
Q83YR6      ----------------------MNKE--NQLVEI---DVLSLIKTVWKRKFIILLTALVA
F1Z125      ---------------------MNNME--KPTMEI---DVLSLLKKLWTKKFLIIFMALFF
Q3K0S9      ---------------------MNKIA--NTEVEI---NIFNLLKKLWKKKFLITFVAIAF
P0C0T8      ---------------------MNKIA--NTEVEI---NIFNLLKKLWKKKFLITFVAIAF
Q67AY5      ---------------------MNKIA--NTEVEI---NIFNLLKKLWKKKFLITFVAIAF
Q04662      ---------------------MNKIA--NTEVEI---NIFNLLKKLWKKKFLITFVAIAF
Q8GP93      ---------------------MNQDN--TKSDEI---DVLALLHKLWTKKLLILFTAFCF
Q8GPF7      ---------------------MNQDN--TKSDEI---DVLALLHKLWTKKLLILFTAFCF
E3CP61      ---------------------MTQEN--TKRVEI---DVLALLHKLWSKKVFILFTAFYV
E8KUY7      ---------------------MTQEN--TKRVEI---DVLALLHKLWSKKVFILFTAFYV
C2LSE5      ---------------------MTQEN--TKRVEI---DVLALLHKLWTKKVFILFTAFYV
E9DM16      ---------------------MTQEN--TKRVEI---DVLALLQKLWTKKVFVLFTAFYV
I0QIK5      ---------------------MTQEN--TKRVEI---DVLALLQKLWTKKVFILFTAFYV
Q7X560      ----------------------------------------------------ILFTAFYV
Q8GMA6      ---------------------MNQDN--TKSDEI---DVLALLHKLWTKKLLILFTAFYF
Q55204      ---------------------MNQDN--TKSDEI---DVLALLHKLWTKKLLILFTAFYF
Q8GPC4      ---------------------MNQDN--TKSVEI---DVLALLQKLWTKKVFILFTAFYV
Q8GPA9      ---------------------MNQDN--TKSDEI---DVLALLHKLWTKKLLILFTAFYF
G6ERT2      ---------------------MNQDNTKTKSVEI---DILALLHKLWTKKLLILFIAFYF
O87930      ---------------------MNQDNTKTKSVEI---DILALLHKLWTKKLLILFIAFYF
Q8GP55      ---------------------MNQDN--TKSDEI---DVLALLHKLWTKKLLILFTAFYF
F8HDC4      ---------------------MNQDN--TKSVEI---DVLALLHKLWTKKLLILFTAFYF
F8LJ76      ---------------------MNQDN--TKSVEI---DVLALLHKLWTKKLLILFTAFYF
F8LXJ5      ---------------------MNQDN--TKSVEI---DVLALLQKLWTKKVFILFTAFYV
Q1WCR2      ---------------------MNQDN--TKSVEI---DVLALLHKLWTKELLILFTAFYF
G3G7C0      ---------------------MNNQE--MNTIEI---DILLLLKTIWRKKFFILLMGLLG
G3G7J8      ---------------------MNNQE--MNTIEI---DILLLLKTIWRKKFFILLMGPLG
G8DU30      ---------------------MNNQE--VNAIEI---DVLFLLKTIWRKKFLILLTAVLT
A4VTU2      ---------------------MNNQE--VNAIEI---DVLFLLKTIWRKKFLILLTAVLT
D5AGQ4      ---------------------MNNQE--VNAIEI---DVLFLLKTIWRKKFLILLTAVLT
Q9X4U6      ---------------------MNNQE--VNAIEI---DVLFLLKTIWRKKFLILLTAVLT
G3G7G5      ---------------------MNNQE--VNAIEI---DVLFLLKTIWRKKFLILLTAVLT
G7SG35      ---------------------MNNQE--SNTIEI---DVLSLLKTIWRKKFFILVTAVLG
G8DU06      ---------------------MNNQE--SNTIEI---DVLSLLKTIWRKKFFILVTAVLG
G8DUA9      ---------------------MNNQE--SNTIEI---DVLSLLKTIWRKKFFILVTAVLG
G8DTY9      ---------------------MNNQE--SNTIEI---DVLSLLKTIWRKKFFILVTAVLG
G3G7I7      ---------------------MNNQE--MNTIEI---DILLLLKTIWRKKFLIIITALFG
G3G7J3      ---------------------MNNQE--MNTIEI---DILLLLKTIWRKKFLIIITALFG
E0PD82      ---------------------MNSND--QASIEI---DVFYLLRKLWSKKFFIIFIALVV
F5X651      ---------------------MNSND--QASIEI---DVFYLLRKLWSKKFFIIFIALVV
G5JTD6      ---------------------MTSAE--NASFEI---DVFALLKKLWNRKFLIIFVALLF
Q2KM75      ---------------------MNTSE--NTSIEI---DILSLLKRIWQKKVVILFVTLLA
G5KAJ3      ---------------------MNNTE--QSSIEI---DVLSLLKKLWNKKFLILFMGLFV
B9DUJ5      ---------------------MNTTE--TPSMEI---DVLSLLKKLWMKKFLILFMALFF
G5KD12      ---------------------MNTNE--TPSIAI---DVLSLLKKLWMKKTLILFMAIFV
E8JMT8      ---------------------MNSND--NASIEI---DVLYLLRKLWSRKFFIIFIALVV
F5X0J8      ---------------------MNSND--NASIEI---DVLYLLRKLWSRKFFIIFIALVV
H2A601      ---------------------MNSND--NASIEI---DVLYLLRKLWSRKFFIIFIALVV
E7S8W2      ---------------------MKNQE--SQEIEL---DVVSLFKTLWRRKFSIIITALLF
F8DFF5      ---------------------MNNQE--NQAVEI---DVFATLKVLWKRKFSIILVALVF
I1ZPH8      ---------------------MNNQE--NQAVEI---DVFATLKVLWKRKFSIILVALVF
E3CBR9      ---------------------MNNKE--NQAVEI---DVFAMLKTLWKRKFSIVLVALVF
E8K787      ---------------------MNNQE--NQAVEI---DVFAMLKTLWKRKFSIVLVALVF
F9M365      ---------------------MNNQE--NQAVEI---DVFAMLKTLWKRKFSIVLVALVF
A3CQY3      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
E8KLZ0      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
F0FHA9      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
F0FQQ4      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
F0I4H6      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
F0IAY2      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
F0IJI1      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
F0IS52      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
F2C9N1      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
F2CH54      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
F3UDW8      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
F3UNJ5      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
F3SM33      ---------------------MEKQE--KQIVEI---DILSLLRALWLKKFTIVLGAVLF
F9HC66      -----------------------MKE--NKEIGI---DVVQLFKILWKKKLAIILTAVVT
E1LQJ6      -----------------------MKE--NKEIMI---DVFQLFKVLWKKKIAIILTAIVA
Q4JYU0      -----------------------MKE--NKEITI---DVFQLFKVLWKKKTSIILTAIVA
Q4JZY2      -----------------------MKE--NKEITI---DVFQLFKVLWKKKTSIILTAIVA
F9Q346      -----------------------MKE--QNMMEI---DVFQLLKILWKRKVLIALVAIVT
Q6L5R1      -----------------------MKE--QNMMEI---DVFQLLKILWKRKVLIALVAIVT
E9FEC6      -----------------------MKE--QNMMEI---DVFHLLKILWKRKFLIALVAFVT
E0Q2S9      -----------------------MKE--QNMMEI---DVFHLLKILWKRKLLIVLVAFVT
F5VSH0      -----------------------MKE--QNMMEI---DVFHLLKILWKRKLLIVLVAFVT
A5YTV6      -----------------------MKE--QNMMEI---DVFHLLKILWKRKLLIVLVAFVT
Q6L5T1      -----------------------MKE--QNMMEI---DVFHLLKILWKRKLLIALVAFVT
E0PPH8      -----------------------MKE--KNVMEI---DVFHLLKILWKRKLLIVLVAFVT
A5YTT8      -----------------------MKE--QNMMEI---DVFHLLKILWKRKLLIALVAFVT
E6KKR9      -----------------------MKE--QNMMEI---DVFHLLKILWKRKLLIALVAFVT
A1ILY0      -----------------------MKE--QNMMEI---DVFHLLKILWKRKLLIALVAFVT
F2QF91      -----------------------MKE--QNMMEI---DVFHLLKILWKRKLLIALVAFVT
Q4K0I3      -----------------------MKE--QNTIEI---DVFQLLKTLWKHKLIILLVALVT
Q8KWQ1      -----------------------MKE--QNTIEI---DVFQLFKTLWKRKLMILIVALVT
Q4K238      -----------------------MKE--QNTIEI---DVFQSLKTLWKYKLIILLVALVT
B1I966      -----------------------MKE--QNTIEI---DVFQLLKTLWKHKLIILLVALVT
G6J8A3      -----------------------MKE--QNTIEI---DVFQLLKTLWKHKLIILLVALVT
F9LZC3      -----------------------MKE--QNTIEI---DVFQLFKTLWKRKLIILLVALVT
F9P1W9      -----------------------MKE--QNTIEI---DVFQLLKTLWKRKLIILLVALVT
A5LJR9      -----------------------MKE--QNTIEI---DVFQLFKTLWQRKLMILLVALVT
Q9ZII7      -----------------------MKE--QNTIEI---DVFQLFKTLWKRKLMILLVALVT
Q4K1K7      -----------------------MEE--QNTLEI---DVLQLFRSLWKRKLVILLVAIIT
E1LPE6      -----------------------MKD--QNTLEI---DVFQLFRALWKRKLVILLVAIIT
F9MJW6      -----------------------MKD--QNTLEI---DVFQLFRTLWKRKLVILLVTIIT
Q4K0V3      -----------------------MKE--QNTLEI---DVLQLFRALWKRKLVILLVAIIT
Q54519      -----------------------MKE--QNTLEI---DVLQLFRALWKRKLVILLVAIIT
C1CBD0      -----------------------MEK--QNTLEI---DVLQLFRSLWKRKLVILLVAIIT
Q7WVX1      -----------------------MEK--QNTLEI---DVLQLFRSLWKRKLVILLVAIIT
Q4K0E2      -----------------------MQD--QNTLEI---DVFQLFRALWKRKLVILLVAIIT
Q9AH96      -----------------------MQD--QNALEI---DVFQLFRALWKRKLVILLVAIIT
A5M4L2      -----------------------MKE--QNTLEI---DVLQLSRALWKRKLVILLVAIIT
B2ILP4      -----------------------MKE--QNTLEI---DVLQLSRALWKRKLVILLVAIIT
C1CCB8      -----------------------MKE--QNTLEI---DVLQLSRALWKRKLVILLVAIIT
P72511      -----------------------MKE--QNTLEI---DVLQLSRALWKRKLVILLVAIIT
Q4K1S8      -----------------------MKE--QNTLEI---DVLQLSRALWKRKLVILLVAIIT
P96474      -----------------------MKE--QNTLEI---DVLQLFRALWKRKLVILLVAIIT
Q4K196      -----------------------MKE--QNTLEI---DGLQLFRALWKRKLVILLVAIIT
Q4K0Z7      -----------------------MKE--QNTLEI---DVLQLFRSLWKRKLVILLVAIIT
Q4JZ85      -----------------------MKE--QNTLEI---DVLQLFRILWKRKLVILLVAIIT
Q4JYH6      -----------------------MKE--QNTLEI---DVLQLFRALWKRKLVILLVAIIT
Q4JZ19      -----------------------MQD--QNTLEI---DVLQLFRALWKRKLVILLVAIIT
Q4K0A1      -----------------------MQD--QNTLEI---DVFQLFRALWKRKLVILLVAIIT
Q4K1M5      -----------------------MKE--HNTLEI---DILQLFRALWKRKLVILLVAIIT
Q4K2Q8      -----------------------MKE--QNTLEI---DVLQLFRALWKRKLVILLVAIIT
Q4K1G0      -----------------------MKE--QNTLEI---DVLQLFRVLWKRKLVILLVAIIT
Q4K0T6      -----------------------MKE--QNTLEI---DVLQLFRTLWKRKLVILLVAIIT
Q4K0K3      -----------------------MKE--QNTLEI---DVLQLFRALWKRKLVILLVAIIT
Q4K0X6      -----------------------MKE--QNTLEI---DVLQLFRALWKRKLVILLVAIIT
E8KDN1      -----------------------MKE--QDKIEI---DVVQVLKVLWKRKLMIALVAIAT
F9PEU3      -----------------------MKE--QEKFEI---DVFQLVKVLWKRKFLIVLAALVA
E8K321      -----------------------MKE--QDKIEI---DVLQLVKVLWKRKFLIALVALLA
F9PZP6      -----------------------MKE--QDKFEI---DVFQLVKVIWKRKFLIVLTAIIA
D6R2T7      ---------------------MEKKE--NQMMEI---DVLSMLRTLWLKKFTIVLGAVVF
F3UUQ1      ---------------------MEKKE--NQMMEI---DVLSMLRTLWLKKFTIVLGAVVF
E6IZC3      ---------------------MKNQD--NQTVEI---DVLSLVKTLWRRKFLIVVTAFVI
G6A746      ---------------------MKNQD--NQTVEI---DVLSLVKSLWRRKFLIVVTAFVM
B1V0N8      ---------------------------MEEKT-L---DIQEILYALKKRYKLIIIIMLLP
B1BNK2      ---------------------------MEEKT-L---DIQEILYALKKRYKLIIIIMLLP
B1R3X7      ---------------------------MEEKT-L---DIQEILYALKKRYKLIIIIMLLP
Q8XN77      ---------------------------MEEKT-L---DIQEILYALKKRYKLIIIIMLLP
B1HR40      ---------------------------MNEEM-----TIQSLVKVWQKRWFFILILMILS
A7Z922      ---------------------------MNENM-----SFKELFDIIKHRFLLIFIMTAVV
I2CAF3      ---------------------------MNENM-----SFKELFDIIKHRLLLIFIMTAVV
I2HVL3      ---------------------------MNENM-----SFKELFDIIKHRLLLIFIMTAVV
E0U2Z4      ---------------------------MNENM-----SFKELYAIVRHRFVLILLLTIGV
D4G1R3      ---------------------------MNENM-----SFKELYAIVRHRFVLILLITIGV
G4EQZ6      ---------------------------MNENM-----SFKELYAIVRHRFVLILLITIGV
P71050      ---------------------------MNENM-----SFKELYAIVRHRFVLILLITIGV
G4P115      ---------------------------MNENM-----SFKELYAIVRHRFVLILLITIGV
A8FHM0      ---------------------------MNENI-----GFKQLFSVIKEKMALLILIVLIV
C0EBA5      ---------------------------MNEGL-----DLKQILRILVKRL-WIIVLCLIV
F8FCE3      ---------------------------------------------------------MIT
I0BSG5      ------------------------------------------------------------
A8YPQ6      ---------------------------MESTL-----ELTKIKEVLQKNLKILIILPLLF
P95695      ---------------------------MESTL-----ELTKIKEVLQKNLKILIILPLLF
Q2G1K8      ---------------------------MESTL-----ELTKIKEVLQKNLKILIILPLLF
C5QNG5      ---------------------------MENTL-----DLMRVWEIIKKNWKLLVIIPLIF
Q4L9H8      ---------------------------MENKL-----DLSNIFKIIKKNWGIWLFIPIIF
Q2FUV1      ---------------------------MKEKF-----DLVKLLNILKKNIKLLLILPAIC
P39850      ---------------------------MESTI-----DLSELLGRVRKNMKLLIILPLLG
D7UYE3      ---------------------------MGDVV-----DLSKVLKVLKQNLKWIVIIPVVF
Q4A121      ---------------------------MEETI-----DLNKLFAILKKNMKYLIILPIVF
C9AAE4      ---------------------------MNKEI-----NMKKLKQVLQQRIGWILMIISIP
H7F6C7      ---------------------------MNEQI-----DLKKMLLAIRKNSWWLIGIIVVT
F0SX23      -------------------------MPTQLYREF---DLWKTLNVLWKKAWIIILGTGLS
Q38VG4      ---------------------------MEQTI-----NIEQIFGILRKYSRLIILSTVIF
F2I4B6      ---------------------------MEEEI-----SLLDLWQIIKEHIYVIFISSLVG
Q8RBS6      --------------------------MMEEEL-----DLREVFLILRKRIKIILLITVLA
D9SR42      ---------------------------------M---ELKEYWYIIKKRLILIISFTLLC
D9SVC8      ---------------------------------M---DLHELLYIIKKRMVLMVSITLVI
E7RG09      ---------------------------MIETI-----SLREIYSILKNKIRLILAITIVI
D4G2E2      -----------------------------------------------------MIVTAAA
Q8EME7      ---------------------------MEETI-----SLKEIFEVIKKRLLLIFTFILVA
D6Y035      ---------------------------MEESI-----SLKEIIDVLKKRLAMIVSITMIA
Q5WBB3      ---------------------------MEETI-----SLKEIFQTLKQRWRLLVAIPFFA
Q9K6Q9      ---------------------------MEETI-----SLKEMFQTIMRRLKLIIALPVLA
Q97EP7      ---------------------------MEQGNDI---DFTGFIDVLNKEKAMIALVTIFF
Q97ER4      ---------------------------MEQENDI---DFTGIFEVLNKEKAMIAAVTIFF
E4S7Y7      ---------------------------------M---EVKEYFLIIRKRIILIITTTILS
E4Q5T6      ---------------------------------M---EIKEYILIIRKRLPLIVATTLIS
E4SDX3      ---------------------------------M---EIKEYILIIRKRLPLIVATTLIS
G2FWX3      ---------------------------MEEEI-----DLRQYWEVLKKRWKIIAMLPLIA
G7WJV2      ---------------------------MEEKL-----DLKQYWDMLRRRWIIVVALPLIA
G7W774      ---------------------------MEEEI-----DLRQYWEILRKRWIIVVVLPLIA
G2FM60      ---------------------------MEEEM-----ELRQYWDVLRKRWMIVVVIPLIA
H5XZD5      ---------------------------MEEKV-----DLRQYWGVLRKRWIIVVALPLIA
I4DBG9      ---------------------------MEEEI-----DLRQYLEVLGKRWLIIVAIPLIA
G2FWT7      ---------------------------MEEEI-----ELRQYWDMLRKRWMIVVVLPLIA
H5XZG8      ---------------------------MEEEI-----DLRQYWEMLRKRWIIVIVLPLIA
G0V448      ---------------------------MEQEMTL---DLRDLLEIIKKRWKMIFSVTTIC
A0PZ01      ---------------------------MEDEITL---DLRDLFFVLRKRFKLIVSITLIA
B1B737      ---------------------------MEDEITL---DLRNLFFVLRKRFKLIIFITLIA
G5IFS2      -----------------------MGTNQDDEIEI---DLKELFFVMRRKLWVLILTGMLG
B8D0N1      ----------------------MDNIPHNYEYEI---DLTEYLGILNKRKWLILAITILA
D9QTC7      --------------MDNLERQTTDSDITEDMVEI---DLREYFTILWKRKMIIIGLLIVA
G0VNK5      ----------------------------MEEITI---DLKDLFQVVMDHKKKIAAITAAF
D2RIR1      --------------------------MNEQE--I---DLRELWQIVRTNQKTIAKITGGF
I0GRR3      --------------------------MDDKEVTI---DLREVWDLMVTGRMKIAKITALF
                                                                        

G9RSY8      AVAGYL-VSSFAMTPQYEASATLIVNSR--------------------------------
C4Z673      GSVAFM-YSFFVITPQYESTTKVYILNK-------QNASGSVTYSDVQLSSTLSKDYEQL
C6CW36      SVISGI-KSSFYTTPIYEATAKLIVNQS-SGAYQ----QGYPDVGLLQSNLMLMDSYKEI
A8SQS9      AVLFNA-YAYFFIKPTYQSTAKLYVVSA-SDDS-------IVNLQDLNIGSSLTADYEEL
D5HFS3      AVLFNA-FAYFLIKPTYQSTAKLYVVSA-SDDS-------IVNLQDLNIGSSLTKDYEDL
G0LYN8      LIVAAG-LTFFVITPKYQSSVQILVNRK-NTNAA-------TEYAGQQADIQMVTTYKEL
F6ITB3      LIVAAG-LTFFVITPKYQSSVQILVNRK-NTNAA-------TEYAGQQADVQMITTYKEL
G0M1Y0      LIVAAG-LTFFVITPKYQSSVQILVNRK-NTNAA-------TEYAGQQADVQMITTYKEL
D7VC12      LIVAAG-LTFFVITPKYQSSVQILVNRK-NTNAA-------TEYVGQQADVQMITTYKEL
F9UMZ5      LIVAAG-LTFFVITPKYQSSVQILVNRK-NTNAA-------TEYAGQQADVQMITTYKEL
B9Y883      SIVAAL-ITLFLIPKKYTAEAKLIIVQK-SNPDS-----QQISYNDLQTSQKLVNTYSEI
H7F1R6      ILLMSV-YLYAFSVPTYQSETEVLINQS-VPENT------VVQSQDVQANLQLVNTYTSI
H7F570      TLLMLM-YLSFFSTPIYRSSTEVLINQS-VSENS------QVKSQDVQANLQLVNTYASI
A5Z5P8      AIIAGV-WTKVGITPKYTATAKVYMVSA-SKNS-------VVDLADLSIGTSLSEDYAEL
C6LCS6      MIITYL-CSRVFITPTYDSTTKIYVLNR-QNSDA-----AAITYSDLQSATQLTKDYMEL
A7VF43      AVLLNA-CAYFLIKPTYQSTAKLYVVSA-SEDS-------VVNLSDLNIGTSLTKDYEDL
C6CSC7      TVASGV-YTKMFKDPIYEASTKIVVNQP-SQQLA----VGQLDLNQINSNIKMIDTYKEV
C6CS79      ASAAGA-YSAWVMKPVYEAYTKLIVNST-AGQAG----SFKLDLNMINTNLSLINTYKEI
F5LM70      CLITGV-VSKYYLKPVYQASTKLIVNSP-ADNQG----MLRLDMNAINTNISLIHTYKEI
H6LKR9      FVGAYF-GTAKLITPIYEAKTVLYIGRE-NSGLG----TIDVSLGQLEADSQLIIDYKEI
F5LE49      TVMSGI-ISYFFIDKQYAASTKLVVNKS-SSYQG----YDILDYNAVNTNIMLVNTYKEI
F3AHH1      AVLAVT-GTKLFMTPQYQSVTKMYVLSK-QDNAT-------LTSMDMQTSTLLTKDYAEL
H1LCW2      LIIAVG-LEKFVITPQFTSTAQILVNQK-KDTSV-----PRAAFQDQQADVQMISTYKDI
I5AV00      LLANLL-YVNAKYAPYYTSSTKLYVMPK-SSTGN--------LNSDLQAGATLTKDYVEL
H6NE44      SLCTAL-VSVQYLPRVYQASVKLLINSE-GKGNG-------VDISSINTNLKLIKTYSEI
F4BS20      IALTTA-LTNYVLIPRYSSTTQLLVSRQ-DMNTQ------SIELGEIETNIQMINTYRDI
E0RZL4      ALAGLF-LSKFVIRPEYESTTKIYILNK-EENQT-------VTYSDVQISTQLTQDYAEL
C0CK72      VLLSAL-FTFKIVEPMYGASSMIYMRGA-GNT--------ISSLQDLQIGAELTNDYEII
D9S1J8      IMAAAT-YTFWIKKPVYESYTTIMVGKP-VQRVQDS--SAPITYQELQTNRLLVSTYGEI
C2EFR7      GLAAFT-YSKFAVVPQYTSVTKIYLSN-----------KLTENQTNPTPSTELIKDYEEM
Q1WTC7      GLAAFT-YSKFAVVPQYTSVTKIYLSN-----------KLTENQTNPTPSTELIKDYEEM
B0P2G1      AGASGL-ITKFAMTPIYSSTAQLYVVSK----------GGLSQLTDLTMGSQLTQDYMVI
D4MW28      AGASGL-ITKFAMTPIYSSTAQLYVVSK----------GGLSQLTDLTMGSQLTQDYMVI
E5VMX9      AGASGL-ITKFAMTPIYSSTAQLYVVSK----------GGFSQLTDLTMGTQLTQDYMVI
F2I6Z8      IVVASA-YNFLWAEAEYASQTQIVVTPK-D--------SDKDKADEKKAG---LKTYDDL
E6U7N3      LIVAFS-LAAWAISPLYASSTMLVVNAN-NNQNN----TTTITNDQLTTAQELVNTYSVI
C4Z8M6      GAVAFA-ISRFMITPMYESTSELYVLSK-S--------TSITSLADIQTGTSLTNDYIVV
D4JMC3      AAVFGL-YSKITFVPEYEASAEMYVLTK-S--------TSITSLADIQVGSSLTNDYEYV
D6E0V3      AAVFGL-YSKITFVPEYEASAEMYVLTK-S--------TSITSLADIQVGSSLTNDYEYV
E3GPC7      MIVVSV-FTIFFMNKEYSSYTTLMIGKS-EGYSDT---NANANYNEVLTNQKLVGTYSEI
A6BIG6      ALVAFL-ATKLFMTPVYTSVTKLYVMTK-NGEN-----SSSATYTELQSGSMLTKDYMEM
C2CI43      GALSFV-LSSFIITPKYDSNATMIVSNS-TQNNDQNP-QANVDYGQIQANKALISTYSEI
D4RX68      AGAAFI-YFNFVVTPRYTSTARIMVINR-QN-------SDSLTSTDLNSSTTLSSDYVEI
D4J4T5      LVIMFA-YTSFLVTPLYSASSMMYVMPD-NSNS-----MNSSTLSDMQVGQQLTSDYSSM
I5ASF9      ASIAAG-ITKFVMTPMYTSSSMMIVLTK-E--------TTIASIADLQMGSQLTNDYKVL
C0C0F9      ALLAFA-GTKMFITPMYSSTTKMYVLTK-QDS------SAGVTYSDIQTGTQLTKDYMEL
B6W7H3      AALSYA-ASVFVITPKYEATTTMIVSNS--KNEDPNQ-KGDVDINQINANRALVSTYSEI
C7RGH5      GAASFL-LSKFVITPKYDSNTTMIVSNS-NQNNDPNNPQTNVELGQIQANKALISTYSEI
F0GT82      GLGSFA-YSNFVVTPSYNANATMIISSS-SKNEDQQD-LADIDFYQIQANKALISTYSEI
F3AH93      GCGAAA-YTQFCIAPTYTSTSSMLVLSK-E--------TTLTSMADLQLGTQLASDYQVL
B0GAL4      GCIACA-YAGFLVKPLYTSSSMMLVLTK-E--------TTLSSLADLQMGSQLTKDYSIL
G1WUK1      GCIACA-YAGFLVKPLYTSSSMMLVLTK-E--------TTLSSLADLQMGSQLTKDYSIL
D4M2S1      AVIAGA-VTKLFITPVYSATATMLVLTK-E--------TTLSSLADLQIGSQLTKDYNIL
E7GL80      TGAAGA-YSYYLLTPQYISEAKIYVLSK-E--------TTLTSLADLQMGTQLTQDYKEL
G5F9E3      TGAAGA-YSYYLLTPQYISEAKIYVLSK-E--------TTLTSLADLQMGTQLTQDYKEL
D4CG07      GGAFGL-YSKMILVPKYTSTAMMYVLSK-E--------TTLTSLADLQIGSQLTQDYKVM
D4MP31      GGAFGL-YSKMILVPKYTSTAMMYVLSK-E--------TTLTSLADLQIGSQLTQDYKVM
G5HNC6      CMAAGL-YSVMILNPVYTSTSMVYVLSK-E--------TTLTSLADLQIGSQLTKDYSVM
A8RK86      CLGAGA-YSRLILTPVYTSTAMVYVLSK-E--------TTLTSLADLQIGSQLTKDYSVM
G5HTB1      CLGSGI-YSKMILKPVYTSTSMVYVLSK-E--------TTLTSLADLQIGSQLTKDYSVM
A8RSL0      GSVAGA-FSAFVLTPQYKSTAMVYILSK-E--------TTLTSLADLQIGSQLTKDYKII
C5EN02      GGVAGA-FSKFVLTPQYKSTAMVYILSK-E--------TTLTSLADLQIGSQLTKDYKII
G5HG46      GGVAGA-FSKFVLTPQFKSTAMVYILSK-E--------TTLTSLADLQIGSQLTKDYKII
E7GL39      AAITGA-YSKFLITPQYKSEAKLYVLSK-E--------TTLTSLADLQIGSQLTQDYKVL
E7GL56      IGIAGA-GSAFLITPQYKSEAKLYILSK-E--------TTLTSLADLQIGSQLTQDYKVL
G5F9B0      IGIAGA-GSAFLITPQYKSEAKLYILSK-E--------TTLTSLADLQIGSQLTQDYKVL
D3AC81      AVGFGL-FTAMVMKPVYTSSTMLYIVNK-TTT--------LTSLTDLQLGTQLTKDYKVL
D3AE79      AAAAML-YTTTLVEPVYTSSTMIYILNK-TNN--------ITSLSDLQLGTQLTKDYKVL
D4YF14      ATLAAI-VVMFFVEPQYSSQAQLIVNQR-SSQDT------SIQYNEIQTNVTLVSTYRDI
B1YMM6      ALISFA-VSTFLIKPTYQAGTQILVTPK-KQEND------VIDASQVQSSVTLVNTYRVI
D4LG05      ALALNA-FAFFFIEPTYESTAKLYVVST-SDDS-------VVNLNDLNLGTSLTSDYEEL
D4LTH3      ALLLNA-YSFFCIQPTYQSTSKLYIVST-SDDS-------VVNLNDLNLGTSLTSDYEEL
F3ATF6      GVVAGV-YTKLCITPMYTATSSMLVTTQ-ETT--------LTSIADLQLGSALTGDYSIL
E0I7B6      CILSGI-KGFFYTTPVYSASAKLVVNQS-YEYNG----ISMLDYNLIQTNLMVINSYKEI
C9LAS2      GCLSCV-ATKLLITPTYTSTSSMLLLTD-QGLET-------V--SDVQMGTQLTKDYSVL
F7K8E8      ALVAFL-ATQLFGVPKYESTTKIYILNK-QENNA-------VTYSDIQLGTQLTKDYAEL
F7K9V0      ALGTFL-ITQLFITPKYESTTKIYILNK-QENNA-------VTYSDIQLGTQLTKDYAEL
F7KL97      ALGAFL-VTQIFGVPKYESTTKIYILNK-QENNS-------VTYSDIQLGTQLTKDYAEL
D3FZP5      VATSGV-VSYFVLTPMYQSSTQILVSQQ-AAGAA----SAALQQAGFDVDSKYIQTYNVI
C0ZHV9      TIGTAL-VSFYLLTPIYQAKTEILVNRS-LDSTV----ESMLSVAEIDSNLKLIETYRVI
D7WMM9      ALVTAF-ISIFVLKPTYEAETQILVNQK-NIEQP------HLGVQQVETDLRLINTYNII
A8U9F5      LIVAAG-FTFFIATPQYNATTQILVNRT-TESAE------GLQLNDINSNVQMINTYKDI
F4BSE0      LIVAAG-FTFFIATPQYNATTQILVNRT-TESTE------GLQLNDINSNVQMINTYKDI
E7RDR2      ITIAGV-VSFLVLTPMYQTSTQILVNQE-QSEAA------QLTNQNIQTDLQLINTYSVI
I0JRK5      AIISTL-VTFFVLTPSYEASSQFIVNQS-QSQSQ----DNIYEGNELQTNIDLINTYNVI
G2TR26      MIVTAI-VTYFVMTPVYESSTQILVNKA-SDDQT------MYTTNAVQTNVQLVNTYNVI
D5DBK2      ATISAV-ISFFVLTPVYQTNTQILVNQA-KSEQQ------LYNAGAVQTNVQLISTYNDI
D5DY80      ATVSAV-ISFFVLTPVYQSKTQILVNQA-KSDEQ------LYNMQAVQTNIQLINTYNDI
A7Z9K1      SAAGGL-ISFFALTPVYENSTQILVSQS-KNNQK------EVQFNDVQTNLQLINTYNVI
I2CB17      SAAGGL-ISFFALTPVYENSTQILVSQS-KNNQK------EVQFNDVQTNLQLINTYNVI
I2HW54      SAAGGL-ISFFALTPVYENSTQILVSQS-KNNQK------EVQFNDVQTNLQLINTYNVI
G4P1M8      TAAGGL-ISFFALTPIYENSTQILVNQS-KNNQK------EVQFNDVQTNLQLINTYNVI
E0TTZ7      TAAGGL-ISFFALTPIYENSTQILVNQS-KNDRK------EVQFNDVQTNLQLINTYNVI
G4EQF2      TAAGGL-ISFFALTPIYENSTQILVNQS-KNERK------EVQFNDVQTNLQLINTYNVI
P96715      TAAGGL-ISFFALTPIYENSTQILVNQS-KNERK------EVQFNDVQTNLQLINTYNVI
I0F9R7      TAAGGL-ISFFALTPIYENSTQILVNQS-KNDRK------EVQFNDVQTNLQLINTYNVI
G9QKR5      ALISGL-VSFFILTPIYQASTQLLVNQS-KNDQQ------MYDFNQVQANLQLVNTYSVI
B5UQ74      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------VIQYNEVQTNIQLTNTYKVI
B7HFH2      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGT------ALQIGEVQTNIQLTNTYKVI
Q72XH7      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------AIQYNEVQTNVQLTNTYKVI
C2V4M3      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------AIQFNEVQTNIQLTNTYKVI
C2YZB3      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------AIQYNEVQTNIQLTNTYKVI
C2P8H2      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------AIQFNEVQTNIQLTNTYKVI
C2Y451      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------AIQYNEVQTNIQLTNTYKVI
C3EBC1      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGS------AIQFNEVQTNIQLTNTYKVI
C3H980      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------AIQYNEVQTNIQLTNTYKVI
C2PN23      AIVMAI-ISFFFMTPLYQSSTQILVNQK-KQEGT------AIQIGEIQSNIQLTNTYKVI
B9IRQ7      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGT------AIQLGEIQSNIQLTNTYKVI
A0RL71      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGS------MFQAGEVQTNIQLTNTYKVI
C2XJI0      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGS------MFQAGEVQTNIQLTNTYKVI
Q3EV65      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------MFQAGEIQTNIQLTNTYKVI
C2T8T7      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------AIQLGEIQSNIQLTNTYKVI
C2RG50      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------AIQLGEIQSNIQLTNTYKVI
Q814Y9      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------AIQLGEIQSNIQLTNTYKVI
B3ZRD5      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGS------MFQAGEVQTNIQLTNTYKVI
Q6HB08      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------MIQAGEVQTNIQLTNTYKVI
C2NQN7      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGS------MFQAGEVQTNIQLTNTYKVI
C3GRR1      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------MIQAGEVQTNIQLTNTYKVI
C2ULR7      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------MFQAGEIQTNIQLTNTYKVI
C3GBJ9      AIVSAI-ISFFFMTPIYQSATQILVNQK-KQEGA------MFQAGEVQTNIQLTNTYKVI
C2WVG7      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGS------AIQYNEVQTNIQLTNTYKVI
B7IQS9      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------MIQAGEIQTNIQLTNTYKVI
A9VRC4      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------MIQAGEIQTNIQLTNTYKVI
C2MTG4      AIISAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------MIQAGEVQTNIQLTNTYKVI
B7HXB5      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------MIQAGEVQTNIQLTNTYKVI
C2SBU5      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGA------MIQAGEVQTNIQLTNTYKVI
C2SSX9      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGT------AIQYNEVQTNIQLTNTYKVI
G9QCG2      AIVSAI-ISFFFMTPIYQSSTQILVNQK-KQEGT------AIQLGEIQSNIQLTNTYKVI
Q2BFS6      VATSGL-ISYFYLTPIYQSSTQLLVNQA-KSDQP------VYNPGEIQTNLQLINTYNVI
I3EBB4      VMVSGV-VSYFFLTPIYEASTQLLVNQA-KNEQA------LYNYNEVQTNLQLINTYNVI
A4ITF4      TVVSGV-VSYFLLTPIYQASTQILVNQA-KSEQQ------MYNVGEIQTNLQLINTYSVI
C5D962      TIISGV-VSYFFLTPIYQASTQILVNQA-KSEQQ------LYNYNEIQTNVQLINTYSVI
G8MZ94      TVVSGV-VSYFILTPIYEASTQILVNQA-KSEQQ------LYNFNEIQTNVQLINTYSVI
Q5KUM4      TVVSGV-VSYFLLTPIYQSSTQILVNQA-KSEQQ------LYNFNEIQTNVQLINTYSVI
D4YHG8      IVLAAL-VTFFLMTPKYTSTTDIVVNNA-----ATATTENTITQSGLQANLTLLNTYQSL
F7V793      AVAAGG-ISYGLITPKYAATSSLYMVSA--------DRNKVVDLTSLTAGSSMATDYEQL
H4GK02      GIIAAA-DAEFLVQPKYTASTQILVNNK------ENKVQAGQAYNNQQADVQLINTYKDI
F6IR92      GLIATV-VTLWVVKPQYQANVQILVNRK------HS--SAGTDLTGQQADVQMITTYKEL
G0M0G0      GLVATV-VTLWVVKPQYQANVQILVNRK------HS--SAGTDLTGQQADVQMITTYKEL
D7VBW5      GTIATV-VTLWVIQPEYQANVQILVNRK------HS--SAGADLTGQQADVQMITTYKEL
F9UQ55      GTIATV-VTLWVIQPEYQANVQILVNRK------HS--SAGADLTGQQADVQMITTYKEL
G2KUP2      VAISSF-ITYGVMRPKYTSTTDLLVNQK------LSKSQAAIQSQQVQADVQRVYTYKDI
G8PE07      TLLSVL-VTFFIMTPKYSATTEILVNRK------LPAEMQGAQFQQVQADVQMISTYKDI
E0NHP5      TLLAAL-MTFFVMTPKYSATTQILVNRK------LSDDMAGAQLQQTQADVQMINTYKDI
Q03GL9      TLLAAF-MTFFVMTPKYSATTQILVNRK------LSDDMAGAQLQQTQADVQMISTYKDI
F3Y921      VGISGI-MTFFMITPKYSSQAQLIVRLP-------QTTNAN--SNEVSANLQMINTYKDL
G4L593      LALAAV-VTFFIMTPQYNSRAQMIVALP-------QDENSDESLNTVNYNLQMLNTYKDI
E6LD65      LALSGV-VTFFIVTPKYSSQAQLVVTLP-------QSDSTN--VNDVNSNLQMINTYKDF
C9ALZ8      LAISGI-VTFFILTPKYSSQAQLIVTLP-------QSDTAN--VNDVNTNLQMINTYKDM
C9BUG6      LAISGI-VTFFILTPKYSSQAQLIVTLP-------QSDTAN--VNDVNTNLQMINTYKDM
Q3XYS7      LAISGI-VTFFILTPKYSSQAQLIVTLP-------QSDTAN--VNEVNTNLQMINTYKDM
C9B453      LAISGI-VTFFILTPKYSSQAQLIVTLP-------QSDTAN--VNDVNTNLQMINTYKDM
D4RJF5      LAISGI-VTFFILTPKYSSQAQLIVTLP-------QSDTAN--VNDVNTNLQMINTYKDM
C8ZXT8      LAFAGI-ATFFVITPKYSSQAQLIVTLP-------QSETTN--VNDVNTNLQMINTYKDM
F0EKB8      LALAGI-FTFFVITPKYSSQAQLIVTLP-------QSETTN--ANDVNTNLQMINTYKDM
C9A6V4      LALAGI-FTFFVITPKYSSQAQLIVTLP-------QSETTN--ANDVNTNLQMINTYKDM
C9CHY7      LALAGI-FTFFVITPKYSSQAQLIVTLP-------QSETTN--ANDVNTNLQMINTYKDM
D4JI68      GAVAFA-ISRFMITPMYESTSELYVL---------SKSTSITSLADIQTGTSLTNDYIVV
D6E329      GAVAFA-ISRFMITPMYESTSELYVL---------SKSTSITSLADIQTGTSLTNDYIVV
E6UHY5      GIVGYS-YAKFVLPLQYTASIKIYVTNG--KTGDQDNDDNLINAQDLNTARSLATTYIVI
E9SAU2      GVAGYS-YAKFVLPLQYTSSIKIYVTNGVRNSHDDDDENELINGADINTARSLAATYIVI
F7K0U2      ALVAVL-VTKLFMTPVYTSTTKMYVLSK-------QDANSAVTSSDLQAGSQLTKDYMEL
O06029      TILGSI-YTFFIASPVYTASTQLVVKLP-------NSDNSAAYAGEVTGNIQMANTINQV
G8P3D6      TILGSI-YTFFIASPVYTASTQLVVKLP-------NSDNSAAYAGQVTGNIQMANTINQV
A9QSJ3      TILGGI-YTFFIASPVYTASTQLVVKLP-------NSDNSAAYAGQVTGNIQMANTINQV
F9VC43      TILGSI-YTFFIASPVYTASTQLVVKLP-------NSDNSAAYAGQVTGNIQMANTINQV
G6FD41      TILGSI-YTFFIASPVYTASTQLVVKLP-------NSDNSAAYAGQVTGNIQMANTINQV
G9M881      TILGSI-YTFFIASPVYTASTQLVVKLP-------NSDNSAAYAGQVTGNIQMANTINQV
Q3ZK51      TILGSI-YTFFIASPVYTASTQLVVKLP-------NSDNSAAYAGQVTGNIQMANTINQV
Q83VG0      TILGSI-YTFFIASPVYTASTQLVVKLP-------NSDNSAAYAGQVTGNIQMANTINQV
C6LDI9      AAAAFT-VTKILITPMYSSSSMIYI--V-------GDSLDVSFLVNMEVGTALTADYQMI
G5F9H3      AAITGA-YSKFLITPQYKSEAKLYV--L-------SKETTLTSLADLQIGSQLTQDYKVL
C0CZV8      AGAAGA-FSAFVLTPQYTSTAMVYI--L-------SKETTLTSLADLQIGSQLTKDYKII
G5GFW1      FGIFGA-YSYFILSPQYTSTAMLYV--F-------SKETTLTSLADLQIGSQLTKDYKII
F8KGP2      GVLGYV-VAQFVVVPKYTATTEILVNQK---H---ENNDNGQAYNNQQADIQMINTYKDI
B3XL22      GILGYV-VAQFVVVPKYTATTEILVNQK---H---ENNDNGQAYNNQQADIQMINTYKDI
F8DRU3      GVLGYV-VAQFVVVPKYTATTEILVNQK---H---ENNDNGQAYNNQQADIQMINTYKDI
C2EWM2      GIVGFV-VAEFVITPQYTASTQILVNQK---H----DNADGQAYNNQQADIQVINTYKDI
D0DSJ3      GVIAWG-IATFVIPAKYTATTQILVNQR---N---SNDNNGQAYNNQQADIQMINTYKDI
B2GF32      GVIAWG-IATFVIPAKYTATTQILVNQR---N---SNDNNGQAYNNQQADIQMINTYKDI
C0WW25      GVIAWG-IATFVIPAKYTATTQILVNQR---N---SNDNNGQAYTNQQADIQMINTYKDI
F0K0J8      GLIAYG-VSEYVLVPKYTASTQLLVNRK---TADANHADANQAYANQQADINAITTYKDI
G6F8H0      GLIAYG-VSEYVLVPKYTSSTQLLVNRK---T-----TDANQAYTNQQADINAVTTYKDI
F0HVF2      GLIAYG-VSEYVLVPKYTASTQLLVNRK---T-----EDANQAYANQQADINAVTTYKDI
Q1G8E3      GLIAYG-VSEYVLVPKYTASTQLLVNRK---T-----ADANQAYANQQADINAITTYKDI
D6S4X3      AIIAWG-VSSFMIQPKYSASTQLLVNQK---T---DEKNIGAAYTLQQANMQVITTYKDI
Q5FIC6      ALVGWG-VSEFVISPKYTSTAQLLVNQK---S---RNNDPNAAYATQQANMQMVTTYKDI
E4SMV6      ALVGWG-VSEFVISPKYTSTAQLLVNQK---S---RNNDPNAAYATQQANMQMVTTYKDI
F0TGY3      ALVGWG-VSEFVISPKYTSTAQLLVNQK---S---RNNDPNAAYATQQANMQMVTTYKDI
F2M2M7      ALVGWG-VSEFVISPKYTSTAQLLVNQK---S---RNNDPNAAYATQQANMQMVTTYKDI
A4ZGZ7      ALVGWG-IANFVISPKYTSSAQILVNQK---S---NKNDPNTAYITQQANMQLVNTYKDI
C2EPK4      AVIGWG-LAEFVVTPKYSSSAQILVNQK---S---RNNDPNAAYVTQQANMQMVTTYKDI
C7XKF2      ALVGWG-VANFIISPKYTSNAQILVNQK---A---NKNDPNAAYNTQQANMQMVTTYKDI
E3R265      ALVGWG-VANFIISPKYTSNAQILVNQK---A---NKNDPNAAYNTQQANMQMVTTYKDI
D0DJG9      ALVGWG-VANFIISPKYTSNAQILVNQK---A---NKNDPNAAYNTQQANMQMVTTYKDI
D5GZJ9      ALVGWS-VANFIISPKYTSNAQILVNQK---A---NKNDPNAAYNTQQANMQMVTTYKDI
A8YX90      ALVGWG-IANFVISPKYTSSAQILVNQK---S---NKNDPNTAYITQQANMQLVNTYKDI
F0NWJ8      ALVGWG-LANFVISPKYTSSAQILVNQK---A---NKNDPNAAYATQQANMQMVTTYKDI
C2JZS0      MAVAYF-GTKMLVAPKYQSSTSMLVNRK---Q--DN--NPNMQLNAQQADIQLINTYKDI
C1J9I2      MAAAYF-GAKAFIAPKYESDTSLLVNRK---Q--DN--DPNMQLNAQQADIQIINTYKDI
Q58Z11      MFIAYF-GAKTFIAPKYSASTSMLVNRK---Q--DN--NPNMQLNAQQADIQIINTYKDI
B1MZT2      AGIGYG-IAKFLIAPTYSASTSMLVNRS---T--DNT-TGNANLSDQQADVQIINTYKNL
C2KHF2      ACAGYG-VAKFVIAPTYSASTSMLVNRS---A--DDTSTATANLSDQQADVQLINTYKNL
Q03W94      AAAGFG-IAKFVIAPTYSASTSMLVNRS---A--DDTSTATANLSDQQADVQLINTYKNL
G2Z8Q4      MIAIAF-YTSYFVTPIYQVSTDVLV---------NQKKNEQVTVSDVQSNQQFVNTYSVI
D9ST43      TFLAGI-LSFLIIEPTYEAKSTIVVGKA----DRGSNDNPKYQFDDIMMYKNLITTYAEI
H7F5T7      ASLSLC-IALFVITPSYQMQSQVLVVPS------SKDQSGVSQSAEVQANLQMINTYKAL
G9WIR0      AAVAYA-GSRFLIHPKYQSTAAL-LVNR------SNNTDPNAALGNQQADIQIIYTYRDL
D3LB11      ALMAFA-VCKFVITPQYQSTTAL-LVNR------SQDDTAATALNDQQADVQLIYTYKDL
A0NKF7      TAITFA-ACKFVIAPKYQSTAAL-LVNR------SQDDTAATALNDQQADVQLIYTYKDL
Q04DV7      TAIAFA-TCKFVIAPKYQSTAAL-LVNR------SQDDTAATALNDQQADVGLIYTYKDL
F6BI63      VVMSGI-LSFYVIKPTYQASTSLIVSKS----QTAQYNNGQIQFQDVQTNRLLAATYAEI
G2MWC1      MIVSGI-FSYFIATPVYKASTSLIVSRT----QSSVLTNSQIQVQDIQTSRMLAATYSEI
B0K4N2      TIISGI-FSYFIATPVYKASTSLIVSRT----QSSALNNSQIQVQDIQTSRMLAATYSEF
C7ISF8      TIISGI-FSYFIATPVYKASTSLIVSRT----QSSALNNSQIQVQDIQTSRMLAATYSEF
B0KAR6      TIISGI-FSYFIATPVYKASTSLIVSRT----QSSALNNSQIQVQDIQTSRMLAATYSEF
E8UV30      TIISGI-FSYFIATPVYKASTSLIVSRT----QSSALNNSQIQVQDIQTSRMLAATYSEF
C0GGR6      VATSLV-ASLYFIQPVYESSATLLVGKP--------TEGTQVVIQDVQLNRQLVKTYEEI
A4J8V1      MLTSGI-ISFFVLTPRYEASTTLMVGKT-----YSGQDAMMLQYNDILTANQLVKTYSQI
C8VYQ7      MLTSGI-VSYFLITPIYKSSTTLMVGKT-----YAGENGPLLQYNDILTANQLVKTYSQI
C8W5K3      VLTSGI-ISYYFLTPVYSATATILVNNK------SQRIMGGLDYQDIMLSTELAKTYSKI
B1BNH4      TLVSAI-LSFFVIKPQYEATTKLFIGKQ-----E-SQDNNAYNNNDVMMYQQLMKTYAEL
B1V1Z3      TLVSAI-LSFFVIKPQYEATTKLFIGKQ-----E-SQDNNAYNNNDVMMYQQLMKTYAEL
B1R3V2      TLVSAI-LSFFVIKPQYEATTKLFIGKQ-----E-SQDNNAYNNNDVMMYQQLMKTYAEL
Q0SVR9      TLVSAI-LSFFVIKPQYEAKTKLFIGKQ-----ETSQNAANYDNNDIMMYQKLMKTYAEL
Q8XN47      TLVSAI-LSFFVIKPQYEAKTKLFIGKQ-----ETTQENASYNNNDVMMYQKLMKTYAEL
G7M0Q2      VIISAA-LSFLVISPKYETSTKVFIGKE--GSVIKDLPDQNYNGNDVEMYQKLLKTYAEI
G7M565      TALSAI-ISIFIISPKYEASTKVFIGKE----LNAQGQEQSYDTNDVQMYQKLLKTYVEI
A6M2M0      TLLALI-ISYFIIPPKYEANTKVFIGKE-----NTTGQDQNYSTNDVQMYQKLIKTYAEI
G7M1R8      TILAGL-VSFFVIAPKYESNTKVFIGKE-----NTNSKDQSYNSSDVQMYQQLLKTYAEV
Q4JZ56      GCISFL-YYQFFVPKTYTSDTRIYVVSK--------GDNKNLSNADLQAGSALTKDYKEI
Q7X554      VAFSFL-GTYFFIQPTYTSPTRIYVANQ------ATDDNN-LSAQDLQAGTYLVNDYYEI
Q7X550      AVFSFL-GTYFFIQPTYTSTTRIYVVNQ------ATDNNN-LSAQDLQAGAFLVKDYKEI
Q7X562      AAFSFL-VTYFFIQPTYTSTTRIYVVNQ------ATDNKN-LSAEDLQAGTYLVNDYKEI
Q7X556      AAFSFL-LTYFFIQPTYTSTTRIYVVNQ------ATDNNN-LSAQDLQAGTYLVNDYNEI
Q7X552      AVFSFL-GTYFFIQPTYTSTTRIYVVNQ------ATDNKN-LSAQDLQAGTYLANDYKEI
Q7X558      AAFSFL-GTYFFIQPTYTSTTRIYVVNQ------ATDNNN-LSAQDLQAGTYLANDYKEI
C5NWJ9      TAASLA-YSIFLVTPQYSSTTKVYVVNQ------KKDDKA-ITTQDVQLGSLLVKDYKEI
F3A498      TAVSLA-YSIFLVTPQYSSTTKVYVVNQ------KKDDKA-ITTQDVQLGSLLVKDYKEI
Q9AHD3      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGTYLVKDYREI
Q4K2E2      GAIAFA-YSSFIIKPEYTSTTRIYVVNR------NQGDKSGLTNQDLQAGSYLVKDYREI
Q4K2F8      GAIAFS-YSSFIIKPEYTSTTRIYVVNR------NQGDKSGLTNQDLQAGSYLVKDYREI
Q4K046      GAGAFV-YSTFIVRPEYTSVTRIYIVNR------NQGDKAGLTNQDLQAGTYLVKDYREI
Q4K0R8      GAGAFA-YSTFVVKPEYTSTTRIYVVNR------NQEDKPGLTNQDLQAGTYLVKDYREI
Q4JYY0      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQEDKPGLTNQDLQAGTYLVKDYREI
Q4JZW8      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------DQGDKSGLTNQDLQAGTYLVKDYREI
I0J9C8      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------DQGDKPGLTNQDLQAGSYLVKDYREI
Q4K0M4      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------DQGDKPGLTNQDLQAGSYLVKDYREI
Q4JZS4      GAGAFA-YSAFIVKPEYTSTTRIYVVNR------NQGDKSGLTNQDLQAGSYLVKDYREI
Q4JZK2      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------DQGDKPGLTNQDLQAGSYLVKDYREI
Q9AHA5      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKSGLTNQDLQAGSYLVKDYREI
Q9X9A0      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKSGLTNQDLQAGSYLVKDYREI
Q4JYK9      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKLGLTNQDLQAGSYLVKDYREI
Q4K006      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDNPGLTNQDLQAGSYLVKDYREI
Q4JZG8      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
A6YIA7      SAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGTYLVKDYREI
E5F5C4      SAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKSGLTNQDLQAGTYLVKDYREI
Q9AHB8      SAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGTYLVKDYREI
Q4JZL8      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
Q4K1B8      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
Q8VU32      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQEGKSGLTNQDLQAGTYLVKDYREI
D2ERX9      GAGAFA-YSAFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
G6C7Z0      GAGAFA-YSTFIVNPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
Q4K2A9      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGTYLVKDYREI
D6ZQI7      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGTYLVKDYREI
Q9ZFT9      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGTYLVKDYREI
Q4K255      GAVAFA-YSTFIVKPEYMSTTRIYVVNR------NQGDKPGLTNQDLQAGAYLVKDYREI
F9HJP7      AILALG-YSVFIAKPSYQSTTRIYVVSR------QQSDNNALTNQDLQAGAYLVKDYKEI
E8JWI4      GILALG-YSVFIAKPAYKSTTRIYVVNR------QQGENPTLTNQDLQAGSYLVKDYKEI
A8AZR4      AVLALG-YSLFIAKPSYQSTTRIYVVNR------QQTDNNTLTNQDLQAGSYLVKDYKEI
D0RXH3      AVLALG-YSLFIAKPSYQSTTRIYVVNR------QQTDNNTLTNQDLQAGSYLVKDYKEI
Q83YR6      AVLALG-YSLFIAKPSYQSTTRIYVVNR------QQTDNNTLTNQDLQAGSYLVKDYKEI
F1Z125      GTLALL-SSIFLIKPSYTASTRIYVLNK------TQQADN-LSATDLQAGGLLVNDYKEI
Q3K0S9      ATAGLF-YSLFIVTPQYTSSTRIYVINP------NTPNNS-ITAQDLQAGSFLANDYKEI
P0C0T8      ATAGLF-YSLFIVTPQYTSSTRIYVINP------NTPNNS-ITAQDLQAGSFLANDYKEI
Q67AY5      ATAGLF-YSLFIVTPQYTSSTRIYVINP------NTPNNS-ITAQDLQAGSFLANDYKEI
Q04662      ATAGLF-YSLFIVTPQYTSSTRIYVINP------NTPNNS-ITAQDLQAGSFLANDYKEI
Q8GP93      AAFSFL-GTYFFIQPTYTSSTRIYVVNQ------ANDSKN-LSAQDLQADTFLTKDYKEI
Q8GPF7      AAFSFL-GTYFFIQPTYTSTTRIYVVNQ------ATDNKS-LSAQDLQAGTYLVNDYKEI
E3CP61      AVFAFL-GTYFLIQPTYTSSTRIYVANQ------TNDSKN-ISAQDLQAGTFLTKDYKEI
E8KUY7      AVFAFL-GTYFLIQPTYTSSTRIYVANQ------TNDSKN-ISAQDLQAGTFLTKDYKEI
C2LSE5      AVFAFL-GTYFLIQPTYTSSTRIYVVNQ------ANDGKN-LSAQDLQAGTFLTKDYKEI
E9DM16      AVFAFL-GTYFFIQPTYTSSTRIYVVNQ------ADDGKN-LSAQDLQAGTFLTKDYKEI
I0QIK5      AVFAFL-GTYFFIQPTYTSSTRIYVVNQ------ADDGKN-LSAQDLQAGTFLTKDYKEI
Q7X560      AAFSFL-VTYFFIQPTYTSTTRIYVVNQ------ATDNNN-LSAQDLQAGTYLANDYKEI
Q8GMA6      AAFSFL-GTYFFIQPTYTSTTRIYVVNQ------ATDNNN-LSAQDLQAGTYLANDYKEI
Q55204      AAFSFL-GTYFFIQPTYTSTTRIYVVNQ------ATDNNN-LSAQDLQAGTYLVNDYKEI
Q8GPC4      AAFSFL-VTYFFIQPTYTSTTRIYVVNQ------ATDNNN-LSAQDLQAGTYLANDYKEI
Q8GPA9      AAFSFL-VTYFFIQPTYTSTTRIYVVNQ------ATDNKN-LSAEDLQAGTYLVNDYKEI
G6ERT2      AAFSFL-GTYFFIQPTYTSTTRIYVVNQ------ATDNNN-LSAQDLQAGTYLVNDYKEI
O87930      AAFSFL-GTYFFIQPTYTSTTRIYVVNQ------ATDNNN-LSAQDLQAGTYLVNDYKEI
Q8GP55      AVFSFL-GTYFFIQPTYTSTTRIYVVNK------ATDNNN-LSAQDLQAGTYLANDYKEI
F8HDC4      AAFSFL-GTYFFIQPTYTSTTRIYVVNQ------ATDNKN-LSAQDLQAGTYLVNDYKEI
F8LJ76      AAFSFL-GTYFFIQPTYTSTTRIYVVNQ------ATDNKN-LSAQDLQAGTYLVNDYKEI
F8LXJ5      AAFSFL-VTYFFIQPTYTSTTRIYVVNQ------ATDNNN-LSAQDLQAGTFLVKDYKEI
Q1WCR2      AVFSFL-GTYFFIQPTYTSTTRIYVVNQ------ATDNNN-LSAQDLQAGTFLVKDYKEI
G3G7C0      AGLAFA-YSSFLVTPQYKSTTRIYVVGQ------HAEAGAGLTNQDLQAGSYLAKDYKEI
G3G7J8      AGLAFA-YSSFLVTPQYKSTTRIYVVGQ------HAEAGAGLTNQDLQAGSYLVKDYKEI
G8DU30      AGLAFV-YSSFLVTPQYESTTRIYVVSQ------NVEAGAGLTNQELQAGTYLVKDYREI
A4VTU2      AGLAFV-YSSFLVTPQYDSTTRIYVVSQ------NVEAGAGLTNQELQAGTYLAKDYREI
D5AGQ4      AGLAFV-YSSFLVTPQYDSTTRIYVVSQ------NVEAGAGLTNQELQAGTYLAKDYREI
Q9X4U6      AGLAFV-YSSFLVTPQYDSTTRIYVVSQ------NVEAGAGLTNQELQAGTYLAKDYREI
G3G7G5      AGLAFV-YSSFLVTPQYDATTRIYVVSQ------NVEAGAGLTNQELQAGTYLVKDYKEI
G7SG35      AGLAFV-YSSFLVTPQYDSTTRIYVVSQ------NVEAGAGLTNQELQAGTYLVKDYKEI
G8DU06      AGLAFV-YSSFLVTPQYDSTTRIYVVSQ------NVEAGAGLTNQELQAGTYLVKDYKEI
G8DUA9      AGLAFV-YSSFLVTPQYDSTTRIYVVSQ------NVEAGAGLTNQELQAGTYLVKDYKEI
G8DTY9      AGLAFV-YSSFLVTPQYDSTTRIYVVSQ------NVEAGAGLTNQDLQAGSYLVKDYKEI
G3G7I7      AGIAFV-YSSFLVTPPYDSTTRIYVVSQ------NVEAGAGLTNQELQAGTYLVKDYREI
G3G7J3      AGIAFV-YSSFLVTPQFDSTTRIYVVSQ------NVEAGAGLTNQELQAGTYLVKDYKEI
E0PD82      GTVALL-GSIFLIKPKYTSTTRIYVVSK------TADN---ITSQDLQAGSYLVNDYKEV
F5X651      GTVALL-GSIFLIKPKYTSTTRIYVVSK------TADN---ITSQDLQAGSYLVNDYKEV
G5JTD6      GFVTLF-VSVFIIPKTYTAGTRIYVVNN------STSDS--INYQDIQAGTDLVNDYKEI
Q2KM75      GFLALV-ASMFLIKPSYTSTTRLYVINR------QQSDN--LTATDLQAGGYLVNDYKEI
G5KAJ3      GTLALM-ASLFLIKPSYTSTTRLYVINR------QQSDN--LTATDLQAGGYLVNDYKEI
B9DUJ5      GTLALL-GSVFLIKPSYSASTRIYVINQ------QNAEN--ITATDLQAGSFLVNDYKEI
G5KD12      GVLTLL-VSAFLIKPSYTSSTRIYVINQ------QNSDN--LTALDLQAGGYLVNDYKEI
E8JMT8      GTVALL-GSIFFIKPKYTSTTRIYVVSR------SSD--SSLTNQDLQAGSYLVNDYKEV
F5X0J8      GTVALL-GSVFLIKPKYTSTTRIYVVSR------SSD--SSLTNQDLQAGSYLVNDYKEV
H2A601      GTVALL-GSVFFLKPKYTSTTRIYVVSR------SSD--GSLTNQDLQAGSYLVNDYKEV
E7S8W2      AIGALG-YSAFVAKKIYQSTSRIYVVSR------QNQENNALTNQDLQAGSYLVKDYREI
F8DFF5      AIAAFG-YSAFLAKKEYQSTSRIYVVSR------QNQDNNALTNSDLQAGAYLVKDYREI
I1ZPH8      AIAAFG-YSAFLAKKEYQSTSRIYVVSR------QNQDNNALTNSDLQAGAYLVKDYREI
E3CBR9      AIAAFG-YSAFLAKKEYQSTSRIYVVSR------QNQDNNALTNSDLQAGSYLVKDYREI
E8K787      AIAAFG-YSAFLAKKEYQSTSRIYVVSR------QNQDNNALTNSDLQAGSYLVKDYREI
F9M365      AIAAFG-YSAFLAKKEYQSTSRIYVVSR------QNQDNNALTNSDLQAGSYLVKDYREI
A3CQY3      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
E8KLZ0      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
F0FHA9      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
F0FQQ4      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
F0I4H6      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
F0IAY2      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
F0IJI1      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
F0IS52      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
F2C9N1      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
F2CH54      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
F3UDW8      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
F3UNJ5      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
F3SM33      SLLAFG-YSVFIAKKMYQSTTRIYVVSR------QNETQAALTNQDLQAGSYLVKDFKEI
F9HC66      ALLAFG-LSSFVLKPEYASTTRIYVVSR------NQSENTGLTNQDLQAGTYLVKDYKEI
E1LQJ6      AVIAFG-VSSFVLTPEYSSTTRIYVVNR------NQSEKAGLTNQDLQAGTYLVKDYKEI
Q4JYU0      AVLAFA-VSSFVLTPEYSSTTRIYVVNR------NQSEKAGLTNQDLQAGTYLVKDYKEI
Q4JZY2      AVLAFA-VSSFVLTPEYSSTTRIYVVNR------NQSEKAGLTNQDLQAGTYLVKDYKEI
F9Q346      GVVAFA-YSSFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
Q6L5R1      GVVAFA-YSSFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
E9FEC6      GTVAFA-YSSFIVKPEFTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
E0Q2S9      GAVAFA-YSSFIVKSEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
F5VSH0      GAVAFA-YSSFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
A5YTV6      GAVAFS-YSSFIVKPEFTSTTRIYVVNR------NQGNKPGLTNQDLQAGSYLVKDYREI
Q6L5T1      GTVAFA-YSSFIVKPEFTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
E0PPH8      GAVAFA-YSSFIVKPEFTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
A5YTT8      GTVAFA-YSSFIVKPEFTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
E6KKR9      GIVAFA-YSSFIVKPEFTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
A1ILY0      GIVAFA-YSSFIVKPEFTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
F2QF91      GTVAFA-YSSFIVKPEFTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
Q4K0I3      GAGAFA-YSIFIVKPEYTSTTRIYVVNR------NQENKPGLTNQDLQAGTYLVKDYHEI
Q8KWQ1      GAGAFA-YSTFIVKPEYTSTTRIYVVNH------NQGNKLGLTNQDLQAGSYLVKDYREI
Q4K238      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGTYLVKDYREI
B1I966      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGTYLVKDYREI
G6J8A3      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGTYLVKDYREI
F9LZC3      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
F9P1W9      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGSYLVKDYREI
A5LJR9      SAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKPGLTNQDLQAGTYLVKDYREI
Q9ZII7      GAGAFA-YSTFIVKPEYTSTTRIYVVNR------NQGDKSGLTNQDLQAGSYLVKDYREI
Q4K1K7      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------DQGEKSGLTNQDLQAGTYLVKDYREI
E1LPE6      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NQGEKSGLTNQDLQAGSYLVKDYREI
F9MJW6      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NQGEKSGLTNQDLQAGSYLVKDYREI
Q4K0V3      SSVAFA-YSTFVIKPEFTSMTRIYVVNR------NQGEKSGLTNQDLQAGSSLVKDYREI
Q54519      SSVAFA-YSTFVIKPEFTSMTRIYVVNR------DQGEKSGLTNQDLQAGSSLVKDYREI
C1CBD0      SSVAFA-YSTFVIKPEFTSTTRIYVVSR------DQGEKSGLTNQDLQAGSYLTKDYREI
Q7WVX1      SSVAFA-YSTFVIKPEFTSTTRIYVVSR------DQGEKSGLTNQDLQAGSYLTKDYREI
Q4K0E2      SSVAFA-YSTFIIKPEFTSTTRIYVVNR------NQEEKSGLTNQDLQAGSYLVKDYREI
Q9AH96      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NKEEKSGLTNQDLQAGSYLVKDYREI
A5M4L2      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------DQGEKSGLTNQDLQAGSYLVKDYREI
B2ILP4      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------DQGEKSGLTNQDLQAGSYLVKDYREI
C1CCB8      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------DQGEKSGLTNQDLQAGSYLVKDYREI
P72511      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------DQGEKSGLTNQDLQAGSYLVKDYREI
Q4K1S8      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------DQGEKSGLTNQDLQAGSYLVKDYREI
P96474      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NQGEKPGLTNQDLQAGAYLVKDYREI
Q4K196      SSVAFT-YSTFVIKPEFTSTTRIYVVNR------NQEEKPGLTNQDLQAGSYLVKDYREI
Q4K0Z7      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NQEEKSGLTNQDLQAGTYLVKDYREI
