BYKdb

Dataset for cluster tadcd of phylum cyanobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

473 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K9SLA9          --------------------------------------------------------MNKL
A0A168TT23      -------------------MSNYGIHDGRHLKPIEDQNTALAQYDPYQSKANEDDDAIDL
A0A0M1JWX9      --------------------MQTAPNSQPSSFDQNGKQPQIVPLSYLAEVPDADEEELDL
A0A2T1M1V6      -----------------------------------------------------------M
A0A2G7GCS2      -----------------------------------------------------------M
K9XBH8          -----------------------------------------------------------M
A0A1Z4LJ30      -----------------------------------------------------------M
K9RI76          -----------------------------------------------------------M
A0A352AE27      ----------------------------------------------------------ML
A0A3B8JH60      -----------------------------------------------------------M
A0A3C0N766      -----------------------------------------------------------M
K9W9J7          -----------------------------------------------------------M
A0A139WSU3      -----------------------------------------------------------M
A0A433VN22      ------------------------------------------------------------
Q7NF11          ------------------------------------------------------------
A0A1Z4JCS8      -----------------------------------------------------------M
A0A6P0PI80      -----------------------------------------------------------M
A0A6P0WGT6      -----------------------------------------------------------M
F4XTX2          -----------------------------------------------------------M
Q7NJN6          -----------------------------------------------------------M
U5QCC3          ------------------------------------------------------------
A0A0S3TYD7      ----------------------------------------MKQPQNPSQTPASDAIELDL
A0A2T1DNG3      ------------------------------------------MTAAQPKLNLSAATDPGY
A0A3S0Y9N9      --------------------------------------------------------MEEY
A0A433UNK7      --------------------------------------------------------MEEY
A0A6P0ZKB8      --------------------------------------------------------MEEY
U5QL42          -------------------------------------------MVNPQASLGPPSDNFNL
A0A140K3H3      ------------------------------------MNNQLVNPNSLYLPTPETESAFSL
K9XUB8          ------------------------------------MNNQLVNSNTLYLPTPETESTFSL
A0A6H2NHD5      ----------MVFPKTSSPSPAQPSANGNGH------HHNGYLPAPPAPVVVEADDDFDL
A0A2P8W4F7      ------------MPFPPSSTPRETNGHSNGHGNGHGSGRPEFVPMMAPPSLVEKGDDVDL
A0A5Q4E0Z4      ------------MPFSSTPTSEETNGNGNGH------AKHSFVPVSAPSAIVDDSDDFDL
A0A2P8VVX1      -------------------------------------------MVSTSTLPTSTDQEFGY
A0A2P8WHY0      -------------------------------------------MTHAAYQPIPDEPEFGY
A0A2T1CMT9      --------------------------------------------MDQNNWETETQGDLGY
A0A7G8J1V5      ----------------MSNLISNQGEKPLHSNPPSNQSSPTDNGTE--------ESGIKL
A0A354B169      ------------------------------------------------MGAMGVAEEIDL
Q0IDT5          ----------------MSNLIARPGQSPDLVPQTIQDVQVRDLGLNLSNLKAEASDEIDL
A0A7G8FZD9      ----------------MTNLSAQP------NPQAVEGLLQVD-----------GSDEIDL
G4FMX5          ----------------MSNLSAQP------NPQAVDGLLQVD-----------GSDEIDL
A0A7G8FAU7      ----------------MSNLIPRAGHSPNLAVQGIQTVQVRDLGTSVAAGPAAADDEIDL
A3ZA21          ----------------MSNLIPRAGHSPNLAVQGIQTVQVRDLGTSVAAGPAAADDEIDL
A0A076HBF2      ----------------MSNLVAAPGQSPDFDARNVQTVRVHEVGTN-EP-IG-TEDEIDL
A0A7G8FP50      ----------------MSNLVAAPGQSPDFEPRTIEAVRVRDLGSA-TV-DNLSDDDIDW
A0A7G8E8K7      ----------------MSNLVAAPGQSPDFDPRNVQTVHVREVGTN-EA-MG-ADDEIDL
A0A7G8GAH0      ----------------MSNLVAAPGQSPDFDSRNIETVRVREIGTN-EP-MG-ADDEIDL
A0A7G8GNR2      ----------------MSNLVAAPGQSPDFDPRKDQTVRVRNHGAT-EI-VK-TDDEIDL
A0A7G8ICD3      ----------------MSNLVAAPGQSPDFDPRNVQTVRVREIDTN-QP-IG-ADDEIDL
A0A2D6FCW3      ----------------MSNLIVNPXQTPDFNRHQAQTVNVQDLGRX-VVQAADNNDEIDX
A0A7G7KJ95      ----------------MSKLVASPGQSPDFNPQGIQTVQVRDLGQV-PPGMGSSDDEIDL
A0A7G8EAN3      ----------------MSNLVASPGQSPDFNPQGIQTVQVRDLGQV-PPGVSSGDDEINL
A0A563VQJ3      ----------------------------MTNNGFNYYPPKELESNYYNLPKSRENLDLDL
A0A1D8TX52      --------------------------------------------MKELDLNAAAETDAGY
A0A1D9G4T2      --------------------------------------------MKELDLNAAGETDAGY
A0A6P0PR27      --------------------------------------------MKELDLNAAGETDAGY
A0A6P0WER7      --------------------------------------------MKELDLNAAGETDAGY
F4XP71          --------------------------------------------MKELDLNAAGETDAGY
A0A6L9YR57      --------------------------------------------MKELDLNAAAETDAGY
A0A6P0KZ31      --------------------------------------------MKELDLNAAGETDAGY
A0A6P0LPB8      --------------------------------------------MKELDLNAAGETDAGY
A0A6P0SEV1      --------------------------------------------MKELDLNGAAETDAGY
A0A6B3N2I8      --------------------------------------------MKELDLNGAAETDAGY
A0A6M0B891      --------------------------------------------MKELDLNGAAETDAGY
A0A6P0IJQ1      --------------------------------------------MKELDLNGAAETDAGY
A0A6P0J8J8      --------------------------------------------MKELDLNGAAETDAGY
A0A6P0ZSH6      --------------------------------------------MKELDLNGAAETDAGY
A0A1U7N5X9      --------------------------------------------MKELDLNAAAETDAGY
A0A6L9Z1V0      --------------------------------------------MKELDLNGAAETDAGY
A0A6P0LC12      --------------------------------------------MKELDLNAAAETDAGY
A0A6P0MVJ3      --------------------------------------------MKELDLNAAAETDAGY
A0A2W6ZAV2      ------------MPDPLPSPDELLPPGTLVTLGASSGQVVLIPQEAETQPAPGGSEELKL
K9W742          --------------------------------------------MTQSNLNTVPDTDPGY
A0A3D1PBA3      ----------------------------------------MARVNEHNLPI-NTETDGGY
K9XPB0          ----------------------------------------MKQIEWE-----ENSSDLGY
A0A350Y7Z1      -------------------------------------------MIQSNLP--GDETNLGY
A0A352X2A7      -------------------------------------------MTQSNLP--ETESDFGY
A0A0D8ZYV0      ----------------------------------------MVRGIENN-PNVANETEPGY
A0A2T1FP73      ----------------------------------------MVRVNESNMPMTVEESDGGY
A0A433VMS2      ----------------------------------------MVRVNESNMPMTVEESDGGY
K9TYA7          ----------------------------------------MVRVNESNMPMTVEESDGGY
A0A2P8QUE1      ----------------------------------------MVRVNESNMPMTVEESDGGY
K9SA61          ---------------------------MALVPHTPGNFAPHRSPVTDPRWTDSGDSDGGY
A0A2G7GMH8      --------------------------------------------MNKDNFAMATEQEAGY
A0A6N8FU92      --------------------------------------------MNKENLAMNGEQETGY
A0A2T1DWE8      -----------------------------------------MVVVTVGNLANTVETDPGY
A0A1U7I8L3      --------------------------------------MVNVNTNNLNPAA---ETEAGY
A0A2T1DJL8      MPSVASQKASFSSRSIASFRRFVWHRSDELSFAKGVPIVAESHLNLIAAA----DPDPGY
A0A1Z4J9W0      --------------------------------------MAQSNITLFNASPHAQEPDPGY
A0A0N7Z5K9      --------------------------------------MAQGNITLFNPSPPAQEPDPGY
A0A0S3TXC5      ------------------------------------MIVAQGNITLFNPSSPMQEPDPGY
B8HNB0          -------------------------------MVQFNAERWLQNQQLLNELYFSASDKVEL
A0A563VS48      --------------------------------------------MNTIEQNVHIDEYLDF
A0A318BJ18      ---------------------------MSFISSNLGSPGAIGSAQSAIASPTIADGPSVL
A0A3B8Y8H9      ----------------------MTDLPNNSLAVNSPQPQVNQTIQSQLREQNEEDISLSV
A0A2W1JVB9      ----------------------------------------------MPAEYQLEEEVIDL
A0A3M1SVZ4      -------------------------------------------------MESGGESTIQL
A0A6H1U102      ----------------------------------------MPDRFAGLDRMTLPDDNNDL
A0A7C3ZEJ3      ----------------------------------------------------MPERGTDL
A0A563VLD6      --------------------------------------MNNPINNPEFVQLPSQETGFSL
A0A2P8W9H0      -----------------------------------MASELQLSSKGALHPEGDQEGGLRL
A0A6I5P386      ------------------------------------MIAKRLPTVGIPLDERDREGGLRI
A0A654SFI6      ---------------------------------MQPSIADRGNYPDTPADYREDGLHIDL
A0A318BG22      --------------------MIRSLTNDTRPGPIDDLQSRRGAMRPAAEVEQWDGGSISL
K9SSQ0          ---------------------------------------------------MKVYSSKVF
A0A2W1JIN9      -------------------------------------------------------MDQSL
A0A318AJV1      ----------------------------------MLKQTSDHRVSHLAPPQDQARLGDAV
A0A6P0IC70      -------------------------------------------------------METSL
A0A6B3MUB5      -------------------------------------------------------METSL
A0A6M0B7N4      -------------------------------------------------------METSL
A0A6P0J9W3      -------------------------------------------------------METSL
A0A6P0ZWE1      -------------------------------------------------------METSL
A0A1U7N2U4      -------------------------------------------------------METSL
A0A1D9G1F2      -------------------------------------------------------MDTSL
A0A6P0PNZ7      -------------------------------------------------------MDTSL
F4XV38          -------------------------------------------------------MDTSL
A0A6P0W137      -------------------------------------------------------MDTSL
A0A6L9Y9E2      -------------------------------------------------------MDTSL
A0A6P0SGR0      -------------------------------------------------------MDTSL
A0A6M0BK48      -------------------------------------------------------MDTSL
A0A6L9YZL1      -------------------------------------------------------MDTSL
A0A6P0KYM4      -------------------------------------------------------MDTSL
A0A6P0LSD6      -------------------------------------------------------MDTSL
A0A6P0X384      -------------------------------------------------------MEKSF
A0A2P8QIL5      -------------------------------------------------------MEQKY
A0A2T1FLY5      -------------------------------------------------------MEQKY
A0A433W447      -------------------------------------------------------MEQKY
K9U1K8          -------------------------------------------------------MEQKY
K9UYB2          -------------------------------------------------------MEKSI
A0A218QN17      -------------------------------------------------------MEKGI
K9RKN2          -------------------------------------------------------MEKGI
A0A2I8ADV2      -------------------------------------------------------MGRGI
A0A1W5CKM3      -------------------------------------------------------MGKGI
A0A5Q0GMF5      -------------------------------------------------------MGKGI
Q3MEW0          -------------------------------------------------------MGKGI
A0A1Z4KIC7      -------------------------------------------------------MGKGI
Q8YSM5          -------------------------------------------------------MGKGI
A0A1Q4S1H4      -------------------------------------------------------MEKGV
A0A433VBU6      -------------------------------------------------------MEKGV
A0A1Q4RZJ6      -------------------------------------------------------MEKGF
A0A1Z4SNV3      -------------------------------------------------------MEKGF
A0A2H2XJQ1      -------------------------------------------------------MEKGF
A0A3S5K358      -------------------------------------------------------MEKGF
A0A0T7BPJ4      -------------------------------------------------------MAKGI
A0A0C1QS61      -------------------------------------------------------MEKSV
A0A139X3R8      -------------------------------------------------------MEKSV
A0A1Z4I7C5      -------------------------------------------------------MGKGI
A0A0C2MDK7      -------------------------------------------------------MEKGI
A0A1Y0RCK1      -------------------------------------------------------MEKRI
A0A1Z4PWZ0      -------------------------------------------------------MEKGI
A0A0C2QLT0      -------------------------------------------------------MEKGI
A0A1Z4J2K1      -------------------------------------------------------MEKGI
A0A3S0ZSX0      -------------------------------------------------------MEKGF
A0A2N6K4T3      -------------------------------------------------------MEKGL
A0A370CKT2      -------------------------------------------------------MEKGL
A0A0S3TL97      -------------------------------------------------------MEKGL
A0A2N6M8A0      -------------------------------------------------------MEKGL
A0A2N6M9E1      -------------------------------------------------------MEKGL
A0A2N6KJI4      -------------------------------------------------------MEKGL
A0A2N6MZ77      -------------------------------------------------------MEKGL
A0A2N6KT20      -------------------------------------------------------MEKGL
G6FSN3          -------------------------------------------------------MEKGL
A0A4D9CI02      -------------------------------------------------------MEKGL
A0A328I8B9      ------------------------------------------------------------
A0A4Q9J4Z7      -------------------------------------------------------MEKGL
A0A0M0SU69      -------------------------------------------------------MEKGL
A0A1Z4TIZ8      -------------------------------------------------------MEKGL
A0A2T1E9V8      ---------------------------------------------------MEAPENIQF
A0A1Z4LN32      ------------------------------------------------MENQNLSEEIDV
A0A2I8A9F5      ------------------------------------------------METQNSAEDIDI
A0A218Q6R8      ------------------------------------------------METKNYPDEIDI
A0A218QGE0      ------------------------------------------------MDTKNYPEEIDV
A0A3M2GQQ6      -----------------------------------------MQNAIAINPIQDYKNDTDF
A0A6H1U2X0      -----------------------------------------MQNAIAINPIQDYKNDTDF
K1XF69          ------------------------------------------MVMDFSNIEHRESIDLDL
B5W297          --------------------------------------------MDFSNIEHRESIDLDL
A0A6H2AL05      ------------------------------------------MVMDFSNIEHRESIDLDL
H1W7M8          ------------------------------------------MVMDFSNIEHRESIDLDL
A0A5Q4H6A5      ------------------------------------------MVMDFSNIEHRESIDLDL
D5A466          --------------------------------------------MDFSNIEHRESIDLDL
U5QJM6          ------------------------------------------------------------
A0A1Z4RPC6      --------------------------------------MTNLQTTNSLSSNHREELDINI
A0A2T1CMZ0      --------------------------------------MTNLQRNNVYNPNRRAEFDINI
L8M4F7          ---------------------------MFKIPNNNSAYSSQTEGEANASINSRDSIDLDI
A0A140K2P2      -----------------------------MTNNYPANNSNNYNYPSETLSASREAIDVNI
K9XWX4          -----------------------------MTNNYPANNSNNYNYPSEVSSASREAIDVNI
A0A140KB14      ----------------------MSNFTGMSNGQTPENLSLNNSY-----TASRESIDVNL
K9XX88          ----------------------MSNFTGMSNGQTPENLSLNNSY-----TASRENIDVNL
A0A563VSV6      ---------------------------MVNSLTNNGGSQPDNSYPNYGLEESRESTDIEI
L8LZE9          -------------------------MYPVNNSSSNG------SYTQGNYPESKEKFEVEI
A0A433NM31      ------------------------------------------------MQSNKQEEYIDL
A0A1Z4NDS1      ---------------------------------------------MDSVTSTTNVEEIDL
U9VXM0          ---------------------------------------------MASQENSVKEVEIDL
A0A6M0RI13      ---------------------------------------------MASQDNSVKEIEIDL
A0A6M0S1N5      ---------------------------------------------MASQDNSVKEIEIDL
K9F4D9          ---------------------------------------------MASQDNSVKEIEIDL
A0A6I5QPI5      --------------------------------------MVAQQANGETRTYTEYIEELDF
A0A1Z3HMQ0      ---------------------------------------------MDGKTYQDYVEEIDL
A0A433W533      -------------------------------------------MQERLIETSENL-DLDF
A0A2P8QWJ3      -------------------------------------------MQERLIETSENL-DLDF
A0A2T1FKP8      -------------------------------------------MQEQLIETSENL-DLDF
K9U6L7          -------------------------------------------MQEQLIETSENL-DLDF
A0A1E5QP61      ------------------------------------------------MDSTDYTEGIDF
U5DPF5          -------------------------------------------MEAIDRNLRQDDDFLDL
A0A6P0X488      ------------------------------------------------MESQQHIEDIDF
A0A6P0UVD5      ------------------------------------------------MESQQHIQDIDF
A0A6P0VDM0      ------------------------------------------------MESQQHIQDIDF
A0A6M0G142      ------------------------------------------------MESQQHVEDIDF
A0A6P0MR53      ------------------------------------------------MESQQHVEDIDF
A0A3M2GIL5      ------------------------------------------------MENQIYTEDIDF
A0A6H1TSJ9      ------------------------------------------------MENQIYTEDIDF
A0A3M1PML8      ----------------------------------------------MSLVSQDYSEEIDF
A0A6M8BE85      ----------------------------------------------MSLASQDYYEEIDF
A0A0T7BPZ0      ------------------------------------------------MSNPEHIEEIDL
A0A352X442      ------------------------------------------------MESTEYIEEIDF
A0A6B3NF44      ------------------------------------------------MEALEYSEEIDF
A0A6M0EPL4      ------------------------------------------------MEALEYSEEIDF
A0A6P0K6L6      ------------------------------------------------MEALEYSEEIDF
A0A6P0MRR9      ------------------------------------------------MESVGFSEELDF
A0A6P0UX57      ------------------------------------------------MESVGFSEELDF
A0A6P0X1X4      ------------------------------------------------MESVGFSEELDF
A0A0M0SHU3      ----------------------------------------------MKESEFKEVEEIDF
A0A1D2PBN3      ------------------------------------------------MESKPNFEEIDF
A0A0C2LVR7      ------------------------------------------------MESKPNFEEIDF
A0A1Z4PQB9      ------------------------------------------------MESKPNFEEIDF
A0A1Z4SFN6      ------------------------------------------------MESKQNLEEVDF
K9PGI8          ------------------------------------------------MESIPKFEEIDF
K9TLQ0          ------------MDIDGNSPPFFQQLNGPFPSGQTPLPSTILP-----PLNDDADA-LNL
K9QF04          ----------------------------------MTQNVENLTLFKPQALPKPQSDPWEL
K9W1T3          --------------------------------------------------------MDEF
K9SGJ5          -------------------------------------------MPEYSLNPGQPEESIDL
A0A6N2JS94      ----------------------------------------MTEYPKATYVGKYVDDSFKL
A0A6C2DSN4      ----------------------------------------MTAYPKATYVGKYVDDSFKL
L8MYT6          ----------------------------------------MTAYPKATYVGKYVDDSFKL
A0A352JGJ6      ----------------------------------------MTEYPKATYAGKYVDDSFKL
A0A1J5GLS2      ----------------------------------------MTEYPKANYVGKYVDDSFKL
A0A2W4W6M5      ----------------------------------------MSEYPKAISTGKYVDDSFKL
A0A2W7AN33      ----------------------------------------MPAYPKATYVGKYVDNSFKF
A0A256BLV2      ----------------------------------------MTEYPKATYVGKYVDDSFKL
A0A2W6ZXF3      ----------------------------------------MTEYPKANYVGRYVDDSFKL
A0A2Z5WX66      ----------------------------------------MTEYPKANYAGKYIDDSFKL
Q7NEU3          ----------------MTKQPFADPVDK--------------------PAQVVEESSFDW
A0A3C0N2P0      ----------------MGPDGDYQPLLPNGNGKQLSQLSTLNAA----EFSVLNEDKFDL
A0A6P0JR04      ----------------MVSNLNSQPPFSGGSGHSPLAKSGVSESLPPPNLAKSEEDTLNL
A0A6B3M6M6      ----------------MGSDANFQPLLPNSNTQVLLPT-SALSG----GISGIDEDQLDL
A0A6P0KD09      ----------------MGSDANFQPLLPNSNTQVLLPT-SVLSG----GISAIDEDKLDL
A0A6B3NIJ0      ----------------MGSDANFQPLLPNSNTQVLLPT-SVLSG----GISAIDEDKLDL
A0A6M0F053      ----------------MGSDANFQPLLPNSNTQVLLPT-SVLSG----GISAIDEDKLDL
A0A6P2ATU9      ------------MVSNLNPQPHLPPRPPGPIPPSSQNTGDPFVT----LQGNSDEDSFNF
A0A352XE00      ----------------MNLNGDGKVLSINGNAQQSLEVPGINSK----NVADIPNHQVDM
A0A6P0QC14      ----------------MGPDGDYQPMPPYGNGNQAPHLYSPYTT----GLSEFDEDKFDL
B4VS56          ----------------MGSNGEYQPLPPNRNGHLPSELSSLSLY----ELVETEDDKLDL
A0A352AAQ3      ----------------MALTGDYQPLLPTSNGKQLSELMPIYTN----GFSEIQEDKLDL
A0A350Y472      ----------------MGPKVDYQPLLVNANDKPSSVSPPIYPS----GFSLVEEEKLDL
A0A355DVB4      ----------------MGPKVDYQPLLVNANDKPSSVSPPIYPS----GFSLVEEEKLDL
A0A1Z4RMB9      ------------------------MLSNNSNEQNTNSAYPSIA-----PKRDSLD--VNF
A0A318B4H2      --------------MNTNLTYEEAPFDPSAASVVTPVAVDKPA-----GQRLDERAVSAL
B4WQE3          -------------------------------MSSANPPVLRDI-----IQEPDQEGGLRL
A0A2K3BR24      ------------------------------------------M-----PTTTDQEDYIDL
K9YXY1          ----------------------------MDHQEQLPASSVNPI-----PTTTDQEDYIDL
A0A1Q4RTR1      ------------------------------------------M-----SALNTENDSINF
A0A1Z4SQV2      ------------------------------------------------MQVNAENDSINF
A0A2H2XGN1      ------------------------------------------------MQVNAENDSINF
A0A433UXH8      ------------------------------------------------MAVNTENDSINF
A0A0V7ZFJ4      ------------------------------------MTHNSFD-----FNQEDDD-FIDL
A0A0V7ZNJ9      -------------------------------------MTSSPQ-----VEREDTD-YIDL
A0A367RIS1      -----------------------------------------MP-----SHQDDQD-LINF
A0A235IXQ2      -----------------------------------------ML-----SDQNNQD-LINF
A0A1W5CNX3      -----------------------------------------MP-----SHQDDQD-LINF
A0A5Q0GJJ5      -----------------------------------------MP-----SHQDDQD-LINF
Q3MEB7          -----------------------------------------MP-----SHQDDQD-LINF
A0A1Z4KHN9      -----------------------------------------MP-----SQQDDQD-LINF
Q8YT70          -----------------------------------------MP-----SQQDDQD-LINF
A0A166IWU6      -----------------------------------------MP-----SYQEDQD-EIDL
A0A2S0Q8C0      -----------------------------------------MP-----SYQEDQD-EIDL
W6FSX4          -----------------------------------------MP-----SYQEDQD-EIDL
A0A218Q4C1      -----------------------------------------MP-----SYQEDQD-EINL
A0A6P1ZT04      -----------------------------------------MP-----SYQEEQD-EINL
A0A5P8VSD1      -----------------------------------------MP-----SHQDEQD-LINF
A0A1S1ZVW2      -----------------------------------------MP-----INQETTD-VIDL
A0A0R0M9H9      -----------------------------------------MA-----INQEETD-VIDL
A0A7H0F4U6      -----------------------------------------MP-----INQEETD-VIDL
A0A1B7WX82      -----------------------------------------MS-----INQEDQDSSIDI
A0A1B7WTD1      -----------------------------------------MS-----INQEDQD-SIDI
A0A480ABC0      -----------------------------------------MS-----INQEDQD-SIDI
A0A1Z4LRU5      -------------------------------------MTNEMQ-----VNQEEQD-YIDL
A0A1Z4JVB4      -----------------------------------------MP-----TKQEDRD-SIDF
K9PIA4          -----------------------------------------MP-----TKQEDRD-TIDL
A0A1Z4HVE1      -----------------------------------------MP-----TKQEERE-VIDV
A0A252ECZ1      -----------------------------------------MP-----TKRDDRD-LIDF
A0A1Z4G5Y1      -----------------------------------------MP-----TKRDDRD-LIDF
A0A252DNA2      -----------------------------------------MP-----TKRDDRD-LIDF
A0A252E1Q4      -----------------------------------------MP-----TKRDDRD-LIDF
A0A6G9SK36      -----------------------------------------MP-----TKQEERD-VIDV
A0A1Z4M597      -----------------------------------------MP-----TKQEERE-VIDV
A0A1Z4MWT1      -----------------------------------------MP-----TKQEERE-VIDV
A0A1Z4TX53      -----------------------------------------MP-----TKQEERE-VIDV
A0A2A2TNQ5      -----------------------------------------MP-----SHEEDTDY-INL
A0A3S1C4K5      -----------------------------------------MP-----SNQEDQNE-VDF
A0A1X4G3D5      --------------------------------------MPINQ-----VNQEESDV-IDL
D4TNI2          --------------------------------------MPINQ-----VNQEESDV-IDL
A0A1Z4H6Z8      ------------MNVIGAIILFVGTEGSDSPNYIWYFGTLFMP-----TKQDDRDL-IDF
A0A1Z4NPM1      -----------------------------------------MA-----SEYEEQDY-IDI
A0A3F3KPR9      ------------------------MLIFCVMVEPVIATGVYMP-----INKKETDV-IDL
D4TGN7          ------------------------MLIFCVMVEPVIATGVYMP-----INKKETDV-IDL
A0A1Z4UZW9      -----------------------------------------MS-----INQEDQDSSIDI
A0A0K2M5H0      -----------------------------------------MS-----INQEDQDSPIDI
A0A1B7VSH4      -----------------------------------------MS-----INQETQDSSVDI
A0A1B7W126      -----------------------------------------MS-----INQETQDSSVDI
A0A3D4C6Q6      -----------------------------------------MS-----INQETQDSSVDI
A0A1B7UVJ4      -----------------------------------------MS-----INQEDQDSSIDI
A0A1B7UTR1      -----------------------------------------MS-----INQEDQDSSLDI
K7W0A4          -----------------------------------------MS-----INQEDQDSSFDI
A0A5C0DRW9      -----------------------------------------MS-----INQEDQDSSFDI
A0A6H2C088      -----------------------------------------MS-----INQEDQDSSLDI
A0A1U7HGH0      ------------------------------------------M-----EVTE-----LDL
K9XJD3          ------------------------------------------M-----EVTE-----LDL
K9SX01          ------------------------------------------------MNQSPAEDKNPL
A0A4P7ZT55      -------------------------------------------------MPAVPDGEINL
A0A1E5QIR9      ------------------------------------------------MTHLEDSDAIDL
A0A6P1A9A0      ---------------MISNRNSQSISPNWNGKQLPPQLPPTIS-----GLAKEEEESFNP
A0A1Z4IBC7      ----------------------------------------MTM-----ESLRSIEE-VDI
A0A1W5CPC7      ----------------------------------------MTM-----DSLQGFEE-VDI
A0A5Q0GKD1      ----------------------------------------MTM-----DSLQGFEE-VDI
Q3MDC6          ----------------------------------------MTM-----DSLQGFEE-VDI
A0A1Z4KM73      ----------------------------------------MTM-----DSLQGFEE-VDI
Q8YNX7          ----------------------------------------MTM-----DSLQGFEE-VDI
A0A367R4K6      ----------------------------------------MTM-----ESLPNVEE-VNI
A0A1E2WSV8      ----------------------------------------MTM-----ESLPNFEE-VNI
A0A7D7L9Y1      ----------------------------------------MTM-----ESLPNFEE-VNI
A0A2R5FRT9      ----------------------------------------MTM-----ESLPHVEE-VNI
A0A2K8T1B6      ----------------------------------------MTM-----ESLPQFEE-VNI
A0A235I9I0      ----------------------------------------MTM-----ESLPNFEE-VNI
A0A2D0HQT8      ----------------------------------------MTM-----ESLPNFEE-VNI
A0A2L2NU95      ----------------------------------------MTM-----ESLPSFEE-VNI
A0A367S084      ----------------------------------------MTM-----ESLPNFEE-VNI
A0A1Z4SMD6      ------------------------------------------------MNQGFI-EEIDV
A0A2H2Y096      ------------------------------------------------MNQGFI-EEIDV
K9S8M8          ------------------------------------------M-----EFQHYP-EEIDF
A0A1Z4NFV0      ------------------------------------------M-----ENPSYL-EEIDV
A0A3M9ZEU1      ------------------------------------------M-----HPKDHL-EEVDL
A0A1Z4JK72      -------------------------------------MTSMKM-----ETKQYS-EDFDL
A0A0N7Z489      -------------------------------------MTSMNI-----ETKRYS-EDFDL
A0A0S3TXS2      -------------------------------------MTSMNI-----ETKRYS-EDFDL
A0A2A2TPF8      ------------------------------------------M-----EKQSNS-DDLDL
A0A1Z4R0P8      ------------------------------------------M-----EKQSYP-DELDL
A0A0T7BUI3      ------------------------------------------M-----EKQKAL-EELDI
A0A1Z4LP32      ------------------------------------------M-----QNKKNN-QEVDI
K9REP9          ------------------------------------------M-----KNKNNA-QEIDI
A0A1Z4SIJ3      ------------------------------------------M-----ENEGYPLQEAEI
A0A2H2XPG4      ------------------------------------------M-----ENEGYPLQEAEI
K9V3C7          ---------------------------------MLINQEKPDM-----KPQHYT-EEIDL
A0A1Z4T6Y7      -----------------------------------------ME-----QQNNRS-EDIDI
A0A2H2Y561      -----------------------------------------ME-----QQNNRS-EDIDI
A0A1Q4S362      -----------------------------------------ME-----QQHNRS-EDIDI
A0A3S1CIN8      -----------------------------------------ME-----QQHNRS-EDIDI
A0A2A2TC28      ------------------------------------------M-----ETKGYL-EEIDI
A0A0C1NCB0      -----------------------------------------ME-----ETKGHQ-EEIDI
A0A2N6K7Q9      ------------------------------------------M-----ETNSYT-QEAEI
A0A2N6MXH6      ------------------------------------------M-----ETNSYT-QATEI
A0A2N6M5A8      ------------------------------------------M-----ENNSYT-QATEI
A0A2N6LL61      ------------------------------------------M-----ETNSYT-QATEI
A0A0S3TP66      ------------------------------------------M-----ETNSYT-QATEI
G6FP91          ------------------------------------------M-----ENNSYT-QATEI
A0A1U7GYR5      ------------------------------------------M-----ETNSYT-QATEI
A0A2N6KY52      ------------------------------------------M-----ETNSYT-QATEI
A0A2N6KMP5      ------------------------------------------M-----ETNSYT-QATEI
A0A2N6MA45      ------------------------------------------M-----ETNSYT-QATEI
A0A4Q9J9V9      ------------------------------------------M-----ETNSYT-QETEI
A0A328IGA1      ------------------------------------------M-----ETNSYT-QETEI
A0A4D9CE41      ------------------------------------------M-----ETNSYT-QETEI
A0A0M0SFT2      ------------------------------------------M-----ETNNYT-QETEI
A0A1Z4TLC8      ------------------------------------------M-----ETNSYT-QETEI
A0A0C2LFH0      ------------------------------------------M-----ETRGYQ-EEVEI
A0A1Z4IYV4      ------------------------------------------M-----ETKGYQ-EEVDI
A0A1Z4Q0T6      ------------------------------------------M-----ETKGYQ-EEIDI
A0A0C2PT44      ------------------------------------------M-----ETKGYQ-EEIDI
A0A1D2P6J4      ------------------------------------------M-----ETKGYQ-EEVDI
B4WP72          ------------------------------------------M-----RDKEYTEE-IDL
A0A2T1CIL7      ---------------------------------------MIPT-----IVPSTHEEQIDF
A0A433V7A0      ---------------------------------MKYPKHTTTI-----DSREPEE--IDF
