BYKdb

Dataset for cluster orphancd of phylum fibrobacteres

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1J5EXB2      MNDTIHFSVAFLMAKQGQEFVL--------------------------------------
A0A3C0PF94      MNSMQSRNVLPVPKVMGMDYYIPHYLNLIWRWKWYICIVTPVIFVAWAIGVIKFGNTRPA
                **.    .*  :    * :: :                                      

A0A1J5EXB2      ----------------------------SQVDPLIAFRNLSEQLS---------------
A0A3C0PF94      LESSAVLQFMQSSGTTGPIDNETMLVQKSSCDAFIHSRSFIENISDKLSLRLSVKKYFRS
                                            *. *.:*  *.: *::*               

A0A1J5EXB2      --------------------VSEKG-----------------------------------
A0A3C0PF94      EIFDSISIDKDAAVGKYDFVVGNDGYSIYYSNKKLRINKKIVISGRLIELSSFFLPSILL
                                    *.:.*                                   

A0A1J5EXB2      ----------------------------------------KKTGILQMTYANRYPDRAAS
A0A3C0PF94      KLTNDFVSEPHSFTFFISTQRQAVDNVLKYLSTKFPGSGERDNSIMAITLQEHDYPLGTQ
                                                        ....*: :*  :.    .:.

A0A1J5EXB2      ILNTIANAYVRQNVAMLSAEAEKTLLFLEGQLPALRMKLDSSEKALTEYRHSVGTVDLTG
A0A3C0PF94      VVNEIADEFVQHNSEQRLNTKNENVEVLEKQLQEARNNLAGADNALRQFREVNSNVGVTN
                ::* **: :*.:*        ::.: .** **   * :* .:::** ::*   ..*.:*.

A0A1J5EXB2      EARVVLEKQVDLQQQLLTL-----------------------------------------
A0A3C0PF94      SAASSVSELVTLENSVNSLKSSITEANVLQARCQIANSDDISDDKMTALNEAITYLASRQ
                .*   :.: * *::.: :*                                         

A0A1J5EXB2      --------------ARQKQEMTRLFKEDHPSVIAISEQEATLRKEMGK------------
A0A3C0PF94      SVAAPALQSDFNEASADKKRVDAEYAPQHPRVIENRKKIARIAANISKALSDAVAKMRAD
                              : :*: :   :  :** **   :: * :  ::.*            

A0A1J5EXB2      ----------VAISAKELPLTQQEVIKLQEDVNINNALYSSMLNNIQELRVVRAGEIGNV
A0A3C0PF94      AVGAVNRKDALTSENQRLPAQELRYSDLMRKRDNAEELFTNLLSRYNISKMSAASQSSFV
                          :: . : **  :    .*  . :  : *::.:*.. :  .:  *.: . *

A0A1J5EXB2      RIVDYASHEIFPIKPRR-----KLIFAGILLGSLLLGAGFIFLLRMTMRGVRSSSEIERD
A0A3C0PF94      TIMD---HAVVPNSPSRLQSMLRVLLIGLVI-ALVFGFGLPAGIDYLDKRARNEGDCRRF
                 *:*   * :.* .* *     .::: *::: :*::* *:   :    . .*...:  * 

A0A1J5EXB2      TGVSVYAKIPE----SEHDTGSRKKGSNVQTLMEADPDDFACEALRTLRTALDFSFLERG
A0A3C0PF94      SALPFLEGIPKKNDSEKNNVSKKEKIDDKLVAAGFEPDTFD-EMYRSLRTKILLHLHGEA
                :.:..   **:    .:::....:* .:  .    :** *  *  *:*** : : :   .

A0A1J5EXB2      QKVLVITGLLPSVGKSFVSENLSVLFAGMKKNVLLIDADLRRG----RISHRNKKGLTDV
A0A3C0PF94      HKMLVVTSLNAGEGKSLTASNLAIVMAQQKLRTLLIDGDMRRGVQHNSFVLEKKPGLSEI
                :*:**:*.* .. ***:.:.**::::*  * ..****.*:***     :   :* **:::

A0A1J5EXB2      LHGHASLDEV-----IEKKNNGGISVLGAGSIPTNPSELLASDMFANIIAKVRENYDLIV
A0A3C0PF94      ISSPDELTTMPVSSFIQKAHIPDLSLLSCGMPIPNPAECMNSSKFRDLTAMLAEWFDVIV
                : .  .*  :     *:* :  .:*:*..*   .**:* : *. * :: * : *.:*:**

A0A1J5EXB2      IDTPPILLVTDAQLVCKYADFALMIVRYGAHNMEAIKEGMQLIDRSGIHNK--AIVLNRC
A0A3C0PF94      LDTPPLRVAVDAAILPEAFSHYIIVVRAVKTNIVALEK--KIVDFPGLYQKVLGIVLNGA
                :****: :..** :: :  .. :::**    *: *:::  :::* .*:::*  .**** .

A0A1J5EXB2      QYEGGRYGYGYGYGYRYHGKYGYKPSVNV
A0A3C0PF94      PIDKKMHNYTYSY-YRH------------
                  :   :.* *.* **:            

© 1998-2020Legal notice