Q4JZ85      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NQEEKSGLTNQDLQAGSYLVKDYREI
Q4JYH6      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NQEEKSGLTNQDLQAGSYLVKDYREI
Q4JZ19      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NQEEKSGLTNQDLQAGTYLVKDYREI
Q4K0A1      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NQEEKSGLTNQDLQAGSYLVKDYREI
Q4K1M5      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NQEEKSGLTNQDLQAGTYLVKDYREI
Q4K2Q8      SSVAFV-YSTFVIKPEFTSTTRIYVVNR------DQGEKSGLTNQDLQAGSYLVKDYREI
Q4K1G0      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NQGEKSGLTNQDLQAGSYLVKDYREI
Q4K0T6      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NQEEKSGLTNQDLQAGSYLVKDYREI
Q4K0K3      SSVAFT-YSTFVIKPEFTSTTRIYVVNR------NQGEKSGLTNQDLQAGTYLVKDYREI
Q4K0X6      SSVAFA-YSTFVIKPEFTSTTRIYVVNR------NQEEKSGLTNQDLQAGSYLVKDYREI
E8KDN1      GVLAFG-FSSFIVKPQFTSTTRIYVVNR------NQGDKPGLSNQDLQAGSYLVKDYREI
F9PEU3      GLAAFA-YSSFVIQPQYTSTTRIYVVNR------NQADKPGLTNQDLQAGSYLVKDYREI
E8K321      GITAFA-YSSFVIKPQYTSTTRIYVVNR------NQADKPGLTNQDLQAGAYLVKDYREI
F9PZP6      GLAAFA-YSSFVIKPQYTSTTRIYVVNR------NQADKPGLTNQDLQAGAYLVKDYREI
D6R2T7      ALLALG-YSAFIAPKVYQTTTRIYVVSR------QNTTESALTNQDLQAGSYLVKDFKEI
F3UUQ1      ALLALG-YSAFIAPKVYQTTTRIYVVSR------QNTTESALTNQDLQAGSYLVKDFKEI
E6IZC3      AIIALG-YSTFIIKPTYTSSTRIYVVNR------QPGDNSTLTNQDLQAGSYLVKDYKEI
G6A746      AIITLG-YNTFIIKPNYTSSTRIYVVNR------QPSDNSTLTNQDLQAGSYLVKDYKEI
B1V0N8      ILFSAY--KAYKMKPSYQSRVKFFIGKE--GIKGTYSVG------ELEEYKKMIGAYVEI
B1BNK2      ILFSAY--KAYKMKPSYQSRVKFFIGKE--GIKGTYSVG------ELEEYKKMIGAYVEI
B1R3X7      ILFSAY--KAYKMKPSYQSRVKFFIGKE--GIKGTYSVG------ELEEYKKMIGAYVEI
Q8XN77      ILFSAY--KAYKMKPSYQSRVKFFIGKE--GIKGTYSVG------ELEEYKKMIGAYVEI
B1HR40      IGIAVF-INYFLQTPIYEAETQLLVNQK--SYENQQLIG----AQNVDTDLRLINTYNVI
A7Z922      TLVTGY-IQFRVISPVYQASTQVLIHET--SGEKNSNL------SDVQLNLHYNNTFQTI
I2CAF3      TLVTGY-IQFRVISPVYQSSTQVLIHET--SGEKNSNL------SDVQLNLHYNNTFQTI
I2HVL3      TLVTGY-IQFRVISPVYQSSTQVLIHET--SGEKNSNL------SDVQLNLHYNNTFQTI
E0U2Z4      TLITGF-AQFKVISPTYQASTQVLVHES--DGEENSNL------SDIQRNLQYSSTFQSI
D4G1R3      TLIMGF-VQFKVISPTYQASTQVLVHES--DGEENSNL------SDIQRNLQYSSTFQSI
G4EQZ6      TLIMGF-VQFKVISPTYQASTQVLVHES--DGEENSNL------SDIQRNLQYSSTFQSI
P71050      TLIMGF-VQFKVISPTYQASTQVLVHES--DGEENSNL------SDIQRNLQYSSTFQSI
G4P115      TVMTGF-VQFKVISPTYQASTQVLVHES--DGEENSNL------SDIQRNLQYSSTFQSI
A8FHM0      TGISAY-YQFYVSTPVYQATTQILVHKR--SNDAQANL------NDIQMNLQYTRTFQVL
C0EBA5      GGLGAFSITKFLMTPMYTSSATMYVNNK--TKTDNVDII---SGSDLVTSQKLISTYSQI
F8FCE3      SLCTAL-VSVQYLPRVYQASVKLLINSE--GKGNGVDIS------SINTNLKLIKTYSEI
I0BSG5      -MCTAL-VSVQYLPRVYQASVKLLINSE--GKGNGVDIS------SINTNLKLIKTYSEI
A8YPQ6      LIISAI-VTFFVLSPKYQANTQILVNQT--KGDNPQFMA-----QEVQSNIQLVNTYKEI
P95695      LIISAI-VTFFVLSPKYQANTQILVNQT--KGDNPQFMA-----QEVQSNIQLVNTYKEI
Q2G1K8      LIISAI-VTFFVLSPKYQANTQILVNQT--KGDNPQFMA-----QEVQSNIQLVNTYKEI
C5QNG5      LILSAI-FTFFLAKPKYEASTQILVSQ---KEKESKMMA-----QEVQSNIQLVNTYAEI
Q4L9H8      LLISLI-ITFLFMTPKYEATTQILINQ---KEKNKELMA-----QEVQSNIQLVNTYSQI
Q2FUV1      LVVSAA-LTFFVMPDKYTASTQILVNM---KKSSSDLAF-----QNVQSSLQSVNTYTEI
P39850      LLISAI-ISFFFLDVKYQASTQILVNQ---KGNDSQIMA-----QEVQSNIQLVNTYSEI
D7UYE3      LIIAMA-LTYFFMTPKYASSTQILVNK---KESNSQFMA-----QEVQSNLQLVNTYAEI
Q4A121      LVLSMM-MTFLFITPKYSSSTQVLVNQ---KETDSQMMA-----QQVQSDLQLVNTYSEI
C9AAE4      LLAMFL-YLTFFAEPIYQKSAQLLISQS--ETTSGNRLE----NQTIQADLQLVSTYSTI
H7F6C7      ILSMFI-YLQYIATPIYQKSTQILVNQS--ESTKSNSVD----SQTVQADLQLVNTYSTI
F0SX23      GAIALG-ITYYFMTPLYTASIKLYVNNS--TELAVQITD-----SDMKASQSLIKTYMTI
Q38VG4      TLLAGI-LTFFVITPQYSASTEVLVNRK--QNTDANAQ-----YNQVQTDVQMINTYKDL
F2I4B6      VLLAAA-YAFVLATPIYQSSTEILVNQS--ESKGQNNTL----NQDINASLQLINTYSDV
Q8RBS6      MLVSGL-ISYYVLSPVYKASTSLIISRT--QN---ITINDQIQLQDIQTSRMLAATYSEI
D9SR42      GAISGI-ITTFVIDKIYTADISVLIGK----QESSDSEKTSTTYNDILMYQKIVKTYSQI
D9SVC8      GASGWI-FSTLFINKLYTSDISVIIGKN--YRNPAEGESSIATYSDILMYQKAVKTYGKI
E7RG09      MIITAL-ISYYFITPIYQTSTQLLISQK--QSEVIV--D----SQSIDIDLQLVSTYSEI
D4G2E2      TAAGGL-ISFFALTPIYENSTQILVNQS--KNERKEV-Q----FNDVQTNLQLINTYNVI
Q8EME7      ALAAAI-ISYFVMTPKYENSSQFIVNQS--NQEQANQFT----QTDIRTNVEIINTYNVI
D6Y035      VIAAAS-VSYFVLTPKYQASTQVLVSQA--ATGASILSS----ANPFESDARYIETYSVI
Q5WBB3      MLVSAI-ISSFVLTPMYERSTQLLVNQA--VPEGQL--N----QQVVRNNLELIDTYSEI
Q9K6Q9      VCLAGF-VSFFLLTPIYQSSTQILVNHS--NDNQSF--N----SQDIRTNIDLINTYSVI
Q97EP7      VLFSAI-LSFFIIKPTYQGHVTVIIGRN--DSKSSTNEQ----YNDVMMSQNLTKTYAQI
Q97ER4      VLFSAI-LSFFIIKPTYQGHVTVIIGKN--DSKSSTNEQ----YNDVMMSQNLTKTYAQI
E4S7Y7      SLIAAI-LSFYVLEPVYRASVTLFAGRS--TNNSASSDSIQALYSDVLLGQQLVKDYREI
E4Q5T6      TFIAAI-LSFYILPPIYKATVTLFAGRS--TNSNGSNDNIQALYSDVLLGQQLVKDYREI
E4SDX3      TLIAAI-LSFYILPPIYKATVTLFAGRS--TNSDGANDSIQALYSDVLLGQQLVKDYREI
G2FWX3      ALVSGI-VSFYCIQPVFQTSTTLIVGKK--SLDIGQPLEHMLDYNVLLANQQLTKTYAAI
G7WJV2      ALTSGV-ISFFVLKPVYQASTTLIVGKK--AAEPGQEAAKILDNNVLLANQQLAKTYALI
G7W774      ALTSGI-ISYFIIKPVYQASTTLIVGKK--ASEEGQAAVQMLDNNVLLANQQLAKTYAAI
G2FM60      ALTSGM-ISFFVMKPVYQASTTLIVGKK--AAETGKDPTQILDNSVLLANQQLAKTYATI
H5XZD5      ALTSGV-ISFFVIKPVYQASTTLIVGKK--AAESGQEAVKMLDNNVLQANQQLAKTYALI
I4DBG9      AITSGV-ISFFILKPSYEASTTLIVGKK--ATEEGQAAAQMLDNNVLLANQQLAKTYATI
G2FWT7      ALTSGI-ISFFVIKPVYQASTTLIVGKK--AAEAGQAATQMLDNSVLLANQQLAKTYATI
H5XZG8      ALTSGV-VSFFILKPVYQASTTLIVGKK--ATESGQAAMQMLDNSVLLANQQLAKTYAAI
G0V448      ILISAL-LSFFVLPPIYEAKVSIIIGKE--DTSQEKRID--YN--DIMMYQKLVKTYASI
A0PZ01      TILSGI-ISFFVIHPTYEATLSVFIGKN--ENEQSQKIS--YNESDIMMYQRLVKTYATI
B1B737      TILSGI-ISFFVIHPTYEATLSVFIGKN--ENEQSQKIS--YNESDIMMYQRLVKTYATI
G5IFS2      AAVSGI-FTATMMKPVYTSSTMLYIVN-----KTTTLTSLT----DLQLGSQLTKDYKVL
B8D0N1      GVMGYI-LT-SYKPAVFQSDALLMIDE-----TPTTLNQIE--LSPFNNNNRDLITYSKL
D9QTC7      IIGSLV-AS-SLMTKIYQTSALVMVKED-KGMENLFSEQMGALGSLAGSTSNKLATYTQI
G0VNK5      MIAGGA-YL-CIASPVYQSTSLLRIKQD-KGLGDSIMSQVS--GGNTLDDKQRMMTDAEI
D2RIR1      LGLAVA-YL-LIVPNTYQSTALLRIKQE-RGLSSSIMEQLP--IGNAQLTKQQMNTNAEI
I0GRR3      LVAAGA-YL-LITPPTYQSTSLLRIKQE-KGLGDSILSSVA---GNAGMTTQRMNTNAEI
                            :     .                                     

G9RSY8      ------------------------------------------------------------
C4Z673      V-TSRYVIEGVINDLK---------------------------------------LD---
C6CW36      I-SSAAILDKVVEKNPS--------------------------------------LS---
A8SQS9      I-LSYPVLDQVIDKM-N--------------------------------------LN---
D5HFS3      I-LSYPVLDQVIEKL-G--------------------------------------LD---
G0LYN8      I-AGQVVLKPAKQQLSKRYG-----------------------------------IE---
F6ITB3      I-AGQVVLKPAKQQLSKRFG-----------------------------------IE---
G0M1Y0      I-AGQVVLKPAKQQLSKRFG-----------------------------------IE---
D7VC12      I-AGQVVLNPAKQQLSKRYG-----------------------------------IE---
F9UMZ5      I-AGQVVLKPAKQQLSKRYG-----------------------------------IE---
B9Y883      L-KSEAISDEVIQNL-K--------------------------------------LE---
H7F1R6      I-TSPRILSAVSAIL-D--------------------------------------DK---
H7F570      L-KSPGLLNGVAQKI-N--------------------------------------HK---
A5Z5P8      L-HVRPIIEAINEEN-D--------------------------------------LG---
C6LCS6      V-TTRPVLEAVISAL-E--------------------------------------LE---
A7VF43      M-LSYPLLEQVIAKL-D--------------------------------------LS---
C6CSC7      I-KTPAILGKVAEKYPQ--------------------------------------LG---
C6CS79      I-KTPAIMDLVVKKHPE--------------------------------------LG---
F5LM70      I-KTPAIMDLVVKEHPE--------------------------------------YG---
H6LKR9      A-LTRLVIDAVVKNT-G--------------------------------------LNIND
F5LE49      I-KTPAIMEKVASRFTG--------------------------------------EG---
F3AHH1      I-LSRTVTEAVIGKL-D--------------------------------------LD---
H1LCW2      I-TNQLVLKTASERLANPVKVIRSARKARYHVSANGHRHLIKASRPAVVKSTGTPYD---
I5AV00      I-QSREVTEAVSARL-S--------------------------------------MK---
H6NE44      L-RTSAVLEKVAAAYPE--------------------------------------FM---
F4BS20      I-EDPVVIDKVINEL-G--------------------------------------NT---
E0RZL4      I-KSRRVLEEVIQRLHL--------------------------------------TD---
C0CK72      F-TSRPILQEVIDEL-K--------------------------------------LD---
D9S1J8      A-KSRSTLEEVLRRL-N--------------------------------------LN---
C2EFR7      V-KSRAVLENIIEKQ-D--------------------------------------LR---
Q1WTC7      V-KSRAVLENIIEKH-D--------------------------------------LR---
B0P2G1      V-KTRPVLEQVIADL-K--------------------------------------LD---
D4MW28      V-KTRPVLEQVIADL-K--------------------------------------LD---
E5VMX9      V-KTRPVLEQVIADL-K--------------------------------------LD---
F2I6Z8      L-HTPLILQPVAQAH-Q--------------------------------------RD---
E6U7N3      L-TSDTVLDQVISDL-N--------------------------------------LK---
C4Z8M6      V-KGRPVLDQVIENL-N--------------------------------------LN---
D4JMC3      I-TGRTVLSQVIDNL-D--------------------------------------MD---
D6E0V3      I-TGRTVLSQVIDNL-D--------------------------------------MD---
E3GPC7      A-KSKSVVSEVENNL-N--------------------------------------LD---
A6BIG6      V-KSRPVLEKVISEL-N--------------------------------------LD---
C2CI43      V-KSKGIADKVIKNL-G--------------------------------------LD---
D4RX68      V-KSRTVLEQVIANL-D--------------------------------------LK---
D4J4T5      I-KSRSFMEDVIKKL-N--------------------------------------LT---
I5ASF9      I-LSRPVLEKTIKKT-G--------------------------------------LD---
C0C0F9      V-KSRPVLEQVIAVL-N--------------------------------------LD---
B6W7H3      V-KSKGVADKVIDNL-K--------------------------------------LD---
C7RGH5      V-KSKGIAERVINNL-G--------------------------------------LD---
F0GT82      V-KSKGIADQVIKNL-S--------------------------------------LN---
F3AH93      I-KSKPVMEQVIENL-N--------------------------------------LK---
B0GAL4      I-TSRPVLTDVIDQL-D--------------------------------------LD---
G1WUK1      I-TSRPVLTDVIDQL-D--------------------------------------LD---
D4M2S1      I-TSRTVLQDVVDEL-N--------------------------------------LD---
E7GL80      I-GSRPVMQEVINTL-N--------------------------------------LD---
G5F9E3      I-GSRPVMQEVINTL-N--------------------------------------LD---
D4CG07      I-TSRPVLQQVVDEL-G--------------------------------------LE---
D4MP31      I-TSRPVLQQVVDEL-G--------------------------------------LE---
G5HNC6      I-TSRPVLEQVIEKQ-G--------------------------------------LD---
A8RK86      I-TSRPVLEQVIKNQ-G--------------------------------------LN---
G5HTB1      I-TSRPVLEQVIENQ-G--------------------------------------LN---
A8RSL0      V-TSRRVLNQVIEDM-E--------------------------------------LS---
C5EN02      V-TSRRVLNQVIDDM-K--------------------------------------LN---
G5HG46      V-TSRRVLNQVIDEM-E--------------------------------------LG---
E7GL39      V-GSRPVLQGVVDHM-K--------------------------------------LD---
E7GL56      V-SSRPVMEGVINHL-K--------------------------------------LD---
G5F9B0      V-SSRPVMEGVIKHL-K--------------------------------------LD---
D3AC81      V-TSRPVTAQVITNL-D--------------------------------------LN---
D3AE79      V-TSRPVLEQVTENL-G--------------------------------------LN---
D4YF14      I-LGDGVLTEVNNSL-D--------------------------------------GK---
B1YMM6      I-KSPAILEKVQAEVKN--------------------------------------AP---
D4LG05      M-FSYPVLNRVIEKL-K--------------------------------------LD---
D4LTH3      M-LSYPVLNRVIEKL-D--------------------------------------LD---
F3ATF6      A-TSRSVLEEVIEDL-G--------------------------------------LN---
E0I7B6      I-KSKAIMDKVAAAYPD--------------------------------------LG---
C9LAS2      I-TSRPVLDETVKNL-D--------------------------------------LE---
F7K8E8      I-QSRFVLEEVVQGM-G--------------------------------------LD---
F7K9V0      I-QSRFVLEEVVQGM-G--------------------------------------LD---
F7KL97      I-QSRFVLEEVVQGM-G--------------------------------------LD---
D3FZP5      M-KSPYILDQVIDEL-D--------------------------------------LN---
C0ZHV9      I-ESPRVMERVLEVI-G--------------------------------------AG---
D7WMM9      I-TSSAILSKVINKL-D--------------------------------------LD---
A8U9F5      I-KGPVVLNEVRENL-G--------------------------------------TN---
F4BSE0      I-KGPVILNEVRENL-G--------------------------------------TK---
E7RDR2      I-KSPAILDEVASQL-D--------------------------------------LD---
I0JRK5      I-KSPRILDQVVEEL-G--------------------------------------LD---
G2TR26      I-KSPSILDKVIDEL-K--------------------------------------LN---
D5DBK2      I-KSPAILDKVIDKL-K--------------------------------------LD---
D5DY80      I-TSPVILDKVIKEL-K--------------------------------------LD---
A7Z9K1      I-KSPVILDEVIKQL-H--------------------------------------LS---
I2CB17      I-KSPVILDEVIKQL-H--------------------------------------LS---
I2HW54      I-KSPVILDEVIKQL-H--------------------------------------LS---
G4P1M8      I-KSPAILDEVIKEM-G--------------------------------------LS---
E0TTZ7      I-KSPAILDEVIKEM-G--------------------------------------LS---
G4EQF2      I-KSPAILDEVIKEM-G--------------------------------------LS---
P96715      I-KSPAILDEVIKEM-G--------------------------------------LS---
I0F9R7      I-KSPAILDEVIKEM-G--------------------------------------LS---
G9QKR5      I-KSPAVLEKVIKEL-K--------------------------------------LD---
B5UQ74      I-KSPVILEQVKEKL-G--------------------------------------LN---
B7HFH2      I-KSPVILEQVKQKL-N--------------------------------------LN---
Q72XH7      I-KSPVILEQVKEMQ-G--------------------------------------LN---
C2V4M3      I-KSPVILDQVKEKL-G--------------------------------------LN---
C2YZB3      I-KSPVILDQVKEKL-G--------------------------------------LN---
C2P8H2      I-KSPVILDQVKEKL-G--------------------------------------LN---
C2Y451      I-KSPVILDQVKEKL-G--------------------------------------LN---
C3EBC1      I-KSPVILDQVKENL-G--------------------------------------LN---
C3H980      I-KSPVILDQVKEKL-G--------------------------------------LN---
C2PN23      I-KSPVILDQVNEKL-N--------------------------------------LK---
B9IRQ7      I-KSPVILDQVKSKL-G--------------------------------------LN---
A0RL71      I-KSPVILEQVNEKL-N--------------------------------------LN---
C2XJI0      I-KSPVILEQVNEKL-N--------------------------------------LN---
Q3EV65      I-KSPVILEQVNEKL-N--------------------------------------LN---
C2T8T7      I-KSPVILDRVNEKL-N--------------------------------------LN---
C2RG50      I-KSPVILDRVNEKL-N--------------------------------------LN---
Q814Y9      I-KSPVILDRVNEKL-N--------------------------------------LN---
B3ZRD5      I-KSPVILEQVNEKL-N--------------------------------------LN---
Q6HB08      I-KSPVILEQVNEKL-N--------------------------------------LN---
C2NQN7      I-KSPVILEQVNEKL-N--------------------------------------LN---
C3GRR1      I-KSPVILEQVNEKL-N--------------------------------------LN---
C2ULR7      I-KSPVILDQVNEKL-N--------------------------------------LN---
C3GBJ9      I-KSPVILDQVNEKL-N--------------------------------------LN---
C2WVG7      I-KSPVILEQVNEKL-N--------------------------------------LN---
B7IQS9      I-KSPVILEQVNEKL-N--------------------------------------LN---
A9VRC4      I-KSPVVLDQVNEKL-N--------------------------------------LN---
C2MTG4      I-KSPVILDQVNEKL-K--------------------------------------LN---
B7HXB5      I-KSPVILDQVNEKL-N--------------------------------------LN---
C2SBU5      I-KSPVILDQVNEKL-N--------------------------------------LN---
C2SSX9      I-KSPVVLDQVNEKL-N--------------------------------------LN---
G9QCG2      I-KSPVILEQVNEKL-N--------------------------------------LN---
Q2BFS6      I-KSPAILDLVKEEL-D--------------------------------------LD---
I3EBB4      I-KSPAILDLVIKEL-H--------------------------------------LD---
A4ITF4      I-KSPTILEKVKGEL-Q--------------------------------------LD---
C5D962      I-KSPTILEKVKEEL-N--------------------------------------LD---
G8MZ94      I-KSPTILEKVKDEL-H--------------------------------------LD---
Q5KUM4      I-KSPTILEKVKDEL-H--------------------------------------LD---
D4YHG8      V-SRPLVLDPAIADVPEAEG-----------------------------------M----
F7V793      I-RVRTIADDTIKDLHLKYD-----------------------------------Y----
H4GK02      I-TNQVILQEATKDLANPET-----------------------------------SH---
F6IR92      I-TNSVVLKPARQDLMDEHG-----------------------------------LR---
G0M0G0      I-TNSVVLKPARQDLMDEHG-----------------------------------LR---
D7VBW5      I-TKPVVLKPARQTLMAETD-----------------------------------IR---
F9UQ55      I-TKPVVLKPARQTLMAETD-----------------------------------IR---
G2KUP2      I-TSPVIQNTVKKDLAGEPG-----------------------------------MT---
G8PE07      I-MSPAVLRDVDSSLAGQAG-----------------------------------YP---
E0NHP5      I-TSPTVLREADEKLTGLPG-----------------------------------YK---
Q03GL9      I-TSPTVLKTVNTKLQGQPG-----------------------------------YE---
F3Y921      I-KSDSLIGEIHKQLNATAN-----------------------------------IQ---
G4L593      IEEGDALAASMQDRLASDYG-----------------------------------LD---
E6LD65      I-VSDLVLNQVQSRLDTQYK-----------------------------------IA---
C9ALZ8      I-VSDLVLNEVKDRLETEDN-----------------------------------VK---
C9BUG6      I-VSDLVLNEVKDRLETEDN-----------------------------------VK---
Q3XYS7      I-VSDLVLNEVKNRLETEDN-----------------------------------VK---
C9B453      I-VSDLVLNEVKDRLETEDN-----------------------------------VK---
D4RJF5      I-VSDLVLNEVKDRLETEDN-----------------------------------VK---
C8ZXT8      I-VSDLVLNEVKDRLESESN-----------------------------------VK---
F0EKB8      I-VSDLVMTQVKDRLESENN-----------------------------------LD---
C9A6V4      I-VSDLVMTQVKDRLESENN-----------------------------------LD---
C9CHY7      I-VSDLVMTQVKDRLESENN-----------------------------------LD---
D4JI68      V-KGRPVLDQVIENLNLNES-----------------------------------YK---
D6E329      V-KGRPVLDQVIENLNLNES-----------------------------------YK---
E6UHY5      L-DDPLLYESISDKLLKDYD-----------------------------------VD---
E9SAU2      L-DDASVYEAISDRLLEDYK-----------------------------------IE---
F7K0U2      I-KSRSVMEQVISQLQLDMS-----------------------------------VD---
O06029      I-VSPVILDKVRSNLNLSDD----------------------------------------
G8P3D6      I-VSPVILDKVQSNLNLSDD----------------------------------------
A9QSJ3      I-VSPVILDKVQSNLNLSDD----------------------------------------
F9VC43      I-VSPVILDKVQSNLNLSDD----------------------------------------
G6FD41      I-VSPVILDKVQSNLNLSDD----------------------------------------
G9M881      I-VSPVILDKVQSNLNLSDD----------------------------------------
Q3ZK51      I-VSPVILDKVQSNLNLSDD----------------------------------------
Q83VG0      I-VSPVILDKVQSNLNLSDD----------------------------------------
C6LDI9      A-TSRPVVDQVIENLELDMT-----------------------------------YE---
G5F9H3      V-GSRPVLQGVVDHMKLDMT-----------------------------------YR---
C0CZV8      V-TSRPVLEDVIEGLELNTT-----------------------------------YK---
G5GFW1      I-SSRPVLQKVINTLDLKID-----------------------------------YK---
F8KGP2      I-TNQVILSKASKQLKNPVK-----------------------------------V----
B3XL22      I-TNQVILSKASKQLKNPVR-----------------------------------V----
F8DRU3      I-TNQVILSKASKQLKNPVR-----------------------------------V----
C2EWM2      I-TNQVILSKASKQLENPVR-----------------------------------V----
D0DSJ3      I-TNQVILKSASKQLANP------------------------------------------
B2GF32      I-TNQVILKSASKQLANP------------------------------------------
C0WW25      I-TNQVILKSASKQLANP------------------------------------------
F0K0J8      I-TSNVILKGASKYLANPVT-----------------------------------L----
G6F8H0      I-TSNVILKGASKYLANPVT-----------------------------------L----
F0HVF2      I-TSNVILKGASKYLANPVT-----------------------------------L----
Q1G8E3      I-TSNVILKGASKYLANPVT-----------------------------------L----
D6S4X3      V-TSPKILKAASKQLANPVK-----------------------------------V----
Q5FIC6      V-TSNKILTEASNRLANPTV-----------------------------------V----
E4SMV6      V-TSNKILTEASNRLANPTV-----------------------------------V----
F0TGY3      V-TSNKILTEASNRLANPTV-----------------------------------V----
F2M2M7      V-TSNKILTEASNRLANPTV-----------------------------------V----
A4ZGZ7      V-TSHVILQDASDRLANPVR-----------------------------------V----
C2EPK4      V-TSHKILEEASNRLANPTV-----------------------------------V----
C7XKF2      V-TSHVILQDASNRLANPVR-----------------------------------V----
E3R265      V-TSHVILQDASNRLANPVR-----------------------------------V----
D0DJG9      V-TSHVILKDASDRLANPVR-----------------------------------V----
D5GZJ9      V-TSHVILKDASDRLANPVR-----------------------------------V----
A8YX90      V-TSHVILQDASDRLANPVR-----------------------------------V----
F0NWJ8      V-TSHVILQDASDRLANPVR-----------------------------------V----
C2JZS0      I-TRPLVLKTVSKNLTSPQK-----------------------------------VK---
C1J9I2      I-TRPVVLQAVAEDLTSPQR-----------------------------------VM---
Q58Z11      I-TRPVILREVADDLTSPRR-----------------------------------VK---
B1MZT2      V-ISSNVLGDVADKLKQPKT-----------------------------------EV---
C2KHF2      I-ISSNVLGTVSDKLKNPAP-----------------------------------IV---
Q03W94      I-ISSNVLGTVSKELKNPAP-----------------------------------IV---
G2Z8Q4      L-TSSRILDQVKDNLN---------------------------------------LP---
D9ST43      G-RSASVAENASKMLK----------------------------------------D---
H7F5T7      I-KSPKVLNQVSADLK---------------------------------------GE---
G9WIR0      A-TRPVILDQVARNLR---------------------------------------GR---
D3LB11      V-TRPVILNKVAKELK---------------------------------------ST---
A0NKF7      I-TRPVILNKVAKELK---------------------------------------ST---
Q04DV7      I-TRPVILNKVAKELK---------------------------------------ST---
F6BI63      A-TSRSVLQEAINKLN---------------------------------------LN---
G2MWC1      V-KSRRVLQPVIERLR---------------------------------------LP---
B0K4N2      V-KSRRVLQPVIERLR---------------------------------------LP---
C7ISF8      V-KSRRVLQPVIERLR---------------------------------------LP---
B0KAR6      V-KSRRVLQPVIERLR---------------------------------------LP---
E8UV30      V-KSRRVLQPVIERLR---------------------------------------LP---
C0GGR6      A-RSGVVASAVIQDLN---------------------------------------LD---
A4J8V1      A-KSRTVVEKVMQSEK---------------------------------------IN---
C8VYQ7      A-KSRTVAEKIIEQEK---------------------------------------LD---
C8W5K3      A-VSRTVAEKVLQVEK---------------------------------------LD---
B1BNH4      A-KTSDLVTKAVKSAD---------------------------------------LD---
B1V1Z3      A-KTSDLVTKAVKSAD---------------------------------------LD---
B1R3V2      A-KTSDLVTKAVKSAD---------------------------------------LD---
Q0SVR9      A-KTSDLVTKAVKNAK---------------------------------------LD---
Q8XN47      V-KTSDLVTKAVKSAN---------------------------------------LD---
G7M0Q2      I-KTNDLIEKAVDVEN---------------------------------------LD---
G7M565      I-KTNDLIDRAINFSN---------------------------------------LN---
A6M2M0      I-KTNDLVQRAIDSSD---------------------------------------IN---
G7M1R8      V-KTNDLVEKAIEKTG---------------------------------------AD---
Q4JZ56      I-LSDEVLEETISDLK---------------------------------------LE---
Q7X554      I-TSDDVLSEVIKDEK---------------------------------------LN---
Q7X550      I-TSNDVLSEVIKDEK---------------------------------------LN---
Q7X562      I-TSNDVLSEVIKDEK---------------------------------------LN---
Q7X556      I-TSNDVLSEVIKDEK---------------------------------------LN---
Q7X552      I-TSNDVLSEVIKDEK---------------------------------------LN---
Q7X558      I-TSNDVLSEVIKDEK---------------------------------------LN---
C5NWJ9      I-LSNKVMEDAAEKSG---------------------------------------TE---
F3A498      I-LSNKVMEDSAEKSG---------------------------------------LG---
Q9AHD3      I-LSQDVLEEVVSDLK---------------------------------------LD---
Q4K2E2      I-LSQDVLEKVVTDLQ---------------------------------------LD---
Q4K2F8      I-LSQDVLEKVVTDLQ---------------------------------------LD---
Q4K046      I-LSQDVLEKVAANLK---------------------------------------LD---
Q4K0R8      I-LSHDVLEKVATNLK---------------------------------------LD---
Q4JYY0      T-LSHDVLEKVATNLK---------------------------------------LD---
Q4JZW8      T-LSQDVLEKVATNLK---------------------------------------LD---
I0J9C8      I-LSQDVLEKVVTNLK---------------------------------------LD---
Q4K0M4      I-LSQNVLEKVATNLK---------------------------------------LD---
Q4JZS4      I-LSQDVLEKVATNLK---------------------------------------LD---
Q4JZK2      I-LSQDVLEKVATNLK---------------------------------------LD---
Q9AHA5      I-LSQDALEKVATNLK---------------------------------------LD---
Q9X9A0      I-LSQDALEKVATNLK---------------------------------------LD---
Q4JYK9      I-LSQDSLEKVATNLK---------------------------------------LD---
Q4K006      I-LSQDVLEKVATNLK---------------------------------------LD---
Q4JZG8      V-LSQDVLEKVVTNLK---------------------------------------LD---
A6YIA7      I-LSQDALEKVATNLK---------------------------------------LD---
E5F5C4      I-LSQDALEKVATNLK---------------------------------------LD---
Q9AHB8      I-LSQDALEKVATNLK---------------------------------------LD---
Q4JZL8      I-LSQDALEKVATNLK---------------------------------------LD---
Q4K1B8      I-LSQDALEKVATNLK---------------------------------------LD---
Q8VU32      I-LSQDVLEKVATNLK---------------------------------------LD---
D2ERX9      I-LSQDVLEKVATNLK---------------------------------------LD---
G6C7Z0      I-LSQDVLEKVATNLK---------------------------------------LD---
Q4K2A9      I-LSQDVLEKVAINLK---------------------------------------LD---
D6ZQI7      I-LSQDVLEKVATNLK---------------------------------------LD---
Q9ZFT9      I-LSQDVLEKVATNLK---------------------------------------LD---
Q4K255      I-LSQDVLEKVATNLK---------------------------------------LD---
F9HJP7      I-LSQDVLSTVISELK---------------------------------------LS---
E8JWI4      I-LSQDVLASVISELK---------------------------------------LS---
A8AZR4      I-LSQDVLSTVISELK---------------------------------------LP---
D0RXH3      I-LSQDVLSTVISELK---------------------------------------LP---
Q83YR6      I-LSQDVLSTVISELK---------------------------------------LP---
F1Z125      I-TSRDVMKDVIANDG---------------------------------------VS---
Q3K0S9      I-TSTDVLEKVISSEK---------------------------------------LN---
P0C0T8      I-TSTDVLEKVISSEK---------------------------------------LN---
Q67AY5      I-TSTDVLEKVISSEK---------------------------------------LN---
Q04662      I-TSTDVLEKVISSEK---------------------------------------LN---
Q8GP93      I-TLNDVLSEVIKDEK---------------------------------------LN---
Q8GPF7      I-TSNDVLSEVIKDEK---------------------------------------LN---
E3CP61      I-TSNDVLSEVIKDEK---------------------------------------LK---
E8KUY7      I-TSNDVLSEVIKDEK---------------------------------------LK---
C2LSE5      I-TSNDVLSEVIKDEK---------------------------------------LN---
E9DM16      I-TSNDVLSEVIKDEK---------------------------------------LN---
I0QIK5      I-TSNDVLSEVIKDEK---------------------------------------LN---
Q7X560      I-TSNDVLSEVIKDEK---------------------------------------LN---
Q8GMA6      I-TSNDVLSEVIKDEK---------------------------------------LN---
Q55204      I-TSNDVLSEVIKDEK---------------------------------------LN---
Q8GPC4      I-TSNDVLSEVIKDEK---------------------------------------LN---
Q8GPA9      I-TSNDVLSEVIKDEK---------------------------------------LN---
G6ERT2      I-TSNDVLSEVIKDEK---------------------------------------LN---
O87930      I-TSNDVLSEVIKDEK---------------------------------------LN---
Q8GP55      I-TSNDVLSEVIKDEK---------------------------------------LN---
F8HDC4      I-TSNDVLSEVIKDEK---------------------------------------LN---
F8LJ76      I-TSNDVLSEVIKDEK---------------------------------------LN---
F8LXJ5      I-TSNDVLSEVIKDEK---------------------------------------LN---
Q1WCR2      I-TSNDVLSEVIKDEK---------------------------------------LN---
G3G7C0      I-LSQDVLTQIATELN---------------------------------------LN---
G3G7J8      I-LSQDVLTQIATELN---------------------------------------LN---
G8DU30      I-LSQDVLTQVATELN---------------------------------------LK---
A4VTU2      I-LSQDVLTQVATELN---------------------------------------LK---
D5AGQ4      I-LSQDVLTQVATELN---------------------------------------LK---
Q9X4U6      I-LSQDVLTQVATELN---------------------------------------LK---
G3G7G5      I-LSQDVLTQVATELN---------------------------------------LK---
G7SG35      I-LSQDVLTQVATELN---------------------------------------LN---
G8DU06      I-LSQDVLTQVATELN---------------------------------------LN---
G8DUA9      I-LSQDVLTQVATELN---------------------------------------LN---
G8DTY9      I-LSQDVLTQVATELN---------------------------------------LN---
G3G7I7      I-LSQDVLTQVATELN---------------------------------------LK---
G3G7J3      I-LSQDVLSRVKTELG---------------------------------------LT---
E0PD82      I-TSSEVLSSVIDQQK---------------------------------------LA---
F5X651      I-TSSEVLSSVIDQQK---------------------------------------LP---
G5JTD6      I-QSQDVLDDVVKKEK---------------------------------------LD---
Q2KM75      I-TSRDVMHDVIAKEN---------------------------------------VS---
G5KAJ3      I-TSRDVMQDVIASDG---------------------------------------LS---
B9DUJ5      I-TSRDVMKDVIATNS---------------------------------------LS---
G5KD12      I-TSRDVMKDVIANNN---------------------------------------VT---
E8JMT8      I-TSNEVLSSVIDQEN---------------------------------------LS---
F5X0J8      I-TSNEVLSSVISQEN---------------------------------------LS---
H2A601      I-TSNEVLSSVISQEN---------------------------------------LS---
E7S8W2      I-LSQNVLNQAIEELK---------------------------------------LE---
F8DFF5      I-LSQNVLSQAIEELK---------------------------------------LN---
I1ZPH8      I-LSQNVLSQAIEELK---------------------------------------LD---
E3CBR9      I-LSQNVLSQAIEELK---------------------------------------LD---
E8K787      I-LSQNVLSQAIEELK---------------------------------------LD---
F9M365      I-LSQNVLSQAIEELK---------------------------------------LD---
A3CQY3      I-LSQAVLSQAISELK---------------------------------------LQ---
E8KLZ0      I-LSQAVLSQAISELK---------------------------------------LQ---
F0FHA9      I-LSQAVLSQAISELK---------------------------------------LQ---
F0FQQ4      I-LSQAVLSQAISELK---------------------------------------LQ---
F0I4H6      I-LSQAVLSQAISELK---------------------------------------LQ---
F0IAY2      I-LSQAVLSQAISELK---------------------------------------LQ---
F0IJI1      I-LSQAVLSQAISELK---------------------------------------LQ---
F0IS52      I-LSQAVLSQAISELK---------------------------------------LQ---
F2C9N1      I-LSQAVLSQAISELK---------------------------------------LQ---
F2CH54      I-LSQAVLSQAISELK---------------------------------------LQ---
F3UDW8      I-LSQAVLSQAISELK---------------------------------------LQ---
F3UNJ5      I-LSQAVLSQAISELK---------------------------------------LQ---
F3SM33      I-LSQAVLSQAISELK---------------------------------------LQ---
F9HC66      I-LSQDVLEKVISNLK---------------------------------------LE---
E1LQJ6      I-LSQDVLEKVISNLK---------------------------------------LE---
Q4JYU0      I-LSQDVLEKVISNLK---------------------------------------LE---
Q4JZY2      I-ISQDVLEEVISNLK---------------------------------------LE---
F9Q346      I-LSQDVLEKVATDLK---------------------------------------LD---
Q6L5R1      I-LSQDVLEKVATDLK---------------------------------------LD---
E9FEC6      I-LSQDVLEKVATDLK---------------------------------------LD---
E0Q2S9      I-LSQGVLEKVATDLK---------------------------------------LD---
F5VSH0      I-LSQGVLEKVATDLK---------------------------------------LD---
A5YTV6      I-LSQDVLEKVATDLK---------------------------------------LD---
Q6L5T1      I-LSQDVLEKVATDLK---------------------------------------LE---
E0PPH8      I-LSQDVLEKVATDLK---------------------------------------LE---
A5YTT8      I-LSQDVLEKVATDLK---------------------------------------LE---
E6KKR9      I-LSQDVLEKVTTDLK---------------------------------------LE---
A1ILY0      I-LSQDVLEKVATDLK---------------------------------------LE---
F2QF91      I-LSQDVLEKVATDLK---------------------------------------LE---
Q4K0I3      I-LSQDVLEKVATNLK---------------------------------------LD---
Q8KWQ1      I-LSQDVLEKVATNLK---------------------------------------LD---
Q4K238      I-LSQDVLEKVATNLK---------------------------------------LD---
B1I966      I-LSQDVLEKVATNLK---------------------------------------LD---
G6J8A3      I-LSQDVLEKVATNLK---------------------------------------LD---
F9LZC3      I-LSQDVLEKVATNLK---------------------------------------LD---
F9P1W9      I-LSQDVLEKVATNLK---------------------------------------LD---
A5LJR9      I-LSQDALEKVATNLK---------------------------------------LD---
Q9ZII7      I-LSQDALEKVATNLK---------------------------------------LD---
Q4K1K7      I-LSQDVLEEVVSDLK---------------------------------------LD---
E1LPE6      I-LSQDVLEKVVSDLK---------------------------------------LD---
F9MJW6      I-LSQDVLEKVVSDLK---------------------------------------LD---
Q4K0V3      I-LSQDVLEEVVSDLK---------------------------------------LD---
Q54519      I-LSQDVLEEVVSDLK---------------------------------------LD---
C1CBD0      I-LSQDVLEEVVSDLK---------------------------------------LD---
Q7WVX1      I-LSQDVLEEVVSDLK---------------------------------------LD---
Q4K0E2      I-LSQDVLEEVVSDLK---------------------------------------LD---
Q9AH96      I-LSQDVLEEVVSDLK---------------------------------------LD---
A5M4L2      I-LSQDVLEEVVSDLK---------------------------------------LD---
B2ILP4      I-LSQDVLEEVVSDLK---------------------------------------LD---
C1CCB8      I-LSQDVLEEVVSDLK---------------------------------------LD---
P72511      I-LSQYVLEEVVSDLK---------------------------------------LD---
Q4K1S8      I-LSQDVLEEVVSDLK---------------------------------------LD---
P96474      V-LSQDVLEEVISDLK---------------------------------------LD---
Q4K196      I-LSQDVLEEVVSGLK---------------------------------------LD---
Q4K0Z7      I-LSQDVLEEVISDLK---------------------------------------LD---
Q4JZ85      I-LSQDVLEEVISDLK---------------------------------------LD---
Q4JYH6      I-LSQDVLEEVISDLK---------------------------------------LD---
Q4JZ19      I-LSQDVLEEVISDLK---------------------------------------LD---
Q4K0A1      I-LSQDVLEEVISDLK---------------------------------------LD---
Q4K1M5      I-LSQDVLEEVISDLK---------------------------------------LD---
Q4K2Q8      I-LSQDVLEEVVSDLK---------------------------------------LD---
Q4K1G0      I-LSQDVLEEVVSDLK---------------------------------------LD---
Q4K0T6      I-LSQDVLEEVISDLK---------------------------------------LD---
Q4K0K3      I-LSQDVLEEVVSDLK---------------------------------------LD---
Q4K0X6      I-LSQDVLEEVISDLK---------------------------------------LD---
E8KDN1      I-LSQDVLEKVVTEQN---------------------------------------LK---
F9PEU3      I-LSQDVLEKVVADQS---------------------------------------LA---
E8K321      I-LSQDVLEKVVADQS---------------------------------------LT---
F9PZP6      I-LSQDVLEKVVADQK---------------------------------------LT---
D6R2T7      I-LSQAVLSQAISDLQ---------------------------------------LK---
F3UUQ1      I-LSQAVLSQAISDLQ---------------------------------------LK---
E6IZC3      I-LSQDVLAKVISDLK---------------------------------------LN---
G6A746      I-LSQDVLAKVISDLK---------------------------------------LN---
B1V0N8      F-NNEDVVSKLLKKAN---------------------------------------ID---
B1BNK2      F-NNEDVVSKLLKKAN---------------------------------------ID---
B1R3X7      F-NNEDVVSKLLKKAN---------------------------------------ID---
Q8XN77      F-NNEDVVSKLLKKAN---------------------------------------ID---
B1HR40      I-KSPVILTKVIDVLA---------------------------------------LE---
A7Z922      M-KSPVVLEKVKQTLH---------------------------------------LS---
I2CAF3      M-KSPVVLEKVKQTLH---------------------------------------LS---
I2HVL3      M-KSPVVLEKVKQTLH---------------------------------------LS---
E0U2Z4      M-KSTALMEEVKAELH---------------------------------------LS---
D4G1R3      M-KSTALMEEVKAELH---------------------------------------LS---
G4EQZ6      M-KSTALMEEVKAELH---------------------------------------LS---
P71050      M-KSTALMEEVKAELH---------------------------------------LS---
G4P115      M-KSTALMEEVKAELH---------------------------------------LS---
A8FHM0      L-KSPIVIEKVKETLN---------------------------------------LT---
C0EBA5      A-QTPEVIDQVIRKLK---------------------------------------LD---
F8FCE3      L-RTSAVLEKVAAAYP---E-----------------------------------FM---
I0BSG5      L-RTSAVLEKVAAAYP---E-----------------------------------FM---
A8YPQ6      V-KSPRILDEVSKDLN---------------------------------------DK---
P95695      V-KSPRILDEVSKDLN---------------------------------------DK---
Q2G1K8      V-KSPRILDEVSKDLN---------------------------------------DK---
C5QNG5      I-KSPRILDDVAKE-N---------------------------------------KD---
Q4L9H8      L-KSPRILDEVAKK-D---------------------------------------NK---
Q2FUV1      I-KSPRILDKVSREFD---------------------------------------GQ---
P39850      V-KSPRILDKVSKELD---------------------------------------DK---
D7UYE3      I-KSPRILESVSKNLD---------------------------------------RE---
Q4A121      I-KSPRILDKVSKNLK---------------------------------------GK---
C9AAE4      I-MSPRILNEVSEALE---------------------------------------GS---
H7F6C7      I-SSPRILNEVQQDLG---------------------------------------KQ---
F0SX23      I-QSDTVLEKVITTLG-LPP-----------------------------------SN---
Q38VG4      I-TKPVIMDSVTKKINDGKT-----------------------------------NK---
F2I4B6      I-RNEVVLSPVIDQLN---------------------------------------LQ---
Q8RBS6      V-KSRRVLQPVVTKLN---------------------------------------LP---
D9SR42      A-KSRKVADDVKEKLS---------------------------------------LN---
D9SVC8      A-TSRTVASDVIDKLS---------------------------------------LN---
E7RG09      L-KSPIILDQVISQLD---------------------------------------LE---
D4G2E2      I-KSPAILDEVIKEMG---------------------------------------LS---
Q8EME7      I-KSPAILDTVATELQ---------------------------------------LD---
D6Y035      L-KSPYILDQVVDELE---------------------------------------LE---
Q5WBB3      I-KSPRILNEVIEAEG---------------------------------------LD---
Q9K6Q9      I-KSPAILDKVIDNLQ---------------------------------------LE---
Q97EP7      A-ESRSVASKTVSKLS---------------------------------------NG---
Q97ER4      A-QSKQVADKTVSKLA---------------------------------------DG---
E4S7Y7      A-VSRTVLERVIKELN---------------------------------------LK---
E4Q5T6      A-VSRTVLERVIKELN---------------------------------------LK---
E4SDX3      A-VSRTVLERVIKELN---------------------------------------LN---
G2FWX3      A-KSRTVEQNVINGLE---------------------------------------LP---
G7WJV2      A-QSRTVEEKVIKELN---------------------------------------LE---
G7W774      A-QSRTVEQSVIDDLD---------------------------------------LS---
G2FM60      A-QSRTVEQNVLKDLN---------------------------------------LP---
H5XZD5      A-QSRTVEEKVIEELD---------------------------------------LE---
I4DBG9      A-QSRTVEEQVIKDLD---------------------------------------LP---
G2FWT7      A-QSRTVEQSVLNDLN---------------------------------------LA---
H5XZG8      A-QSRTVEQNVINNLD---------------------------------------LP---
G0V448      A-KSRTVVEKTIQKLS---------------------------------------KQ---
A0PZ01      A-KTNDVLEQVIEKLN---------------------------------------LD---
B1B737      A-KTNDVLEKVIEKLK---------------------------------------LD---
G5IFS2      V-TSRPVTSKVIENLDLNLDHEQ-------------------------------------
B8D0N1      L-KTRKLLKKVSQHFDENKVSVK-------------------------------------
D9QTC7      L-KSRSIIQQTIEELELKSKETGELIS---------------------------------
G0VNK5      L-KSRNVVLPVIEKTEERNDDGELPDY---------------------------------
D2RIR1      L-KSRHVVIPVIEQTEE-EKDGKYPRY---------------------------------
I0GRR3      L-KSRNVIEPVIEKTEEPNKDGKLPSY---------------------------------
                                                                        

G9RSY8      ------------------------------------------------------------
C4Z673      ------------ET----------------------------------------------
C6CW36      ------------DS----------------------------------------------
A8SQS9      ------------MD----------------------------------------------
D5HFS3      ------------MD----------------------------------------------
G0LYN8      ------------RS----------------------------------------------
F6ITB3      ------------RS----------------------------------------------
G0M1Y0      ------------RS----------------------------------------------
D7VC12      ------------RS----------------------------------------------
F9UMZ5      ------------RS----------------------------------------------
B9Y883      -----------DLD----------------------------------------------
H7F1R6      ------------YS----------------------------------------------
H7F570      ------------YS----------------------------------------------
A5Z5P8      ------------YT----------------------------------------------
C6LCS6      -----------NIS----------------------------------------------
A7VF43      ------------YD----------------------------------------------
C6CSC7      ------------LS----------------------------------------------
C6CS79      ------------LT----------------------------------------------
F5LM70      ------------VT----------------------------------------------
H6LKR9      NESKNGITGKSSMT----------------------------------------------
F5LE49      ------------LT----------------------------------------------
F3AHH1      ------------LK----------------------------------------------
H1LCW2      ------------VS----------------------------------------------
I5AV00      ------NTVGGYIS----------------------------------------------
H6NE44      ------------LT----------------------------------------------
F4BS20      ------------MS----------------------------------------------
E0RZL4      ------------ME----------------------------------------------
C0CK72      ------------MD----------------------------------------------
D9S1J8      ------------TT----------------------------------------------
C2EFR7      ------------YS----------------------------------------------
Q1WTC7      ------------YS----------------------------------------------
B0P2G1      ------------MD----------------------------------------------
D4MW28      ------------MD----------------------------------------------
E5VMX9      ------------MD----------------------------------------------
F2I6Z8      ------------V-----------------------------------------------
E6U7N3      ------------TD----------------------------------------------
C4Z8M6      ------------ES----------------------------------------------
D4JMC3      ------------ET----------------------------------------------
D6E0V3      ------------ET----------------------------------------------
E3GPC7      ------------LS----------------------------------------------