A0A2T1FTR8      --------------------------------------------------------MDEI
K9UA41          --------------------------------------------------------MDEI
A0A0C2LBE2      ---------------------------------------MSAM-----EPVPNSEE-IDF
A0A433NN38      ---------------------------------------MDSI-----KHTHSLEE-IDF
A0A2N6K0T2      -----------------------------------------MK-----ESEFHVEE-IDF
A0A2N6ML72      -----------------------------------------MK-----ESEFHVEE-IDF
G6FQZ6          -----------------------------------------MK-----ESEFHVEE-IDF
A0A2N6MQX9      -----------------------------------------MK-----ESEFHVEE-IDF
A0A2N6KXT6      -----------------------------------------MK-----ESEFHVEE-IDF
A0A2N6KGB9      -----------------------------------------MK-----ESEFHVEE-IDF
A0A2N6L3Y5      -----------------------------------------MK-----ESEFHVEE-IDF
A0A0S3TIS7      -----------------------------------------MK-----ESEFHVEE-IDF
A0A1U7GW28      -----------------------------------------MK-----ESEFHVEE-IDF
A0A2N6LW63      -----------------------------------------MK-----ESEFHVEE-IDF
A0A328IH74      -----------------------------------------MK-----ESEFKVEE-IDF
A0A4D9CIB0      -----------------------------------------MK-----ESEFKVEE-IDF
A0A1Z4TQ63      -----------------------------------------MK-----ESEYQLEE-IDV
A0A4Q9J8G2      -----------------------------------------MK-----ESEYQLEE-IDV
A0A350Y0P6      ------------------------------------------M-----ESKQYVED-IDF
A0A352X940      ------------------------------------------M-----ESKQYVED-IDF
B8HTN4          ------------------------------------------M-----QALEDDR--IDL
A0A6P1AFJ5      -----------------MVASGNPAPLIPNFSNYQPLPQYQPL-----TWQGNTEESFDL
B0CAX4          -----------------------------------------MP-----MSNEYSHESIDV
A0A1Z4RN12      ------------------------------------------M-----DSNLHLEEYIDF
A0A2T1CMF9      ------------------------------------------M-----DSNLPIGEHIDF
Q7NDC5          ---------------------------------------------------------MGL
U5QGK3          ---------------------------------------------------------MGL
A0A2W4UY24      ------------------------------------------------MPQKELE--IDF
A0A0D8ZUV2      --------------------------------------------------MEFID--ADI
A0A433VDI0      -----------------------------------MEPTKPIV-----EYSESIN--IDF
A0A3D1PG43      ------------------------------------------M-----ESREAID--INL
A0A2P8QQ72      --------------------------------------MESRV-----ESREAVD--INL
K9TZQ7          --------------------------------------MESRV-----ESREAVD--INL
A0A6N8G584      ------------------------------------------M-----ESNETID--IDL
A0A2G7GPR0      ------------------------------------------M-----ESNETID--IDL
K9XH68          ------------------------------------------M-----ESNETID--IDP
A0A1U7HW70      ------------------------------------------M-----QSNDTID--IDL
A0A2S6VEJ8      ------------------------------------------M-----ESNETID--IDL
A0A140KBA0      ------------------------------------------M-----ESNLYIDEYLDF
K9XSG1          ------------------------------------------M-----ESNLYTDEYLNF
A0A2T1GMT4      ------------------------------------------M-----ESQESID--LNL
K9UI51          ------------------------------------------M-----ESQESID--LNL
A0A1Z4QL41      ------------------------------------------M-----ESREAVD--LDF
A0A2T1FXY4      ------------------------------------------M-----ESRESID--LDL
K9TYI2          ------------------------------------------M-----ESRESID--LNL
A0A252D4T4      ------------------------------------------M-----ESRESID--FDL
A0A252DJH5      ------------------------------------------M-----ESRESID--FDL
A0A252EB80      ------------------------------------------M-----ESRESID--FDL
A0A6G9SKZ9      ------------------------------------------M-----ESRESID--FDF
A0A1Z4HPW5      ------------------------------------------M-----ESRESID--FDF
A0A1Z4MSN1      ------------------------------------------M-----ESRESID--FDL
A0A1Z4U1C2      ------------------------------------------M-----ESRESID--FDL
A0A0D6KV51      ------------------------------------------------------------
A0A1Z4MKF8      ------------------------------------------M-----ESRESID--FDL
A0A2C6WC43      ------------------------------------------M-----ESRETLD--LDL
A0A1Z4L5A1      ------------------------------------------M-----ESRETID--LDL
A0A367QD86      ------------------------------------------M-----ESRETID--LDL
A0A2K8SM78      ------------------------------------------------------------
A0A2R5FPC0      ------------------------------------------M-----ESRESID--LDL
A0A5P8W5T6      ------------------------------------------M-----ESRESID--LDL
A0A7D7LDT7      ------------------------------------------M-----ESRESID--LDL
A0A235IZ96      ------------------------------------------M-----ESRESID--LDL
A0A2L2NGP0      ------------------------------------------M-----ESRESID--LDL
K9QM62          -------------------------------MKAKTLEVDSTI-----KSREAID--LDF
A0A1Z4FWI3      ------------------------------------------M-----ESRESID--LDF
A0A1Z4JYE7      ------------------------------------------M-----ESRESID--LDL
A0A0F5YE28      ------------------------------------------M-----EDRESID--LDI
U7QEH7          ------------------------------------------M-----EDRESID--LDI
A0A3S1ATK5      -------------------------------------MSKTPM-----ESREDID--LDL
A0A2Z6CPH0      -------------------------------------MAKNIM-----ESRESLD--LDF
A0A1Z4GT50      ------------------------------------------M-----ESRESID--LDL
A0A1Z4GIX0      -------------------------------------MSKNSM-----ESRETID--LDI
A0A2H6LC24      -------------------------------------MSKNSM-----ESRETID--LDI
B2J6N5          -------------------------------------MSAKST-----ESRESID--LDL
A0A367RMI4      -------------------------------------MSEKSM-----ESRESID--LDL
A0A235HUM0      -------------------------------------MSEKSM-----ESRESID--LDL
A0A2L2NW47      -------------------------------------MSEKSM-----ESRESID--LDL
A0A1E2WUR1      -------------------------------------MSEKSM-----ESRESID--LDL
A0A235IKU3      -------------------------------------MSEKSM-----ESRESID--LDL
A0A1U7MYU6      ------------------------------------------M-----ESRSSID--LDI
A0A1D8TNX9      ------------------------------------------M-----ESRSSID--LDI
A0A6P0L6C2      ------------------------------------------M-----ESRSSID--LDL
A0A6P0MVH0      ------------------------------------------M-----ESRSSID--LDI
A0A6P0KJV0      ------------------------------------------M-----ESRSSID--LDL
A0A6L9ZJG4      ------------------------------------------M-----ESRSSID--IDI
F4XKF3          --------------MAGLVANSHQYQKLFYCAIYLGGAPEELM-----ESRSSID--LDL
A0A1D9FX10      ------------------------------------------M-----ESRSSID--LDL
A0A6P0Q0T0      ------------------------------------------M-----ESRSSID--LDL
A0A6P0W5I0      ------------------------------------------M-----ESRSSID--LDL
A0A3C0NJ41      ------------------------------------------M-----ESRESLD--LDF
A0A352AG88      ------------------------------------------M-----DSAESLD--LDL
A0A350Y374      ------------------------------------------M-----QSTDSPD--LDF
A0A355DPX0      ------------------------------------------M-----QSTDSPD--LDF
                                                                            

K9SLA9          NRGWV------ALRQH---KFPALVAFGIIFGGAALVTV--RI----Q---PIYEAKGQV
A0A168TT23      LEIWR------TILKRKWVVVSILAVFIATAALSSWLTI------------PVYRATAVV
A0A0M1JWX9      GQLFA------VIRRR---AFVILGVAIAVTGAVWVWTD--NQ----T---PQYEGKFQL
A0A2T1M1V6      NHALS------VVRRH---WPPLLALNLLLIAATVYVIT--NIEKFVS---PTWKANAQL
A0A2G7GCS2      NHIVN------IIRRH---WMPLLLLNGVILAGTLYAVI--YTKTNVA---PVWKASAKL
K9XBH8          NHIVN------IIRRH---WMPLLLLNGVVLAATLYAVI--YSKTSVP---PVWKANAEL
A0A1Z4LJ30      NRIAK------IAIRH---WKLLLAWNILILGITAINIK--VA----P---RVWSSQAQL
K9RI76          SRIAT------IAIRH---WKLLLAWNILLIGITAINIK--LT----P---RVWEGKAQL
A0A352AE27      ARIAT------ITARH---WKFLLALNVLVLAAAASNYV--TS----P---KVWTAKAQL
A0A3B8JH60      GKIAA------IASRH---WKSLLVLNLLVLAATAGKLA--TS----P---KVWTANAQL
A0A3C0N766      GKIAA------IASRH---WKSLLVLNLLVLAATAGKLA--TS----P---KVWTANAQL
K9W9J7          GKVAA------IATRH---WKSLFILNLLVIAATAGKLA--TS----P---KVWTATAQL
A0A139WSU3      NKLVT------ISTKH---WKSLIAFNVLVVLATAVAVS--NA----K---PVWIAKTQL
A0A433VN22      ---MT------IAARH---WKSLLVLNALVVSATIAAYS--TS----K---PVWTTTAQL
Q7NF11          MHVIQ------VLKRH---WRPLLVLNGLVLAATIGVAC--YY----P---RTWTATTRI
A0A1Z4JCS8      KKIAL------IASRH---WKALLGLNAVVIFGTLGAML--TT----P---KVWTAQAQL
A0A6P0PI80      KKVVA------ILNRH---WILLLVFNSLVLAASFGAFS--LL----K---PFWIAKAQL
A0A6P0WGT6      KKVVA------ILNRH---WILLLVFNSLVLAASFGAFS--LL----K---PFWIAKAQL
F4XTX2          KKVVA------ILNRH---WILLLVFNSLVLAASFGAFS--LL----K---PFWIAKAQL
Q7NJN6          SSIVA------IGRRH---WRPLLALNTVLLAATVGIAV--FY----P---RTWTASAQL
U5QCC3          MSTLA------IARRH---LRPLLILNGAILTTAIGIAL--FF----P---KSWTATTQL
A0A0S3TYD7      RKTFM------MLTRY---WLPATLAFSLVTVPAAVFLM--TR----K---SSYQATGAV
A0A2T1DNG3      GQLFA------ILKRH---YLWVLAAGTVSVAIAFAYTL--KQ----E---STYISGMQF
A0A3S0Y9N9      LQYWL------IFKRR---WLPVSIVFFTVVALSIVKTL--LE----T---PIYQATAQL
A0A433UNK7      LRYWS------ILKRR---WLPTSIVFLSLLALSIVKTV--LE----T---PIYQAGGQL
A0A6P0ZKB8      LRYLS------IIKRR---WLPTSIVFLTLVGLSIVKTY--LE----T---PIYQAGGQL
U5QL42          LSIWR------TLRKR---KLLSLSVAVAVFGGVAAFTY--TR----P---YIYESETLI
A0A140K3H3      TELKQ------TLSRQ---WKPALLVASTVCAGIFLSTV--LQ----N---PKYQSQTLI
K9XUB8          TELKQ------TLSRQ---WKPALLVASTVCIGMFLSTV--LQ----T---PKYRSQTLL
A0A6H2NHD5      GHLVG------VLKRR---AITFLGVTLLSLGGLTLWHL--TR----P---AVYSGGFDL
A0A2P8W4F7      KRLLG------VFKRR---AGVFLGVAALSFGGLTLWHL--SQ----P---PAYSGSVNL
A0A5Q4E0Z4      GHLIG------VLKRR---VGVFVGVAALSFGGLTLWHL--SR----P---PVYSGTANL
A0A2P8VVX1      GQLFQ------ILLRR---WPWIIASLGVATAGAVFVSL--RQ----E---PIYRSNMQL
A0A2P8WHY0      GQLLG------ILLRR---WPWIAGTLVLSVAGAVLVFL--RE----D---PTYRSSMQL
A0A2T1CMT9      GELFS------KLWHR---RLWFIGAFTGVLAIAVPLAL--LK----P---AVYQSYMQI
A0A7G8J1V5      RNIYV------SLLRR---RKLVLTTAGIVLTLATVNLA--SE----RIFRPVYQGNFKL
A0A354B169      RELWL------ALRRR---RKLVTVTASTVLALTVMVTA--YQ----RIFTPVYLGSFSL
Q0IDT5          RELWR------ALKRR---KKIVGFTAAAVLVLSGVVTT--YQ----RLFMPVYEGSFAL
A0A7G8FZD9      RELWR------ALKRR---KKLIGVTAAGVIALTCVITA--YQ----RIFRPVYQGSFAL
G4FMX5          RDLWR------ALKRR---KKLVGVTAAGVISLTCVSTA--YQ----RIFRPVYQGSFAL
A0A7G8FAU7      RELWR------ALKRR---KKLVGVTAAAVVALAGMVTA--YQ----RIFRPVYQGSFAL
A3ZA21          RELWR------ALKRR---KKLVGVTAAAVVALAGMVTA--YQ----RIFRPVYQGSFAL
A0A076HBF2      RELWR------ALQRR---KKLVGVTAGSIIVLAALFTT--YQ----RLFRPVYEGSFSL
A0A7G8FP50      RELWR------ALLRR---KKLVTVVAGGVIVLAAVNTA--FQ----RITSPVYQGSFRL
A0A7G8E8K7      RELWR------ALQRR---KKLVAVTAGSVIVLAVLFTT--YQ----RLFRPVYQGSFSL
A0A7G8GAH0      RELWR------ALQRR---KKLVAVTTGSVIVLAALFTT--YQ----RLFRPVYQGSFSL
A0A7G8GNR2      RELWR------ALQRR---KKLVAVTAGSVIVLAALFTT--YQ----RLFRPVYQGSFSL
A0A7G8ICD3      RELWR------ALQRR---KKLVTVTAGSVIVLAALFTT--YQ----RLFRPVYQGSFSL
A0A2D6FCW3      RELWR------ALRRR---KNLVGVTAAGVLALSGLNTA--YQ----RIFRPVYQGSFAL
A0A7G7KJ95      REVWR------ALRRR---KKLVGVTAAAVIGLAGLVTV--YQ----RVFRPVYQGSFVL
A0A7G8EAN3      RELLR------ALRRR---KKLVGVTALVVFSISALITI--RE----RVINPTYVGSFAL
A0A563VQJ3      GQYLL------KLKRR---WKPAILVFLATLGGSVFLSL--FL----Q---NSYQAAGKL
A0A1D8TX52      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTI--KK----E---PNYISSLQL
A0A1D9G4T2      GQLLA------VLWRR---RLWIISVLLTSLPIAFYITL--KK----E---PNYISSLQL
A0A6P0PR27      GQLLA------VLWRR---RLWIISVLLTSLPIAFYITL--KK----E---PNYISSLQL
A0A6P0WER7      GQLLA------VLWRR---RLWIISVLLTSLPIAFYITL--KK----E---PNYISSLQL
F4XP71          GQLLA------VLWRR---RLWIISVLLTSLPIAFYITL--KK----E---PNYISSLQL
A0A6L9YR57      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTI--KK----E---PTYISSLQL
A0A6P0KZ31      GQLLA------VLWRR---RLWILSVLLTSLPIAFYITL--NK----E---PTYISSLQL
A0A6P0LPB8      GQLLA------VLWRR---RLWILSVLLTSLPIAFYITL--NK----E---PTYISSLQL
A0A6P0SEV1      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A6B3N2I8      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A6M0B891      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A6P0IJQ1      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A6P0J8J8      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A6P0ZSH6      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A1U7N5X9      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PNYISSLQL
A0A6L9Z1V0      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A6P0LC12      GQLLA------VLWRR---RLWILSILLTSLPIAFYVTI--KK----E---PTYISSLQL
A0A6P0MVJ3      GQLLA------VLWRR---RLWILSVLLTSLPIAFYITI--KK----E---PTYISSLQL
A0A2W6ZAV2      GNLLP------ILRRR---QRLLVAVFAATVAIGAAATL--FQ----RVVSPVYQGDFRL
K9W742          GQLFA------ILIRR---RLWLLGILCLALGIATFKAF--TT----K---STYVSSLQL
A0A3D1PBA3      GQLFS------VLMRR---RFWLLGVLGSVLTIATVFTL--IS----K---PTYQSTMQL
K9XPB0          GQLLG------ILWRR---RFWIGGVFLGVLAVAIPLAL--MK----Q---PLYMSQMQL
A0A350Y7Z1      GQLFS------ILLRR---RFWMLGVFCGVLAIAIPIAL--NK----E---PTYQSSMQL
A0A352X2A7      GQLFA------ILLRR---KFWLLGVFCSVLAIAIPIAL--KK----E---PTYQSSIQL
A0A0D8ZYV0      GQLFA------VLSRR---RYWLLGVLGGVLTIATALTL--TA----E---PTFQSTMQI
A0A2T1FP73      GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
A0A433VMS2      GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
K9TYA7          GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
A0A2P8QUE1      GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
K9SA61          GQIFA------VLARR---RLWLLGVFGSVVAAAAGLTF--LT----T---PVYQSSLQL
A0A2G7GMH8      GQLLS------VLMRR---RFLLLSVFFGILSMATVLTI--IT----K---PTYKSSMQL
A0A6N8FU92      GQLLL------VLMRR---RFLLLSVFLSVLSAATILTL--MT----K---PTYKSSMQL
A0A2T1DWE8      GQLVA------ALFRR---KLWLLGIFLTVLSAVTIYTL--LK----K---PIYQSSMQL
A0A1U7I8L3      GQLLA------ILLRR---RYWLLGIFSVVLAITAIVTI--TT----K---PTYKSSMQL
A0A2T1DJL8      GQLLS------VLMRR---RLWLIGGLGLSLIGAALFTL--FS----K---PTFRSSMQL
A0A1Z4J9W0      GQLFG------VLLRR---KLWFLGALAGTLALAAGVTA--VL----P---PTYRSTMQL
A0A0N7Z5K9      GQLFG------VLMRR---KIWFLGAVAGTIALAAAVTA--FM----P---PTYRSTMQM
A0A0S3TXC5      GQLFG------VLMRR---KIWFLGALAGTIALAAGVTA--FM----P---PTYRSTMQM
B8HNB0          LR---------TLKKR---WIPALATAVTVFAGCYIYSA--LQ----T---PLYRSEALI
A0A563VS48      QKYWL------VLKRR---WLPATLTLCGVLGISLGYAL--SQ----E---QIYEAEAKV
A0A318BJ18      RHYLR------IAMRW---RWVILGVTIACVLLGLVVTL--LM----T---PTYTATATV
A0A3B8Y8H9      SQIVP------WLRRR---FWLIGSISLAVSLSAVSYAF--TR----A---PVYEESFQI
A0A2W1JVB9      GKYWL------ILKRR---WLPATIIFLLMFSTATLAAF--LK----A---PIYQSQGTL
A0A3M1SVZ4      DRAFP------IVKRR---WLPASVVFAAIFTVFYIAAQ--KD----R---PVYIAEGEI
A0A6H1U102      SEVLR------ILRKR---AGSAAAIATAVFAGVGLSTA--TK----T---PEYQSETLI
A0A7C3ZEJ3      SDVGR------TLRKR---WPSAAAVATAVFAGVSFSTV--TQ----T---PDYQSETLI
A0A563VLD6      SELKQ------IIFRR---WKPALIVGTTVFAGIFIPTM--LQ----T---PKYQSETFI
A0A2P8W9H0      DRFVA------ALRRH---LLLIAGITTLTASAAVLKAI--TD----A---PTYQSSFDI
A0A6I5P386      DYLLS------SLKRH---FLLITGVTVLTTALAVTKAV--TD----E---PVYQAEFEL
A0A654SFI6      ARYW-------IEARALRFWIAAIIALALIAGLVVTL----LS----T---PLYRAGARI
A0A318BG22      QRYVA------TLTKH---RLLILGTTIAAALLALIVTM--LT----E---PRYVARTTF
K9SSQ0          SPLLSTFLVRRLVRKH---LVTVISTTALTLGGAAIYTF--NQ----P---FLYESKGSL
A0A2W1JIN9      SRLPL------VFSRH---RWSALAAFSAVMCGLCLYVV--FA----P---RLYTSKVRL
A0A318AJV1      AAAKR------MLRRR---WATMLGVSSVVFVVALSVVA--CL----P---PRYVAVARI
A0A6P0IC70      SSLVS------VLKRR---FWPALATFASVIGASIAYLV--YT----S---PVYEVKARL
A0A6B3MUB5      SSLVS------VLKRR---FWPALATFASVIGASIAYLV--YT----S---PVYEVKARL
A0A6M0B7N4      SSLVS------VLKRR---FWPALATFASVIGASIAYLV--YT----S---PVYEVKARL
A0A6P0J9W3      SSLVS------VLKRR---FWPALATFASVIGASIAYLV--YT----S---PVYEVKARL
A0A6P0ZWE1      SSLVS------VLKRR---FWPALATFASVIGASIAYLV--YT----S---PVYEVKARL
A0A1U7N2U4      SSLPL------ALRRR---LLAALATFTSVIGGGMAYLV--VT----P---PVYQVKARL
A0A1D9G1F2      SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6P0PNZ7      SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
F4XV38          SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6P0W137      SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6L9Y9E2      SSLPL------ALRRR---LLPALATFTSVIGGAIAYLV--VT----P---PVYQMKARL
A0A6P0SGR0      SSLPL------ALKRR---LLPALATFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6M0BK48      SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6L9YZL1      SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6P0KYM4      SSLPL------ALKRR---LLPALVTLTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6P0LSD6      SSLPL------ALKRR---LLPALVTLTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6P0X384      SSLPS------VLKRR---FLPALATFVSVIGASIVYVV--SS----S---PVYQVTGRL
A0A2P8QIL5      ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
A0A2T1FLY5      ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
A0A433W447      ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
K9U1K8          ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
K9UYB2          SSVFT------ILKRR---SFPALLMFAAVLGGAYAYIS--TA----P---KMYESAIRL
A0A218QN17      SSLLA------ILKRR---ALPALVTFTAVIGGAVAYLT--VT----P---RLYEASARL
K9RKN2          SSLLT------IVMRR---SLPALATFVAVMGGAFAYLS--IT----P---RVYETSARL
A0A2I8ADV2      STLFA------VLRRR---GLPAVSTLAAVIGASVAYLA--IT----P---RFYATSAKM
A0A1W5CKM3      STLLG------VLGRR---GFPAVTVFASVIGASFAYLA--VT----P---RLYETSARL
A0A5Q0GMF5      STLLG------VLGRR---GFPAVTVFASVIGASFAYLA--VT----P---RLYETSARL
Q3MEW0          STLLG------VLGRR---GFPAVTVFASVIGASFAYLA--VT----P---RLYETSARL
A0A1Z4KIC7      STLLG------VLGRR---GFPAVTVFAAVIGASFAYLA--VT----P---RLYETSARL
Q8YSM5          STLLG------VLGRR---GFPAVTVFAAVIGASFAYLA--VT----P---RLYETSARL
A0A1Q4S1H4      SSLWT------VAKRR---SLPAFLTLSAVIAGAVTYLA--VA----P---RMYETSSRL
A0A433VBU6      SSLWA------VVRRR---SLPAFLTLSAVMAGAVTYLA--VA----P---RMYETSSRL
A0A1Q4RZJ6      WSVLS------VLKRR---GLPALITFTAVIGGAVAYLK--VT----P---RLYESSSRL
A0A1Z4SNV3      WSVLA------VIKRR---GLPALITFTAVISGAVAYLK--VT----P---RLYETSARL
A0A2H2XJQ1      WSVLA------VIKRR---GLPALITFTAVISGAVAYLK--VT----P---RLYETSARL
A0A3S5K358      WSVLS------VLKRR---GLPALITFTAVIGGAVAYLK--VT----P---RLYESSSRL
A0A0T7BPJ4      SSLVA------VLKRR---GLPAAAAFVAVMGAAGAYLL--LS----P---KLYEASARM
A0A0C1QS61      SSVLG------VLKRR---SLPAVAAFVATIGGAIAYLA--VT----P---SQYEASARL
A0A139X3R8      SSVLS------VLKRR---SLPAVAAFVAAIGGAIAYLA--VT----P---SQYEASARL
A0A1Z4I7C5      STLLA------VLGRR---GFPAITVFAAVIGTSFAYLQ--VT----P---RLYESSARL
A0A0C2MDK7      SSVLA------VLRRR---SLPAVAAFVAVMGGAIAYLA--VT----P---SKYEAYARL
A0A1Y0RCK1      SNVLA------VLKRR---SAPAIAAFAAVIGGAIAYLA--VT----P---SKYEAYARL
A0A1Z4PWZ0      SSVIG------VLRRR---SLPAIAAFVAVIGGAMAYLT--VT----P---SKYAASARV
A0A0C2QLT0      SSVIG------VLRRR---SLPAIAAFVAVIGGAIAYLA--VT----P---SKYEAYARL
A0A1Z4J2K1      SSVIA------VLRRR---SLPAIAAFVAVIGGAIAYLA--VT----P---SKYEASARL
A0A3S0ZSX0      SSLLL------IFKRR---AFPALATFAAVIGGAIAYLQ--VT----P---HRYQTSARL
A0A2N6K4T3      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--MT----P---RQYQTSTRL
A0A370CKT2      SSLPS------ILKRR---ALPALVTFAAVISGAIAYLQ--IT----P---RQYQTSTRL
A0A0S3TL97      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---HQYQTSTRL
A0A2N6M8A0      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---HQYQTSTRL
A0A2N6M9E1      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---RQYQTSTRL
A0A2N6KJI4      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---RQYQTSTRL
A0A2N6MZ77      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---RQYQTSTRL
A0A2N6KT20      SSLPS------ILKRR---ALPALVTFAAVISGAIAYLQ--IT----P---RQYQTSTRL
G6FSN3          SSLPS------ILKRR---ALPALVTFAAVISGAIAYLQ--IT----P---RQYQTSTRL
A0A4D9CI02      SSLPF------ILKRR---ALPALVTFAAVIGGAIAYLL--IT----P---RLYEISTRL
A0A328I8B9      --------------------LPALVTFAAVIGGAIAYLI--IT----P---RLYEISTRL
A0A4Q9J4Z7      SSLPF------ILKRR---ALPALVTFAAVIGGAIAYLI--IT----P---RLYEISTRL
A0A0M0SU69      SSLPF------ILKRR---ALPALATFIAVIGGAIIYLQ--IT----P---RLYETSTRL
A0A1Z4TIZ8      SSLLF------ILKRR---TLPALATFAAVIGGAIAYLQ--IT----P---RLYETSTRL
A0A2T1E9V8      YNYWC------IFKRH---WLPALAIFSTITGGSYLYTS--AK----T---PIYSAQGQI
A0A1Z4LN32      QKYLL------VLKRR---WLIASVVFAGFASFGVLHWV--SQ----K---PAYQATGKL
A0A2I8A9F5      QKYLL------VLKRR---WLVIAGVFVLFATLGGTLAL--KQ----P---KSYEATGKL
A0A218Q6R8      QKYWL------VLKRR---WLIIAAVSTACAALGGVNFF--IQ----P---TTYQASGKL
A0A218QGE0      QKYLL------VLKRR---WLIASGVFAVFATLGGINFV--IQ----P---PVYEASGKL
A0A3M2GQQ6      VELGR------TLVKR---WSIIAIVMTSVFATVAVSTL--RT----T---PQYRSETLI
A0A6H1U2X0      VELGR------TLVKR---WSIIAIVMTSVFATVAVSTL--RT----T---PQYRSETLI
K1XF69          GRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSGKI
B5W297          GRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSGKI
A0A6H2AL05      GRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSGKI
H1W7M8          GRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSGKI
A0A5Q4H6A5      GRYLQ------TLKRR---WFWLLGVFVLTVSGAVYATQ--FL----S---PTYQNSGKI
D5A466          GRYLQ------TLKRR---WFWLLGVFVLTVSGAVYATQ--FL----S---PTYQNSGKI
U5QJM6          -----------------------MMTMAATFTLAVAYTF--LS----Q---PVYKSEMLM
A0A1Z4RPC6      GNYLQ------KLKRR---WIPALAVFIVTVGTTAFLSG--FL----E---KNYKSEGKI
A0A2T1CMZ0      EEYLL------KLKRR---WLPALSVFVVTVGTTLFLTS--FL----E---KTYKSEGKI
L8M4F7          GEYLL------KLKRR---WKIASALFLLTVGAAGLLST--KL----S---TKYEAEGKL
A0A140K2P2      SQYLI------KLRRR---WKLALAVFLLTAGITTALSL--LL----Q---KTYQAQGKL
K9XWX4          SGYLI------KLRRR---WKLALAVFLLTAGVTTALSL--LL----Q---KTYQAQGKL
A0A140KB14      YNYLQ------KLSRR---WKPALAVFLLTVGSMAALST--LL----K---KSYQAEGKL
K9XX88          YNYLQ------KLRRR---WKPALAVFLLTVGSVAALST--LL----K---KSYQAEGKL
A0A563VSV6      ASYFQ------KLKRR---WKPALAVFLLTVVSTFAATS--LL----E---EKYQAEGKI
L8LZE9          LSYLQ------KIQRR---WKPALAVFLLTAGSIGLASV--FL----T---TKYQAGGKI
A0A433NM31      RQYWL------ILKRR---WLPASAVFGFVLLLTALVTF--LQ----K---PVYQAQGKL
A0A1Z4NDS1      QKYVQ------VLQRR---WLPGLAIFGTCVTLATIYAF--SL----Q---PSYKAEGNL
U9VXM0          QKYWR------VLKRR---WLIALTIFGLTTTAAVGVGI--TQ----K---PEYEAEAKL
A0A6M0RI13      QKYWR------VLKRR---WLIALTVFGLTTTAAVGVGI--TQ----K---PEYQAESKL
A0A6M0S1N5      QKYWR------VLKRR---WLIALTVFGLTTTAAVGVGI--TQ----K---PEYQAESKL
K9F4D9          QKYWR------VLKRR---WLIALTVFGLTTTAAVGVGI--TQ----K---PEYQAESKL
A0A6I5QPI5      QKYWL------VLKRR---WIPAFAVFSTTVALSVFAAL--SE----E---SVYKAEGRV
A0A1Z3HMQ0      QRYWL------VLKRR---WLPASLVFAACVVAAALVGL--SQ----K---DTYQASGKL
A0A433W533      SKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATGKL
A0A2P8QWJ3      SKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATGKL
A0A2T1FKP8      SKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATGKL
K9U6L7          SKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATGKL
A0A1E5QP61      QKYWL------VLKRH---WLPASSVFALIVTLATYKAA--TA----D---PVYEAQGKL
U5DPF5          QKYWS------ILKRR---WLPASLVTISTIGLTGIYSA--RQ----T---PIYEARARL
A0A6P0X488      QNYWL------ILKRR---WLPGTLVLLLTVILATTAAL--LK----Q---PTYAAQGKL
A0A6P0UVD5      QSYWL------ILRRR---WLPGTLVLLLTVILATTAAL--LK----Q---PTYAAQGKL
A0A6P0VDM0      QSYWL------ILRRR---WLPGTLVLLLTVILATTAAL--LK----Q---PTYAAQGKL
A0A6M0G142      QKYWL------ILRRR---WLPGTLVLLLTVMLATTAAL--LK----K---PSYTAQGKL
A0A6P0MR53      QKYWL------ILKRR---WLPGTMVFLLTVMLATTAAF--LK----K---PSYTAQGKL
A0A3M2GIL5      QKYWL------VLKRH---WLPSSCVFLLIFALAFAFAY--TR----K---PTYEASGKL
A0A6H1TSJ9      QKYWL------VLKRH---WLPSSCVFLLIFALAFAFAY--TR----K---PTYEASGKL
A0A3M1PML8      QKYWN------VLKRR---WLPATSVFLTLTLLSAAVAI--RQ----K---SSYQAETLL
A0A6M8BE85      QKYWN------VLKRR---WLPATTVFLTLTALSTAIAL--RQ----K---PSYEAETLL
A0A0T7BPZ0      TKYWL------ILQRR---WLPTLGIVGIALTMAFGYVL--SI----K---PTYKAQGSI
A0A352X442      QKYWL------VLKRR---WLPAVGVFGGIVAVAGLAVI--RQ----V---PSYQAQGTI
A0A6B3NF44      QKYWL------VLKRR---WLPATGVVAMTVALSALAVS--RQ----K---DSYKAEGKL
A0A6M0EPL4      QKYWL------VLKRR---WLPATGVVAMTVALSALAVS--RQ----K---DSYKAEGKL
A0A6P0K6L6      QKYWL------VLKRR---WLPATGVVAMTVALSALAVS--RQ----K---DSYKAEGKL
A0A6P0MRR9      KKYWL------VLRRR---WLPGVVVSAIVVTLAVLSTS--KE----E---TVYKAGGQL
A0A6P0UX57      KKYWL------VLRRR---WLPGVAVSAMVVTLAVLSTS--RE----E---TVYKAGGQL
A0A6P0X1X4      KKYWL------VLRRR---WLPGVAVSAMVVTLAVLSTS--RE----E---IVYKAGGQL
A0A0M0SHU3      QKYLL------VLQRR---WMTAVGIFGAVVTLALLYAF--SL----K---PTYTAQASL
A0A1D2PBN3      QKYLL------VLQRR---WVSAVGVFGVVVTVASLYAF--SL----K---PTYNAEGSL
A0A0C2LVR7      QKYLL------VLQRR---WVPAVGVFGAVVTLVSLYAF--SL----K---PTYNAEGSL
A0A1Z4PQB9      QKYLL------VLQRR---WVPAVGVFGVAVTLVSLYAF--SL----K---PTYKAEGSL
A0A1Z4SFN6      QSYLL------VVQRR---WLAAVSVFGVVVALASLQAF--SS----K---PSYEAQGSL
K9PGI8          QKYLL------ILQRR---WIPAAGVFGVVVTLAFLYAV--SL----K---PAYKAEGSL
K9TLQ0          RHLLS------VARRR---IFVFAGVSIAVACGVLVKVL--TQ----T---PIYEGNFRL
K9QF04          HQLGA------IARRR---LVVFIAVSGVIIAGVICKQW--LQ----K---PIYKQQFQL
K9W1T3          TQYWF------IFKRR---WLPASLVFTLVLGVTALVTF--QQ----K---PIYQAQGQI
K9SGJ5          SRFLR------TLRKR---WLVVASISATLFATVAAYTY--IK----E---PVYQSETSL
A0A6N2JS94      AKFFR------VLRKR---WIVIVAVSVTVFAGNTYYTF--TR----T---PQYRSSASL
A0A6C2DSN4      AKFLR------VLRKR---WIVIVAVSVTVFAGNTYYTI--TR----I---PQYRSSASL
L8MYT6          AKFLR------VLRKR---WIVIVAVSVTVFAGNTYYTI--TR----I---PQYRSSASL
A0A352JGJ6      AKFFR------VLRKR---WIVIVAVSASVFVGNAYYTF--TR----T---PQYRSSASL
A0A1J5GLS2      AKFFR------ILRKR---WIVIVAVSASVFAGTTYYTF--TR----V---PQYKAGAAL
A0A2W4W6M5      AKFFR------VLRKR---WIVVAAVSVTVFAGNAYYTF--SR----T---PQYRSNASL
A0A2W7AN33      AKVLR------VFRDR---WTVIATVSVTMLAGSALYTF--TR----T---PQYRSIASL
A0A256BLV2      AKFFR------VLRKR---WIVIVAVSVSVFAGNTYYTF--TR----T---PQYRSSASL
A0A2W6ZXF3      AKFFR------VLRKR---WIVIVAVSASVFAGTTYYTF--TR----T---PQYKAGAAL
A0A2Z5WX66      AKFFR------VLRKR---WMVIVAVSVTVFAGNTYYTF--TR----T---PQYRSNASL
Q7NEU3          QTYAR------TIWRR---RYAFIGVFVATFSLAAAYTF--LS----N---PVYEGEMLL
A0A3C0N2P0      RRLLA------VARRR---IILVAGVAIAVTSGVAAKVL--RQ----V---PIYEGSFQL
A0A6P0JR04      RQALS------ALRRR---WLLMLLVSVAVTAGVSFRVF--NE----V---PVYRSQFRL
A0A6B3M6M6      SRIIS------LVRRR---VLVIAGVAIAISSGIIAKTL--GK----T---PQYQGKFQL
A0A6P0KD09      SQILS------LVRRR---MVVIAGVAIAISSGIIAKTL--GK----T---PQYQGKFQL
A0A6B3NIJ0      SQILS------LVRRR---MVVIAGVAIAISSGIIAKTL--GK----T---PQYQGKFQL
A0A6M0F053      SQILS------LVRRR---MVVIAGVAIAISSGIIAKTL--GK----T---PQYQGKFQL
A0A6P2ATU9      RLALS------MLRRR---WWILLLVGTAVTSVMGMRVL--QE----D---PLYRSQFRL
A0A352XE00      RQIIA------IARRR---FILTAGVAVAVTSGVATRVL--QQ----V---PKYEGKFQL
A0A6P0QC14      RKILA------VARRR---LIIIAGVAIAVSSGIASKVL--KQ----V---PNYEGKFQL
B4VS56          RQILA------VARRR---ALVVAGMAIAVTSGIVTKVL--QQ----T---PNYEGKFQL
A0A352AAQ3      GQILG------VVRRR---FIVIAGVAIAVTSGIVARVL--KQ----T---PNYEGKFQL
A0A350Y472      RQILA------VAQRR---AIIIAGVAIAVSGGIVSQVL--KQ----E---PNYEGKFQL
A0A355DVB4      RQILA------VAQRR---AIIIAGVAIAVSGGIVSQVL--KQ----E---PNYEGKFQL
A0A1Z4RMB9      NEYLL------KVKRR---WKPALGVFLLTLGVTGALSL--LQ----T---KTYQAEGKI
A0A318B4H2      ERYWR------AMLNR---RLLILAVLLASMTVGVIVYL--MA----T---PQYLATARI
B4WQE3          GRVVD------VLKRH---VFLITGITALATSAVVARAL--TE----T---PLYRADFEL
A0A2K3BR24      QQYWM------ALKRR---SLSAIIVFASTIGIAAAYSF--QQ----E---PIYQAKAKL
K9YXY1          QQYWM------ALKRR---SLSAIIVFASTIGITAAYSF--QQ----E---PIYQAKAKL
A0A1Q4RTR1      RQAWR------ILKRR---WLAVTIVISSAIGVTGAITF--SQ----T---PIYEAEGKL
A0A1Z4SQV2      RQAWR------IMKRR---WLAVTVVLSSVVGITGAVTF--SQ----T---PIYEAEGKL
A0A2H2XGN1      RQAWR------IMKRR---WLAVTVVLSSVVGITGAVTF--SQ----T---PIYEAEGKL
A0A433UXH8      RQAWR------IMKRR---WLAVTIVLSSVVGITGAVTF--SQ----T---PIYEAEGKL
A0A0V7ZFJ4      QQYWL------TLKRR---WLPALIVSSSVFGMAAFNTL--KQ----E---PIYSAEGKL
A0A0V7ZNJ9      EQYWL------ILKRR---WVPASVVAGSVVGLAALVTF--MQ----K---PIYEAKAEL
A0A367RIS1      QQYWR------ILKRR---WFLIAIIMGSVFGVTGLVAF--SK----K---PIYESEGKL
A0A235IXQ2      QQYWL------TVKRR---WFLILIIIGSVFGVTGVVTF--SE----K---PIYEAEGKL
A0A1W5CNX3      QQYWL------IAKRR---WLLIATIMGSVFGVTGLLTF--SQ----K---PIYEAEGKL
A0A5Q0GJJ5      QQYWL------IAKRR---WLLIATIMGSVFGVTGLLTF--SQ----K---PIYEAEGKL
Q3MEB7          QQYWL------IAKRR---WLLIATIMGSVFGVTGLLTF--SQ----K---PIYEAEGKL
A0A1Z4KHN9      QQYWL------IVKRR---WLLIAAIIGSVFGVTGLVTF--SQ----K---PIYEADGKL
Q8YT70          QQYWL------IVKRR---WLLIAAIIGSVFGVTGLVTF--SQ----K---PIYEADGKL
A0A166IWU6      RQYWL------AVKRR---WLLIVIIIGSVFGITSFVTF--NQ----K---QIYEAEGKL
A0A2S0Q8C0      RQYWL------AVKRR---WFLIVIIIGSVFGITSFVTF--NQ----K---PIYEAEGKL
W6FSX4          RQYWL------AVKRR---WFLIVIIIGSVFGITSFVTF--NQ----K---PIYEAEGKL
A0A218Q4C1      QQYWL------TVKRR---WLLIATIITSVFGFTAFVTF--SQ----K---PIYQAEGKL
A0A6P1ZT04      QQYWL------TVKRR---WLLIATIIGSVFGITAFITF--SQ----K---PIYQAEGKL
A0A5P8VSD1      QQYWL------TLKRR---WLLIITIMGSVFGVTGLVTF--IQ----K---PIYEAESKL
A0A1S1ZVW2      QVYWL------ILKRR---WLVILLVMASVLGAAISYTY--SQ----K---PVYQAKGKL
A0A0R0M9H9      QVYWL------ILKRR---WLVILLVMASVLGAAISYTY--SQ----K---PVYQAKGKL
A0A7H0F4U6      QIYWL------ILKRR---WLVILLVIASVLGAAISYTY--SQ----K---PVYQAKGKL
A0A1B7WX82      QQYWL------IFKRR---WLVSSIVFASVFGITAFVTY--TT----K---PVYESEGKL
A0A1B7WTD1      QQYWL------ILKRR---WFVASVVMASVISATAFMTY--TQ----K---PVYESQGKL
A0A480ABC0      QQYWL------ILKRR---WFVASVVMASVISATAFMTY--TQ----K---PVYESQGKL
A0A1Z4LRU5      GQYWL------ILKRR---WLPALLVTSSIFGLAAFVTF--RQ----K---PVYQAEGKL
A0A1Z4JVB4      QQYWL------ILKRR---WLLTSFVTGSVFGLAALLTF--LQ----K---PAYESPAKL
K9PIA4          QHYWT------VLKRR---WLVTSIVISTVFGLTALVTF--LK----T---PVYESKAKL
A0A1Z4HVE1      QQYWT------VLKRR---WPVTTVVIGSVFGLTCLFTF--LQ----K---PVYESQAKL