A6BIG6      ------------ME----------------------------------------------
C2CI43      ------------MD----------------------------------------------
D4RX68      ------------YS----------------------------------------------
D4J4T5      ------------ID----------------------------------------------
I5ASF9      ------------MD----------------------------------------------
C0C0F9      ------------ME----------------------------------------------
B6W7H3      ------------MD----------------------------------------------
C7RGH5      ------------MD----------------------------------------------
F0GT82      ------------MG----------------------------------------------
F3AH93      ------------IS----------------------------------------------
B0GAL4      ------------MD----------------------------------------------
G1WUK1      ------------MD----------------------------------------------
D4M2S1      ------------MT----------------------------------------------
E7GL80      ------------IT----------------------------------------------
G5F9E3      ------------IT----------------------------------------------
D4CG07      ------------YG----------------------------------------------
D4MP31      ------------YG----------------------------------------------
G5HNC6      ------------LT----------------------------------------------
A8RK86      ------------MT----------------------------------------------
G5HTB1      ------------LS----------------------------------------------
A8RSL0      ------------LT----------------------------------------------
C5EN02      ------------LT----------------------------------------------
G5HG46      ------------LT----------------------------------------------
E7GL39      ------------MT----------------------------------------------
E7GL56      ------------YS----------------------------------------------
G5F9B0      ------------YS----------------------------------------------
D3AC81      ------------LS----------------------------------------------
D3AE79      ------------LG----------------------------------------------
D4YF14      ------------FT----------------------------------------------
B1YMM6      ------------DS----------------------------------------------
D4LG05      ------------MD----------------------------------------------
D4LTH3      ------------MD----------------------------------------------
F3ATF6      ------------MN----------------------------------------------
E0I7B6      ------------LS----------------------------------------------
C9LAS2      ------------LP----------------------------------------------
F7K8E8      ------------LS----------------------------------------------
F7K9V0      ------------LS----------------------------------------------
F7KL97      ------------LS----------------------------------------------
D3FZP5      ------------RT----------------------------------------------
C0ZHV9      ------------ST----------------------------------------------
D7WMM9      ------------VT----------------------------------------------
A8U9F5      ------------LT----------------------------------------------
F4BSE0      ------------LT----------------------------------------------
E7RDR2      ------------MS----------------------------------------------
I0JRK5      ------------MT----------------------------------------------
G2TR26      ------------MT----------------------------------------------
D5DBK2      ------------SS----------------------------------------------
D5DY80      ------------GS----------------------------------------------
A7Z9K1      ------------MT----------------------------------------------
I2CB17      ------------MT----------------------------------------------
I2HW54      ------------MT----------------------------------------------
G4P1M8      ------------MT----------------------------------------------
E0TTZ7      ------------MT----------------------------------------------
G4EQF2      ------------MT----------------------------------------------
P96715      ------------MT----------------------------------------------
I0F9R7      ------------MT----------------------------------------------
G9QKR5      ------------MT----------------------------------------------
B5UQ74      ------------IP----------------------------------------------
B7HFH2      ------------TT----------------------------------------------
Q72XH7      ------------IT----------------------------------------------
C2V4M3      ------------IA----------------------------------------------
C2YZB3      ------------IT----------------------------------------------
C2P8H2      ------------IT----------------------------------------------
C2Y451      ------------IT----------------------------------------------
C3EBC1      ------------IT----------------------------------------------
C3H980      ------------MT----------------------------------------------
C2PN23      ------------MT----------------------------------------------
B9IRQ7      ------------IT----------------------------------------------
A0RL71      ------------MT----------------------------------------------
C2XJI0      ------------MT----------------------------------------------
Q3EV65      ------------MT----------------------------------------------
C2T8T7      ------------MT----------------------------------------------
C2RG50      ------------MT----------------------------------------------
Q814Y9      ------------MT----------------------------------------------
B3ZRD5      ------------MT----------------------------------------------
Q6HB08      ------------MT----------------------------------------------
C2NQN7      ------------MT----------------------------------------------
C3GRR1      ------------MT----------------------------------------------
C2ULR7      ------------MT----------------------------------------------
C3GBJ9      ------------MT----------------------------------------------
C2WVG7      ------------MT----------------------------------------------
B7IQS9      ------------MT----------------------------------------------
A9VRC4      ------------MT----------------------------------------------
C2MTG4      ------------MT----------------------------------------------
B7HXB5      ------------MT----------------------------------------------
C2SBU5      ------------MT----------------------------------------------
C2SSX9      ------------MT----------------------------------------------
G9QCG2      ------------MT----------------------------------------------
Q2BFS6      ------------IT----------------------------------------------
I3EBB4      ------------MT----------------------------------------------
A4ITF4      ------------QT----------------------------------------------
C5D962      ------------LT----------------------------------------------
G8MZ94      ------------RT----------------------------------------------
Q5KUM4      ------------RT----------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
H4GK02      -----------------------------------------------------ANGKAYD
F6IR92      -----------------------------------------------------R------
G0M0G0      -----------------------------------------------------R------
D7VBW5      -----------------------------------------------------R------
F9UQ55      -----------------------------------------------------R------
G2KUP2      -----------------------------------------------------KK-----
G8PE07      -----------------------------------------------------GE-----
E0NHP5      -----------------------------------------------------SG-----
Q03GL9      -----------------------------------------------------KG-----
F3Y921      ------------LS----------------------------------------------
G4L593      ------------MT----------------------------------------------
E6LD65      ------------ME----------------------------------------------
C9ALZ8      ------------MT----------------------------------------------
C9BUG6      ------------MT----------------------------------------------
Q3XYS7      ------------MT----------------------------------------------
C9B453      ------------MT----------------------------------------------
D4RJF5      ------------MT----------------------------------------------
C8ZXT8      ------------MT----------------------------------------------
F0EKB8      ------------LT----------------------------------------------
C9A6V4      ------------LT----------------------------------------------
C9CHY7      ------------LT----------------------------------------------
D4JI68      ------------TL----------------------------------------------
D6E329      ------------TL----------------------------------------------
E6UHY5      ------------DLKNYFT-------------------------------ISVDEKGNEY
E9SAU2      ------------DLRNYFT-------------------------------VATDEKGKEY
F7K0U2      ------------KL----------------------------------------------
O06029      ------------SF----------------------------------------------
G8P3D6      ------------SF----------------------------------------------
A9QSJ3      ------------SF----------------------------------------------
F9VC43      ------------AF----------------------------------------------
G6FD41      ------------SF----------------------------------------------
G9M881      ------------SF----------------------------------------------
Q3ZK51      ------------SF----------------------------------------------
Q83VG0      ------------SF----------------------------------------------
C6LDI9      ------------NL----------------------------------------------
G5F9H3      ------------EL----------------------------------------------
C0CZV8      ------------DL----------------------------------------------
G5GFW1      ------------EL----------------------------------------------
F8KGP2      ------------IKPAQPA---EYRRNADGT-----RKLIKE---AQPAVVE-RGGKSYN
B3XL22      ------------IKPAQPA---EYRRNADGT-----RRLIKE---AQPAVVE-RGGKSYS
F8DRU3      ------------IKPAQPA---EYRRNADGT-----RKLIKE---AQPAVVE-RGGKSYN
C2EWM2      ------------ITPAKKA---VYERNANGR-----RVLVRS---AKPAVVERTNGKSYH
D0DSJ3      ----------------------------------------------------SGSQRAYA
B2GF32      ----------------------------------------------------SGSQRAYT
C0WW25      ----------------------------------------------------SGSQRAYA
F0K0J8      ------------VKKATPA---------------------KKAVKAKPAVYK-RESKSYS
G6F8H0      ------------VKKATPAKKAVYKTN-DGT-----RTLVKKAVKAKPAVYK-RESKSYS
F0HVF2      ------------VKKATPAKKAVYKTNDDGT-----RTLVKKAVNAKPAVYK-RESKSYS
Q1G8E3      ------------VKKATPA---------------------KKAVKAKPAVYK-RESKSYS
D6S4X3      ------------VKEAVPA---KYETLADGT-----KKLVKK---AQPAVLE-RSGKSYT
Q5FIC6      ------------VKKAQKA---VYRTDENGR-----RRLVRK---AQPAVIE-RSGKSYS
E4SMV6      ------------VKKAQKA---VYRTDENGR-----RRLVRK---ARPAVIE-RSGKSYS
F0TGY3      ------------VKKAQKA---VYRTDENGR-----RRLVRK---ARPAVIE-RSGKSYS
F2M2M7      ------------VKKAQKA---VYRTDENGR-----RRLVRK---ARPAVIE-RSGKSYS
A4ZGZ7      ------------VKKAKPA---KYKT-IDGR-----KVLVRK---AQPAVIE-RDGKSYS
C2EPK4      ------------VKKAKKA---VYRIDENGR-----RRLVRR---AQPAVIE-RSGKSYV
C7XKF2      ------------VKKAKPA---KYKTNAEGR-----RVLVRK---AQPEVVE-RSGKSYS
E3R265      ------------VKKAKPA---KYKTNAEGR-----RVLVRK---AQPEVVE-RSGKSYS
D0DJG9      ------------VRKARPA---KYRTNEEGR-----RVLVRK---AQPEVVE-RSGKSYS
D5GZJ9      ------------VRKARPA---KYRTNEEGR-----RVLVRK---AQPEVVE-RSGKSYS
A8YX90      ------------VKKAKPA---KYRTNADGR-----RVLVRK---AQPAVIE-RDGKSYS
F0NWJ8      ------------VMKAKPA---KYRTNADGR-----RVLVRK---AQPAVIE-RDGKSYS
C2JZS0      ------------VQKAEKA---VYGTRYNSITGVQEKYLVKK---EQPAKYKLEPAKYDN
C1J9I2      ------------VKKAKPA---VYGTRYNAATGTRERYVTEE---AQPAKYKLKPAKYSN
Q58Z11      ------------VKKAQKA---VYGTRYNAATGVRERYVVKE---EQPAKYKLKPAKYAN
B1MZT2      ------------VQPAKPA---VYETLADGT-----RRLVSP---EQKEITKTSSQQTYD
C2KHF2      ------------VQKAKDA---VYKTLADGT-----RRLVTP---AQKEITKPSNKKKYY
Q03W94      ------------VQEAQDA---EYKTLADGT-----QRLVTP---AKKRITKPSTKTKYN
G2Z8Q4      ------------QS----------------------------------------------
D9ST43      ------------VS----------------------------------------------
H7F5T7      ------------YT----------------------------------------------
G9WIR0      ------------YP----------------------------------------------
D3LB11      ------------YP----------------------------------------------
A0NKF7      ------------YP----------------------------------------------
Q04DV7      ------------YP----------------------------------------------
F6BI63      ------------MT----------------------------------------------
G2MWC1      ------------LT----------------------------------------------
B0K4N2      ------------LT----------------------------------------------
C7ISF8      ------------LT----------------------------------------------
B0KAR6      ------------LT----------------------------------------------
E8UV30      ------------LT----------------------------------------------
C0GGR6      ------------MS----------------------------------------------
A4J8V1      ------------TT----------------------------------------------
C8VYQ7      ------------IT----------------------------------------------
C8W5K3      ------------IT----------------------------------------------
B1BNH4      ------------YN----------------------------------------------
B1V1Z3      ------------YN----------------------------------------------
B1R3V2      ------------YN----------------------------------------------
Q0SVR9      ------------YN----------------------------------------------
Q8XN47      ------------YN----------------------------------------------
G7M0Q2      ------------VK----------------------------------------------
G7M565      ------------LS----------------------------------------------
A6M2M0      ------------LN----------------------------------------------
G7M1R8      ------------IN----------------------------------------------
Q4JZ56      ------------ST----------------------------------------------
Q7X554      ------------LS----------------------------------------------
Q7X550      ------------MT----------------------------------------------
Q7X562      ------------MT----------------------------------------------
Q7X556      ------------LS----------------------------------------------
Q7X552      ------------LS----------------------------------------------
Q7X558      ------------LS----------------------------------------------
C5NWJ9      ------------IT----------------------------------------------
F3A498      ------------LT----------------------------------------------
Q9AHD3      ------------LT----------------------------------------------
Q4K2E2      ------------MP----------------------------------------------
Q4K2F8      ------------MP----------------------------------------------
Q4K046      ------------MP----------------------------------------------
Q4K0R8      ------------MP----------------------------------------------
Q4JYY0      ------------MP----------------------------------------------
Q4JZW8      ------------MP----------------------------------------------
I0J9C8      ------------MP----------------------------------------------
Q4K0M4      ------------MP----------------------------------------------
Q4JZS4      ------------MP----------------------------------------------
Q4JZK2      ------------MP----------------------------------------------
Q9AHA5      ------------MP----------------------------------------------
Q9X9A0      ------------MP----------------------------------------------
Q4JYK9      ------------MP----------------------------------------------
Q4K006      ------------MP----------------------------------------------
Q4JZG8      ------------MP----------------------------------------------
A6YIA7      ------------MP----------------------------------------------
E5F5C4      ------------MP----------------------------------------------
Q9AHB8      ------------MP----------------------------------------------
Q4JZL8      ------------IP----------------------------------------------
Q4K1B8      ------------MP----------------------------------------------
Q8VU32      ------------MP----------------------------------------------
D2ERX9      ------------MP----------------------------------------------
G6C7Z0      ------------MP----------------------------------------------
Q4K2A9      ------------MP----------------------------------------------
D6ZQI7      ------------IP----------------------------------------------
Q9ZFT9      ------------MP----------------------------------------------
Q4K255      ------------MP----------------------------------------------
F9HJP7      ------------ST----------------------------------------------
E8JWI4      ------------GS----------------------------------------------
A8AZR4      ------------GT----------------------------------------------
D0RXH3      ------------GT----------------------------------------------
Q83YR6      ------------GT----------------------------------------------
F1Z125      ------------MT----------------------------------------------
Q3K0S9      ------------YP----------------------------------------------
P0C0T8      ------------YP----------------------------------------------
Q67AY5      ------------YP----------------------------------------------
Q04662      ------------YP----------------------------------------------
Q8GP93      ------------MT----------------------------------------------
Q8GPF7      ------------LS----------------------------------------------
E3CP61      ------------MT----------------------------------------------
E8KUY7      ------------MT----------------------------------------------
C2LSE5      ------------MT----------------------------------------------
E9DM16      ------------MT----------------------------------------------
I0QIK5      ------------MT----------------------------------------------
Q7X560      ------------MT----------------------------------------------
Q8GMA6      ------------LS----------------------------------------------
Q55204      ------------MT----------------------------------------------
Q8GPC4      ------------MT----------------------------------------------
Q8GPA9      ------------MT----------------------------------------------
G6ERT2      ------------LS----------------------------------------------
O87930      ------------LS----------------------------------------------
Q8GP55      ------------LS----------------------------------------------
F8HDC4      ------------LS----------------------------------------------
F8LJ76      ------------LS----------------------------------------------
F8LXJ5      ------------MT----------------------------------------------
Q1WCR2      ------------MT----------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------LS----------------------------------------------
F5X651      ------------LS----------------------------------------------
G5JTD6      ------------IS----------------------------------------------
Q2KM75      ------------MS----------------------------------------------
G5KAJ3      ------------LT----------------------------------------------
B9DUJ5      ------------LS----------------------------------------------
G5KD12      ------------LT----------------------------------------------
E8JMT8      ------------LS----------------------------------------------
F5X0J8      ------------LS----------------------------------------------
H2A601      ------------LS----------------------------------------------
E7S8W2      ------------MT----------------------------------------------
F8DFF5      ------------MT----------------------------------------------
I1ZPH8      ------------MT----------------------------------------------
E3CBR9      ------------LT----------------------------------------------
E8K787      ------------MT----------------------------------------------
F9M365      ------------LT----------------------------------------------
A3CQY3      ------------TS----------------------------------------------
E8KLZ0      ------------TS----------------------------------------------
F0FHA9      ------------TS----------------------------------------------
F0FQQ4      ------------TS----------------------------------------------
F0I4H6      ------------TS----------------------------------------------
F0IAY2      ------------TS----------------------------------------------
F0IJI1      ------------TS----------------------------------------------
F0IS52      ------------TS----------------------------------------------
F2C9N1      ------------TS----------------------------------------------
F2CH54      ------------TS----------------------------------------------
F3UDW8      ------------TS----------------------------------------------
F3UNJ5      ------------TS----------------------------------------------
F3SM33      ------------TS----------------------------------------------
F9HC66      ------------KT----------------------------------------------
E1LQJ6      ------------KT----------------------------------------------
Q4JYU0      ------------KT----------------------------------------------
Q4JZY2      ------------KT----------------------------------------------
F9Q346      ------------LP----------------------------------------------
Q6L5R1      ------------LP----------------------------------------------
E9FEC6      ------------LP----------------------------------------------
E0Q2S9      ------------LP----------------------------------------------
F5VSH0      ------------LP----------------------------------------------
A5YTV6      ------------LP----------------------------------------------
Q6L5T1      ------------LP----------------------------------------------
E0PPH8      ------------LP----------------------------------------------
A5YTT8      ------------LP----------------------------------------------
E6KKR9      ------------LP----------------------------------------------
A1ILY0      ------------LP----------------------------------------------
F2QF91      ------------LP----------------------------------------------
Q4K0I3      ------------IP----------------------------------------------
Q8KWQ1      ------------MP----------------------------------------------
Q4K238      ------------IP----------------------------------------------
B1I966      ------------IP----------------------------------------------
G6J8A3      ------------IP----------------------------------------------
F9LZC3      ------------MP----------------------------------------------
F9P1W9      ------------MA----------------------------------------------
A5LJR9      ------------MP----------------------------------------------
Q9ZII7      ------------MP----------------------------------------------
Q4K1K7      ------------LT----------------------------------------------
E1LPE6      ------------LT----------------------------------------------
F9MJW6      ------------LT----------------------------------------------
Q4K0V3      ------------LT----------------------------------------------
Q54519      ------------LT----------------------------------------------
C1CBD0      ------------LT----------------------------------------------
Q7WVX1      ------------LT----------------------------------------------
Q4K0E2      ------------LT----------------------------------------------
Q9AH96      ------------LT----------------------------------------------
A5M4L2      ------------LT----------------------------------------------
B2ILP4      ------------LT----------------------------------------------
C1CCB8      ------------LT----------------------------------------------
P72511      ------------LT----------------------------------------------
Q4K1S8      ------------LT----------------------------------------------
P96474      ------------LM----------------------------------------------
Q4K196      ------------LT----------------------------------------------
Q4K0Z7      ------------LT----------------------------------------------
Q4JZ85      ------------LT----------------------------------------------
Q4JYH6      ------------LT----------------------------------------------
Q4JZ19      ------------LT----------------------------------------------
Q4K0A1      ------------LT----------------------------------------------
Q4K1M5      ------------LT----------------------------------------------
Q4K2Q8      ------------LT----------------------------------------------
Q4K1G0      ------------LT----------------------------------------------
Q4K0T6      ------------LT----------------------------------------------
Q4K0K3      ------------LT----------------------------------------------
Q4K0X6      ------------LT----------------------------------------------
E8KDN1      ------------FD----------------------------------------------
F9PEU3      ------------MD----------------------------------------------
E8K321      ------------ID----------------------------------------------
F9PZP6      ------------MD----------------------------------------------
D6R2T7      ------------IS----------------------------------------------
F3UUQ1      ------------IS----------------------------------------------
E6IZC3      ------------MQ----------------------------------------------
G6A746      ------------MQ----------------------------------------------
B1V0N8      ------------LP----------------------------------------------
B1BNK2      ------------LP----------------------------------------------
B1R3X7      ------------LP----------------------------------------------
Q8XN77      ------------LP----------------------------------------------
B1HR40      ------------TS----------------------------------------------
A7Z922      ------------ET----------------------------------------------
I2CAF3      ------------ET----------------------------------------------
I2HVL3      ------------ET----------------------------------------------
E0U2Z4      ------------ES----------------------------------------------
D4G1R3      ------------ES----------------------------------------------
G4EQZ6      ------------ES----------------------------------------------
P71050      ------------ES----------------------------------------------
G4P115      ------------ES----------------------------------------------
A8FHM0      ------------ES----------------------------------------------
C0EBA5      ------------MT----------------------------------------------
F8FCE3      ------------LT----------------------------------------------
I0BSG5      ------------LT----------------------------------------------
A8YPQ6      ------------YS----------------------------------------------
P95695      ------------YS----------------------------------------------
Q2G1K8      ------------YS----------------------------------------------
C5QNG5      ------------YS----------------------------------------------
Q4L9H8      ------------YS----------------------------------------------
Q2FUV1      ------------YS----------------------------------------------
P39850      ------------YS----------------------------------------------
D7UYE3      ------------FS----------------------------------------------
Q4A121      ------------YS----------------------------------------------
C9AAE4      ------------YD----------------------------------------------
H7F6C7      ------------YD----------------------------------------------
F0SX23      ------------EQ----------------------------------------------
Q38VG4      ------------LS----------------------------------------------
F2I4B6      ------------EN----------------------------------------------
Q8RBS6      ------------MS----------------------------------------------
D9SR42      ------------MS----------------------------------------------
D9SVC8      ------------YS----------------------------------------------
E7RG09      ------------MS----------------------------------------------
D4G2E2      ------------MT----------------------------------------------
Q8EME7      ------------LT----------------------------------------------
D6Y035      ------------ES----------------------------------------------
Q5WBB3      ------------MT----------------------------------------------
Q9K6Q9      ------------DT----------------------------------------------
Q97EP7      ------------TT----------------------------------------------
Q97ER4      ------------TT----------------------------------------------
E4S7Y7      ------------IS----------------------------------------------
E4Q5T6      ------------MT----------------------------------------------
E4SDX3      ------------MT----------------------------------------------
G2FWX3      ------------LT----------------------------------------------
G7WJV2      ------------LT----------------------------------------------
G7W774      ------------LT----------------------------------------------
G2FM60      ------------LT----------------------------------------------
H5XZD5      ------------LT----------------------------------------------
I4DBG9      ------------LT----------------------------------------------
G2FWT7      ------------LT----------------------------------------------
H5XZG8      ------------LT----------------------------------------------
G0V448      ------------VT----------------------------------------------
A0PZ01      ------------VT----------------------------------------------
B1B737      ------------VT----------------------------------------------
G5IFS2      ------------------------------------------------------------
B8D0N1      ------------------------------------------------------------
D9QTC7      ------------------------------------------------------------
G0VNK5      ------------------------------------------------------------
D2RIR1      ------------------------------------------------------------
I0GRR3      ------------------------------------------------------------
                                                                        

G9RSY8      ---------EDQAAAQAPIT----------------------------------------
C4Z673      --YESL---VKRVSASNATD--T-RIIAITVTDPEPEQAQKIANSVRDLAAKHITEVM--
C6CW36      --SYEM---SKILQVYSYEN--S-QVLNLTYQATSYESAAETVNAISLVFKEEIPKIM--
A8SQS9      --SEQL---AKMISLVNPTD--T-RVLQIVVTSTDKQQACDIANTLANVAIDYLPDTM--
D5HFS3      --SEGL---AKMITLENPSD--T-RVLKITVTSTDKQQACDIANTLANVSIEYLPDTM--
G0LYN8      --LSTL---KSEVSVTSTAN--S-QVFSISVTDTNAKASATIANQIARSFKNQVQKII--
F6ITB3      --LNTL---KSEVSVTSTTN--S-QVFSIAVTDADAKASATIANQIARSFKNQVKKII--
G0M1Y0      --LNTL---KSEVSVTSTTN--S-QVFSIAVTDADAKASATIANQIARSFKNQVKKII--
D7VC12      --LNSL---KSEVSVTSTTN--S-QVFSIAVTDANAKASATIANQIARSFKNQVQKII--
F9UMZ5      --LNTL---KSEVSVTSTTN--S-QVFSIAVTDADAKASATIANQIARSFKNQVQKII--
B9Y883      --TEGY---QKIVKISSVKD--T-EVITIAVTSKDPKEAAVIANEIVDVFRDKIYSIM--
H7F1R6      --IKEL---SNMINVSNASD--S-QVIRIQVESKNPKDAVKIANETVRVFKKEIPKIM--
H7F570      --VKEL---SEMVDVSSTSD--S-QVITISVEGENAKDIVKIANDVVQTFRNEIPKIM--
A5Z5P8      --YEQL---NGMIDISTVED--T-RILKISATSIKPEEAKTIANALAEKAVTEIPKLM--
C6LCS6      --YEEL---ADKISVSTATD--G-RIISIRATDENPQEAKAIADEVRNAVSAQIIKVM--
A7VF43      --YEQL---ADMITLENPTD--T-RVLKITVTSTDPEEAMNIANTLAEISVKYLPETM--
C6CSC7      --AKEL---TKKISVSSVNG--T-QVMTLAVQDVSYQQAAKIVNAISLVFQQEIPNIF--
C6CS79      --TQQL---MHNIRFSSVNG--T-QVVTISYLDTDYKRAAQVVNTVSYVFQQQIPLIM--
F5LM70      --SDDL---MRRIQFSSVSD--T-QIFTLSLEDASYSKAAQMINTVAQMFQKQIPNIM--
H6LKR9      --YTDF---QKNTEIEAINN--S-RLFTVGFKDPDPEIAKKVSDELAKQLTIAVSQIV--
F5LE49      --SDML---AGMTKVTSIAD--T-QVMTITATADNYATAAKLANAVSDVFKAEISGIM--
F3AHH1      --PEQL---ASKVEIGNTTD--T-RIVTIKVTDADPYQARDIANTLRDTAAEHIKNVM--
H1LCW2      --VKQL---QGAISVTNQQN--S-QVFALNVKSDDPQKSAAIANTVAKVFKQKIRRIM--
I5AV00      --PSAI---RGMIRVSVADN--T-RVITIYITDFDPFRACDIANCVREEAAKHITNVM--
H6NE44      --PEQM---AEMLEVKQSSD--S-QVMTLVIRDTDYRRAAETVNAISYTFQKEIENVM--
F4BS20      --EVEL---QQKVEVITQDD--S-QIFGIKVTDTDPNRAAEMANLMAATFQENIDGII--
E0RZL4      --YKDL---YDVLKVDTPSD--T-RIVAITVRDKDPLMAMKIANCIREVASEHITNVM--
C0CK72      --YKEL---QARIELSNPTD--T-RILKVEYKDKDPKMASKVVNTLVQVSMDSVKEI---
D9S1J8      --YEKL---KSRIKVNLVKN--T-EIIEIRVSDHDPVMAATIANAVSESFSRQVIRIM--
C2EFR7      --YGEL---SKKVNAENKDE--T-QIISISVTDPNPVVAQRLANSIRDESIKHVTKVM--
Q1WTC7      --YGEL---SKKVNAENKDE--T-QIISISVTDPNPVVAQRLANSIRDESIKHVTKVM--
B0P2G1      --YKEL---EKKITVENPSD--T-RIMQITITDKDAALAQSITQDLAEVTAKTVAEKM--
D4MW28      --YKEL---EKKITVENPSD--T-RIMQITITDKDAALAQSITQDLAEVTAKTVAEKM--
E5VMX9      --YKEL---ENKITVENPSD--T-RIMQITITDKDAALAQSITQDLAEVTAKTVAEKM--
F2I6Z8      ---ETL---SENIHLEADQQ--S-AVFNVIVTDDNASQAQGLASDISKEFIQQLPQVL--
E6U7N3      --ASAL---AKNISVEGVNQ--T-QVLKITVKDTNPQVAKNIANDIARVAPSIIIQTV--
C4Z8M6      --YKTL---GGRVTLDNPSN--S-RVLNITVTDPDPQMAKTIADEIAKVASAYIAEKM--
D4JMC3      --YEQL---SKRVSIENPTD--T-RVLKIVVTDTDLEASKTVADEIAKVSSQYIADNM--
D6E0V3      --YEQL---SKRVSIENPTD--T-RVLKIVVTDTDLEASKTVADEIAKVSSQYIADNM--
E3GPC7      --DGQL---SKMIDVTTVND--T-ELIKITVTDEDPVEAASIANETAKVFMSNIGELM--
A6BIG6      --PEDL---EEMITTETPTE--T-RIMSIYVQSTSPKQAKQIADAVRNAVSVQIKQIM--
C2CI43      --YEEF---SSKVSIEPVKD--T-QIISVKVVDTIPERAMDIANETANIFKGSIGDIM--
D4RX68      --VGEL---KGMVSASIVNN--T-RMISIKVTDKDPILAKEITDDIATVTSERICEVM--
D4J4T5      --YQQL---LEKVEVTNPTS--S-RILQVTVNDPNPQTAADIANEMASVAESKLKEIT--
I5ASF9      --YKEL---KKYLTITNEND--T-RILQLSVEQPNPKLAKKVVDTLAAVSSAYIADKM--
C0C0F9      --AEEL---EETITAETPVD--T-RILTIIVENQDPKLAKEIADALRESVSIQITEIM--
B6W7H3      --YGDF---SQKVSIEPVKD--T-QIISVKVVDTVAERAMDIANATSMVFKDSVTKIM--
C7RGH5      --YEEF---SSKVSIEPVKD--T-QIISVKVVDTIPERAMDIANETANIFKSSIGEIM--
F0GT82      --YEEF---SKKVSIEPVKD--T-QIISVNVVDSVPTRAMDIANETANIFKSSIGDIM--
F3AH93      --PNAL---KGMVSITNPAN--T-RILNVSVTSTDPKQAKILVDELAVVSSEYVGDKM--
B0GAL4      --YKQL---KNMITVTNQDD--T-RILQLSVEYSDAKQAKEIVDKLSEVASEYIGDKM--
G1WUK1      --YKQL---KDMITVANQDD--T-RILQLSVEYSDAKQAKEIVDKLSEVASEYIGDKM--
D4M2S1      --YKEL---KERITVENPSD--T-RILSITATDKDPEMAKKIADTLAKTSADFIGDKM--
E7GL80      --YRQL---AEKLKLENPKD--T-RILYLTVTDPNPYMAKAIVDEIANAASDYIGEIM--
G5F9E3      --YRQL---AEKLKLENPKD--T-RILYLTVTDPNPYMAKAIVDEIANAASDYIGEIM--
D4CG07      --YKAL---REKLTIDNPKD--T-RILTLSVEDPDPILAADIVNTVAECSSEYIGEIM--
D4MP31      --YKAL---REKLTIDNPKD--T-RILTLSVEDPDPILAADIVNTVAECSSEYIGEIM--
G5HNC6      --YDQL---KEKITITNPTD--T-RILNMTVSDEDPVRARAIVDEVARASSDYIGDIM--
A8RK86      --YGQL---KARIRISNPAD--T-RILNMTVSDTDPVRAKAIADEVANASSDYIGDIM--
G5HTB1      --YTQL---KNMIRISNPAD--T-RILNMSVSDTDPVRAKAIVDAVAKASSDYIGDIM--
A8RSL0      --YKEL---VEKVTIDNPQD--T-RILSISVEDPDPAMAKLIADKIAVTSSDYIGDIM--
C5EN02      --YKEL---LEKVTIDNPQD--T-RILSISVEDPAPDMAKLIADKIATVSSDYIGDIM--
G5HG46      --YKDL---KEKVTIDNPQD--T-RILSISVEDPDPNMAKMIADKIATVSSDYIGDIM--
E7GL39      --YREL---EKKLTIDNPNN--T-RILTLTIKDPNPYLAKSIVDEVANTASDYIGEIM--
E7GL56      --YKEL---AGKLTVENPQN--T-RILSLTVRDENPYMAKQIVDDIANTASDYIGEIM--
G5F9B0      --YKEL---AGKLTVENPQN--T-RILSLTVRDENPYMAKQIVDDIANTASDYIGEIM--
D3AC81      --HEQL---VRKIKVDNPTD--T-RILTISVEDTDPYMAKSIADEFASVASARMAEIM--
D3AE79      --YQQL---NGKITVNNPTD--T-RILTISAKDTNPETARAIADEVASVSVARIAEIM--
D4YF14      --VPQL---RNALRVEQSTD--S-QAFNISATMDTPGDAQNIVNSVITEFEKTLISIYGD
B1YMM6      --ISAL---NNMITVESEQN--S-QVINVSVQNTDAALASNVANSVAKVFSDDITDLM--
D4LG05      --YEDL---AKLYTLNNPSD--T-RVLQITATTTDPQLSMDLAETMAEEAVSYLPDTM--
D4LTH3      --YNQL---KQLYTLNNPTD--T-RVLQITATTTDPQLSMDLAETMAVEAVSYLPDTM--
F3ATF6      --HHQL---RGSITITNPEG--T-HIMEVTARSSDPETAKKIADTMAVVSAQYIKEKM--
E0I7B6      --SDQL---ISGVSVSSSNE--S-QIMDITFASTSYPQAAKAVNAIAKIFKGQNPSIM--
C9LAS2      --YEEL---KEKISVENPEG--T-RILNITVEDSEPKMAQKIVNEVASISSQFIGDKM--
F7K8E8      --YEEM---KKKVSVTTPTD--T-RILAITVTDTDPVMAMQLANAIREAAAVHIMNVM--
F7K9V0      --YEEM---KKKVSVTTPTD--T-RILAITVEDTDPVMAMQLANSIREAAAVHIMNVM--
F7KL97      --YDEM---KKKVSVTTPTD--T-RILAITVTDTDPVMAMQLANAIREAAAVHIMNVM--
D3FZP5      --HGQL---NGQLNVSQEGQ--S-QVVTIRVEDANPAMAVNLANATAAVFQREIANLL--
C0ZHV9      --MEEL---LLQTKVEPVKD--S-QVISITVEDPDQGRAVLIANTIAKTFQEEVVKML--
D7WMM9      --PEVL---MDQITVSSANN--S-QVVNINVVDKQAELAVDIANTIADVFQEEIQVLM--
A8U9F5      --TTEL---SEKIEITTQEN--S-QVFSLTVTDESPYEASEIANAVAEIFQSEIGNIM--
F4BSE0      --TIEL---SEKIEITTQEN--S-QVFSLTVTDESPYESAEIANSVATTFQDGIGNIM--
E7RDR2      --VEQL---NSKITVATAQN--S-QVVDITVQDENPAQAVDIANTTAKVFEGEIQNLM--
I0JRK5      --SATL---SDKIQVSNAEQ--S-QVVNVVATDEDPQQAAAIANTTVQVFKEDIPQLM--
G2TR26      --TDEL---NSKIEVSTEQN--S-QVFTLTVKDTNPYMATKIANKIGEVFKKEVKNIM--
D5DBK2      --AKSL---SGQIQVTSSEN--S-QVAQITVQDTNAKRATEIANTTASVFQKEVPKIM--
D5DY80      --GQSL---SGKIQVINAKD--S-QVVQIVVQDTNAKRATDIANTTASVFQKEVPKIM--
A7Z9K1      --SKEL---ESKITVSSEQD--S-QVVTIAVRDTDAKRAAVMANAVAAVFQDKITAIM--
I2CB17      --SKEL---ESKITVSSEQD--S-QVVTIAVRDTDAKRAAVMANAVAAVFQDKITAIM--
I2HW54      --SKEL---ESKITVSSEQD--S-QVVTIAVRDTDAKRAAVMANAVAAVFQDKITAIM--
G4P1M8      --SQEL---NDKITVSSEQD--S-QVVNISVKDENAETAAHIANTIASVFKTKITSIM--
E0TTZ7      --SQEL---NDKITVSSEQD--S-QVVNISVKDESAETAAHIANTIASVFKDKITSIM--
G4EQF2      --SQEL---NDKITVSSEQD--S-QVVNISVRDENAETAAHIANTIASVFQDKITSIM--
P96715      --SQEL---NDKITVSSEQD--S-QVVNISVRDENAETAAHIANTIASVFQDKITSIM--
I0F9R7      --SQEL---NDKITVSSEQD--S-QVVNISVRDENAETAAHIANTIASVFQDKITSIM--
G9QKR5      --TDTL---NQKITVDSEQN--S-QVLNVSVQDPDPDKAVLIANKIAEVFKQEIVKIM--
B5UQ74      --VQEL---NKRIEVTNEKD--S-QVVTVTAQDNDPKVARDIANTIAEIFKSEVAKIM--
B7HFH2      --VQAL---TGKINVMNEKD--S-QVISVMAEDKDPKLARDIANATAEVFQAEVAKIM--
Q72XH7      --IQEL---NKKIEVVNEKD--S-QVVTLMAQDQDPRLARDIANTTAEVFKGEIAKIM--
C2V4M3      --TQEL---NKQIEVTNEKD--S-QVVSVTTQDKDPKLARDIANTTAEVFKSEVAKIM--
C2YZB3      --TQEL---NQKIEVANEKD--S-QVVAVTAKDKDPNLARDIANTTADVFKGEVAKIM--
C2P8H2      --VQEL---NNKIEVANEKD--S-QVVAVTAQDKDPKLARDIANTTAEVFKGEVAKIM--
C2Y451      --VQEL---NNKIEVANEKD--S-QVVAVTAQDKDPKLARDIANMTAEVFKGEVAKIM--
C3EBC1      --VQEL---NKKIEVANEKD--S-QVVALTAQDKDPKLARDIANTTAEVFKGEVAKIM--
C3H980      --VQEL---NNKIEVANEKD--S-QVVAVTAQDKDPKLARDIANTTAEVFQGEVAKIM--
C2PN23      --AQDL---TGKINVANEKD--S-QVISITVEDKNPKLARDIANATADVFKGEVAKIM--
B9IRQ7      --IQDL---NKKIEVANEKD--S-QVVTVTAQDKSPSLARDIANATADVFKGEVAKIM--
A0RL71      --AQAL---TKKINVANEKD--S-QVISVTAEDKDPKVARDIANATADVFKGEVAKIM--
C2XJI0      --AQEL---TKKVNVANEKD--S-QVIAVTAEDKDPKIARDIANATADVFKGEVAKIM--
Q3EV65      --AQEL---TKKVNVANEKD--S-QVIAVTAEDKDPKIARDIANATADVFKGEVAKIM--
C2T8T7      --AQAL---TKKINIANEKD--S-QVISVTAEDKDPKLARDIANATADVFKDEVAKIM--
C2RG50      --AQAL---TKKINIANEKD--S-QVISVTAEDKDPKLARDIANATADVFKDEVAKIM--
Q814Y9      --AQAL---TKKINIANEKD--S-QVISVTAEDKDPKLARDIANATADVFKDEVAKIM--
B3ZRD5      --AQAL---TKKINVANEKD--S-QVISVTAEDKDPKVARDIANATADVFKGEVAKIM--
Q6HB08      --AQAL---TKKINVANEKD--S-QVISVTADDKDPKVARDIANATADVFKGEVAKIM--
C2NQN7      --AQAL---TKKINVANEKD--S-QVISVTAEDKDPKVARDVANATADVFKGEVAKIM--
C3GRR1      --AQAL---TKKVNVANEKD--S-QVISVTAEDKDPKVARDIANATADVFKGEVAKIM--
C2ULR7      --AQAL---TGKINVANEKD--S-QVISVTAEDKDPKLARDIANATADVFKGEVAKIM--
C3GBJ9      --MQEL---TKKINVANEKD--S-QVISVTAEDKDPKLARDIANATADVFKGEVAKIM--
C2WVG7      --AQAL---MGKINVANEKD--S-QVISVTATDKDPKLARNIANATADVFKDEVAKIM--
B7IQS9      --SQAL---TGKINVANEKD--S-QVISVTAEDKDPKLARDIANATADVFKGEVAKIM--
A9VRC4      --AQAL---TGKINVANEKD--S-QVISVTAEDKDPKLARDIANATADVFKGEVAKIM--
C2MTG4      --AQAL---TGKINVANEKD--S-QVISVTAEDKDPKLARDIANATADVFKGEVAKIM--
B7HXB5      --AQAL---TGKINVANEKD--S-QVISVTAEDKDPKLARDIANATADVFKGEVAKIM--
C2SBU5      --AQAL---TGKINVANEKD--S-QVISVTAEDKDPKLARDIANATADVFKGEVAKIM--
C2SSX9      --AQAL---TGKINVANEKD--S-QVISVTAEDKDPKLARDIANATADVFKGEVAKIM--
G9QCG2      --AQAL---TGKINVANEKD--S-QVISVTAEDKDPKLARDIANATADVFKGEVAKIM--
Q2BFS6      --TSQL---DSKITVGSQKD--S-QVLAITVQDPDPNMAADIANTTANVFKREIVEIM--
I3EBB4      --TEEL---NEKINVQSEKD--S-QVVNISVQDPDPYQAAKIANKTAEVFKREIVKIM--
A4ITF4      --LDEL---NEQIQVSSEKD--S-QVFSVTVQDPDPAMAAKIANKTAEVFKNEIVKIM--
C5D962      --VDEL---NEQIQVSSEKD--S-QVFSVTVQDPDPAMAAKIANKTADVFKNEIVKIM--
G8MZ94      --LDEL---NEQIQVSSEKD--S-QVFSVTVQDPDPAMAAKIANKTAEVFKNEIVKIM--
Q5KUM4      --LDEL---NEQIQVSSEKD--S-QVFSVTVQDPDPAMAAKIANKTAEVFKNEIVKIM--
D4YHG8      -TAAEL---AENVTVSMDSD--S-LLFTISVENESPYVAANLANAIAVSFSEVVQQVL-Q
F7V793      ---KQL---QGMIDITNVSD--T-RVLKITVRSENPEEAKEIANTLAYKAVNYLPKLT-K
H4GK02      LSVAEL---KDALSVSTQTN--S-QVFTLNAEASNPTEAKAMANTVASVFKKRVKKIM-D
F6IR92      -SVNTL---KQAVSVTSTAN--S-QVFSIVVRDHNASASAVIANQIATTFKSQVKQII-K
G0M0G0      -SVNTL---KQAVSVTSTAN--S-QVFSIVVRDHNASASAVIANQIATTFKSQVKQII-K
D7VBW5      -SLESL---KQTVSVTSTAN--S-QVFSIVVRDKNAKASAMIANQIAATFKDQVQHII-R
F9UQ55      -SLESL---KQTVSVTSTAN--S-QVFSIGVRDKNAKASAMIANQIAATFKDQVQHII-K
G2KUP2      ----------TNISVFSQQN--S-QVFSVSATANNPYTASDIANETAKVFQNKIKKMM-D
G8PE07      ---NGM---KKAISISSQQN--S-QVFSITAKSTNPEMAAKIANKTASVFKNKIGKIM-S
E0NHP5      --VDNL---KSSISISSQQN--S-QVFSINAKSTNPNTAAKMANETAKVFKRKVVKIM-S
Q03GL9      -DVDSL---KGSLSVNSQQN--S-QVFSITAKSTNPNTAAKMANETATTFKNKVVKIM-S
F3Y921      --TEEL---RNSIEITQSQD--S-QMFTIIATAKQATTAEKIANLTANTFQQKAKHTL-N
G4L593      --IREI---KDSMEVEQSEE--S-QMFSIVATGESAADAEHIANTAAEVFQDTVQDVLTN
E6LD65      --PKEI---KKLISVEQSQN--S-QMFSIIVTTTKSVEAAHIANTVAKTFQDNAKDVL-N
C9ALZ8      --AGQI---KDAISVNQSQN--S-QMFSIQATSTNAVTAQQIANTTSQVFQENAKDVM-N
C9BUG6      --AEQI---KDAISVNQAEN--S-QMFSIQAISTNAVAAQQIANTTSQVFQENAKDVM-N
Q3XYS7      --AGQI---KDAISVNQSEN--S-QMFSIQAISTNAVTAQQIANTTSQVFQENAKDVM-N
C9B453      --AGQI---KDAISVNQSEN--S-QMFSIQAISTNAVTAQQIANTTSQVFQENAKDVM-N
D4RJF5      --AEQI---KDAISVNQSQN--S-QMFSIQAISTNAVTAQQIANTTSQVFQENAKDVM-N
C8ZXT8      --AGEI---KDAISVNQSQN--S-QMFSIQATNPNAVTAQKIANTTALVFQENAKDVM-N
F0EKB8      --VGQL---KESISINQSQN--S-QMFSIQATSTNAVSAQNIANTTALVFQENAQDVM-N
C9A6V4      --VGQL---KESISINQSQN--S-QMFSIQATSTNAVSAQNIANTTALVFQENAQDVM-N
C9CHY7      --VGQL---KESISINQSQN--S-QMFSIQATSTNAVSAQNIANTTALVFQENAQDVM-N
D4JI68      ---------GGRVTLDNPSN--S-RVLNITVTDPDPQMAKTIADEIAKVASAYIAEKM-K
D6E329      ---------GGRVTLDNPSN--S-RVLNITVTDPDPQMAKTIADEIAKVASAYIAEKM-K
E6UHY5      IPYGQI---KRLINISAVNN--T-EVLQVTVTSQVPKFSADICSYISELAQEVITRTT-K
E9SAU2      IPTGQI---KRLITIAAVNN--T-EVLQVTVTSEVPNFSADICSYISEIAPDMIIRTT-K
F7K0U2      ---------SGEITVSNTAD--T-RILSISVENESPKLAKEIADAVRESASVQITQIT-D
O06029      ---------QKQVTAANQTN--S-QVIMLTVKYSNPYIAKKIADETAKIFSSDAAKLL-N
G8P3D6      ---------QKQVTAANQTN--S-QVITLTVKYSNPYIAQKIADETAKIFSSDAAKLL-N
A9QSJ3      ---------QKQVTAANQTN--S-QVITLTVKYSNPYIAQKIADETAKIFSSDAAKLL-N
F9VC43      ---------QKQVTAANQTN--S-QVITLTVKYSNPYIAQKIADETAKIFSSDAPKLL-N
G6FD41      ---------QKQVTAGNQTN--S-QVITLTVKYSNPYVAQKIADETAKIFSSDAAKLL-N
G9M881      ---------QKQVTAANQTN--S-QVITLTVKYSNPYIAQKIADETAKIFSSDAAKLL-N
Q3ZK51      ---------QKQVTAANQTN--S-QVITLTVKYSNPYIAQKIADETAKIFSSDAAKLL-N
Q83VG0      ---------QKQVTAANQTN--S-QVITLTVKYSNPYIAQKIADETAKIFSSDAEKLL-N
C6LDI9      ---------EKAIEVTNTTD--T-HILKITVSDSDAERAKRIVDELTVILIDTAAEVM-D
G5F9H3      ---------EKKLTIDNPNN--T-RILTLTIKDPNPYLAKSIVDEVANTASDYIGEIM-E
C0CZV8      ---------KKKITIDNPAD--T-RILSISVMDPDPQMAKAIADKVAATASDYVGDIM-E
G5GFW1      ---------KKKLTVDNPND--T-RILSLSIVDEDPAMAKKIVDEVANTASDYIGDLM-E
F8KGP2      LSTAEL---KKAISVKTQQN--S-QVFSLQVKTDDPQESAVVANTVANVFKQQIKKIM-S
B3XL22      LSTDEL---KKAISVSTQQN--S-QVFSLQVKTDDPQESAVVANTVANVFKQQIKKIM-S
F8DRU3      LSTAEL---KEAISVQTQQN--S-QVFSLQVKTDDPQESAVVANTVANVFKQQIKKIM-S
C2EWM2      VTTAQL---KKAISVQTQQN--S-QVFTLNAKTNNAEESAAIANTVASVFKQQIKHIM-S
D0DSJ3      LSVAKL---KGSLKVSTQTN--S-QVFSLSAEAGNPTEAKVIANTVAKVFKKQIRSMM-N
B2GF32      LSVAKL---KGLLTVSTQNN--S-QVFSLSAEAGNPTEAKVIANTVAKVFKKQIRSMM-N
C0WW25      LSVAKL---KGLLTVSTQNN--S-QVFSLSAEAGNPTEAKVIANTVAKVFKKQIRSMM-N
F0K0J8      VSASEL---ASAVSVTTTDS--S-QVFTLSATAETPAKAQAIANAVAKEFKEQIPKIM-N
G6F8H0      VSANEL---ASAVSVTTTTS--S-QVFTLSATAETPAKAQAIANAVAKEFKEQIPKIM-D
F0HVF2      ISPSEL---ASAVSVTTTTS--S-QVFTLSATAETPAKAQAIANAVAKEFKEQIPKIM-D
Q1G8E3      VSASEL---ASAVSVTTTDS--S-QVFTLSATAETPAKAQAIANAVAKEFKEQIPKIM-N
D6S4X3      ISATEL---SKAISVSTQQQ--S-QVFSIKATSDTPEKAQAEANAVAQTFKTEIPEIM-S
Q5FIC6      VSASEL---AKSISVGTQQQ--S-QVFSISAEADTPAKAKAEVNAVAETFRKEIPTIM-S
E4SMV6      VSAKEL---AKSISVGTQQQ--S-QVFSISAKADTPAKAKAEVNAVAETFRKEIPNIM-S
F0TGY3      VSAKEL---AKSISVGTQQQ--S-QVFSISAKADTPAKAKAEVNAVAETFSKEIPNIM-S
F2M2M7      VSAKEL---AKSISVDTQQQ--S-QVFSISAKADTPAKAKAEVNAVAETFRKEIPTIM-S
A4ZGZ7      VSASQL---AKNISVNTQQQ--S-QVFSVSATADTPEKAKAEANAVARSFRDQIPNIM-N
C2EPK4      VSAKQL---AKNISVNTQQQ--S-QVFSISAESNTPAKARAEVNAVAETFSKEIPNIM-S
C7XKF2      VSTSEL---AKSVSVNTQQQ--S-QVFSISATADTPEKAKVEANAVARSFRDQIPNIM-N
E3R265      VSTSEL---AKSVSVNTQQQ--S-QVFSISATADTPEKAKVEANAVARSFRDQIPNIM-N
D0DJG9      VSTSEL---AKSVSVNTQQQ--S-QVFSISATADTPEKAKVEANAVARSFRDQIPNIM-N
D5GZJ9      VSTSEL---AKSVSVNTQQQ--S-QVFSISATADTPEKAKVEANAVARSFRDQIPNIM-N
A8YX90      VSASQL---AKDISVNTQQQ--S-QIFSVSATADTPEKAKAEANAVARSFRDQIPNIM-N
F0NWJ8      VSASQL---AKNISVNTQQQ--S-QVFSVSAEADTPEKAKAEANAVARSFRDQIPNIM-N
C2JZS0      LTESDI---ASKVTVSSSQN--S-QVFTISVTDTSPTRARDIANEIARVFKTKIATIM-S
C1J9I2      ISEEDL---TKMVSVSTQQN--S-QVFTVNVKDTSPVRARDIANEIAKVFEKKIAKIM-S
Q58Z11      ISEDDL---DKMISVSNAQN--S-QVFTVNVRDTDPVRAKDVANEIAKVFKAKIASIM-S
B1MZT2      FTVDQL---KKMVSISNQQN--S-QVFAINVTSKDPKQAALVANTVADSFKAKIGGFM-K
C2KHF2      LSVDEL---KSMVTISSQQN--S-QVFSINVKSKDPKLAADVANEVADVFKDKIGGFM-K
Q03W94      LSVEEL---KSMISISNQTN--S-QVFSINVKAKDSKLAADVANEVADAFKDKIGGFM-K
G2Z8Q4      --VKQL---KQQITIENVAN--S-QVITIKVTDSSAEKATLIANKVTTVFKDNIKNIM-D
D9ST43      --TKDI---LDSIIVIPKED--T-QLIEFKVQNENPQEAYRILNAVCNAFMEEGERIY-S
H7F5T7      --ASQL---SEMIQPSTEEN--S-QVINITATTDSPEEAAKIANITAKEFVKTTPEIM-R
G9WIR0      --DISSSSLASMVTVSSVQN--S-QIFSISARSNDPVESRDIANMTADVFKTKAVQVM-G
D3LB11      --SLTSTALSKMITVSSTTN--S-QIFSIAVRSTNSQESKDIANETASVFKNEAVKLM-G
A0NKF7      --TLTSTALAKMITVSSTTN--S-QIFSIAVRSTSSQEAKDIANETASVFKNEAVKLM-G
Q04DV7      --TLTSTALAKMITVSSTTN--S-QIFSIAVRSTSSQEAKDIANETASVFKNEAVKLM-G
F6BI63      --TDQL---KKNIDVAEEGD--T-EVINISVKDNDPKIAADIANAVAGSFVDNIVKIM-K
G2MWC1      --VDQL---KNSVDVAAKDN--T-EIIEISVENSDPSKAAEMANAIADSFMENIVKIM-K
B0K4N2      --VDQL---KNSVDVAAKGN--T-EIIEISVKNSDPRKAAEIANAIADSFVENIVKIM-N
C7ISF8      --VDQL---KNSVDVAAKGN--T-EIIEISVKNSDPRKAAEIANAIADSFVENIVKIM-N
B0KAR6      --VDQL---KNSVDVAAKGN--T-EIIEISVKNSDPRKAAEIANAIADSFVENIVKIM-N
E8UV30      --VDQL---KNSVDVAAKGN--T-EIIEISVKNSDPRKAAEIANAIADSFVENIVKIM-N
C0GGR6      --VNQL---RGMINVRQVSD--T-EIISISVSDNSPDRAAFLANSVANTFITKVGTIM-N
A4J8V1      --YEQL---SQSIDVKPVKD--T-QLIQITVEDIDPERAARLANFTAVVFIRKVTEIM-K
C8VYQ7      --PEAF---SAKINVEPVRD--T-QLISISIEDASPDKAARLANISGQVFMKKVVEVM-K
C8W5K3      --PDQF---IGKVSVQPVKE--S-QLINITVVDPNPNTAAHLANITSRVFVEIIVDIM-E
B1BNH4      --QEDIKAILKNLNATPSAE--T-QILDLSFKGGNPKEVLKLTEALTNEFISESKELI-P
B1V1Z3      --QEDIKAILKNLNATPSAE--T-QILDLSFKGGNPKEVLKLTEAITNEFISESKELI-P
B1R3V2      --QKDIKAILKNLNATPSAE--T-QILDLSFKGGNPKEVLKLTEALTNEFISESKELI-P
Q0SVR9      --QNEIKGVLNNLNVTPSAD--T-QILDLSFKGKNPKEVLKVTEAITDEFISESKELI-P
Q8XN47      --QKEIKGILNNLNVTPSAD--T-QILDLSYKGGNPKDVLKVTEAITSEFISESKELI-P
G7M0Q2      --PNDV---LKNLTVTPTVD--T-QILEIKYVNQDKVIAKNILDSITNQFIVESKQLI-P
G7M565      --SDKI---LSTLSVTPRSD--T-QILEISYISPHKSEAGDVVKTVTDEFMRSSKELI-P
A6M2M0      --SENV---LDNLSVTPRTD--T-QILEISYVSANQALAGDVVNSVTNEFIRSSREFI-P
G7M1R8      --SQDV---LDNLTVTPTAN--T-QILEIKYVSKNKNQSEEILQAISDQFIKTATELI-P
Q4JZ56      --LESL---ASKIKISIPAE--T-RIISISVTNTNSDEAARIANGIRKVAALKIKEVT-Q
Q7X554      --EAQL---AKMISVNIPTD--T-RLISISANAKTGQDAQTLANKVRKVASEKIKNVT-K
Q7X550      --EAEL---AKMISVDIPTD--T-RLISISVKAKTGQDAQVLANKVREVASKKIKNVT-K
Q7X562      --EAEL---DKMISVDIPTD--T-RLISISVNAKTGQDAQTLANKVREVALEKIKNVT-K
Q7X556      --EAKL---SKMVSVNIPTD--T-RLISISVNAKTGQDAQTLANKVREVASKKIKKVT-K
Q7X552      --EAEL---SKMVSVNIPTD--T-RLISISVNAKTGQDAQTLANKVREVASKKIKKVT-K
Q7X558      --EAEL---SKMVSVNIPTD--T-RLISISVNAKTGQDAQTLANKVREVASKKIKKVT-K
C5NWJ9      --ARQL---AGKVSVDAPKD--T-RIISITVRDKDPQVASDLANTVKEVSADQIKDVT-K
F3A498      --AKQL---AGKVSVDAPKD--T-RIISITVRDKDPQVASDLANTVKSVSADQIKDVT-K
Q9AHD3      --PKGL---ANKIKVTVPVD--T-RIVSISVNDRVPEEASRIANSLREVAAQKIISIT-R
Q4K2E2      --TKNL---ASKIQVTVPVD--T-RIVSISVKDKQPEEASRIANSLRKIAAKKIISVT-R
Q4K2F8      --TKNL---ASKIQVTVPVD--T-RIVSISVKDKQPEEASRIANSLRKIAAKKIISVT-R
Q4K046      --AKTL---TSKVQVTVPAD--T-RVVSISVKDKQPEEASRIANSLREVATEKIVAVT-R
Q4K0R8      --ARAL---ASKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
Q4JYY0      --AKTL---ASKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVTVT-R
Q4JZW8      --AKTL---ASKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
I0J9C8      --TKTL---ASKVKVTVPTD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
Q4K0M4      --TKTL---ASKVKVTVPTD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
Q4JZS4      --AKTL---TRKVQVTVPVD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
Q4JZK2      --AKTL---ASKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
Q9AHA5      --AKTL---ASKVQVTVPTD--T-RIVSISVKDKQPEEASRIANSLREVAVERIVAVT-R
Q9X9A0      --AKTL---ASKVQVTVPTD--T-RIVSISVKDKQPEEASRIANSLREVAVEKIVAVT-R
Q4JYK9      --AKTL---ASKVQVAVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
Q4K006      --AKTL---ASKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
Q4JZG8      --AKTL---ASKVQVTVPAD--T-RIVSISVKDKQPEEASRIANFLREVAAEKIVAVT-R
A6YIA7      --AKTL---ASKVQVAVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
E5F5C4      --AKTL---ASKVQVAVPAD--T-RIVSISVKNKQPEEASRIANSLREVAAEKIVAVT-R
Q9AHB8      --AKTL---ASKVQVAVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
Q4JZL8      --AKTL---ASKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
Q4K1B8      --AKTL---ASKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
Q8VU32      --AKAL---TSKVQVTVPTD--T-RIVSISVKDKEPEEASRIANSLREVAAGKIVAVT-R
D2ERX9      --AKTL---ASKVQVTVPTD--T-RIVSISVKNKQPEEASRIANSLREAAAEKIIAVT-R
G6C7Z0      --VKTL---ASKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIIAVT-R
Q4K2A9      --AKAL---TSKVQVIVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIIAVT-R
D6ZQI7      --AKTL---TSKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIIAVT-R
Q9ZFT9      --AKTL---TSKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIIAVT-R
Q4K255      --AKTL---TSKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIIAVT-R
F9HJP7      --TADL---AGKVAVSVPTD--T-RIVSITVTNGDPNQASRIANTLREVAAEKIIAVT-K
E8JWI4      --PSDL---ASKVTVTVPTD--T-RIVSITVTHADPAEASRIANTLREVAAEKIIAVT-K
A8AZR4      --TAEI---SKSVSVSVPTD--T-RIVSITVKNSDPNQASRIANTLREVAAEKIIAVT-K
D0RXH3      --TAEL---SKSVSVSVPTD--T-RIVSITVKNSDPNQASRIANTLREVAAEKIIAVT-K
Q83YR6      --TAEL---SKSVSVSVPTD--T-RIVSITVKNSDPNQASRIANTLREVAAEKIIAVT-K
F1Z125      --PEEL---SKMIAVTIPAD--T-RVISIAVTNHDPQAAKDLANSVRDVASEKIKSVT-K
Q3K0S9      --SSQL---LQKITVSILKD--T-RVISISVEDANPKMSQKLANSVREAAVSKIKAVT-Q
P0C0T8      --SSQL---LQKITVSILKD--T-RVISISVEDANPKMSQKLANSVREAAVSKIKAVT-Q
Q67AY5      --SSQL---LQKITVSILKD--T-RVISISVEDANPKMSQKLANSVREAAVSKIKAVT-Q
Q04662      --SSQL---LQKITVSILKD--T-RVISISVEDANPKMSQKLANSVREAAVSKIKAVT-Q
Q8GP93      --EAEL---AKMISVDIPTD--T-RLISISVNAKTGQDAQTLANKVREAASEKIKNVI-K
Q8GPF7      --ETEL---SKMVSVNIPTD--T-RLISISVNAKTGQDAQTLANKVREVASEKIKNVI-K
E3CP61      --EAEL---AKKISVNIPTD--T-RLISISVSAKTGQDAQLLANKVREVASEKIKNVT-K
E8KUY7      --EAEL---AKKISVNIPTD--T-RLISISVSAKTGQDAQLLANKVREVASEKIKNVT-K
C2LSE5      --EAEL---AKMISVNIPTD--T-RLISISVNAKTGQDAQTLANKVREVASEKIKNVT-K
E9DM16      --EADL---AKMISVNIPTD--T-RLISISVNAKTGQDAQSLANKVRDVAAEKIKKVT-K
I0QIK5      --EADL---AKMISVNIPTD--T-RLISISVNAKTGQDAQSLANKVRDVAAEKIKKVT-K
Q7X560      --EAEL---AKMISVNIPTD--T-RLISISVNAKTGQDAQTLANKVREVASEKIKKVT-K
Q8GMA6      --EAEL---SKMVSVNIPTD--T-RLISISVNAKTGQDAQTLANKVREVASKKIKKVT-K
Q55204      --EAEL---AKMISVNIPTD--T-RLISISVNAKTGQDAQTPANKVREVASEKIKKVT-K
Q8GPC4      --EAEL---AKMISVNIPTD--T-RLISISVNAKTGQDAQTLANKVREVASEKIKKVT-K
Q8GPA9      --EAEL---DKMISVDIPTD--T-RLISISVNAKTGQDAQTLANKVREVALEKIKNVT-K
G6ERT2      --EAEL---AKMISVNIPTD--T-RLISISVNAKTGQDAQTLANKVRKVASEKIKKVT-K
O87930      --EAEL---AKMISVNIPTD--T-RLISISVNAKTGQDAQTLANKVRKVASEKIKKVT-K
Q8GP55      --ETEL---SKMVSVNIPTD--T-RLISISVKAKTGQDAQVLANKVREVASKKIKNVT-K
F8HDC4      --EAEL---SKMVSVNIPTD--T-RLISISVKAKTGQDAQVLANKVREVASKKIKTVT-K
F8LJ76      --EAEL---SKMVSVNIPTD--T-RLISISVKAKTGQDAQVLANKVREVASKKIKTVT-K
F8LXJ5      --EAEL---AKMISVDIPTD--T-RLISISVKAKTGQDAQVLANKVREVASKKIKNVT-K
Q1WCR2      --EAEL---AKMISVDIPTD--T-RLISISVKAKTGQDAQVLANKVREVASKKIKNVT-K
G3G7C0      ---ENL---KEKVSVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAAQKIVEVT-K
G3G7J8      ---ENL---KEKVSVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAAQKIVEVT-K
G8DU30      ---ESL---KEKISVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAAQKVAEVT-K
A4VTU2      ---ESL---KEKISVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAVQKVVEVT-K
D5AGQ4      ---ESL---KEKISVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAVQKVVEVT-K
Q9X4U6      ---ESL---KEKISVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAVQKVVEVT-K
G3G7G5      ---ESL---KEKISVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAAQKIVEVT-K
G7SG35      ---ENL---KEKVSVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAAQKIVEVT-K
G8DU06      ---ENL---KEKVSVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAAQKIVEVT-K
G8DUA9      ---ENL---KEKVSVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAAQKIVEVT-K
G8DTY9      ---ENL---KEKVSVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAAQKIVEVT-K
G3G7I7      ---ESL---KEKISVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAAQKVVEVT-K
G3G7J3      ---EDI---SNKISVSIPVD--T-RIVSISVRDADPNEAARIANSLRTFAAQKIVEVT-K
E0PD82      --TSEL---SDMITVDIPTD--T-RVISISVEDTDAQEAADIANAVREIAAEKIKAVT-K
F5X651      --TSEL---SDMITVDIPTD--T-RVISISVEDTDGQEAADIANAVREIAAEKIKAVT-K
G5JTD6      --SDEL---AKKVSVQVPTD--T-RLITIAVQDRSPQEASRLANAVREVAIQKIKDVT-R
Q2KM75      --PEEL---SQMITVTVPAD--T-RVISISVNNHEPQKAKDLANAVREVASEKIKDVT-K
G5KAJ3      --PEQL---SKMIAVTVPAD--T-RVISISVTNHHPQEAKDLANSIREAASEKIKKVT-K
B9DUJ5      --PDTL---SKMISVTIPAD--T-RVISITVTNHDPQQAKDLANSIREVASEKIKSVT-K
G5KD12      --PEQL---SKMITVTIPAD--T-RVISISVTNHDPQQAKTLANSVREVASEKIKSVT-K
E8JMT8      --TSEL---SDMISVDIPTD--T-RVISISVEDTDAQEAADIANTIREVAAEKIKSVT-K
F5X0J8      --TSEL---SNMISVNIPTD--T-RVISISVEDTDAQEASDIANTIREVAAEKIKSVT-K
H2A601      --TSEL---SNMISVNIPTD--T-RVISISVEDTDAKEASDIANTIREVAAEKIKSVT-K
E7S8W2      --PAEL---AKKVSVAVPTD--T-RILSITASDPDPQEAARIANGLKDVAAERIIAVT-K
F8DFF5      --PAEL---SKKINVSVPTD--T-RILSITAKDGDPKEAARIANGLRNVAAEKITSVT-K
I1ZPH8      --PAEL---SKKINVSVPTD--T-RILSITAKDGDPKEAARIANGLRNVAAEKITSVT-K
E3CBR9      --PAEL---SKKISVSVPTD--T-RILSITAKDGDPKEAARIANGLRNVAAEKIISVT-K
E8K787      --PAEL---SKKISVSVPTD--T-RILSITAKDGDPKEAARIANGLRNVAAEKIIAVT-K
F9M365      --PAEL---SKKISVSVPTD--T-RILSITAKDGDPKEAARIANGLRNVAAAKIISVT-K
A3CQY3      --PREL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
E8KLZ0      --PREL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
F0FHA9      --PREL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
F0FQQ4      --PREL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
F0I4H6      --PREL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
F0IAY2      --PREL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
F0IJI1      --PREL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
F0IS52      --PREL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
F2C9N1      --PREL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
F2CH54      --PREL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
F3UDW8      --PREL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
F3UNJ5      --PREL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
F3SM33      --PRKL---TRHITVSVPAD--T-RIVSITVKDDNPEEAARIANAFRNIAAEKIIEVT-K
F9HC66      --VKEL---TKKIQVTVPVD--T-RIVSIVVKDDQPEEASRIANALREVAAEKIIKVT-R
E1LQJ6      --VREL---SKKIQVTVPVD--T-RIVSITVKNAQPEEASRIANALREVAAEKIISVT-R
Q4JYU0      --VKEL---SKKIQVTVPVD--T-RIVSITVKNAQPEEASRIANALREVAAEKIISVT-R
Q4JZY2      --VKEL---SKKIQVTVPVD--T-RIVSITVKNAQPEEASRIANALREVAAEKIISVT-R
F9Q346      --SKGL---ASKIKVTVPAD--T-RIVSISVTDRAPEEASRIANSLREVAAQKIISVT-R
Q6L5R1      --SKGL---ASKIKVTVPAD--T-RIVSISVTDRAPEEASRIANSLREVAAQKIISVT-R
E9FEC6      --PKGL---ASKIKVTVPVD--T-RIVSISVTDRLPEEASRIANSLREVAAQKIISVT-R
E0Q2S9      --PKDL---AGKIKVTVPAD--T-RIVSISVTDRLPEEASRIANSLREVAAQKIISVT-R
F5VSH0      --PKDL---AGKIKVTVPAD--T-RIVSISVTDRLPEEASRIANSLREVAAQKIISVT-R
A5YTV6      --PKGL---AGKIKVTVPVD--T-RIVSISVTDRVPEEASRIANSLREVAAQKIISVT-R
Q6L5T1      --PKGL---ASKIKVTVPVD--T-RIVSISVTDRAPEEASRIANSLREVAAQKIISVT-R
E0PPH8      --PKDL---AIKIKVTVPVD--T-RIVSISVTDRAPEEASRIANSLREVAAQKIISVT-R
A5YTT8      --PKGL---ASKIKVTVPVD--T-RIVSISVTDRAPEEASRIANSLREVAAQKIISVT-R
E6KKR9      --PKGL---ASKIKVTVPVD--T-RIVSISVTDRAPEEASRIANSLREVAAQKIISVT-R
A1ILY0      --PKGL---ASKIKVTVPVD--T-RIVSISVTDRAPEEASRIANSLREVAAQKIISVT-R
F2QF91      --PKGL---ASKIKVTVPVD--T-RIVSISVTDRAPEEASRIANSLREVAAQKIISVT-R
Q4K0I3      --VKTL---TSKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSIREVAAEKIIAVT-R
Q8KWQ1      --AKTL---ASKVQVTVPDD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
Q4K238      --AKTL---TSKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIIAVT-R
B1I966      --AKTL---TSKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIIAVT-R
G6J8A3      --AKTL---TSKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIIAVT-R
F9LZC3      --AKTL---ASKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREAAAEKIIAVT-R
F9P1W9      --AKTL---ASKVQVTVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIIAVT-R
A5LJR9      --AKTL---ASKVQVAVPAD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
Q9ZII7      --AKTL---ASKVQVTVPTD--T-RIVSISVKDKQPEEASRIANSLREVAVEKIVAVT-R
Q4K1K7      --PKGL---ANKIKVTVPVD--T-RIVSISVKDKQPEEASRIANSLREVAAEKIVAVT-R
E1LPE6      --PKGL---ANKIKVTVPVD--T-RIVSISVNNRVPEEASRIANSLREVAAQKIISIT-R
F9MJW6      --PKGL---ANKIKVTVPVD--T-RIVSISVNDRVPEEASRIANSLREVAAQKIISIT-R
Q4K0V3      --PKDL---ANKIKVTVPVD--T-RIVSVSVSDRVPEEASRIANSLREVAAQKIISIT-R
Q54519      --PKDL---ANKIKVTVPVD--T-RIVSVSVSDRVPEEASRIANSLREVAAQKIISIT-R
C1CBD0      --PKGL---ANKIKVAVPVD--T-RIVSISVNDQVPEGASRIANSLREVAAQKIISIT-R
Q7WVX1      --PKGL---ANKIKVAVPVD--T-RIVSISVNDQVPEGASRIANSLREVAAQKIISIT-R
Q4K0E2      --PKGL---ANKIKVTVPVD--T-RIVSISVNDRVPEEASRIANSLREVAAQKIISIT-R
Q9AH96      --PKGL---ANKIKVTVPVD--T-RIVSISVNDRVPEEASRIANSLRKVAAQKIISIT-R
A5M4L2      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
B2ILP4      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
C1CCB8      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
P72511      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
Q4K1S8      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
P96474      --PKGL---ANKIKVTVPVD--T-RIVSVSVSDRVPEEASRIANSLREVAAQKIISIT-R
Q4K196      --PKGL---ANKIEVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
Q4K0Z7      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
Q4JZ85      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
Q4JYH6      --PKGL---ANKIKVTVPVD--T-RIVSISVNDRVSEEASRIANSLREVAGQKIISIT-R
Q4JZ19      --PKGL---ANKIKVIVPID--T-RIVSVSVNDRVPEEASRIANSLREVAAKKIISIT-R
Q4K0A1      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
Q4K1M5      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
Q4K2Q8      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
Q4K1G0      --PKGL---ASKIKVTVPAD--T-RIVSVSVNDRVPEEASRIANSLREVAAKKIISIT-R
Q4K0T6      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
Q4K0K3      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
Q4K0X6      --PKGL---ANKIKVTVPVD--T-RIVSVSVNDRVPEEASRIANSLREVAAQKIISIT-R
E8KDN1      --AKAL---AKKIQVTVPAD--T-RIVSISVKDGNPEEASRIANGLREVAAQKIISVT-K
F9PEU3      --AKTL---GRKVSVTVPAD--T-RIVSISVRDGKPEEASRIANALREVAAQKIISVT-R
E8K321      --AKTL---GKKVSVTVPAD--T-RIVSISVRDGKPEEASRIANALREVAAQKIISVT-R
F9PZP6      --AKTL---GRKVSVTVPAD--T-RIVSISVRDGNPEEASRIANALREVAAQKIISVT-R
D6R2T7      --PAEL---AKNISVSVPVD--T-RIVSITVKNKSPEEAARIANSLRNVAAEKIIEVT-K
F3UUQ1      --PAEL---AKNISVSVPVD--T-RIVSITVKNKSPEEAARIANSLRNVAAEKIIEVT-K
E6IZC3      --PSAL---AKKITVTVPTD--T-RIVSIAVSDGDAKEAARIANSLRQVAAEKIIAVT-K
G6A746      --PSAL---AKKITVTVPTD--T-RIVSIAVSDGDAKEAARVANSLRQVAAEKIIAVT-K
B1V0N8      --TNYV---RSGLSFIPGSG--SIPTLEISYRSYNKEEVDQIIKVMTDGFESTVGEYI-V
B1BNK2      --TNYV---RSGLSFIPGNG--SIPTLEISYRSYNKEEVDQIIKVMTDEFESTVGEYI-V
B1R3X7      --TNYV---RSGLSFIPGNG--SIPTLEISYRSYNKEEVDQIIKVMTDEFESTVGEYI-V
Q8XN77      --TNYV---RSGLSFIPGNG--SIPTLEISYRSYNKEEVDQIIKVMTDEFESIVGEYI-V
B1HR40      --PETL---MKQIEVSSANN--S-QVVNIRVQDEDEARAVKIANTIAEIFKEEIPILM-H
A7Z922      --ASAL---KAKITTSSETD--S-EIITIAVQDENPKQAAAIANTLMKTFKKEVRDRM-N
I2CAF3      --ASAL---KAKITTSSETD--S-EIITVAVQDENPKQAAAIANTLMKTFKKEVRDRM-N
I2HVL3      --ASAL---KAKITTSSETD--S-EIITVAVQDENPKQAAAIANTLMKTFKKEVRDRM-N
E0U2Z4      --ASSL---KGKVITSSENE--S-EMITVAVQDHDPAKAADIANTLVNKFEKEVDERM-N
D4G1R3      --ASSL---KGKVVTSSENE--S-EIINVAVQDHDPAKAAEIANTLVNKFEKEVDERM-N
G4EQZ6      --ASSL---KGKVVTSSENE--S-EIINVAVQDHDPAKAAEIANTLVNKFEKEVDERM-N
P71050      --ASSL---KGKVVTSSENE--S-EIINVAVQDHDPAKAAEIANTLVNKFEKEVDERM-N
G4P115      --ASSL---KGKVITSSENE--S-EIITVAVQDHDPAKAAEIANTLVNKFEKEVDERM-N
A8FHM0      --AEGL---KHKIATSTENE--S-EVINISVQDEDRAKAVAIANTATEVLQEEIKKTM-N
C0EBA5      --VGQV---RSMLSFSAVGE--T-EIMRITATSEDPELAANLANAVTEFAPAVIKSVI-G
F8FCE3      --PEQM---AEMLEVKQSSD--S-QVMTLVIRDTDYRRAAETVNAISYTFQKEIENVM-K
I0BSG5      --PEQM---AEMLEVKQSSD--S-QVMTLVIRDTDYRRAAETVNAISYTFQKEIENVM-K
A8YPQ6      --PSKL---SSMLTITNQEN--T-QLINIQVKSGHKQDSEKIANSFAKVTSKQIPKIM-S
P95695      --PSKL---SSMLTITNQEN--T-QLINIQVKSGHKQDSEKIANSFAKVTSKQIPKIM-S
Q2G1K8      --PSKL---SSMLTITNQEN--T-QLINIQVKSGHKQDSEKIANSFAKVTSKQIPKIM-S
C5QNG5      --ADKL---SKMIDVNTEAD--S-QILNVGVRSKSEKESEKIANDVAKVFSKDVPDIM-S
Q4L9H8      --SDEI---NNMLSIDAESD--S-QILNVNVESKNKKDSEKIANEIAKVVSDEMPKIM-S
Q2FUV1      --TAEL---NSFLKVTNQTN--S-QIITVSVTTGNKSESDKIVNKISKVFAHDMPKIM-S
P39850      --RSEI---SSMLTVTNQAE--S-QVLNIDVESKSGSNSEKIANKIAEVFSDEVPDIM-N
D7UYE3      --SSEI---LSMLTVNNQSQ--S-QILNISVRSNSRATSKKVANEVAKVFSKDIKKIM-N
Q4A121      --SEEI---AGMLTVSNQAE--S-QILNIAVENESREAAGKVANEIANVFSKDVNKIM-N
C9AAE4      --VAEL---SEILSVTNATN--S-QIIEINAYHQSPKIAAEIANTTASVFSEEIPKIM-N
H7F6C7      --TAEL---AEMIQVKNATN--S-QVIDISVEHPDPKVAARIANATARTFTEEIPNIM-K
F0SX23      --TKKI---REMVSTNTIYD--T-EVFAVSVTAANPDEAAQIANTIAGIVPNYIGEIV-Q
Q38VG4      --NDEI---ADMLSITNNQN--S-QVFSVTAKADNAYTAADIANMTATTFQKKVPKIM-S
F2I4B6      --PDQL---REKISVESKNN--S-QVFSIIVNDPNPERAATIANTTAEVFQKAIRKMM-N
Q8RBS6      --VEDL---KGKIDVTSKDN--T-EIIEISVRDNNPERAAEIANAIASSFMDNIVKIM-K
D9SR42      --SGAL---LGSMSVSSSTD--T-EFMTIRFSSKDPELAAKITNQWAASLKEISKKIK-G
D9SVC8      --PSAL---LGSVAVVTPSE--T-EFMTIRVTLRNPEEAALIANQWALSLKEISKEIQ-G
E7RG09      --YQEM---VEKVNVEVTEN--S-QLLTIFVTDPDPAVAVGIANKVAEVFETEIMELM-N
D4G2E2      --SQEL---NDKITVSSEQD--S-QVVNISVRDENAETAAHIANTIASVFQDKITSIM-N
Q8EME7      --SSQL---SEKISVASEEN--S-QVVTVTATDPDPLLATDIANTTVQVFQDEIPDIM-N
D6Y035      --HRSL---NTALNVQQEGG--S-QVVTISIEDTDPSMAVSKANATAEVFRNEIETLL-N
Q5WBB3      --YGDL---EAAVSVGSQSN--S-QVVTITVESESPADATLLTNSIATVFQEQIPDIM-S
Q9K6Q9      --YSQL---NERLQINSENN--S-QVVNITVKHEKPAMAVAIANEIALVFQNEIVEIM-N
Q97EP7      --IDQV---SKVVSVTPETG--T-QIIDITANAKSPEEAADLANDFSDSFVAVSKEVY-T
Q97ER4      --ADQV---LGLVSVTPQTG--T-QIIDITANGKSPDKAADLANDFSDSFVEVSKAVY-T
E4S7Y7      --IDQL---KSMVSVQLKND--T-RILMINIESKDPKYAALIANKLAEVFIEAVQKIM-K
E4Q5T6      --TEEL---SNMVSVQLKND--T-RILMINIESKDPKFAATVANKLAEVFIEAVQRIM-K
E4SDX3      --PEEL---GSMVSVQLKND--T-RILMINIESKDPKFAATIANKLAEVFIEAVQRIM-K
G2FWX3      --VEGL---DKLISVNPVKD--T-EILEITVSNTTPELAASIANEVAQEFSKAVIEIK-K
G7WJV2      --VEGL---DPMISINPVKA--T-EILEIRVRNTSPEQAAAIANTMAQEFSKAVIDIK-K
G7W774      --VSEL---DKLITINPVKT--T-EILEIQVLNTDPQLATAIANTMASEFSKAVIEIK-K
G2FM60      --VDEL---NSLIAINPVKT--T-EILEIQVTNTNSELAALIANTMAQEFTKAVIEIK-K
H5XZD5      --VEGL---DRLISINQVKT--T-EILEIQVSNTNSELAASIANTMAQEFSKAVIEIK-K
I4DBG9      --VEAL---DKLITVDQVKT--T-EILEIKVSNNDPKLAASIANTMAKEFSKAVIEIK-K
G2FWT7      --VGEL---DKLISINPVKT--T-EILEIQVSNTDPKLAASIANTMAQEFSKAVIEIK-K
H5XZG8      --VAEF---DKMITINPVKT--T-EILEIQVLNKDPELAADIANSMANEFSKAVIEIK-K
G0V448      --YDEF---ISSITVTPQPD--T-QIMDIKVQSKDPKDAMITANTLSQIFLEESMRIY-P
A0PZ01      --TKEL---DKMIEVTPQQD--T-QIMDIKVQSKDPEKARKIAETLTPIFIQKSKITI-P
B1B737      --TKEL---DKMIEVTPQQD--T-QIMDIKVQNKDPERARKIAETLTPIFIQKSKITI-P
G5IFS2      -----L---LRKLTVANPQD--T-RILTISVEDNDPYMAKAIADEMASVAASRMAEIMDT
B8D0N1      ----YL---ITNLNIEIIPD--T-RLIKISIKHTDPVIARQIISYLIEEFIINNRNLKKS
D9QTC7      --PQAL---RNKISISGGQEGSG-NLITITVNYSDPVVAKRIANTLVDKFQQMNQAMNQS
G0VNK5      --ESYV---KKHIVTKPYKD--T-EILEVDVTGKSPEQAQQANNLIVQGFMNRLTELSHD
D2RIR1      --EDYV---KSHIVTKPYKD--T-EILEVDVTGKSPEQAQEANQLLVQGFLDRLAQLSHA
I0GRR3      --EGYI---KSHVTTKPFKD--T-EILQVDVTGKSPEQAQEANQLIVDGFLSRLAELSHA
                                                                        

G9RSY8      ------------------------------------------------------------
C4Z673      DI----------------------------------------------------------
C6CW36      NV----------------------------------------------------------
A8SQS9      ST----------------------------------------------------------
D5HFS3      ST----------------------------------------------------------
G0LYN8      KV----------------------------------------------------------
F6ITB3      KV----------------------------------------------------------
G0M1Y0      KV----------------------------------------------------------
D7VC12      KV----------------------------------------------------------
F9UMZ5      KV----------------------------------------------------------
B9Y883      NI----------------------------------------------------------
H7F1R6      KI----------------------------------------------------------
H7F570      KV----------------------------------------------------------
A5Z5P8      GT----------------------------------------------------------
C6LCS6      DV----------------------------------------------------------
A7VF43      ST----------------------------------------------------------
C6CSC7      QV----------------------------------------------------------
C6CS79      KV----------------------------------------------------------
F5LM70      KI----------------------------------------------------------
H6LKR9      GV----------------------------------------------------------
F5LE49      KV----------------------------------------------------------
F3AHH1      NI----------------------------------------------------------
H1LCW2      SI----------------------------------------------------------
I5AV00      DA----------------------------------------------------------
H6NE44      KV----------------------------------------------------------
F4BS20      NV----------------------------------------------------------
E0RZL4      DI----------------------------------------------------------
C0CK72      DA----------------------------------------------------------
D9S1J8      NV----------------------------------------------------------
C2EFR7      KV----------------------------------------------------------
Q1WTC7      KV----------------------------------------------------------
B0P2G1      DV----------------------------------------------------------
D4MW28      DV----------------------------------------------------------
E5VMX9      DV----------------------------------------------------------
F2I6Z8      AV----------------------------------------------------------
E6U7N3      KA----------------------------------------------------------
C4Z8M6      KQ----------------------------------------------------------
D4JMC3      EQ----------------------------------------------------------
D6E0V3      EQ----------------------------------------------------------
E3GPC7      KI----------------------------------------------------------
A6BIG6      NV----------------------------------------------------------
C2CI43      KV----------------------------------------------------------
D4RX68      KV----------------------------------------------------------
D4J4T5      GM----------------------------------------------------------
I5ASF9      EV----------------------------------------------------------
C0C0F9      DA----------------------------------------------------------
B6W7H3      KV----------------------------------------------------------
C7RGH5      NV----------------------------------------------------------
F0GT82      KV----------------------------------------------------------
F3AH93      EV----------------------------------------------------------
B0GAL4      EV----------------------------------------------------------
G1WUK1      EV----------------------------------------------------------
D4M2S1      EV----------------------------------------------------------
E7GL80      EM----------------------------------------------------------
G5F9E3      EM----------------------------------------------------------
D4CG07      EM----------------------------------------------------------
D4MP31      EM----------------------------------------------------------
G5HNC6      EM----------------------------------------------------------
A8RK86      EM----------------------------------------------------------
G5HTB1      EM----------------------------------------------------------
A8RSL0      EM----------------------------------------------------------
C5EN02      EM----------------------------------------------------------
G5HG46      EM----------------------------------------------------------
E7GL39      EM----------------------------------------------------------
E7GL56      EM----------------------------------------------------------
G5F9B0      EM----------------------------------------------------------
D3AC81      DS----------------------------------------------------------
D3AE79      DS----------------------------------------------------------
D4YF14      DV----------------------------------------------------------
B1YMM6      NV----------------------------------------------------------
D4LG05      ST----------------------------------------------------------
D4LTH3      ST----------------------------------------------------------
F3ATF6      EV----------------------------------------------------------
E0I7B6      KV----------------------------------------------------------
C9LAS2      EV----------------------------------------------------------
F7K8E8      DI----------------------------------------------------------
F7K9V0      DI----------------------------------------------------------
F7KL97      DI----------------------------------------------------------
D3FZP5      RV----------------------------------------------------------
C0ZHV9      SM----------------------------------------------------------
D7WMM9      TV----------------------------------------------------------
A8U9F5      NV----------------------------------------------------------
F4BSE0      NV----------------------------------------------------------
E7RDR2      NV----------------------------------------------------------
I0JRK5      NV----------------------------------------------------------
G2TR26      KV----------------------------------------------------------
D5DBK2      NI----------------------------------------------------------
D5DY80      NV----------------------------------------------------------
A7Z9K1      NV----------------------------------------------------------
I2CB17      NV----------------------------------------------------------
I2HW54      NV----------------------------------------------------------
G4P1M8      NV----------------------------------------------------------
E0TTZ7      NV----------------------------------------------------------
G4EQF2      NV----------------------------------------------------------
P96715      NV----------------------------------------------------------
I0F9R7      NV----------------------------------------------------------
G9QKR5      NV----------------------------------------------------------
B5UQ74      SV----------------------------------------------------------
B7HFH2      SV----------------------------------------------------------
Q72XH7      NV----------------------------------------------------------
C2V4M3      SV----------------------------------------------------------
C2YZB3      NV----------------------------------------------------------
C2P8H2      SV----------------------------------------------------------
C2Y451      SV----------------------------------------------------------
C3EBC1      SV----------------------------------------------------------
C3H980      SV----------------------------------------------------------
C2PN23      NV----------------------------------------------------------
B9IRQ7      NV----------------------------------------------------------
A0RL71      NV----------------------------------------------------------
C2XJI0      NV----------------------------------------------------------
Q3EV65      NV----------------------------------------------------------
C2T8T7      NV----------------------------------------------------------
C2RG50      NV----------------------------------------------------------
Q814Y9      NV----------------------------------------------------------
B3ZRD5      NV----------------------------------------------------------
Q6HB08      NV----------------------------------------------------------
C2NQN7      NV----------------------------------------------------------
C3GRR1      NV----------------------------------------------------------
C2ULR7      NV----------------------------------------------------------
C3GBJ9      NV----------------------------------------------------------
C2WVG7      SI----------------------------------------------------------
B7IQS9      NV----------------------------------------------------------
A9VRC4      NV----------------------------------------------------------
C2MTG4      NV----------------------------------------------------------
B7HXB5      NV----------------------------------------------------------
C2SBU5      NV----------------------------------------------------------
C2SSX9      NI----------------------------------------------------------
G9QCG2      NV----------------------------------------------------------
Q2BFS6      NI----------------------------------------------------------
I3EBB4      NV----------------------------------------------------------
A4ITF4      NI----------------------------------------------------------
C5D962      NI----------------------------------------------------------
G8MZ94      NI----------------------------------------------------------
Q5KUM4      NI----------------------------------------------------------
D4YHG8      -V----------------------------------------------------------
F7V793      -T----------------------------------------------------------
H4GK02      -V----------------------------------------------------------
F6IR92      -V----------------------------------------------------------
G0M0G0      -V----------------------------------------------------------
D7VBW5      -V----------------------------------------------------------
F9UQ55      -V----------------------------------------------------------
G2KUP2      -I----------------------------------------------------------
G8PE07      -V----------------------------------------------------------
E0NHP5      -I----------------------------------------------------------
Q03GL9      -I----------------------------------------------------------
F3Y921      -V----------------------------------------------------------
G4L593      -V----------------------------------------------------------
E6LD65      -V----------------------------------------------------------
C9ALZ8      -V----------------------------------------------------------
C9BUG6      -V----------------------------------------------------------
Q3XYS7      -V----------------------------------------------------------
C9B453      -V----------------------------------------------------------
D4RJF5      -V----------------------------------------------------------
C8ZXT8      -V----------------------------------------------------------
F0EKB8      -V----------------------------------------------------------
C9A6V4      -V----------------------------------------------------------
C9CHY7      -V----------------------------------------------------------
D4JI68      -Q----------------------------------------------------------
D6E329      -Q----------------------------------------------------------
E6UHY5      -A----------------------------------------------------------
E9SAU2      -A----------------------------------------------------------
F7K0U2      -A----------------------------------------------------------
O06029      -V----------------------------------------------------------
G8P3D6      -V----------------------------------------------------------
A9QSJ3      -V----------------------------------------------------------
F9VC43      -V----------------------------------------------------------
G6FD41      -V----------------------------------------------------------
G9M881      -V----------------------------------------------------------
Q3ZK51      -V----------------------------------------------------------
Q83VG0      -V----------------------------------------------------------
C6LDI9      -S----------------------------------------------------------
G5F9H3      -M----------------------------------------------------------
C0CZV8      -M----------------------------------------------------------
G5GFW1      -M----------------------------------------------------------
F8KGP2      -V----------------------------------------------------------
B3XL22      -V----------------------------------------------------------
F8DRU3      -V----------------------------------------------------------
C2EWM2      -V----------------------------------------------------------
D0DSJ3      -V----------------------------------------------------------
B2GF32      -V----------------------------------------------------------
C0WW25      -V----------------------------------------------------------
F0K0J8      -V----------------------------------------------------------
G6F8H0      -V----------------------------------------------------------
F0HVF2      -V----------------------------------------------------------
Q1G8E3      -V----------------------------------------------------------
D6S4X3      -V----------------------------------------------------------
Q5FIC6      -V----------------------------------------------------------
E4SMV6      -V----------------------------------------------------------
F0TGY3      -V----------------------------------------------------------
F2M2M7      -V----------------------------------------------------------
A4ZGZ7      -I----------------------------------------------------------
C2EPK4      -V----------------------------------------------------------
C7XKF2      -I----------------------------------------------------------
E3R265      -I----------------------------------------------------------
D0DJG9      -I----------------------------------------------------------
D5GZJ9      -I----------------------------------------------------------
A8YX90      -I----------------------------------------------------------
F0NWJ8      -I----------------------------------------------------------
C2JZS0      -I----------------------------------------------------------
C1J9I2      -I----------------------------------------------------------
Q58Z11      -V----------------------------------------------------------
B1MZT2      -I----------------------------------------------------------
C2KHF2      -I----------------------------------------------------------
Q03W94      -I----------------------------------------------------------
G2Z8Q4      -Q----------------------------------------------------------
D9ST43      -G----------------------------------------------------------
H7F5T7      -I----------------------------------------------------------
G9WIR0      -KSI--------------------------------------------------------
D3LB11      -KTI--------------------------------------------------------
A0NKF7      -KTI--------------------------------------------------------
Q04DV7      -KTI--------------------------------------------------------
F6BI63      -V----------------------------------------------------------
G2MWC1      -I----------------------------------------------------------
B0K4N2      -I----------------------------------------------------------
C7ISF8      -I----------------------------------------------------------
B0KAR6      -I----------------------------------------------------------
E8UV30      -I----------------------------------------------------------
C0GGR6      -L----------------------------------------------------------
A4J8V1      -V----------------------------------------------------------
C8VYQ7      -L----------------------------------------------------------
C8W5K3      -LNT--------------------------------------------------------
B1BNH4      -N----------------------------------------------------------
B1V1Z3      -N----------------------------------------------------------
B1R3V2      -N----------------------------------------------------------
Q0SVR9      -N----------------------------------------------------------
Q8XN47      -N----------------------------------------------------------
G7M0Q2      -N----------------------------------------------------------
G7M565      -N----------------------------------------------------------
A6M2M0      -N----------------------------------------------------------
G7M1R8      -N----------------------------------------------------------
Q4JZ56      -V----------------------------------------------------------
Q7X554      -V----------------------------------------------------------
Q7X550      -V----------------------------------------------------------
Q7X562      -V----------------------------------------------------------
Q7X556      -V----------------------------------------------------------
Q7X552      -V----------------------------------------------------------
Q7X558      -V----------------------------------------------------------
C5NWJ9      -I----------------------------------------------------------
F3A498      -I----------------------------------------------------------
Q9AHD3      -V----------------------------------------------------------
Q4K2E2      -V----------------------------------------------------------
Q4K2F8      -V----------------------------------------------------------
Q4K046      -V----------------------------------------------------------
Q4K0R8      -V----------------------------------------------------------
Q4JYY0      -V----------------------------------------------------------
Q4JZW8      -V----------------------------------------------------------
I0J9C8      -V----------------------------------------------------------
Q4K0M4      -V----------------------------------------------------------
Q4JZS4      -V----------------------------------------------------------
Q4JZK2      -V----------------------------------------------------------
Q9AHA5      -V----------------------------------------------------------
Q9X9A0      -V----------------------------------------------------------
Q4JYK9      -V----------------------------------------------------------
Q4K006      -V----------------------------------------------------------
Q4JZG8      -V----------------------------------------------------------
A6YIA7      -V----------------------------------------------------------
E5F5C4      -V----------------------------------------------------------
Q9AHB8      -V----------------------------------------------------------
Q4JZL8      -V----------------------------------------------------------
Q4K1B8      -V----------------------------------------------------------
Q8VU32      -V----------------------------------------------------------
D2ERX9      -V----------------------------------------------------------
G6C7Z0      -V----------------------------------------------------------
Q4K2A9      -V----------------------------------------------------------
D6ZQI7      -V----------------------------------------------------------
Q9ZFT9      -V----------------------------------------------------------
Q4K255      -V----------------------------------------------------------
F9HJP7      -V----------------------------------------------------------
E8JWI4      -V----------------------------------------------------------
A8AZR4      -V----------------------------------------------------------
D0RXH3      -V----------------------------------------------------------
Q83YR6      -V----------------------------------------------------------
F1Z125      -V----------------------------------------------------------
Q3K0S9      -V----------------------------------------------------------
P0C0T8      -V----------------------------------------------------------
Q67AY5      -V----------------------------------------------------------
Q04662      -V----------------------------------------------------------
Q8GP93      -D----------------------------------------------------------
Q8GPF7      -D----------------------------------------------------------
E3CP61      -V----------------------------------------------------------
E8KUY7      -V----------------------------------------------------------
C2LSE5      -V----------------------------------------------------------
E9DM16      -V----------------------------------------------------------
I0QIK5      -V----------------------------------------------------------
Q7X560      -V----------------------------------------------------------
Q8GMA6      -V----------------------------------------------------------
Q55204      -V----------------------------------------------------------
Q8GPC4      -V----------------------------------------------------------
Q8GPA9      -V----------------------------------------------------------
G6ERT2      -V----------------------------------------------------------
O87930      -V----------------------------------------------------------
Q8GP55      -V----------------------------------------------------------
F8HDC4      -V----------------------------------------------------------
F8LJ76      -V----------------------------------------------------------