A0A252ECZ1      HQYWP------ILKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A1Z4G5Y1      QEYWP------ILKRR---WPVTAVVIGSVFGLTALVTF--VQ----K---PVYESQAKL
A0A252DNA2      QEYWP------ILKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A252E1Q4      QEYWP------ILKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A6G9SK36      QQYWT------IIKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A1Z4M597      QQYWT------VLKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A1Z4MWT1      QQYWT------VLKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A1Z4TX53      QQYWT------VLKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A2A2TNQ5      QEYLL------VLKRR---WLAAAIVMGSVFGITAFVTY--SQ----K---PIYEASGKL
A0A3S1C4K5      QQYLR------ILKRR---WLVTAGVMGSVFGLTALVTF--SQ----K---PVYESQGKL
A0A1X4G3D5      QLYWM------ILRRR---WLVVLLVMASVLGGAISYTL--FQ----K---PVYQAKGKL
D4TNI2          QLYWM------ILRRR---WLVVLLVMASVLGGAISYTL--FQ----K---PVYQAKGKL
A0A1Z4H6Z8      QEYWP------ILKRR---WPVTAVVIGSVFGMTALVTF--LQ----K---PVYESQAKL
A0A1Z4NPM1      QQYWL------ILRRR---WLVILLVLGSVFGLAAFYTF--TL----K---PVYEAGGKL
A0A3F3KPR9      QIYWL------ILKRR---WLVILLVIASVLGAAISYTY--SQ----K---PVYQAKGKL
D4TGN7          QIYWL------ILKRR---WLVILLVIASVLGAAISYTY--SQ----K---PVYQAKGKL
A0A1Z4UZW9      QQYWL------IFKGR---WPMASIVFAVVFGVTALVTY--ST----K---PVYESEGKL
A0A0K2M5H0      QQYWL------IFKRR---WPVASVVFAFVFGVTALVTY--ST----K---PVYESEGKL
A0A1B7VSH4      QQYWL------IFKRR---WLVASIVFASVFGATALVTY--LT----K---PVYESEGKL
A0A1B7W126      QQYWL------IFKRR---WLVASIVFASVFGATALVTY--LT----K---PVYESEGKL
A0A3D4C6Q6      QQYWL------IFKRR---WLVASIVFASVFGATALVTY--LT----K---PVYESEGKL
A0A1B7UVJ4      QQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PVYESEGKL
A0A1B7UTR1      QQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PVYESEGKL
K7W0A4          QQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PIYESEGKL
A0A5C0DRW9      QQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PVYESEGKL
A0A6H2C088      QQYWL------TFKRH---WLVTSIVFASVLGVTALFTY--SA----K---PVYESEGKL
A0A1U7HGH0      HKYWY------ILKRR---WLPAVAAFGTVMGITYLHTL--SR----V---PIYQAQGEL
K9XJD3          HKYWC------ILKRR---WLPAVAAFGTVMGITYLHTL--SR----V---PIYQAQGEL
K9SX01          FELLS------IVRRY---WFLEISIFSLVFGVSAFLTF--QE----K---PIYQATGSL
A0A4P7ZT55      KEIWM------ALRRRRRWFLAGFGVTLAITGVLTLGQR--LF----R---PTYEGSFTL
A0A1E5QIR9      KQYGL------VFKRR---FFPAAIVFCAAIGATAAITF--LQ----K---PTYQAQGEL
A0A6P1A9A0      SKIFG------VLRRR---WWLIGIVTISVSAVVGVRVF--QE----E---PIYQSRFQV
A0A1Z4IBC7      HKYIE------VLQRR---WLAVVGVFGLSLALGCLYAF--SL----K---PSYKADGSL
A0A1W5CPC7      HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
A0A5Q0GKD1      HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
Q3MDC6          HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
A0A1Z4KM73      HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
Q8YNX7          HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
A0A367R4K6      QKYLE------VLQRR---WLTVIGIFSIAVTLGCLYAF--SL----K---PSYKAEGSL
A0A1E2WSV8      QKYLE------VIQRR---WLPLVGIFSIAVTLGCLYAF--SL----K---PSYKAEGSL
A0A7D7L9Y1      QKYLE------VIQRR---WLPLVGIFSIAVTFGCLYAF--SL----K---PSYKAEGSL
A0A2R5FRT9      QKYLE------VIQRR---WLPLVGIFGITVTLGCLYAF--SL----K---PSYKAEGSL
A0A2K8T1B6      QKYLE------VIQRR---WLPLVGIFGISVTLGCLYAF--SL----K---PSYKAEGSL
A0A235I9I0      QKYLE------VFQRR---WLPLVGIFAISVSLGCLYAF--SL----K---PSYKAEGSL
A0A2D0HQT8      QKYLE------VFQRR---WLPLVGIFAISVSLGCLYAF--SL----K---PSYKAEGSL
A0A2L2NU95      QKYLE------VIQRR---WLPLVGIFAISVTLGCLYAF--SL----K---PSYKAEGSL
A0A367S084      QKYLE------VFQRR---WLPLVGIFAISVSLGCLYAF--SL----K---PSYKAEGSL
A0A1Z4SMD6      QNYWL------VLKRR---WLIAAGVLLTFVGLSGVAIY--MQ----K---PEYEASGML
A0A2H2Y096      QNYWL------VLKRR---WLIAAGVLLTFVGLSGVAIY--MQ----K---PEYEASGML
K9S8M8          QKYWL------ILKRH---WLPATGAFLLAVCGAAAMAF--TA----E---PIYEAQGKL
A0A1Z4NFV0      HRYWL------VLKRR---WLVVVGILAASTALSGFVLS--TQ----R---PQFEAIGQL
A0A3M9ZEU1      QKYWL------VLKRR---WLPATGVFGTVVALSTLAAV--MQ----K---PTYTATASL
A0A1Z4JK72      QNYWL------ILKRR---WLTAATVLAATVGLVGLATS--MQ----R---PSFEANGRL
A0A0N7Z489      QSYWL------VLKRR---WLVAAGVFAATVGVAGLATS--LQ----R---PNYEANGRA
A0A0S3TXS2      QSYWL------VLKRR---WLVAAGVFAATVGLAGLATS--LQ----R---PNYEATGRV
A0A2A2TPF8      QNYWL------VLKRR---WLIASGIFLTSVALSGFVIS--LQ----R---ANYEAKGKL
A0A1Z4R0P8      QNYWL------VLKRR---WPIALGIFLTSVALSGFAIS--LQ----K---ANYEAEGKI
A0A0T7BUI3      QQYFL------VLQRR---WKILLALIITSVGFSGFAIL--RQ----K---PQYQATGML
A0A1Z4LP32      QQYWL------IIKRR---WLFIVAAMLGSIGLSWFVIL--QQ----K---PQYQANGLL
K9REP9          QQYWL------IVKRR---WLFLVAAMLGSIGLSWLLIL--RQ----K---PEYQATGLL
A0A1Z4SIJ3      QKYWL------VLKRR---WLFVAVTVAASVGVAGIFIV--RQ----H---PEYRANGML
A0A2H2XPG4      QKYWL------VLKRR---WLFVAVTVAASVGVAGIFIV--RQ----H---PEYRANGML
K9V3C7          KNYWL------VLKRR---WLIAAGIFLTSVAMSGFVIS--LQ----K---ATYEASGKL
A0A1Z4T6Y7      RNYWL------ALKRR---WLVASGIFITTVALSGFAIS--LQ----R---PTYQASGKL
A0A2H2Y561      RNYWL------ALKRR---WLVASGIFITTVALSGFAIS--LQ----R---PTYQASGKL
A0A1Q4S362      RSYWL------VLKRR---WLVASGILFTSIALSGFAIS--LQ----R---PTYQASGKL
A0A3S1CIN8      RSYWL------VLKRR---WLIASGILFTSIALSGFAIS--LQ----R---PTYQASGKL
A0A2A2TC28      QQYWL------VLKRR---WLIAATVFCASVGLSGLVVL--RQ----K---PQYEASGML
A0A0C1NCB0      QKYLL------VIQRR---WHIVAGVMLVSMVLSGLGIY--LQ----K---PKYQATGIL
A0A2N6K7Q9      QQYLL------ILKRR---WRLIAAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6MXH6      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6M5A8      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6LL61      QQYLL------ILQRR---WRLITTIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A0S3TP66      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
G6FP91          QQYLL------ILKRR---WRLITTIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A1U7GYR5      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6KY52      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6KMP5      QQYLL------ILKRR---WQLITTIIVASIGLSGSVLF--MQ----K---PEYQADGIL
A0A2N6MA45      QQYLL------ILQRR---WRLITTIIVASIGLSGSALF--MQ----K---PEYQADGIL
A0A4Q9J9V9      QQYIL------VLKRR---WQLIASIIIASIGLSGLALF--MQ----K---PEYQADGIL
A0A328IGA1      QQYIL------VLKRR---WQLIASIILASIGLSGLALF--MQ----K---PEYQADGIL
A0A4D9CE41      QQYIL------VLKRR---WQLIASIILASIGLSGLALF--MQ----K---PEYQADGIL
A0A0M0SFT2      QQYIL------VLKRR---WRLIASIVLAAIGLSGLALF--MQ----K---PEYQADGIL
A0A1Z4TLC8      QQYIL------VLKRR---WRLIASIIIASIGLSGLALF--MQ----K---PEYQADGIL
A0A0C2LFH0      QKYWL------VLKRR---WPIVVGVLLASIGFSSFLIF--LQ----K---PEYQASGML
A0A1Z4IYV4      QKYWL------VLKRR---WPIVAGVVLASVGLSSFAVF--LQ----K---PKYQASGML
A0A1Z4Q0T6      QKYWL------VLKRR---WPIVAGVVLASIGLTTFAVF--LQ----K---PEYQATGML
A0A0C2PT44      QKYWL------VLKRR---WPIVAGSVLTSIGLTTFAVF--LQ----K---PEYQATGML
A0A1D2P6J4      QKYWL------VLKRR---WPIVAGVVLASVGLSSFAVF--LQ----K---PEYQATGML
B4WP72          QKYWC------VLRRR---WRLATFVFSSSICLTVLALA--SQ----E---AEYEATGKL
A0A2T1CIL7      QKYWL------VLKRR---WLPATMIFTGVTGIFVLSAL--SK----P---PTYMAEAQL
A0A433V7A0      QKGWL------TIKRH---WKPALGIFGVVFIITGIGVL--MK----S---PSYTAYGKL
A0A2T1FTR8      AQYWL------VLKRR---WMPAALVFALTTAVATVWTF--KQ----Q---EIFQAKGQV
K9UA41          AQYWL------VLKRR---WMPAALVFALTTAVATVWTF--KQ----Q---EIFQAKGQV
A0A0C2LBE2      QKYWL------ILQRR---WLPAVGVCGVVVSLASLLAF--SS----K---PTFKAEGSL
A0A433NN38      QKYWL------VLQRR---WLPAVGIFGTVLTLASVYAF--SL----K---PYYQAQASL
A0A2N6K0T2      QKYLL------VLQRR---WMTAVGVFGVIVSLALLYAL--ST----K---PTYTAQASL
A0A2N6ML72      QKYLL------VLQRR---WMTAVGVFGVIVTLALLHAL--ST----K---PTYTAQASL
G6FQZ6          QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--SI----K---PTYTAQASL
A0A2N6MQX9      QKYLL------VLQRR---WMTAVGVFGVVFTLALLHAL--ST----K---PTYTAQASL
A0A2N6KXT6      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A2N6KGB9      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A2N6L3Y5      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A0S3TIS7      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A1U7GW28      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A2N6LW63      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A328IH74      QKYLL------VLQRR---WLTAVGICGVVLSLALLYAF--SL----K---PTYTAQASL
A0A4D9CIB0      QKYLL------VLQRR---WMTAVGICGVVLSLALLYAF--SL----K---PTYTAQASL
A0A1Z4TQ63      QKYLL------VLQRR---WMTAVGVFGAVVTLALLYAF--SL----K---PTYTAQASL
A0A4Q9J8G2      QKYLL------VLQRR---WMTAVGVFGVVLTLALLYAL--SS----K---PTYTAQASL
A0A350Y0P6      QKYWL------ILRRR---WLPSTVVFGFIFTLATTVAF--VK----K---PSYSAYGKL
A0A352X940      QKYWL------ILKRR---WLPATMVFLLSIGVAVGVAY--TR----Q---PIYEAGGKL
B8HTN4          GKYLT------ILKRR---WLGGAIAFGSILSLVIAYTL--LQ----K---PVYQAQGLL
A0A6P1AFJ5      RQLLT------VARRR---RWLILGTSLLVGSGVAVRNL--DR----E---QVYAGKFRL
B0CAX4          RNYFR------ILRRR---WIPATAVFGSVFVLTALATF--LQ----K---PVYEAEGKL
A0A1Z4RN12      NKYWQ------VLKRR---WLPATATFTGVVLLSLIAAL--SS----Q---KVYEAEAQL
A0A2T1CMF9      SRYWQ------VVRRH---WIPASATFAGVLALSLIAAL--AS----K---NIYQAEARL
Q7NDC5          REYLR------ILNRH---WPYAAGTALAVVTVVTVWTF--AL----P---PVWEAQGRL
U5QGK3          RDYLR------VLNRH---RLYAGGVFVLVVAGVAVWTF--TS----P---SVWEAKGRL
A0A2W4UY24      QKYWL------VLKRH---WLLALAVCGLTTAAAAFLGS--TQ----A---LLYKAEGKL
A0A0D8ZUV2      HKLWL------ILKRR---WLPAAGVFSCVVGLSVVAAM--MP----K---SSYQAEGKL
A0A433VDI0      QKYWS------ILKRR---WLPAVIVFSGVVGLSVVVVL--LQ----K---PVYQAEGKL
A0A3D1PG43      QNLWL------SIKRR---WLPAAGIFGCVLGCSALAAS--LQ----Q---PMYQAQGKI
A0A2P8QQ72      QNLQL------AIKRR---WLAAAGVFGFVLGLSTIVTL--LQ----A---PLYQAEGKL
K9TZQ7          QNLQL------AIKRR---WLAAAGVFGFVLGLSTIVTL--LQ----A---PLYQAEGKL
A0A6N8G584      KRVWL------ILKRR---WLPAAGVFGVVVAVATVLAS--MQ----R---PVYEAQGKL
A0A2G7GPR0      KRVWL------ILKRR---WLPAAGVFGVVVAAAAALAS--MQ----R---PVYEAQGKL
K9XH68          KRVWL------ILKRR---WLPAAGVFGVVVAAATAFAS--MQ----R---PVYEAQGKL
A0A1U7HW70      KRVWL------ILKRR---WLPAAGVFGVVVAAATAFAS--MQ----R---PVYEAQGKL
A0A2S6VEJ8      KRVWL------ILKRR---WLPAAGVFGVVVAAATALAS--MQ----R---PVYEAQGKL
A0A140KBA0      KKYWL------VLKRR---IVPASITCLGVMTLSLVTAL--SL----E---QVYQAEGQV
K9XSG1          QKYWL------VVKRR---IVPASVTCLGVITLSLVTAL--SL----E---QIYEAEGQV
A0A2T1GMT4      SHYLF------AVKRH---WIPAVSIFAATVALSIAATS--LL----K---PSYQAEGRL
K9UI51          SHYLF------AVKRH---WIPAVSIFAATVALSIAAAS--LL----K---PSYQAEGRL
A0A1Z4QL41      GRYLS------SVKRH---WIPATCIFATTVILSALAST--RL----K---PSYESEGKL
A0A2T1FXY4      SQYLL------SLKRR---WLPAVSIFATTVTLSVVAAT--LM----R---PSYEGEGQL
K9TYI2          SQYLL------SLKRR---WLPAVSIFATTVTLSVVAAA--FM----K---PSYEGEGKL
A0A252D4T4      GRYLS------IVKRQ---WLPAVTIFASTVALSAVATT--FL----K---PTYEAEGKL
A0A252DJH5      GRYLS------IVKRQ---WLPAVTIFASTVALSAVATT--FL----K---PTYEAEGKL
A0A252EB80      GRYLS------IVKRQ---WIPAVTIFASTVALSAVATT--FL----K---PTYQAEGKL
A0A6G9SKZ9      GRYLS------IVKRQ---WIPAASIFASTVALSVVATT--FL----K---PSYEAEGKL
A0A1Z4HPW5      GRYLS------IVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A1Z4MSN1      SRYLS------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A1Z4U1C2      SRYLS------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A0D6KV51      -----------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A1Z4MKF8      SRYLS------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A2C6WC43      NRYLL------MLKRW---WVPAATIFIATVMLSAVATR--FI----K---PSYEAEGKL
A0A1Z4L5A1      NRYLL------MLKRW---WIPAATIFLATVMLSAVATR--FM----K---PSYEAEGKL
A0A367QD86      NRYLL------MLKRW---WIPAATIFIATVMLSAVATR--FM----K---PSYEAEGKL
A0A2K8SM78      ------------------------------------------M----K---PSYEAEGKL
A0A2R5FPC0      SRYLL------ILKRW---WLPGTAIFAATVMLSAVATQ--FM----K---PSYEAEGKL
A0A5P8W5T6      GRYLL------ILKRW---WLPATAIFAATVMLSAIATQ--FM----K---PSYEAEGKL
A0A7D7LDT7      NRYLL------ILKRW---WLPAVSIFVATVILSAISTR--FM----K---PDYEAEGKL
A0A235IZ96      NRYLL------ILKRW---WIPAVGIFVGTVMLSAISTT--FM----K---PSYEAEGKL
A0A2L2NGP0      NRYLL------ILKRW---WIPAVGIFVGTVMLSAISTT--FM----K---PSYEAEGKL
K9QM62          HRYLL------MLKRR---WILTVGIFFATAGFGVFATT--LM----K---PSYEAAGKL
A0A1Z4FWI3      GRYLS------VLKRQ---WIPATTIFASTVAVSVMATT--FM----K---PSYESEGKL
A0A1Z4JYE7      KIYLY------LLRRR---WISVTSIFLGTVSLSILATT--LL----K---PAYESSGKL
A0A0F5YE28      GKYLQ------TVKRY---WLIVISVFLLCVGLSVYGTK--YL----K---PTYAASGKL
U7QEH7          GKYFK------TVQRY---WLVVIGVFALCVGLSVYGTK--YL----E---PTYAASGKL
A0A3S1ATK5      SRYLL------MIKRQ---WIPAASIFVATIALSALATT--RL----Q---PSYEAEGKL
A0A2Z6CPH0      SHYLM------ILKRR---WLCVTSIVIGTIALSALAAT--LI----K---PSYEAEGKL
A0A1Z4GT50      SRYLL------MLKRQ---WLPANSIFAATVAMSALATT--YM----K---PSYEAQGKL
A0A1Z4GIX0      NRYLL------VLRRR---WILILSILAASVGLSVAATT--LL----K---ASYEAEAKL
A0A2H6LC24      NRYLL------VLRRR---WILILSILAASVGLSVAATT--LL----K---ASYEAEAKL
B2J6N5          SRYLL------ILKRW---WLPATVIFTATVILSAIATQ--FM----K---PSYEAEGKL
A0A367RMI4      NRYLL------ILKRW---WLPAFSVFVATVILSAISTQ--FL----K---PDYEAEGKL
A0A235HUM0      NRYLL------ILKRW---WVPAFSIFVATVILSAISTK--FL----K---PDYEAEGKL
A0A2L2NW47      SRYLL------ILKRW---WLPAFSIFVATVILSAISTQ--FL----K---PDYEAEGKL
A0A1E2WUR1      NRYLL------ILKRW---WLPAVSIFVATVILSAVSTR--FM----K---PDYEAEGKL
A0A235IKU3      NRYLL------ILKRW---WIPAVGIFVGTVMLSAISTT--FM----R---PSYEAEGKL
A0A1U7MYU6      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A1D8TNX9      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A6P0L6C2      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A6P0MVH0      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A6P0KJV0      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A6L9ZJG4      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
F4XKF3          SQYKL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A1D9FX10      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A6P0Q0T0      SQYKL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A6P0W5I0      SQYKL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A3C0NJ41      QKLWL------ALKRR---WLPGVAVFAVVVGLTVPLALSKKQ----K---TDYEAKGKL
A0A352AG88      QKLGL------VIKRR---WLIGAVVFLGMVGLTIPMALLQSQ----Q---TSYEAKGKL
A0A350Y374      YKLWL------VIKRR---WLVGGGVFVLMVGLTIPVALTQMQ----K---GDYEAQGKL
A0A355DPX0      YKLWL------VIKRR---WLVGGGVFVLMVGLTIPVALAQMQ----K---GDYEAQGKL
                                                                     :      

K9SLA9          LIESTIEST--------------TGSVAAPTTTASIPNPNQDNIASSEGLPPLPTDTAIS
A0A168TT23      QI---NHET-------------------------------ANILRIEDFEAAPRSWQGVE
A0A0M1JWX9      LVEPVTGEGANSLSSRL-----------------------GALAGGLGMGIPGSSGSGVD
A0A2T1M1V6      NIPIKG-DKLNAN---------------------------LGTLGNLSDGGSDFTREVNP
A0A2G7GCS2      NLPQPT-TRLDTN---------------------------LGTLGQLQNSALGFTRELNP
K9XBH8          NLPQST-NSINAS---------------------------LGTLGQLQNSGLGFSRELNP
A0A1Z4LJ30      ILPNVT-NDSDAD---------------------------LGKLGSVRDGGVVFSQQINP
K9RI76          ILPNVT-NQSDAD---------------------------LGKLGNVRDEGIVFSQQLNP
A0A352AE27      ILPDTT-SSLDAN---------------------------LGTLGSLTNDEPVFSNQLNP
A0A3B8JH60      ILPNTT-GDLDAN---------------------------LGTLGSLRNGGSGFSTEVNP
A0A3C0N766      ILPNTT-GDLDAN---------------------------LGTLGSLRNGGSGFSTEVNP
K9W9J7          ILPQKS-GNLDAN---------------------------LGTLGSLRNGDPGFSSEVNP
A0A139WSU3      ILPKTT-SNLDAN---------------------------LGTLGSLRNGDSAFSSEVNP
A0A433VN22      ILPKTT-SNLDAS---------------------------LGTLGTFKNGNLDFSPELNP
Q7NF11          ILPSTN-KNAEIS---------------------------LGALGEVRETGTSFSSEVNA
A0A1Z4JCS8      ILPSSNGGNLDAN---------------------------LGTLGSYRNSDPSFSPQVNP
A0A6P0PI80      ILPET--GKLQAS---------------------------LGTLGSLTKGDSELSAKSHP
A0A6P0WGT6      ILPET--GKLQAS---------------------------LGTLGSLTKGDSELSAKSHP
F4XTX2          ILPET--GKLQAS---------------------------LGTLGSLTKGDSELSAKSHP
Q7NJN6          ILPNAS-SNLSAN---------------------------LGPLGNIQQQGLPFSNELNP
U5QCC3          ILPDTS-SNLSAS---------------------------LGPLGNLQQQGLTFSTELSP
A0A0S3TYD7      LV---KKQA-STTSVLGLQV---------------------------DVGEIESLDKSGP
A0A2T1DNG3      LVEPNYQGK---------------------------------NSGADPFTDATVEVD---
A0A3S0Y9N9      VL---KKNATSSLTGVGS-----------------------------QLGQLENSVSGKP
A0A433UNK7      VL---KKNSTSSLTGVGN-----------------------------QLGQLESSVSGRP
A0A6P0ZKB8      VL---KKNSTSSLTGVGS-----------------------------QLGQLESSVSGRP
U5QL42          LVD-------------------------------------NRQQIPVVQTTESALPSAAN
A0A140K3H3      LLENQKTQQSA-----------------------------SVSPEQQSLAT--GYYNLKD
K9XUB8          LLENNKTQQSA-----------------------------LVSPGQQSLNT--GYSNLKD
A0A6H2NHD5      LVEPVTSAN-------------------------------SLEGDLLNLSQGTRSG--LD
A0A2P8W4F7      LVEPVTNAP-------------------------------PVGLEEVVGAQGNRGA--LD
A0A5Q4E0Z4      LVEPVTAVN-------------------------------PLGLEAMVGVAGARNTSGLD
A0A2P8VVX1      LVEPNYQQE-------------------------------LNSSDLSSFAD--QDPRDAD
A0A2P8WHY0      IVEPNYEDD-------------------------------VTARELDGLAN--ASDQSID
A0A2T1CMT9      LAESNYQAKDLQD---------------------------NQRDSEEQFAD--ANVEL-D
A0A7G8J1V5      LISDPFSNQRG--NRG------------------------GGSTGSSAFEELARNTTNND
A0A354B169      LITDPISSENSNGNSN------------------------ATALSGTMFEQLARNTTSND
Q0IDT5          LITDPISNEGGNNSAA------------------------SSAASGTVFEQLARNTTQND
A0A7G8FZD9      LITDPISSDSGNNSGS------------------------SSGLNGTVFEELARNTTSND
G4FMX5          LITDPISNDSGNNSAS------------------------AGGLNGSMFEELARNTTSND
A0A7G8FAU7      LITDPISNEGGNGRNA------------------------AFAASGTMFEQLARNTTQND
A3ZA21          LITDPISNEGGNGRNA------------------------AFAASGTMFEQLARNTTQND
A0A076HBF2      LITDPISNEGG-GRSG------------------------MANVEGTMFEQLARNTTSND
A0A7G8FP50      LITDPFNSKNG-G----------------------------SGVGGTVFERLAINTTSND
A0A7G8E8K7      LITDPISNE-N-GRSS------------------------MANVEGTMFEQLALNTTSND
A0A7G8GAH0      LITDPISNEGG-GRAG------------------------MANVEGTMFEQLARNTTSND
A0A7G8GNR2      LITDPISNEGG-GRAG------------------------MANVEGTMFEQLARNTTSND
A0A7G8ICD3      LITDPISNEGG-GRSG------------------------MANVEGTMFEQLARNTTSND
A0A2D6FCW3      LITDPLNNESG-NRAA------------------------AAALDGGMFEELARNTTSND
A0A7G7KJ95      LITDPISTEGG-GSHA------------------------AAGFNNTMFEQLARNTTSND
A0A7G8EAN3      LITDPISEEGR-GRLP------------------------A---NNDMFEQLARNTTSND
A0A563VQJ3      LFRQNTAASLT-----------------------------GIGEDISSLDS--IGVNETP
A0A1D8TX52      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A1D9G4T2      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6P0PR27      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6P0WER7      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
F4XP71          LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6L9YR57      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6P0KZ31      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6P0LPB8      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6P0SEV1      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6B3N2I8      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6M0B891      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6P0IJQ1      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6P0J8J8      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6P0ZSH6      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A1U7N5X9      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6L9Z1V0      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6P0LC12      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A6P0MVJ3      LVEPNYID--------------------------------KTRGIESQFTE--STVDI-D
A0A2W6ZAV2      LVSDPIDASSTEG---------------------------AADSSLRALAL--QPQDRAN
K9W742          LVEPNYQSKRQD----------------------------GQEGAEKQIVD--PNIQV-D
A0A3D1PBA3      LIEPNYQGKRDT----------------------------DAQRPSQQYAE--SGVKIDD
K9XPB0          LIESNYQTKDSTRGND------------------------NNQYLEEEFAD--SSIEI-D
A0A350Y7Z1      LIEPYVQQKQE-----------------------------GKPQTEEQFTD--SNVEV-D
A0A352X2A7      LIEPLVQEKQQ-----------------------------RRSE-ENQFTE--SNIEV-D
A0A0D8ZYV0      LIEANYQGRKD-----------------------------IQPGADSEFTD--ANVEI-D
A0A2T1FP73      LIEPNYQGKKDG----------------------------TTPRQGEQYAD--SGVTIDD
A0A433VMS2      LIEPNYQGKKDG----------------------------TTPRQGEQYAD--SGVTIDD
K9TYA7          LIEPNYQGKKDG----------------------------TTPRQGEQYAD--SGVTIDD
A0A2P8QUE1      LIEPNYQGKKDG----------------------------TTPRQGEQYAD--SGVTIDD
K9SA61          LVESNYQGRDQNG---------------------------D-RASEGQFTD--SNVKL-D
A0A2G7GMH8      LVEPNYQGKTDQG---------------------------QGKTTESEFAD--SNVEV-D
A0A6N8FU92      LVEPNYQGKSEQG---------------------------QRKTTESDFTD--SNVEV-D
A0A2T1DWE8      LVEPNYQSKKDSG---------------------------A--GSENQFAD--SNVEI-D
A0A1U7I8L3      LVEPNYQGKQEGS---------------------------K--NAENDFAD--SNVEI-D
A0A2T1DJL8      LSESNYRSRKTDN---------------------------P--ATPS-FAD--SNVEI-D
A0A1Z4J9W0      MVESNYRERRSPN---------------------------D--TRPS-FAD--PNVET-D
A0A0N7Z5K9      LVESNYRERRAPG---------------------------D--NSPS-FAD--PNVES-D
A0A0S3TXC5      LIESNYRERRTPG---------------------------D--NSVS-FAD--PNVET-D
B8HNB0          LTGKEQSTP------LGEEINSTSS-----------------YSN-----------WSNP
A0A563VS48      LI---KSNKTDTLSGF------------------------ENETG--NIEVISE--ESDP
A0A318BJ18      EI---AREA-------------------------------SQVTNFQGVERQSSLVDQEF
A0A3B8Y8H9      LV---DTPG-DSNRGLPGGINSSLG----------------------NFLGVST--NSDN
A0A2W1JVB9      RI---KESQ-SGLTEL--------------------------DLG--GISPLSG--DSSP
A0A3M1SVZ4      LIEKVSSTPSVTGVGS--------------------------EVG--LLDPLTK--ENSP
A0A6H1U102      LL---DNEA---------------------------------STPLVPGAP--EIATRKD
A0A7C3ZEJ3      LL---DKKT---------------------------------GVSIEPTVPLQDGYTAKD
A0A563VLD6      LL---ENPQTKESARIVPGNMTRGS----------------------AFSSLRD------
A0A2P8W9H0      LTPSSTLETQIIS-----------------------------TLNPNALSNQTEFGNSTI
A0A6I5P386      LTPSVTPESKVVS-----------------------------NLTSEGLGDAINSADIAV
A0A654SFI6      EISQISANV-TSLDPL----------------------------------------ENES
A0A318BG22      EV---QREA-PRVLDV--------------------------NSA-----------ESDS
K9SSQ0          LI---EN-----------------------------------APT-----------DGNS
A0A2W1JIN9      IL---DGTPSTSVSDFGSTIAQQP--------------------------------GNGA
A0A318AJV1      RI---DPSL--------NPMSQDQG---------------Q-GVI-----------GAET
A0A6P0IC70      ML---DNKQ-VSVSPLGRDLSQLPN---------------R-GPG-----------GANP
A0A6B3MUB5      ML---DNKQ-VSVSPLGRDLSQLPN---------------R-GPG-----------GANP
A0A6M0B7N4      ML---DNKQ-VSVSPLGRDLSQLPN---------------R-GPG-----------GANP
A0A6P0J9W3      ML---DNKQ-VSVSPLGRDLSQLPN---------------R-GPG-----------GANP
A0A6P0ZWE1      ML---DNKQ-VSVSPLGRDLSQLPN---------------R-GPG-----------GANP
A0A1U7N2U4      ML---ENKK-VSVSELGRNLSQVPA---------------N-TPG-----------EASP
A0A1D9G1F2      ML---DNKK-VSVSELGDNLSQVPA---------------N-TPG-----------GADP
A0A6P0PNZ7      ML---DNKK-VSVSELGDNLSQVPA---------------N-TPG-----------GADP
F4XV38          ML---DNKK-VSVSELGDNLSQVPA---------------N-TPG-----------GADP
A0A6P0W137      ML---DNKK-VSVSELGDNLSQVPA---------------N-TPG-----------GADP
A0A6L9Y9E2      ML---DNKK-VSVSELGRNLSQVPA---------------N-TPG-----------GANP
A0A6P0SGR0      ML---DNKK-VSVSELGDNLSQVPA---------------N-TPG-----------GANP
A0A6M0BK48      ML---DNKK-VSVSELGDNLSQVPA---------------N-TPG-----------GADP
A0A6L9YZL1      ML---DNKK-VSVSELGDNLSQVPA---------------N-TPG-----------GADP
A0A6P0KYM4      ML---DNKK-VSVSELGDNLSQVPA---------------N-IPG-----------GADP
A0A6P0LSD6      ML---DNKK-VSVSELGDNLSQVPA---------------N-IPG-----------GADP
A0A6P0X384      ML---DEKK-VSVSELGREISQLEG---------------E-IPG-----------QESP
A0A2P8QIL5      ML---DGKQLSLAGETGRDLTQESA---------------R-LD-------------SNP
A0A2T1FLY5      ML---DGKQLSLAGETGRDLTQESA---------------R-LD-------------SNP
A0A433W447      ML---DGKQLSLAGETGRDLTQESA---------------R-LD-------------SNP
K9U1K8          ML---DGKQLSLAGETGRDLTQESA---------------R-LD-------------SNP
K9UYB2          MV---DEKRGTSVSELGRNLTQV-----------------S-NSP-----------GNSP
A0A218QN17      MQ---DDRR-VSVSELGRDLTQVSS---------------G-APG-----------GPSP
K9RKN2          ML---DEKQ-ISVSELGRDLTQVAN---------------S-TPG-----------GPSP
A0A2I8ADV2      MV---DAKG-VSVSELGRDLTQP-S---------------V-VGR-----------SSNP
A0A1W5CKM3      ML---DDKK-ASVSELGRDLTQI-N---------------S-TAI-----------GRNP
A0A5Q0GMF5      ML---DDKK-ASVSELGRDLTQI-N---------------S-TAI-----------GRNP
Q3MEW0          ML---DDKK-ASVSELGRDLTQI-N---------------S-TAI-----------GRNP
A0A1Z4KIC7      ML---DDKK-ASVSELGRDLTQI-T---------------P-TGV-----------GRNP
Q8YSM5          ML---DDKK-ASVSELGRDLTQI-T---------------P-TGV-----------GRNP
A0A1Q4S1H4      MV---DDKG-VSVSDFGRSITQLNA---------------G-TPG-----------GASA
A0A433VBU6      ML---DSKS-VSVSALGRDITQLDA---------------G-TPG-----------GASP
A0A1Q4RZJ6      IF---DDRR-TSVSELGRDLSQTSI---------------T-SAG------------NSP
A0A1Z4SNV3      IF---DDKR-VSVSELGRDLSQTSV---------------S-GSG------------NSA
A0A2H2XJQ1      IF---DDKR-VSVSELGRDLSQTSV---------------S-GSG------------NSA
A0A3S5K358      IF---DDRR-TSVSELGRDLSQTSV---------------T-SPG------------NSP
A0A0T7BPJ4      ML---DDKR-VSVSDLGRDLTQVTS---------------T-TPG-----------GPSP
A0A0C1QS61      ML---DSKQ-TSVSELGRNLSQVSS---------------N-TPG-----------GPSP
A0A139X3R8      ML---DNKQ-TSISELGRDLSQVSS---------------N-TPG-----------GPSP
A0A1Z4I7C5      ML---EDKK-ASVSELGRDLTQINS---------------S-SVG------------RNP
A0A0C2MDK7      ML---DDKR-VSVSELGRDLTQVSA---------------N-APG------------ISP
A0A1Y0RCK1      ML---DDKR-VSVSELGRDLTQVSS---------------N-SPG------------NSP
A0A1Z4PWZ0      ML---DDKR-VSVSELGRDLTQVSS---------------N-APG------------ISP
A0A0C2QLT0      MQ---DDKR-VSVSELGRDLTQVSS---------------N-APG------------ISP
A0A1Z4J2K1      MQ---DDKR-VSVSELGRDLTQVSS---------------S-GPG------------ISP
A0A3S0ZSX0      ML---DDKR-VSVSELGRDLTQMPT---------------N-IPG-----------GPSP
A0A2N6K4T3      ML---DQKR-VSVSELGRDLTQLSS---------------D-TPG-----------GSNP
A0A370CKT2      ML---DQKR-VSVSELGRDLTQLNS---------------G-TPG-----------GSNP
A0A0S3TL97      ML---DQKR-VSVSELGRDLTQLNS---------------G-TPG-----------GSNP
A0A2N6M8A0      ML---DQKR-VSVSELGRDLTQLNS---------------G-TPG-----------GSNP
A0A2N6M9E1      ML---DQKR-VSVSELGRDLTQLNS---------------G-TPG-----------GSNP
A0A2N6KJI4      ML---DQRR-VSVSELGRDLTQLNS---------------G-TPG-----------GSNP
A0A2N6MZ77      ML---DQKR-VSVSELGRDLTQLNS---------------G-TPG-----------GSNP
A0A2N6KT20      ML---DQKR-VSVSELGRDLTQLNS---------------G-TPG-----------GSNP
G6FSN3          ML---DQKR-VSVSELGRDLTQLNS---------------G-TPG-----------GSNP
A0A4D9CI02      IL---DQKR-VSVSELGRDLTQLSP---------------G-TSG-----------NSNP
A0A328I8B9      IL---DQKR-VSVSELGRDLTQLSP---------------G-TSG-----------NSNP
A0A4Q9J4Z7      IL---DQKR-VSVSELGRDLTQLSP---------------G-TSG-----------NSNP
A0A0M0SU69      IL---DQKR-VSVSELGRDLTQLSS---------------A-TPG-----------GSNP
A0A1Z4TIZ8      IL---DQKR-VSVSELGRDLTQLSP---------------G-TPG-----------GSNP
A0A2T1E9V8      LF---KQDK-TSS-----------------------------LIGLDSDAQAMDSQSNSS
A0A1Z4LN32      LF---RTDR-TSS--L-------TGAGE--------------EIG--HLESIKR--EANP
A0A2I8A9F5      LF---QMNR-TSS--L-------TGIGG--------------KIG--DLESI----GSNP
A0A218Q6R8      LF---QLNR-TSS--L-------TGVGG--------------RIG--DLESI----GANP
A0A218QGE0      LF---QSNQ-TSS--L-------TGVGE--------------KIG--HLESIKP--EANP
A0A3M2GQQ6      LV--------------------------------------D-DRS--SVPVVPG--LESP
A0A6H1U2X0      LV--------------------------------------D-DRS--SVPVVPG--LESP
K1XF69          LF---KVDR-TS-SLAGIG--EGLG-----------------ELK--AL---LA--DQTP
B5W297          LF---KVDR-TS-SLAGIG--EGLG-----------------ELK--AL---LA--DQTP
A0A6H2AL05      LF---KVDR-TS-SLAGIG--EGLG-----------------ELK--AL---LA--DQTP
H1W7M8          LF---KVDR-TS-SLAGIG--EGLG-----------------ELK--AL---LA--DQTP
A0A5Q4H6A5      LF---KVDR-TS-SLAGIG--EGLG-----------------ELK--AL---LA--DQTP
D5A466          LF---KVDR-TS-SLAGIG--EGLG-----------------ELK--AL---LA--DQTP
U5QJM6          LL---EDKS-SQTQVL-----EDAA-----------------QQI--QLGGGAD--FTTQ
A0A1Z4RPC6      LF---KKNS-VD-SFLDLQ--SKPE-----------------QLN--SI---LP--DQTP
A0A2T1CMZ0      LF---KKNT-PN-ELLNLS--ENTN-----------------EFN--SL---LN--TQTP
L8M4F7          LF---KSSS-LA-SLTGVA--KNSS-----------------ALE--TLNYSLG--QQSP
A0A140K2P2      LF---KQNS-TA-SLTGVG--KNVG-----------------ELK--PL---LV--NQSP
K9XWX4          LF---KQNS-TA-SLTGVG--ENVG-----------------ELK--PL---LV--NQSP
A0A140KB14      LF---KQNN-TA-SLTKVG--QGVG-----------------ELK--PL---LN--DQSP
K9XX88          LF---KQNN-TA-SLTKVG--QGIG-----------------ELK--PL---LN--DQSP
A0A563VSV6      LF---KQKN----NLLPVG--EGVG-----------------ELT--TF---LN--NQTP
L8LZE9          LF---EPQD----NLTDLG--NPSN-----------------DLQ--SL---TV--GATP
A0A433NM31      LL---KRTG-STSTVTGLG--KELG-----------------QLD--SLVDSPE--SNYP
A0A1Z4NDS1      LI---KTNN-TP-SLTGLG--EAIG-----------------KLE--SL--TR---DSNP
U9VXM0          LF---ELSN-QTSSLVGFE--GGTR-----------------ELR--AL--TN---LDNP
A0A6M0RI13      LF---ELSN-QASALVGLE--GGNR-----------------ELR--AL--TN---LDNP
A0A6M0S1N5      LF---ELSN-QASALVGLE--GGNR-----------------ELR--AL--TN---LDNP
K9F4D9          LF---ELSN-QASALVGLE--GGNR-----------------ELR--AL--TN---LDNP
A0A6I5QPI5      LF---RSDR-TT-SLTGLG--DDRG-----------------RVE--IL-------AADP
A0A1Z3HMQ0      LF---QVDR-ST-SLTGVG--DEIG-----------------DLE--AV--NPV--NSDP
A0A433W533      IV---KKND-QTAALTGLG--QGIG-----------------DLE--GL--NL---QSNP
A0A2P8QWJ3      IV---KKND-QTAALTGLG--QGIG-----------------DLE--GL--NL---QSNP
A0A2T1FKP8      IV---KKND-QTAALTGLG--QGIG-----------------DLE--GL--NL---QSNP
K9U6L7          IV---KKND-QTAALTGLG--QGIG-----------------DLE--GL--NL---QSNP