F8LXJ5      -V----------------------------------------------------------
Q1WCR2      -V----------------------------------------------------------
G3G7C0      -V----------------------------------------------------------
G3G7J8      -V----------------------------------------------------------
G8DU30      -G----------------------------------------------------------
A4VTU2      -V----------------------------------------------------------
D5AGQ4      -V----------------------------------------------------------
Q9X4U6      -V----------------------------------------------------------
G3G7G5      -V----------------------------------------------------------
G7SG35      -V----------------------------------------------------------
G8DU06      -V----------------------------------------------------------
G8DUA9      -V----------------------------------------------------------
G8DTY9      -V----------------------------------------------------------
G3G7I7      -V----------------------------------------------------------
G3G7J3      -V----------------------------------------------------------
E0PD82      -V----------------------------------------------------------
F5X651      -V----------------------------------------------------------
G5JTD6      -V----------------------------------------------------------
Q2KM75      -V----------------------------------------------------------
G5KAJ3      -V----------------------------------------------------------
B9DUJ5      -V----------------------------------------------------------
G5KD12      -V----------------------------------------------------------
E8JMT8      -V----------------------------------------------------------
F5X0J8      -V----------------------------------------------------------
H2A601      -V----------------------------------------------------------
E7S8W2      -V----------------------------------------------------------
F8DFF5      -V----------------------------------------------------------
I1ZPH8      -V----------------------------------------------------------
E3CBR9      -V----------------------------------------------------------
E8K787      -V----------------------------------------------------------
F9M365      -V----------------------------------------------------------
A3CQY3      -V----------------------------------------------------------
E8KLZ0      -V----------------------------------------------------------
F0FHA9      -V----------------------------------------------------------
F0FQQ4      -V----------------------------------------------------------
F0I4H6      -V----------------------------------------------------------
F0IAY2      -V----------------------------------------------------------
F0IJI1      -V----------------------------------------------------------
F0IS52      -V----------------------------------------------------------
F2C9N1      -V----------------------------------------------------------
F2CH54      -V----------------------------------------------------------
F3UDW8      -V----------------------------------------------------------
F3UNJ5      -V----------------------------------------------------------
F3SM33      -V----------------------------------------------------------
F9HC66      -V----------------------------------------------------------
E1LQJ6      -V----------------------------------------------------------
Q4JYU0      -V----------------------------------------------------------
Q4JZY2      -V----------------------------------------------------------
F9Q346      -V----------------------------------------------------------
Q6L5R1      -V----------------------------------------------------------
E9FEC6      -V----------------------------------------------------------
E0Q2S9      -V----------------------------------------------------------
F5VSH0      -V----------------------------------------------------------
A5YTV6      -V----------------------------------------------------------
Q6L5T1      -V----------------------------------------------------------
E0PPH8      -V----------------------------------------------------------
A5YTT8      -V----------------------------------------------------------
E6KKR9      -V----------------------------------------------------------
A1ILY0      -V----------------------------------------------------------
F2QF91      -V----------------------------------------------------------
Q4K0I3      -V----------------------------------------------------------
Q8KWQ1      -V----------------------------------------------------------
Q4K238      -V----------------------------------------------------------
B1I966      -V----------------------------------------------------------
G6J8A3      -V----------------------------------------------------------
F9LZC3      -V----------------------------------------------------------
F9P1W9      -V----------------------------------------------------------
A5LJR9      -V----------------------------------------------------------
Q9ZII7      -V----------------------------------------------------------
Q4K1K7      -V----------------------------------------------------------
E1LPE6      -V----------------------------------------------------------
F9MJW6      -V----------------------------------------------------------
Q4K0V3      -V----------------------------------------------------------
Q54519      -V----------------------------------------------------------
C1CBD0      -V----------------------------------------------------------
Q7WVX1      -V----------------------------------------------------------
Q4K0E2      -V----------------------------------------------------------
Q9AH96      -V----------------------------------------------------------
A5M4L2      -V----------------------------------------------------------
B2ILP4      -V----------------------------------------------------------
C1CCB8      -V----------------------------------------------------------
P72511      -V----------------------------------------------------------
Q4K1S8      -V----------------------------------------------------------
P96474      -V----------------------------------------------------------
Q4K196      -V----------------------------------------------------------
Q4K0Z7      -V----------------------------------------------------------
Q4JZ85      -V----------------------------------------------------------
Q4JYH6      -V----------------------------------------------------------
Q4JZ19      -V----------------------------------------------------------
Q4K0A1      -V----------------------------------------------------------
Q4K1M5      -V----------------------------------------------------------
Q4K2Q8      -V----------------------------------------------------------
Q4K1G0      -V----------------------------------------------------------
Q4K0T6      -V----------------------------------------------------------
Q4K0K3      -V----------------------------------------------------------
Q4K0X6      -V----------------------------------------------------------
E8KDN1      -V----------------------------------------------------------
F9PEU3      -V----------------------------------------------------------
E8K321      -V----------------------------------------------------------
F9PZP6      -V----------------------------------------------------------
D6R2T7      -V----------------------------------------------------------
F3UUQ1      -V----------------------------------------------------------
E6IZC3      -V----------------------------------------------------------
G6A746      -V----------------------------------------------------------
B1V0N8      -N----------------------------------------------------------
B1BNK2      -N----------------------------------------------------------
B1R3X7      -N----------------------------------------------------------
Q8XN77      -N----------------------------------------------------------
B1HR40      -V----------------------------------------------------------
A7Z922      -I----------------------------------------------------------
I2CAF3      -I----------------------------------------------------------
I2HVL3      -I----------------------------------------------------------
E0U2Z4      -V----------------------------------------------------------
D4G1R3      -V----------------------------------------------------------
G4EQZ6      -V----------------------------------------------------------
P71050      -V----------------------------------------------------------
G4P115      -V----------------------------------------------------------
A8FHM0      -M----------------------------------------------------------
C0EBA5      -IGE--------------------------------------------------------
F8FCE3      -V----------------------------------------------------------
I0BSG5      -V----------------------------------------------------------
A8YPQ6      -V----------------------------------------------------------
P95695      -V----------------------------------------------------------
Q2G1K8      -V----------------------------------------------------------
C5QNG5      -V----------------------------------------------------------
Q4L9H8      -V----------------------------------------------------------
Q2FUV1      -V----------------------------------------------------------
P39850      -V----------------------------------------------------------
D7UYE3      -V----------------------------------------------------------
Q4A121      -V----------------------------------------------------------
C9AAE4      -I----------------------------------------------------------
H7F6C7      -I----------------------------------------------------------
F0SX23      -G----------------------------------------------------------
Q38VG4      GT----------------------------------------------------------
F2I4B6      -I----------------------------------------------------------
Q8RBS6      -I----------------------------------------------------------
D9SR42      -S----------------------------------------------------------
D9SVC8      -T----------------------------------------------------------
E7RG09      -I----------------------------------------------------------
D4G2E2      -V----------------------------------------------------------
Q8EME7      -V----------------------------------------------------------
D6Y035      -I----------------------------------------------------------
Q5WBB3      -I----------------------------------------------------------
Q9K6Q9      -V----------------------------------------------------------
Q97EP7      -A----------------------------------------------------------
Q97ER4      -A----------------------------------------------------------
E4S7Y7      -I----------------------------------------------------------
E4Q5T6      -I----------------------------------------------------------
E4SDX3      -I----------------------------------------------------------
G2FWX3      -V----------------------------------------------------------
G7WJV2      -V----------------------------------------------------------
G7W774      -V----------------------------------------------------------
G2FM60      -V----------------------------------------------------------
H5XZD5      -V----------------------------------------------------------
I4DBG9      -V----------------------------------------------------------
G2FWT7      -V----------------------------------------------------------
H5XZG8      -V----------------------------------------------------------
G0V448      -T----------------------------------------------------------
A0PZ01      -N----------------------------------------------------------
B1B737      -N----------------------------------------------------------
G5IFS2      APPNIVEEGYVPTRQTSPSLVKNTAIGGMAGLFLAAVIVLAVFVMNDTIKTPEDVEKYLQ
B8D0N1      ATVN--ARNYVARQLEKVSRDLKNIEAEVRHYKEENKSLVLSNFTQKIMQSMLDLEENLA
D9QTC7      DLQG--AAGFVSKQLKEVKTRLANLEEKLLEYKKEHDVILPEKQGEDLLEKLTKLETAKS
G0VNK5      EQKR--TREFLEQRLGASKDELSQAEDKLQQYQAANKMYSTDDQMKQLTDKLNIVDKAKA
D2RIR1      ESSA--TREFLEQRVKSSKKELDDAETKLKNYQVKHKIFSTDNQMKSLAERITDLDKAKA
I0GRR3      EQGA--TRAFLEERVESSKKELSDAEDKLQKFQVENKLFSTQDQIKQITDKLSIIDKEKA
                                                                        

G9RSY8      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
G5IFS2      LNVLG---------------------------------------TIPVFEVDDGKKGRKG
B8D0N1      EVEINIKTHRAALNHLYNKLQSSRELILSSKTLSKNPAYTELKNRLTELEIELDSLTTVY
D9QTC7      KAEVELKQAEAGLKEVRANYNDQDKDIISARTIAQNPMVQKYKEQLSNLEVELTGLKESY
G0VNK5      ENQLNLETAQAGLNSVNEQLSS------AGVSIADSPAIQQYKTQLAQLEATKASYVGKY
D2RIR1      QNKLDMETAQAALGSINDQLAG------AGAALADSPSIQQAKNKLVDLETQKAGYTGKY
I0GRR3      ANKLNLEQAQAALGTINGQLDN------SGRGIADSAALQQYKVQLAQLAAEKAGYTGIY
                                                                        

G9RSY8      ------------------------------------------------------------
C4Z673      ------------------------------------------------------------
C6CW36      ------------------------------------------------------------
A8SQS9      ------------------------------------------------------------
D5HFS3      ------------------------------------------------------------
G0LYN8      ------------------------------------------------------------
F6ITB3      ------------------------------------------------------------
G0M1Y0      ------------------------------------------------------------
D7VC12      ------------------------------------------------------------
F9UMZ5      ------------------------------------------------------------
B9Y883      ------------------------------------------------------------
H7F1R6      ------------------------------------------------------------
H7F570      ------------------------------------------------------------
A5Z5P8      ------------------------------------------------------------
C6LCS6      ------------------------------------------------------------
A7VF43      ------------------------------------------------------------
C6CSC7      ------------------------------------------------------------
C6CS79      ------------------------------------------------------------
F5LM70      ------------------------------------------------------------
H6LKR9      ------------------------------------------------------------
F5LE49      ------------------------------------------------------------
F3AHH1      ------------------------------------------------------------
H1LCW2      ------------------------------------------------------------
I5AV00      ------------------------------------------------------------
H6NE44      ------------------------------------------------------------
F4BS20      ------------------------------------------------------------
E0RZL4      ------------------------------------------------------------
C0CK72      ------------------------------------------------------------
D9S1J8      ------------------------------------------------------------
C2EFR7      ------------------------------------------------------------
Q1WTC7      ------------------------------------------------------------
B0P2G1      ------------------------------------------------------------
D4MW28      ------------------------------------------------------------
E5VMX9      ------------------------------------------------------------
F2I6Z8      ------------------------------------------------------------
E6U7N3      ------------------------------------------------------------
C4Z8M6      ------------------------------------------------------------
D4JMC3      ------------------------------------------------------------
D6E0V3      ------------------------------------------------------------
E3GPC7      ------------------------------------------------------------
A6BIG6      ------------------------------------------------------------
C2CI43      ------------------------------------------------------------
D4RX68      ------------------------------------------------------------
D4J4T5      ------------------------------------------------------------
I5ASF9      ------------------------------------------------------------
C0C0F9      ------------------------------------------------------------
B6W7H3      ------------------------------------------------------------
C7RGH5      ------------------------------------------------------------
F0GT82      ------------------------------------------------------------
F3AH93      ------------------------------------------------------------
B0GAL4      ------------------------------------------------------------
G1WUK1      ------------------------------------------------------------
D4M2S1      ------------------------------------------------------------
E7GL80      ------------------------------------------------------------
G5F9E3      ------------------------------------------------------------
D4CG07      ------------------------------------------------------------
D4MP31      ------------------------------------------------------------
G5HNC6      ------------------------------------------------------------
A8RK86      ------------------------------------------------------------
G5HTB1      ------------------------------------------------------------
A8RSL0      ------------------------------------------------------------
C5EN02      ------------------------------------------------------------
G5HG46      ------------------------------------------------------------
E7GL39      ------------------------------------------------------------
E7GL56      ------------------------------------------------------------
G5F9B0      ------------------------------------------------------------
D3AC81      ------------------------------------------------------------
D3AE79      ------------------------------------------------------------
D4YF14      ------------------------------------------------------------
B1YMM6      ------------------------------------------------------------
D4LG05      ------------------------------------------------------------
D4LTH3      ------------------------------------------------------------
F3ATF6      ------------------------------------------------------------
E0I7B6      ------------------------------------------------------------
C9LAS2      ------------------------------------------------------------
F7K8E8      ------------------------------------------------------------
F7K9V0      ------------------------------------------------------------
F7KL97      ------------------------------------------------------------
D3FZP5      ------------------------------------------------------------
C0ZHV9      ------------------------------------------------------------
D7WMM9      ------------------------------------------------------------
A8U9F5      ------------------------------------------------------------
F4BSE0      ------------------------------------------------------------
E7RDR2      ------------------------------------------------------------
I0JRK5      ------------------------------------------------------------
G2TR26      ------------------------------------------------------------
D5DBK2      ------------------------------------------------------------
D5DY80      ------------------------------------------------------------
A7Z9K1      ------------------------------------------------------------
I2CB17      ------------------------------------------------------------
I2HW54      ------------------------------------------------------------
G4P1M8      ------------------------------------------------------------
E0TTZ7      ------------------------------------------------------------
G4EQF2      ------------------------------------------------------------
P96715      ------------------------------------------------------------
I0F9R7      ------------------------------------------------------------
G9QKR5      ------------------------------------------------------------
B5UQ74      ------------------------------------------------------------
B7HFH2      ------------------------------------------------------------
Q72XH7      ------------------------------------------------------------
C2V4M3      ------------------------------------------------------------
C2YZB3      ------------------------------------------------------------
C2P8H2      ------------------------------------------------------------
C2Y451      ------------------------------------------------------------
C3EBC1      ------------------------------------------------------------
C3H980      ------------------------------------------------------------
C2PN23      ------------------------------------------------------------
B9IRQ7      ------------------------------------------------------------
A0RL71      ------------------------------------------------------------
C2XJI0      ------------------------------------------------------------
Q3EV65      ------------------------------------------------------------
C2T8T7      ------------------------------------------------------------
C2RG50      ------------------------------------------------------------
Q814Y9      ------------------------------------------------------------
B3ZRD5      ------------------------------------------------------------
Q6HB08      ------------------------------------------------------------
C2NQN7      ------------------------------------------------------------
C3GRR1      ------------------------------------------------------------
C2ULR7      ------------------------------------------------------------
C3GBJ9      ------------------------------------------------------------
C2WVG7      ------------------------------------------------------------
B7IQS9      ------------------------------------------------------------
A9VRC4      ------------------------------------------------------------
C2MTG4      ------------------------------------------------------------
B7HXB5      ------------------------------------------------------------
C2SBU5      ------------------------------------------------------------
C2SSX9      ------------------------------------------------------------
G9QCG2      ------------------------------------------------------------
Q2BFS6      ------------------------------------------------------------
I3EBB4      ------------------------------------------------------------
A4ITF4      ------------------------------------------------------------
C5D962      ------------------------------------------------------------
G8MZ94      ------------------------------------------------------------
Q5KUM4      ------------------------------------------------------------
D4YHG8      ------------------------------------------------------------
F7V793      ------------------------------------------------------------
H4GK02      ------------------------------------------------------------
F6IR92      ------------------------------------------------------------
G0M0G0      ------------------------------------------------------------
D7VBW5      ------------------------------------------------------------
F9UQ55      ------------------------------------------------------------
G2KUP2      ------------------------------------------------------------
G8PE07      ------------------------------------------------------------
E0NHP5      ------------------------------------------------------------
Q03GL9      ------------------------------------------------------------
F3Y921      ------------------------------------------------------------
G4L593      ------------------------------------------------------------
E6LD65      ------------------------------------------------------------
C9ALZ8      ------------------------------------------------------------
C9BUG6      ------------------------------------------------------------
Q3XYS7      ------------------------------------------------------------
C9B453      ------------------------------------------------------------
D4RJF5      ------------------------------------------------------------
C8ZXT8      ------------------------------------------------------------
F0EKB8      ------------------------------------------------------------
C9A6V4      ------------------------------------------------------------
C9CHY7      ------------------------------------------------------------
D4JI68      ------------------------------------------------------------
D6E329      ------------------------------------------------------------
E6UHY5      ------------------------------------------------------------
E9SAU2      ------------------------------------------------------------
F7K0U2      ------------------------------------------------------------
O06029      ------------------------------------------------------------
G8P3D6      ------------------------------------------------------------
A9QSJ3      ------------------------------------------------------------
F9VC43      ------------------------------------------------------------
G6FD41      ------------------------------------------------------------
G9M881      ------------------------------------------------------------
Q3ZK51      ------------------------------------------------------------
Q83VG0      ------------------------------------------------------------
C6LDI9      ------------------------------------------------------------
G5F9H3      ------------------------------------------------------------
C0CZV8      ------------------------------------------------------------
G5GFW1      ------------------------------------------------------------
F8KGP2      ------------------------------------------------------------
B3XL22      ------------------------------------------------------------
F8DRU3      ------------------------------------------------------------
C2EWM2      ------------------------------------------------------------
D0DSJ3      ------------------------------------------------------------
B2GF32      ------------------------------------------------------------
C0WW25      ------------------------------------------------------------
F0K0J8      ------------------------------------------------------------
G6F8H0      ------------------------------------------------------------
F0HVF2      ------------------------------------------------------------
Q1G8E3      ------------------------------------------------------------
D6S4X3      ------------------------------------------------------------
Q5FIC6      ------------------------------------------------------------
E4SMV6      ------------------------------------------------------------
F0TGY3      ------------------------------------------------------------
F2M2M7      ------------------------------------------------------------
A4ZGZ7      ------------------------------------------------------------
C2EPK4      ------------------------------------------------------------
C7XKF2      ------------------------------------------------------------
E3R265      ------------------------------------------------------------
D0DJG9      ------------------------------------------------------------
D5GZJ9      ------------------------------------------------------------
A8YX90      ------------------------------------------------------------
F0NWJ8      ------------------------------------------------------------
C2JZS0      ------------------------------------------------------------
C1J9I2      ------------------------------------------------------------
Q58Z11      ------------------------------------------------------------
B1MZT2      ------------------------------------------------------------
C2KHF2      ------------------------------------------------------------
Q03W94      ------------------------------------------------------------
G2Z8Q4      ------------------------------------------------------------
D9ST43      ------------------------------------------------------------
H7F5T7      ------------------------------------------------------------
G9WIR0      ------------------------------------------------------------
D3LB11      ------------------------------------------------------------
A0NKF7      ------------------------------------------------------------
Q04DV7      ------------------------------------------------------------
F6BI63      ------------------------------------------------------------
G2MWC1      ------------------------------------------------------------
B0K4N2      ------------------------------------------------------------
C7ISF8      ------------------------------------------------------------
B0KAR6      ------------------------------------------------------------
E8UV30      ------------------------------------------------------------
C0GGR6      ------------------------------------------------------------
A4J8V1      ------------------------------------------------------------
C8VYQ7      ------------------------------------------------------------
C8W5K3      ------------------------------------------------------------
B1BNH4      ------------------------------------------------------------
B1V1Z3      ------------------------------------------------------------
B1R3V2      ------------------------------------------------------------
Q0SVR9      ------------------------------------------------------------
Q8XN47      ------------------------------------------------------------
G7M0Q2      ------------------------------------------------------------
G7M565      ------------------------------------------------------------
A6M2M0      ------------------------------------------------------------
G7M1R8      ------------------------------------------------------------
Q4JZ56      ------------------------------------------------------------
Q7X554      ------------------------------------------------------------
Q7X550      ------------------------------------------------------------
Q7X562      ------------------------------------------------------------
Q7X556      ------------------------------------------------------------
Q7X552      ------------------------------------------------------------
Q7X558      ------------------------------------------------------------
C5NWJ9      ------------------------------------------------------------
F3A498      ------------------------------------------------------------
Q9AHD3      ------------------------------------------------------------
Q4K2E2      ------------------------------------------------------------
Q4K2F8      ------------------------------------------------------------
Q4K046      ------------------------------------------------------------
Q4K0R8      ------------------------------------------------------------
Q4JYY0      ------------------------------------------------------------
Q4JZW8      ------------------------------------------------------------
I0J9C8      ------------------------------------------------------------
Q4K0M4      ------------------------------------------------------------
Q4JZS4      ------------------------------------------------------------
Q4JZK2      ------------------------------------------------------------
Q9AHA5      ------------------------------------------------------------
Q9X9A0      ------------------------------------------------------------
Q4JYK9      ------------------------------------------------------------
Q4K006      ------------------------------------------------------------
Q4JZG8      ------------------------------------------------------------
A6YIA7      ------------------------------------------------------------
E5F5C4      ------------------------------------------------------------
Q9AHB8      ------------------------------------------------------------
Q4JZL8      ------------------------------------------------------------
Q4K1B8      ------------------------------------------------------------
Q8VU32      ------------------------------------------------------------
D2ERX9      ------------------------------------------------------------
G6C7Z0      ------------------------------------------------------------
Q4K2A9      ------------------------------------------------------------
D6ZQI7      ------------------------------------------------------------
Q9ZFT9      ------------------------------------------------------------
Q4K255      ------------------------------------------------------------
F9HJP7      ------------------------------------------------------------
E8JWI4      ------------------------------------------------------------
A8AZR4      ------------------------------------------------------------
D0RXH3      ------------------------------------------------------------
Q83YR6      ------------------------------------------------------------
F1Z125      ------------------------------------------------------------
Q3K0S9      ------------------------------------------------------------
P0C0T8      ------------------------------------------------------------
Q67AY5      ------------------------------------------------------------
Q04662      ------------------------------------------------------------
Q8GP93      ------------------------------------------------------------
Q8GPF7      ------------------------------------------------------------
E3CP61      ------------------------------------------------------------
E8KUY7      ------------------------------------------------------------
C2LSE5      ------------------------------------------------------------
E9DM16      ------------------------------------------------------------
I0QIK5      ------------------------------------------------------------
Q7X560      ------------------------------------------------------------
Q8GMA6      ------------------------------------------------------------
Q55204      ------------------------------------------------------------
Q8GPC4      ------------------------------------------------------------
Q8GPA9      ------------------------------------------------------------
G6ERT2      ------------------------------------------------------------
O87930      ------------------------------------------------------------
Q8GP55      ------------------------------------------------------------
F8HDC4      ------------------------------------------------------------
F8LJ76      ------------------------------------------------------------
F8LXJ5      ------------------------------------------------------------
Q1WCR2      ------------------------------------------------------------
G3G7C0      ------------------------------------------------------------
G3G7J8      ------------------------------------------------------------
G8DU30      ------------------------------------------------------------
A4VTU2      ------------------------------------------------------------
D5AGQ4      ------------------------------------------------------------
Q9X4U6      ------------------------------------------------------------
G3G7G5      ------------------------------------------------------------
G7SG35      ------------------------------------------------------------
G8DU06      ------------------------------------------------------------
G8DUA9      ------------------------------------------------------------
G8DTY9      ------------------------------------------------------------
G3G7I7      ------------------------------------------------------------
G3G7J3      ------------------------------------------------------------
E0PD82      ------------------------------------------------------------
F5X651      ------------------------------------------------------------
G5JTD6      ------------------------------------------------------------
Q2KM75      ------------------------------------------------------------
G5KAJ3      ------------------------------------------------------------
B9DUJ5      ------------------------------------------------------------
G5KD12      ------------------------------------------------------------
E8JMT8      ------------------------------------------------------------
F5X0J8      ------------------------------------------------------------
H2A601      ------------------------------------------------------------
E7S8W2      ------------------------------------------------------------
F8DFF5      ------------------------------------------------------------
I1ZPH8      ------------------------------------------------------------
E3CBR9      ------------------------------------------------------------
E8K787      ------------------------------------------------------------
F9M365      ------------------------------------------------------------
A3CQY3      ------------------------------------------------------------
E8KLZ0      ------------------------------------------------------------
F0FHA9      ------------------------------------------------------------
F0FQQ4      ------------------------------------------------------------
F0I4H6      ------------------------------------------------------------
F0IAY2      ------------------------------------------------------------
F0IJI1      ------------------------------------------------------------
F0IS52      ------------------------------------------------------------
F2C9N1      ------------------------------------------------------------
F2CH54      ------------------------------------------------------------
F3UDW8      ------------------------------------------------------------
F3UNJ5      ------------------------------------------------------------
F3SM33      ------------------------------------------------------------
F9HC66      ------------------------------------------------------------
E1LQJ6      ------------------------------------------------------------
Q4JYU0      ------------------------------------------------------------
Q4JZY2      ------------------------------------------------------------
F9Q346      ------------------------------------------------------------
Q6L5R1      ------------------------------------------------------------
E9FEC6      ------------------------------------------------------------
E0Q2S9      ------------------------------------------------------------
F5VSH0      ------------------------------------------------------------
A5YTV6      ------------------------------------------------------------
Q6L5T1      ------------------------------------------------------------
E0PPH8      ------------------------------------------------------------
A5YTT8      ------------------------------------------------------------
E6KKR9      ------------------------------------------------------------
A1ILY0      ------------------------------------------------------------
F2QF91      ------------------------------------------------------------
Q4K0I3      ------------------------------------------------------------
Q8KWQ1      ------------------------------------------------------------
Q4K238      ------------------------------------------------------------
B1I966      ------------------------------------------------------------
G6J8A3      ------------------------------------------------------------
F9LZC3      ------------------------------------------------------------
F9P1W9      ------------------------------------------------------------
A5LJR9      ------------------------------------------------------------
Q9ZII7      ------------------------------------------------------------
Q4K1K7      ------------------------------------------------------------
E1LPE6      ------------------------------------------------------------
F9MJW6      ------------------------------------------------------------
Q4K0V3      ------------------------------------------------------------
Q54519      ------------------------------------------------------------
C1CBD0      ------------------------------------------------------------
Q7WVX1      ------------------------------------------------------------
Q4K0E2      ------------------------------------------------------------
Q9AH96      ------------------------------------------------------------
A5M4L2      ------------------------------------------------------------
B2ILP4      ------------------------------------------------------------
C1CCB8      ------------------------------------------------------------
P72511      ------------------------------------------------------------
Q4K1S8      ------------------------------------------------------------
P96474      ------------------------------------------------------------
Q4K196      ------------------------------------------------------------
Q4K0Z7      ------------------------------------------------------------
Q4JZ85      ------------------------------------------------------------
Q4JYH6      ------------------------------------------------------------
Q4JZ19      ------------------------------------------------------------
Q4K0A1      ------------------------------------------------------------
Q4K1M5      ------------------------------------------------------------
Q4K2Q8      ------------------------------------------------------------
Q4K1G0      ------------------------------------------------------------
Q4K0T6      ------------------------------------------------------------
Q4K0K3      ------------------------------------------------------------
Q4K0X6      ------------------------------------------------------------
E8KDN1      ------------------------------------------------------------
F9PEU3      ------------------------------------------------------------
E8K321      ------------------------------------------------------------
F9PZP6      ------------------------------------------------------------
D6R2T7      ------------------------------------------------------------
F3UUQ1      ------------------------------------------------------------
E6IZC3      ------------------------------------------------------------
G6A746      ------------------------------------------------------------
B1V0N8      ------------------------------------------------------------
B1BNK2      ------------------------------------------------------------
B1R3X7      ------------------------------------------------------------
Q8XN77      ------------------------------------------------------------
B1HR40      ------------------------------------------------------------
A7Z922      ------------------------------------------------------------
I2CAF3      ------------------------------------------------------------
I2HVL3      ------------------------------------------------------------
E0U2Z4      ------------------------------------------------------------
D4G1R3      ------------------------------------------------------------
G4EQZ6      ------------------------------------------------------------