A0A1E5QP61      LF---KKQN-TTSALVTDAG-AKIG-----------------QLD--TL--TQ---FNNP
U5DPF5          LL---QTAD-GAIPFAGFSGGSST--------------------------------SNTL
A0A6P0X488      LL---KKRI-LSSLGTEAG--EQIG-----------------ELE--AL--NNF--INTP
A0A6P0UVD5      LL---KKRI-LSSLGTEAG--EQIG-----------------ELE--AL--NNF--INTP
A0A6P0VDM0      LL---KKRI-LSSLGTEAG--EQIG-----------------ELE--AL--NNF--INTP
A0A6M0G142      LL---KKRI-VSSIGTEAG--EQIG-----------------ELE--AL--NNF--INTP
A0A6P0MR53      LL---KKRI-LSSLGTEAG--EQIG-----------------ELE--AL--NNF--INTP
A0A3M2GIL5      LI---KKRN-TTSALVTEAG-AKLG-----------------ELD--SV--YQ---LNSP
A0A6H1TSJ9      LI---KKRN-TTSALVTEAG-AKLG-----------------ELD--SV--YQ---LNSP
A0A3M1PML8      QV---RSSG-AA-KLTGVG--EGLG-----------------ELE--KL--TL---QSNP
A0A6M8BE85      QV---RSSA-AS-RLTGVG--EGLG-----------------ELE--RL--TL---QSNP
A0A0T7BPZ0      LI---RTNR-TS-SLTGLG--GDIG-----------------RLE--SL--TQ---TNNP
A0A352X442      LI---QKDR-SA-SLTGLD--EALS-----------------QFD--KL--AQ---KSDP
A0A6B3NF44      LF---KEDN-SS-SLTGLE--NEIG-----------------ELK--GL--TN---TSDP
A0A6M0EPL4      LF---KEDN-SS-SLTGLE--NEIG-----------------ELK--GL--TN---TSDP
A0A6P0K6L6      LF---KEDN-SS-SLTGLE--NEIG-----------------ELK--GL--TN---TSDP
A0A6P0MRR9      LL---KEDR-SAGALTGLEGLDEAG-----------------RLK--GL--TS---NSEP
A0A6P0UX57      LL---KEDR-SAGALTGLEGLDETG-----------------RLK--GL--TT---NSEP
A0A6P0X1X4      LL---KEDR-SAGALTGLEGLDETG-----------------RLK--GL--TT---KSEP
A0A0M0SHU3      LI---KTNR-TS-SLTGLG--EDIG-----------------RIE--SL--VR---ENSP
A0A1D2PBN3      LI---KTNR-TS-SLTGLG--EALG-----------------RLE--SL--GV---NNNP
A0A0C2LVR7      LI---KTNR-TS-SLTGLG--EALG-----------------RLE--SL--GV---NNNP
A0A1Z4PQB9      LI---KTNR-TS-SLTGLG--EALG-----------------RLE--SL--GV---NNNP
A0A1Z4SFN6      LV---KTNR-ST-SLTGLG--ESIG-----------------RIE--SL--TN---TNNP
K9PGI8          LI---KTNR-SA-SLTGLG--EGIG-----------------QVD--SL--VN---TNSP
K9TLQ0          LV--------------------------------------EPIKGQDNLEQLNQALTRNS
K9QF04          MLDSATSDS-DSN-----------------------------PLADSPRRSAVVPLQFRD
K9W1T3          LI---KKNN-STSLLL--------------------------NLD--KIDGSAG--AGNQ
K9SGJ5          LI---DDAT-ISVSNL--------------------------PVND----GLDKYSKEPS
A0A6N2JS94      LV----NST-IAVSDI--------------------------QLP-----GLPS-SSTVN
A0A6C2DSN4      LI---NNST-IPVSDI--------------------------QVPNAPSSGLPA-SPVIN
L8MYT6          LI---NNST-IPVSDI--------------------------QVPNAPSSGLPA-SPVIN
A0A352JGJ6      LI---NNST-IAISDI--------------------------QVP-----GLPG-SSLIN
A0A1J5GLS2      LI---NNST-IAVSDI--------------------------QIP-----GLPG-TSSIN
A0A2W4W6M5      LI---NNST-IAVSDI--------------------------QVP-----GLPS-ASLIN
A0A2W7AN33      LI----NST-ISAPNI--------------------------QPT-----GAST-SSMVD
A0A256BLV2      LV----NST-IAVSDI--------------------------QLP-----GLST-SSLVN
A0A2W6ZXF3      LI---NNST-IAVSDI--------------------------QVP-----GLPG-ASSIN
A0A2Z5WX66      LI---NNST-IAVSDI--------------------------QVP-----GLPG-TSLIN
Q7NEU3          LLE---DRN-SQPKVL------------------------ADEAS--PMSYFAS--NSAD
A0A3C0N2P0      LVGPVSSSE-DKLGKL------------------------AQSLN--EGGGSSS--NTPD
A0A6P0JR04      LVEPI-AGE-ASFDQF------------------------SQRLI--GQLGFEL-----D
A0A6B3M6M6      LVEPV-TGE-QKLDQL------------------------NQSLK--TTAGIQT--DGLD
A0A6P0KD09      LVEPV-TGE-QKLDQL------------------------NQSLK--TTAGIKA--DGLD
A0A6B3NIJ0      LVEPV-TGE-QKLDQL------------------------NQSLK--TTAGIKA--DGLD
A0A6M0F053      LVEPV-TGE-QKLDQL------------------------NQSLK--TTAGIKA--DGLD
A0A6P2ATU9      LVEPI-ASE-QQFDQF------------------------SQRLI--GQLGLDF-----D
A0A352XE00      LIGPV-SGG-DRLDEL------------------------SQSLA--QNTGSQG--NAPD
A0A6P0QC14      LVGPV-SGE-DQVDKL------------------------TQSLG--QNVGIEV--EGPD
B4VS56          LVGSV-SGE-DQLEQI------------------------SESLN--QSAGVQT--NSID
A0A352AAQ3      LVGSV-SGE-DRVEQL------------------------TEALS--KTANIQV--EGPD
A0A350Y472      LVGSP-SGE-DQAEQL------------------------TEALS--KTGTVQV--QGPD
A0A355DVB4      LVGSP-SGE-DQAEQL------------------------TEALS--KTGTVQV--QGPD
A0A1Z4RMB9      LF---KQTS-AAS--Y-------TG-IG------------E-EAG--TLKPILN--DQTP
A0A318B4H2      EI---QRSQ-AKV--V--------------------------NVGGLEMEDRSR--DLQF
B4WQE3          LTPLVTLET-QIISTISPDALSNQS---------------E-SVG-----------VGLL
A0A2K3BR24      LF---QGES-QAL-----------------------------ALP--TLEQQGN---AGP
K9YXY1          LF---QGES-QAL-----------------------------ALP--TLEQQGN---AGP
A0A1Q4RTR1      TFN--KANL-YSS--L-------TGITG------------GQELE--MLGRGAN--AGNP
A0A1Z4SQV2      LFN--RANL-YSS--L-------TGITE------------SQNID--V--PGIN--STNP
A0A2H2XGN1      LFN--RANL-YSS--L-------TGITE------------SQNID--V--PGIN--STNP
A0A433UXH8      LFN--KANL-YSS--L-------TGITE------------GQNID--V--PGIN--SNNP
A0A0V7ZFJ4      RFN---SDR-VSA--L-------TA-LN------------S-QMG--EVAAITG--KGNP
A0A0V7ZNJ9      LFN--KQSN-VSS--L-------TG-LS------------G-AVG--ELSGITN--LSNP
A0A367RIS1      LFN--KESG-LSS--L-------TG-VN------------E-QLG--QLSGVTN--LSNP
A0A235IXQ2      LFN--KQSG-VSS--L-------TG-VN------------E-QLG--QLSGVTN--VSNP
A0A1W5CNX3      LFN--KQSG-VSS--L-------TG-VS------------E-QLG--QLSGVTN--LSNP
A0A5Q0GJJ5      LFN--KQSG-VSS--L-------TG-VS------------E-QLG--QLSGVTN--LSNP
Q3MEB7          LFN--KQSG-VSS--L-------TG-VS------------E-QLG--QLSGVTN--LSNP
A0A1Z4KHN9      LFN--KQSG-VSS--L-------TG-VS------------E-QLG--QLSGVTN--LSNP
Q8YT70          LFN--KQSG-VSS--L-------TG-VS------------E-QLG--QLSGVTN--LSNP
A0A166IWU6      IFD--KQNS-VSS--L-------TG-VS------------E-GVG--ELSGLTS--SSNP
A0A2S0Q8C0      IFD--KQNS-VSS--L-------TG-VS------------E-GVG--ELSGLTN--SSNP
W6FSX4          IFD--KQNS-VSS--L-------TG-VS------------E-GVG--ELSGLTS--SSNP
A0A218Q4C1      IFD--KQSS-VSS--L-------TG-VS------------E-RVG--ELSRLTN--LSNP
A0A6P1ZT04      IFD--KQSS-VSS--L-------TG-VS------------E-RVG--ELSGLTN--LSNP
A0A5P8VSD1      LF---NNQS-PSS--L-------TA-VS------------Q-QLG--QLTGLTT--NSNL
A0A1S1ZVW2      LFE--KKDG-VSS--L-------TS-LA------------T-SVG--ELGGVGN--NSNP
A0A0R0M9H9      LFE--KKDG-VSS--L-------TS-LA------------T-SVG--ELGGIGN--NSNP
A0A7H0F4U6      LFE--KKDG-VSS--L-------TS-LA------------T-SVG--ELGGLGN--NSNP
A0A1B7WX82      VFT--KKGV-ASS--L-------TTNIS------------Q-QMG--ELGGLTN--LSNP
A0A1B7WTD1      VFT--KKDA-ASS--L-------SS-LS------------D-KMG--ELGGLTN--LSNP
A0A480ABC0      VFT--KKDA-ASS--L-------SS-LS------------D-KMG--ELGGLTN--LSNP
A0A1Z4LRU5      RFD--KNNN-VSS--L-------SG-LG------------G-QIG--ELSGITN--LSNP
A0A1Z4JVB4      IFN--KQNG-ISS--F-------SD-IA------------A-KAG--ELRGLTS--FSNP
K9PIA4          LFN--KQNG-VSS--L-------TG-FS------------S-KMG--ELGGLTN--LSNP
A0A1Z4HVE1      LFN--KQNG-VSS--L-------TG-LS------------S-QVG--ELSGLTN--LSNP
A0A252ECZ1      LFN--KQSG-VSS--L-------SG-LS------------S-QVG--ELSGLTN--LSNP
A0A1Z4G5Y1      LFN--KQSG-VSS--L-------TG-LS------------S-QVG--ELSGLTN--LSNP
A0A252DNA2      LFN--KQSG-VSS--L-------TG-LS------------S-QVG--ELSGLTN--LSNP
A0A252E1Q4      LFN--KQSG-VSS--L-------TG-LS------------S-QVG--ELSGLTN--LSNP
A0A6G9SK36      LFD--KQNG-VSS--L-------TG-IS------------A-QVG--ELSGLTN--LSNP
A0A1Z4M597      LFN--KQNG-VSS--L-------TG-LS------------S-QVG--ELSGLTN--LSNP
A0A1Z4MWT1      LFN--KQNG-VSS--L-------TG-LS------------S-QVG--ELSGLTN--LSNP
A0A1Z4TX53      LFN--KQNG-VSS--L-------TG-LS------------S-QVG--ELSGLTN--LSNP
A0A2A2TNQ5      LL---KQNE-ASN--L-------TG-LN------------Q-KLG--ELSGLTN--TSNP
A0A3S1C4K5      LI---KNNG-ASS--L-------TG-LS------------E-KVG--ALSALTN--TSSP
A0A1X4G3D5      LFEGDRVSS-LTR--L-------GG-LA------------E-LAQ--LTGATGS--GGSG
D4TNI2          LFEGDRVSS-LTR--L-------GG-LA------------E-LAQ--LTGATSS--GGSG
A0A1Z4H6Z8      LFN--KQSG-ASS--L-------SG-LS------------S-QVG--ELSGLTN--LSNP
A0A1Z4NPM1      ML---KQNS-SSS--L-------IG-LS------------D-KLG--ELSGLTN--TSNP
A0A3F3KPR9      LFE--KKDG-VSS--L-------TS-LA------------T-SVG--ELGGLGN--NSNP
D4TGN7          LFE--KKDG-VSS--L-------TS-LA------------T-SVG--ELGGLGN--NSNP
A0A1Z4UZW9      VFT--KKSG-ASS--L-------TS-LS------------Q-QMG--ELGALTN--LSNP
A0A0K2M5H0      VFT--KKSG-ASS--L-------SS-LS------------Q-QMG--ELGALTN--LSNP
A0A1B7VSH4      VFT--KKSG-ASS--L-------SG-LS------------Q-QMG--ELGALTN--LSNP
A0A1B7W126      VFT--KKSG-ASS--L-------SG-LS------------Q-QMG--ELGALTN--LSNP
A0A3D4C6Q6      VFT--KKSG-ASS--L-------SG-LS------------Q-QMG--ELGALTN--LSNP
A0A1B7UVJ4      VFT--KRSG-ASS--L-------AD-IS------------Q-SMG--ELGGLTN--LSNP
A0A1B7UTR1      VFT--KRSG-ASS--L-------AD-IS------------Q-SMG--ELGGLTN--LSNP
K7W0A4          VFT--KKSG-ASS--L-------AG-LS------------Q-SLG--ELGGLTN--LSNP
A0A5C0DRW9      VFT--KKSG-ASS--L-------AG-LS------------Q-SLG--ELGGLTN--LSNP
A0A6H2C088      VFT--KKSG-ASS--L-------AG-LS------------Q-SLG--ELGGLTN--LSNP
A0A1U7HGH0      LF---RQDR-SSS--L-------IG-LQ--------------SAT--QANPTTQ--NDTS
K9XJD3          LF---RQDR-SSS--L-------IG-LQ--------------SAT--QANPTTQ--NDTS
K9SX01          LF---KSQR-QSN----------TL-TG------------VNSVA--QISDTVA---GDP
A0A4P7ZT55      LV---SDPL-SEDRQL-------GG-PS------------N-QLS--DLALVNP--GTVD
A0A1E5QIR9      LF---KKNN-VTT--------NVTV-VG------------K-EVP--EIHSP----PTNP
A0A6P1A9A0      LV---GQLT-NEQ--I------------------------N-PLA--EQAGVST--KSVD
A0A1Z4IBC7      MI---MTNR-TFS--L-------TG-LP------------Q-DIG--KLEPLNV--NDNP
A0A1W5CPC7      MI---KTNR-TSS--L-------TG-LP------------Q-DIG--RLEPLNV--NDNP
A0A5Q0GKD1      MI---KTNR-TSS--L-------TG-LP------------Q-DIG--RLEPLNV--NDNP
Q3MDC6          MI---KTNR-TSS--L-------TG-LP------------Q-DIG--RLEPLNV--NDNP
A0A1Z4KM73      MI---KTNR-TSS--L-------TG-LP------------Q-DIG--RLEPLNV--NDNP
Q8YNX7          MI---KTNR-TSS--L-------TG-LP------------Q-DIG--RLEPLNV--NDNP
A0A367R4K6      MI---KTNR-TSS--L-------TG-LP------------E-DIG--RLEALNV--NDNP
A0A1E2WSV8      MI---KTNR-SSS--L-------TG-LP------------Q-DIG--RLEALNV--NDNP
A0A7D7L9Y1      MI---KTNR-SSS--L-------TG-LP------------Q-DIG--RLEALNV--NDNP
A0A2R5FRT9      MI---KTNR-SSS--L-------TG-LS------------E-DIG--RLEALNV--NDNP
A0A2K8T1B6      MI---KTNR-SSS--L-------TG-LS------------Q-DIG--RLEALNV--NDNP
A0A235I9I0      MI---KTNR-SSS--L-------TG-LP------------D-DIG--RLEALNV--NDNP
A0A2D0HQT8      MI---KTNR-SSS--L-------TG-LP------------D-DIG--RLEALNV--NDNP
A0A2L2NU95      MI---KTNR-SSS--L-------TG-LP------------D-DIG--RLEALNV--NDNP
A0A367S084      MI---KTNR-SSS--L-------TG-LP------------D-DIG--RLEALNV--NDNP
A0A1Z4SMD6      LF---QSNR-TSS--L-------TK-VG------------E-KIG--DLESVMR--EGNP
A0A2H2Y096      LF---QSNR-TSS--L-------TK-VG------------E-KIG--DLESVMR--EGNP
K9S8M8          LL---KKKN-TTSALV-------TD-AS------------A-KVG--ELDTLSD--KDTP
A0A1Z4NFV0      LF---QSNR-TSA--Y-------TK-IG------------E-NTG--SLESLRH--ESNP
A0A3M9ZEU1      LV---KADR-SSS--L-------VG-LT------------KVETG--ELQALTT--ANSP
A0A1Z4JK72      LV---QSNR-TTS--L-------TG-VG------------E-KVG--TLESLKR--EGNP
A0A0N7Z489      LV---QSNR-TTS--L-------TG-VG------------E-RVG--TLEALRR--EGNP
A0A0S3TXS2      LV---QSNR-TTS--L-------TG-VG------------E-RVG--TLEALRR--EGNP
A0A2A2TPF8      LF---QANR-TNS--L-------TG-VD------------G-KFR--DLESIRR--EANP
A0A1Z4R0P8      LF---QANR-TNS--L-------TG-VD------------G-KFR--DLESIRR--EANP
A0A0T7BUI3      LF---KSDR-ISS--L-------TK-AG------------E-KIG--DLESLIR--ENNP
A0A1Z4LP32      LF---KSDR-ISS--L-------TK-AG------------E-KIG--DLESLMR--EGNP
K9REP9          LF---KSDR-ISS--L-------TK-AG------------E-KIG--DLESLMR--EGNP
A0A1Z4SIJ3      LF---KSDR-ISS--L-------TK-AG------------E-KIG--DLESLMR--QGNP
A0A2H2XPG4      LF---KSDR-ISS--L-------TK-AG------------E-KIG--DLESLMR--QGNP
K9V3C7          LF---QTNR-TSS--L-------TG-VG------------E-KIG--SLESFRN--EANP
A0A1Z4T6Y7      LF---QTNR-ASF--L-------TG-VG------------E-KIG--DLETVRR--EANP
A0A2H2Y561      LF---QTNR-ASF--L-------TG-VG------------E-KIG--DLETVRR--EANP
A0A1Q4S362      LF---QANR-ASL--L-------TG-VG------------E-KVG--DLESVRR--EANP
A0A3S1CIN8      LF---QANR-ASL--L-------TG-VG------------E-KVG--DLESVRR--EANP
A0A2A2TC28      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLESLMR--EGNP
A0A0C1NCB0      LI---QSDR-TSS--L-------TK-AG------------E-KIG--HLESLMR--EGNP
A0A2N6K7Q9      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A2N6MXH6      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A2N6M5A8      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A2N6LL61      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A0S3TP66      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
G6FP91          LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A1U7GYR5      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A2N6KY52      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A2N6KMP5      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A2N6MA45      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A4Q9J9V9      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A328IGA1      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A4D9CE41      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A0M0SFT2      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A1Z4TLC8      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLEALMR--EGNP
A0A0C2LFH0      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLESLMR--EGNP
A0A1Z4IYV4      LF---QSDR-TSS--L-------TK-VG------------E-KIG--DLESLMR--EGNP
A0A1Z4Q0T6      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLESLMR--EGNP
A0A0C2PT44      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLESLMR--EGNP
A0A1D2P6J4      LF---KSDR-TSS--L-------TK-VG------------E-KIG--DLESLMR--EGNP
B4WP72          LI---KGGR-TSS--L-------TG-LN------------V-DIG--ELEALDS-LQKDP
A0A2T1CIL7      LI---RIDK-SSQ--L-------VG-LE------------E-ERG--QIEVIGK--DSNP
A0A433V7A0      LF---RVDT-TPF--LIGIKTKD-----------------E-NVS--PLVPLTF--EGNP
A0A2T1FTR8      IL---KKTN-KTS--ALLSSATNAA-SG------------G-AIG--ELEGLTG---STP
K9UA41          IL---KKTN-KTS--ALLSSATNAA-SG------------G-AIG--ELEGLTG---STP
A0A0C2LBE2      LI---KTNR-TSS--L-------TG-LG------------E-AIG--RLDTLTM--ESNP
A0A433NN38      LI---KTNR-TSS--L-------TG-LG------------E-DLG--RLEALVS--QSSP
A0A2N6K0T2      LI---KTNR-TSS--L-------TG-LG------------E-DLG--RLESLVQ--DNSP
A0A2N6ML72      LI---KTSR-TSS--L-------TG-LG------------E-DLG--RLESLVQ--DNSP
G6FQZ6          LI---KTSR-TSS--L-------TG-LG------------E-DLG--RLESLVQ--NNSP
A0A2N6MQX9      LI---KTSR-TSS--L-------TG-LG------------E-DLG--RLESLVQ--DNSP
A0A2N6KXT6      LI---KTSR-TSS--L-------TG-LG------------E-DLG--RLESLVQ--NNSP
A0A2N6KGB9      LI---KTSR-TSS--L-------TG-LG------------E-DLG--RLESLVQ--DNSP
A0A2N6L3Y5      LI---KTSR-TSS--L-------TG-LG------------E-DLG--RLESLVQ--DNSP
A0A0S3TIS7      LI---KTSR-TSS--L-------TG-LG------------E-DLG--RLESLVQ--DNSP
A0A1U7GW28      LI---KTSR-TSS--L-------TG-LG------------E-DLG--RLESLVQ--DNSP
A0A2N6LW63      LI---KTSR-TSS--L-------TG-LG------------E-DLG--RLESLVQ--DNSP
A0A328IH74      LI---KTNR-TSS--L-------TG-LG------------E-DIG--RLESLVR--ENSP
A0A4D9CIB0      LI---KTNR-TSS--L-------TG-LG------------E-DIG--RLESLVR--ENSP
A0A1Z4TQ63      LI---KTNR-ASS--L-------TG-LG------------E-DIG--RLESLAE--NNTP
A0A4Q9J8G2      LI---KTNR-ASS--L-------TG-LG------------E-DLG--RLESLAE--KDSP
A0A350Y0P6      LL---QKRS-ATS--ALVTEAG------------------E-KIG--QLEALNN-FINTP
A0A352X940      LL---QKKN-KTS--ALVTKAG------------------E-KIG--ELDSLNA-FINTP
B8HTN4          LL---KDSE-NPL--ASMGA--------------------T-SVG--NLVALGG--KSSP
A0A6P1AFJ5      LV---EPVT-TDP--TT-----------------------N-IVA--ENQPLSA--SRLD
B0CAX4          LL---KKQG-GAT--IADLEI-------------------G-GLG--GLEALSS--KSSP
A0A1Z4RN12      LI---KPDR-TSK--L-------IG-ID------------T-NPE--EIKGLTQ--DKDP
A0A2T1CMF9      LI---EPEQ-TSR--R-------IG-IE------------D-GNP--EVKKTVL--EKDP
Q7NDC5          LF---KQKD-TAI--DNPT-AVGLR---------------G-ALG--QMGS-VA--YGNP
U5QGK3          LF---KQKD-TAV--GSENPARSLR---------------G-SLG--QLDS-VA--FGNP
A0A2W4UY24      LF---ESSK-PVT--AIVGLD-------------------T-GEG--NLTPLTS--QSNP
A0A0D8ZUV2      LL---KRVN-ETS--AATGLGS--------------------QIG--ELDTLAQ--QTNP
A0A433VDI0      ML---KKVD-WAS--AATGVGE--------------------QIG--ELDTLAQ--QSNP
A0A3D1PG43      LL---KKID-NAS--SVTELSQ------------------T-DNS--ELEPLSQ--LGNP
A0A2P8QQ72      LL---KKPS-ETS--SLN--PE------------------K-YEP--RLEPLSA--ESNP
K9TZQ7          LL---KKPS-ETS--SLN--PE------------------K-YEP--RLEPLSA--ESNP
A0A6N8G584      LF---KRAD-RTT--AISGLKD------------------I-NVG--ELEAIAA--KANP
A0A2G7GPR0      LF---KRAD-RTT--AISGLKD------------------I-NVG--ELEAIAT--KANP
K9XH68          LF---RKAD-RTT--AISGLKD------------------I-NVG--ELEALAT--KANP
A0A1U7HW70      LF---RKAD-RTT--AISGLKD------------------I-NVG--ELEAIAT--KANP
A0A2S6VEJ8      LF---RKAD-RTA--AISGLKD------------------I-NVG--ELEALAA--KANP
A0A140KBA0      MI---KTNK-SAK--L-------TG-LE------------N-DIG--KIEVLTN--ESDP
K9XSG1          MI---KTNK-SAK--L-------TG-LE------------N-DIG--KIEVLTN--ESDP
A0A2T1GMT4      LF---KNST-FRV--IGPNLIPNSM-EG------------S-ESG--DLKSLVS--TQNP
K9UI51          LF---KNST-FRV--IGPNLIPSNM-EG------------S-ESG--DLKSLVS--NQNP
A0A1Z4QL41      LF---KVPS-FQI--LGTNLLPNSS-EG------------G-GIG--DLKPLVS--TQNP
A0A2T1FXY4      LF---KTPS-FNV--VGSNLLPSIS-EG------------Q-ETG--DLRALVS--TQNP
K9TYI2          LF---KTPS-FNV--VGSNLLPSIS-EG------------Q-ETG--DLRALVS--TQNP
A0A252D4T4      LF---KTPS-FNV--VGTNLLPSDS-EG------------G-TSG--DLKPLVS--TQNP
A0A252DJH5      LF---KTPS-FNV--VGTNLLPSDS-EG------------G-TSG--DLKPLVS--TQNP
A0A252EB80      LF---KTPS-FNV--VGTNLLPSDS-EG------------G-GSG--DLKPLVS--TQNP
A0A6G9SKZ9      LF---KTPS-FSV--VGADLLPSES-E---------------ARG--DLRPLVS--TQNP
A0A1Z4HPW5      LF---KTPS-FNV--VGTELLPTET-Q---------------ARG--DLRPLVS--TQNP
A0A1Z4MSN1      LF---KTPS-FNV--VGSELLPSES-Q---------------ARG--DLRPLVS--TQNP
A0A1Z4U1C2      LF---KTPS-FNV--VGSELLPSES-Q---------------ARG--DLRPLVS--TQNP
A0A0D6KV51      LF---KTPT-FNV--VGSELLPSES-Q---------------ARG--DLRPLVS--TQNP
A0A1Z4MKF8      LF---KTPT-FNV--VGSELLPSES-Q---------------ARG--DLRPLVS--TQNP
A0A2C6WC43      LF---RIPS-FKV--VGSNLLPTTT-EG------------G-STG--DLKSLIA--SQNP
A0A1Z4L5A1      LF---RIPS-FKV--VGSNLLPTTT-EG------------G-STG--DLKSLIA--SQNP
A0A367QD86      LF---RIPS-FKV--VGSNLLPTTT-EG------------G-STG--DLKSLIA--SQNP
A0A2K8SM78      LF---RIPS-FKV--VGSNLFPTNA-EG------------G-DPG--DLKSLLA--TQNP
A0A2R5FPC0      LF---RIPS-FKV--VGSNLFPTNA-EG------------G-DPG--DLKSLLA--TQNP
A0A5P8W5T6      LF---RIPS-FKV--VGSNLLPTNT-EG------------G-DAG--DLKSLLA--TQNP
A0A7D7LDT7      LF---RLPS-FKV--AGTNLSPGSS-EG------------G-DSG--DLKPLVA--TQNP
A0A235IZ96      LF---RVPS-FKV--AGSNLSPGSS-EG------------G-DSG--DLKALVA--TQNP
A0A2L2NGP0      LF---RVPS-FKV--AGSNLSPGSS-EG------------G-DSG--DLKALVA--TQNP
K9QM62          LF---RIPA-FNI--VGSNLLPNSS-EG------------E-FRG---LRALVS--TQNP
A0A1Z4FWI3      LF---KSPS-FNV--VGTNLLPNGS-EG------------Q-ATG--DLKSLVS--NQNP
A0A1Z4JYE7      WF---RIPS-FKT--IGTNLLPNNN-EG------------D-AAG--DLKSLVS--TQNP
A0A0F5YE28      LF---KVDR-TSS--L-------AG-IG------------E-GLG--ELKALLA--DQTP
U7QEH7          LF---KVDR-TSS--L-------AG-IG------------E-GLG--ELKALLA--DQTP
A0A3S1ATK5      LF---KLPS-FQV--LGNNLLRSNS-EG------------E---G--DLKSLVS--TQNP
A0A2Z6CPH0      LF---RMPS-FKT--VGTNLLPNNN-EG------------D-QAG--DLKSLVS--TQNP
A0A1Z4GT50      LF---KTPS-FKV--IGSNLLPNNS-EG------------E-EA---DLKPLVS--TQNP
A0A1Z4GIX0      LF---RMPS-FNV--VGTNLLPSNN-EG------------E-ETG--DLRSLVS--TQNP
A0A2H6LC24      LF---RMPS-FNV--VGTNLLPSNN-EG------------E-ETG--DLRSLVS--TQNP
B2J6N5          LF---RIPS-FKV--VGSNLLPTNT-EG------------G-DAG--DLKSLLA--TQNP
A0A367RMI4      LF---RVPS-FKV--AGNNLYPDTS-EG------------G-DAG--DLKPLVA--TQNP
A0A235HUM0      LF---RVPS-FKV--AGNNLSPGTS-EG------------G-DSG--DLKPLVA--TQNP
A0A2L2NW47      LF---RVPS-FKV--GGNNLSPGTA-EG------------G-DSG--DLKPLVA--TQNP
A0A1E2WUR1      LF---RLPS-FKV--AGTNLSPGSS-EG------------G-DSG--DLKPLVA--TQNP
A0A235IKU3      LF---RVPS-FKV--AGSNLSPGSS-EG------------G-DSG--DLKALVA--TQNP
A0A1U7MYU6      LF---KIDR-TAF--L-------TG-LG------------E-EIE--QLRPLVD--AQNP
A0A1D8TNX9      LF---KIDR-TAF--L-------TG-LG------------E-EID--QLRPLVD--AQNP
A0A6P0L6C2      LF---KIDR-TAF--L-------TG-LG------------E-EID--QLRPLVD--AQNP
A0A6P0MVH0      LF---KIDR-TAF--L-------TG-LG------------E-EID--QLRPLVD--AQNP
A0A6P0KJV0      LF---KIDR-TAF--L-------TG-LG------------E-EIE--QLRPLVD--AQNP
A0A6L9ZJG4      LF---KIDR-TPF--L-------TG-LG------------E-EIE--QLRPLVD--AQNP
F4XKF3          LF---KIDR-TAF--L-------TG-LG------------E-EID--QLRPLVD--AQNP
A0A1D9FX10      LF---KIDR-TAF--L-------TG-LG------------E-EID--QLRPLVD--AQNP
A0A6P0Q0T0      LF---KIDR-TAF--L-------TG-LG------------E-EID--QLRPLVD--AQNP
A0A6P0W5I0      LF---KIDR-TAF--L-------TG-LG------------E-EID--QLRPLVD--AQNP
A0A3C0NJ41      LF---KVNR-TAS--L-------TG-VGQVERLEGGQTAQQ-PVG--GLGALTQ--TGNP
A0A352AG88      LF---KVSR-TAD--L-------TG-VG------------Q-QVG--ELAPLTT--NSNP
A0A350Y374      LF---KVNR-TTS--L-------TG-LG------------K-EVG--NFAPLTT--DSNP
A0A355DPX0      LF---KVNR-TTS--L-------TG-LG------------K-EVG--NFAPLTT--DSNP
                                                                            

K9SLA9          TIPPGDRLANEAAVIKSNAIAKEVVGVLNQ------------------------------
A0A168TT23      QF-----YQTQYEILRGRQLAENVVEKLEVWDHPELSGEISQRNLYRELRALPGRLVQLI
A0A0M1JWX9      -------YQSQIALLRSPKLMEPIIQQLKP------------------------------
A0A2T1M1V6      -------LYTQSAILMSDSVLGRVLT--------------VDP-----------------
A0A2G7GCS2      -------LQIQMTILTSDTVMERALA--------------VDP-----------------
K9XBH8          -------LQTQLSILTSDTVMQRVLS--------------VDP-----------------
A0A1Z4LJ30      -------LNILSSVAMSDRVIQEVWQ--------------NDP-----------------
K9RI76          -------LNILSSIATSDHVVEEVWQ--------------NDP-----------------
A0A352AE27      -------LKVQAYILTSDALMQRLWA--------------SDT-----------------
A0A3B8JH60      -------LKVQASILTSDELLQKARA--------------IDP-----------------
A0A3C0N766      -------LKVQASILTSDELLQKARA--------------IDP-----------------
K9W9J7          -------LKVQASILTSDALLEQVLV--------------SDP-----------------
A0A139WSU3      -------LNVQASILTSDTLLEKVLA--------------SDP-----------------
A0A433VN22      -------LKVQTSILMSDALLEKVLD--------------SDP-----------------
Q7NF11          -------LKVQSAILTSSEVLSKAWQ--------------ADP-----------------
A0A1Z4JCS8      -------LKIQEAILTSDAILEKAWA--------------ADP-----------------
A0A6P0PI80      -------LNMQASILKSDALMRRLLE--------------SDP-----------------
A0A6P0WGT6      -------LNMQASILKSDALMRRLLE--------------SDP-----------------
F4XTX2          -------LNMQASILKSDALMRRLLE--------------SDP-----------------
Q7NJN6          -------TSIQSNILLSSDVLRPVWQ--------------KDP-----------------
U5QCC3          -------TTIQSNILLSDSVLRRVWL--------------KDP-----------------
A0A0S3TYD7      -------LTTQAELIKSLPIVQRTIEDLNL----------QDD-----------------
A0A2T1DNG3      -------YATQISLMQSSNLLKKAMTLLQT------------------------------
A0A3S0Y9N9      -------MGTEVAVLRSLPIAERTINALSL------------------------------
A0A433UNK7      -------LGTEVAVLRSLPLAEQTINAIRL------------------------------
A0A6P0ZKB8      -------LGTEVAVLRSIPLAERTINTLGF------------------------------
U5QL42          -------LETEIQILKSRSLIGRAIHRLAPP-----------------------------
A0A140K3H3      -------LSTEVLVLRSYPLIAKAVKQVQQK-----------------------------
K9XUB8          -------LSTEILVLRSYPLIAKAVEKVQQE-----------------------------
A0A6H2NHD5      -------YTSQIRVLRSPGVINPILESIQQR-----------------------------
A0A2P8W4F7      -------YDSQIRVLRGPAVIEPILADIQRR-----------------------------
A0A5Q4E0Z4      -------YTSQIRVLRGPDVINPILANIQRQ-----------------------------
A0A2P8VVX1      -------YATQLALMRSGQFLQEAVDVLRTD-----------------------------
A0A2P8WHY0      -------YNTQLTLMRSEQFLREAVASLEAE-----------------------------
A0A2T1CMT9      -------YTTQIKVLTSHEILQRVVNQLKLKDQRSEQASSSYGG----------------
A0A7G8J1V5      -------IPTLIELLRSPLLLKPVADQL--------------------------------
A0A354B169      -------LPTLIEVLRSPMLLNPIAQHF--------------------------------
Q0IDT5          -------IPTLIEVLESPLLLAPIAKRF--------------------------------
A0A7G8FZD9      -------LPTLIELLQSPLLLSPIAERF--------------------------------
G4FMX5          -------LPTLIELLQSPLLLSPIAERF--------------------------------
A0A7G8FAU7      -------IPTLIEVLQSPLLLAPIAKRF--------------------------------
A3ZA21          -------IPTLIEVLQSPLLLAPIAKRF--------------------------------
A0A076HBF2      -------IPTLIEVLQSPVLLQPVADKF--------------------------------
A0A7G8FP50      -------TPTLIEVLRSPLLLRPLADQF--------------------------------
A0A7G8E8K7      -------IPTLIEVLQSSVLLKPVADQF--------------------------------
A0A7G8GAH0      -------IPTLIEVLQSPVLLQPVADKF--------------------------------
A0A7G8GNR2      -------IPTLIEVLKSPVLLQPVADKF--------------------------------
A0A7G8ICD3      -------IPTLIEVLQSPVLLQPVAEKY--------------------------------
A0A2D6FCW3      -------IPTLIELLQSPLLLSPIAQRY--------------------------------
A0A7G7KJ95      -------IPTLIEVLQSPLLLGPIARRF--------------------------------
A0A7G8EAN3      -------IATLIEVLRSPLLLSPIAKRF--------------------------------
A0A563VQJ3      -------LKNEIEKITASPVLQETIDQL--------------------------------
A0A1D8TX52      -------YATQLQLMGSSELIQRAVDLLRDD-----------------------------
A0A1D9G4T2      -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
A0A6P0PR27      -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
A0A6P0WER7      -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
F4XP71          -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
A0A6L9YR57      -------YATQLQLMGSSELIQRAVDLLRDD-----------------------------
A0A6P0KZ31      -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
A0A6P0LPB8      -------YATQLQLMRSSELIQRAVELLRDD-----------------------------
A0A6P0SEV1      -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
A0A6B3N2I8      -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
A0A6M0B891      -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
A0A6P0IJQ1      -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
A0A6P0J8J8      -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
A0A6P0ZSH6      -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
A0A1U7N5X9      -------YATQLQLMRSSELMKRAVELLRDD-----------------------------
A0A6L9Z1V0      -------YATQLQLMRSSELIQRAVELLRDD-----------------------------
A0A6P0LC12      -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
A0A6P0MVJ3      -------YATQLQLMRSSELIQRAVDLLRDD-----------------------------
A0A2W6ZAV2      -------TPVLIEVLTSPLLLEPIAQRL--------------------------------
K9W742          -------SATQLNLMQGSQLLQKALDLLRPD-----------------------------
A0A3D1PBA3      -------YATQINVMRSSLLLQRAADILRPE-----------------------------
K9XPB0          -------YPTQLKLMRSSYLLKKVVKKLGVE-----------------------------
A0A350Y7Z1      -------YATQLNLMRSSQLIQKAVDRLHPK-----------------------------
A0A352X2A7      -------YTTQINLMRSSQLIQRAVNLLQDK-----------------------------
A0A0D8ZYV0      -------YATQINVMRSTLLLQRAVDLLKPE-----------------------------
A0A2T1FP73      -------YATQINVMRSSLLIQRAVDILRSE-----------------------------
A0A433VMS2      -------YATQINVMRSSLLIQRAVDILRSE-----------------------------
K9TYA7          -------YATQINVMRSSLLIQRAVDILRSE-----------------------------
A0A2P8QUE1      -------YATQINVMRSSLLIQRAVDILRSE-----------------------------
K9SA61          -------YSTQLQLMKSSQLLQRAVDQLKPT-----------------------------
A0A2G7GMH8      -------IATQINLMSSSILLQRAVSLLQPE-----------------------------
A0A6N8FU92      -------IATQINLMSSSILLQKAVYLLQPK-----------------------------
A0A2T1DWE8      -------YSTQLTQMRSSQLLQKAVVLLQAE-----------------------------
A0A1U7I8L3      -------YATQLNLMRSSQLIQKAVDLLRPQ-----------------------------
A0A2T1DJL8      -------NATQLNLMRSSQLLQRAVDQLKLN-----------------------------
A0A1Z4J9W0      -------AATQVNLMRSGQLLQRAVDQLKPR-----------------------------
A0A0N7Z5K9      -------TATQVNLMRSTQLLQRAVDELQPR-----------------------------
A0A0S3TXC5      -------TATQVNLMRSTPLLQRAVDELKPR-----------------------------
B8HNB0          -------LINEIQVLQSSSLVTKAQQQLKP------------------------------
A0A563VS48      -------LATEAEILRSRPILEKLIKELDL----------RDE-----------------
A0A318BJ18      -------YETQYGLLRSRALSERVATQLRLVDDPKFYEMYKFNSDDPAFQLVNGRYTSTG
A0A3B8Y8H9      Y------FLTQIQILYSYKIIAPVLEKLNK-----VFPPETEE-----------------
A0A2W1JVB9      -------LDTEIETILSVPVLQEALKQLKL----------TDD-----------------
A0A3M1SVZ4      -------LDTEAEIISSVPIVEQTIAALQL----------KNS-----------------
A0A6H1U102      -------RSTEIQILQSHSLVAKAISRLED------------------------------
A0A7C3ZEJ3      -------LSTEIQILQSRSLVSKAVAQLEN------------------------------
A0A563VLD6      -------LSTEILVLRSNSLISQAIAQYPN------------------------------
A0A2P8W9H0      -------DETRLRILTSPRVIEPILKELQK------------------------------
A0A6I5P386      -------DETTLKILESPRVMKPILEELQK------------------------------
A0A654SFI6      RVSELQYLNTQYELLESRFMATRVADAASLETDPAFIEAFDLD-----------------
A0A318BG22      RPSDSMFMETQLAFIRSRAMAEGIVKRLHLDQNDAFVDDAATG-----------------
K9SSQ0          -------LSTQAAILASRPLIETALPKIPA-----NLSTNLSK-----------------
A0A2W1JIN9      -------LANQEEIVSSKRLLERAL----------QSYRQQWD-----------------
A0A318AJV1      -------METEAGLMASRGLAVAVVRKLHLDR---DPEFASPS-----------------
A0A6P0IC70      -------IANQAELVKSQRILQQAIDQVFS-----QYVSNLVT-----------------
A0A6B3MUB5      -------IANQAELVKSQRILQQAIDQVFS-----QYVSNLVT-----------------
A0A6M0B7N4      -------IANQAELVKSQRILQQAIDQVFS-----QYVSNLVT-----------------
A0A6P0J9W3      -------IANQAELVKSQRILQQAIDQVFS-----QYVSNLVT-----------------
A0A6P0ZWE1      -------IANQAELVKSQRILQQAIDQVFS-----QYVSNLVT-----------------
A0A1U7N2U4      -------IATQAELVGSQRVLQGALYQI-------GILGSSPE-----------------
A0A1D9G1F2      -------IATQAELVGSERLLQGALDEI-------ALLGSSQE-----------------
A0A6P0PNZ7      -------IATQAELVGSERLLQGALDEI-------ALLGSSQE-----------------
F4XV38          -------IATQAELVGSERLLQGALDEI-------ALLGSSQE-----------------
A0A6P0W137      -------IATQAELVGSERLLQGALDEI-------ALLGSSQE-----------------
A0A6L9Y9E2      -------IATQAELVGSERVLQRALDEI-------ALLGTSDE-----------------
A0A6P0SGR0      -------IATQAELVGSERVLEGALYQI-------GILGSSQE-----------------
A0A6M0BK48      -------IATQAELVGSERVLQGALDEI-------ALLGSSPE-----------------
A0A6L9YZL1      -------IATQAELVGSERVLQGALDEI-------ALLGSSPE-----------------
A0A6P0KYM4      -------IATQAELVGSERVLQGALYQI-------ALLSSSPE-----------------
A0A6P0LSD6      -------IATQAELVGSERVLQGALYQI-------ALLSSSPE-----------------
A0A6P0X384      -------LATQVELIKSQPVLLRTINQLFP----------NEE-----------------
A0A2P8QIL5      -------VATQAELALSQKVLRQAIYEAYT-----ANNRNSNA-----------------
A0A2T1FLY5      -------VATQAELALSQKVLRQAIYEAYT-----ANNRNSNA-----------------
A0A433W447      -------VATQAELALSQKVLRQAIYEAYT-----ANNRNSNA-----------------
K9U1K8          -------VATQAELALSQKVLRQAIYEAYT-----ANNRNSNA-----------------
K9UYB2          -------LANQAEVVKSERVLQKALEIASA-----KTSPETLN-----------------
A0A218QN17      -------LANEAELVKSQRVLERAIALASL-----KSYNGSPP-----------------
K9RKN2          -------LADQAELVKSQRVLEKAIKIFSS-----QYKIKNDQ-----------------
A0A2I8ADV2      -------LADQAELVKSQAVLDQAIKTLA---------SKHPQ-----------------
A0A1W5CKM3      -------LADQAELLKSQTVLQLAISKLNP-----PIKDSSTQ-----------------
A0A5Q0GMF5      -------LADQAELLKSQTVLQLAISKLNP-----PIKDSSTQ-----------------
Q3MEW0          -------LADQAELLKSQTVLQLAISKLNP-----PIKDSSTQ-----------------
A0A1Z4KIC7      -------LADQAELLKSQTVLQLAISKLNP-----PIKDSSTQ-----------------
Q8YSM5          -------LADQAELLKSQTVLQLAISKLNP-----PIKDSSTQ-----------------
A0A1Q4S1H4      -------LGDQAELIKSQQVLEKALTALKA-----NSQTASQA-----------------
A0A433VBU6      -------LADQAELIKSQQVLEKALTALKA-----NPQTASSS-----------------
A0A1Q4RZJ6      -------LANQAELIKSERILTQALAIAGN-----SDGGQNGS-----------------
A0A1Z4SNV3      -------LANQAELIKSERILNQALAI--------AETSEAGR-----------------
A0A2H2XJQ1      -------LANQAELIKSERILNQALAI--------AETSEAGR-----------------
A0A3S5K358      -------LANQAELIKSERILTQALAIVGNSDVENSEDGQNGS-----------------
A0A0T7BPJ4      -------LADQAELVKSEKVLEKAIAATYP-----PG----VK-----------------
A0A0C1QS61      -------LADQAELVKSQRVLNRALQIFKS-----SYK---ST-----------------
A0A139X3R8      -------LADQAELAKSQRVLNRALQIFQS-----SHK---TN-----------------
A0A1Z4I7C5      -------LADQAEFLKSQPVLQLAISKLNR-----QQG-NSTQ-----------------
A0A0C2MDK7      -------LADQAELIKSQRVLERAIAIAFP-----QTKGNLSL-----------------
A0A1Y0RCK1      -------LADQAELIKSQRVLERAIAIAFP-----QIKGNLSQ-----------------
A0A1Z4PWZ0      -------LADQAELVKSQRVLERAIAIAFP-----EIKGNLSL-----------------
A0A0C2QLT0      -------LADQAELIKSQRVLERAIAIAFP-----EIKGNLQR-----------------
A0A1Z4J2K1      -------LADQAELIKSQRVLEQAVAIAFP-----EIKGNLQR-----------------
A0A3S0ZSX0      -------LADQAELIKSQRVLRRAIARVIP-----QLNSSSLS-----------------
A0A2N6K4T3      -------LADQAELIKSQRVLQRALTEVTA-----ESGFRSPE-----------------
A0A370CKT2      -------LADQAELIKSQRVLQRALTEVTA-----ESGFRSPE-----------------
A0A0S3TL97      -------LADQAELIKSQRVLQRALTEVTA-----ESGFRSPE-----------------
A0A2N6M8A0      -------LADQAELIKSQRVLQRALTEVTA-----ESGFRSPE-----------------
A0A2N6M9E1      -------LADQAELIKSQRVLQRALTEVTA-----ESGFRSPE-----------------
A0A2N6KJI4      -------LADQAELIKSQRVLQRALTEVTA-----ESGFRSPE-----------------
A0A2N6MZ77      -------LADQAELIKSQRVLQRALTEVTA-----ESGFRSPE-----------------
A0A2N6KT20      -------LADQAELIKSQRVLQRALTEVTA-----ESGFRSPE-----------------
G6FSN3          -------LADQAELIKSQRVLQRALTEVTA-----ESGFRSPE-----------------
A0A4D9CI02      -------LADQAELIKSQRVLQKALAKVAA-----ESGFSSPE-----------------
A0A328I8B9      -------LADQAELIKSQRVLQKALAKVAA-----ESGFSSLE-----------------
A0A4Q9J4Z7      -------LADQAELIKSQRVLQKALAKVAA-----ESGFSSVE-----------------
A0A0M0SU69      -------LADQAELIKSQRILQKALTKVAA-----ESGFSLPE-----------------
A0A1Z4TIZ8      -------LADQAELIKSQRVLQKALAKVSA-----ESGFSPPG-----------------
A0A2T1E9V8      -------LNTESRLILSENILRKILDIVNE----------NSS-----------------
A0A1Z4LN32      -------LDTQAIILQSEPIIKDVVKSLEL----------KGN-----------------
A0A2I8A9F5      -------LDTQALLVRSKPILEEVVNTLNL----------KDK-----------------
A0A218Q6R8      -------LDTQALLVRSTPIIEDVINTLEL----------KDQ-----------------
A0A218QGE0      -------LDTQAIVMQSEPVMQDAIETLKL----------KDK-----------------
A0A3M2GQQ6      YPGPQKDLSTEIQILRSHALVAKAIAALGD----------TDN-----------------
A0A6H1U2X0      YPGPQKDLSTEIQILRSHALVAKAIAALGD----------TDN-----------------
K1XF69          -------LSTQIELMYSNPLLETVIERLNL----------TNE-----------------
B5W297          -------LSTQIELMYSNPLLETVIERLNL----------TNE-----------------
A0A6H2AL05      -------LSTQIELMYSNPLLETVIERLNL----------TNE-----------------
H1W7M8          -------LSTQIELMYSNPLLETVIERLNL----------TNE-----------------
A0A5Q4H6A5      -------LSTQIELMHSNPLLETVIERLNL----------TNE-----------------
D5A466          -------LSTQIELMHSNPLLETVIERLNL----------TNE-----------------
U5QJM6          -------INTQLQVLLSRPLVNKAVVRLSK----------KYP-----------------
A0A1Z4RPC6      -------LSTEKLRITSEPVLQQTIDQLKL----------VDA-----------------
A0A2T1CMZ0      -------LSTEKLRMISEPVLQQTIDQLKL----------ENS-----------------
L8M4F7          -------LHNQREQIFTSAVLQQTVENLDL----------KNE-----------------
A0A140K2P2      -------LSTQIEVITSDPVLQQTIDQLKL----------VDD-----------------
K9XWX4          -------LSTQIEVITSTPVIQQTIDKLKL----------QDD-----------------
A0A140KB14      -------LKTEIERMKAEPILVQTIEKLKL----------KDE-----------------
K9XX88          -------LKTEIERMKTEPILVQTIEKLKL----------KDE-----------------
A0A563VSV6      -------LLTQQEVISSAPVLQQTIEILKL----------TNE-----------------
L8LZE9          -------LVSQKEILTSSPILQKTIDQLSL----------TDA-----------------
A0A433NM31      -------VNTQAEIINSVAFAQRTINELDL----------KNE-----------------
A0A1Z4NDS1      -------SDTQVKIITSNQVIQETIQRLGL----------KDS-----------------
U9VXM0          -------LDTQIEVFGSIPLVQQVIEQLKL----------QND-----------------
A0A6M0RI13      -------LDTQIEVFRSIPLVQKVIETLKL----------QDD-----------------
A0A6M0S1N5      -------LDTQIEVFRSIPLVQKVIETLKL----------QDD-----------------
K9F4D9          -------LDTQIEVFRSIPLVQKVIETLKL----------QDD-----------------
A0A6I5QPI5      -------LDTQAELIRSLPLMQATVDALGL----------TTS-----------------
A0A1Z3HMQ0      -------LSTQAAILSSLPVLQEAVNALDL----------QDA-----------------
A0A433W533      -------VNTEIEVVRSIPLLQKTIAALNL----------KDD-----------------
A0A2P8QWJ3      -------VNTEIEVVRSIPLLQKTIAALNL----------KDD-----------------
A0A2T1FKP8      -------VNTEIEVVRSIPLLQKTIAALNL----------KDD-----------------
K9U6L7          -------VNTEIEVVRSIPLLQKTIAALNL----------KDD-----------------
A0A1E5QP61      -------LDTEAEVISSMPIVKETVEALNF----------RDD-----------------
U5DPF5          -------LANEAAIIRSLPIGQQVIERLDI----------RNA-----------------
A0A6P0X488      -------LDTEAQVITSRPLVEKTIEQLDL----------KNK-----------------
A0A6P0UVD5      -------LDTEAQVITSRPLIEKTIEQLDL----------KNK-----------------
A0A6P0VDM0      -------LDTEAQVITSRPLIEKTIEQLDL----------KNK-----------------
A0A6M0G142      -------LDTEAQVITSRPLIEKTIEQLDL----------KNQ-----------------
A0A6P0MR53      -------LDTEAQVITSRPLIEETIKQLEL----------RNQ-----------------
A0A3M2GIL5      -------LDTEAEIISSTPIIEQTIAELQL----------KGP-----------------
A0A6H1TSJ9      -------LDTEAEIISSTPIIEQTIAELQL----------KGP-----------------
A0A3M1PML8      -------VDSQAQIIQSAPIVSEVIRSLDL----------RDE-----------------
A0A6M8BE85      -------VDSQAQIIQSAPIVSEVIQSLDL----------RDE-----------------
A0A0T7BPZ0      -------VETQAKIVASVPVIQKTIRSLDL----------KDN-----------------
A0A352X442      -------IATAAAIVKSRPIAEKTVAELNL----------RDE-----------------
A0A6B3NF44      -------LATQAEIIRSRPIAQKTIEILQL----------KDE-----------------
A0A6M0EPL4      -------LATQAEIIRSRPIAQKTIEILQL----------KDE-----------------
A0A6P0K6L6      -------LATQAEIIRSRPIAQKTIEILQL----------KDE-----------------
A0A6P0MRR9      -------LATQAQVVLSRPIAENTVKDLNL----------QDE-----------------
A0A6P0UX57      -------LATQAQVVLSRPIAEKTVKKLDL----------RDE-----------------
A0A6P0X1X4      -------LATQAQVVLSRPIAEKTVKKLDL----------RNE-----------------
A0A0M0SHU3      -------VDTQAKIVISVPVIQETITSLSL----------KND-----------------
A0A1D2PBN3      -------SDTQAKIVASVPVIQETITELDL----------RDN-----------------
A0A0C2LVR7      -------SDTQAKIVASVPVIQETITELDL----------RDK-----------------
A0A1Z4PQB9      -------SDTQAKIVVSVPVIQETITELDL----------RDD-----------------
A0A1Z4SFN6      -------LETQAKIVESVPVIQETIRTLNL----------KDD-----------------
K9PGI8          -------SDTQAKIVVSVPVIQETIRVLKL----------KNE-----------------
K9TLQ0          GKGEILDYETQMEVLLSSPIINPIFTNIQQ----------NYP-----------------
K9QF04          -------FKTEIEVLASYKVISPLLPTIQS----------RYP-----------------
K9W1T3          -------INTQAELINSIPVAQETIATLNL----------S-------------------
K9SGJ5          -------LDTEIAILKSRSLIEPAVAQLDN----------IDP-----------------
A0A6N2JS94      -------LGTEIAILKSRPLIEIAVSKMHQ----------SPS-----------------
A0A6C2DSN4      -------LGTEIGILKSRPLIESAIAKMRQ----------SSD-----------------
L8MYT6          -------LGTEIGILKSRPLIESAIAKMRQ----------SSD-----------------
A0A352JGJ6      -------LGTEIGILRSRPLIEVAVTKIKQ----------SSA-----------------
A0A1J5GLS2      -------LGTEIGILRSRPLIEVAVAKMKQ----------SPT-----------------
A0A2W4W6M5      -------LGTEIGILRSRPLIEVAVSKMRQ----------SPS-----------------
A0A2W7AN33      -------LGTEIAILKSRPLIETAVCKMQQ----------SPT-----------------
A0A256BLV2      -------LGTEVAILKSRPLIEIAVSKMQQ----------SPS-----------------
A0A2W6ZXF3      -------LGTEIGILRSRPLIEIAVAKMRQ----------SPT-----------------
A0A2Z5WX66      -------LGTEIGILRSRPLIEVAVAKLQQ----------SAS-----------------
Q7NEU3          -------INTQIEVLLRRPLIEKALRVLRP----------KFP-----------------
A0A3C0N2P0      -------YDTQIQVLWSPQVLSKIVKEIQT----------RYP-----------------
A0A6P0JR04      -------YETQVEVLRSPTVMRPIVEKIQE----------KYP-----------------
A0A6B3M6M6      -------YESQIEVLKSPQVMSPIVESIQA----------RYP-----------------
A0A6P0KD09      -------YESQIEVLRSPQVMLPIVESIQA----------RYP-----------------
A0A6B3NIJ0      -------YESQIEVLRSPQVMLPIVESIQA----------RYP-----------------
A0A6M0F053      -------YESQIEVLRSPQVMLPIVESIQA----------RYP-----------------
A0A6P2ATU9      -------YETQIEVLRSPAVLAPIIEQIQT----------QYP-----------------
A0A352XE00      -------YETQIQVLWSSQIMIPIVKKIQA----------QYP-----------------
A0A6P0QC14      -------YETQIQVLWSPQVISPILKNIQA----------QYP-----------------
B4VS56          -------YETQIQVLWSPQVMTPIVEQIQS----------RYP-----------------
A0A352AAQ3      -------YETQIQVLWSPQVMAPIVKKIQA----------RYP-----------------
A0A350Y472      -------YETQIQVLWSPQVMAPIVAQIQS----------RYP-----------------
A0A355DVB4      -------YETQIQVLWSPQVMTPIVKQIQS----------RYP-----------------
A0A1Z4RMB9      -------LTTQIQVLRSEPVVQQVIDQLKL----------TDN-----------------
A0A318B4H2      -------YETQYNLLKARSLAERVARVLGL----------QNDDKFFAMYGGEEPSAAAP
B4WQE3          -------DDTKLKILTSPRVLVSAVEELEK----------TYP-----------------
A0A2K3BR24      -------LTNQSQIMQSAPMLQEVIDRLGL----------KND-----------------
K9YXY1          -------LTNQSQIMQSAPMLQEVVDRLGL----------KND-----------------
A0A1Q4RTR1      -------LETQAEIIRSQPVIQKTIDILEL----------KNK-----------------
A0A1Z4SQV2      -------LETQAEIIRSQPLVQKTIDTLEL----------RNN-----------------
A0A2H2XGN1      -------LETQAEIIRSQPLVQKTIDTLEL----------RNN-----------------
A0A433UXH8      -------LETQAELIRSQPLVQKTIDALEL----------KNS-----------------
A0A0V7ZFJ4      -------LATEAQIIRSRPIIQKTISKLNL----------RDS-----------------
A0A0V7ZNJ9      -------LETEAKVIRSNPIIQKTIDKFNL----------RDD-----------------
A0A367RIS1      -------LETEAEIIRSNPLTQKTIAELHL----------KDK-----------------
A0A235IXQ2      -------LETEAEIIRSYPLTKKTIAELQL----------KDK-----------------
A0A1W5CNX3      -------LETEAEIIRSNPIIQKTIAESQL----------KDE-----------------
A0A5Q0GJJ5      -------LETEAEIIRSNPIIQKTIAESQL----------KDE-----------------
Q3MEB7          -------LETEAEIIRSNPIIQKTIAESQL----------KDE-----------------
A0A1Z4KHN9      -------LETEAEIIRSNPIIQKTIAESQL----------KDE-----------------
Q8YT70          -------LETEAEIIRSNPIIQKTIAESQL----------KDE-----------------
A0A166IWU6      -------LETQAEIIRSHPLIQKTIVDLQL----------KDQ-----------------
A0A2S0Q8C0      -------LETQAEIIRSHPLIQKTIVDLQL----------KDQ-----------------
W6FSX4          -------LETQAEIIRSHPLIEKTIVDLQL----------KDQ-----------------
A0A218Q4C1      -------LDTQAEIIRSHPLIQQTIDNLQL----------KNQ-----------------
A0A6P1ZT04      -------LETQAEIIRSHPLIQKIIDELQL----------KDQ-----------------
A0A5P8VSD1      -------LETEAEIIRSHPLTQKIIDELHI----------KDN-----------------
A0A1S1ZVW2      -------IDTEAEVIRSHPLITKTINQLGT----------KNT-----------------
A0A0R0M9H9      -------IDTEAEVIRSHPLITKTINQLGI----------KNT-----------------
A0A7H0F4U6      -------IDTEAEVIRSHPLITKTINQLGI----------KNT-----------------
A0A1B7WX82      -------VDTESEIIRSYPIIIKTITTLKL----------TDD-----------------
A0A1B7WTD1      -------VDTEAEVIRSNPIISKTINDLKL----------KGK-----------------
A0A480ABC0      -------VDTEAEVIRSNPIVTKTITELKL----------KGR-----------------
A0A1Z4LRU5      -------LDTEAEVIQSHPLIKETITKLNL----------INE-----------------
A0A1Z4JVB4      -------VDTEAEVIRSYPIIQKTITTLKL----------KDK-----------------
K9PIA4          -------VDTEAEVIRSYPIINKTITTLNL----------KDE-----------------
A0A1Z4HVE1      -------VDTEAEVIRSNPIVLKTITSLNL----------KDK-----------------
A0A252ECZ1      -------VDTEAEVIRSNPIVQKTITSLNL----------KDK-----------------
A0A1Z4G5Y1      -------VDTEAEVIRSNPIVQKTIASLNL----------KDK-----------------
A0A252DNA2      -------VDTEAEVIRSNSIVQKTITSLKL----------KDK-----------------
A0A252E1Q4      -------VDTEAEVIRSNSIVQKTITSLKL----------KDK-----------------
A0A6G9SK36      -------VDTEAEVVRSNPIVQKTIISLNL----------KDR-----------------
A0A1Z4M597      -------VDTEAEVIRSNPIVLKTITSLDL----------KDK-----------------
A0A1Z4MWT1      -------VDTEAEVIRSNPIVLKTITSLNL----------KDK-----------------
A0A1Z4TX53      -------VDTEAEVIRSNPIVLKTITSLNL----------KDK-----------------
A0A2A2TNQ5      -------LETEAEIIRSNPLVKKIVNELEM----------QDK-----------------
A0A3S1C4K5      -------LDTEAEVIRSNPLVKKTISELEL----------KDK-----------------
A0A1X4G3D5      -------LENEAEVIRSRPMLEQLVETLEL----------QDD-----------------
D4TNI2          -------LENEAEVIRSRPMLEQLVETLEL----------QDD-----------------
A0A1Z4H6Z8      -------VDTEAEVIRSNPIIQKTITSLNL----------KDK-----------------
A0A1Z4NPM1      -------LDTEAEVIRSTPSVQKTIEKFQL----------RTP-----------------
A0A3F3KPR9      -------IDTEAEVIRSHPLITKTINQLGI----------KNT-----------------
D4TGN7          -------IDTEAEVIRSHPLITKTINQLGI----------KNT-----------------
A0A1Z4UZW9      -------VDTESEIIRSYPIVNKTITTLKL----------TDD-----------------
A0A0K2M5H0      -------VDTESEIIRSYPIVIKTITTLKL----------TDN-----------------
A0A1B7VSH4      -------VDTESEIIRSYPIVIKTITTLNL----------TDD-----------------
A0A1B7W126      -------VDTESEIIRSYPIVIKTITTLNL----------TDD-----------------
A0A3D4C6Q6      -------VDTESEIIRSYPIVIKTITTLNL----------TDD-----------------
A0A1B7UVJ4      -------VDTESEIIRSYPIVIKTITTLNL----------TND-----------------
A0A1B7UTR1      -------VDTESEIIRSYPIVIKTITTLNL----------TND-----------------
K7W0A4          -------VDTESEIIRSYPIVIKTITTLNL----------TND-----------------
A0A5C0DRW9      -------VDTESEIIRSYPIVIKTITTLNL----------TND-----------------
A0A6H2C088      -------VDTESEIIRSYPIVIKTITTLNL----------TND-----------------
A0A1U7HGH0      -------LATEAKVIRSIPILQQALEQINE----------ASQ-----------------
K9XJD3          -------LATEAKVIRSVPILQQALEQINE----------ASQ-----------------
K9SX01          -------RYTQLQVIRSTPVVAQTIKAL--------------------------------
A0A4P7ZT55      -------LPNLIEVLTSPMLLQPLANAQGL------------------------------
A0A1E5QIR9      -------LDTEVAIVRSVATSEGVMQALDL----------RDE-----------------
A0A6P1A9A0      -------YETQIQVLSSPKVLSPILEKIKA----------EYP-----------------
A0A1Z4IBC7      -------LETQVRIIGSNPVLERTINTLNL----------KEA-----------------
A0A1W5CPC7      -------LETQVRIIGSNPVLEQTIKALNL----------KDK-----------------
A0A5Q0GKD1      -------LETQVRIIGSNPVLEQTIKALNL----------KDK-----------------
Q3MDC6          -------LETQVRIIGSNPVLEQTIKALNL----------KDK-----------------
A0A1Z4KM73      -------LETQVRIIGSNPVLQQTIKALNL----------KDQ-----------------
Q8YNX7          -------LETQVRIIGSNPVLQQTIKALNL----------KDQ-----------------
A0A367R4K6      -------LETQVKIVGSNPVLEQTIKELNL----------TDN-----------------
A0A1E2WSV8      -------LETQVRVIGSNPVIEKTINSLKL----------KDS-----------------
A0A7D7L9Y1      -------LETQVRVIGSNPVIEKTINSLKL----------KDS-----------------
A0A2R5FRT9      -------LETQVRVIGSNPVIEKTINSLNL----------KDS-----------------
A0A2K8T1B6      -------LETQVRVIGSNPVIEETINSLNL----------KDS-----------------
A0A235I9I0      -------LETQVRVIGSNPVIEKTINSLNL----------KDG-----------------
A0A2D0HQT8      -------LETQVRVIGSNPVIEKTINSLNL----------KDS-----------------
A0A2L2NU95      -------LETQVRVIGSNPVIEKTINSLNL----------KDS-----------------
A0A367S084      -------LETQVRVIGSNPVIEKTINSLNL----------KDS-----------------
A0A1Z4SMD6      -------LETQAVILNSEPIIQKVINTLKL----------KDK-----------------
A0A2H2Y096      -------LETQAVILNSEPIIQKVINTLKL----------KDK-----------------
K9S8M8          -------LDTEAEVIRSTPIAEEVITSMGL----------RSS-----------------
A0A1Z4NFV0      -------LSTQAVVLQSRPILEQVIAKLNL----------RDR-----------------
A0A3M9ZEU1      -------VETQAEIVRSAAIARATIEALDL----------RDD-----------------
A0A1Z4JK72      -------LDTQAVVVTSYPILQRVIDTLQL----------KNS-----------------
A0A0N7Z489      -------LDTQAAVVTSYPILQRVIDTLQL----------KNA-----------------
A0A0S3TXS2      -------LDTQAAVVTSYPILQRVIDTLQL----------KNS-----------------
A0A2A2TPF8      -------LSTQAVILQSRPILQAVVEKLNL----------RDK-----------------
A0A1Z4R0P8      -------LSTQAVILQSRPILQAVIERLNL----------RDD-----------------
A0A0T7BUI3      -------LNTQAVIVNSQPVIKEVIKTLNL----------KDN-----------------
A0A1Z4LP32      -------LETQAVVIQSEPILQEVIDTLNL----------KDD-----------------
K9REP9          -------LETQAVIVQSEPILQKVIDTLNL----------KDD-----------------
A0A1Z4SIJ3      -------LETQAVIVDSEPVLEEVIRTLDL----------KDK-----------------
A0A2H2XPG4      -------LETQAVIVDSEPVLEEVIRTLDL----------KDK-----------------
K9V3C7          -------LSTQAAILESRPIVQEVIQALDL----------KDN-----------------
A0A1Z4T6Y7      -------LSTQAEILQSRPILEAVIKKLDL----------RDK-----------------
A0A2H2Y561      -------LSTQAEILQSRPILEAVIKKLDL----------RDK-----------------
A0A1Q4S362      -------LSTQAEILQSRPILEEVIKKLDL----------RDK-----------------
A0A3S1CIN8      -------LSTQAEILQSRPIIEEVIKKLDL----------RDK-----------------
A0A2A2TC28      -------LQTQAVIVNSQPILQEVINNLNL----------KDK-----------------
A0A0C1NCB0      -------SDTQAVVVTSAPILQQVIDKLAL----------KNN-----------------
A0A2N6K7Q9      -------LETQAVIVNSHPMLQEVITSLQL----------KDE-----------------
A0A2N6MXH6      -------LETQAVIVNSHPMLQEVITALQL----------KDD-----------------
A0A2N6M5A8      -------LETQAVIVNSHPMLQEVITALQL----------KDD-----------------
A0A2N6LL61      -------LETQAVIVNSHPMLQEVITALQL----------KDD-----------------
A0A0S3TP66      -------LETQAVIVNSHPMLQEVITALQL----------KDD-----------------
G6FP91          -------LETQAVIVNSHPMLQEVITALQL----------KDD-----------------
A0A1U7GYR5      -------LETQAVIVNSHPMLQEVITALQL----------KDD-----------------
A0A2N6KY52      -------LETQAVIVNSHPMLQEVITALQL----------KDD-----------------
A0A2N6KMP5      -------LETQAVIVNSHPMLQEVITALQL----------KDD-----------------
A0A2N6MA45      -------LETQAVIVNSHPMLQEVITALQL----------KDD-----------------
A0A4Q9J9V9      -------LETQAVIVNSHPMLQEVITALDL----------KDE-----------------
A0A328IGA1      -------LETQAVIVNSHPMLQEVITALDL----------KDE-----------------
A0A4D9CE41      -------LETQAVIVNSHPMLQEVITALDL----------KDE-----------------
A0A0M0SFT2      -------LETQAVIVNSHPMLQEVITALDL----------KDE-----------------
A0A1Z4TLC8      -------LETQAVIVNSHPMLQEVITALDL----------KNE-----------------
A0A0C2LFH0      -------LETQAVILKSEPILKEVIDTLGL----------KDK-----------------
A0A1Z4IYV4      -------LETQSVILTSQPILEEVIKTLEL----------KDK-----------------
A0A1Z4Q0T6      -------LETQAVILQSQPILEEVINTLRL----------KDK-----------------
A0A0C2PT44      -------LETQAVILKSEPILEEVIKTLEL----------KDK-----------------
A0A1D2P6J4      -------LETQAVILKSEPILEEVINTLGL----------KDK-----------------
B4WP72          -------LRTQAEIIQSLPTLEKAIATAEA----------AVI-----------------
A0A2T1CIL7      -------VVTEAEILRSRPILEKAIKQLNL----------KND-----------------
A0A433V7A0      -------LSTEAEILLSEPLIRETISALNL----------KDE-----------------
A0A2T1FTR8      -------VNTQAEILKSLTTIKGAL--IEL----------RDG-----------------
K9UA41          -------VNTQAEILKSLTTIKGAL--VEL----------RDG-----------------
A0A0C2LBE2      -------SETQAKIVASVPVIQETIAELDL----------KDD-----------------
A0A433NN38      -------VDTQVKIVTSVPVLQETIKALDL----------RDS-----------------
A0A2N6K0T2      -------VDTQAKIVTSVPVIQETITSLSL----------KND-----------------
A0A2N6ML72      -------VDTQAKIVTSVPVLQETITSLSL----------KND-----------------
G6FQZ6          -------VDTQAKIVTSVPVLQATITSLSL----------KND-----------------
A0A2N6MQX9      -------VDTQAKIVTSVPVLQETITSLSL----------KDD-----------------
A0A2N6KXT6      -------VDTQAKIVTSVPVLQETITSLSL----------KND-----------------
A0A2N6KGB9      -------VDTQAKIVTSVPVLQETITSLSL----------KND-----------------
A0A2N6L3Y5      -------VDTQAKIVTSVPVLQATITSLSL----------KND-----------------
A0A0S3TIS7      -------VDTQAKIVTSVPVLQATITSLSL----------KND-----------------
A0A1U7GW28      -------VDTQAKIVTSVPVLQATITSLSL----------KND-----------------
A0A2N6LW63      -------VDTQAKIVTSVPVLQATITSLSL----------KND-----------------
A0A328IH74      -------VDTQAKIVISVPVIQETITSLSL----------KNN-----------------
A0A4D9CIB0      -------VDTQAKIVISVPVIQETITSLSL----------KNN-----------------
A0A1Z4TQ63      -------LDTQAKIVTSVPVIQETITSLSL----------KND-----------------
A0A4Q9J8G2      -------LDTQAKIVTSVPVIQETITTLSL----------KDD-----------------
A0A350Y0P6      -------LDTEAQIITAQPILEKTIAKLNL----------KTA-----------------
A0A352X940      -------LDTEAQVITSLPLIQKTIERLNL----------KTE-----------------
B8HTN4          -------IDTEAQIIRSTPIIQELITTLQL----------KDP-----------------
A0A6P1AFJ5      -------YATQIQVLWSNQVLSPISEAIKQ----------KYP-----------------
B0CAX4          -------VQTEAEIIRSEPILRQTITALKL----------VDD-----------------
A0A1Z4RN12      -------IETEAKILQSRPIVERLIKELEL----------KND-----------------
A0A2T1CMF9      -------IETEAEILGSRTIVEKVIQELDL----------KSE-----------------
Q7NDC5          -------LDTQAEILQSRPVAAGVIRDLQL----------GDP-----------------
U5QGK3          -------LDTQAEIIQSRPLVEKVIRTLQL----------KDP-----------------
A0A2W4UY24      -------LDTQVEIFLSKPIAEKVINQLKI----------EDS-----------------
A0A0D8ZUV2      -------LKTEAAVLSSIPLAQQTITALNL----------KDN-----------------
A0A433VDI0      -------LKTETEVLRSIPLVQRTIAELNL----------KDE-----------------
A0A3D1PG43      -------SQTEIEIMSSRPLAKETIAALNL----------KDK-----------------
A0A2P8QQ72      -------VSTESEIVSSIPLAQKTIAALTL----------KDE-----------------
K9TZQ7          -------VSTESEIVSSIPLAQKTIAALTL----------KDE-----------------
A0A6N8G584      -------LNTEIEIIRSVPFIEKTITALNL----------RND-----------------
A0A2G7GPR0      -------LNTEIEIIRSVPFVEKTISALNL----------RNS-----------------
K9XH68          -------LNTEIEIIRSVPFLEKTITALNL----------RND-----------------
A0A1U7HW70      -------LNTEIEIIRSVPFLEKTIASLNL----------RND-----------------
A0A2S6VEJ8      -------LNTEIEIIRSVPFLEKTITALNL----------RND-----------------
A0A140KBA0      -------LTTEVEVVSSRPIIDRVIKELDL----------RNK-----------------
K9XSG1          -------LTTEVEVVSSRPIIDRVIKELDL----------RNK-----------------
A0A2T1GMT4      -------ITTQMEVIASRPLLQKTADRLKL----------KND-----------------
K9UI51          -------ITTQMEVIASRPLLQRTADRLKL----------KND-----------------
A0A1Z4QL41      -------ISTQIEVISSPPVLQKTIDKLKL----------KNQ-----------------
A0A2T1FXY4      -------ISSQMEVISSPALLQRTIDELQL----------KND-----------------
K9TYI2          -------VSSQIEVISSPTLLQQAIDELQL----------KNN-----------------
A0A252D4T4      -------ISTQIEVISSPILLQRTIDELQL----------KNA-----------------
A0A252DJH5      -------ISTQIEVISSPILLQRTIDELQL----------KNA-----------------
A0A252EB80      -------ISTQIEVISSPILLQRTIDELQL----------KNA-----------------
A0A6G9SKZ9      -------ITTQIEVITSPLLLQKTIDELQL----------KNN-----------------
A0A1Z4HPW5      -------ITTQIEVITSPLLLQKTIDELQL----------KNN-----------------
A0A1Z4MSN1      -------ITTQIEVITSPLLLQKTIDELQL----------KNK-----------------
A0A1Z4U1C2      -------ITTQIEVITSPLLLQKTIDELQL----------KNK-----------------
A0A0D6KV51      -------ITTQIEVITSPLLLQKTIDELQL----------KNK-----------------
A0A1Z4MKF8      -------ITTQIEVITSPLLLQKTIDELQL----------KNK-----------------
A0A2C6WC43      -------INTQIEVISSPALLQKTIDKLQL----------KDQ-----------------
A0A1Z4L5A1      -------INTQIEVISSPALLQKTIDKLQL----------KDK-----------------
A0A367QD86      -------INTQIEVISSPPLLQKTIDKLQL----------KDK-----------------
A0A2K8SM78      -------INTQIEVISSPNLLQRTIDKLQL----------KDE-----------------
A0A2R5FPC0      -------INTQIEVISSPNLLQRTIDKLGL----------KDE-----------------
A0A5P8W5T6      -------INTQIEVISSPTLLQRTIDKLGL----------KDD-----------------
A0A7D7LDT7      -------ISSQIEVITSPKLLQRTIDKLQL----------KDN-----------------
A0A235IZ96      -------VSTQIEVITSPSLLQRAIDKLKL----------KDK-----------------
A0A2L2NGP0      -------VSTQIEVITSPSLLQRAIDKLKL----------KDK-----------------
K9QM62          -------ISTEVEVITSYPLLQRTIDALKL----------KNN-----------------
A0A1Z4FWI3      -------ISSQIEVISSPTLLQRTIDELQL----------KND-----------------
A0A1Z4JYE7      -------ISTQVEVISSPPLLEKVINKLEL----------TNE-----------------
A0A0F5YE28      -------LSTQIEIISSNRLLNQVIEQLNL----------VDD-----------------
U7QEH7          -------LSTQIEIIYSNRLLNQVINQLNL----------VDS-----------------
A0A3S1ATK5      -------ISTEIEVISSRPLLQQTIDKLGL----------KNK-----------------
A0A2Z6CPH0      -------ISTQIEVISSPLLLEQIIDKIQL----------KDE-----------------
A0A1Z4GT50      -------ISTQIEVITSPPLLQRTIDQLHL----------KNN-----------------
A0A1Z4GIX0      -------INTQIEVISSPPLLQRTIDKLQL----------KND-----------------
A0A2H6LC24      -------INTQIEVISSPPLLQRTIDKLQL----------KND-----------------
B2J6N5          -------INTQIEVISSPTLLQRTIDKLQL----------KDQ-----------------
A0A367RMI4      -------ISSQIEVISSPALLQRTIDKLQL----------KDN-----------------
A0A235HUM0      -------ISSQIEVISSPALLQRTIDKLQL----------KDK-----------------
A0A2L2NW47      -------ISSQIEVISSPALLQRTIDKLQL----------KDN-----------------
A0A1E2WUR1      -------ISSQIEVITSPKLLQRTIDKLQL----------KDN-----------------
A0A235IKU3      -------VSTQIEVITSPNLLQRAIDKLKL----------KDK-----------------
A0A1U7MYU6      -------LSTEVEVIYSHPLLQQIIDQLNL----------TDN-----------------
A0A1D8TNX9      -------LSTEVEVIYSHPLLQQIIDQLNL----------TDN-----------------
A0A6P0L6C2      -------LSTEVEVIYSHPLLQQIIDQLNL----------TNN-----------------
A0A6P0MVH0      -------LSTEVEVIYSHPLLQQIIDQLNL----------TDN-----------------
A0A6P0KJV0      -------LSTEVEVIYSHPLLQQIIDQLNL----------TDN-----------------
A0A6L9ZJG4      -------LSTEVEVIYSHPLLQQIIDQLNL----------TDN-----------------
F4XKF3          -------LSTEVEVIYSHPLLQQIIDQLNL----------TDN-----------------
A0A1D9FX10      -------LSTEVEVIYSHPLLQQIIDQLNL----------TDN-----------------
A0A6P0Q0T0      -------LSTEVEVIYSHPLLQQIIDQLNL----------TDN-----------------
A0A6P0W5I0      -------LSTEVEVIYSHPLLQQIIDQLNL----------TDN-----------------
A0A3C0NJ41      -------VSTEMEILHSIPLAQKTIAAFNL----------KDN-----------------
A0A352AG88      -------ITTEIEILRSVPLAKETIAALNL----------KSE-----------------
A0A350Y374      -------ISTEIEILSSLPLLDKTLNTLNL----------KDD-----------------
A0A355DPX0      -------ISTEIEILSSVPLLDKTLNTLNL----------KDD-----------------
                                                                            

K9SLA9          -----TATENEL---------EAEQSIESFLANLQVTNLP--D----------SEILEIS
A0A168TT23      RSDPPSAQPAAVQSPEAARAAAIRSAGGRLRARISVSPRE--N----------SRLVYVS
A0A0M1JWX9      -----K--YPEV---------EYKTLVTGEKPPLIIEQKK--EA---------TKIIEVR
A0A2T1M1V6      -----EKSE-FS---------NLEDY----KKLFTIEPQT--Q----------TTVIDLE
A0A2G7GCS2      -----EKSL-YP---------RLSDY----KLAFSATPQE--Q----------STIINLQ
K9XBH8          -----EKSS-YL---------RLSDY----KSLFTVSPQE--Q----------TTIIALE
A0A1Z4LJ30      -----EKAD-FS---------RLNNF----KKLFEVSPEK--E----------STVISVS
K9RI76          -----EKSE-YS---------RLSQF----KKLFEVTPEK--E----------STVISLE
A0A352AE27      -----ENSQ-FG----------LRSY----KKLFEISPQE--Q----------STTISLT
A0A3B8JH60      -----EKNK-AP---------KPSQY----KKLFKVSPQE--Q----------STIISLA
A0A3C0N766      -----EKNK-AP---------KPSQY----KKLFKVSPQE--Q----------STIISLA
K9W9J7          -----QKTK-FS---------RLAKY----KRLFQVKPQE--Q----------STIISLA
A0A139WSU3      -----ERGK-FN---------SISRY----RQLFKVTPQE--Q----------STIMLLT
A0A433VN22      -----EKNK-FK---------NLEQY----KALFQVSPQE--Q----------STVLSLT
Q7NF11          -----QREK-YP---------QLGSY----EKLFKAVPQS--Q----------TTILAVE
A0A1Z4JCS8      -----ERDA-AN---------KPRNY----GQFFEVTSLE--Q----------TSVMLLS
A0A6P0PI80      -----EKTD-FQ---------RLVQY----KQLFAVSPHQ--E----------STTIWLN
A0A6P0WGT6      -----EKTD-FQ---------RLVQY----KQLFAVSPHQ--E----------STTIWLN
F4XTX2          -----EKTD-FQ---------RLVQY----KQLFAVSPHQ--E----------STTIWLN