P71050      ------------------------------------------------------------
G4P115      ------------------------------------------------------------
A8FHM0      ------------------------------------------------------------
C0EBA5      ------------------------------------------------------------
F8FCE3      ------------------------------------------------------------
I0BSG5      ------------------------------------------------------------
A8YPQ6      ------------------------------------------------------------
P95695      ------------------------------------------------------------
Q2G1K8      ------------------------------------------------------------
C5QNG5      ------------------------------------------------------------
Q4L9H8      ------------------------------------------------------------
Q2FUV1      ------------------------------------------------------------
P39850      ------------------------------------------------------------
D7UYE3      ------------------------------------------------------------
Q4A121      ------------------------------------------------------------
C9AAE4      ------------------------------------------------------------
H7F6C7      ------------------------------------------------------------
F0SX23      ------------------------------------------------------------
Q38VG4      ------------------------------------------------------------
F2I4B6      ------------------------------------------------------------
Q8RBS6      ------------------------------------------------------------
D9SR42      ------------------------------------------------------------
D9SVC8      ------------------------------------------------------------
E7RG09      ------------------------------------------------------------
D4G2E2      ------------------------------------------------------------
Q8EME7      ------------------------------------------------------------
D6Y035      ------------------------------------------------------------
Q5WBB3      ------------------------------------------------------------
Q9K6Q9      ------------------------------------------------------------
Q97EP7      ------------------------------------------------------------
Q97ER4      ------------------------------------------------------------
E4S7Y7      ------------------------------------------------------------
E4Q5T6      ------------------------------------------------------------
E4SDX3      ------------------------------------------------------------
G2FWX3      ------------------------------------------------------------
G7WJV2      ------------------------------------------------------------
G7W774      ------------------------------------------------------------
G2FM60      ------------------------------------------------------------
H5XZD5      ------------------------------------------------------------
I4DBG9      ------------------------------------------------------------
G2FWT7      ------------------------------------------------------------
H5XZG8      ------------------------------------------------------------
G0V448      ------------------------------------------------------------
A0PZ01      ------------------------------------------------------------
B1B737      ------------------------------------------------------------
G5IFS2      KKKSRKERKAERLREETEDRIQREIAQEMAERRREADEDEEDIMPHQV-----FGKRKNR
B8D0N1      TDKHPEIIKLKAEKKSILNEISNTLGEVITSTIYTTNPVYNNLKQELVKLETELTSLKAQ
D9QTC7      TDNHPKVIATNRKIDEVTKRLNETVEEIVRSKTETINPIYQTLKEKVITLQSKIITTKVQ
G0VNK5      TDEHPKMQEINNQINSTRDSLNQEISKIVSQQAPSSNSVQQGLLADKFKNEAAIAVAQSK
D2RIR1      TSENPKMKEINRQIGAARYSLRKEIQAIIAQKAPSSSSVQQKLLSDKFTNEALIAVAQGK
I0GRR3      TEDHEKMQAVNQKIANVQASMEKEIGSIVARQAPSSSSVQQKLLADKFQNEAMVAVEQAK
                                                                        

G9RSY8      ---------------------------------------------------------ND-
C4Z673      ---------------------------------------------------------EA-
C6CW36      ---------------------------------------------------------DN-
A8SQS9      ---------------------------------------------------------NA-
D5HFS3      ---------------------------------------------------------SA-
G0LYN8      ---------------------------------------------------------NN-
F6ITB3      ---------------------------------------------------------NN-
G0M1Y0      ---------------------------------------------------------NN-
D7VC12      ---------------------------------------------------------NN-
F9UMZ5      ---------------------------------------------------------NN-
B9Y883      ---------------------------------------------------------EN-
H7F1R6      ---------------------------------------------------------DN-
H7F570      ---------------------------------------------------------DN-
A5Z5P8      ---------------------------------------------------------SS-
C6LCS6      ---------------------------------------------------------EA-
A7VF43      ---------------------------------------------------------NA-
C6CSC7      ---------------------------------------------------------EN-
C6CS79      ---------------------------------------------------------DN-
F5LM70      ---------------------------------------------------------DN-
H6LKR9      ---------------------------------------------------------EN-
F5LE49      ---------------------------------------------------------DN-
F3AHH1      ---------------------------------------------------------EA-
H1LCW2      ---------------------------------------------------------NN-
I5AV00      ---------------------------------------------------------EA-
H6NE44      ---------------------------------------------------------SN-
F4BS20      ---------------------------------------------------------EN-
E0RZL4      ---------------------------------------------------------DA-
C0CK72      ---------------------------------------------------------KE-
D9S1J8      ---------------------------------------------------------EN-
C2EFR7      ---------------------------------------------------------IS-
Q1WTC7      ---------------------------------------------------------IS-
B0P2G1      ---------------------------------------------------------KS-
D4MW28      ---------------------------------------------------------KS-
E5VMX9      ---------------------------------------------------------KS-
F2I6Z8      ---------------------------------------------------------DK-
E6U7N3      ---------------------------------------------------------GS-
C4Z8M6      ---------------------------------------------------------DP-
D4JMC3      ---------------------------------------------------------SQ-
D6E0V3      ---------------------------------------------------------SQ-
E3GPC7      ---------------------------------------------------------SN-
A6BIG6      ---------------------------------------------------------DS-
C2CI43      ---------------------------------------------------------DN-
D4RX68      ---------------------------------------------------------ENM
D4J4T5      ---------------------------------------------------------QA-
I5ASF9      ---------------------------------------------------------QA-
C0C0F9      ---------------------------------------------------------DS-
B6W7H3      ---------------------------------------------------------DN-
C7RGH5      ---------------------------------------------------------DN-
F0GT82      ---------------------------------------------------------DN-
F3AH93      ---------------------------------------------------------IP-
B0GAL4      ---------------------------------------------------------TP-
G1WUK1      ---------------------------------------------------------TP-
D4M2S1      ---------------------------------------------------------TP-
E7GL80      ---------------------------------------------------------TP-
G5F9E3      ---------------------------------------------------------TP-
D4CG07      ---------------------------------------------------------IP-
D4MP31      ---------------------------------------------------------IP-
G5HNC6      ---------------------------------------------------------IP-
A8RK86      ---------------------------------------------------------VP-
G5HTB1      ---------------------------------------------------------IP-
A8RSL0      ---------------------------------------------------------VP-
C5EN02      ---------------------------------------------------------VP-
G5HG46      ---------------------------------------------------------VP-
E7GL39      ---------------------------------------------------------VP-
E7GL56      ---------------------------------------------------------VP-
G5F9B0      ---------------------------------------------------------VP-
D3AC81      ---------------------------------------------------------AP-
D3AE79      ---------------------------------------------------------VP-
D4YF14      ---------------------------------------------------------SN-
B1YMM6      ---------------------------------------------------------DN-
D4LG05      ---------------------------------------------------------KA-
D4LTH3      ---------------------------------------------------------KA-
F3ATF6      ---------------------------------------------------------AP-
E0I7B6      ---------------------------------------------------------DN-
C9LAS2      ---------------------------------------------------------KA-
F7K8E8      ---------------------------------------------------------QA-
F7K9V0      ---------------------------------------------------------QA-
F7KL97      ---------------------------------------------------------QA-
D3FZP5      ---------------------------------------------------------DN-
C0ZHV9      ---------------------------------------------------------NN-
D7WMM9      ---------------------------------------------------------DN-
A8U9F5      ---------------------------------------------------------EN-
F4BSE0      ---------------------------------------------------------EN-
E7RDR2      ---------------------------------------------------------DN-
I0JRK5      ---------------------------------------------------------DN-
G2TR26      ---------------------------------------------------------DN-
D5DBK2      ---------------------------------------------------------DN-
D5DY80      ---------------------------------------------------------DN-
A7Z9K1      ---------------------------------------------------------DN-
I2CB17      ---------------------------------------------------------DN-
I2HW54      ---------------------------------------------------------DN-
G4P1M8      ---------------------------------------------------------DN-
E0TTZ7      ---------------------------------------------------------DN-
G4EQF2      ---------------------------------------------------------DN-
P96715      ---------------------------------------------------------DN-
I0F9R7      ---------------------------------------------------------DN-
G9QKR5      ---------------------------------------------------------DN-
B5UQ74      ---------------------------------------------------------DN-
B7HFH2      ---------------------------------------------------------DN-
Q72XH7      ---------------------------------------------------------DN-
C2V4M3      ---------------------------------------------------------DN-
C2YZB3      ---------------------------------------------------------DN-
C2P8H2      ---------------------------------------------------------DN-
C2Y451      ---------------------------------------------------------DN-
C3EBC1      ---------------------------------------------------------DN-
C3H980      ---------------------------------------------------------DN-
C2PN23      ---------------------------------------------------------DN-
B9IRQ7      ---------------------------------------------------------DN-
A0RL71      ---------------------------------------------------------DN-
C2XJI0      ---------------------------------------------------------DN-
Q3EV65      ---------------------------------------------------------DN-
C2T8T7      ---------------------------------------------------------DN-
C2RG50      ---------------------------------------------------------DN-
Q814Y9      ---------------------------------------------------------DN-
B3ZRD5      ---------------------------------------------------------DN-
Q6HB08      ---------------------------------------------------------DN-
C2NQN7      ---------------------------------------------------------DN-
C3GRR1      ---------------------------------------------------------DN-
C2ULR7      ---------------------------------------------------------DN-
C3GBJ9      ---------------------------------------------------------DN-
C2WVG7      ---------------------------------------------------------DN-
B7IQS9      ---------------------------------------------------------DN-
A9VRC4      ---------------------------------------------------------DN-
C2MTG4      ---------------------------------------------------------DN-
B7HXB5      ---------------------------------------------------------DN-
C2SBU5      ---------------------------------------------------------DN-
C2SSX9      ---------------------------------------------------------DN-
G9QCG2      ---------------------------------------------------------DN-
Q2BFS6      ---------------------------------------------------------DN-
I3EBB4      ---------------------------------------------------------DN-
A4ITF4      ---------------------------------------------------------DN-
C5D962      ---------------------------------------------------------DN-
G8MZ94      ---------------------------------------------------------DN-
Q5KUM4      ---------------------------------------------------------DN-
D4YHG8      ---------------------------------------------------------EN-
F7V793      ---------------------------------------------------------LK-
H4GK02      ---------------------------------------------------------NN-
F6IR92      ---------------------------------------------------------NN-
G0M0G0      ---------------------------------------------------------NN-
D7VBW5      ---------------------------------------------------------NN-
F9UQ55      ---------------------------------------------------------NN-
G2KUP2      ---------------------------------------------------------NS-
G8PE07      ---------------------------------------------------------NN-
E0NHP5      ---------------------------------------------------------NN-
Q03GL9      ---------------------------------------------------------NN-
F3Y921      ---------------------------------------------------------DK-
G4L593      ---------------------------------------------------------DK-
E6LD65      ---------------------------------------------------------DR-
C9ALZ8      ---------------------------------------------------------DK-
C9BUG6      ---------------------------------------------------------DK-
Q3XYS7      ---------------------------------------------------------DK-
C9B453      ---------------------------------------------------------DK-
D4RJF5      ---------------------------------------------------------DK-
C8ZXT8      ---------------------------------------------------------DK-
F0EKB8      ---------------------------------------------------------DK-
C9A6V4      ---------------------------------------------------------DK-
C9CHY7      ---------------------------------------------------------DK-
D4JI68      ---------------------------------------------------------DP-
D6E329      ---------------------------------------------------------DP-
E6UHY5      ---------------------------------------------------------GS-
E9SAU2      ---------------------------------------------------------GY-
F7K0U2      ---------------------------------------------------------DA-
O06029      ---------------------------------------------------------TN-
G8P3D6      ---------------------------------------------------------TN-
A9QSJ3      ---------------------------------------------------------TN-
F9VC43      ---------------------------------------------------------TN-
G6FD41      ---------------------------------------------------------TN-
G9M881      ---------------------------------------------------------TN-
Q3ZK51      ---------------------------------------------------------TN-
Q83VG0      ---------------------------------------------------------TN-
C6LDI9      ---------------------------------------------------------AK-
G5F9H3      ---------------------------------------------------------VP-
C0CZV8      ---------------------------------------------------------VP-
G5GFW1      ---------------------------------------------------------VP-
F8KGP2      ---------------------------------------------------------NN-
B3XL22      ---------------------------------------------------------NN-
F8DRU3      ---------------------------------------------------------NN-
C2EWM2      ---------------------------------------------------------NN-
D0DSJ3      ---------------------------------------------------------NN-
B2GF32      ---------------------------------------------------------NN-
C0WW25      ---------------------------------------------------------NN-
F0K0J8      ---------------------------------------------------------NN-
G6F8H0      ---------------------------------------------------------NN-
F0HVF2      ---------------------------------------------------------NN-
Q1G8E3      ---------------------------------------------------------NN-
D6S4X3      ---------------------------------------------------------NN-
Q5FIC6      ---------------------------------------------------------NN-
E4SMV6      ---------------------------------------------------------NN-
F0TGY3      ---------------------------------------------------------NN-
F2M2M7      ---------------------------------------------------------NN-
A4ZGZ7      ---------------------------------------------------------DN-
C2EPK4      ---------------------------------------------------------NN-
C7XKF2      ---------------------------------------------------------NN-
E3R265      ---------------------------------------------------------NN-
D0DJG9      ---------------------------------------------------------NN-
D5GZJ9      ---------------------------------------------------------NN-
A8YX90      ---------------------------------------------------------DN-
F0NWJ8      ---------------------------------------------------------DN-
C2JZS0      ---------------------------------------------------------SN-
C1J9I2      ---------------------------------------------------------SN-
Q58Z11      ---------------------------------------------------------SN-
B1MZT2      ---------------------------------------------------------NN-
C2KHF2      ---------------------------------------------------------NN-
Q03W94      ---------------------------------------------------------NN-
G2Z8Q4      ---------------------------------------------------------QN-
D9ST43      ---------------------------------------------------------QN-
H7F5T7      ---------------------------------------------------------NN-
G9WIR0      ---------------------------------------------------------SN-
D3LB11      ---------------------------------------------------------SN-
A0NKF7      ---------------------------------------------------------SN-
Q04DV7      ---------------------------------------------------------SN-
F6BI63      ---------------------------------------------------------DN-
G2MWC1      ---------------------------------------------------------DN-
B0K4N2      ---------------------------------------------------------DN-
C7ISF8      ---------------------------------------------------------DN-
B0KAR6      ---------------------------------------------------------DN-
E8UV30      ---------------------------------------------------------DN-
C0GGR6      ---------------------------------------------------------DN-
A4J8V1      ---------------------------------------------------------DN-
C8VYQ7      ---------------------------------------------------------DN-
C8W5K3      ---------------------------------------------------------NG-
B1BNH4      ---------------------------------------------------------GN-
B1V1Z3      ---------------------------------------------------------GN-
B1R3V2      ---------------------------------------------------------GN-
Q0SVR9      ---------------------------------------------------------GN-
Q8XN47      ---------------------------------------------------------GN-
G7M0Q2      ---------------------------------------------------------GN-
G7M565      ---------------------------------------------------------GN-
A6M2M0      ---------------------------------------------------------GN-
G7M1R8      ---------------------------------------------------------GN-
Q4JZ56      ---------------------------------------------------------TD-
Q7X554      ---------------------------------------------------------ED-
Q7X550      ---------------------------------------------------------ED-
Q7X562      ---------------------------------------------------------ED-
Q7X556      ---------------------------------------------------------ED-
Q7X552      ---------------------------------------------------------EN-
Q7X558      ---------------------------------------------------------ED-
C5NWJ9      ---------------------------------------------------------ED-
F3A498      ---------------------------------------------------------DD-
Q9AHD3      ---------------------------------------------------------SD-
Q4K2E2      ---------------------------------------------------------SD-
Q4K2F8      ---------------------------------------------------------SD-
Q4K046      ---------------------------------------------------------SD-
Q4K0R8      ---------------------------------------------------------SD-
Q4JYY0      ---------------------------------------------------------SD-
Q4JZW8      ---------------------------------------------------------SD-
I0J9C8      ---------------------------------------------------------SD-
Q4K0M4      ---------------------------------------------------------SD-
Q4JZS4      ---------------------------------------------------------SD-
Q4JZK2      ---------------------------------------------------------SD-
Q9AHA5      ---------------------------------------------------------SD-
Q9X9A0      ---------------------------------------------------------SD-
Q4JYK9      ---------------------------------------------------------SD-
Q4K006      ---------------------------------------------------------SD-
Q4JZG8      ---------------------------------------------------------SD-
A6YIA7      ---------------------------------------------------------SD-
E5F5C4      ---------------------------------------------------------SD-
Q9AHB8      ---------------------------------------------------------SD-
Q4JZL8      ---------------------------------------------------------SD-
Q4K1B8      ---------------------------------------------------------SD-
Q8VU32      ---------------------------------------------------------SD-
D2ERX9      ---------------------------------------------------------SD-
G6C7Z0      ---------------------------------------------------------SD-
Q4K2A9      ---------------------------------------------------------SD-
D6ZQI7      ---------------------------------------------------------SD-
Q9ZFT9      ---------------------------------------------------------SD-
Q4K255      ---------------------------------------------------------SD-
F9HJP7      ---------------------------------------------------------SD-
E8JWI4      ---------------------------------------------------------SD-
A8AZR4      ---------------------------------------------------------SD-
D0RXH3      ---------------------------------------------------------SD-
Q83YR6      ---------------------------------------------------------SD-
F1Z125      ---------------------------------------------------------QD-
Q3K0S9      ---------------------------------------------------------ED-
P0C0T8      ---------------------------------------------------------ED-
Q67AY5      ---------------------------------------------------------ED-
Q04662      ---------------------------------------------------------ED-
Q8GP93      ---------------------------------------------------------ED-
Q8GPF7      ---------------------------------------------------------ED-
E3CP61      ---------------------------------------------------------ED-
E8KUY7      ---------------------------------------------------------ED-
C2LSE5      ---------------------------------------------------------ED-
E9DM16      ---------------------------------------------------------ED-
I0QIK5      ---------------------------------------------------------ED-
Q7X560      ---------------------------------------------------------ED-
Q8GMA6      ---------------------------------------------------------ED-
Q55204      ---------------------------------------------------------ED-
Q8GPC4      ---------------------------------------------------------ED-
Q8GPA9      ---------------------------------------------------------ED-
G6ERT2      ---------------------------------------------------------ED-
O87930      ---------------------------------------------------------ED-
Q8GP55      ---------------------------------------------------------DD-
F8HDC4      ---------------------------------------------------------ED-
F8LJ76      ---------------------------------------------------------ED-
F8LXJ5      ---------------------------------------------------------DD-
Q1WCR2      ---------------------------------------------------------DD-
G3G7C0      ---------------------------------------------------------SE-
G3G7J8      ---------------------------------------------------------SE-
G8DU30      ---------------------------------------------------------SD-
A4VTU2      ---------------------------------------------------------SD-
D5AGQ4      ---------------------------------------------------------SD-
Q9X4U6      ---------------------------------------------------------SD-
G3G7G5      ---------------------------------------------------------SD-
G7SG35      ---------------------------------------------------------SD-
G8DU06      ---------------------------------------------------------SD-
G8DUA9      ---------------------------------------------------------SD-
G8DTY9      ---------------------------------------------------------SD-
G3G7I7      ---------------------------------------------------------SD-
G3G7J3      ---------------------------------------------------------SD-
E0PD82      ---------------------------------------------------------DD-
F5X651      ---------------------------------------------------------DD-
G5JTD6      ---------------------------------------------------------DD-
Q2KM75      ---------------------------------------------------------QD-
G5KAJ3      ---------------------------------------------------------QD-
B9DUJ5      ---------------------------------------------------------QD-
G5KD12      ---------------------------------------------------------QD-
E8JMT8      ---------------------------------------------------------DD-
F5X0J8      ---------------------------------------------------------DD-
H2A601      ---------------------------------------------------------DD-
E7S8W2      ---------------------------------------------------------SD-
F8DFF5      ---------------------------------------------------------SD-
I1ZPH8      ---------------------------------------------------------SD-
E3CBR9      ---------------------------------------------------------SD-
E8K787      ---------------------------------------------------------SD-
F9M365      ---------------------------------------------------------SD-
A3CQY3      ---------------------------------------------------------SD-
E8KLZ0      ---------------------------------------------------------SD-
F0FHA9      ---------------------------------------------------------SD-
F0FQQ4      ---------------------------------------------------------SD-
F0I4H6      ---------------------------------------------------------SD-
F0IAY2      ---------------------------------------------------------SD-
F0IJI1      ---------------------------------------------------------SD-
F0IS52      ---------------------------------------------------------SD-
F2C9N1      ---------------------------------------------------------SD-
F2CH54      ---------------------------------------------------------SD-
F3UDW8      ---------------------------------------------------------SD-
F3UNJ5      ---------------------------------------------------------SD-
F3SM33      ---------------------------------------------------------SD-
F9HC66      ---------------------------------------------------------SD-
E1LQJ6      ---------------------------------------------------------SD-
Q4JYU0      ---------------------------------------------------------SD-
Q4JZY2      ---------------------------------------------------------SD-
F9Q346      ---------------------------------------------------------SD-
Q6L5R1      ---------------------------------------------------------SD-
E9FEC6      ---------------------------------------------------------SD-
E0Q2S9      ---------------------------------------------------------SD-
F5VSH0      ---------------------------------------------------------SD-
A5YTV6      ---------------------------------------------------------SD-
Q6L5T1      ---------------------------------------------------------SD-
E0PPH8      ---------------------------------------------------------SD-
A5YTT8      ---------------------------------------------------------SD-
E6KKR9      ---------------------------------------------------------SD-
A1ILY0      ---------------------------------------------------------SD-
F2QF91      ---------------------------------------------------------SD-
Q4K0I3      ---------------------------------------------------------SD-
Q8KWQ1      ---------------------------------------------------------SD-
Q4K238      ---------------------------------------------------------SD-
B1I966      ---------------------------------------------------------SD-
G6J8A3      ---------------------------------------------------------SD-
F9LZC3      ---------------------------------------------------------SD-
F9P1W9      ---------------------------------------------------------SD-
A5LJR9      ---------------------------------------------------------SD-
Q9ZII7      ---------------------------------------------------------SD-
Q4K1K7      ---------------------------------------------------------SD-
E1LPE6      ---------------------------------------------------------SD-
F9MJW6      ---------------------------------------------------------SD-
Q4K0V3      ---------------------------------------------------------SD-
Q54519      ---------------------------------------------------------SD-
C1CBD0      ---------------------------------------------------------SD-
Q7WVX1      ---------------------------------------------------------SD-
Q4K0E2      ---------------------------------------------------------SD-
Q9AH96      ---------------------------------------------------------SD-
A5M4L2      ---------------------------------------------------------SD-
B2ILP4      ---------------------------------------------------------SD-
C1CCB8      ---------------------------------------------------------SD-
P72511      ---------------------------------------------------------SD-
Q4K1S8      ---------------------------------------------------------SD-
P96474      ---------------------------------------------------------SD-
Q4K196      ---------------------------------------------------------SD-
Q4K0Z7      ---------------------------------------------------------SD-
Q4JZ85      ---------------------------------------------------------SD-
Q4JYH6      ---------------------------------------------------------SD-
Q4JZ19      ---------------------------------------------------------SD-
Q4K0A1      ---------------------------------------------------------SD-
Q4K1M5      ---------------------------------------------------------SD-
Q4K2Q8      ---------------------------------------------------------SD-
Q4K1G0      ---------------------------------------------------------SD-
Q4K0T6      ---------------------------------------------------------SD-
Q4K0K3      ---------------------------------------------------------SD-
Q4K0X6      ---------------------------------------------------------SD-
E8KDN1      ---------------------------------------------------------SD-
F9PEU3      ---------------------------------------------------------SD-
E8K321      ---------------------------------------------------------SD-
F9PZP6      ---------------------------------------------------------SD-
D6R2T7      ---------------------------------------------------------PD-
F3UUQ1      ---------------------------------------------------------PD-
E6IZC3      ---------------------------------------------------------AD-
G6A746      ---------------------------------------------------------AD-
B1V0N8      ---------------------------------------------------------SN-
B1BNK2      ---------------------------------------------------------SN-
B1R3X7      ---------------------------------------------------------SN-
Q8XN77      ---------------------------------------------------------SN-
B1HR40      ---------------------------------------------------------DN-
A7Z922      ---------------------------------------------------------KG-
I2CAF3      ---------------------------------------------------------KG-
I2HVL3      ---------------------------------------------------------KG-
E0U2Z4      ---------------------------------------------------------QG-
D4G1R3      ---------------------------------------------------------QG-
G4EQZ6      ---------------------------------------------------------QG-
P71050      ---------------------------------------------------------QG-
G4P115      ---------------------------------------------------------QG-
A8FHM0      ---------------------------------------------------------DR-
C0EBA5      ---------------------------------------------------------DS-
F8FCE3      ---------------------------------------------------------SN-
I0BSG5      ---------------------------------------------------------SN-
A8YPQ6      ---------------------------------------------------------DN-
P95695      ---------------------------------------------------------DN-
Q2G1K8      ---------------------------------------------------------DN-
C5QNG5      ---------------------------------------------------------DN-
Q4L9H8      ---------------------------------------------------------DN-
Q2FUV1      ---------------------------------------------------------DN-
P39850      ---------------------------------------------------------DN-
D7UYE3      ---------------------------------------------------------DN-
Q4A121      ---------------------------------------------------------DN-
C9AAE4      ---------------------------------------------------------DN-
H7F6C7      ---------------------------------------------------------DN-
F0SX23      ---------------------------------------------------------SS-
Q38VG4      ---------------------------------------------------------DN-
F2I4B6      ---------------------------------------------------------DN-
Q8RBS6      ---------------------------------------------------------DN-
D9SR42      ---------------------------------------------------------DN-
D9SVC8      ---------------------------------------------------------DN-
E7RG09      ---------------------------------------------------------DN-
D4G2E2      ---------------------------------------------------------DN-
Q8EME7      ---------------------------------------------------------DN-
D6Y035      ---------------------------------------------------------DN-
Q5WBB3      ---------------------------------------------------------DN-
Q9K6Q9      ---------------------------------------------------------DN-
Q97EP7      ---------------------------------------------------------GD-
Q97ER4      ---------------------------------------------------------GD-
E4S7Y7      ---------------------------------------------------------EN-
E4Q5T6      ---------------------------------------------------------EN-
E4SDX3      ---------------------------------------------------------EN-
G2FWX3      ---------------------------------------------------------DS-
G7WJV2      ---------------------------------------------------------DS-
G7W774      ---------------------------------------------------------DS-
G2FM60      ---------------------------------------------------------DS-
H5XZD5      ---------------------------------------------------------DS-
I4DBG9      ---------------------------------------------------------DS-
G2FWT7      ---------------------------------------------------------DS-
H5XZG8      ---------------------------------------------------------DS-
G0V448      ---------------------------------------------------------GS-
A0PZ01      ---------------------------------------------------------GN-
B1B737      ---------------------------------------------------------GN-
G5IFS2      NAARDLKERKQEADFQDVPIDED-------EEEVDERAAHGKSARRNARQIKKADRETY-
B8D0N1      KESLNIQFQKIKAKTEQLPKKELEYSRLLRKLEVSEKLYTMLLTRYQELKITEAMKVSD-
D9QTC7      IDTHQQQIKELEKELNALPDKALALARLKRKNKIAEKVYTMLRERKEELQIQKAMKTSD-
G0VNK5      KTALDQMDAQNDAIISSLPEKEQGFVRVKRDADVSNEIYVMLAKRLEEAKVAEVMVPNE-
D2RIR1      NNAIDQLEKKNADEIARLPQTQQGYLQVKRDADVAQEIYVMLAKRLEEAKVAEVMVPTE-
I0GRR3      AKALAALDKENEDLISKLPEKEQGYVRVKRDTEVAQEIYVMLAKRLEEAKIAENMVPTE-
                                                                        

G9RSY8      ------------------------------------------------------------
C4Z673      VNVVDQA----------NLPDEPVSPSIPKWTIIGVLVGIVISAAVIIIQHLLDDTIK--
C6CW36      ITILNEA------KVKDTRPHNPVNINLVTSILVAFVLSLLASVALVLILHFLDDTLK--
A8SQS9      PNIAQVA------RV----ADKKVGPSYMKYTAIGALLGALIYCIFIIIGYLMDDTIH--
D5HFS3      PNIAQVA------RV----ADQKVGPSYLKYTAIGALLGALIYCLIVIVGYLMDDTIH--
G0LYN8      VTIVAPA------ET----PNGAVSPKKPLNMLVGLVAGLLLGFVYASLRMLTDRRVR--
F6ITB3      VTIVAPA------ET----PKSAVSPKKPLNLLIGLVAGLLLGIVYAAVRMLTDRRVH--
G0M1Y0      VTIVAPA------ET----PKSSVSPKKPLNLLIGLVAGLLLGIVYAAVRMLTDRRVH--
D7VC12      VTIVAPA------ET----PSGTVSPKKPLNMLIGLVVGLLLGFVYAAIRMLTDRRVH--
F9UMZ5      VTIVAPA------ET----PNGAVSPKKPLNMLIGLVVGLLLGIVYAAIRMLTDRRVH--
B9Y883      VTVLNSA------KI----PEKKSSPSNVKNTLIGFLLGCVIDGCIVLYILLNDRNIR--
H7F1R6      ISVLSPA------FY--DSAMSPVKPHQSLMLVISGLFGLVIGIIIMFVRDLFDRSIK--
H7F570      VYILSKA------TF--SDNMSPVKPSKGLLIMVSVVLGTVVGIIIMFFRHLFDNSIK--
A5Z5P8      PNIAERA------IT----PKGKSSPSLKKNVMMGAFGGMVVVLAIFTFLFITDDTIK--
C6LCS6      VNVVEEA------NL----PEKKARPANIKNAVIGGTVALLVALVIILIQTVMDDRIK--
A7VF43      PNIAQVA------RI----PDEKAGPSYLKFTLIGALLGAFLYCLVIIIRYLLDDTIH--
C6CSC7      VSILNEA------LL--DDQPAPVSPNVTLNIIIAFVVSLMIAVGIAFLLEYMDDTIK--
C6CS79      VYILHTA------DS--NDQPVKVKPETKLNIAIGFVAAFLLSITLVLALNYFDDTLR--
F5LM70      VFVLHEA------DP--AKTPAPVKPNVPLNVAISFLASLMFAIGLVFALEYFDDTLK--
H6LKR9      IRILDQS------TL----PVKPISPNILINTIIGGLFGLLFSLFVILIMFLFNDTVK--
F5LE49      VTILNEA------KT--TDNVGPVTPNIKLNVAAAFIVSLLISVGLVFLIEHLDDTVK--
F3AHH1      VNVVDEA------NI----PDSPVGPSAMKNGMIAGILGCVIAVMIVIIRYLTNDTIQ--
H1LCW2      VTIVSEA------TP----VKQKSFPKTSIVLLAGAVIGLLVGLGYAFIRELTDTTIK--
I5AV00      VNVVDEA------SI----PMAKSGPNPKRNAILGGIFGAFLAIAAVIIFNLADDTIK--
H6NE44      ITTLGVA------NP--EKPARPILPNTQLNVLVSVLVTLLLGVGYAFLHHMLQDTVK--
F4BS20      VAILSKA------KV----NAVPISPNLSLNQVVGLLVGFLLGMILSIILETMDKKVR--
E0RZL4      INIAETA------NV----PTDKASPSVARWTIIAGFIGAVVVAFFAILGYLLDDSIK--
C0CK72      PYLVEEA------VA----DNEPVSPSPKKNLAVGALAGLFLVGMVLVIRYVSNDKVC--
D9S1J8      VQVIDEA------IP----IYQKVQPKPVLNLSLSLILGLMMGVFFAFLQESFDTSIK--
C2EFR7      VGVVDKA------NY----PQSQSYPITIKWIEYGFLIGFVLSIGVLLIRFILDDTIK--
Q1WTC7      VGVVDKA------NY----PQSQSYPITIKWIEYGFLIGFVLSIGVLLIRFILDDTIK--
B0P2G1      PTIIEKA------YK----ADKPDSPSLKKNVLIGAVLGFILMAAAIVIQYLMNDTIL--
D4MW28      PTIIEKA------YK----ADKPDSPSLKKNVLIGAVLGFILMAAAIVIQYLMNDTIL--
E5VMX9      PTIIEKA------YK----ADKPDSPSLKKNVLIGAVLGFILMAAAIVIQYLMNDTIL--
F2I6Z8      VTLLSPA------SY----NEKPVSPNYGLNLLLGAVLGGLISLVIQAIRVLNDDTVR--
E6U7N3      VEVVSDA------KL----ELKPVFPNIVLFSAIGLLIGFIGAYATLLVRDLLDHTFD--
C4Z8M6      PTIIQSG------YD----DGGAVSPNIGKNTVIGAFAGAFLSIAVIVVSYLFNDTII--
D4JMC3      PKIIQTA------YA----SKTPVNNNILKNTVIGAVLGLILAAGIVVLGYMLDDTIS--
D6E0V3      PKIIQTA------YA----SKTPVNNNILKNTVIGAVLGLILAAGIVVLGYMLDDTIS--
E3GPC7      LQVVDAA------EV----NSTPVSPNLKLNVAIAFLLGIVVSVFIIFIREMLNTSVK--
A6BIG6      VNTVEEA------NL----PMYPSSPSTKKNMLIGGLLGILASVGIVLFVYLSDDTLK--
C2CI43      VQILDGA------TL----PEEPSSPKIAKNTAIGLVLGFVLGMAVALFRELADSSVN--
D4RX68      VSLVDSA------DL----PTTPSSPATKRNTVIALLLGVVISSAVIIIIGIKDDRIK--
D4J4T5      IKIYEEA------AV----PDRPSSPSLKKNCALGLLAGIVLAMAVITILYLLDDTIK--
I5ASF9      PKIVEVG------EV----PIRPTSPSLMKNVVIGFLLGALLMIAFITVQVMMNDSVV--
C0C0F9      VNTFEEG------NL----PTEPSSPSLVKNMAIGGLLGLIIALGIIVLIFVLDDTIK--
B6W7H3      VQILDKA------NL----PEKPSSPNIKKNTLVGFVLGFILGVGISLFKELSDTTFK--
C7RGH5      VQILDGA------IL----PEEASSPNIKKNTAIGIILGFVLGVAVVLFKEIADSSVK--
F0GT82      VQILDGA------TI----PVEPVSPNVSKNTVVGAIIGLVLGIIISMFKELYDISIK--
F3AH93      PKIIEKG------EI----PTYKDGPNIKKNAFLGLFAGLFASAGVFALLAIMSDFIK--
B0GAL4      PKIIEKG------EV----PTSRSNTGVAKMAVMGVLAGMILCAGVIVIRTIMDDTIK--
G1WUK1      PKIIEKG------EV----PTSRSNTGVAKMAVMGVLAGMILCAGVIVVRTIMDDTIK--
D4M2S1      PKIIEEG------EV----PTIQTSPSTKKNVLIGALAGLVLSAGVIILLTLMDDTIK--
E7GL80      PKLIEDG------MV----ATVQTSPNVKKNAAVGGLVMLVLACGVITLSVIMNDTIR--
G5F9E3      PKLIEDG------MV----ATVQTSPNVKKNAAVGGLVMLVLACGVITLSVIMNDTIR--
D4CG07      PKIVEEG------EA----AVAPTSPNVKKNAVMGAAGGIFLVCAFVAVRVIVNDTVK--
D4MP31      PKIVEEG------EA----AVAPTSPNVKKNAVMGAAGGIFLVCAFVAVRVIVNDTVK--
G5HNC6      PKIIEGG------VV----PDKPASPNVTRNAALGGMALAVISCAIITLQVIMNDTIR--
A8RK86      PKIIEQG------VV----PAAPASPSIKKNAALGGLACIAAACGVITLKVIMNDTIR--
G5HTB1      PKIIENG------VV----PSVPTSPNIKKNAALGGLAMIVAACGIISLQVIMNDTIR--
A8RSL0      PKLIEEG------EV----PILKSSPSNTKNALIGGFIGAVLVCGFITVNVILNDTIR--
C5EN02      PKLIEEG------EI----PIQKSSPSNVKNALIGALLGAVIVCGLITVQVVMNDTIR--
G5HG46      PKLIEEG------EV----PVLKSSPSNAKNALIGGLLGAVLICGLITVQVVMNDTIR--
E7GL39      PKLIEDG------EV----ASEKASPNVLKNTIIGGILGLLLVCGFIVVRVILNDTVK--
E7GL56      PKMIEDG------VV----ASEPYSPSIKRNALLGGILAVFLICALIAVRVVFSDTVK--
G5F9B0      PKMIEDG------VV----ASEPYSPSIKRNALLGGILAVFLICALIAVRVVFSDTVK--
D3AC81      PNIVEEA------YL----PTQKTKPSITKNTMIGGLAGVFLAGAIILVLFVMNDAIK--
D3AE79      PKIVETG------NL----PTAPSSPNVKKNTVLGGLAAGIAAAGIIILLYLMNDSIR--
D4YF14      LYVVSSA------TF----NPSPVSPNVVRVTIIGGLLGAMIMVAIALVIEVLDSRVK--
B1YMM6      VKVLSVS------GI----PTTPVSPNILLNTAIAAVVGFLLGVGLAFLREVLDRRIR--
D4LG05      PNIAQHA------KL--PEHKA--APSYFKFTVIGGLLGLLICAGILIVRYLMDDTIH--