Q7NJN6          -----ERTEKFT---------RLDTY----GKLFKGKPGD--Q----------STIVQLE
U5QCC3          -----EKQEKFP---------RLEDY----TKLFKSKIED--Q----------STIVQVQ
A0A0S3TYD7      -----D--NAPL---------KVEDF----LKRLKVTPVN--R----------SDILRVE
A0A2T1DNG3      -----E--YPELDPDNPG---SVGGF----RGALTIVQVG--TKKVD------TKIFSIT
A0A3S0Y9N9      ---------------------NLNPL--VFLKELQVKNIE--Q----------TDILEIS
A0A433UNK7      ---------------------NINPL--VFLKDLEVKNIE--N----------TDILEVY
A0A6P0ZKB8      ---------------------NLNPL--VFLKDLEVKNIE--N----------TDILEVY
U5QL42          --------FNIL---------NSTTA----ADNISISQIG--D----------AGVLRVA
A0A140K3H3      --------YGDL---------TVTDV----MENLSITQAA--VNEMP------TDVLVVS
K9XUB8          --------YSDL---------TVGNV----IGNLSIIQAN--VNEIP------TDVLVVS
A0A6H2NHD5      --------YPDI---------TYGTL----LNNLTITRDG--E----------SKVLRVN
A0A2P8W4F7      --------YPNI---------TYNAL----LSRLSIVQEG--E----------SKVLRVT
A0A5Q4E0Z4      --------YPEI---------TYTTL----LNDLVISQEG--E----------SKVLRIT
A0A2P8VVX1      --------YPEI---------TVDEL----RAGFTLARLS----EGR----TGTRIFQAS
A0A2P8WHY0      --------YPDL---------DVDQV----VNTFSLQRVG--GEERD----KATRVFQAT
A0A2T1CMT9      -----VISDSEA---------TTAAIIAALRESIGVYQVL--DESTDSNKDSATKIIQVS
A0A7G8J1V5      ----------NI---------SARGL----AGRISIQQGG--DSRRR--F-ASTETLQVS
A0A354B169      ----------DL---------TYLNL----SSRLKISIGG--EKSQE-----AEGVLNVS
Q0IDT5          ----------DV---------SENEL----AERINITTGG--AKRKE-----AEGVLKVS
A0A7G8FZD9      ----------DL---------SENAL----AGRITITTGG--AKRSQ-----AEGILKVS
G4FMX5          ----------DL---------SENGL----ASRITITTGG--EKRTE-----AEGILRVS
A0A7G8FAU7      ----------DL---------AENAL----ASRIEISTGG--AKRKE-----ADGVLNVS
A3ZA21          ----------DL---------AENAL----ASRIEISTGG--AKRKE-----ADGVLNVS
A0A076HBF2      ----------EL---------TTDAL----RSRVDISTGG--AKRKE-----AEGVLNVR
A0A7G8FP50      ----------DL---------SADDL----SRRISIKT-----RSKE-----SKGVLIVN
A0A7G8E8K7      ----------DL---------EIDDL----RERINIQTGG--EKRKE-----AEGILNVS
A0A7G8GAH0      ----------EL---------TTGEL----IDRIDISTGG--AKRKE-----AEGVLNVR
A0A7G8GNR2      ----------EL---------STGAL----RSRVNISTGG--AKRKE-----AEGVLNVS
A0A7G8ICD3      ----------GL---------STGGL----IGRIEINSGG--AKRKE-----AKGVLNVS
A0A2D6FCW3      ----------DL---------NANAL----AKRITITTGG--EKRKE-----AEGILNVS
A0A7G7KJ95      ----------DL---------DENSL----ANRITISSGG--EKRKE-----AEGVLNVS
A0A7G8EAN3      ----------GL---------STNGL----AGKITI-IGG--NNPRE-----AEGILKVR
A0A563VQJ3      ------------------------ELTDGEGEPLKPKNFA--QNLTVELV-GGSDVIEVG
A0A1D8TX52      --------YPDI---------TIRDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A1D9G4T2      --------YPDI---------TVGDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6P0PR27      --------YPDI---------TVGDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6P0WER7      --------YPDI---------TVGDI----RGSLRLAQVL--QGKTE------TKVFQAV
F4XP71          --------YPDI---------TVGDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6L9YR57      --------YPNI---------TIRDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6P0KZ31      --------YPDI---------TIRDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6P0LPB8      --------YPDI---------TVGDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6P0SEV1      --------YPDI---------TIRDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6B3N2I8      --------YPDI---------TVGDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6M0B891      --------YPDI---------TVGDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6P0IJQ1      --------YPDI---------TVGDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6P0J8J8      --------YPDI---------TVGDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6P0ZSH6      --------YPDI---------TVGDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A1U7N5X9      --------YPNI---------TVGDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6L9Z1V0      --------YPDI---------KVGDI----RDSLRLAQVL--QGKTE------TKVFQAV
A0A6P0LC12      --------YPDI---------TIRDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A6P0MVJ3      --------YPDI---------TIGDI----RGSLRLAQVL--QGKTE------TKVFQAV
A0A2W6ZAV2      ----------NV---------SPDKI----ASGLKIVSGG--DA---------SGVMDVS
K9W742          --------YPDL---------TLKEL----RKSLSVFQVE--GSQDDS----KTKIFAAN
A0A3D1PBA3      --------YPTI---------TAKEI----KANLKLRQVL--EEK------VNTKIVEAT
K9XPB0          --------GSDA---------EIAEIVEQLKSSLSVYQVI--DESEDNKG-TETKIIEVA
A0A350Y7Z1      --------YPEI---------QVTDI----KESFSLTGVQ--EEDTDIKD-TQTKIVKVV
A0A352X2A7      --------YPTI---------KVEEI----REFLTITRII--EDETE------TKIVKID
A0A0D8ZYV0      --------YPDM---------TVKEL----KQTLVLTPLV--EENSNTKY---TKIVEAN
A0A2T1FP73      --------YPTL---------TVAEV----KKNLVLKQVV--EEKAN------TKIVEAT
A0A433VMS2      --------YPTL---------TVAEV----KKNLVLKQVV--EEKAN------TKIVEAT
K9TYA7          --------YPTL---------TVAEV----KKNLVLKQVV--EEKAN------TKIVEAT
A0A2P8QUE1      --------YPTL---------TVAEV----KKNLVLKQVV--EEKAN------TKIVEAT
K9SA61          --------YPDI---------TVGHL----KEALIVTQVE--DD-----K-TKTKIFEAI
A0A2G7GMH8      --------YPDI---------DIKSL----RKSLTLSPVQ--GQDGTGKK-VRTKIVEVL
A0A6N8FU92      --------YPDI---------DIQEI----KKSLVLIPVQ--GQEGTGKK-VRTKIVEVL
A0A2T1DWE8      --------YPKL---------EAAEL----QKALVLTQVE--E----D-K-VKTKIFQAV
A0A1U7I8L3      --------YPKI---------KVKDI----KEALVVNQLQ--E----D-K-VNTKIFEVT
A0A2T1DJL8      --------GSNL---------DVGDL----QKGLTVSQVI--EQRGND-K-INTSIFEMV
A0A1Z4J9W0      --------YSDI---------DVDRL----RKRLNIAQVQ--ELRGNE-R-VTTNLVEVT
A0A0N7Z5K9      --------YSDI---------DVDRL----RNRLNIAQVQ--ELRGSE-R-VNTSIVEMS
A0A0S3TXC5      --------YSDI---------DVDRL----TRRLNIVQVQ--ELRGNE-R-VNTNIVEMS
B8HNB0          -----P--HNKT---------SVGSI----AGGLSITQVG--D----------SDVLKVT
A0A563VS48      -----G--GELI---------RYQSF----RESFQVRPIT--G----------TDILNIR
A0A318BJ18      RAERVRIAGEIL------------------RDNLTIGSTR--L----------SRLVDIT
A0A3B8Y8H9      ---------------------EKVEYQAFIENQLSINRPK--D----------TNIIIVS
A0A2W1JVB9      -----E--GEPL---------KIFDF----EEQLSIKKAR--A----------GDVIELA
A0A3M1SVZ4      -----E--GKLV---------EYSDV----LKNLKLSKVQ--S----------SDILTIS
A0A6H1U102      -----S--TSQL---------SVSQV----VRHLSIRQAG--E----------ADVLIVS
A0A7C3ZEJ3      -----S--FSNL---------SVEDV----VRNLSIRQAG--D----------ADVLIVS
A0A563VLD6      -----TFKGLSV---------GEVIS----KLSINTQEVNEIP----------TDVLTVS
A0A2P8W9H0      -----S--QPSV---------SYGQL----ITNLKIVPNQ--D----------GEILTVT
A0A6I5P386      -----I--YPEM---------TYRQL----IFSLGIKKSN--E-----------DVLVVS
A0A654SFI6      -----E--ETPV---------TRRDVEQVLLDNIKVTPIS--Q----------SSLVDIE
A0A318BG22      -----GGDGKAPAVRQRRIDAATAVV----MRNIEAAPLV--G----------SSVIELR
K9SSQ0          -----Q----DL---------IT-------QISDHLTITP--D----------AKVLNIS
A0A2W1JIN9      -----DPVDIPL---------SVGEL----KQSLQTGIVP--G----------TDIFQLQ
A0A318AJV1      -----RLTHRPA---------TPDQIVTRVTKSVGVSRDQ--L----------SYIISLG
A0A6P0IC70      -----K-----I---------TPKEL----KKDLTVKNIP--A----------TNILEIS
A0A6B3MUB5      -----K-----I---------TPKEL----KKDLTVKNIP--A----------TNILEIS
A0A6M0B7N4      -----K-----I---------TPKEL----KKDLTVKNIP--A----------TNILEIS
A0A6P0J9W3      -----K-----I---------TPKEL----KKDLTVKNIP--A----------TNILEIS
A0A6P0ZWE1      -----K-----I---------TPKEL----KKDLTVKNIP--A----------TNILEIS
A0A1U7N2U4      -----G-----L---------TINTL----RRDLKVKIVP--A----------TNILELS
A0A1D9G1F2      -----G-----L---------TIDTL----REDLKVKIVP--A----------TNILELS
A0A6P0PNZ7      -----G-----L---------TIDTL----REDLKVKIVP--A----------TNILELS
F4XV38          -----G-----L---------TIDTL----REDLKVKIVP--A----------TNILELS
A0A6P0W137      -----G-----L---------TIDTL----REDLKVKIVP--A----------TNILELS
A0A6L9Y9E2      -----G-----L---------TIDKL----REDLKVKIVP--A----------TNILELS
A0A6P0SGR0      -----G-----L---------TIDTL----REDLKVKIVP--A----------TNILELS
A0A6M0BK48      -----G-----L---------TIDKL----REDLKVKIVP--A----------TNILELS
A0A6L9YZL1      -----G-----L---------TIYKL----REDLKVKIVP--A----------TNILELS
A0A6P0KYM4      -----G-----L---------TIDKL----RQDLKVKIVP--A----------TNILELS
A0A6P0LSD6      -----G-----L---------TIDKL----RKDLKVKIVP--A----------TNILELS
A0A6P0X384      -----A----LI---------STDDL----KEGLNTKIVP--A----------TNILELS
A0A2P8QIL5      -----E----PP---------TVEEL----RKQLKVKTVP--A----------TSILEIK
A0A2T1FLY5      -----E----PP---------TVEEL----RKQLKVKTVP--A----------TSILEIK
A0A433W447      -----E----PP---------TVEEL----RKQLKVKTVP--A----------TSILEIK
K9U1K8          -----E----PP---------TVEEL----RKQLKVKTVP--A----------TSILEIK
K9UYB2          ----------SI---------TTKQL----RRGLRVKVVP--A----------TNIIDLS
A0A218QN17      -----S----QI---------TSGDL----SKGLGVKIVP--A----------TNILELS
K9RKN2          -----NFGKDGL---------TSEYL----RKNLSVKIVP--A----------TNILQIS
A0A2I8ADV2      -----I----QL---------TPTDI----SSALKVSILP--A----------TNILQLN
A0A1W5CKM3      -----K----PL---------TASDI----RSNLKVIIVP--A----------TNILDLR
A0A5Q0GMF5      -----K----PL---------TASDI----RSNLKVIIVP--A----------TNILDLR
Q3MEW0          -----K----PL---------TASDI----RSNLKVIIVP--A----------TNILDLR
A0A1Z4KIC7      -----K----PL---------TPSDI----RSNLKVIIVP--A----------TNILDLR
Q8YSM5          -----K----PL---------TPSDI----RSNLKVIIVP--A----------TNILDLR
A0A1Q4S1H4      -----E----KT---------TLKKL----SRDLKVKIIP--A----------TNILELS
A0A433VBU6      -----E----KL---------SFKQL----SRDLKVKIIP--A----------TNILELR
A0A1Q4RZJ6      -----T----KL---------TVDEF----SQGIRVKTIP--A----------TNILEIS
A0A1Z4SNV3      -----S----TI---------TTAEL----SRGIRIKTIP--A----------TSILEIS
A0A2H2XJQ1      -----S----TI---------TTAEL----SRGIRIKTIP--A----------TSILEIS
A0A3S5K358      -----T----KL---------TVDEL----SQGIRVKTIP--A----------TNILEIS
A0A0T7BPJ4      -----D----SI---------TPEKL----RKKLKVKIVP--A----------TNILEFK
A0A0C1QS61      -----T----QV---------KIQDL----NKGLGVKIVP--A----------TNILQLS
A0A139X3R8      -----T----QV---------KTPDL----SKGLGVKIVP--A----------TNILQLS
A0A1Z4I7C5      -----K----KL---------SPSDI----KSNLKVVIVP--A----------TNILELR
A0A0C2MDK7      -----S----PV---------STAEL----SHNLKVKIVP--A----------TNILELS
A0A1Y0RCK1      -----S----PV---------STAEL----SHNLKVKIVP--A----------TNILELN
A0A1Z4PWZ0      -----S----PV---------TTGEL----SHNLKVTIVP--A----------TNILELS
A0A0C2QLT0      -----S----PV---------TTTEL----SRNLKVKIVP--A----------TNILELS
A0A1Z4J2K1      -----S----PV---------STAEL----SHNLKVKIVP--A----------TNILELS
A0A3S0ZSX0      -----T----PL---------TPEKV----RQGLKVKIVP--A----------TNILEVS
A0A2N6K4T3      -----N----EL---------TVDQL----TQGLKVKIVP--A----------TNILEVS
A0A370CKT2      -----N----EL---------TVDQL----SQGLKIKIVP--A----------TNILEVS
A0A0S3TL97      -----N----EL---------TVDQL----SQGLKIKIVP--A----------TNILEVS
A0A2N6M8A0      -----N----EL---------TVDQL----SQGLKIKIVP--A----------TNILEVS
A0A2N6M9E1      -----N----EL---------TVDQL----SQGLKVKIVP--A----------TNILEVS
A0A2N6KJI4      -----N----EL---------TVDQL----SQGLKIKIVP--A----------TNILEVS
A0A2N6MZ77      -----N----EL---------TVDQL----SQGLKIKIVP--A----------TNILEVS
A0A2N6KT20      -----N----EL---------TVDQL----SQGLKIKIVP--A----------TNILEVS
G6FSN3          -----N----EL---------TVDQL----SQGLKIKIVP--A----------TNILEVS
A0A4D9CI02      -----N----EL---------TVGQL----SRNLKVKIVP--A----------TNILEVS
A0A328I8B9      -----N----EL---------TVGQL----SRNLKVKIVP--A----------TNILEVS
A0A4Q9J4Z7      -----N----EL---------TVGQL----SRNLKVKIVP--A----------TNILEVS
A0A0M0SU69      -----N----EL---------TVGQL----SQNLKVKIVP--A----------TNILEVS
A0A1Z4TIZ8      -----N----EL---------TVEQL----SQNLKVKIVP--A----------TNILEVS
A0A2T1E9V8      -----Q--KTPL---------SVGDL----QAGLEVINIE--G----------TDILQVT
A0A1Z4LN32      -----N--GKPL---------DPNSI------SIGTGSIV--G----------TDILRVS
A0A2I8A9F5      -----K--GERL---------KIESV------DIQVEAIP--G----------TDGLKVG
A0A218Q6R8      -----E--NNLL---------RPESI------NINIERIM--G----------TDGLQVS
A0A218QGE0      -----K--GNPL---------SPDAI------SIKTEAVV--G----------TDVLKVS
A0A3M2GQQ6      ----------PI---------GVKQV----ASNLSIHKAG--E----------ADVLIVS
A0A6H1U2X0      ----------PI---------GVKQV----ASNLSIHKAG--E----------ADVLIVS
K1XF69          -----D--GEPV---------APEDI----RRNLDMRIIG--G----------TDIVLLT
B5W297          -----D--GEPV---------APEDI----RRNLDMRIIG--G----------TDIVLLT
A0A6H2AL05      -----D--GEPV---------APEDI----RRNLDMRIIG--G----------TDIVLLT
H1W7M8          -----D--GEPV---------APEDI----RRNLDMRIIG--G----------TDIVLLT
A0A5Q4H6A5      -----D--GDPI---------YPEDI----RRNLDIRIIG--G----------TDIVLLT
D5A466          -----D--GDPI---------YPEDI----RRNLDIRIIG--G----------TDIVLLT
U5QJM6          -----K--LKDD---------DIDDV----IKRLEIEQVT--R----------TQVVSVA
A0A1Z4RPC6      -----A--GKPL---------KTEDF----KKKLTVEIVG--G----------TDVIQIA
A0A2T1CMZ0      -----L--GEPL---------KVKEF----KEKLAIEIVG--G----------SDVISIE
L8M4F7          -----N--GEFI---------DPNGL----RPQLKVKLLP--G----------TDLIQIL
A0A140K2P2      -----Q--GKPI---------KPKDF----EKKLSIELVG--G----------SDVIEIT
K9XWX4          -----Q--GKPI---------KPKDF----EKKLNIELVG--G----------SDVVEIT
A0A140KB14      -----E--GKAL---------KPEVL----NNKLKIEIIG--G----------TDVISVR
K9XX88          -----E--GKAL---------KPEAL----NKKLKIEIVS--G----------TDVISLR
A0A563VSV6      -----E--GETL---------TAKDL----RRKLQVGLVG--G----------SDVIEII
L8LZE9          -----E--GEPL---------TPEKM----TKKLKADLVG--A----------SDVIEIT
A0A433NM31      -----Q--GEPL---------KIKEF----QQRLEVKNIK--G----------TDTLLIS
A0A1Z4NDS1      -----E--GNPL---------QIKAF----RSKLKVDSAK--G----------TDIIQVS
U9VXM0          -----E--GELL---------QPDEL----LRDLTITGIP--G----------TDVLKVT
A0A6M0RI13      -----E--GELL---------QPEDL----LKSLTVTGVP--G----------TDVLKVT
A0A6M0S1N5      -----E--GELL---------QPEDL----LKSLTVTGVP--G----------TDVLKVT
K9F4D9          -----E--GELL---------QPEDL----LKGLTVTGVP--G----------TDVLKVT
A0A6I5QPI5      -----S--GRPL---------NPRAL----LGKVSAQPVG--G----------TDVLRIS
A0A1Z3HMQ0      -----K--GNSI---------PPDVL----RRGLTIAPLE--G----------TDVLRVA
A0A433W533      -----R-TSEPL---------KPADI----IGKLKLKNIG--G----------TDVMQVT
A0A2P8QWJ3      -----R-TSEPL---------KPADI----IGKLKLKNIG--G----------TDVMQVT
A0A2T1FKP8      -----R-TSEPL---------KPADI----IGKLKLKNIG--G----------TDVMQVT
K9U6L7          -----R-TSEPL---------KPADI----IGKLKLKNIG--G----------TDVMQVT
A0A1E5QP61      -----Q--GKFI---------PPGDF----LSQLNVKKIE--G----------TDVLMIA
U5DPF5          -----D--GTPM---------APQNI----VGNLKVYEVP--N----------THILELT
A0A6P0X488      -----A--GESV---------KPGYI----LGGLTVEGIK--G----------TDVLKVS
A0A6P0UVD5      -----A--GESV---------KPSYV----LGGLTVEGIK--G----------TDVLKVS
A0A6P0VDM0      -----A--GESV---------KPSYV----LGGLTVEGIK--G----------TDVLKVS
A0A6M0G142      -----E--GEAV---------KPGYI----LGGLTVEGIK--G----------TDVLKLS
A0A6P0MR53      -----A--GESV---------KPGYI----LGGLTVEGIK--G----------TDVLELS
A0A3M2GIL5      -----E--GNLI---------PPGGL----LSGLGVKGIK--G----------TDVLLIT
A0A6H1TSJ9      -----E--GNLI---------PPGGL----LSGLGVKGIK--G----------TDVLLIT
A0A3M1PML8      -----K--GEPV---------LVKDF----LSKLKANSIP--A----------TDLLRVT
A0A6M8BE85      -----N--GDPM---------LVKDV----VSKLTARSIP--A----------TDLLRVT
A0A0T7BPZ0      -----Q--GKPL---------TIEDL----TKNIKVEVVK--G----------SEVMQIS
A0A352X442      -----T--GNPI---------KPEVV----LQGLQVKPVA--G----------TDVMTLT
A0A6B3NF44      -----E--GNPL---------DPKTL----WAGLEVKPVT--G----------TDVMGIS
A0A6M0EPL4      -----E--GNPL---------DPKTL----WAGLEVKPVT--G----------TDVMGIS
A0A6P0K6L6      -----E--GNPL---------DPKTL----WAGLEVKPVT--G----------TDVMGIS
A0A6P0MRR9      -----E--GNPL---------DPETL----LKHLSAEPVA--G----------TDVLNVT
A0A6P0UX57      -----E--GEPM---------AAEQL----LKALTAEPVA--G----------TDVLDVT
A0A6P0X1X4      -----E--GEPI---------APEKL----LKGLTAEPVA--G----------TDVLDVT
A0A0M0SHU3      -----E--GEPL---------TVEEL----LEDLKVESVK--G----------TDVLEIS
A0A1D2PBN3      -----K--GKPL---------TIQEL----SKKLKIKGDK--G----------TEVLEVS
A0A0C2LVR7      -----R--GKPL---------TIQEL----SKKLKIKGDK--G----------TEVLEVS
A0A1Z4PQB9      -----K--GKPL---------TIQEL----SKELKIKGDK--G----------TEVLEVS
A0A1Z4SFN6      -----E--GQLL---------TIPNF----TAKLKTKNYK--G----------TEVLDIY
K9PGI8          -----R--GKFI---------QTQDL----SHKLKVESSK--G----------TDILQIS
K9TLQ0          -----E-----L---------KFEEL----IKNLSVRRLK--S----------TKILDIR
K9QF04          -----D-----I---------DYRQL----VKQLKIKHKE--N----------TAIVEVS
K9W1T3          -----Q---------------KPESF----LKPLKVTNIR--S----------TDILQVS
K9SGJ5          -----TM-TQDQ---------MVSYV----LENLYIRQEK--G----------ASVLWLI
A0A6N2JS94      -----AA-YKDI---------DALTI----MSGLDIRPEK--D----------TMVLRLT
A0A6C2DSN4      -----GS-SKPI---------DASSV----INGLDIRPEK--D----------ALILRLT
L8MYT6          -----GS-SKPI---------DASSV----INGLDIRPEK--D----------ALILRLT
A0A352JGJ6      -----SSKIKDI---------DAVTI----MSGLEIRPEK--D----------ALILRLN
A0A1J5GLS2      -----ASAYREI---------DAGTI----MGGLEIRPEK--D----------ALILRLI
A0A2W4W6M5      -----ANTYKEI---------DAGTI----MGGLEIRPEK--D----------ALILRLT
A0A2W7AN33      -----AIPYKDI---------DTLAI----MDGLDIQPEK--N----------AMVLRLI
A0A256BLV2      -----ALSFKDL---------DPLTI----MNGLDIRPEK--D----------TMVLRLT
A0A2W6ZXF3      -----ASSYKEI---------DAGTI----MNGLEIRPER--D----------ALILRLI
A0A2Z5WX66      -----SNASKDI---------DAVTI----MNGLEIRPEK--D----------ALILRLT
Q7NEU3          -----E--LLDQ---------DAEDI----TKRLEIIREE--R----------TQVAVVS
A0A3C0N2P0      -----D--I------------DANTL----RSQLQISRLG--E----------TKILEVR
A0A6P0JR04      -----K--M------------DYNGV----IGNLSISRVE--T----------TKILEVS
A0A6B3M6M6      -----E--F------------DYNTL----QEQLTVSQLR--E----------TKILEAR
A0A6P0KD09      -----E--F------------DYDSF----QDKLTVTQLR--E----------TKILETR
A0A6B3NIJ0      -----E--F------------DYDSF----QDKLTVTQLR--E----------TKILETR
A0A6M0F053      -----E--F------------DYDSF----QDKLTVTQLR--E----------TKILETR
A0A6P2ATU9      -----E--V------------DYGAL----VGAFNVSQIV--G----------TKIMEVS
A0A352XE00      -----E--I------------DYNLL----RTKLTISRLQ--Q----------TKILEIR
A0A6P0QC14      -----E--I------------DYDTL----RGKLGISRLA--E----------TKILEVR
B4VS56          -----E--I------------DYNTL----RSQLAINQLQ--E----------TKILEVR
A0A352AAQ3      -----T--V------------DYDTL----RTKLIISRLQ--Q----------TKILEVR
A0A350Y472      -----E--V------------DYSAL----RTKLTISRLQ--E----------TKILEVR
A0A355DVB4      -----E--V------------DYSAL----RTKLTISRLQ--E----------TKILEVR
A0A1Z4RMB9      -----E--DKPL---------KPEDF----RKKLVTEVVG--G----------TDVVDVK
A0A318B4H2      RTRSAQEQGKRLDQ-------AASIL----LDNITVEPIG--A----------SALVDIT
B4WQE3          -----D-----I---------SYDSL----KNNLTITPND--N----------GKTLTVQ
A0A2K3BR24      -----E--GEPL---------TPGGM----RKNLNVTRLS--D----------TEILEIA
K9YXY1          -----E--GEPL---------TPGGV----RKNLNVTRLS--D----------TEILEIA
A0A1Q4RTR1      -----K--GQPL---------AFEEF----SKNLKVSGVK--G----------TDILQIS
A0A1Z4SQV2      -----N--GQPL---------TVEEF----SQKLKVAGVK--G----------TDVLEVS
A0A2H2XGN1      -----N--GQPL---------TVEEF----SQKLKVAGVK--G----------TDVLEVS
A0A433UXH8      -----K--GQPL---------TIEEF----SQKLKVTGVK--G----------TEVLQIS
A0A0V7ZFJ4      -----K--GKLL---------KPSVL----ISKLRVNAVG--D----------TDILNLS
A0A0V7ZNJ9      -----D--NEPI---------SIEDF----LKQLKVKSAK--G----------TDVLEIS
A0A367RIS1      -----L--GQPL---------EIDTF----LSNLKIKSIR--G----------TDILQLS
A0A235IXQ2      -----L--GQPL---------EIDDF----LHNLKIKSVR--G----------TDILQLS
A0A1W5CNX3      -----Q--GQPL---------EIDDF----LRSLKIKSVR--G----------TDILQLT
A0A5Q0GJJ5      -----Q--GQPL---------EIDDF----LRSLKIKSVR--G----------TDILQLT
Q3MEB7          -----Q--GQPL---------EIDDF----LRSLKIKSVR--G----------TDILQLT
A0A1Z4KHN9      -----Q--GQPL---------EIDDF----LRNLKIKSVR--G----------TDILQLS
Q8YT70          -----Q--GQPL---------EIDDF----LRNLKIKSVR--G----------TDILQLS
A0A166IWU6      -----E--GEPL---------RIDNF----LGSLKVNAVR--G----------TDVLQLS
A0A2S0Q8C0      -----E--GEPL---------KIDHV----LGSLKVQAIR--G----------TDLLQLS
W6FSX4          -----E--GEPL---------KIDHV----LGSLKVQAIR--G----------TDLLQLS
A0A218Q4C1      -----E--GEPL---------GVGSF----LGKLKVTTIR--G----------TDVLQLS
A0A6P1ZT04      -----E--GEPL---------AIDDF----LKKLKVQSIR--G----------TDVLQLS
A0A5P8VSD1      -----L--GQPL---------ELRDF----LRNLKIKNIR--G----------TNILQLS
A0A1S1ZVW2      -----K--GEPI---------EIDVF----LKQLKLQIIR--G----------TDVMELS
A0A0R0M9H9      -----K--GEPI---------EIDRF----LKQLKLQTIR--G----------TDVMELS
A0A7H0F4U6      -----K--GEPI---------DIDRF----LKQLKLQTIR--G----------TDVMELS
A0A1B7WX82      -----K--GGQI---------SLENF----LKKLKLKSIR--G----------TDVLQVS
A0A1B7WTD1      -----K--GAPM---------TTDAF----LKTLKLKTIR--G----------TDVMELS
A0A480ABC0      -----K--GAPM---------TTGDF----LKILKLKTIR--G----------TDVMELS
A0A1Z4LRU5      -----E--GETL---------SHEAF----LKLLQVKSIR--G----------TDVLQLS
A0A1Z4JVB4      -----K--GQPL---------SIEDF----LKNLKLKTIR--G----------TDVMQIS
K9PIA4          -----T--GEYL---------PIETF----LKILQLKTIR--G----------TDVMQLS
A0A1Z4HVE1      -----S--GKPL---------TIEKF----LKLLKLKTIR--G----------TDVMQLS
A0A252ECZ1      -----S--GKLV---------SIERF----LKVLKLKTIR--G----------TDVMQLS
A0A1Z4G5Y1      -----S--GKPL---------SIEKF----LKKLKLKTIR--G----------TDVMQLS
A0A252DNA2      -----S--GKPL---------SIEKF----LKLLKLKTIR--G----------TDVMQLS
A0A252E1Q4      -----S--GKPL---------SIEKF----LKLLKLKTIR--G----------TDVMQLS
A0A6G9SK36      -----W--GKPL---------TIEKF----LKILKLKTIR--G----------TDVMQLS
A0A1Z4M597      -----S--GKPL---------TIEKF----LKLLKLKTIR--G----------TDVMQLS
A0A1Z4MWT1      -----S--GKPL---------SIEKF----LKLLKLKTIR--G----------TDVMQLS
A0A1Z4TX53      -----S--GKPL---------SIEKF----LKLLKLKTIR--G----------TDVMQLS
A0A2A2TNQ5      -----K--GKPL---------EIDDF----LKNLKVKSVK--G----------TDVMELT
A0A3S1C4K5      -----K--GKPL---------KVEPF----LKLLKVKSVK--G----------TDVLEMT
A0A1X4G3D5      -----E--GKPL---------DPDVI----LGNLKLQTVR--G----------TNVMEFT
D4TNI2          -----E--GKPL---------DPDVI----LGNLKLQTVR--G----------TNVMEFT
A0A1Z4H6Z8      -----S--GKPL---------TIEKF----LKLLKLKTIR--G----------TDVMQLS
A0A1Z4NPM1      -----K--GKPL---------SVEDF----LKNLKVKSVR--G----------TDVMELS
A0A3F3KPR9      -----K--GEPI---------EIDRF----LKQLKLQTIR--S----------TDVMELS
D4TGN7          -----K--GEPI---------EIDRF----LKQLKLQTIR--G----------TDVMELS
A0A1Z4UZW9      -----Q--GKQL---------SLEVF----LKKLKLKTIR--G----------TDVMQLS
A0A0K2M5H0      -----Q--GKQL---------SLEVF----LKKLKLKTVR--G----------TDVMQLS
A0A1B7VSH4      -----Q--GKQL---------SLEVF----LKKLKLKTVR--G----------TDVMQLS
A0A1B7W126      -----Q--GKQL---------SLEVF----LKKLKLKTVR--G----------TDVMQLS
A0A3D4C6Q6      -----Q--GKQL---------SLEVF----LKKLKLKTVR--G----------TDVMQLS
A0A1B7UVJ4      -----Q--GKQI---------SLENF----LTKLKLKTIR--G----------TDVLQVS
A0A1B7UTR1      -----Q--GKQI---------SLENF----LTKLKLKTIR--G----------TDVIQLS
K7W0A4          -----Q--GKQI---------SLENF----LKKLKLKTIR--G----------TDVIQLS
A0A5C0DRW9      -----Q--GKQI---------SLENF----LKKLKLKTIR--G----------TDVIQLS
A0A6H2C088      -----Q--GKQI---------SLENF----LKKLKLKTIR--G----------TDVIQLS
A0A1U7HGH0      -----N---TTL---------SLESL----RQGLDIVAVE--G----------TEILQVV
K9XJD3          -----N---TAL---------SLESL----RQGLDIVDVE--G----------TEILQVV
K9SX01          --------ALPL---------DNDVF----LKPLSLDVIK--Y----------TDVIQVS
A0A4P7ZT55      ---------------------EPDAL----VGRVTARSVQRDA----------DGVLKVS
A0A1E5QIR9      -----E--GQPL---------KRKDF----LRRLSISTLK--D----------TDVLQIS
A0A6P1A9A0      -----N-----Y---------DYSSL----SNNLKINRLG--Q----------TQILEVR
A0A1Z4IBC7      -----N--GKKL---------SIRIF----AQQLKIEGIK--G----------TDVVQIS
A0A1W5CPC7      -----N--GKPL---------SIRIF----AKQLKIEGIK--G----------TDVVQLS
A0A5Q0GKD1      -----N--GKPL---------SIRIF----AKQLKIEGIK--G----------TDVVQLS
Q3MDC6          -----N--GKPL---------SIRIF----AKQLKIEGIK--G----------TDVVQLS
A0A1Z4KM73      -----N--GKPL---------SIRIF----AKQLKIEGIK--G----------TDVVQLS
Q8YNX7          -----N--GKPL---------SIRIF----AKQLKIEGIK--G----------TDVVQLS
A0A367R4K6      -----H--GKLL---------SIRDL----AQQLKVEGIK--G----------TDVVQLS
A0A1E2WSV8      -----Q--GKPL---------SIPDL----AKQLKIEGIK--G----------TDVVQLS
A0A7D7L9Y1      -----Q--GKPL---------SIPVL----AEQLKIEGIK--G----------TDVVQLS
A0A2R5FRT9      -----K--GKLL---------SIPDL----AKQLKIEGIK--G----------TDVVQIS
A0A2K8T1B6      -----K--GKRL---------SIPDL----AKKLKIEGIK--G----------TDVVQLS
A0A235I9I0      -----Q--GKLL---------SIPDL----AKQLKIEGIK--G----------TDVVQLS
A0A2D0HQT8      -----Q--GKLL---------SIPDL----AKQLKIEGIK--G----------TDVVQLS
A0A2L2NU95      -----Q--GKLL---------SIPDL----AKQLKIEGIK--G----------TDVVQLS
A0A367S084      -----Q--GKLL---------SIPNL----AKQLKIEGIK--G----------TDVVQLS
A0A1Z4SMD6      -----K--GKLL---------NPELV------KVKVETIT--G----------TDVLKIS
A0A2H2Y096      -----K--GKLL---------NPELV------KVKVETIT--G----------TDVLKIS
K9S8M8          -----S--GKPM---------KPESF----LRGLEVKTIR--G----------TDVLLIT
A0A1Z4NFV0      -----N--GKLL---------DPDLL------KIKVEPVM--G----------TDVLKVS
A0A3M9ZEU1      -----N--GKRL---------QPQDI----SKQLKVKNIP--S----------TDVLHLA
A0A1Z4JK72      -----K--GRPM---------DPEEL----SKQLKVEAVP--T----------TDILNLK
A0A0N7Z489      -----Q--GRPL---------EPDEL----SRQIKVEPVP--T----------TDILDVK
A0A0S3TXS2      -----Q--GRPM---------EPEEL----SRQVKVEAVP--T----------TDILELK
A0A2A2TPF8      -----T--GKLI---------EPESL------IIKVEPIA--G----------TDVLDVV
A0A1Z4R0P8      -----T--GKLV---------DPKSL------IIKVEPVA--G----------TDVLNVS
A0A0T7BUI3      -----Q--GKFR---------NPETL------LIKVEPIV--G----------TDVLKVS
A0A1Z4LP32      -----D--GKPL---------EPESL------PMEVEALV--G----------TDVINVS
K9REP9          -----D--GKPL---------EPEAL------DLEIEPLV--G----------TDVINVS
A0A1Z4SIJ3      -----K--GHPL---------DPDQL------KIKIEAIP--G----------TDVLKVS
A0A2H2XPG4      -----K--GHPL---------DPDQL------KIKIEAIP--G----------TDVLKVS
K9V3C7          -----K--GRSL---------VPEAF------KIKVEAVP--G----------TDILNVS
A0A1Z4T6Y7      -----N--GNLV---------KPESL------NIKVEPII--G----------ADVLNVS
A0A2H2Y561      -----N--GNLV---------KPESL------NIKVEPII--G----------ADVLNVS
A0A1Q4S362      -----N--GELL---------EPESI------NIKIEPIP--G----------TDVLNVA
A0A3S1CIN8      -----N--GELL---------KPESI------NIKIDPIP--G----------TDVLKVA
A0A2A2TC28      -----D--GKPV---------DVELF------KVLVEPVV--G----------TDVIKVS
A0A0C1NCB0      -----D--GTPL---------QPEDL------EIKVDPVV--G----------TDVLKVS
A0A2N6K7Q9      -----Q--GKLI---------APELL------KVNVKPIV--G----------TDVLRVS
A0A2N6MXH6      -----Q--GKLI---------EPELL------KVNVKPIV--G----------TDVLRVS
A0A2N6M5A8      -----Q--GKLI---------DPELL------KVNVKPIV--G----------TDVLRVS
A0A2N6LL61      -----Q--GKLI---------DPELL------KVNVKPIV--G----------TDVLRVS
A0A0S3TP66      -----Q--GKLI---------DPELL------KVNVKPIV--G----------TDVLRVS
G6FP91          -----Q--GKLI---------DPELL------KVNVKPIV--G----------TDVLRVS
A0A1U7GYR5      -----Q--GKLI---------DPELL------KVNVKPIV--G----------TDVLRVS
A0A2N6KY52      -----Q--GKLI---------DPELL------KVNVKPIV--G----------TDVLRVS
A0A2N6KMP5      -----Q--GKLI---------DPELL------KVNVKPIV--G----------TDVLRVS
A0A2N6MA45      -----Q--GKLI---------DPELL------KVNVKPIV--G----------TDVLRVS
A0A4Q9J9V9      -----Q--GKII---------DPELL------KINVKPIV--G----------TDVLKVS
A0A328IGA1      -----Q--GKII---------DPELL------KINVKPIV--G----------TDVLKVS
A0A4D9CE41      -----Q--GKII---------DPELL------KINVKPIV--G----------TDVLKVS
A0A0M0SFT2      -----Q--GKLI---------DPELL------KINVKPIV--G----------TDVLKVS
A0A1Z4TLC8      -----Q--GKLI---------DPELL------KINVKPIV--G----------TDVLKVS
A0A0C2LFH0      -----K--GNAL---------DPESL------KIKVEPIV--G----------TDVLKVS
A0A1Z4IYV4      -----K--GNTL---------DPESL------KIKVEPIV--G----------TDVLQVS
A0A1Z4Q0T6      -----K--GNTL---------EPESL------KIKVEPIV--G----------TDVLKVS
A0A0C2PT44      -----K--GETL---------DSESL------KIKVEPIV--G----------TDVLKVS
A0A1D2P6J4      -----K--GATL---------EPESL------KIKVEPIV--G----------TDVLKVS
B4WP72          -----E---EAL---------TPTSL----KEGLEVKAIP--G----------TDILEIS
A0A2T1CIL7      -----Q--GNFL---------KYQEI----LANLEVKPIV--G----------TDVLQVF
A0A433V7A0      -----Q--DNAR---------LETNL----KKQFQVKNIA--G----------ADVMQIS
A0A2T1FTR8      -----KYANRPERKRLDKFINKNESF----VQQLKVSSIK--N----------TDLLEVT
K9UA41          -----KYANRPERKRLDKFINKNESF----VQQLKVSSIK--N----------TDLLEVT
A0A0C2LBE2      -----K--GKAI---------TIEEL----TNTLKISSLK--G----------TEILQVS
A0A433NN38      -----L--GNPL---------RIEDL----AAALSVVSVK--G----------TDLLEIY
A0A2N6K0T2      -----D--GEPL---------RVEDV----QKNLKVEGVK--G----------TDVLEVS
A0A2N6ML72      -----E--GEPL---------KVEDL----QKKLKVEGVK--G----------TDVLEVS
G6FQZ6          -----E--GEPL---------KVEDL----QKKLKVEGVK--G----------TDVLEVS
A0A2N6MQX9      -----E--GEPL---------KVEDL----QKKLKVEGVK--G----------TDVLEVS
A0A2N6KXT6      -----E--GEPL---------KVEDL----QKKLKVEGVK--G----------TDVLEVS
A0A2N6KGB9      -----E--GEPL---------KVEDL----QKKLKVEGVK--G----------TDVLEVS
A0A2N6L3Y5      -----E--GEPL---------KVEDL----QKKLKVEGVK--G----------TDVLEVS
A0A0S3TIS7      -----E--GEPL---------KVEDL----QKKLKVEGVK--G----------TDVLEVS
A0A1U7GW28      -----E--GEPL---------KVEDL----QKKLKVEGVK--G----------TDVLEVS
A0A2N6LW63      -----E--GEPL---------KVEDL----QKKLKVEGVK--G----------TDVLEVS
A0A328IH74      -----E--GEPL---------TVEEL----LENLKVEGVK--G----------TDVLEIS
A0A4D9CIB0      -----E--GEPL---------TVEEL----LENLKVEGVK--G----------TDVLEIS
A0A1Z4TQ63      -----E--GEPL---------KIEDL----LKNLKVEGLK--G----------TDVLEIS
A0A4Q9J8G2      -----E--GEPL---------KIKDL----LKNLKVEGLK--G----------TDVLEIS
A0A350Y0P6      -----E--GTPV---------QPSSI----GAGLKVEGIK--G----------TDVMEVS
A0A352X940      -----N--GSPI---------KPENL----LGRLTVKGLK--G----------TDVMTVS
B8HTN4          -----Q--GQLL---------KPEAF----LESLSVNNIR--G----------TDLLQVS
A0A6P1AFJ5      -----E-----I---------NYNSL----AQNLKISQVN--N----------TKILEIS
B0CAX4          -----E--DQPL---------ETKDF----IEALTVFNVR--D----------TDVLKVT
A0A1Z4RN12      -----D--GEPL---------TYKSV----STALSVEPII--G----------TDLLKIT
A0A2T1CMF9      -----K--GEPL---------TYKTV----KKALKVEPVI--G----------TDLLQIS
Q7NDC5          -----RRPGELL---------ATTDF----LRALKVEALR--R----------TDLLVIK
U5QGK3          -----QRRGQLL---------RPEKF----LKALKVETLR--R----------TDLLVIR
A0A2W4UY24      -----E--GAPL---------EANAL----LQDMSVRAIP--G----------TDVLAVS
A0A0D8ZUV2      -----D--GEVL---------LPEGF----LKKQNIKQLA--A----------TDVLEVT
A0A433VDI0      -----A--GVPL---------EPEDF----IKELKVKQLS--A----------TDILQLA
A0A3D1PG43      -----K--GATV---------QPTEL----LGKLKLKNVP--A----------TDVVQVA
A0A2P8QQ72      -----E--GKPL---------KPTAL----ISQLTLKNIP--A----------TDVLQVA
K9TZQ7          -----E--GKPL---------KPTAL----ISQLTLKNIP--A----------TDVLQVA
A0A6N8G584      -----S--GALI---------KPQVL----ANRINARNVP--L----------TDVLQIS
A0A2G7GPR0      -----G--GSLM---------KPQTL----ATRINAKNVP--L----------TDVLQIS
K9XH68          -----G--GSLI---------KPQAL----AGKMSAKNIP--L----------TDVLQIS
A0A1U7HW70      -----S--GSLI---------KPQAL----AGKMSARNIP--L----------TDVLQIS
A0A2S6VEJ8      -----N--GSLL---------KPQVL----ASRVNARNIP--L----------TDVLQIS
A0A140KBA0      -----Q--DELY---------RYKDL----INKLEIKPVT--G----------GNVIKIS
K9XSG1          -----Q--DELY---------RYKDL----INNLEIKALT--G----------SNVIKIA
A0A2T1GMT4      -----R--GKLI---------AASDL----HSGLTTKIVG--G----------ADILQVS
K9UI51          -----R--GKLL---------TASDI----HTGLTTKIIG--G----------SDILQIG
A0A1Z4QL41      -----K--GEPL---------EVEDL----VKDLTLKIIG--G----------TDVLKIT
A0A2T1FXY4      -----R--GELQ---------EVEAF----KKAVKLKIVG--G----------TDVLRIT
K9TYI2          -----R--GEPQ---------EIEAF----KKAVKLKIVG--G----------TDVLQIT
A0A252D4T4      -----I--GEPL---------TVEAL----KKAINLKIIG--G----------TDVLLVS
A0A252DJH5      -----I--GEPL---------TVEAL----KKAINLKIIG--G----------TDVLLVS
A0A252EB80      -----I--GEPL---------TVESL----KKAINLKIIG--G----------TDVLLVS
A0A6G9SKZ9      -----E--GKPL---------TAEAL----KKALNLKIIG--G----------TDVLQVS
A0A1Z4HPW5      -----Q--GQLL---------TPEAL----KKALNLKIIG--G----------ADVLQIS
A0A1Z4MSN1      -----E--GKPL---------TTEAL----KKALSIKIIG--G----------TDVLLVS
A0A1Z4U1C2      -----E--GKPL---------TTEAL----KKALSIKIIG--G----------TDVLLVS
A0A0D6KV51      -----E--GKPL---------TPEVL----KKALNIKIIG--G----------TDVLLVS
A0A1Z4MKF8      -----E--GKPL---------TPEVL----KKALNIKIIG--G----------TDVLLVS
A0A2C6WC43      -----E--GQPL---------TVKAL----QKSLILKIIG--G----------TDVLRVT
A0A1Z4L5A1      -----E--GQPL---------TVKAL----QKSLVLKIIG--G----------TDVLRIT
A0A367QD86      -----E--GQPL---------TVKAL----QKSLVLKIIG--G----------TDVLRIT
A0A2K8SM78      -----E--GKPL---------EVEKL----RNSLTLKIVN--G----------TDVLRIS
A0A2R5FPC0      -----E--GKPI---------EVEKL----RKAVILKIIN--G----------TDVLRIS
A0A5P8W5T6      -----E--GKPI---------EVEKL----RKAVIMKIVN--G----------TDVLRIS
A0A7D7LDT7      -----E--GIPL---------EVQAL----KKALNLKIIG--G----------TDVLLIS
A0A235IZ96      -----E--DKPL---------EVQAL----QKSLTLKIVG--G----------TDVLKIT
A0A2L2NGP0      -----E--DKPL---------EVKAL----QKSLTLKIVG--G----------TDVLRIT
K9QM62          -----Q--GKPL---------TVKAL----AKNLDLKIVG--G----------TDVLQIT
A0A1Z4FWI3      -----K--GEPL---------TVEAL----KQRLTLKIVG--G----------TDVLLVS
A0A1Z4JYE7      -----K--GEPL---------TVEEL----QEKLTLKIIG--G----------TDVLEIT
A0A0F5YE28      -----E--GKLI---------DPESI----RKSLEVKIIG--G----------TDIVSLS
U7QEH7          -----E--GKLR---------EAESI----RKSLEVKIIG--G----------TDIVSLS
A0A3S1ATK5      -----K--GEVL---------EVEDL----QKSLTLKIVG--G----------TDVLKLT
A0A2Z6CPH0      -----N--GESL---------KVEEL----QKKLKLKIIG--G----------TDVLRVS
A0A1Z4GT50      -----N--GEVL---------AVEEL----AEALELKIVG--G----------TDVLQLN
A0A1Z4GIX0      -----K--GEPL---------KVEEL----QKNLTLKIVG--G----------TDVLRIA
A0A2H6LC24      -----K--GEPL---------KVEEL----QKNLTLKIVG--G----------TDVLRIA
B2J6N5          -----E--GKPL---------EVEKL----RKSLTLKIVS--A----------TDVLRIS
A0A367RMI4      -----D--GEPL---------EVKKL----LKLLNLKVIG--G----------TDVLRIS
A0A235HUM0      -----E--GEPL---------EVKAL----QKALNLKIVG--G----------TDVLRIS
A0A2L2NW47      -----E--GEPL---------EVKEL----LKVLNLKIVG--G----------TDVLRIA
A0A1E2WUR1      -----E--GIPL---------EVQAL----KKALNLKIIG--G----------TDVLLIS
A0A235IKU3      -----E--DKPL---------EVQAL----QKSLTLKIVG--G----------TDVLKIT
A0A1U7MYU6      -----E--GLPL---------EPEAL----KRRLTIKIVG--G----------TDVVRLS
A0A1D8TNX9      -----E--GLPL---------EPEAL----KRRLTIKIVG--G----------TDVVRLS
A0A6P0L6C2      -----E--GLPL---------EPEAL----KRSLTVKIVG--G----------TDVVRLS
A0A6P0MVH0      -----E--GLPL---------EPEAL----KRSLTVKIVG--G----------TDVVRLS
A0A6P0KJV0      -----E--GLPL---------EPEAL----KKKLTVKIVG--G----------TDVVRLS
A0A6L9ZJG4      -----E--GLPL---------EPEAL----KRRLTIKIVG--G----------TDVVRLS
F4XKF3          -----E--GLPL---------QPEAL----KRKLTVKIVG--G----------TDVVRLS
A0A1D9FX10      -----E--GLPL---------EPEAL----KKKLTVKIVG--G----------TDVVRLS
A0A6P0Q0T0      -----E--GLPL---------QPEAL----KRKLTVKIVG--G----------TDVVRLS
A0A6P0W5I0      -----E--GLPL---------QPEAL----KRKLTVKIVG--G----------TDVVRLS
A0A3C0NJ41      -----K--GKSL---------TPEDF----QKKLKAKIVG--G----------TDVVELS
A0A352AG88      -----D--GTPL---------SPEAL----HEKLTIENLA--E----------TDVLELA
A0A350Y374      -----Q--GEPI---------SPESL----QKKLKIKTIG--A----------TDVIEII
A0A355DPX0      -----Q--GEPI---------SPESL----QKKLKIKTIG--A----------TDVIEIT
                                                                            

K9SLA9          YHDPDPKRAASIVNTVSKIYIASDLETKSLEAKSLLQFVERQ-LPTSKSALESAEIKLRQ
A0A168TT23      VNSFDPAFAAQLANAVVEEYVRSTMQRRYDAGQEAREFLEGQ-LADMRIALERADQNLID
A0A0M1JWX9      YQDEDPEKIDFILKKLAENYLRYSFEDRQTNTRKGIQFIEEQ-LPQLRQRVDTLQGQLQK
A0A2T1M1V6      VEATSPELAYQRVKTLMNSYQKRLNELRQQDVKSQDQFAENA-LKKAQNNLILAQNKLTQ
A0A2G7GCS2      VKASSPEIAQKRLSNLINVYQLRLNELRHQDTNVRKQFSQTD-LEDAQAQLAKAQAELAN
K9XBH8          VKASSPEIAQQRLNNLINIYQLRLNELRYQDTSVREEFSRGD-IEKARQQLEQAQAALAS
A0A1Z4LJ30      VEGSSPELAQQRANGLIKAFRDRLQELRKDEAQQRSQFMQDE-VKQAYQKLFKTQKNLSE
K9RI76          VQGSSPELAKNRAAALIAAFSNRLQELRLDEAKQRSQFMQGE-VKLANTKLLKAQKALSE
A0A352AE27      VKGSSPELAHQRAIALIEAYQQRLNELRQTDGVARAQFSQKQ-LEQAQQRLNQAQMELAQ
A0A3B8JH60      VNGSTPEVARQRAIALLKVYQARLNELRQADGMSRKQFSQKE-LEQAKERLAQAQMALAQ
A0A3C0N766      VNGSTPEVARQRAIALLKVYQARLNELRQADGMSRKQFSQKE-LEQAKERLAQAQMALAQ
K9W9J7          VSGSTPELAKGRANNLLQVYQQRLNQLRQADSASRKQFSQKE-LNQAKARLDQAQRAVAQ
A0A139WSU3      VSGSSPKLANQRAIAITEAYQNRLNELRQANSRTRQKFSQIE-LEQAKLKLAQAQSKLTI
A0A433VN22      VSGSQPDLATLRTQNLIKAYQARLDELREGNSKERQKFNVKE-LEQAKAKLSNAQTKIAR
Q7NF11          AKGNAPEVAEARADLVVRSYVARLEELRNAYAASRDTLSQKE-LDRARRELTRAEAALAR
A0A1Z4JCS8      VTGSSPDIAKQRAEAILNAYRQRLSELRQANNNTRDGFSQKQ-LEQAQRRLTEAQTALAQ
A0A6P0PI80      ATGASPELARDRVRALISAYQERLNELRQADGTTRVEFNKKA-LDRAKQKLDQSQEALAK
A0A6P0WGT6      ATGASPELARDRVRALISAYQERLNELRQADGTTRVEFNKKA-LDRAKQKLDQSQEALAK
F4XTX2          ATGASPELARDRVRALISAYQERLNELRQADGTTRVEFNKKA-LDRAKQKLDQSQEALAK
Q7NJN6          AKGSSPELAQQRAEWVLQSYQTRLNALRLDDARRRDEFSRVE-TAKAQNNLQTAQVELYG
U5QCC3          VKGSSPEIAKNRANALLQSYQRRLNELRLDDARRRDQFSHEE-LERAKRTLQQTQSELAS
A0A0S3TYD7      YRSNDPMEAAEVVNHLMQLYVQDNLTANRAEAKSAREFIQSQ-LPEVERNVRQVEGEIRA
A0A2T1DNG3      YTSNDPIKTQKVLQAVQKVYQDYNLQQQQDRLTRGLAFVDKQ-LPQVEGKVKDAEAALEQ
A0A3S0Y9N9      YADTNPRMAASIVNTLMKIYIENDIDINRAQTRSARSFIAQQ-LPLSKAALQAAEKKLQD
A0A433UNK7      YTSTDPRTAASVVNTLMKVYIENDINANRAQTRSARDFIAQQ-LPLRKAALQTSERRLQF
A0A6P0ZKB8      YTDEEPRTAASVVNTLMKIYIENDIEANRAQTKSARDFIAQQ-LPARKAALQAAERKLQL
U5QL42          YRDTNPERAKAVLTALGATYVEYSLESKRGQADNAIKFIEAK-LPRAKKVLNQTAIAIRE
A0A140K3H3      YTDTNPERAKAVLDALGSTYVEYSLNRQRSQAGNAINFIDEQ-LPKAQAELNEVAKAIRN
K9XUB8          YIDSNPERAKAVLEALGSTYVEYSLNRQRSQAANAINFIDQQ-LPKAQAELDDVAKKIRN
A0A6H2NHD5      YRDQDPEVVAFVLSEVAEGFVDYSVDDRQAELRRGLTFLDEQ-LQEKWQEVSDIEDNLSD
A0A2P8W4F7      YNGADPAVVSFVLNQVVEGFVDYSVQDRQGDLRRGLTFLDEQ-LQEKWQEVEAIESDLSE
A0A5Q4E0Z4      YKNSDPEVVTTVISEVVKGFVAYSVQDRQGELRRGLEFLDEQ-LQEKWQEVDTIESGLSD
A0A2P8VVX1      YTANDPTQPQRVLAALQDIYLNYNQEQQAQRLSRGLDNVNNR-LANTQQNLRDSQSALEQ
A0A2P8WHY0      YVDSDPIKTQRLLEALKEAYLEFNEAQQARRLERGLEHTNNR-LDNTQKNLQQAQAALEK
A0A2T1CMT9      YVGSSPVETKKVLTAIQEVYLKYNLEQQEKRLRDALTFINQQ-IPQARKELTQTETNLTK
A0A7G8J1V5      LTGRNPAETEQLLKALSSTYLQAAQQQRQKRLEDGLNFLNKQ-APELEARSNALQDELAS
A0A354B169      LTGHDPVQDELVLKAISAAYLHAALEQRQKRLADGLTFLNKN-APTLQQKTSQLQSDLAK
Q0IDT5          LTGRNPKEDGQLLEAISAAYLQTALQQRQKRLTDGIAFLDLQ-APALQAKADAIQGELAE
A0A7G8FZD9      LVGRDKDEDQQLLTALSDTYLKVALQERQQRLADGLNFLNKQ-APALEAKTEQIQSEVAA
G4FMX5          LVGRDKDEDQQLLTALSDTYLKVALQERQQRLADGLNFLNKQ-APALEAKTEQIQSEVAA
A0A7G8FAU7      LTGRDPEQDEVLLQAISTAYLQAALQQRQQRLADGIDFLNKQ-APALQQKTEAIQNELAA
A3ZA21          LTGRDPEQDEVLLQAISTAYLQAALQQRQQRLADGIDFLNKQ-APALQQKTEAIQNELAA
A0A076HBF2      LTGRNPIEDERLLNALSNTYLQAALQQRQQRLADGLAFLNKQ-APSLQTRLDQLQGELAD
A0A7G8FP50      LTGRNPSESQRLLKALSSTYLQAALEERRRRLSDGLAFLNKQ-APSLQSKVDQIQGELAD
A0A7G8E8K7      LKGSDPVEDERLLKALSSTYLQAALQQRQQRLADGLAFLNKQ-APSLQTRLDQLQGELAD
A0A7G8GAH0      LTGRNPIEDERLLKALSNTYLQAALQQRQQRLADGLAFLNKQ-APSLQTRLDQLQGELAD
A0A7G8GNR2      LTGRDPVEDELLLKALSSTYLQAALQQRQQRLADGLAFLNKQ-APSLQTRLDQLQGELAG
A0A7G8ICD3      LTGRDPIEDERLLKALSNTYLQAALQQRQQRLADGLAFLNKQ-APSLQTRLDQLQGELAD
A0A2D6FCW3      VTGRDPVEDKQLLDDLSSTYLQAALQQRQQRLSDGLNFLNKQ-APALEAKTEEIQSEVSD
A0A7G7KJ95      LTGRDPEQDEAVLKALSTAYLQAALQQRQQRLADGLAFLNKQ-APALQAKTDQIQSEVAA
A0A7G8EAN3      LTGKDPVEDQRLLSALSETYLQAALQQRQQRLADGLAFLNKQ-APALQAKTDQIQSEVAA
A0A563VQJ3      YNADRPEIAAEIVNTLMTIYVREQIRNNQAEPANAKEFINRQ-LPEIEVKVETAESELEQ
A0A1D8TX52      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPKARKDLEQAEQQLEQ
A0A1D9G4T2      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0PR27      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0WER7      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
F4XP71          YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6L9YR57      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPKARKDLEQAEQQLEQ
A0A6P0KZ31      YTSNDRIKTQKVLQAIQKVYQEYNLEQQEMRLNKGLAFINQQ-LPTARKNLEQAEQRLEQ
A0A6P0LPB8      YTSNDRIKTQKVLQAIQKVYQEYNLEQQEMRLNKGLAFINQQ-LPTARKNLEQAEQRLEQ
A0A6P0SEV1      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6B3N2I8      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6M0B891      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0IJQ1      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0J8J8      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0ZSH6      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A1U7N5X9      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPKARKDLEQAEQQLEQ
A0A6L9Z1V0      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0LC12      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINEQ-LPTARKNLEQAEQRLEQ
A0A6P0MVJ3      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARKNLEQAEQRLEQ
A0A2W6ZAV2      LLWDDRREGQQILEAISAEYLAFSMRQRQERLAQGLEFLDTQ-APVLQQGVVELQQQLSS
K9W742          YTANDPVKTQKVLQAVQRVYLNYNREQQRLRLAKGLAFIDEQ-LPKARLSVTQSEAALEK
A0A3D1PBA3      YTANDPVKAEKVLEAVYKVYQIYNREQQQQRLQKGLKFINEQ-IPVVSKTVDQAENKLEQ
K9XPB0          YVSQDYNDSKKILEAIEQVYIEYNVEQQEKRLRDGLAFIAKQ-IPAAQQEVAAIEAKLTQ
A0A350Y7Z1      YTSNDPIQTQDVLAAIQTVYQDYNLQQQQVRLTEGLAFINDQ-LPTARDNVIQAEKALEQ
A0A352X2A7      YISKDPIQTQEVLKAIQKIYQNYNLEQQKQRLVDGLSFIDNQ-LVTAANNVNKAERSLEE
A0A0D8ZYV0      YVSNDPVKTQKVLQTIYQVYQSYNREQQEQRLKKGLKFINEQ-IPGVRNQVAQSEAQLEK
A0A2T1FP73      YTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-IPAVTKTVDQAENKLEE
A0A433VMS2      YTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-IPAVTKTVDQAENKLED
K9TYA7          YTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-IPAVTKTVDQAENKLEE
A0A2P8QUE1      YTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-IPAVTKTVDQAENKLEE
K9SA61          YTGDDPEKTQAVLQAVQKVYQDYNREQQELRLSRGLAFINDQ-LPKVQAEVREAEAALEA
A0A2G7GMH8      YTDNDPQRTQNVLNAMQQVYQDYNLEQQKLRLAKGLTFINEQ-LPVIKDRVNQAENALEL
A0A6N8FU92      YTDNDPVRTNDVLSAMQQVYQDYNLEQQKIRLAKGLTFINEQ-LPLVQDRVNQAENALEL
A0A2T1DWE8      YTSDDPEKTQKVLMAVQQVYKDYNREQQKLRLTRGLAFVDEQ-LPLVEKQVDRAEDAMER
A0A1U7I8L3      YIDNDPIKTQTVLETIKRVYQDYNREQQQLRLTKGLSFIDAQ-LPSLRESTVRTEAALEK
A0A2T1DJL8      YTGHDRQQTQAVLQAIQQVYQQYNLEQQKARLTKGLGFINEQ-IPQVEARVNQAEAALER
A0A1Z4J9W0      YIDHDRIKTREVLKALEKVYQDYNLEQQRNRLTKGLSFIDRQ-IPEVQAKVNQAESNLER
A0A0N7Z5K9      YIDYDRVKTREVLKSLQRVYQDYNLEQQRNRLAKGLSFIDRQ-IPQVQEKVNKAEADLER
A0A0S3TXC5      YIDHDRVKTREVLKALQRVYQDYNLEQQRNRLAKGLSFIDRQ-IPQVQAKVDKAEADLEQ
B8HNB0          YTGTDPKTVQAILDALNKTYIDYSLEKRRSQVSSGVRFIEEQ-LPAAQAKLAQSAQAVRN
A0A563VS48      YEGNDPEVVASVVNQALMLYKDQDRLSNRTEAVAARTFITEQ-LPQVKANVQEAESELRK
A0A318BJ18      FSSPDPDFSARIANAWAENFIQTNLERKIQATSYGRNLLQRQ-LALQKERLDDSQRQLVA
A0A3B8Y8H9      YQDIDPRKVTFILNELAKVYLDYSLNDPRMKKTQGLQFVEDQ-LPKLDQEVSSLQKELER
A0A2W1JVB9      YESEDPEEAALVINTLMKVYLADNLRINRLEASSARQYIDQE-LPKTREKIENLEEQLRR
A0A3M1SVZ4      YQDENPKKAATFVNSLIEVYLEDDILRKRAELTATREFIEAK-LPDAEYTLSQAEQELRQ
A0A6H1U102      YTDTDPSRAKAILEALGSTYVDYSLERQLSQATNAIDFIEEQ-LPKAQAELNETAQAIQK
A0A7C3ZEJ3      YTDRDPERAKAVLEALGNTYVDYSLERQRSEATNAIGFIKEQ-LPEAQKELNQSASAIRE
A0A563VLD6      FIDSSPQRAKEVLDALGKVYVQYSLDKQRSQAANAIDFIDEQ-LPDSQLDLDKVAYDIRS
A0A2P8W9H0      YSSEDPEQVTDVLEVVMAGYLRYSLEDRQNDIFRGLDFLDEQ-LPEVRERVSSLEAELED
A0A6I5P386      YKSTDSEKVTYVLDLLLSTYLRYSLEDRQNDINRGISFVDEQ-LPVVRQQVQDLETELEN
A0A654SFI6      FSSPSPEISSKISNLWADEFIRANYEKRFGANIDAREFLNKQ-IEELRERLSISERDLVE
A0A318BG22      YTSNDARLSAAIANAAVDQFIESTTQRQYAASSYARSFVGNR-LTQQRARLEESERQLVA
K9SSQ0          YSDRNPKTAATIL----QGLLETYKAYGANKANQATQLIQAQ-IPDAKKQLDQNSTALTR
A0A2W1JIN9      YTSSDPELASRMLNSIAQTVVQENTETIQAEAKSAREFLEGQ-IPQRRQELLQVEARMSK
A0A318AJV1      FKSRDAAKSSRIANAFADTYLDMRVHGEASSSVQQAAFFRQR-LDELARQVNDADTRLAA
A0A6P0IC70      YQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRALTEAAEVAESK
A0A6B3MUB5      YQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRALTEAAEVAESK
A0A6M0B7N4      YQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRALTEAAEVAESK
A0A6P0J9W3      YQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRALTEAAEVAESK
A0A6P0ZWE1      YQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRALTEAAEVAESK
A0A1U7N2U4      YQSQNPELATTVLNAVANAMVSESAQGIRSEARAVREFLEKE-VPLRRLEVEATEAALNK
A0A1D9G1F2      YQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6P0PNZ7      YQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVAAAEAALNK
F4XV38          YQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6P0W137      YQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6L9Y9E2      YQGQNPELATTVLNAIANAMVSESAEGIRSEAKAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6P0SGR0      YQGQNPELATTVLNAIANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVEAAEAALNQ
A0A6M0BK48      YQGQNPELATTVLNAVANAMVTESAEGIRSEAKAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6L9YZL1      YQGQNPELATTVLNAIANAMVTESAEGIRSEAKAVREFLEKE-VPLRRLEVAAAEAALNQ
A0A6P0KYM4      YQGQNPELATTVLNAVANAMVTESAEGIRSEAKAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6P0LSD6      YQGQNPELATTVLNAVANAMVTESAEGIRSEAKAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6P0X384      YESENPELATRLLNTVLQVMVQESSEAIRSEARSLREFLEAE-LPKRRAAAEAAEAALSK
A0A2P8QIL5      YSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-VPKKRAQLAQVEATLSQ
A0A2T1FLY5      YSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-VPKKRAQLAQVEATLSQ
A0A433W447      YSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-VPKKRAQLAQVEATLSQ
K9U1K8          YSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-VPKKRAQLAQVEATLSQ
K9UYB2          YQSEDSQLAANLVNSVAMAMIRDHVQAISSEATKIREFLETKELPKARQALMVAEMEESA
A0A218QN17      YKSKDPELAAQLLNAVSQAMIEENTKTISSEATKVREFLENNEIPNARKRLATAEQNESN
K9RKN2          YENQDPLLAARLLNAVSSAMVEYDIKAISSEATKVKDFLENKQLPIARKKLREAEATESQ
A0A2I8ADV2      YFHQDPQFAADVLNAVSQAMVEENIQAISSEATKVRKFLEKE-VPVARNRLQQAEVAESR
A0A1W5CKM3      YQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQRLLQAELAETK
A0A5Q0GMF5      YQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQRLLQAELAETK
Q3MEW0          YQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQRLLQAELAETK
A0A1Z4KIC7      YQSPEPNQAAQVLNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQRLLQAELAETK
Q8YSM5          YQSPEPNQAAQVLNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQRLLQAELAETK
A0A1Q4S1H4      YKASDPVFAARLLNAVSNAMVEENIKTISSEATKVRQFLEKNEVPNAQQRLKVAEIKENK
A0A433VBU6      YKAADPVFATRLVNAVTDAMVEENIKTMSSEATKVREFLEKKEVPNAQQRLKAAEIKENK
A0A1Q4RZJ6      YQSKNPDLAATYANAVAMATIRDNIKSISSEATKVRQFLQQQ-LPQARTQLQAAEVAENN
A0A1Z4SNV3      YQSKNPELAATYVNAVAMATIRDNTKSISTEATKVRQFLQQQ-LPQARAQLQAAEAAENK
A0A2H2XJQ1      YQSKNPELAATYVNAVAMATIRDNTKSISTEATKVRQFLQQQ-LPQARAQLQAAEAAENK
A0A3S5K358      YQSKNPDLAAAYANAVAMATIRDNIKSISSEATKVRQFLQQQ-LPQARTQLQAAEAAENN
A0A0T7BPJ4      YEARDAQLAAKLLNVIAQTMVEENTRTISSQATKVREFLEKKEVPAAQRNLTVAEANENR
A0A0C1QS61      YQSKNPKLAAQLLNSVARAMEEESANTIRQEAANVRKFLEME-VPKAREKLENAELTENR
A0A139X3R8      YQSKDPILAAQLLNAVSRAMEEESANTIRQEAANVRKFLATE-VPKARQNLEDAELKENK
A0A1Z4I7C5      YQSPNPEQTAQVLNAVSQAMVEENIKTINSEATKVREFLSQK-VPQARQRLQQAELAETR
A0A0C2MDK7      YQSRDPQLAAKVLNAVSQAMVEDNVKSIGLEATKVKQFLEQKQVPEAEKKLLQAEDLENK
A0A1Y0RCK1      YQSKNPQLAAQLLNAISQAMVEDNTKSINSEATKVKEFLEEKQVPEADKQLRQAEAQENK
A0A1Z4PWZ0      YQSEYPKLAARLLNAVAQAMVEDNIKAISSEATKVKAFLEKKQVPSAEKQLLQAEEKENK
A0A0C2QLT0      YQSKDPRLAAKLLNAISQAMVEDNTKAISSEATKVKKFLEEKQVPEADKQLRLAEATENK
A0A1Z4J2K1      YQSKDPQLAAKLLNAISQAMVEDNTKAISSEATKVKKFLEEKQVPEADKQLRLAEATENK
A0A3S0ZSX0      YEHKDPALASKLVNAVSQAMVEDNTQIIRQEAANVRKFLQQQ-VPEARQRLEKAELIENK
A0A2N6K4T3      YLNKDPILATKVVNAVSKAMVEDNTQVIRQEAANVRKFLETK-VPDARKRLQEAEQKENR
A0A370CKT2      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A0S3TL97      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A2N6M8A0      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A2N6M9E1      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A2N6KJI4      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A2N6MZ77      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A2N6KT20      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
G6FSN3          YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A4D9CI02      YLNKDPTLATKVVNAVSQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKRVEEAEQKENK
A0A328I8B9      YLNKDPTLATKVVNAISQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKRVEEAEQKENK
A0A4Q9J4Z7      YLNKDPTLATKVVNAISQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKRVEEAEQKENK
A0A0M0SU69      YLNKDPTLATRVVNAVSQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKRVEEAEQKENK
A0A1Z4TIZ8      YLNKNPTLATKVVNAISQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKRVEEAEQKENK
A0A2T1E9V8      YKSNNPEIASLVVNQLMNVYVNRNLLGNRAAAISAGNFITSQ-LPKVKANVYNADAAIRK
A0A1Z4LN32      YTSGKPELAIKVVDKVMEAYIKKNIYTNRSEAIAARSFIEKQ-LPSAKRGLSKVTEELRD
A0A2I8A9F5      YVSEDPYLAKAIVNQVMKSYIANNILTNRSEVMAAGDFIAKQ-LPGAKTELEEAQKALLQ
A0A218Q6R8      YVSEEPQLAKEVVNQVMKSYIANNILANRSEAIAAATFIQQQ-LPQAKKELEEITEALRQ
A0A218QGE0      YTSDNPESAKAIVDQVMKSYIANNILSNRTQAISAGAFIEKE-LPRAKAQLEKAAEALRK
A0A3M2GQQ6      YTDTDPARAKAILDVLGKTYVDYSLERQVSQASNAIEFIEEQ-LPKAQQELSESALAIQS
A0A6H1U2X0      YTDTDPARAKAILDVLGKTYVDYSLERQVSQASNAIGFIEEQ-LPKAQQELSESALAIQS
K1XF69          YQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-LPRVQQELFLAEKSIQD
B5W297          YQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-LPRVQKELFLAEKSIQD
A0A6H2AL05      YQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-LPRVQKELFLAEKSIQD
H1W7M8          YQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-LPRVQKELFLAEKSIQD
A0A5Q4H6A5      YQSKNPQEVADVINTIMEVYIDANVSGIRQEASGAKEFIQEQ-LPRVQQELFLAEKSIQD
D5A466          YQSKNPQEVADVINTIMEVYIEANVSGIRQEASGAKEFIQEQ-LPRVQQELFLAEKSIQN
U5QJM6          FKDTDRQLVQDMLKELAKIYIDYSQDVQKSQVSGAITFINAE-LPRVRMNVEASEEALRD
A0A1Z4RPC6      YKDPDPVIASKVINTLMDVYIKEQVNSNKKATASADSFVTST-IPKIEDKLQTLESRLQN
A0A2T1CMZ0      YKDPDPIIASKVVNTLMGVYIKEHVRSNKSATVSADSFISST-IPKIETKLNSLEANLQS
L8M4F7          YKDPNPKFAADIVNSLMNVYVEAQIRGNQSDPAVAKKFINQQ-IPTLKAKVESAESALAK
A0A140K2P2      YAHPNPKVAADVVNTLMNTYINEQIRTNQSEPASAREFINKQ-LPQIESQVSQAESELRN
K9XWX4          YAHPNPKVAADVVNTLMNTYINEQIRANQSEPASAREFINKQ-LPQIESQVSQAESELRN
A0A140KB14      YQDQDPYTAADVINTLMKLYLDEQVKSTQAETANADSFISNQ-LPQIEQKLSKAESDLRR
K9XX88          YQDQDPYTAADVINTLMKLYLDEQVKSTQAETANADGFISNQ-LPQIEQKLSQAESDLRR
A0A563VSV6      YKDSDPIQASQVVNTLMDVYIKNQVRSNQAETENADSFVTTQ-IPQVEDKLKQNESILQE
L8LZE9          YEDKDPQIASNVVNTLMNIFLENKIANNQKDTESADFFVESQ-LPQVEKRLEEYESILQN
A0A433NM31      YKSTVPEQAQAVVNKLMDSYLRNNMMATRTEAIAARNFIESQ-LPKSKISVQKAEAQLRE
A0A1Z4NDS1      YQDNDPELAAKVVNKLMEVYVQNNIRENRAEASAAGTFLDDQ-RPNAARIVQAAELELRR
U9VXM0          YTSDDPELAANVVNTLTDIYIENDIQTNRAAAVAAQEFISAQ-LPESEAAVNEAEEALRQ
A0A6M0RI13      YTSEDPEIAATVVNTLADIYIENDIQTNRAAALAAQEFITAQ-LPESEEAVEEAEASLRR
A0A6M0S1N5      YTSEDPEIAATVVNTLADIYIENDIQTNRAAALAAQEFITAQ-LPESEEAVEEAEASLRR
K9F4D9          YTSEEPEIAATVVNTLADIYIENDIQTNRAAALAAQEFITAQ-LPESEEAVEEAEASLRR
A0A6I5QPI5      VESEDPEEAAAIVNQVIESYREQNIESNREEAAAARQFIEEQ-LPTTEAEVLRVEGALRE
A0A1Z3HMQ0      YQSPNGELSAAVVNQVMTSYIERNITMNRSEATAARQFVQEQ-LPKAEAEVEQAAEALRQ
A0A433W533      YKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-IPDVEARVRRAESALRR
A0A2P8QWJ3      YKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-IPDVEARVRRAESALRR
A0A2T1FKP8      YKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-IPDVEARVRRAESALRR
K9U6L7          YKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-IPDVEARVRRAESALRR
A0A1E5QP61      FKSQYPKEAADAVNKLMDVYINNNILVNRREATAAREFIMQQ-LPDTEETVRQAEAALRA
U5DPF5          YQSTDPEEAARVVDSFMEVYRDNDVRINRSEAAAAREFIEEQ-LPLTERSVREAEEALRR
A0A6P0X488      FNGPDPKDAAEVVNQLMQVYLQNNVLTNREEAVAAREFIAKQ-LPATEKTLRQAESALRS
A0A6P0UVD5      FNGPNPEDAAEVVNQLMQVYLQNNVLTNREEAVAAREFIAKQ-LPATEKTLRKAESDLRS
A0A6P0VDM0      FNGPNPEDAAEVVNQLMQVYLQNNVLTNREEAVAAREFIAKQ-LPATEKTLRKAESDLRS
A0A6M0G142      FSGPNPEDTAKVVNQLMNVYLQNNVLTNRAEAVAAREFIAQQ-LPQTQENLRQAESALRR
A0A6P0MR53      FESPNSEDAAAVVNQLMKVYLQNNVLTNRAEAVAAREFIAQQ-LPKTQETLRQAESALRR
A0A3M2GIL5      YQAGNPEEAATVVNKVMEVYIENNILVNRSEAAAAREFINKE-LPEIEARLSRAEAELRN
A0A6H1TSJ9      YQAGNPEEAATVVNKVMEVYIENNILVNRSEAAAAREFINKE-LPEIEARLSRAEAELRN
A0A3M1PML8      YASEDPEETAAVINRLVDIYTKNNVLVNRAEAAAARDFIAKE-LPKTEAAVKAADSDLRR
A0A6M8BE85      YASDDPEEAAAVLNRLVEVYTKNNVLVNRAEAAAAREFIAKE-LPKTEAAVRAADSDLRR
A0A0T7BPZ0      FTHENAQLAANVVNQVMDNYITENIRANRAEAESARKFIISQ-LPISESSVRAAESAFRQ
A0A352X442      YQSKKPDVAAAVVNKVMEVYIADDIQANRAKAAAAREFITEQ-LPRLKQNVSIADAELRN
A0A6B3NF44      YVSEDPEEAAKVANNIMEVYIKNDIQTNRQKAVAAREFIDQQ-LPQVEANVSKSEEALRR
A0A6M0EPL4      YVSEDPEEAAKVANNIMEVYIKNDIQTNRQKAVAAREFIDQQ-LPQVEANVSKSEEALRR
A0A6P0K6L6      YVSEDPEEAAKVANNIMEVYIKNDIQTNRQKAVAAREFIDQQ-LPQVEANVSKSEEALRR
A0A6P0MRR9      YESDNPELVAAVVNKTMEGYIENNIETNRAQAVAARKFLEGQ-VPRMKARVSRAEEDLRR
A0A6P0UX57      YKSDDPEVAVAVVNTTMDGYIENNIETNRAQAVAARKFLEKQ-VPKIEQRVKRAEEDLRK
A0A6P0X1X4      YKSDDPELAAAIVNTTMDGYIENNIETNRAQAVAAREFLEKQ-VPKIEQRVRLAEENLRK
A0A0M0SHU3      YTNENPQLAAKVINKVVDTYIKQNIQANREEATSAGRFILQQ-LPKTEEAVQKAELALRR
A0A1D2PBN3      YTDTNPTLAAKVVNKLMQAYIKNNIEANREEAVSARKFIQRQ-LPATETSVKRAEAELRR
A0A0C2LVR7      YTDTNPTLAAKVVNKLMQAYIKNNIRANREEAVSARKFIQKQ-LPATEISVKRAEAQLRR
A0A1Z4PQB9      YTDTNPTLAAKVVNKLMQAYIKNNIGANREEAVSVRKFIQKQ-LPATERSVKRAEAELRR
A0A1Z4SFN6      YKDEDPYLAAKVVNQMMEVYIKNNIEANRAEAVSARKFIMKE-LPATELSVRAAESTLRK
K9PGI8          YTDKDPTLAAKVVNKVMDAYIRNNIEANRAEAVSARKFISQQ-LPATEISVRGAELALRK
K9TLQ0          YQDTDPQKIQIILKELATGYIHYSEMEQQTTLRQGLEFVETQ-LPRLQQRVDTLQEYLEK
K9QF04          YQDTDPEKIEFVLDKLAEGYTAYYLEKLQTSSKQALKLVEAL-SPQQRQRVDQLQVQLQR
K9W1T3          YTDTDPAKAAKIINTVMSIYIKSDVNAQRSEAKAAREFVEKQ-LPIIEVTVRQAEQDLRK
K9SGJ5          YRDPDPQRAKDVLDSLASAYSQYSLKDRRSRSSTAIQFIEDK-LPQVKKDLDESALTVTK
A0A6N2JS94      YTDSNPKRAQGVLNALAQTYVEYSLKDRRTKSSTAIKFIQDK-LPQVKQQLDKSALAVTQ
A0A6C2DSN4      YTDSDPKRAREVLGALSQTYVEYSLKDRRTKSSNAIKFIQDK-LPQVKQKLEKSALAVTQ
L8MYT6          YTDSDPKRAREVLGALSQTYVEYSLKDRRTKSSNAIKFIQDK-LPQVKQKLEKSALAVTQ
A0A352JGJ6      YIDSDPKRAREVLNALAQTYVEYSLKDRRTKSSTAIKFIQDK-LPQVKQQLDKSALAVTR
A0A1J5GLS2      YTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAIKFIQEK-LPQVKQQLEKSALAVTQ
A0A2W4W6M5      YTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAIKFIQDK-LPQVKQQLDKSALAVTQ
A0A2W7AN33      YTDSNPKRAQEVLNALSQTYVEYSLNNRRTNSSTAIKFIQDK-LPQVKQQLDKSALAVTQ
A0A256BLV2      YTDSDPKRAREVLTALTQTYVEYSLKDRRTKSSTAIKFIQDK-LPQVKQQLDKSALAVTQ
A0A2W6ZXF3      FTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAIKFIQEK-LPQVKQQLDKSALAVTQ
A0A2Z5WX66      YTDSNPKRAREVLTALSETYVEYSLKDRRTKSSTAIKFIQGK-LPQVKQQLDKSALAVTQ
Q7NEU3          FEDTDPQVVKAILDELSRTYIDYSLEIQKSKLDGAIAFIENE-LPPVRKEVERAEEQLRT
A0A3C0N2P0      YQDSNPEKIQFVLERVAQGYVNYSAKEQQDSVTQGLGFVNEQ-TKNLQKRVNELQKSIQS
A0A6P0JR04      YQDSDPEKIKYILDQVAAGFVDYSQREQKTGRQKGLTFVEDQ-LPELQNRVDTLQADLQT
A0A6B3M6M6      YQDSDPEKIKFVLEQVVKGYIKYSEQEQQTTTRQGIQFVESQ-LPKLQERVNKFQEQLQR
A0A6P0KD09      YQDSDPEKIKFVLEQIVKGYIKYSEQEQQTTTRQGIQFVESQ-LPKLKERVNKLQEQLQR
A0A6B3NIJ0      YQDSDPEKIKFVLEQIVKGYIKYSEQEQQTTTRQGIQFVESQ-LPKLKERVNKLQEQLQR
A0A6M0F053      YQDSDPEKIKFVLEQIVKGYIKYSEQEQQTTTRQGIQFVESQ-LPKLKERVNKLQEQLQR
A0A6P2ATU9      YQDSDPHKIQFVLDKLAAGLIAYSQMEQQTGRQKGLGFVEEQ-LPILEERVNTLQNDLQA
A0A352XE00      YQDSDPEKIKFILDQVANGYINYSRQEQQTTTQQGIQFVKDQ-LPKLQERVNQLQAQLQE
A0A6P0QC14      YQDSDPEKIQFILKELADGYVEYSKIEQRNSVEKGLEFVNGQ-TKELQKRVKDLQQKIQT
B4VS56          YQDSDPEKIQFILEQIATGYVNYSLSEQQTSTRQGIQFVEEQ-LPKLQGRVDSLQQKLQR
A0A352AAQ3      YQDSDPEKIRFILEQVADGYVKYSETEQRTAVTQGLAFVNKQ-AKELQGIVNDLQQKVQD
A0A350Y472      YQDSDPNKIQFILEQVANGYVQYSEAEQRTAVTQGLAFVNKQ-TQKLQELVNDLQQQIQN
A0A355DVB4      YQDSDPDKIQFILEQVANGYVKYSEAEQRTAVTQGLAFVNKQ-TQKLQELVNDLQQQIQN
A0A1Z4RMB9      YRHPNPKTASEVVNALMDVYVKEQIRGNQSQPAAAKDFITKE-LPSIESKVQQAESQISA
A0A318B4H2      FKSPSAELSSKVANSWAAEYIQSNLDRRFATTADARGFLEQR-LAQLRSRLEASERELVA
B4WQE3          YRSDDPYKVTTVLEVVLQTYLNYSLEDRQNDIYRGVDFVNDQ-LPAVRARVNELEAELEA
A0A2K3BR24      YEHPEPEKAATIVNELMNVYRENNVLNNRSEATAAREFIEEQ-LPKTEQSVQAAEEKFRE
K9YXY1          YEHPDPEKAATIVNELMNVYRENNVLNNRSEATAAREFIEEQ-LPKTEQSVQAAEEKFRE
A0A1Q4RTR1      YRSPDKKMAAAVVDSVIKNYLENDIRANRTEVVSAREFISKQ-LPEVEAKVRQAEVSLRL
A0A1Z4SQV2      YRSPDAKQAANIVNTLIKNYLENDIRTNRTEAVAAREFISKQ-LPEVETKVRSAEYGLRQ
A0A2H2XGN1      YRSPDAKQAANIVNTLIKNYLENDIRTNRTEAVAAREFISKQ-LPEVETKVRSAEYGLRQ
A0A433UXH8      YRSSNPKLAANVVNTLIKNYLENDIRTNRTEVVAAREFISKE-LPEVETKVRSAEYGLRQ
A0A0V7ZFJ4      YESNDPQKAAAIVNSLMKDYQENNISTNTAEARSAREFLNKQ-LPEVEQRLIRAEAELRE
A0A0V7ZNJ9      YKGTDPQQAAAIVNSLMQDYIDNNIRVNTAEARAAREFLNNQ-LPEVESRVVKAEAELRK
A0A367RIS1      YRSANPQQATAIINKLMSAYLENNVRINRSQARAAREFLNKQ-LPLVEAKVAEGEAALRQ
A0A235IXQ2      YRSTNPQEATAIINRLMSAYLANNVRINRSEARAAREFLNKQ-LPLVEAKVTEEEAALRR
A0A1W5CNX3      YRSANPEEATAIINRLMNTYLENNVRNNRSEATAAREFLSKQ-LPLVEAKVTEAEAALRR
A0A5Q0GJJ5      YRSANPEEATAIINRLMNTYLENNVRNNRSEATAAREFLSKQ-LPLVEAKVTEAEAALRR
Q3MEB7          YRSANPEEATAIINRLMNTYLENNVRNNRSEATAAREFLSKQ-LPLVEAKVTEAEAALRR
A0A1Z4KHN9      YRSADPKEATAIVNKLMSAYLENNVRNNRSEATAAREFLSKQ-LPLVEAKVTEAEAALRR
Q8YT70          YRSADPKEATAIVNKLMSAYLENNVRNNRSEATAAREFLSKQ-LPLVEAKVTEAEAALRR
A0A166IWU6      YRSVDPELAKAIVNKLMNVYIDDNVMTNRSQATAAREFLNKQ-LPLVEKQVAESELALRQ
A0A2S0Q8C0      YRSVDPEVGKAVVNKLMNVYIDDNVMTNRSQATAAREFLNKQ-LPLVEKQVAESELALRQ
W6FSX4          YRSVDPEVGKAVVNKLMNVYIDDNVMTNRSQATAAREFLNKQ-LPLVEKQVAESELALRQ
A0A218Q4C1      YNSIDPQEAQSTVNQLMAAYLNNNVLNNRSQAAAAREFLTEQ-LPLVEAKVSEAELALRR
A0A6P1ZT04      YLNTDPQEAQATVNQLMAAYLEDNVLTNRSQAAAAREFLSKQ-LPQVEAQVSDAELALRR
A0A5P8VSD1      YRSANPQEATAILNRLMSAYLENNIRINRSEATATREFLNKQ-LPLVQAKLAESQAALRR
A0A1S1ZVW2      YNSTNPQEAADTVNTLMKYYLDNNILINRSQATAARKFLSQE-LPRIEKQVTKAELELRR
A0A0R0M9H9      YNSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQVIKAELELRR
A0A7H0F4U6      YNSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQVIKAELELRR
A0A1B7WX82      YSSTNPQEAANVVNSLMKYYLESNILNNRTEARSAREFLAKQ-LPEVERQVTKAEMSLRR
A0A1B7WTD1      YKSTDKQEAANVVNSLMKHYLASNINTNRAEAIAAREFLSQE-LPKVERRVTEAEIALRR
A0A480ABC0      YKSTDKREAANVVNSLMKHYLASNVSTNRAEAIAAREFLSKE-LPKVERRVTEAEIALRR
A0A1Z4LRU5      YKSTDPKEAANVVNSLMGDYMENNVETNTAEVRAAREFLQKE-LPQVEGRVVQAEAALRQ
A0A1Z4JVB4      YRSKNPQESADVVNFLMKSYIESNISNNRTEARSLREFLSKQ-LPEVENRVLRAEMALRR
K9PIA4          YRSPNPKEAADVINTLMKYYLESNVRTNRSTAKSAREFLNKE-LPQVEKRVMKAEMSLRE
A0A1Z4HVE1      YRSTNPQEAASVINSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A252ECZ1      YRSTNPQEAASVINSLMNYYLESNVRTNSAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A1Z4G5Y1      YNSTNPEEAATVLNSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A252DNA2      YRSTNPQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMSLRR
A0A252E1Q4      YRSTNPQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMSLRR
A0A6G9SK36      YRSTNPQEAATVINSLMKYYLESNVRTNRAEARSAREFLTKQ-LPEVEQRVLRAEMALRR
A0A1Z4M597      YRSTNPQEAASVINSLMNYYLENNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A1Z4MWT1      YRSTNPQEAASVINSLMSYYLENNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A1Z4TX53      YRSTNPQEAASVINSLMSYYLENNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A2A2TNQ5      YRGTNPLETAKVINTLMNNYLENNIRSNRTEVTAARDFLRKQ-LPEIENKVVQAEATLRR
A0A3S1C4K5      YRDTDPKVAADVINTLVKYYIENNIRVNRLDATSAREFLSKQ-LPNIEGRVIAAEAGLRK
A0A1X4G3D5      YDSKIPDEAAKIVNGLMNEYLLSNIVINNSASSKARQVLAKK-LPRVERELAKAETDLRQ
D4TNI2          YDSKIPDEAAKVVNGLMNEYLLSNIVINNSASAKARQVLAKK-LPRVERELAKAETDLRQ