D4LTH3      PNIAQHA------KL--PEYKA--APSYSRYTMMGGLLGLILCAGVLIVRYLMDDTIH--
F3ATF6      PKIIEEA------EV----PSSPVSPSMNKNVMMGALAGFALAAAIVILFAIMNDSIK--
E0I7B6      VTVLNEA------NV-SATNPHPINMDPFSSLMISFIVSAMLAVGLAFLLDYMDDTIK--
C9LAS2      PKIIDEG------QL--PTHKA--SPNMKKNALLGLLLGLFLSAGMIAVVAIMDDTIK--
F7K8E8      VNVSETA------NM--PMEKA--GPSVLKNTFIGGVIGVFLMIAIVLVRFLMDDTVK--
F7K9V0      VNVSETA------NM--PMKKA--SPSVMKNTFIGGVLGIFLMIAVILVRFLMDDTIK--
F7KL97      VNVSETA------NM--PMDKA--GPSVLKNTLIGGVLGVFLMIAIVLVRFLMDDTVK--
D3FZP5      VVILAPA------EL--SSNPTPVSPNPSLNMAIAFVVGLMAAVGLAFLLEYLDQSVR--
C0ZHV9      VHILAEA------RN--NPAAIPVSPKPILNSVIAFVLGLATSMVVVFLLVQMDTRLQ--
D7WMM9      VNILSVA------QL--DKEPVPIAPNKTLYIVAASFIGFVISAALIIILESLDTTIK--
A8U9F5      VTIISEA------VP--VTDQ--ISPNNLLNLVIGLLVGLMLGVGSAFLLEFMDKSVR--
F4BSE0      VTIISEA------VP--NTNQ--ISPNNLLNLVIGSLVGVILGVGIAFVLEFMDKSVR--
E7RDR2      VSILSPA------VL--KDNPSPFAPNPKLNMAIAAVIGMMLGVGIAFLLEYLDTTIK--
I0JRK5      VNVLSEA------AV--GSTPTQVSPKPLLNIAIALVVGLMVGVGIAFLLEYLDNTLK--
G2TR26      VTVISKA------QV--PG--GPVSPKPLLNIAIALVVGLMAGVGIAFLLEYLDNTIK--
D5DBK2      VSILSKA------DL--ATSKSPIKPQPLLNIAIALVVGLMVGVGLSFLLEYLDNTVK--
D5DY80      VKVLSKA------TV--GESSSPVKPQPLLNVAIAIVVGLMLGIGLSFLLEYLDNTLK--
A7Z9K1      VSILSKA------EA--ADSQSPAEPNRKLNIAIAFAAGLLGGIGLAFLLEHLDNTIK--
I2CB17      VSILSKA------EA--ADSQSPAEPNRKLNIAIAFAAGLLGGIGLAFLLEHLDNTIK--
I2HW54      VSILSKA------EA--ADSQSPAEPNRKLNIAIAFAAGLLGGIGLAFLLEHLDNTIK--
G4P1M8      VSILSKA------EV--SDHPSPVSPKPLLNIAIAFAAGLAGSIGLAFLLEHLDNTIK--
E0TTZ7      VSILSKA------EV--SEHPSPVSPKPLLNIAIAFAAGLAGSIGLAFLLEHLDNTIK--
G4EQF2      VSILSKA------EV--SEHPSPVSPKPLLNIAIAFAAGLAGSIGLAFLLEHLDNTIK--
P96715      VSILSKA------EV--SEHPSPVSPKPLLNIAIAFAAGLAGSIGLAFLLEHLDNTIK--
I0F9R7      VSILSKA------EV--SEHPSPVSPKPLLNIAIAFAAGLAGSIGLAFLLEHLDNTIK--
G9QKR5      VSILSKA------DL--GKDMTPVKPKPLLNIAIAVVVGLMAGVGLAFLLEYLDNTIK--
B5UQ74      VTVLSKA------EI--MENQSPIKPVPMLNIAIAFIVGLMAAFGLVFLLEFLDNTVK--
B7HFH2      VTVLSKA------EV--VENQSPIKPRPMFNVAIAFVVGLMAAVGIAFLLEYLDNTVK--
Q72XH7      VTVLSKA------EV--AENQSPIKPRPMLNVAIAFVVGVMAAVGLAFLLEYLDNTVK--
C2V4M3      VTVLSKA------EV--AENLSPIKPLPMLNVAIVFVVGLMAAIGLAFLLEYLDNTVK--
C2YZB3      VTVLSKA------EI--AENQSPIKPRPMLNVAIAFIVGVMAAVGLAFLLEYLDNTVK--
C2P8H2      VTVLSKA------EL--SEELSPIKPRPMLNVAIAFVVGLMAAVGLAFLLEYLDNTVK--
C2Y451      VTVLSKA------EL--PEELSPIKPRPMLNVAIAFVVGLMAAVGLAFLLEYLDNTVK--
C3EBC1      VTVLSKA------EV--AENQSPIKPAPMLNVAIAFVVGLMASVGLAFLLEYLDNTVK--
C3H980      VTVLSKA------EV--AENLSPIKPRPMLNVAIAFVVGLMASIGLAFLLEYLDNTVK--
C2PN23      VTVLSKA------EV--AENQSPIKPRPMLNVAIACIVGLIASVGLAFLLEYLDNTVK--
B9IRQ7      VTVLSKA------EV--TENQSPIKPRPMLNVAIAFVVGLMAAVGLSFLLEYLDNTVK--
A0RL71      VTVLSKA------EV--AENQSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVK--
C2XJI0      VTVISKA------EV--AENQSPIKPVPMLNVAIAFVVGLMASVGLAFLLEYLDNTVK--
Q3EV65      VTVISKA------EV--AENQSPIKPAPMLNIAIAFIVGLMASVGLAFLLEYLDNTVK--
C2T8T7      VTVLSKA------EV--AENQSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVK--
C2RG50      VTVLSKA------EV--AENQSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVK--
Q814Y9      VTVLSKA------EV--AENQSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVK--
B3ZRD5      VTVLSKA------EV--GENQSPIKPRPMLNVVIAFVVGLMASVGLAFLLEYLDNTVK--
Q6HB08      VTVLSKA------EV--AENQSPIKPRPMLNVAIAFFVGLMAAVGLAFLLEYLDNTVK--
C2NQN7      VTVLSKA------EV--AENQSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVK--
C3GRR1      VTVLSKA------EV--AENQSPIKPRPMLNVAIAFVVGLMAAVGLAFLLEYLDNTVK--
C2ULR7      VTVLSKA------EV--VENQSPIKPRPMLNLAIAFVVGLMASVGLAFLLEYLDNTVK--
C3GBJ9      VTVLSKA------EV--AENQSPIKPRPMLNVAIAFVVGLMAAVGLAFLLEYLDNTVK--
C2WVG7      VTVLSKA------EV--VENQSPIKPRPMLNVAIAFVVGLIAAVGLAFLLEYLDNTVK--
B7IQS9      VTVLSKA------EV--AENLSPIKPRPMLNVAIAFVVGLMASVGLAFLLEYLDNTVK--
A9VRC4      VTVLSKA------EV--AENQSPIKPRPMLNVVIAFIVGLMASVGLAFLLEYLDNTVK--
C2MTG4      VTVLSKA------EV--AENQSPIKPRPMLNVAIAFVVGLMAAVGLAFLLEYLDNTVK--
B7HXB5      VTVLSKA------EV--AENQSPIKPRPMLNVAIAFIVGLMAAVGLAFLLEYLDNTVK--
C2SBU5      VTVLSKA------EV--AENQSPIKPRPMLNVAIAFIVGLMAAVGLAFLLEYLDNTVK--
C2SSX9      VTVLSKA------EV--AENQSPIKPVPMLNVAIAFVVGLMASVGLAFLLEYLDNTVK--
G9QCG2      VTVLSKA------EV--AENQSPIKPAPMLNVAIAFIVGLMASVGLAFLLEYLDNTVK--
Q2BFS6      VKILAKA------EL--TDNPAPIKPNKLLNMAIALVVGLMAGVGLAFLLEYMDNTVK--
I3EBB4      VSILAKA------TV--TDNQAPVKPKPLLNIAIALVVGLMTGVGLAFLLEYLDNTIK--
A4ITF4      VTILSKA------EV--KEDQTPVKPKPLLNMAIAFVVGLMTGVGLAFLLEYLDNTIK--
C5D962      VTILSKA------EV--KENQAPVKPKPMLNMAIAFVVGLMTGVGLAFLLEYLDNTIK--
G8MZ94      VTILSKA------EV--KEHQAPVKPKPLLNMAIAFVVGLMTGVGLAFLLEYLDNTIK--
Q5KUM4      VTILSKA------EV--KEHQAPVKPKPLLNMAIAFVVGLMTGVGLAFLLEYLDNTIK--
D4YHG8      VSIVTPA----------EPGQSPTSPNVILNIIIGALLGLIVGVVWQLVNAMLDNSVK--
F7V793      PTIVDEA----------VTPDTQDSPNNTKNAAIGALIGLVVVLAVITVRFLMDDTFK--
H4GK02      VTIVSSA----------TTPKKKSFPNVKLFALAGAVVGFVISFGYLLIKELFDTTVR--
F6IR92      VTIVAPA----------ETPDAPVSPKKMINILLGLVMGLLLGLVYASVRILTNRRVQ--
G0M0G0      VTIVAPA----------ETPDAPVSPKKMINILLGLVMGLLLGLVYASVRILTNRRVQ--
D7VBW5      VTIVAPA----------ETPDQPVAPKKIINILIGFVGGLILGLVYASVRILSNRRVQ--
F9UQ55      VTIVAPA----------ETPDQSVAPKKIINILIGFVGGLILGLVYASVRILSNRRVQ--
G2KUP2      VTIVSKA----------TPVLKPTSPHYMLNILAGLLIGLLIGLGASLLSEFNDKSVK--
G8PE07      VSMVSKA----------QADDQPVSPRTKLNLVAGLILGLLIGFGLAFLRELSDRTVT--
E0NHP5      VSIVSKA----------APDDDPVSPRTKLNIAAGIVIGFLLGVGLAFLREFSDRTVT--
Q03GL9      VSIVSKA----------TADDQPVSPRTKLNIAAGLAVGLLLGMGLAFLREFSDRTVT--
F3Y921      VIIISPA----------FADMKPISPNKKINLALGLTFGLLIGIIDTFGLEFFDKTIK--
G4L593      ITIVSRA----------SASAKPASPNNMLNLAIGLILGLLVGIGLSFLMEVLDRTVK--
E6LD65      ITITSSA----------VAESDPVSPNKKLFLAAGLILGALIGIIGTLLIELMDRTVK--
C9ALZ8      ISIISGA----------VANTTPISPNNKLNLVIGLVLGMMVGVGLAFLFELLDRTVK--
C9BUG6      ISIISGA----------VANTTPVSPNNKLNLMTGLMLGMMVGVGLAFLLELLDRTVK--
Q3XYS7      ISIISGA----------VANTTPVSPNNKLNLVIGLMLGMMVGVGLASLFELLDRTVK--
C9B453      ISIISGA----------VANTTPVSPNNKLNLVIGLVLGMMVGVGLAFLFELLDRTVK--
D4RJF5      ISIISGA----------VANTTPVSPNNKLNLVIGLVLGMMVGVGLAFLFELLDRTVK--
C8ZXT8      ISIISSA----------VASTSPVSPNNKLNLAIGLVLGLMVGVGLAFLFELLDRTVK--
F0EKB8      ISIISIA----------VASTTPVSPNNKLNLAIGLVLGIMVGVGLAFLLELLDRTVK--
C9A6V4      ISIISSA----------VASTTPVSPNNKLNLAIGLVLGIMIGVGLAFLLELLDRTVK--
C9CHY7      ISIISSA----------VASTTPVSPNNKLNLAIGLVLGIMVGVGLAFLMELLDRTVK--
D4JI68      PTIIQSG----------YDDGGAVSPNIGKNTVIGAFAGAFLSIAVIVVSYLFNDTII--
D6E329      PTIIQSG----------YDDGGAVSPNIGKNTVIGAFAGAFLSIAVIVVSYLFNDTII--
E6UHY5      VETVSPP----------KVPTTPSGPNISKYLMLGLIAGLAVSVGFALITSFFDNTVK--
E9SAU2      VETVSPP----------RVPTSPSGPNIMRYLLLGLVAGLVISISIILVTNFFDNTVK--
F7K0U2      VNMVEEG----------NLPKNPTSPNTMKNAMLGGILGIFLALGAIVLIYILDDTIK--
O06029      VNILSKA----------KAQTTPISPKPKLYLAISVIAGLVLGLAIALLKELFDNKIN--
G8P3D6      VNILSKA----------KAQTTPISPKPKLYLAISVIAGLVLGLAIALLKELFDNKIN--
A9QSJ3      VNILSKA----------KAQTTPISPKPKLYLAISVIGGLVLGLAIALLQELFDNKIN--
F9VC43      VNILSKA----------KAQTTPISPKPKLYLAISVIAGLVLGLAIALLKELFDNKIN--
G6FD41      VNILSKA----------KAQTTPISPKPKLYLAISVIVGLVLGLAIALLKELFDNKIN--
G9M881      VNILSKA----------KAQTTPISPKPKLYLAISVIVGLVLGLAIALLKELFDNKIN--
Q3ZK51      VNILSKA----------KAQTTPISPKPKLYLAISVIAGLVLGLAIALLKELFDNKIN--
Q83VG0      VNILSKA----------KAQTTPISPKPKLYLAISVIAGLVLGLAIALLKELFDNKIN--
C6LDI9      PNIIQNG----------YVSQYPDSPSIMKNTFLGALAGFIISCVSVISAFIMNDTIN--
G5F9H3      PKLIEDG----------EVASEKASPNVLKNTIIGGILGLLLVCGFIVVRVILNDTVK--
C0CZV8      PKLIEDG----------EVPLLKTSPSNTKNALIGGLVGTLLVCGFVTARVVLNDTVR--
G5GFW1      PKLIEDG----------EVPIHKTSPHTVLNAVIGAVLAVVIVVGVTVLQVIFDESIK--
F8KGP2      VTIVSRA----------STPDEPSFPNKKLFALAGAVLGLILSFLYILIGDLLDTSIH--
B3XL22      VTIVSRA----------STPDEPSFPNKKLFALAGAVLGLMLSFLYILIGDLMDTSVH--
F8DRU3      VTIVSRA----------STPDEPSFPNKKLFALAGAVLGLILSFLYILLGDLMDTSVH--
C2EWM2      VTIISRA----------NTPKAPSFPNKKLFTLAGAVLGLLLSFAYVLIKELTDTTVK--
D0DSJ3      VTIVSEA----------TTPTSQSFPNKKLFALAGLVLGFLISYVYVLLRDLTDTTVR--
B2GF32      VTIVSEA----------TTPTSQSFPNKELFALAGLVLGFLISYVYVLIRDLTDTTVR--
C0WW25      VTIVSEA----------TTPTSQSFPNKKLFALAGLVLGFLISYVYVLIRDLTDTTVR--
F0K0J8      VTIVAEA----------SKGTKS-FPKVSMFTAIGVLAGLVISLLIIIIKDLSDTTVR--
G6F8H0      VTIVAEA----------AKGTKS-YPNVKMITMVGVLAGLVISLLIIIIKDLSDTTVR--
F0HVF2      VTIVAEA----------PKGTKS-FPKVSLITAIGVLAGLVISLLIIIIKDLSDTTVR--
Q1G8E3      VTIVAEA----------SKGTKS-FPKVSMFTAIGVLAGLVISLLIIIIKDLSDTTVR--
D6S4X3      VTVIADA----------NNGTQT-FPNVRLFTIAGFVLGFVICLFVIILKEMLNTTVR--
Q5FIC6      VTIVANG----------TNGVQS-SPNVKLFTLAGFVVGLVLSFAVVIIREMSNTTVR--
E4SMV6      VTIVANG----------TNGVQS-SPNVKLFTLAGFVVGLVLSLAVIIIREMSNTTVR--
F0TGY3      VTIVANG----------TNGVQS-SPNVKLFTLAGFVVGLVLSLAVVIIREMSNTTVR--
F2M2M7      VTIVANG----------TNGVQS-SPNVKLFTLAGFVIGLVLSLAVVIIREMSNTTVR--
A4ZGZ7      VTIFAPA----------TNGVQS-SPNVKMFTLAGFVIGLVLTFAMILIREMTNTTVR--
C2EPK4      VTIVARG----------TMGTQS-SPNVKLYTLAGFVIGLVLSFAVIIIREMTNTTVR--
C7XKF2      VTIVAPA----------TDGNQS-SPNVKLFTLAGFVIGLVLSFAVVLIREMSDTTVK--
E3R265      VTIVAPA----------TDGNQS-SPNVKLFTLAGFVIGLVLSFAVVLIREMSDTTVK--
D0DJG9      VTIVAPA----------TNGSQS-SPNVKLFTLAGFAIGLVLSFAVVLIREMSDTTVK--
D5GZJ9      VTIVAPA----------TNGSQS-SPNVKLFTLAGFVIGLVLSFAVILIREMNDTTVK--
A8YX90      VTIVAPA----------TNGVQS-SPNVKMFTLAGFVIGLVLTFAMILIREMTNTTVR--
F0NWJ8      VTIVAPA----------TNGVQS-SPNVKLFTLAGFVIGLVLTFAVILIREMTNTTVR--
C2JZS0      VSIVSDA----------LANPNPVSPKLKFLAVLGFVAGIVIAYGWGLIRELTDTTVK--
C1J9I2      VSVVSRA----------TANTIPVSPKLKLLSIVGLALGILIALSWGLVRELTDQTIK--
Q58Z11      VSIVSRA----------TADPTPVTPNLKIASLIGLILGMVLAFTVGLIRELTDQTIK--
B1MZT2      VSIIDSA----------KIDNKPVGPKIQIFMLAGLVILGGLAFLVALVRELSDTTIK--
C2KHF2      VSIIDSA----------KANKKPVSPNTKLFTLAGLLVLGGLTFLYMLIKELADTTIK--
Q03W94      VSIVDAA----------KANKQPVAPNVKLFTLAGLVVLGGLTFLYMLVKELSDTTIK--
G2Z8Q4      VSILSEA------KA--DDNNIPIKPNKKSALVMGAFGGLVIGILFSFSLQLLNTTIK--
D9ST43      IKVIDGA----------KIPEEPIKPNKLLNIAIAFFIGMVVSMGLAVLREYMDNTLK--
H7F5T7      VQLLNEA------YV--KTNDKPVFPSPTIFTAVGLLVGLFMGVSFVILKTLFSNKIT--
G9WIR0      VSIVSRG----------LRQDTPVSPNVRLFTLAGFLLGVFIVVLFVLIKEMSDNTYR--
D3LB11      VTVVSSG----------LKDNTPVFPNTKLFSLAGFLIGGFLAVAYVLIKELSDNTYR--
A0NKF7      VTIVSSG----------LKNNTPVFPNTKLFSLAGFLIGGFLAVAYVLIKEISDNIYR--
Q04DV7      VTIVSSG----------LKNNTPVFPNTKLFSLAGFLIGGFLAVAYVLIKEISDNTYR--
F6BI63      VSVIDEA----------IPPTTKISPKPTLNMSIAAILGIMVSIFIIFLFEYFDKTYK--
G2MWC1      VQVIDKA----------IPPTSKISPKTSLNIAVAAILGLMVSIFVVFLLEYMDRTIK--
B0K4N2      VQVIDKA----------IPPTSKISPKTSLNIAVAAILGFMISVFIVFLLEYMDRTIK--
C7ISF8      VQVIDKA----------IPPTSKISPKTSLNIAVAAILGFMISVFIVFLLEYMDRTIK--
B0KAR6      VQVIDKA----------IPPTSKISPKTSLNIAVAAILGFMISVFIVFLLEYMDRTIK--
E8UV30      VQVIDKA----------IPPTSKISPKTSLNIAVAAILGFMISVFIVFLLEYMDRTIK--
C0GGR6      VSIIDEA----------EPSTSAVSPRPNLNAAIAGVLAIMLGVFMAFALEYMDNTIK--
A4J8V1      VNIIDHA----------VVPTLPVKPNKKLNIIIAGVVGLMVALGIVFLLEFLDRTIK--
C8VYQ7      VNIVDPA----------VPAPAPVKPNKKMNILLAGVIGLMAAVGLVFLLEFLDQTIK--
C8W5K3      AKVIDIA----------IPSNSPIKPNEKLNILIAGLLSLMIAIGILLLREFIDQTVK--
B1BNH4      VQVIQKP----------QLPEKPVSPNKKLNIFIAFVLGLMVGVGVVLLLEYLDNTFK--
B1V1Z3      VQVIQKP----------QLPEKPVSPNKKLNIFIAFVLGLMVGVGVVLLLEYLDNTFK--
B1R3V2      VQVIQKP----------QLPEKPVSPNKKLNIFIAFVLGLMVGVGVVLLLEYLDNTFK--
Q0SVR9      VQVIQKP----------QLPENPVSPNKKLNILIAFVLGLMIGVGIVLLLEYLDNTFK--
Q8XN47      IQVIQKA----------QLPEHPVSPNKKLNILIAFVLGLMIGVGVVLLLEYLDNTFK--
G7M0Q2      IKIIESV----------KIPEDPVSPNKKINIAISFILGLMVSIGLSFLLEFMDNTFN--
G7M565      VKTIESV----------KVTDNPVSPNKKLNIGLAFAAGVIIGLGLSFLIEFMDNTFK--
A6M2M0      VKVVESV----------KVPQKPVSPNKKMYIGVGLLLGLIGSAGASFLLEFLNNTFK--
G7M1R8      VKVVEQV----------KLPEQPVSPNKKLNIAIAFLLGLMVSVGLAFLLEFMDNTFK--
Q4JZ56      VTTLQTA----------RPPQTPSGPHVRKSTTAGLVLGAFLTVFLVVAKEILDDRIK--
Q7X554      VTTLEEE----------QIPESPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRVR--
Q7X550      VTTLGEA----------KLPESPSSPKIKLNVLLGAVLGAFLAVVGVLVREILDDRVR--
Q7X562      VTTLEEA----------KLPVSPSSPNIKLNVLLGAVLGGFLAVVGVLVREILDDRIR--
Q7X556      VTTLEEA----------KLPVSPSSPNIKLNVLLGAVLGGFLAVVGVLVREILDDRVR--
Q7X552      VTTLEEA----------KLPESPSSPNIKLNVLLGAVLGGFLAVVGVLVREILDDRVR--
Q7X558      VTTLDEA----------KLPESPSSPNIKLNVLLGAVLGGFLAVGGVLVREILDDRVR--
C5NWJ9      VTTLEEA----------KAATSPSSPNIPKNGALATALGFILAVAGVILFELLDDRVK--
F3A498      VTTLEEA----------KAATSPSSPNIPRNAVLATALGFILAVAGVVLFELLDDRVK--
Q9AHD3      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGVIGTSVIVLHLELLDTRVK--
Q4K2E2      VTTLEEA----------RPATSPSSPNIRRNTLIGFLGGLGVVVMVVLLLELLDVRVK--
Q4K2F8      VTTLEEA----------RPATSPSSPNIRRNTLIGFLGGLGVVVMVVLLVELLDVRVK--
Q4K046      VTTLEEA----------RPATTPSSPDVRRNSMFGFLGGAAVTAIAVFLIELLDTRVK--
Q4K0R8      VTTLEEA----------RPATTPSSPNVRRNSLFSFLGGAVVTVIAVLLIELLDTRVK--
Q4JYY0      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVK--
Q4JZW8      VTTLEEA----------RPVTTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELIDTRVK--
I0J9C8      VTTLEEA----------RPATTPSSPNVRHNSLFGFLGGAVVTVIAVLLIELLDTRVK--
Q4K0M4      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVK--
Q4JZS4      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDIRVK--
Q4JZK2      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIEVLDTRVK--
Q9AHA5      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELFDTRVK--
Q9X9A0      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVK--
Q4JYK9      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVK--
Q4K006      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVK--
Q4JZG8      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVK--
A6YIA7      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVK--
E5F5C4      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVK--
Q9AHB8      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVK--
Q4JZL8      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIEVLDTRVK--
Q4K1B8      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVK--
Q8VU32      VTTLEEA----------RPATTPSSPNVRRNTLVGFLGGAVVTVITVLLIELLDTRVK--
D2ERX9      VTTLEEA----------RPATTPSSPNVRRNTLFGFLGGAVVTVITVLLIELLDTRVK--
G6C7Z0      VTTLEEA----------RPATTPSSPNVQRNTLFGFLGGVVVTVITVLLIELLDTRVK--
Q4K2A9      VTTLEEA----------RPATTPSSPNVRLNTLVAFLGGTVVTVITVLLIELLDTRVK--
D6ZQI7      VTTLEEA----------RPAMTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVK--
Q9ZFT9      VTTLEEA----------RPAMTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVK--
Q4K255      VTTLEEA----------RPATTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVK--
F9HJP7      VTTLEEA----------EAPKSPSSPNIRRNVMIGFVGGAVAMVVLVLIVEVLDDRVK--
E8JWI4      VTTLEEA----------ETPKTPSSPNIRRNTIIGVLAGGVLMVLVVVSVEILDDRVK--
A8AZR4      VTTLEEA----------EVPKSPSSPNIRRNVMLSFFAGVIVMVIIVVFVEVLDDRVK--
D0RXH3      VTTLEEA----------EVPKSPSSPNIRRNVILGFLAGAMVMIVIVLIVEILDDRVK--
Q83YR6      VTTLEEA----------EVPKSPSSPNIRRNVILGFLAGAMVMIVIVLIVEILDDRVK--
F1Z125      VTPLEKA----------VMPTSPSSPNIKRNTLVGILFGAFLTIVTVIVGEVVDDRVK--
Q3K0S9      ITTLEKG----------NLPKAPSSPNIKKNVLIGFIVGAGLSTIVLVIMGILDDRVN--
P0C0T8      ITTLEKG----------NLPKAPSSPNIKKNVLIGFIVGAGLSTIVLVIMGILDDRVN--
Q67AY5      ITTLEKG----------NLPKAPSSPNIKKNVLIGFIVGAGLSTIVLVIMGILDDRVN--
Q04662      ITTLEKG----------NLPKAPSSPNIKKNVLIGFIVGAGLSTIVLVIMGILDDRVN--
Q8GP93      VTTLEEA----------KLPESPSSPNIKRNVLLGAVFGGFLAVVGVLVREILDDRVR--
Q8GPF7      VTTLEEA----------KLPESPSSPNIKRNVLLGAVFGGFLAVVGVLGREILDDRIR--
E3CP61      VTTLEDA----------KLPESPSSPNIKRNVLIGAVFGVFLAVVGVLGREILDDRIR--
E8KUY7      VTTLEDA----------KLPESPSSPNIKRNVLIGAVFGVFLAVVGVLGREILDDRIR--
C2LSE5      VTTLEEA----------KLPESPSSPNIKRNVLLGAVLGGFLAVVGVLVREILDDRIR--
E9DM16      VTTLEDA----------KLPDSPSSPNIKRNVALGAVLGGFLAIVGVLVREILDDRIR--
I0QIK5      VTTLEDA----------KLPDSPSSPNIKRNVALGAVLGGFLAIVGVLVREILDDRIR--
Q7X560      VTTLEEA----------KLPESPSSPNIKRNVLLGAVLGGFLAVVGVLVREILDDRVR--
Q8GMA6      VTMLEEA----------KLPESPSSPNIKLNVLLGAVLGGFLAVVGVLVREILDDRVR--
Q55204      VTTLEEA----------KLPESPSSPNIKLNVLLGAVLGAFLAVVGVLVREILDDRVR--
Q8GPC4      VTTLEEA----------KLPESPSSPNIKLNVLLGAVLGAFLAVVGVLVREILDDRVR--
Q8GPA9      VTTLEEA----------KLPESPSSPNIKLNVLLGAVLGGFLAVVGVLVREILDDRIR--
G6ERT2      VTTLEEA----------KLPESPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRVR--
O87930      VTTLEEA----------KLPESPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRVR--
Q8GP55      ITTLGEA----------KLPSSPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRVR--
F8HDC4      VTTLEEA----------KLPSSPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRIR--
F8LJ76      VTTLEEA----------KLPSSPSSPNIKRNVLLGAILGGSVAIVAVLVREVLDDRIR--
F8LXJ5      VTTLGEA----------KLPSSPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRIR--
Q1WCR2      VTTLGEA----------KLPSSPSSPNIKRNVLLGAILGGFVAIVAVLVREVLDDRIR--
G3G7C0      VTTLEEA----------VPAEEPSTPNTKRNIILGLLAGGILATALVLVMEILDDRVK--
G3G7J8      VTTLEEA----------VPAEEPSTPNTKRNIILGLLAGGILATALVLVMEILDDRVK--
G8DU30      VTTLEEA----------VPAEAPTTPNTKRNILLGLLAGGILATGLVLVMEVLDDRVK--
A4VTU2      VTTLEEA----------VPAEEPTTPNTKRNILLGLLAGGILATGLVLVMEVLDDRVK--
D5AGQ4      VTTLEEA----------VPAEEPTTPNTKRNILLGLLAGGILATGLVLVMEVLDDRVK--
Q9X4U6      VTTLEEA----------VPAEEPTTPNTKRNILLGLLAGGILATGLVLVMEVLDDRVK--
G3G7G5      VTTLEEA----------VPAEEPTTPNTKRNILLGLLAGGILATGIILAMEVLDDRVK--
G7SG35      VTTLEEA----------VPAEEPTTPNTKRNIILGLLAGGILATGLVLVMEVLDDRVK--
G8DU06      VTTLEEA----------VPAEEPTTPNTKRNIILGLLAGGILATGLVLVMEVLDDRVK--
G8DUA9      VTTLEEA----------VPAEEPTTPNTKRNIILGLLAGGVLATALVLVMEVLDDRVK--
G8DTY9      VTTLEEA----------VPAEEPTTPNTKRNIILGLLAGGILATALVLVMEVLDDSVK--
G3G7I7      VTTLEEA----------VPAEEPTTPNTKRNILLGLLAGGILATGIILAMEVLDDRVK--
G3G7J3      VTTLEEA----------VPAEEPTTPNIKRNILLGLLAGGILATGIILAMEVLDDRVK--
E0PD82      VTTLEAA----------ATPKHPSSPNVKKNLALGMLVGGALAVIVILVVEVLDDRVR--
F5X651      VTTLEAA----------ATPKHPSSPNVKKNLALGILVGGVLAVIVILVVEVLDDRVR--
G5JTD6      VTTAETA----------KVPTSPTSPRIKRNLVLGTAAGGFIAVVTLIIFEALDDRIK--
Q2KM75      VTALEKA----------QLPTKPSSPNSKRNAVMGLLVGAVLSIFAVILKEVLDDRVK--
G5KAJ3      VTPLEKA----------QLPTSPSSPNIQRNTLIGFFLGALLTIIVIVVGEVLDDRIK--
B9DUJ5      VTPLEKA----------QLPSKPSSPNIKRNTMIGMLIGGLFTIVIIVIKEVLDDRVK--
G5KD12      VTPLENA----------ELPTSPSSPNIKRNTLIGVLIGGLMTIVVIILKEVLDDRVK--
E8JMT8      VTTLEAA----------EVASKPSSPNIKRNAALGALVGGFLAIVGILVLEVLDDHVR--
F5X0J8      VTTLEAA----------EVASKPSSPNIKRNAALGALVGGFLAIVGILVLEVLDDRVR--
H2A601      VTTLEAA----------EVASKPSSPNIKRNAALGVLVGGFLAIVGILVLEVLDDRVR--
E7S8W2      VTTLDEA----------VVPQNPSSPNIKRNVVIGFVLGGVSISILVILSEVLDDRVK--
F8DFF5      VTTLDEA----------EVPQSPSSPNIKRNVLLGFVAGAGLMVVLLVVVEVLDDRVK--
I1ZPH8      VTTLDEA----------EVPQSPSSPNIKRNVLLGFVAGAGLMVVLLVVVEVLDDRVK--
E3CBR9      VTTLDEA----------EVPQSPSSPNIRRNVLLGFIAGAGLMVVLMVVVEVLDDRVK--
E8K787      VTTLDEA----------EVPQSPSSPNIRRNVLLGFIAGAGLMVVLMVVVEVLDDRVK--
F9M365      VTTLDEA----------EVPQSPSSPNIRRNVLLGFIAGAGLMVVLMVVVEVLDDRVK--
A3CQY3      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
E8KLZ0      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
F0FHA9      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
F0FQQ4      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
F0I4H6      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
F0IAY2      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
F0IJI1      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
F0IS52      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
F2C9N1      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
F2CH54      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
F3UDW8      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
F3UNJ5      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
F3SM33      VTTLEEA----------TVPAEPSSPNIRRNVILGFLGGSVLMSIFIIAVEILDDRVK--
F9HC66      VTTLEEA----------RPAITPSSPNIRRNTALAFLVGGAVMVVAVVLLELLDDRVK--
E1LQJ6      VTTLEEA----------RPALSPSSPNIRRNTLLAFLAGGVVMVVSILLFELLDDRVK--
Q4JYU0      VTTLEEA----------RAALSPSSPNIRRNTLLAFLAGGAVMVVSVLLLELLDDRVK--
Q4JZY2      VTTLEEA----------RPALSPSSPNIRRNTLLAFLVGGAVMVVSVLLLELLDDHVK--
F9Q346      VTTLEEA----------RPATSPSSPNIRRNTMIGFLAGAVVMIVAVLLIELLDTRVK--
Q6L5R1      VTTLEEA----------RPATSPSSPNIRRNTMIGFLAGAVVMIVAVLLIELLDTRVK--
E9FEC6      VTTLEEA----------RPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVELLDTRVK--
E0Q2S9      VTTLEEA----------RPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVELLDTRVK--
F5VSH0      VTTLEEA----------RPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVELLDTRVK--
A5YTV6      VTTLEEA----------RPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVELLDTRVK--
Q6L5T1      VTTLEEA----------RPATSPSSPNIRRNTLVGFLAGAVVMVVTVLLVELLDTRVK--
E0PPH8      VTTLEEA----------RPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVELLDTRVK--
A5YTT8      VTTLEEA----------RPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVEILDTRVK--
E6KKR9      VTTLEEA----------RPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVEILDTRVK--
A1ILY0      VTTLEEA----------RPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVELLDTRVK--
F2QF91      VTTLEEA----------RPATSPSSPNIRRNTMVGFLAGAVVMVVTVLLVEILDTRVK--
Q4K0I3      VTTLEEA----------RPATTPSSPNVRRNTLVGFLGAAAVTVITVLLIELFDTRVK--
Q8KWQ1      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGVVVTVIAVLFIELLDTRVK--
Q4K238      VTTLEEA----------RPATTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVK--
B1I966      VTTLEEA----------RPATTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVK--
G6J8A3      VTTLEEA----------RPAMTPSSPNVRRNTLVGFLGGAAVTVITVLLIELLDTRVK--
F9LZC3      VTTLEEA----------RPATTPSSPNVRRNTLFGFLGGAVVTVITVLLIELLDTRVK--
F9P1W9      VTTLEEA----------RPATTPSSPNVRRNTLFGFLGGVVVTVITVLLIELFDTRVK--
A5LJR9      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELLDTRVK--
Q9ZII7      VTTLEEA----------RPATTPSSPNVRRNSLFGFLGGAVVTVIAVLLIELFDTRVK--
Q4K1K7      VTTLEEA----------RPATTPSSPNVRRNTLFGFLGGAVVTVIAVLLIELLDTRVK--
E1LPE6      VTTLEEA----------RPAISPSSPNIRRNTVIGAGLGAGLVIVVVLLIELFDDRVK--
F9MJW6      VTTLEEA----------RPAISPSSPNIRRNTVIGAGLGAGLVIVVVLLIELFDDRVK--
Q4K0V3      VTTLEEA----------RPATSPSSPNIKRSTLIVFLAGVIGTSVIVLILELLDTRVK--
Q54519      VTTLEEA----------RPATSPSSPNIKRSTLIGFLAGVIGTSVIVLILELLDTRVK--
C1CBD0      VTTLEEA----------RPAISPSSPNIKLNTLIGFLVGLIVINVTVLLLELLDTRVK--
Q7WVX1      VTTLEEA----------RPAISPSSPNIKLNTLIGFLVGLIVINVTVLLLELLDTRVK--
Q4K0E2      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGVIGTSVIVLLLELLDTRVK--
Q9AH96      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGVIGTSVIVLLLELLDTRVK--
A5M4L2      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGVSGTSVIVFLLEFLNTRVK--
B2ILP4      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGVSGTSVIVFLLEFLNTRVK--
C1CCB8      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGVSGTSVIVFLLEFLNTRVK--
P72511      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGVSGTSVIVFLLEFLNTRVK--
Q4K1S8      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGVSGTSVIVFLLEFLNTRVK--
P96474      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGVIGTSVIVLLLELLDTRVK--
Q4K196      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGGIGTSVIVFLLELLDTRVK--
Q4K0Z7      VTTLEEA----------RPATSPSSPNIKRNTLIGFLAGGIGTSVIVLLLELLDTHVK--
Q4JZ85      VTTLEEA----------RPAISPSLPNIKRNTLIGFLAGGIGTSVIVFLLELLDTHVK--
Q4JYH6      VTTLEEA----------RPTISPSSPNIKRNTLIGFLAGGIGTSVIVLLLELLDTRVK--
Q4JZ19      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGGLGTSVIVLLLELLDTRVK--
Q4K0A1      VTTLEEA----------RPATSPSSPNIKRNTLIGFLAGGIGTSVIVLLLELLDTHVK--
Q4K1M5      VTTLEEA----------RPAISPSSPNIKRNILIGFLAGGVGTGVIVLLLELLDTHVK--
Q4K2Q8      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGVIGTSVIVLLLELLDTRVK--
Q4K1G0      VTTLEEA----------RPAISPSSPNLKRNTLIGFLAGVIGTSVIVLLLELLDTRVK--
Q4K0T6      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGGIGTSVIVFLLELLDTHVK--
Q4K0K3      VTTLEEA----------RPAISPSSPNIKRNILIGFLAGVIGTSVIVLLLELLDTRVK--
Q4K0X6      VTTLEEA----------RPAISPSSPNIKRNTLIGFLAGGIGTSVIVLLLELLDTRVK--
E8KDN1      VTTLEEA----------RPALSPSSPNIRRNTILGVGVGAGIVILLAISVEVLDDRVK--
F9PEU3      VTTLEEA----------RPATSPSSPNIRRNTMMATIAGVGFVTVIVLLVELLDDRVK--
E8K321      VTTLEEA----------RPATSPSSPNIRRNTMMATIAGVGFVVVIVLLVELLDDRVK--
F9PZP6      VTTLEEA----------RPATSPSSPNIRRNTMMATIAGVGIVIVVVLLVELLDDRVK--
D6R2T7      VTTLEEA----------EIPKEPSSPNIRRNILLGFLVGGLVFALVIITVELVDDRVK--
F3UUQ1      VTTLEEA----------EIPKEPSSPNIRRNILLGFLVGGLVFALVIITVELVDDRVK--
E6IZC3      VTTLEEA----------EIPNAPSSPNIRRNTLIGFLAGGVLISVVILVVEVLDDRVK--
G6A746      VTTLEEA----------EVPNSPSSPNIKRNTLIGFLTGGALISMVIIIVEVLDDRVK--
B1V0N8      IEILDYP------KS--I----TIMPNKKKVILVGAIAGLVIALGIVFILDYLDNSVK--
B1BNK2      IEILDYP------KS--I----TIMPNKKKVILVGVIAGLVIALGVIFILDYLDNSIK--
B1R3X7      IEILDYP------KS--R----TIMPNKKKVILVGVIAGLVIALGVIFILDYLDNSIK--
Q8XN77      IEILDYP------KS--R----TIMPNKKKVILVGVIAGLVIALGVIFILDYLDNSIK--
B1HR40      INILFVA------QS--SEHPVPVKPNKLLNLLIATIGGFSLALVLAYFLETLDRTIK--
A7Z922      VIVLSEA------KA--SESP-MVKPSRIRNIMMAFGAALMAGVTLAFFLHFLDETVK--
I2CAF3      VIVLSEA------KA--SESP-MVKPSRIRNIVMAFGAALMAGVTLAFFLHFLDETVK--
I2HVL3      VIVLSEA------KA--SESP-MVKPSRIRNIMMAFGAALMAGVTLAFFLHFLDETVK--
E0U2Z4      VHILSEA------KA--SESP-MIKPARLRNMVMAFGAAVMGGITLAFFLHFLDDTCK--
D4G1R3      VHILSEA------KA--SESP-MIKPARLRNMVMAFGAAVMGGITLAFFLHFLDDTCK--
G4EQZ6      VHILSEA------KA--SESP-MIKPARLRNMVMAFGAAVMGGITLAFFLHFLDDTCK--
P71050      VHILSEA------KA--SESP-MIKPARLRNMVMAFGAAVMGGITLAFFLHFLDDTCK--
G4P115      VHILSEA------KA--SESP-MIKPARLRNMVMAFGAAVMGGITLAFFLHFLDDTCK--
A8FHM0      INVLSEA------KL--SNTI-LMNSRKFVHIVLALGASLLGGVTLIFLMNLLDDTVK--
C0EBA5      VSVLESA------RP--SGSP-SSPSTTKNTLIGALAGAVI-AVLIVLLMEMFDTTIR--
F8FCE3      ITTLGVA------NP--EKPARPILPNTQLNVLVSVLVTLLLGVGYAFLHHMLQDTVK--
I0BSG5      ITTLGVA------NP--EKPARPILPNTQLNVLVSVLVTLLLGVGYAFLHHMLQDTVK--
A8YPQ6      VSILSKA------DG--TAV--KVAPKTVVNLIGAFFLGLVVALIYIFFKVIFDKRIK--
P95695      VSILSKA------DG--TAV--KVAPKTVVNLIGAFFLGLVVALIYIFFKVIFDKRIK--
Q2G1K8      VSILSKA------DG--TAV--KVAPKTVVNLIGAFFLGLVVALIYIFFKVIFDKRIK--
C5QNG5      VSILSKA------NG--TAE--KVSPRTIMNLFAGLILGLVLAIIIAALREIFDKRIR--
Q4L9H8      VTILSKA------TG--TAH--KVSPKVPVNIAVAIILGLLVAILIIILKELLDKRIK--
Q2FUV1      VTILSSA------HD--NAV--KVSPIVSVNLVISIIVGIVLAILIIFLKELLDKRIK--
P39850      VSVLSTA------DN--TGK--QVAPKPMVNLVVGLVIGLVIALLIIFIKEVFDKRIK--
D7UYE3      VSILSKA------DV--KAV--QVSPKPLVNAGIGIFLGLIVALLFIFLKQVLDKSLK--
Q4A121      VSILSKA------DY--YGS--KDSPKPLINAVVGVFLGLIVALIIIFLKEILDKRIK--
C9AAE4      VTILAEG------TV--LPQETPARPNKFLFYSLTTFLSLLFAFTYLFLLLVFERSFA--
H7F6C7      VTTLSEA------QF--LGNETPVKPQKVLMLALAAFAGILFAFAFIFIKLLFERTLT--
F0SX23      VKVVDMA------KA--PTE--KASPSLALHTLIGLMLGLVLSISGILLTELLDRRIE--
Q38VG4      VSIISEA------KP--NLV--PVSPKNGLNLLIGFILGLIIGITIAFIRELMDKTIK--
F2I4B6      VSIISKA------QA--SHS--PVSPRKGLALLIGLVLGMGVGLVIAFIHELTDNTVK--
Q8RBS6      VQVIDRA------VP--PTS--KVSPKTSLNVVIAGVLGLMISIFLVFLLEYMDRTVK--
D9SR42      VQILDNA------LV--PSS--PSSPNVRSNVIMTLFFGFVLSIGLTFLVDYLDNTVK--
D9SVC8      VKILDTA------QV--PKS--PSSPNLKLNIIFSFGAGFSLSVVLCFLLEIFDTTIK--
E7RG09      VSILSPA------VV--LENQTPVSPNPPLNILLSAIVGLIIGAAIAMILRYLDTTIR--
D4G2E2      VSILSKA------EV--SEHPSPVSPKPLLNIAIAFAAGLAGSIGLAFLLEHLDNTIK--
Q8EME7      VSVLSQA------EL--AEEPSPVAPNPILNIAIAMVLGAMVGVGIAFLLEYLDNTIK--
D6Y035      IHILSPA------DL--ADSMNPVSPNPELNIAIRLVVGLMGAVGLAFLLEFLDNTIR--
Q5WBB3      VSILSEA------EI--GEDPTPVSPKPLLNIAIAFVVGLMAAVGLAFLLEYLDTTIK--
Q9K6Q9      VSILSTA------EL--GESPSPVSPNPMLNMAIAFVVGLMGAVGIAFLLDYLDTTIK--
Q97EP7      ARIIDRA------TA--PKS--PIKPKKLINIVVAFVLGLFVSIGIAFIKEYMDKTIK--
Q97ER4      ARIIDRA------TA--PKS--PIKPKKMINIAIAFILGLFISVGIAFIKEYMDKTIK--
E4S7Y7      VQIVDKA------VV--PEK--PERPKKALNIAIAFVVGLLIGVGLAFFIEYLDNTIK--
E4Q5T6      VQIVDKA------VV--PDK--PEKPKKLLNTAVAFILGLMVGVGIAFFIEYLDNTIK--
E4SDX3      VQIVDRA------VV--PDK--PEKPKKLLNTAVAFVLGLMVGVGIAFFIEYLDNTIK--
G2FWX3      VSIVDKA------MT--PIN--PVKPNKKLNVLIAFVVGLMAAVGLVFVLEYLKNTVK--
G7WJV2      VSVVDTA------VV--PAK--PVKPNQLLNILIAFVAGLIASFGLVFLLEYLDNTVK--
G7W774      VSIVDTA------VV--PDE--PVKPNKKLNILIAFAVGLMVSVGLVILLEYLDNTIK--
G2FM60      VSIVDTA------VI--PDK--PIKPKKTLNVLIAFVVGLMASVGLVFLLEYMDNTVK--
H5XZD5      VSIVDTA------VI--PDK--PIKPNKLLNILIAFIAGLMVSLGLVFLLEYMDNTVK--
I4DBG9      VSIVDKA------ET--PDA--PVKPNKKLNILIGFVVGLMAAVGLAFLLEYLDNTIK--
G2FWT7      VSIVDTA------VT--PDK--PVKPNKTLNILIAFVVGLMAAVGLAFLLEYLDNTIK--
H5XZG8      VSIVDTA------VI--PDQ--PVKPNKKLNVLIAFVVGLMAAMGLVFLIEFMDNTVK--
G0V448      IQIIDNA------VF--PDK--PVKPKKLLNIAIAFFLGIMISLGATFMLEYMDNTLK--
A0PZ01      VQILDKV------QV--PEK--PVKPHKALNVAIAFFLGLMVSIGLVFVLEYMDNTIK--
B1B737      VQILDKV------QV--PEK--PVKPHKGLNVAIVFFLGLMVSIGLVFVLEYMDNTIK--
G5IFS2      VKRVNDPDDEAEDSE--DDMPGQLDMRAIMDMEHDLPEESLKSSGGQEQRSMAVKRQTAS
B8D0N1      IITVDPP------VV--PE--SPVGPNMKLNLAIAIIMGLFVGVFIAFILEFINNTIQ--
D9QTC7      IVVIDPA------VV--GDEPKPIKPKTKLNVAIAIILATFMGVGIIFVLEYLDTTIK--
G0VNK5      VQVIDAA------TL--PE--KPIKPRKVLIMAIMTLLGLIVGMGTVIVQSLMYRKIR--
D2RIR1      VQVVDEA------TL--PD--KPIKPRKLLTLVLALFLGLFGGTGYTIARTLLNRKIR--
I0GRR3      VQVVDSA------TL--PE--EPIKPKKAMTMLVALLLGLLTGSAFVTAKGILNRRMR--
                                                                        

G9RSY8      --------QLT-------------------------------------------------
C4Z673      --------TSE----DIERYL-GLSTLALIPVNEGQNSNQGKRRVPVPSKGGSKTDITMN
C6CW36      --------SEE----ELKEVL-GIPLLAAMGKMKKEDLRGRRGEQVLIRKEAGGDNVYAS
A8SQS9      --------TSE----DMEKYF-GIVPLTVIPESEQFRTDDVQDITQKHSKRKERSKA---
D5HFS3      --------SAD----DMEKYF-GIVPLTTIPESDQFRTDDTEDEFGKKHNRKERVRA---
G0LYN8      --------VMD----FLTDDL-GLASLGLVNHQNQYSIKKQVSNLTVAHSTHDSQITSQT
F6ITB3      --------DVD----FLTDDL-GLTSLGLVNHQHQHSMKKQVLNLNGGYRPHNDRTSSQA
G0M1Y0      --------DVD----FLTDDL-GLTSLGLVNHQHQHSMKKQVLNLNGGYHPHNDRTNSQA
D7VC12      --------DAD----FLTDEL-GLTSLGLVNHQHHHSMKKQALNLNGGYHTHNDRTSSQA
F9UMZ5      --------DAD----FLTDEL-GLTSLGLVNHQHHHSMKKQALNLNGGYHTHNDRTSSQA
B9Y883      --------TEE----ELKQIF-DYPIIGLIPDMTHGTGGAE-------------------
H7F1R6      --------SKE----DVEAIL-NLPVLSMISEIKEADI--QKFKNKRRKRKG--------
H7F570      --------TAE----DVELLL-NLPVLTIISEIKEESLITQNQRSNNRRKRG--------
A5Z5P8      --------TEE----DVEKYL-GIIPLTVIPDGNVKYGAYSKYNYYKGKKYYTPK-----
C6LCS6      --------NAD----DVQNYL-GVSVLGTIPMDEKKQRRKQVKKKKAKKKF---------
A7VF43      --------TAS----DMEKYF-GIVPLTSIPESDQFNQGDSATDKDKAKSGLKGRSK---
C6CSC7      --------TET----DVQRYL-GQPTLAMVARVEASEFQTGSSRTENRQ--KAGGLENVT
C6CS79      --------TES----DVERYL-GLPTLAAIPNIKQGDLKPKALAIGKTTIGKEGEKNNVS
F5LM70      --------TEE----DVEHYL-GLPTLVAVPEIRAGDMKPKRTPIGK----KVGEASGVP
H6LKR9      --------DED----DIKSLI-DVSVLGSIPEFKGEAR----------------------
F5LE49      --------TEK----DVEKFL-GVPTLAVISKIKTADLKNNAPSEPHKKMAGETAYAGVN
F3AHH1      --------TAE----DVERYL-DLSTLGTLPLEKNEKKEKRDVLEIIKGDRHHDKCRNKS
H1LCW2      --------DDE----FLTNEL-RLTNLGHIAEIRKIHGSHLANKRHGEHLKPNHRRV---
I5AV00      --------NAG----DIQKYL-EISALGVIPLAEGV---KRNKKHRFLNIGRRR------
H6NE44      --------NEK----DVEELL-GLSVLAAIPTVKSKDIALQLSPSGRKVGEIPYATAKQ-
F4BS20      --------DEK----VITEKL-GWIHLGNISEMSKSE--TAIEEKNLVLQYQQITLKKF-
E0RZL4      --------SND----DVERYL-GLSTLALIPLTTDE-----MDKKKKKQKPKKVK-----
C0CK72      --------GED----DVTKAL-GVPVFCIIPESASMLYKGQKKR----------------
D9S1J8      --------SPE----DVAKYL-GLPVIGSIPYIEKGEVA---------------------
C2EFR7      --------TSE----DVEKYL-GLSTLAVIPKISDSNNKKKYYGNYGKGKSKRRKRV---
Q1WTC7      --------TSE----DVEKYL-GLSTLAVIPKISDSNNKKKYYGNYGKGKSKRRKRV---
B0P2G1      --------KEE----DIEKYL-GINTLAQLPLVKGTT--------------KRTKKVKRA
D4MW28      --------KEE----DIEKYL-GINTLAQLPLVKGTT--------------KRTKKVKRA
E5VMX9      --------KEE----DIEKYL-GINTLAQLPLVKGTT--------------KRTKKVKRA
F2I6Z8      --------SQA----VVEEM--GWSLIGVLPQMSEESIEVTRFKRRYRSQDDNDETKRRI
E6U7N3      --------SEE----DVENRL-GISVIGVIPVVQVKE-----------------------
C4Z8M6      --------DTE----DVEKKL-GMNVLGTLPLDEAED------------DGEHGKGR--K
D4JMC3      --------NAD----DMETRT-GLKVLASLPVDETEY------------DGAKTKRRKKK
D6E0V3      --------NAD----DMETRT-GLKVLASLPVDETEY------------DGAKTKRRKKK
E3GPC7      --------SVE----ELKELIDGVPVVAVIPHSEELM-------------THSEGGKK--
A6BIG6      --------TPA----DIERYL-GLNVLTSIPIQTEEK-----------------KVKKRK
C2CI43      --------SAE----EVTEFF-DIPVIGIVPDRKQGN-----------------------
D4RX68      --------TQE----DVEKIF-GMSVLGLIPKFEGEGDK---------------------
D4J4T5      --------TED----DIEKYL-GMTTLAVLPYNGRKQ------------QRQAQKHKKQR
I5ASF9      --------SDE----DVEKYL-QLTTLASIPLKSAED-----------------------
C0C0F9      --------TPD----DVEHYL-GLNVLTSIPIQEGVK------------KSKKVKGMSAR
B6W7H3      --------TTD----DIQEAF-DIPVLGMVPDKSKGE-----------------------
C7RGH5      --------SSE----EVTEYF-DIPVIGIVPDSEQGN-----------------------
F0GT82      --------SAE----EVEEYL-NLPVIGVLPDVKKGN-----------------------
F3AH93      --------TEE----DIARYL-DIPVLATVPDRKDYI------------GKNKKSGRKKK
B0GAL4      --------SEE----DIEKYL-GLSTLSVIPDRKDYI---------------NGSGKKKS
G1WUK1      --------SEE----DIEKYL-GLSTLSVIPDRKDYI---------------NGSGKKKS
D4M2S1      --------SED----DIENYL-GLTTLASIPDRKDYI---------------TGKGLRNS
E7GL80      --------SEE----DVFKYL-ELPVLAVVPERKDSKVERSSSSGRFFGRKKKVSGKRGS
G5F9E3      --------SEE----DVFKYL-ELPVLAVVPERKDSKVERSSSSGRFFGRKKKVSVKRGS
D4CG07      --------TEE----DVEKYL-KLSVLASVPEKDKGK------------RGQR-------
D4MP31      --------TEE----DVEKYL-KLSVLASVPEKDKGK------------RGQR-------
G5HNC6      --------SED----DVSKYL-GISVLAAIPDNGE---------------AEKEQPIKFR
A8RK86      --------SEE----DVGKYL-GMSVLASVPDDDG---------------MAKEQQRNRS
G5HTB1      --------SEE----DVSRYL-GISVLAAIPENGE---------------TENNPLVQKN
A8RSL0      --------TEE----DVTKYL-GLSVLASVPEREGEK------------PEDKEAMISSK
C5EN02      --------TEE----DVTKYL-GLSVLASVPIREGEK------------PEDKEAMISSK
G5HG46      --------TEE----DVTKYL-GLSVLASVPEREGEK------------PEDKEAMISGK
E7GL39      --------SEE----DVSKYL-DLPVLAVIPKKDGNE------------DRKKGQGKQKK
E7GL56      --------SEE----DVERYL-SIPVLAVIPKK-----------------REKGKKKEKH
G5F9B0      --------SEE----DVERYL-SIPVLAVIPKK-----------------REKGKKKEKH
D3AC81      --------TPE----DVERYL-GLNTLATIPVFEGE-----------TGTKKKKSKRKKS
D3AE79      --------NAG----DIERYL-DLNTLGQIPEFEEN-----------ERRKKKKSRWGRR
D4YF14      --------SSD----DLIDLQ-MVKLGGIFELSEDQ--------KEHSRVQSTVATKSRE
B1YMM6      --------TEE----QVHQIL-DLPVLGSIPDIESKVFNASKKASKREAVKQYG------
D4LG05      --------TAE----EMEKYF-GLVPLTTIPESSKV---KSYDGEEEYSSRKRRKRNE--
D4LTH3      --------TAE----DMEKYF-GLVPLTVIPESDQV---AQMETTHS-SKKKRRKKNG--
F3ATF6      --------TED----DIERAL-GIPTLAVIPDRKDYIDDHGGSKKKKGKRRRQSKWRNKR
E0I7B6      --------TER----DIEKAL-ELPMLTLITKMDRSELKRKRPSKPQSHTSTQVGESTYV
C9LAS2      --------TEE----DIEKYL-GLSTLTSVPDRKDYINEKKHGKKKKGKKGRK-------
F7K8E8      --------TPE----DVEKYL-RLSTLAVIP-----LNEGETDAKKKKKKVKRN------
F7K9V0      --------TPE----DVEKYL-QLSTLAVIP-----LNEGEEDGKKKKKKVKRN------
F7KL97      --------TPE----DVEKYL-QLSTLAVIP-----LNEGETDAKKKKKKVKRS------
D3FZP5      --------TEQ----DIEQLL-EIPVLATIAHMDEN---ETQVSKGLTKLGSDDHAKKKS
C0ZHV9      --------SEK----EVEEYL-GLPVLATIAVIDKK-----TRKAFRQPKVEEVRNEYEK
D7WMM9      --------TEQ----DIEELV-GLPIIGLISQISDA---------HHKSTRVKS--RKTR
A8U9F5      --------DER----FITETL-GWSVLGSVSEMSNDELHAKLNIKRPELNSRRT--KSRV
F4BSE0      --------DER----FITETL-GWSVLGSVSEMSNDELHAEVKVKRPEVNSRRT--KSRV
E7RDR2      --------DQQ----DIEEIL-DIPLLGVISPIKEE---A---KLEQTTSSKRR--AG--
I0JRK5      --------SEE----DIESHL-DLPVMGVVSTISEE---DLPERRPTRKKTEDTKVRSES
G2TR26      --------DEQ----DVEQIL-QLPVLGVIGQIDDQ---E-LNGLHRAGKKTKG--KVET
D5DBK2      --------TEQ----DIENLL-ELPLMGVITNIKDV---PKVTNVQRPDMNARVPQRGET
D5DY80      --------TEQ----DIENIL-ELPVMGVVTTIKDV---PKATNVQRPDITARVPQRGET
A7Z9K1      --------SEE----QLESLL-GIPILGTVTSISTK---DSVAKNLRMAETKQA--GGGH
I2CB17      --------SEE----QLESLL-GIPILGTVTSISTK---DSVAKNLRMAETKQA--GGGH
I2HW54      --------SEE----QLESLL-GIPILGTVTSISTK---DSVAKNLRMAETKQA--GGGH
G4P1M8      --------SEE----QLESLL-DIPVLGTVSTIANE---QKTAKSLHGIQSEKA--GSGH
E0TTZ7      --------SEE----QLESLL-DIPVLGTVSTIANE---QKTAKSLQGIQSEKA--GSGH
G4EQF2      --------SEE----QLESLL-DIPVLGTVSTIANE---QKTAKTLQGFQSEKT--GSGH
P96715      --------SEE----QLESLL-DIPVLGTVSTIANE---QKTAKTLQGFQSEKT--GSGH
I0F9R7      --------SEE----QLESLL-DIPVLGTVSTIANE---QKTAKAIQGFQSEKA--GSGH
G9QKR5      --------NEQ----DIEKRL-ELPILGMVTTISEE---DIKLATQRSSHRKQV--RGET
B5UQ74      --------KEE----DVENLL-GLPVLGVVARMDEE---TQINRSVHTSSSRKV--RGQT
B7HFH2      --------KEE----DVESLL-GLPVLGIVARMDEE---T-TNVKSHTLSSRKV--RGQT
Q72XH7      --------KEE----DVENLL-GLPVLGIVARMDEE---T-TNVKSHAPSSRKV--RGQT
C2V4M3      --------KEE----DVENLL-GLPVLGIVARMDEE---T-LNVKSHAPSSRKV--RGQT
C2YZB3      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
C2P8H2      --------KEE----DVENLL-GLPVLGIVARMDEE---T-LNIKSHAPSSRKV--RGQT
C2Y451      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
C3EBC1      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
C3H980      --------KEE----DVENLL-GLPVLGIVARMDEE---T-LNVKSHAPSSRKV--RGQT
C2PN23      --------KEE----DVENLL-GLPVLGIVARMDEE---T-TNVKSHAPSSRKV--RGQT
B9IRQ7      --------KEE----DVENLL-GLPVLGIVARMDEE---T-TNVKSHAPSSRKV--RGQT
A0RL71      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
C2XJI0      --------KEE----DVENLL-GLPVLGIVARMDEE---T-LNVKSHAPSSRKV--RGQT
Q3EV65      --------KEE----DVENLL-GLPVLGIVARMDEE---T-LNVKSHAPSSRKV--RGQT
C2T8T7      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
C2RG50      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
Q814Y9      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
B3ZRD5      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
Q6HB08      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
C2NQN7      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
C3GRR1      --------KEE----DVENLL-GLPVLGIVARMDEE---T-TNVKSHAPSSRKV--RGQT
C2ULR7      --------KEE----DVESLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
C3GBJ9      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
C2WVG7      --------KEE----DVEKLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
B7IQS9      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
A9VRC4      --------KEE----DVESLL-GLPVLGIVARMDEE---T-ASVKSHASSSRKV--RGQT
C2MTG4      --------KEE----DVENLL-GLPVLGIVARMDEE---T-PSVKSHAPSSRKV--RGQT
B7HXB5      --------KEE----DVENLL-GLPVLGIVARMDEE---T-PSVKSHAPSSRKV--RGQT
C2SBU5      --------KEE----DVENLL-GLPVLGIVARMDEE---T-PSVKSHAPSSRKV--RGQT
C2SSX9      --------KEE----DVESLL-GLPVLGIVARMDEE---T-ANVKSHAPSSRKV--RGQT
G9QCG2      --------KEE----DVENLL-GLPVLGIVARMDEE---T-MNVKSHAPSSRKV--RGQT
Q2BFS6      --------TEQ----DIEKLL-DLPVLGTIAIINEE---T-GAMEEKAAR-KQR--GGER
I3EBB4      --------TEQ----DIEKLL-ELPVLGVIATIDEQ---N-DSSIRSERK-ARY--RGET
A4ITF4      --------TEA----DVEKHL-GLPVLGSISVMSPS---T-AKTTRTGLSMQRA--RGET
C5D962      --------TET----DVEKHL-GLPVLGAVSIISAE---E-SKKAKKQVSMVKT--RGET
G8MZ94      --------TEE----DVEKHL-GLPVLGAVSLITAE---G-GQKARRESAIPQT--RGET
Q5KUM4      --------TEE----DVEKHL-GLPVLGAVSLITAE---G-GQKARRESAIPQT--RGET
D4YHG8      --------SSD-----IVEEL-GWTLLGTIP-QMDKSKVENTRFK---------------
F7V793      --------TYE----DIEKEF-GVLPLAVVP-EGDFDKSRGAHKK---------------
H4GK02      --------TNE----FMTDEL-NLVNLGQVS-H-----MRYDRKN---------------
F6IR92      --------TLE----FLTDDL-QLTSLGLVN-HQPVVATKTDNLA---------------
G0M0G0      --------TLE----FLTDDL-QLTSLGLVN-HQPVVATKADNLA---------------
D7VBW5      --------TLE----YLADEL-MLTSLGIIN-HQQPVTATHDQPA---------------
F9UQ55      --------TLE----YLADEL-MLTSLGIIN-HQQPVTATHDQPA---------------
G2KUP2      --------NVD----YL-EDL-GLNNLGLIY-EIDKSDM--KIAT---------------
G8PE07      --------SEE----FLTDEL-GLNSLGVVN-EIAVKDLKKRVVP---------------
E0NHP5      --------SEE----FLTEEL-GLKGLGIIS-EIDENEIRRKIAP---------------
Q03GL9      --------SEE----FLTDEL-GLKGLGIIS-EINESDIRRKITP---------------
F3Y921      --------NEQ----FLSDEL-GLIVLGVVP-TMVGKESETNYTKIKTVNTAIINEDKDK
G4L593      --------DSR----YITDTL-GMTVLGTVP-KMSQKEIEETTKKLTK-----------A
E6LD65      --------DAT----FLTEEL-GFTLLGTVP-DISDKDIAVNIKKTRKLV---------D
C9ALZ8      --------DEK----YVTDTL-GFPILGTVP-EMSAKELNAGIRK--------------K
C9BUG6      --------DEK----YVTDTL-GFPILGTVP-EMSAKELNAGIRK--------------K
Q3XYS7      --------DEK----YVTDTL-GFPILGTVP-EMSAKELNAGIRK--------------Q
C9B453      --------DEK----YVTDTL-GFPILGTVP-EMSAKELNAGIRK--------------K
D4RJF5      --------DEK----YVTDTL-GFPILGTVP-EMSAKELNAGIRK--------------K
C8ZXT8      --------DDK----FVTETI-GYTILGTVP-QMSQKELNATIQK--------------K
F0EKB8      --------DDK----FVTETL-GFTVLGTVP-QMSPKELAATIQK--------------K
C9A6V4      --------DDK----FVTETL-GFTVLGTVP-QMSPKELAATIQK--------------K
C9CHY7      --------DDK----FVTETL-GFTVLGTVP-QMSPKELAATIQK--------------K
D4JI68      --------DTE----DVEKKL-GMNVLGTLP-LDESEDDGEQGKG--------------R
D6E329      --------DTE----DVEKKL-GMNVLGTLP-LDESEDDGEQGKG--------------R
E6UHY5      --------SGE----DIKERF-GVPVLAEIP-DIFMDERGGNGKY--------------G
E9SAU2      --------SGE----EIKERF-GVPVLAEIP-DIFMDEKGGSSKY--------------G
F7K0U2      --------TPD----DVERYL-GLTVLTSIP-IASGTPAAKKVRG--------------L
O06029      --------KEE----DIEA-L-GLTVLGVTS-YDQMSDFNKNTNK--------------N
G8P3D6      --------KEE----DIEA-F-GLTVLGVTT-YAQMSDFNRNTSK--------------N
A9QSJ3      --------KEE----DIEA-L-GLTVLGVTT-YAQMSDFNKNTNK--------------N
F9VC43      --------KEE----DIEA-L-GLTVLGVTT-YAQMSDFNKIANK--------------N
G6FD41      --------KEE----DIEA-L-GLTVLGVTT-YAQMSDFNKNTNK--------------N
G9M881      --------KEE----DIEA-L-GLTVLGVTT-YAQMSDFNKNTNK--------------N
Q3ZK51      --------KEE----DIEA-L-GLTVLGVTT-YAQMSDFNKNTNK--------------N
Q83VG0      --------KEE----DIEA-L-GLTVLGVTS-YAQMSDFNKNTNK--------------N
C6LDI9      --------TEE----DIEKYL-GLNMLGVIP-KSEKDDHIPDSGG--------------K
G5F9H3      --------SEE----DVSKYL-DLPVLAVIP-KK--DGNEDRKKG--------------Q
C0CZV8      --------TEE----DVTRYL-GLTVLASVP-ARKGETPEDKEAM--------------V
G5GFW1      --------TED----DIARYL-DITVLAVLP-----DTDEDEKL----------------
F8KGP2      --------DDD----YLTNEL-GLTNLGHVN-HIEMSRDFKVNNQ---------------
B3XL22      --------DDD----YLTNEV-GLTNLGHVN-HIEMSRDFKVNNQ---------------
F8DRU3      --------DDD----YLTNEL-SLTNLGHVN-HIEMSRDFKVNNQ---------------
C2EWM2      --------SDD----FLTNEL-GLTNLGAVG-HIQMRADQDGIGT---------------
D0DSJ3      --------DND----FMTNEL-GLTNLGQVG-EIYMPADFEFKRF---------------
B2GF32      --------DND----FMTNEL-GLTNLGQVG-EIYMPADFEFKPF---------------
C0WW25      --------DND----FMTNEL-GLTNLGQVG-EIHMPADFEFKPF---------------
F0K0J8      --------EDS----FMTNEL-GLTNLGEIA-HITMPKDWTFTAK---------------
G6F8H0      --------EDS----FMTNEL-GLTNLGEIA-HITMPKDWTFTAK---------------
F0HVF2      --------EDS----FMTNEL-GLTNLGEIA-SITMPKDWTFTAK---------------
Q1G8E3      --------EDS----FMTNEL-GLTNLGEIA-HITMPKDWTFTAK---------------
D6S4X3      --------DDE----FMTKTL-GLTNLGQID-HYHLSNSFKITRV---------------
Q5FIC6      --------DDE----FLTREL-GLTNLGQIA-HFHLSSSFTIKKS---------------
E4SMV6      --------DDE----FLTREL-GLTNLGQIA-HFHLSSSFTIKKS---------------
F0TGY3      --------DDE----FLTREL-GLTNLGQIA-HFHLSSSFTIKKS---------------
F2M2M7      --------DDE----FLTREL-GLTNLGQIA-HFHLSSSFTIKKS---------------
A4ZGZ7      --------DDT----YLTQDL-GLTNLGYVS-HFHVSSSFKLIKK---------------
C2EPK4      --------DDN----YLTQEL-GLTDLGQVA-HFHLSSSFSINKN---------------
C7XKF2      --------DDA----FLTDNL-GLVDLGQVS-HFHVSSSFVIRKK---------------
E3R265      --------DDA----FLTDNL-GLVDLGQVS-HFHVSSSFVIRKK---------------
D0DJG9      --------DDA----FLTDTL-GLVDLGQVS-HFHVSSSFVIRRK---------------
D5GZJ9      --------DDA----FLTDNL-GLVDLGQVS-HFHVSSSFTIRRK---------------
A8YX90      --------DDT----YLTQDL-GLTNLGYVS-HFHVSSSFKLIKK---------------
F0NWJ8      --------DDT----YLTQDL-GLTNLGHVS-HFHVSSSFKLIKK---------------
C2JZS0      --------DID----FITDDL-GLVNLGIVN-YVQKMKSMDEAIRQKQ-----------N
C1J9I2      --------DID----FITDDL-GLVNLGIVN-YVVRMKDMDQAIQQSR-----------A
Q58Z11      --------SID----FITNDL-GLVNLGLVN-YVQRMNDMDEAIARSK-----------N
B1MZT2      --------SPD----EVSQLF-GFTNLGVVS-HIKGMKHFDMAPT-VQ-----------S
C2KHF2      --------SPD----EVSQLF-GMTNLGVIG-HVKPIKNFSMAPSSTT-----------S
Q03W94      --------SPD----EISEAF-GMTNLGIIG-HVKPIKHFSMSPK--V-----------E
G2Z8Q4      --------SEK----DIEALT-DIPILGSIQKERKKRRRHAKRTFKTTH-----------
D9ST43      --------VEE----DINKYL-GIPVIGVIPKDVGKY-----------------------
H7F5T7      --------REE----DFE-VL-DIPVLGLVG-KIDKYHQNGQRMRK--------------
G9WIR0      --------DLS----FLEQ-L-KLNNLGTVN-YASFHKGRAK------------------
D3LB11      --------EPD----YIDQ-L-GFNNLGTVN-YAAFHKRRNN------------------
A0NKF7      --------ETE----YIGQ-L-GFNNLGTVN-YVAFHKRRNN------------------
Q04DV7      --------ETE----YIGQ-L-GFNNLGTVN-YAAFHKRRNN------------------
F6BI63      --------SID----DVKKYL-DLPVLGVIP-ELKD------------------------
G2MWC1      --------SPE----DIKKYL-DLPVLGVIP-EIKN------------------------
B0K4N2      --------SPE----DIKKYL-DLPVLGVIP-EIKN------------------------
C7ISF8      --------SPE----DIKKYL-DLPVLGVIP-EIKN------------------------
B0KAR6      --------SPE----DIKKYL-DLPVLGVIP-EIKN------------------------
E8UV30      --------SPE----DIKKYL-DLPVLGVIP-EIKN------------------------
C0GGR6      --------TPK----DVEQNL-ELPLLGTIP-FFEGE-----------------------
A4J8V1      --------TGD----DVERYL-ELPVLGVIP-KIE-------------------------
C8VYQ7      --------TNE----DINRYL-ELPVLGVIP-KIDA------------------------
C8W5K3      --------SNE----DIERYF-GLPVYGNIP-KIK-------------------------
B1BNH4      --------SRE----DLENTL-DLPIIGTIP-DYDNVGK---------------------
B1V1Z3      --------SRE----DLENTL-DLPIIGTIP-DYDNVGK---------------------
B1R3V2      --------SRE----DLENTL-DLPIIGTIP-DYDNVGK---------------------
Q0SVR9      --------SRE----ELEKTL-DLPIIGAIP-DYDSIEK---------------------
Q8XN47      --------SRE----ELEKTL-ELPIIGTIP-DYDNVGK---------------------
G7M0Q2      --------NKE----EMEKEL-GLPVLGTIP-DFLNE-----------------------
G7M565      --------TRE----EMEEIL-GVPVLGTIP-DKFKS-----------------------
A6M2M0      --------TRE----QIEEIL-GLPVLGVIP-DLFKEGK---------------------
G7M1R8      --------TKE----QLEQIL-EVPVIGAIP-DDLD------------------------
Q4JZ56      --------RFE----ELEK-L-GIPILGSIP-LSKNIK----------------------
Q7X554      --------RPE----DVEDVL-GMTLLGIIP-DTDKI-----------------------
Q7X550      --------RPE----DVEDVL-GMTLLGIIP-DTDKI-----------------------
Q7X562      --------RPE----DVEDAL-GMALLGIVP-DTDKI-----------------------
Q7X556      --------RPE----DVEDAL-GMTLLGIVP-DTDKI-----------------------
Q7X552      --------RPE----DVEDAL-GMTLLGIVP-DTDKI-----------------------
Q7X558      --------RPE----DVEDAL-GMTLLGIVP-DTDKI-----------------------
C5NWJ9      --------RAE----DIEETM-GLVLLGVVP-DTKTGKR---------------------
F3A498      --------RAE----DIEEAM-GLVLLGVVP-DTKTGKR---------------------
Q9AHD3      --------RPE----DIENTL-QMTLLGVVP-NLGKLK----------------------
Q4K2E2      --------RPE----DIEDVM-QIPLLGVIP-NLDKLK----------------------
Q4K2F8      --------RPE----DIEDDM-QIPLLGVIP-NLDKLK----------------------
Q4K046      --------RPE----DVEDVL-QIPLLGIIP-DLDKMK----------------------
Q4K0R8      --------RPE----DVEDVL-RIPLLGLVP-DLDKMK----------------------
Q4JYY0      --------RPE----DFEDVL-QIPLLGLVP-DLDKMK----------------------
Q4JZW8      --------RPE----DVEDVL-QIPLLGVVP-DLDKMK----------------------
I0J9C8      --------RPE----DVEDVL-QIPLLGVVP-DLNKMK----------------------
Q4K0M4      --------RPE----DVEDVL-QIPLLGVVP-DLNKMK----------------------
Q4JZS4      --------RPE----DVEDVL-QIPLLGVVP-DFDKMK----------------------
Q4JZK2      --------RPE----DVEDVL-KIPLLGLVP-DFDKIK----------------------
Q9AHA5      --------RPE----DVEDVL-QIPLLGLVP-DLDKMK----------------------
Q9X9A0      --------RPE----DVEDVL-QIPLLGLVP-DLDKMK----------------------
Q4JYK9      --------RPE----DVEDVL-QIPLLGLVP-DLDKMK----------------------
Q4K006      --------RPE----DVEDVL-QIPLLGVVP-DLNKMK----------------------
Q4JZG8      --------RPE----DVEDVL-KIPLLGLVP-DFNKIK----------------------
A6YIA7      --------RPE----DVEDVL-KIPLLGLVP-DFDKMK----------------------
E5F5C4      --------RPE----DVEDVL-KIPLLGLVP-DFDKIK----------------------
Q9AHB8      --------RPE----DIEDVL-KIPLLGLVP-DFDKMK----------------------
Q4JZL8      --------RPE----DVEDVL-KIPLLGLVP-DFDKIK----------------------
Q4K1B8      --------RPE----DVEDVL-KIPLLGLVP-DFDKIK----------------------
Q8VU32      --------RPE----EVEEVL-QVPLLGVVP-DLDKMK----------------------
D2ERX9      --------RPE----DVEDLL-QIPLLGVVP-DLDKMK----------------------
G6C7Z0      --------RPE----DVEDVL-QIPLLGVVP-DLDKMK----------------------
Q4K2A9      --------RPE----EIEDVL-QMPLLGVVP-DLDKMK----------------------
D6ZQI7      --------RPE----DVEDVL-QMPLLGVVP-DFDKMK----------------------
Q9ZFT9      --------RPE----DVEDVL-QMPLLGVVP-DFDKMK----------------------
Q4K255      --------RPE----DVEDVL-QMPLLGVVP-DFDKMK----------------------
F9HJP7      --------KPE----DIEEVM-GMSLLGIVP-DMRKLK----------------------
E8JWI4      --------KPE----DIEETL-GMTLLGVIP-DMSKVG----------------------
A8AZR4      --------KPE----DIEEVM-GLSLLGVVP-DMRKLK----------------------
D0RXH3      --------KPE----DIEDVM-GATLLGVIP-NLKKL-----------------------
Q83YR6      --------KPE----DIEDVM-GATLLGVIP-NLKKL-----------------------
F1Z125      --------RPE----DVEELL-GMTLLGIVP-NTNKM-----------------------
Q3K0S9      --------TEE----DIEKAL-GLTSLGIVP-DLNKL-----------------------
P0C0T8      --------TEE----DIEKVL-GLTSLGIVP-DLNKL-----------------------
Q67AY5      --------TEE----DIEKVL-GLTSLGIVP-DLNKL-----------------------
Q04662      --------TEE----DIEKVL-GLTSLGIVS-DLNKL-----------------------
Q8GP93      --------RPE----DVEDAL-GMTLLGIVP-DTDKI-----------------------
Q8GPF7      --------RPE----DIEDTL-GMTLLGIVP-DTDKI-----------------------
E3CP61      --------RPE----DIEETL-GMTLLGIVP-DTDKI-----------------------
E8KUY7      --------RPE----DIEETL-GMTLLGIVP-DTDKI-----------------------
C2LSE5      --------RPE----DVEDAL-GMTLLGIVP-DTDKI-----------------------
E9DM16      --------RPE----DIEDAL-GLTLLGIVP-DIDKI-----------------------
I0QIK5      --------RPE----DIEDAL-GLTLLGIVP-DIDKI-----------------------
Q7X560      --------RPE----DVEDAL-GMTLLGIVP-DKDKI-----------------------
Q8GMA6      --------RPE----DVEDAL-GMALLGIVP-DTDKI-----------------------
Q55204      --------RPE----DVEDAL-GMTLLGIVP-DTDKI-----------------------
Q8GPC4      --------RPE----DVEDAL-GMTLLGIVP-DTDKI-----------------------
Q8GPA9      --------RPE----DVEDAL-GMALLGIVP-DTDKI-----------------------
G6ERT2      --------RPE----DVEDVL-GMTLLGIIP-DTDKI-----------------------
O87930      --------RPE----DVEDVL-GMTLLGIIP-DTDKI-----------------------
Q8GP55      --------RPE----DVEDAL-GMTLLGIVP-DTDKI-----------------------
F8HDC4      --------RPE----DVEDVL-EMTLLGIVP-DTDKI-----------------------
F8LJ76      --------RPE----DVEDVL-EMTLLGIVP-DTDKI-----------------------
F8LXJ5      --------RPE----DVEDVL-GMTLLGIIP-DTDKI-----------------------
Q1WCR2      --------RPE----DVEDVL-GMTLLGIIP-DTDKI-----------------------
G3G7C0      --------RPQ----DIEEVM-GLTLLGVVP-DSKKLK----------------------
G3G7J8      --------RPQ----DIEEVM-GLTLLGVVP-DSKKLK----------------------
G8DU30      --------RPQ----DIEEVM-GLILLGIVP-DSKKLK----------------------
A4VTU2      --------RPQ----DIEEVM-GLTLLGIVP-DSKKLK----------------------
D5AGQ4      --------RPQ----DIEEVM-GLTLLGIVP-DSKKLK----------------------
Q9X4U6      --------RPQ----DIEEVM-GLTLLGIVP-DSKKLK----------------------
G3G7G5      --------RPQ----DVEEVM-GLTLLGVVP-DSKKLK----------------------
G7SG35      --------RPQ----DIEEVM-GLTLLGVVP-DSKKLK----------------------
G8DU06      --------RPQ----DIEEVM-GLTLLGVVP-DSKKLK----------------------
G8DUA9      --------RPQ----DIEEVM-GLTLLGVVP-DSKKLK----------------------
G8DTY9      --------RPQ----DIEEVM-GLTLLGVVP-DSKKLK----------------------
G3G7I7      --------RPQ----DIEEVM-GLTLLGVVP-DSKKLK----------------------
G3G7J3      --------RPQ----DIEEVM-GLTLLGVVP-DSKKLK----------------------
E0PD82      --------RPE----DIEEVL-GMTLLGVVP-DIDKM-----------------------
F5X651      --------RPE----DIEDVL-GMTLLGVVP-DIDKM-----------------------
G5JTD6      --------TSE----DIEKAL-DRTLLGVVP-DINSL-----------------------
Q2KM75      --------SPE----DVEDVL-GMTLLGMVP-NTNKM-----------------------
G5KAJ3      --------RPE----DIEEVL-GMTLLGTVP-NTDKL-----------------------
B9DUJ5      --------RPE----DVEEAL-GMTLLGIVP-NIDKM-----------------------
G5KD12      --------RPE----DVEEVL-GMTLLGIVP-NTDKM-----------------------
E8JMT8      --------RPE----DVEEVL-GMTLLGVVP-DIDKL-----------------------
F5X0J8      --------RPE----DVEEVL-GMTLLGVVP-DIDKL-----------------------
H2A601      --------RPE----DVEEVL-GMTLLGVVP-DIDKL-----------------------
E7S8W2      --------KPE----DIEEVM-GITLLGVIP-HVKKL-----------------------
F8DFF5      --------KPE----DVEELM-GLPLLGVVP-DIKKL-----------------------
I1ZPH8      --------KPE----DVEELM-GLPLLGVVP-DIKKL-----------------------
E3CBR9      --------RPE----DVEELM-GLTLLGVVP-DIKKL-----------------------
E8K787      --------RPE----DIEELM-GLTLLGIVP-DIKKL-----------------------
F9M365      --------RPE----DIEELM-GFTLLGIVP-DIKKL-----------------------
A3CQY3      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
E8KLZ0      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
F0FHA9      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
F0FQQ4      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
F0I4H6      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
F0IAY2      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
F0IJI1      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
F0IS52      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
F2C9N1      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
F2CH54      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
F3UDW8      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
F3UNJ5      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
F3SM33      --------KPE----DIEEVM-GLTLLGVIP-DMNRM-----------------------
F9HC66      --------RPE----DVEEVM-QVALLGIVP-DLDKLK----------------------
E1LQJ6      --------RPE----DVEEVM-QIALLGIVP-DLNKLK----------------------
Q4JYU0      --------RPE----DVEEVM-QIALLGVVL-DLNKLK----------------------
Q4JZY2      --------RPE----DVEEVM-QIALLGIIP-DLNKLK----------------------
F9Q346      --------RPE----DVEDVM-QIALLGVVP-NLDKLK----------------------
Q6L5R1      --------RPE----DVEDVM-QIALLGVVP-NLDKLK----------------------
E9FEC6      --------RPE----DIEDVM-QIALLGVVP-NLDKLK----------------------
E0Q2S9      --------RPE----DVEDVM-QIALLGVVP-NLDKLK----------------------
F5VSH0      --------RPE----DVEDVM-QIALLGVVP-NLDKLK----------------------
A5YTV6      --------RPE----DIEDVL-QIALLGVVP-NLDKLR----------------------
Q6L5T1      --------RPE----DIEDVM-QIALLGVVP-NLDKLK----------------------
E0PPH8      --------RPE----DIEDVM-QIALLGVVP-NLDKLK----------------------
A5YTT8      --------RPE----DIEDVL-QIALLGVVP-NLDKLK----------------------
E6KKR9      --------RPE----DIEDVL-QIALLGVVP-NLDKLK----------------------
A1ILY0      --------RPE----DIEDVM-QIALLGVVP-NLDKLK----------------------
F2QF91      --------RPE----DIEDVM-QIALLGVVP-NLDKLK----------------------
Q4K0I3      --------RPE----EVEDVL-QMPLLGVVP-DFNKMK----------------------
Q8KWQ1      --------RPE----DVEDVL-QIPLLGLVP-DLNKMK----------------------
Q4K238      --------RPE----DVEDVL-QMPLLGVVP-DFDKMK----------------------
B1I966      --------RPE----DVEDVL-QMPLLGVVP-DFDKMK----------------------
G6J8A3      --------RPE----DVEDVL-QMPLLGVVP-DFDKMK----------------------
F9LZC3      --------RPE----DVEDVL-QIPLLGVVP-DLDKMK----------------------
F9P1W9      --------RPE----DVEDVL-QIPLLGVVP-DLDKMK----------------------
A5LJR9      --------RPE----DIEDVL-KIPLLGLVP-DFDKMK----------------------
Q9ZII7      --------RPE----DIEDVL-QIPLLGLVP-DLDKMK----------------------
Q4K1K7      --------RPE----DVEDVL-QIPLLGLVP-DLDKMK----------------------
E1LPE6      --------RPE----DIEDVM-EIPLLGIIP-NLDKVK----------------------
F9MJW6      --------RPE----DIEDVM-EIPLLGIIP-NLDKVK----------------------
Q4K0V3      --------RPK----DIEDTL-HMTLLGIVP-NLNKLK----------------------
Q54519      --------RPK----DIEDTL-QMTLLGIVP-NLNKLK----------------------
C1CBD0      --------RPE----DIEDAL-QMTLLGVVP-NLDKLK----------------------
Q7WVX1      --------RPE----DIEDAL-QMTLLGVVP-NLDKLK----------------------
Q4K0E2      --------RPE----DIENTL-QMTLLGVVP-NLNKLK----------------------
Q9AH96      --------RPE----DIENTL-QMTLLGVVP-NLGKLK----------------------
A5M4L2      --------RPE----DIENTL-QMTLLGVVP-NLSKLK----------------------
B2ILP4      --------RPE----DIENTL-QMTLLGVVP-NLSKLK----------------------
C1CCB8      --------RPE----DIENTL-QMTLLGVVP-NLSKLK----------------------
P72511      --------RPE----DIENTL-QMTLLGVVP-NLSKLK----------------------
Q4K1S8      --------RPE----DIENTL-QMTLLGVVP-NLSKLK----------------------
P96474      --------RPE----DIENAL-QMTLLGVVP-NLGKLK----------------------
Q4K196      --------RPE----DIEDTL-QMTLLGVVP-NLNKLK----------------------
Q4K0Z7      --------RPE----DIEDTL-QMTLLGVVP-NLSKLK----------------------
Q4JZ85      --------RPE----DIEDTL-QMTLLGVVP-NLSKLK----------------------
Q4JYH6      --------RPE----DIEDTL-QMTLLGVVP-NLSKLK----------------------
Q4JZ19      --------RPE----DIEDTL-QMTLLGVVP-NLSKLK----------------------
Q4K0A1      --------RPE----DIEDTL-QMTLLGVVP-NLSKLK----------------------
Q4K1M5      --------RPE----DIEDTL-QMTLLGVVP-NLSKLK----------------------
Q4K2Q8      --------RPE----DIEDTL-QMTLLVVVP-NLSKLK----------------------
Q4K1G0      --------RPE----DIEDTL-QMTLLGVVP-NLNKLK----------------------
Q4K0T6      --------RPE----DIEDTL-QMTLLGVVP-NLSKLK----------------------
Q4K0K3      --------RPE----DIEDTL-QMTLLGVVP-NLNKLK----------------------
Q4K0X6      --------RPE----DIEDTL-QMTLLGVVP-NLSKLK----------------------
E8KDN1      --------RPE----DVEEVM-HISLLGVIP-NLEKLK----------------------
F9PEU3      --------RPE----DIEEVM-HISLLGVIP-NLEKLK----------------------
E8K321      --------RPE----DIEEVM-HLSLLGVIP-NLEKLK----------------------
F9PZP6      --------RPE----DIEEVM-HLSLLGVIP-NLEKLK----------------------
D6R2T7      --------KPE----DIEDIL-GLTLLGVVP-DMKKM-----------------------
F3UUQ1      --------KPE----DIEDIL-GLTLLGVVP-DMKKM-----------------------
E6IZC3      --------KPE----DVEEAL-GITLLGVVP-NMNKL-----------------------
G6A746      --------KPE----DVEEAL-GITLLGVVP-NMDKLK----------------------
B1V0N8      --------NKK----ELEKIL-PIPVIGEIP-IHD-------------------------
B1BNK2      --------NKK----ELEKIL-PIPVIGEIP-IHD-------------------------
B1R3X7      --------NKK----ELEKIL-PIPVIGEIP-IHD-------------------------
Q8XN77      --------NKK----ELEKIL-PIPVIGEIP-IHD-------------------------
B1HR40      --------TEQ----DIEEIL-SLPVIGVVS-NIELLNSKKSRAGGSS------------
A7Z922      --------SER----QLSEKT-DLPVLGVVY-DIKNQQTRSDEKHFGE------------
I2CAF3      --------SER----QLSEKT-DLPVLGVVY-DIKNQQTRSDEKHFGE------------
I2HVL3      --------SER----QLSEKT-DLPVLGVVY-DIKNQQTRSDEKHFGE------------
E0U2Z4      --------SAR----QLSERT-GLPCLGSVP-DVQKGRNRG-IKHFGE------------
D4G1R3      --------SAR----QLSERT-GLPCLGSVP-DVHKGRNRG-IKHFGE------------
G4EQZ6      --------SAR----QLSERT-GLPCLGSVP-DVHKGRNRG-IKHFGE------------
P71050      --------SAR----QLSERT-GLPCLGSVP-DVHKGRNRG-IKHFGE------------
G4P115      --------SAR----QLSERT-GLPCLGSVP-DVQKGRNRG-IKHFGE------------
A8FHM0      --------RTH----QIREEI-GLPSLGSVY-QMQADRRAKKDKQSVITGGQNIDL----
C0EBA5      --------GEE----DVAAHY-NIPVLTCIP-ELESTTKKGKYAYEYKS-----------
F8FCE3      --------NEK----DVEELL-GLSVLAAIP-TVKSKDIALQLSPSGRKVGEIPYATAKQ
I0BSG5      --------NDK----DVEELL-GLSVLAAIP-TVKSKDIALQLSPSGRKVGEIPYATAKQ
A8YPQ6      --------DEE----DVEKEL-GLPVLGSIQ-KFN-------------------------
P95695      --------DEE----DVEKEL-GLPVLGSIQ-KFN-------------------------
Q2G1K8      --------DEE----DVEKEL-GLPVLGSIQ-KFN-------------------------
C5QNG5      --------TEE----DVEKEL-GVPVLGSIQ-KIK-------------------------
Q4L9H8      --------TEE----DVEREL-NIPVLGSIQ-KLK-------------------------
Q2FUV1      --------TEE----DVESQL-GLPILGSIQ-KF--------------------------
P39850      --------TEE----EVENEL-VIPVLGSIQ-KFD-------------------------
D7UYE3      --------TEE----DVAEIL-DLPVLGIIQ-DFRK------------------------
Q4A121      --------TEE----DVEELL-DLPVLGVIQ-RFDY------------------------
C9AAE4      --------SNT----EIEEVL-GLKVIGEIS-KEKRVASFKTIQSRSLRGRKRV------
H7F6C7      --------STE----EIEELL-GLHVLGEVS-AFQNNDPFQTKFQKGDR-----------
F0SX23      --------TES----DLERMF-KLPVLGSIT-DFEHVSKHGYASYNYELSHQEGVQI---
Q38VG4      --------DES----FLTEEL-GLTSLGIIN-NIAPKDLIKKAIMKTSTLSRRG------
F2I4B6      --------DVD----FLTKEI-GWNMLGRVS-ELSENDLKVTHKANELQQIYHPDQDQGQ
Q8RBS6      --------TPD----DIKKYL-NLPVLGIIP-EVKNK-----------------------
D9SR42      --------SED----DLSKIL-DSTVLGSIP-DLKFEE----------------------
D9SVC8      --------SEN----DVLKLV-SLPVLSSIP-NFEIDE----------------------
E7RG09      --------VEE----DVTDLL-NLPVLGAIS-PMNDEEDIPVNEPIAFKRREEQEW----
D4G2E2      --------SEE----QLESLL-DIPVLGTVS-TIANEQKTAKTLQGFQSEKTGSGHFGA-
Q8EME7      --------TEQ----DIEKQL-NIPVLGVIS-HMDEKDVRNEQFGRASSVNKSVRSGFDG
D6Y035      --------TED----DLDKTL-GLPVLGAVT-IMDQEEASVDDRMKPSEKGREKHGVS--
Q5WBB3      --------TEK----DIENII-DLPVLGAVS-NMDSVDAA-------------AKKTS--
Q9K6Q9      --------DEK----EVEDVL-ELPVLGVIP-NFEKSEEK-------------KLIV---
Q97EP7      --------TQD----DIKRHL-DLPVLGVIP-SYEEE-----------------------
Q97ER4      --------TQE----DIKKHL-DLPVLGVIP-NYEEE-----------------------
E4S7Y7      --------TPD----DVEKFL-QLPVLAVIP-DLEKVERN--------------------
E4Q5T6      --------TPD----DLEKYL-QLPVLAVIP-DLDEGGKN--------------------
E4SDX3      --------TPD----DVEKYL-QLPVLAVIP-DLDEGGKN--------------------
G2FWX3      --------TSSEKSVDVEQLL-GIPVLGIIP-NYQIGK----------------------
G7WJV2      --------TSG----DVEKLL-GIPVLGIIP-DYGVKKIRARGDGLIGLFVNHL------
G7W774      --------TSD----DVESVL-GIPVLGVIP-TYEAGKRV--------------------
G2FM60      --------TLS----DVEKLL-GIPVLGIIP-DYEMGKQG--------------------
H5XZD5      --------TSS----DVEKLL-GIPVLGIIP-DYEMGK----------------------
I4DBG9      --------TSN----DVETLL-GIPVLGVIP-NYEIGKQA--------------------
G2FWT7      --------TSE----DVEKLL-GIPVLGVIP-NYQIGKQG--------------------
H5XZG8      --------TSE----DVENIL-GIPVLGVIP-NYEIGKQG--------------------
G0V448      --------TES----DVEKYL-ELPVIGIIP-KEIDE-----------------------
A0PZ01      --------TQE----DVEKCL-DIPVLGTIP-NHLSE-----------------------
B1B737      --------TQE----DVEKCL-DIPVLGTIP-DHLS------------------------
G5IFS2      ASSLEDELTGD----DLDEFV-QRIMEQALEGAEAPKEDIDDGTD---------------
B8D0N1      --------RVE----EIEEIT-DVPIIGYIPYIDKKNDGRDHNN----------------
D9QTC7      --------EEQ----DIEELT-DLPVLGTIPDFDTVDHSQGYGRDDQDG-----------
G0VNK5      --------TAE----DVEKEL-GLPVLGMIPDTSTLQVETGSSDGLWSKIRRKLWRK---
D2RIR1      --------TAA----DVEQYL-ELPVLGVIPEAGDHKQP--EEEGFWAGLRRKLWKK---
I0GRR3      --------TTE----DVEHYL-ELPVLGIIPDANGLDKE--EDIGLLEGIRNRLLRRK--
                                                                        

G9RSY8      ------------------------------------
C4Z673      DDKGRSFKASELENKKKSNGAKESVEE---------
C6CW36      INQ---------------------------------
A8SQS9      ------------------------------------
D5HFS3      ------------------------------------
G0LYN8      MKRV--------------------------------
F6ITB3      MKRV--------------------------------
G0M1Y0      MKRV--------------------------------
D7VC12      MKRV--------------------------------
F9UMZ5      MKRV--------------------------------
B9Y883      ------------------------------------
H7F1R6      ------------------------------------
H7F570      ------------------------------------
A5Z5P8      ------------------------------------
C6LCS6      ------------------------------------
A7VF43      ------------------------------------
C6CSC7      IGE---------------------------------
C6CS79      Q-----------------------------------
F5LM70      IQ----------------------------------
H6LKR9      ------------------------------------
F5LE49      Q-----------------------------------
F3AHH1      T-----------------------------------
H1LCW2      ------------------------------------
I5AV00      ------------------------------------
H6NE44      ------------------------------------
F4BS20      ------------------------------------
E0RZL4      ------------------------------------
C0CK72      ------------------------------------
D9S1J8      ------------------------------------
C2EFR7      ------------------------------------
Q1WTC7      ------------------------------------
B0P2G1      RE----------------------------------
D4MW28      RE----------------------------------
E5VMX9      RE----------------------------------
F2I6Z8      ------------------------------------
E6U7N3      ------------------------------------
C4Z8M6      HSRGSHRKKRKKKSASA-------------------
D4JMC3      KTQSSKSDDSKNKKRAV-------------------
D6E0V3      KTQSSKSDDSKNKKRAV-------------------
E3GPC7      ------------------------------------
A6BIG6      KR----------------------------------
C2CI43      ------------------------------------
D4RX68      ------------------------------------
D4J4T5      AKQERQTSRKRKEIETDEFN----------------
I5ASF9      ----SKAKKSRANKRKGRCA----------------
C0C0F9      KFVKSMKR----------------------------
B6W7H3      ------------------------------------
C7RGH5      ------------------------------------
F0GT82      ------------------------------------
F3AH93      KH----------------------------------
B0GAL4      KRNDAGKRKAS-------------------------
G1WUK1      KRNDAGKRKAS-------------------------
D4M2S1      SKTTPKKKKKRRKK----------------------
E7GL80      RKKTEITRKTPEETRQPEKTDQEIPAAALKDKTENS
G5F9E3      RKKAEITRKTPEETRQPEKTDQELPAAALKDKTENS
D4CG07      ------------------------------------
D4MP31      ------------------------------------
G5HNC6      GRKESRKKQKPGQKKKGRED----------------
A8RK86      KRKLERKKRKTEKNRRGE------------------
G5HTB1      KRKKSRKKQKPISKKG--------------------
A8RSL0      PKNKPAVGKSRKKKRGGHAS----------------
C5EN02      SKTKTAPGKSRKKK-GGRAS----------------
G5HG46      SKPKTGTGKSRKKK-GGRAS----------------
E7GL39      SRSTGRGAKAPEKGAGTRQKSGADRKGRGEN-----
E7GL56      KSPKEPGKGETRKGENGKEEIRKEVKGPKEEEQING
G5F9B0      KSPKEPGKGETRKEENGKEEIRKEVKGPKEEEQING
D3AC81      GR----------------------------------
D3AE79      AVE---------------------------------
D4YF14      RRV---------------------------------
B1YMM6      ------------------------------------
D4LG05      ------------------------------------
D4LTH3      ------------------------------------
F3ATF6      ------------------------------------
E0I7B6      PAK---------------------------------
C9LAS2      ------------------------------------
F7K8E8      ------------------------------------
F7K9V0      ------------------------------------
F7KL97      ------------------------------------
D3FZP5      VG----------------------------------
C0ZHV9      AEA---------------------------------
D7WMM9      RGS---------------------------------
A8U9F5      ------------------------------------
F4BSE0      ------------------------------------
E7RDR2      ------------------------------------
I0JRK5      IGA---------------------------------
G2TR26      VGA---------------------------------
D5DBK2      FGS---------------------------------
D5DY80      FGS---------------------------------
A7Z9K1      VDA---------------------------------
I2CB17      VDA---------------------------------
I2HW54      VDA---------------------------------
G4P1M8      FGA---------------------------------
E0TTZ7      FGA---------------------------------
G4EQF2      FGA---------------------------------
P96715      FGA---------------------------------
I0F9R7      FGA---------------------------------
G9QKR5      FGS---------------------------------
B5UQ74      IGS---------------------------------
B7HFH2      IGS---------------------------------
Q72XH7      IGS---------------------------------
C2V4M3      IGS---------------------------------
C2YZB3      IGS---------------------------------
C2P8H2      IGS---------------------------------
C2Y451      IGS---------------------------------
C3EBC1      IGS---------------------------------
C3H980      IGS---------------------------------
C2PN23      IGS---------------------------------
B9IRQ7      IGS---------------------------------
A0RL71      IGS---------------------------------
C2XJI0      IGS---------------------------------
Q3EV65      IGS---------------------------------
C2T8T7      IGS---------------------------------
C2RG50      IGS---------------------------------
Q814Y9      IGS---------------------------------
B3ZRD5      IGS---------------------------------
Q6HB08      IGS---------------------------------
C2NQN7      IGS---------------------------------
C3GRR1      IGS---------------------------------
C2ULR7      IGS---------------------------------
C3GBJ9      IGS---------------------------------
C2WVG7      IGS---------------------------------
B7IQS9      IGS---------------------------------
A9VRC4      IGS---------------------------------
C2MTG4      IGS---------------------------------
B7HXB5      IGS---------------------------------
C2SBU5      IGS---------------------------------
C2SSX9      IGS---------------------------------
G9QCG2      IGS---------------------------------
Q2BFS6      DAV---------------------------------
I3EBB4      VGS---------------------------------
A4ITF4      VGR---------------------------------
C5D962      IGS---------------------------------
G8MZ94      IGS---------------------------------
Q5KUM4      IGS---------------------------------
D4YHG8      ----------GNAVKDGSRNRRRV------------
F7V793      ---------KKTGRDRQNRRQGVK------------
H4GK02      ---KRQKSRGN----------RRV------------
F6IR92      ---AKQRPQTA-A----KPAIKRV------------
G0M0G0      ---AKQRPQTA-A----KPAIKRV------------
D7VBW5      ---IKPQPVTSVV----KAAVKRV------------
F9UQ55      ---IEPQPVTSVV----KAAVKRV------------
G2KUP2      ---NKHGRRIDNH-------ERRV------------
G8PE07      ---NNSDDAKSHDSKDTSRTRRRV------------
E0NHP5      ---KIGGNKRRDD--GETRMRRRV------------
Q03GL9      ---KLRAPMSDDD--DQSRMRRRV------------
F3Y921      STLTQEKNEYAPETMPTRRSRKRL------------
G4L593      RQNNDDNDQGNDGDDVGRRSRTRV------------
E6LD65      GELSQAATQKTESSTEPRRRRSRV------------
C9ALZ8      GPAQTQPKATNDKTAPSRRSRSRV------------
C9BUG6      GPAQTQPKATNDKTAPSRRSRSRV------------
Q3XYS7      GPAPTRPKATNDKTFPSRRSRSRV------------
C9B453      GSAPARPKATNDKTAPSRRSRSRV------------
D4RJF5      GPAPARPKATNDKTAPSRRSRSRV------------
C8ZXT8      PARPTLKKPTNEKTTESRRSRSRV------------
F0EKB8      PSAPFIKKPQGDKTAESRRSRSRV------------
C9A6V4      PSAPFIKKPQGDKSAESRRSRSRV------------
C9CHY7      PSAPFIKKPQGDKSAESRRSRTRV------------
D4JI68      KHGRGSHRKKRKKKSASA------------------
D6E329      KHGRGSHRKKRKKKSASA------------------
E6UHY5      KY----------------------------------
E9SAU2      KY----------------------------------
F7K0U2      SARKYTKRNGKK------------------------
O06029      GTQSGTKSSPPSDHEVNRSSKRNKR-----------
G8P3D6      DTQMGTKASSPSDHEVNRSSKRNKR-----------
A9QSJ3      GTQMGTKSSPPSDHEVNRSSKRNKR-----------
F9VC43      GTQSGTKSSSPSDHGVNRTSKRNKR-----------
G6FD41      GMQSGTKSSPPSEHEVNRSSKRNKR-----------
G9M881      GTQSGTKSSPPSDHKVNRSSKRNKR-----------
Q3ZK51      GTQSGTKSSPPSDHEVNRSSKRNKR-----------
Q83VG0      GTQSGTKSSPPSDHEVNRSSKRNKR-----------
C6LDI9      KTRKKKHQGASVCRLHLKN-----------------
G5F9H3      GKQKKSRSTGRGAKAPEKGAGTRQKSGADRKGRGEN
C0CZV8      SSKSRKKTQTPSGRSRKKKREEKVR-----------
G5GFW1      ---NRRKT----------------------------
F8KGP2      ------------ESRRQNNGNRRV------------
B3XL22      ------------TSRRQNNGNRRV------------
F8DRU3      ------------ESRRQNNGNRRV------------
C2EWM2      --------------SRSDDHHRRV------------
D0DSJ3      --------------DDRAAGHRRV------------
B2GF32      --------------DDRAAGHRRV------------
C0WW25      --------------DDQAAGHRRV------------
F0K0J8      -------TAEKRGSS-----RRRV------------
G6F8H0      -------TAEKRGSS-----RRRV------------
F0HVF2      -------TAEKRGSS-----RRRV------------
Q1G8E3      -------TAEKRGSS-----RRRV------------
D6S4X3      -------TKSPSSSR---IRSRRV------------
Q5FIC6      -------ANMTNRGQ---AKRRRV------------
E4SMV6      -------ASMTNRGQ---TKRRRV------------
F0TGY3      -------ASMTNRGQ---TKRRRV------------
F2M2M7      -------ASMTNRGQ---TKRRRV------------
A4ZGZ7      -------NNNKPAAKREQRKRRRV------------
C2EPK4      -------KPN----KRERLTRHRV------------
C7XKF2      -------NKNSNGPK---RRSRRV------------
E3R265      -------NKNSNGPK---RRSRRV------------
D0DJG9      -------NKNSNGPK---RRSRRV------------
D5GZJ9      -------KNNSNGPK---RRSRRV------------
A8YX90      -------NNNKPAAKREQRKRRRV------------
F0NWJ8      -------NNNKPAAKREQRKRRRV------------
C2JZS0      ADEPDSVGFEPEG--YPQRSRRRV------------
C1J9I2      TDSGNDVQDDLDGIDFPQRSRRRI------------
Q58Z11      KIIDSEAEPETTG--FPQRSRRRV------------
B1MZT2      MSDDGKAMHSRSRLSRLNKD----------------
C2KHF2      VKINQSSGAQRSRLSRLDRE----------------
Q03W94      IAKPENSKTPRSRLSRLDRD----------------
G2Z8Q4      ------------------------------------
D9ST43      ------------------------------------
H7F5T7      ------------------------------------
G9WIR0      ------------------------------------
D3LB11      ------------------------------------
A0NKF7      ------------------------------------
Q04DV7      ------------------------------------
F6BI63      ------------------------------------
G2MWC1      ------------------------------------
B0K4N2      ------------------------------------
C7ISF8      ------------------------------------
B0KAR6      ------------------------------------
E8UV30      ------------------------------------
C0GGR6      ------------------------------------
A4J8V1      ------------------------------------
C8VYQ7      ------------------------------------
C8W5K3      ------------------------------------
B1BNH4      ------------------------------------
B1V1Z3      ------------------------------------
B1R3V2      ------------------------------------
Q0SVR9      ------------------------------------
Q8XN47      ------------------------------------
G7M0Q2      ------------------------------------
G7M565      ------------------------------------
A6M2M0      ------------------------------------
G7M1R8      ------------------------------------
Q4JZ56      ------------------------------------
Q7X554      ------------------------------------
Q7X550      ------------------------------------
Q7X562      ------------------------------------
Q7X556      ------------------------------------
Q7X552      ------------------------------------
Q7X558      ------------------------------------
C5NWJ9      ------------------------------------
F3A498      ------------------------------------
Q9AHD3      ------------------------------------
Q4K2E2      ------------------------------------
Q4K2F8      ------------------------------------
Q4K046      ------------------------------------
Q4K0R8      ------------------------------------
Q4JYY0      ------------------------------------
Q4JZW8      ------------------------------------
I0J9C8      ------------------------------------
Q4K0M4      ------------------------------------
Q4JZS4      ------------------------------------
Q4JZK2      ------------------------------------
Q9AHA5      ------------------------------------
Q9X9A0      ------------------------------------
Q4JYK9      ------------------------------------
Q4K006      ------------------------------------
Q4JZG8      ------------------------------------
A6YIA7      ------------------------------------
E5F5C4      ------------------------------------
Q9AHB8      ------------------------------------
Q4JZL8      ------------------------------------
Q4K1B8      ------------------------------------
Q8VU32      ------------------------------------
D2ERX9      ------------------------------------
G6C7Z0      ------------------------------------
Q4K2A9      ------------------------------------
D6ZQI7      ------------------------------------
Q9ZFT9      ------------------------------------
Q4K255      ------------------------------------
F9HJP7      ------------------------------------
E8JWI4      ------------------------------------
A8AZR4      ------------------------------------
D0RXH3      ------------------------------------
Q83YR6      ------------------------------------
F1Z125      ------------------------------------
Q3K0S9      ------------------------------------
P0C0T8      ------------------------------------
Q67AY5      ------------------------------------
Q04662      ------------------------------------
Q8GP93      ------------------------------------
Q8GPF7      ------------------------------------
E3CP61      ------------------------------------
E8KUY7      ------------------------------------
C2LSE5      ------------------------------------
E9DM16      ------------------------------------
I0QIK5      ------------------------------------
Q7X560      ------------------------------------
Q8GMA6      ------------------------------------
Q55204      ------------------------------------
Q8GPC4      ------------------------------------
Q8GPA9      ------------------------------------
G6ERT2      ------------------------------------
O87930      ------------------------------------
Q8GP55      ------------------------------------
F8HDC4      ------------------------------------
F8LJ76      ------------------------------------
F8LXJ5      ------------------------------------
Q1WCR2      ------------------------------------
G3G7C0      ------------------------------------
G3G7J8      ------------------------------------
G8DU30      ------------------------------------
A4VTU2      ------------------------------------
D5AGQ4      ------------------------------------
Q9X4U6      ------------------------------------
G3G7G5      ------------------------------------
G7SG35      ------------------------------------
G8DU06      ------------------------------------
G8DUA9      ------------------------------------
G8DTY9      ------------------------------------
G3G7I7      ------------------------------------
G3G7J3      ------------------------------------
E0PD82      ------------------------------------
F5X651      ------------------------------------
G5JTD6      ------------------------------------
Q2KM75      ------------------------------------
G5KAJ3      ------------------------------------
B9DUJ5      ------------------------------------
G5KD12      ------------------------------------
E8JMT8      ------------------------------------
F5X0J8      ------------------------------------
H2A601      ------------------------------------
E7S8W2      ------------------------------------
F8DFF5      ------------------------------------
I1ZPH8      ------------------------------------
E3CBR9      ------------------------------------
E8K787      ------------------------------------
F9M365      ------------------------------------
A3CQY3      ------------------------------------
E8KLZ0      ------------------------------------
F0FHA9      ------------------------------------
F0FQQ4      ------------------------------------
F0I4H6      ------------------------------------
F0IAY2      ------------------------------------
F0IJI1      ------------------------------------
F0IS52      ------------------------------------
F2C9N1      ------------------------------------
F2CH54      ------------------------------------
F3UDW8      ------------------------------------
F3UNJ5      ------------------------------------
F3SM33      ------------------------------------
F9HC66      ------------------------------------
E1LQJ6      ------------------------------------
Q4JYU0      ------------------------------------
Q4JZY2      ------------------------------------
F9Q346      ------------------------------------
Q6L5R1      ------------------------------------
E9FEC6      ------------------------------------
E0Q2S9      ------------------------------------
F5VSH0      ------------------------------------
A5YTV6      ------------------------------------
Q6L5T1      ------------------------------------
E0PPH8      ------------------------------------
A5YTT8      ------------------------------------
E6KKR9      ------------------------------------
A1ILY0      ------------------------------------
F2QF91      ------------------------------------
Q4K0I3      ------------------------------------
Q8KWQ1      ------------------------------------
Q4K238      ------------------------------------
B1I966      ------------------------------------
G6J8A3      ------------------------------------
F9LZC3      ------------------------------------
F9P1W9      ------------------------------------
A5LJR9      ------------------------------------
Q9ZII7      ------------------------------------
Q4K1K7      ------------------------------------
E1LPE6      ------------------------------------
F9MJW6      ------------------------------------
Q4K0V3      ------------------------------------
Q54519      ------------------------------------
C1CBD0      ------------------------------------
Q7WVX1      ------------------------------------
Q4K0E2      ------------------------------------
Q9AH96      ------------------------------------
A5M4L2      ------------------------------------
B2ILP4      ------------------------------------
C1CCB8      ------------------------------------
P72511      ------------------------------------
Q4K1S8      ------------------------------------
P96474      ------------------------------------
Q4K196      ------------------------------------
Q4K0Z7      ------------------------------------
Q4JZ85      ------------------------------------
Q4JYH6      ------------------------------------
Q4JZ19      ------------------------------------
Q4K0A1      ------------------------------------
Q4K1M5      ------------------------------------
Q4K2Q8      ------------------------------------
Q4K1G0      ------------------------------------
Q4K0T6      ------------------------------------
Q4K0K3      ------------------------------------
Q4K0X6      ------------------------------------
E8KDN1      ------------------------------------
F9PEU3      ------------------------------------
E8K321      ------------------------------------
F9PZP6      ------------------------------------
D6R2T7      ------------------------------------
F3UUQ1      ------------------------------------
E6IZC3      ------------------------------------
G6A746      ------------------------------------
B1V0N8      ------------------------------------
B1BNK2      ------------------------------------
B1R3X7      ------------------------------------
Q8XN77      ------------------------------------
B1HR40      ------------------------------------
A7Z922      ------------------------------------
I2CAF3      ------------------------------------
I2HVL3      ------------------------------------
E0U2Z4      ------------------------------------
D4G1R3      ------------------------------------
G4EQZ6      ------------------------------------
P71050      ------------------------------------
G4P115      ------------------------------------
A8FHM0      ------------------------------------
C0EBA5      ------------------------------------
F8FCE3      ------------------------------------
I0BSG5      ------------------------------------
A8YPQ6      ------------------------------------
P95695      ------------------------------------
Q2G1K8      ------------------------------------
C5QNG5      ------------------------------------
Q4L9H8      ------------------------------------
Q2FUV1      ------------------------------------
P39850      ------------------------------------
D7UYE3      ------------------------------------
Q4A121      ------------------------------------
C9AAE4      ------------------------------------
H7F6C7      ------------------------------------
F0SX23      ------------------------------------
Q38VG4      ------------------------------------
F2I4B6      GQRKRV------------------------------
Q8RBS6      ------------------------------------
D9SR42      ------------------------------------
D9SVC8      ------------------------------------
E7RG09      ------------------------------------
D4G2E2      ------------------------------------
Q8EME7      AKKTV-------------------------------
D6Y035      ------------------------------------
Q5WBB3      ------------------------------------
Q9K6Q9      ------------------------------------
Q97EP7      ------------------------------------
Q97ER4      ------------------------------------
E4S7Y7      ------------------------------------
E4Q5T6      ------------------------------------
E4SDX3      ------------------------------------
G2FWX3      ------------------------------------
G7WJV2      ------------------------------------
G7W774      ------------------------------------
G2FM60      ------------------------------------
H5XZD5      ------------------------------------
I4DBG9      ------------------------------------
G2FWT7      ------------------------------------
H5XZG8      ------------------------------------
G0V448      ------------------------------------
A0PZ01      ------------------------------------
B1B737      ------------------------------------
G5IFS2      ------------------------------------
B8D0N1      ------------------------------------
D9QTC7      ------------------------------------
G0VNK5      ------------------------------------
D2RIR1      ------------------------------------
I0GRR3      ------------------------------------
                                                

© 1998-2020Legal notice