A0A1Z4H6Z8      YRSTNAQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A1Z4NPM1      YRSTDPQEAANVINFLMKSYLEGNILNNRAEATAAKEFLSKQ-VPQLERRVVVAEADLRR
A0A3F3KPR9      YNSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQVIKAELELRR
D4TGN7          YSSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQVIKAELELRR
A0A1Z4UZW9      YRSTNPQEAAKVVNSIMKYYLESNVRTNRTEARSAREFLSKQ-LPEVEKRVTKAEMNLRR
A0A0K2M5H0      YRSTNPQEAADVVNSLMKYYLESNVRTNRTEARSAREFLSKE-LPEVEHRVTKAEMNLRR
A0A1B7VSH4      YKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAREFLSKQ-LPEVESRVTKAEMNLRR
A0A1B7W126      YKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAREFLSKQ-LPEVESRVTKAEMNLRR
A0A3D4C6Q6      YKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAREFLSKQ-LPEVESRVTKAEMNLRR
A0A1B7UVJ4      YSSTNPQEAANVVNSLMKYYLESNILNNRTEARSARQFLAKQ-LPEVERQVTKAEMSLRR
A0A1B7UTR1      YRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-LPEVEKRVTKAEMTLRR
K7W0A4          YRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-LPEVEKRVTKAEMTLRR
A0A5C0DRW9      YRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-LPEVEKRVIKAEMTLRR
A0A6H2C088      YRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-LPEVEKRVIKAEMTLRR
A0A1U7HGH0      YRGEEPEQAALIVNQLMNVYVSKNLLNNRAAAISAGNFITAQ-LPKVKANLQRADLAVRN
K9XJD3          YRGEDPAQAALVVNQLMNIYVNKNLLNNRAAAISAGNFITAQ-LPKVKANLQRADLAVRN
K9SX01          YLSSSPQDAAKIVNGLMKSYIDNDLLTNREDTASARKFIDEQ-LPKLQISLRQAEAALRR
A0A4P7ZT55      LQWRNPQQGEQLLKALSQSYLAYSLRQRQEKLSQGLKFLDEQ-APGLQERVSQIQQELAN
A0A1E5QIR9      FKSNDPQEAVDVVNRLMQFYQENDIQTNRAQAAAVRRFIEEQ-LPKSEFTVQEAEANLRV
A0A6P1A9A0      YQDSNPEKVKIVLDRVAAGYINYSLNEQQSGLQQGLEFTEDQ-LPQLQERVDKLQERLQI
A0A1Z4IBC7      YKSNNAEQAAKVVNTVIKSYIDLNIQANQDEAVTAKQVILRE-IPKAEESVKKAESELRI
A0A1W5CPC7      YKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETSVKKAESELRI
A0A5Q0GKD1      YKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETSVKKAESELRI
Q3MDC6          YKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETSVKKAESELRI
A0A1Z4KM73      YKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETSVKKAESELRI
Q8YNX7          YKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETSVKKAESELRI
A0A367R4K6      YQSNNPELAAKIINQVIDNYIDLNIKANQNEAFAAKQVLVAE-LPKAEEIVSRAESQLRL
A0A1E2WSV8      YKGGDPELAAKIVNEVIDSYIDLNIKANQNEALTAKQVLVTE-VPKAEEIVRRAESKLRL
A0A7D7L9Y1      YKGGDPELAAKIVNEVIDSYIDLNIKANQNEALTAKQVLVTE-VPKAEEIVRRAESKLRL
A0A2R5FRT9      YKGGNPELAAKIVNEVIDSYIELNIKANQNEALIAKEVLVTE-VPKAEEIVRRTESKLRL
A0A2K8T1B6      YKGSDPELAAKIVNEVIDSYIDLNIKANQNEALTAKEVLVTE-VPKAEEIVRRAESKLRL
A0A235I9I0      YKGGDPKLAAKIVNEVIDSYIDLNIKANQNEARTAKQVLVTE-VPKAEEVVRRAESKLRV
A0A2D0HQT8      YKGGDPKLAAKIVNEVIDSYIDLNIKANQNEARTAKQVLVTE-VPKAEEVVRRAESKLRV
A0A2L2NU95      YKGGDPELAAKIINEVIDSYIDLNIKANQNEARTAKQVLVTE-VPKAEEVVRRAESKLRL
A0A367S084      YKGGDPELAAKIVNEVIDSYIDLNIKANQNEARTAKQVLVTE-VPKAEEVVRRAESKLRL
A0A1Z4SMD6      YSSKDPEVASSVVNQVMKTYVEKNIESNRSQVFAAGSFIKKQ-LPDSKAELEQAAEALRQ
A0A2H2Y096      YSSKDPEVASSVVNQVMKTYVEKNIESNRSQVFAAGSFIKKQ-LPDSKAELEQAAEALRQ
K9S8M8          YTSDDPQEAANVVNVLMEIYIKENIRANRAEATAARKFITEL-LPKTEASLRQAEAQLRD
A0A1Z4NFV0      HISDNPNLAAAVVNQVMESYVESNIQSNRAEAQSAGKFIEQQ-LPRARAELEKSAEELRK
A0A3M9ZEU1      YTDSDPERAAKVVNQVINVYIENNVAANRAEAAAAREFISRE-IPRVEAAVRQAERALRE
A0A1Z4JK72      YSDNDAEMAANVVNQIMKAYIDNNLKTNQEEANKAGRFIESQ-LPRAEAELQKASEELRL
A0A0N7Z489      YADDDPEMAANVVNQVLKAYIDNNLKTNQEEANKAGRFIDNQ-IPPAEEALNRASEDLKN
A0A0S3TXS2      YADDDPEMAANVINQIVKAYIDSNLKTNQEEANKAGRFIDSQ-IPPAEEALNKASEDLRN
A0A2A2TPF8      YISENGKEAAAIVNQLMRSYVENNIRNNRSEALAARKFIEAQ-LPRAKGELDKTAEESRR
A0A1Z4R0P8      FISDKPKEAAAIVNQLMRSYVDNNIKNNRSEALAARKFIEAQ-LPRAKGELDKTTEDLRR
A0A0T7BUI3      HASDNPKLAAKIVNQVMATYAENNVESNRTQVTAAGEFIKKQ-LPSSRKELESAAEALRQ
A0A1Z4LP32      YTSEKPRLAAAIVNQVMRTYVKNNIESNRAQVVAAGQFLKQQ-VPLSRLELENATEALLQ
K9REP9          YTSDKPRLAASIVNQVMESYVDNNIESNRAQVVAAGEFLKKQ-VPLSKIELEQATQALLQ
A0A1Z4SIJ3      YVSINPELAKKVVNQVMQTYVDKNIESNRTQVYAAGEFIKKQ-LPFSRAELESASEALRR
A0A2H2XPG4      YVSINPELAKKVVNQVMQTYVDKNIESNRTQVYAAGEFIKKQ-LPFSRAELESASEALRR
K9V3C7          FTWDNPEIASAVVNKLMDVYVANNLANSRSEAVSAGKFIELQ-IPQAKIELDKTSEALRN
A0A1Z4T6Y7      HISSDSRLAADVINYVMRSYVENNIQTNRLEAVSARKFIENQ-LPRAEQELNKTTEELRS
A0A2H2Y561      HISSDSRLAADVINYVMRSYVENNIQTNRLEAVSARKFIENQ-LPRAEQELNKTTEELRS
A0A1Q4S362      HISGESKKAADVVNQIMRSYVNSNIQNNRQETIAARKFIEGQ-LPRAEGQLNRATEDLRS
A0A3S1CIN8      HISGESKKAADVVNQIMRSYVNSNIQNNRQETIAARKFIEGQ-LPRAEGELNRATEQLRS
A0A2A2TC28      YQSNNPEMTAEVVNQVMNTYIKNNIQSNRTQVFAAGDFIRKR-LPSSRAELERATEALRR
A0A0C1NCB0      YTAKAPNLAANVVNLVMQAYVNNNIQSNQEQVLAAGEFIKKQ-LPYARADLERASEALRQ
A0A2N6K7Q9      YASNDPELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A2N6MXH6      YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A2N6M5A8      YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A2N6LL61      YASNDPKLAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A0S3TP66      YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
G6FP91          YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A1U7GYR5      YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A2N6KY52      YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A2N6KMP5      YTSNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A2N6MA45      YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A4Q9J9V9      YASNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPNSRRELERAAEALRQ
A0A328IGA1      YASNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPNSRRELERAAEALRQ
A0A4D9CE41      YTSNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAGDFIKEQ-LPNSRRELERAAEALRQ
A0A0M0SFT2      YTSNDPELAAAIVNQLMKSYVQNNIQNNRAQVSAAGEFIKEQ-LPNSRRELERAAEALRQ
A0A1Z4TLC8      YASNDPELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPNSRRELERAAEALRQ
A0A0C2LFH0      YTSENPELTASVVNQVMKSYVAKNIQYNRTQVVAAGEFIKKQ-LPQARVELNQAAEALRE
A0A1Z4IYV4      YTSENPELAASVVNQLMKSYVANNIQSNRSQVFAAGEFIKKQ-LPYARAELDRSAEALRQ
A0A1Z4Q0T6      YISENPELAASVVNQLMKSYVANNIQSNRVQVFAAGEFIKKQ-LPYARAELDRSAEALRQ
A0A0C2PT44      YTSENPELAASVVNQLMKSYVANNIQSNRAQVFAAGEYIKKQ-LRYARAELERSAEALRQ
A0A1D2P6J4      YTSENAELAASVVNQLMKSYVANNIQSNRAQVFAAGEFIKKQ-LPYARAELDRSAEALRQ
B4WP72          YQSPDDQTAPVIVNALMEAYIENNVETNREEAIAARRFIAGQ-LPQTESAVSAAEANLRQ
A0A2T1CIL7      YQDSDPKRAASIVNEVIDLYVQEDTLSNRAAPASAREFIKAQ-LPKVELTVAKAEEDLRR
A0A433V7A0      YTSKDPQESASVVNQLMSIYIKNNISANRLQAVAARKFISSQ-LPTSEADVVRAEMALRK
A0A2T1FTR8      FQDPSRELSRDVVEKIMEIYIRDDRTNQRREAEAARKFVAQE-LPKIENEVKQAENDLRL
K9UA41          FQDPSRELARDVVEKIMEIYIRDDRTNQRREAEAARKFVAQE-LPKIETEVKQAENDLRL
A0A0C2LBE2      YIDKDPKLAAKVVNKVMQAYIKNNIEANRQEAVSARKFIQKQ-LPTTEVSVKQAESALRQ
A0A433NN38      YADSDPIMAAKVVNKLVEIYIKQNIQTNRAEAVSARKFMWEQ-VPKTEQAVKQAEANLRK
A0A2N6K0T2      YTHEDPQLAAKVINKVVDTYIKQNIQVNREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A2N6ML72      YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
G6FQZ6          YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A2N6MQX9      YTHEDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A2N6KXT6      YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A2N6KGB9      YTHEDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A2N6L3Y5      YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A0S3TIS7      YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A1U7GW28      YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A2N6LW63      YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A328IH74      YTDENPELAAKVINKIVDTYIQQNIQANREEATSAGRFILQQ-LPKTEEAVQKAELALRR
A0A4D9CIB0      YTDENPELAAKVINKIVDTYIQQNIQANREEATSAGRFILQQ-LPKTEEAVQKAELALRR
A0A1Z4TQ63      YTDENPQLAAKIINRVVDTYIKQNIQANREEATSAGRFILQQ-LPKTEEAVQKAELALRR
A0A4Q9J8G2      YTDENPQLAAKVINKVVDAYIKQNIQANREEATSAGKFILQQ-LPKTEEAVQKAELALRR
A0A350Y0P6      FTSDNPKKAAAVVNQLMNVYVENNILTNRAEAVAAGEFIAKQ-LPQIQNRVRQAESALRN
A0A352X940      VKSQKPKEAAAIVNKLMEVYLENNIQTNRSEAVAARKFIERQ-LPKTESTVRQAEAALRR
B8HTN4          YRSTDPKQAVAIVDLLIKIYKRNNILANRLETTNSREFIERK-LPDVTEQLRGLDRQIRS
A0A6P1AFJ5      YQNSDPEKIKFVLEQVAEGYIAYSWQKQQGSLQQGLEFVNVQ-LPKLQEEVNQLQAELQK
B0CAX4          YKSIDPKESADVVNRLMDDYLKNNIETNRAEAASARVFIEKQ-VPEVAAKLKNLDLSLRR
A0A1Z4RN12      FTDQDPEVALAFVNRAIELYSEDYASYNRSETASARDFIAKQ-LPKAEENVREAEANLRI
A0A2T1CMF9      YENSDPDVAVSFVNRAVELYSDGYALFNSEAALKDGDFIKQQ-LPKLETEVENAEANLRN
Q7NDC5          YRDRDPAVATRVVNTLARHYIDLNMQQNRAEAASTRGFVEAQ-LPAMEQRLRASERKLRS
U5QGK3          YREFNPELAAKVVNTLAQAYIVENVQQNRAEASSTRTFVESQ-LPKMEQRLRDSERRLRE
A0A2W4UY24      YESTSPALAQAVVNAMMAAFIQANVQANRTAAIAAQSFVASQ-LPASKAKVGKIESDLRA
A0A0D8ZUV2      YKSNDPQEAAAVVNKLMSLYIENNVLSNRTAAVEASKFIANQ-LPKTEARVRQAEAALRQ
A0A433VDI0      YKSTNPEEATAVVNKLMNLYIENNILTNRDQAVEAVEFIAKQ-LPRTETTVRQAEAALRQ
A0A3D1PG43      YESKNPEEAAAVVNKLMSLYVQNNIQSNRAQTTAVGEFIAKQ-LPTVQGTLRQAEAKLRR
A0A2P8QQ72      YESKDPQEAAAVVNKLMSAYVDYNIQSNRAEASAAEDFIVKQ-LPQTESTVRAAEASLRR
K9TZQ7          YESKDPQEAAAVVNKLMSAYVDYNIQSNRAEASAAEDFIVKQ-LPQTESTVRAAEASLRR
A0A6N8G584      YQSEDPEEAAAIVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMEATVRQAEQALRQ
A0A2G7GPR0      YQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMEATVRQAELALRQ
K9XH68          YQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMETTVRQAELALRQ
A0A1U7HW70      YQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMETTVRQAELALRQ
A0A2S6VEJ8      YQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMEATVRQAEQALRQ
A0A140KBA0      YEDSDAERAALVVNKIIELYQEKDTENNRSEAIAARQFISEE-LPEVEAKVAQAEADLRN
K9XSG1          YEDSDPERAALVVNKIIELYQEKDTENNRSEAIAAREFISQE-LPEVEAKVAQAEADLRN
A0A2T1GMT4      FKGRNPKDAANIVNTLMNVYLENDIQASQLEAETARQFIEQQ-MPKTLAAVNAAESAVRS
K9UI51          FKGRNSKDAANIVNTLMNVYLENDIQASRLEAENARQFIEQQ-MPKTLAAVNSAESAVRN
A0A1Z4QL41      YKSNKPEEAAEVVNTIMNFYIENDISTNRAEAEETRQFLDKQ-LPKTQTAVQTAEAALRR
A0A2T1FXY4      YKHHDPEKAAAVVNKIMELYLENDILTSRSEAEATRLFMAKQ-LPKTQADVHQAEVKLRI
K9TYI2          YKHHDPEKAAAVVNKIMELYLENDILTSRSEAEATRLFMAKQ-LPKSQAAVHQAEVKLRI
A0A252D4T4      YNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATRKFMAKQ-LPNTKNAVQEAEAALRI
A0A252DJH5      YNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATRKFMAKQ-LPNTKNAVQEAEAALRI
A0A252EB80      YNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATRKFMAKQ-LPNTKNAVQEAEAALRI
A0A6G9SKZ9      YKSRSPEEAAAVVNNIMNLYLENDILTNRAEAESTRKFMARQ-LPNNRSAVQEAEAALRI
A0A1Z4HPW5      YKSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSAVQDAEAALRI
A0A1Z4MSN1      YQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSAVQDAEAALRI
A0A1Z4U1C2      YQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSAVQDAEAALRI
A0A0D6KV51      YQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSAVQDAEAALRI
A0A1Z4MKF8      YQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSAVQDAEAALRI
A0A2C6WC43      YASLNAEEAAAVVNTVMNVYLENDILTNRSEAASTRQFIARQ-LPKTQEAVDKAERELRI
A0A1Z4L5A1      YSSLDPEEAASVVNTVMNVYVESDILTSRSEAASTRQFIARQ-LPKTQEAVDKAERELRI
A0A367QD86      YSSLNPEEAAAVVNTVMNVYVENDILTNRSEAASTRQFIARQ-LPKTQEAVDKAERELRI
A0A2K8SM78      YTSRDPEQSAAVVNTIMSLYLENDILTNRSEAAATRQFMAKQ-LPKTQEAVNNAEVALRI
A0A2R5FPC0      YASRDPEQAAAVVNTIMNLYLENDILTNRSEAAATRQFMAKQ-LPKTQEAVNNAEVALRI
A0A5P8W5T6      YTSRDPKQSADVVNTIMNLYLENDILTNRSEAAATRQFIAKQ-LPKTQQAVNNAEVALRI
A0A7D7LDT7      YSSSNPEEAAAVVNTIMSFYLENDILTNRSEAAAARQFMAKQ-LPKTQAAVNNAEVALRI
A0A235IZ96      YSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATRQFMAKQ-LPKTQAAVNNAEVALRI
A0A2L2NGP0      YSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATRQFMAKQ-LPKTQAAVNNAEVALRI
K9QM62          YKSRNPEEAAAVVNSVMNVYLENDILTNRTEVEATRRFMARQ-LPQTQAAVSTAEVALRK
A0A1Z4FWI3      YKSPDPETAAAVVNTVMNIYLENDSNTNRAEAEATRRFMAKQ-LPNTRAAVQEAEGALRR
A0A1Z4JYE7      YQSNDPKQAAAVVNALMNVYVDNDISTNREEAEATRKFMERQ-LPQTQAAVNYAEAVLRK
A0A0F5YE28      YESPDPLEAANIVNTLMEVYIQTNVNMNQDEAREAREFISQQ-LPPVQQEVFRAEQALRS
U7QEH7          YESKDPKEAADIINTLMEVYMQTNVDMNQEDAIEAREFISQQ-LPKVQEEVFRAEQALRS
A0A3S1ATK5      YKSRDPKEAAVVVNTVMNFYLENDIETNRAEAETTYKFMARQ-LPKTQAAVYAAEVALRK
A0A2Z6CPH0      YQSNNPEEAAAVVNTLMNLYLENDILTSRAEAEATRKFMAKQ-LPISQASVNRAEVALRV
A0A1Z4GT50      YKSRNPEEAAAVVNTIMKMYVENDITTSRAEAEDTREFMSKQ-LPKMQAAVREAEVALRK
A0A1Z4GIX0      YKSTNPEEASAVVNTIIDAYLENDILTSRSEAEATRKFMAKQ-LPNTQAAVHKAEVALRI
A0A2H6LC24      YKSTNPEEAAAVVNTIIDAYLENDILTSRSEAEATRKFMAKQ-LPNTQAAVHKAEVALRI
B2J6N5          YTSPDPEQSAAVVNTIMSLYLDNDILTNRSEAAATRQFIAKQ-LPKTQEVVNNTEVALRI
A0A367RMI4      YKSHNPEEAAAVVNTIMRFYLENDILTNRSEAGAARQFMAKQ-LPTTQAAVNNAEVALRI
A0A235HUM0      YSSHDPEEAAAVVNTVMRFYLENDVLTNRSEAGATRQFMAKQ-LPTTQAAVNNAEVALRI
A0A2L2NW47      YRSHDPEEAAAVVNTIMRFYLENDILTNRSEAGATRQFMAKQ-LPTTQAAVDNAEVALRI
A0A1E2WUR1      YSSSDPEEAAAVVNTIMNFYLENDILTNRSEAAAARQFMAKQ-LPKTQAAVNNAEVALRI
A0A235IKU3      YSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATRQFMAKQ-LPKTQAAVNNAEVALRI
A0A1U7MYU6      YKGNNSDKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A1D8TNX9      YKGNNSDKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A6P0L6C2      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A6P0MVH0      YKGKNSEKGATVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A6P0KJV0      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A6L9ZJG4      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
F4XKF3          YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A1D9FX10      YKGKNSEKGAAVINKLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A6P0Q0T0      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A6P0W5I0      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A3C0NJ41      YKGANPQQIAAVVNKLMSLYIEDNLRTNRAELVAAQDFIAKQ-LPKAETNVGQAETSLRR
A0A352AG88      YESSNPQEAAAVVNYLMNLYIKNNVKANRAEVVAAVKFLNEQ-LPKAEANVNQAEMALRQ
A0A350Y374      YKNKDAKTAAAVVNQLMKLYIENNLRNNRTELVTAQEFITKQ-LPKAEANVNQAEAAVQE
A0A355DPX0      YKNKDAKTAAAVVNELMKLYIENNLRNNRTELVTAQEFITKQ-LPKAEANVNQAEAAVQE
                                                                            

K9SLA9          FKENYRLVDLEI----------EKVTTVKAIKEIEAQMLGLQAELAEVGA----RSKQLQ
A0A168TT23      FAQANGVADLEE----------RVDMSQSSVRTLNDRLSAARGDLVQLRA----FSQLID
A0A0M1JWX9      FRQDYNLIDPKI----------QGEQLAGQITKIDDQLLEAQTALIQQQQ----LYTTLR
A0A2T1M1V6      FQQSTGLFESET----------QTQELMQSINKLRATQTEISSEAESHAT----QARVAA
A0A2G7GCS2      FQQSTGLTEVTE----------QTRSLINQQRELRTTYTNVLSQAQANQA----QAQAAS
K9XBH8          FQEATGISEAVE----------QTRSLIAQLRDLKTNYTTILAQAQGSQA----QAIEAS
A0A1Z4LJ30      FKQKTNLVSSEE----------QTKEIVSTINALETEQAQTIAQAQEFQS----RAKMLS
K9RI76          FKQKTNLVSSEE----------QTQQIVSAINTLNTQQAQAIAEAESAAA----RVRMLS
A0A352AE27      FQKSSGLVNSEE----------QTRGLVQSISELTTAQAQAQAQALASIN----EVRTLS
A0A3B8JH60      FKQSSGLVNSEA----------QTEGIVTTINNLSTAQAQAQALAQAGQN----RVSVLS
A0A3C0N766      FKQSSGLVNSEA----------QTEGIVTTINNLSTAQAQAQALAQAGQN----RVSVLS
K9W9J7          WKQSTGLVNSEA----------QTQGIVTTINNLTSVQAQALAQAQASEN----RIQVLS
A0A139WSU3      FKQSSGLINNED----------QAKGIVDSISTLTTVRAQVLATAEASEN----RAKALS
A0A433VN22      FKQATGIVNNDA----------QTQGIVTTINALVGSRAQALSLAQASAS----RSKVLS
Q7NF11          FKRSTGLVNTDQ----------QTGGLVGVISSLTTSQAQAVAEGTADKA----RAQMLT
A0A1Z4JCS8      FKQSTGLVNNEE----------QTKGLVGTINTLEAAQAQVQAESQATRD----RANTLA
A0A6P0PI80      FQESSGLVNSEA----------QTEGLVRAITDLSISQAQAQAEAQASQH----QLQILS
A0A6P0WGT6      FQESSGLVNSEA----------QTEGLVRAITDLSISQAQAQAEAQASQH----QLQILS
F4XTX2          FQESSGLVNSEA----------QTEGLVRAITDLSISQAQAQAEAQASQH----QLQILS
Q7NJN6          YQRRTGLVNADD----------QTRGIVETLNSLRSTQTLTLAQAEAAAR----RATALE
U5QCC3          YQQTTGLVNVDE----------QTRGLVETLNTLRSSATLAQAQAKAAED----RSRSLE
A0A0S3TYD7      FKENNQIVALDQ----------EQRNSVEITSDFNKRIEDTRAKLVGAIQ----KVNALK
A0A2T1DNG3      FRRDQSLIEPSA----------EAAAQTEMLNRLQADKQATLVQIRELQT----RYGDLQ
A0A3S0Y9N9      FKQQYKVLDLKS----------EATSSVTILTDLEKQVAETISELASQTA----KMKSIK
A0A433UNK7      FKQQNRVLDLKA----------EASASVAILTDLDKQVAATRSDLSSQTA----RMQSIQ
A0A6P0ZKB8      FKQQNRVLDLKA----------EAASSVGILTALDKQVADTRSDLSSQTA----RMQSIK
U5QL42          FRKRYDIPDPDG----------YATSVAEVQQSLQQRIQDLQINLAQTQR----QYSELR
A0A140K3H3      FRQTYNIVDPDE----------YALRVIQFRDGLEQQEKQAEIALARTQR----QYQEIN
K9XUB8          FRQSYHIVDPNE----------YASRVIQFRDGLEQQEKQAEISLAAAQR----RYEEIN
A0A6H2NHD5      FQKQYDLVDVNA----------ASESVTQRLNQMQANQEKLRVELASQIS----LYNALQ
A0A2P8W4F7      FQKRYDIVDVNA----------TSESVTQRLNQMLADQEQLRVDLTAMEP----LYDSLR
A0A5Q4E0Z4      FQKRYDLVNVTT----------TTESVTQRLNQMLADQEQLRVQLTALGP----LYENLR
A0A2P8VVX1      FRINQNLIDPNS----------QAISVVESLNQVQTQQQQLMVELSGLEQ----QYATLE
A0A2P8WHY0      FRQSQNLIDPTL----------QSQAVVTSLNEVQSEQRQLMSQLTELKS----RYQTLE
A0A2T1CMT9      LTKENNLVSPEA----------EATSVKENIRQIAQEREALKAQVGEIAG----SSSALQ
A0A7G8J1V5      FRIRNNLLEPLE----------EGSALKEQEFTLNQQLLGLETE----RN----RLKSVR
A0A354B169      FRERHNLIEPTE----------EGGAIKGRLAQLESQLLGLEAE----RN----RLQRVR
Q0IDT5          FRRRHSLLEPAI----------EGTALKQREATLATQIFGFEAE----RS----RLKRVR
A0A7G8FZD9      FRIKHSLLEPTA----------EGGALRQQELALSNQVLALQAS----RN----RLSKVR
G4FMX5          FRIKHSLLEPTA----------EGGALRQQEAGLSSQVLALQAG----RN----RLSKVR
A0A7G8FAU7      FRRQHSLLEPTA----------EGGALKDRETAVATEILGLEAE----RS----RLQRVR
A3ZA21          FRRQHSLLEPTA----------EGGALKDRETAVATEILGLEAE----RS----RLQRVR
A0A076HBF2      FRTRYSLLEPTA----------EGGALKKRETAMAAQVLGLEAD----RN----RLLKVR
A0A7G8FP50      FRTRYSLLEPTA----------EAGALKSRETDKAAMVLELEAE----RS----RLIKVR
A0A7G8E8K7      FRTRYSLLEPTA----------EGGALKQRETAMAAQVLGLEAD----RN----RLLKVR
A0A7G8GAH0      FRTRYSLLEPTA----------EGGALKERETAMAAQVLGLEAD----RN----RLLKVR
A0A7G8GNR2      FRTRYSLLEPTA----------EAGALKERETSMAAQVLGLEAD----RN----RLLKVR
A0A7G8ICD3      FRTRYSLLEPTA----------EGGALKQRETAMAAQVLGLEAD----RN----RLLKVR
A0A2D6FCW3      FRQRHSLLEPTT----------EGGALKQREAAIAAQVLDLEAG----RN----RLLRVR
A0A7G7KJ95      FRRQHSLLEPSA----------EGGALKEREAGMAAQVLDLQAG----RN----RLLKVR
A0A7G8EAN3      FRRQHSLLEPST----------EGGALKEREAGMAAQVLDLQAG----RN----RLLKVR
A0A563VQJ3      FRTENSIIDLQE----------EKRTIVQDAGAINRQIATLGASYQGKQA----QTKAMQ
A0A1D8TX52      FRKSKNLIDPSQ----------QAVAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A1D9G4T2      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A6P0PR27      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0WER7      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
F4XP71          FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6L9YR57      FRKSKNLIDPSQ----------QAVAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A6P0KZ31      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0LPB8      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0SEV1      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6B3N2I8      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6M0B891      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0IJQ1      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0J8J8      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0ZSH6      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A1U7N5X9      FRKSKNLIDPSQ----------QAVAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A6L9Z1V0      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0LC12      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A6P0MVJ3      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A2W6ZAV2      FRRQNSFLDPSS----------QGEAIQTQRQALNVRLDDLRQTEAKLLG----MASAVG
K9W742          FRKTQNLIEPDA----------QTTALTTALNAIQDERRRNQAQYRELQA----SYNTLQ
A0A3D1PBA3      FRKNYNLIDPEQ----------QATAVSQSLNAIAQERQVIRAQYKDLQA----RYNALQ
K9XPB0          LRSENNLVSPQG----------ESESIKAVLNNIQQERATLKAEQKQTQG----NYRQLQ
A0A350Y7Z1      FRETQNLIDPVQ----------QATTITDALSTVEQEQQAIRAQYQETQA----RYRVLQ
A0A352X2A7      FRENQNLIDPLQ----------EASNVGETLTKIEQERQAVRAQYQETLA----RYNSLQ
A0A0D8ZYV0      FRTNQNLIDPEQ----------QAAAINNSLNAVVQQRQVLRAQFQDTEA----RYRVLQ
A0A2T1FP73      FRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRAQYNDLQA----RYGQLQ
A0A433VMS2      FRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRAQYNDLQA----RYGQLQ
K9TYA7          FRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRAQYNDLQA----RYGQLQ
A0A2P8QUE1      FRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRAQYNDLQA----RYGQLQ
K9SA61          FRKNQNLIDPEA----------QSQTILEALSRTRQEQQTNQAELQATQA----QFASLQ
A0A2G7GMH8      FRESNNLIDPEL----------QAKALTDALNNVKQEQRTNRNQIQQTQS----RLHNLQ
A0A6N8FU92      FRESNNLIDPEL----------QAKALTDALNNVRLEQQTNRNQIQQTQS----RLNDLQ
A0A2T1DWE8      FRKSQNLVDPEV----------QSRALIDALSNLQKEQQTNQAQIREVQG----RYQTLQ
A0A1U7I8L3      FRKSQNLIQPEL----------QAKALIESLKDIQYELRTARAQYQEAQS----RFQTLQ
A0A2T1DJL8      FRKNQDLIDPEL----------QSKSMVDSLAAVQKDQRANRTELQDLQA----RYGALQ
A0A1Z4J9W0      FRSTSNLVDPEV----------QAKSLVDSLKELQQNQQENRGLLASSRA----KFIALQ
A0A0N7Z5K9      FRKSSNLVDPED----------QSRALIESLRELQKDQQSNRGELASAQA----RFLALQ
A0A0S3TXC5      FRKSSNLVDPED----------QSRALVESLRELQKDQQSNRGELASAQA----RFSALQ
B8HNB0          FRKQYGLVTPDA----------YAEAVVSTRMELEKQGKDAEIAVKTTQR----QLEEVN
A0A563VS48      FKNQYQIANLTE----------ETSATINSISNIRSQIDTIEAELEDVNA----RYSALN
A0A318BJ18      YASAQQIINLPA------PGSGIGGTTTVERSIVADDLAALNASLAQATA------ERIQ
A0A3B8Y8H9      FRKKHNFIDPQS----------QSRILSSNLTNIIQKKQENQSLLQEQEI----RYRNLQ
A0A2W1JVB9      FKETNKIVAIDK----------EAEVAVEAVIRLAEKINEAQGRAISAQA----QSDSLR
A0A3M1SVZ4      FKEENNFFALQE----------EAAAATQLMTGLQQRITDTQSQIASTNS----RYNALQ
A0A6H1U102      FRQDYGIVDPES----------YANQVLEQKQLLEKDGQQLEISLSRTQR----QYAELR
A0A7C3ZEJ3      FREKNGIVDPDT----------HATQVVSIKQSLEQQARDVEIALNRTQR----KYQELR
A0A563VLD6      FRQENNLVDPNI----------YASDVSKFRQSLEQDSRSTEIALARAKS----KYQELY
A0A2P8W9H0      LRQRSNLIDPLK----------QGEQLSTQTAKFTAEQFDLRLQLEQSQQ----LYQELQ
A0A6I5P386      LRKSYNLIDPLL----------QGEQLALQASKFRSERFDLWVEIQENQS----IYQDLQ
A0A654SFI6      YANENEILVLETGNREEGSGTASQTLIATDLAALNEALAQAVTDRISAEA----------
A0A318BG22      YAEQNGIISVTD---------AKTAGTGSGAQSLDSASMAALNDRVAAAR----ANRILA
K9SSQ0          FRQQYNITDPDT----------YAASIFSTKQGLATQIQDLQIKMAQTQR----QLQELQ
A0A2W1JIN9      FKQEYGYVTLSA----EGNNNEANQLLVNSYAQLEGQIRDLTSQIQEVDA----RNLSLS
A0A318AJV1      YRAGTGLSADGA----------GSNVVDQQIATLSGQLANAEAEAAGARS----SASVAQ
A0A6P0IC70      YRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEVNA----RLKAIE
A0A6B3MUB5      YRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEINA----RLKAIE
A0A6M0B7N4      YRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEINA----RLKAIE
A0A6P0J9W3      YRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEINA----RLKAIE
A0A6P0ZWE1      YRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEINA----RLKAIE
A0A1U7N2U4      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A1D9G1F2      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6P0PNZ7      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
F4XV38          FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6P0W137      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6L9Y9E2      FKQTTGLVSPEE----------QTQLLVRSLASLEDQERAVSIQLQDAKT----RSQELQ
A0A6P0SGR0      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQEAKT----RSQELQ
A0A6M0BK48      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6L9YZL1      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6P0KYM4      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6P0LSD6      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6P0X384      YKQATGLVSVEE----------QTNNLITSLASLEQEKQLLAAQVQEANG----RVESLR
A0A2P8QIL5      YKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKA----RNSSLE
A0A2T1FLY5      YKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKA----RNSSLE
A0A433W447      YKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKA----RNSSLE
K9U1K8          YKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKA----RNSSLE
K9UYB2          YRERTGIISFDE----------QTKSLVQSLAALEDQQRTLGTQLQEARS----RGESIR
A0A218QN17      YRHISGIISFEE----------QTKSAVESLATLEDQERALTAQLQEAKG----RDASLR
K9RKN2          YRQASGIVSFAE----------QTESLVENLSSLEEQERTLSALLEQVRS----QENSLR
A0A2I8ADV2      YRQKSGVVADTD----------QTKSLVQSLTNLEDQERTLIAQLQEARS----REASLR
A0A1W5CKM3      YRQQSGVVATDD----------QTRSLVNSLAELENQERILAVQLQETRS----RDASLR
A0A5Q0GMF5      YRQQSGVVATDD----------QTRSLVNSLAELENQERILAVQLQETRS----RDASLR
Q3MEW0          YRQQSGVVATDD----------QTRSLVNSLAELENQERILAVQLQETRS----RDASLR
A0A1Z4KIC7      YRQQSGVVATDD----------QTRSLVGSLAELENQERTLAVQLQETRS----RDASLR
Q8YSM5          YRQQSGVVATDD----------QTRSLVGSLAELENQERTLAVQLQETRS----RDASLR
A0A1Q4S1H4      YRQTSGIVSFDD----------QSKSLVTSLANLEDQERMLFAQLQEARS----RDSSLR
A0A433VBU6      YRQTSGVVSFDE----------QSKSLVTSLANLEDQERMLFAQLQEARS----RDASLR
A0A1Q4RZJ6      YRQQSSIVDFDE----------QTKSLVQSVASLEDQQRNLATQLQEANS----RLDSLR
A0A1Z4SNV3      YRQASIIVNYDE----------QTKSLVQSVASLEDQQRTLATQLQDANS----RGESLR
A0A2H2XJQ1      YRQASIIVNYDE----------QTKSLVQSVASLEDQQRTLATQLQDANS----RGESLR
A0A3S5K358      YRQQSSIVDFDE----------QTKSLVQSVASLEDQQRTLATQLQEANS----RLDSLR
A0A0T7BPJ4      QKQASGIVSFDE----------QSKSVVTSLASLEDQERTALAQLQELRS----RAASLE
A0A0C1QS61      YRRSSGIISFTK----------QSESLVDSLAALENQERTLSAQLRELRS----QDASLR
A0A139X3R8      YRQSSGIISFTK----------QSESLVDSLATLENQERTLSAQLQELRS----QDASLR
A0A1Z4I7C5      YRQQSGVVAADD----------QTKSLVGSLADLENQERTLAAQLQEARS----RDASLR
A0A0C2MDK7      YRKSSGIVSVEE----------QTKSLVQSIATLEHQERTLSAQLQEIKT----KDASLG
A0A1Y0RCK1      YRQLSGIVSLEE----------QTKSLVQSIATVEDQERTLSAQLQEIKA----RDVSLR
A0A1Z4PWZ0      YRKSSGIVSFEE----------QTKSLVQSIATVEDQERTLSAQLQEIKA----RDASLR
A0A0C2QLT0      YRKLSGIVSLEE----------QTKSLVQSIATVEDQERTLSTQLQEIKA----RDASLR
A0A1Z4J2K1      YRKLSGIVSLEE----------QTKSLVQSIATVEDQERTLSAQLQEIKA----RDASLR
A0A3S0ZSX0      YRQDSGIVSFDE----------QTKSLVNSLATLEEQEGTLSAQLQELRS----KEVSLR
A0A2N6K4T3      YRQSSGIVSFDE----------QTKSIVESLATLEEQENTLSAQLQELRS----KEASLQ
A0A370CKT2      YRQSSGIVSFDE----------QTKSLVESLANLEQQENTLSAQLQELRS----KEASLQ
A0A0S3TL97      YRQSSGIVSFDE----------QTKSLVESLATLEQQENTLSAQLQELRS----KEASLQ
A0A2N6M8A0      YRQSSGIVSFDE----------QTKSLVESLATLEQQENTLSAQLQELRS----KEASLQ
A0A2N6M9E1      YRQSSGIVSFDE----------QTKSLVESLATLEEQENTLSAQLQELRS----KEASLQ
A0A2N6KJI4      YRQSSGIVSFDE----------QTKSLVESLANLEEQENTLSAQLQELRS----KEASLQ
A0A2N6MZ77      YRQSSGIVSFDE----------QTKSLVESLANLEEQENTLSAQLQELRS----KEASLQ
A0A2N6KT20      YRQSSGIVSFDE----------QTKSLVESLANLEQQENTLSAQLQELRS----KEASLQ
G6FSN3          YRQSSGIVSFDE----------QTKSLVESLANLEQQENTLSAQLQELRS----KEASLQ
A0A4D9CI02      YRQSSGIVSFDE----------QTKSLVNSLATVEEQENTLVAQLQELRS----KEGSLR
A0A328I8B9      YRQSSGIVSFDE----------QTKSLVNSLATVEEQENTLVAQLQELRS----KEGSLR
A0A4Q9J4Z7      YRQSSGIVSFDE----------QTKSLVNSLATVEEQENTLVAQLQELRS----KEGSLR
A0A0M0SU69      YRQSSGIVSFDE----------QTKSLVNSLAIVEEQENTLVAQLQELRS----KEASLR
A0A1Z4TIZ8      YRQSSGIVSFDE----------QTKSLVNSLATLEEQENTLVAQLQELRS----KEASLR
A0A2T1E9V8      FKEKYKLTDLAQ----------TQRSVAENIERIGSQVDSIEAQLSDLNS----RSKGIQ
A0A1Z4LN32      FKQKNKVIELKE----------ETTKAVQIIHEIDKELTEARSELADVGG----QEKEVS
A0A2I8A9F5      FKTQNKIVNLEE----------ESSGLVKNAITIDSEINNARAQLAETIT----REKQIL
A0A218Q6R8      FKTQNQIVDLQE----------EKNATVTIVLALDEELNNARALLADVSA----QEKQII
A0A218QGE0      FKLKNQILELAE----------ETKASVKNISDVEIELAKARSELADARA----QEIQIR
A0A3M2GQQ6      FRQTYGIVDPES----------YANQVLDIKQSLEKDAQSLEITLTRSQR----LYAELR
A0A6H1U2X0      FRQTYGIVDPES----------YANQVLDIKQSLEKDAQSLEITLTRSQR----LYAELR
K1XF69          FKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS----LVNSLG
B5W297          FKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS----LVNSLG
A0A6H2AL05      FKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS----LVNSLG
H1W7M8          FKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS----LVNSLG
A0A5Q4H6A5      FKERNYVVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS----LVNSLG
D5A466          FKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS----LVNSLG
U5QJM6          FRSKNNILDPEE----------QAKALSGVMSDLMEEAEKAKVELQTSRK----QYLALA
A0A1Z4RPC6      FYERNQVVDLQE----------EKRILVGEVGNLNRQIADTGAQLQGAKA----QTESLQ
A0A2T1CMZ0      FYEKNQVVDLQE----------EKKSLVDEIGTLNRAISGVGAQLQGKKA----QTDSLQ
L8M4F7          FRADNKIVDLQQ----------EKQTVIEETANLNRQIAFIGSQYRGTKA----QTDALQ
A0A140K2P2      FKESNQVVNLTK----------EAESTVMQMAEMNSEISKVAAQLQGTMA----QSEALQ
K9XWX4          FKESNQVVNLTR----------EAESTVVQMANLNSEIANVAAQLQGTMA----QSEALQ
A0A140KB14      FKEANRVVNLAK----------EKETLVLELGNLNQQIANVAAQYQGTQA----QTATLN
K9XX88          FKEANRVVNLAK----------EKETLVVELANLNQQIANVAAQFQGTQA----QTATLN
A0A563VSV6      FRTKHKIVDLQE----------EKKVLVAELGTLNRQIATTGSQLKGTQA----QTASLQ
L8LZE9          IRERNNIVDLTQ----------EKRVLVQEIGTLNRQISAIGAQLQGAKA----QTGALS
A0A433NM31      FKERNNILDLEN----------EAKAAVTLVTDLENQIAQAQINLANANM----RSAALQ
A0A1Z4NDS1      FKEENKVINLQE----------EATASVNAIARLEDQITQVQAKLVDATA----RVKTLQ
U9VXM0          FREGNSIVDLEE----------ESRNLVESLFTLDNALIQLKSELADSTA----QASQLQ
A0A6M0RI13      FKEGNNIVDLEE----------ESRNLVESLFTLDNALIQLKSQLADSSA----QASQLQ
A0A6M0S1N5      FKEGNNIVDLEE----------ESRNLVESLFTLDNALIQLKSQLADSSA----QASQLQ
K9F4D9          FKEGNNIVDLEE----------ESRNLVESLFTLDNALIQLKSQLADSSA----QASQLQ
A0A6I5QPI5      FKETNDIISLDQ----------EASNAVSVLAGLDQDIGNIQAQLADISA----QLGQLR
A0A1Z3HMQ0      FKDQNQIIALES----------EANAAVSMINNLETQIGQAQAQLASAIT----RTGELR
A0A433W533      FKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRAELANANT----KLAKLR
A0A2P8QWJ3      FKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRAELANANT----KLAKLR
A0A2T1FKP8      FKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRAELANANT----KLAKLR
K9U6L7          FKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRAELANANT----KLAKLR
A0A1E5QP61      FKEENSVVSLQD----------EATSAVISISNLDSEVIKAQAQYEDATA----RSQALQ
U5DPF5          FKERNRIIVLNE----------EAQTTVRLLGSIDEELVKSQTSLNDTQA----RIQELS
A0A6P0X488      FKEQNNIVSLKE----------EATYAVANIANLDQKISQTRSELEDVAA----RSAALQ
A0A6P0UVD5      FKEQNNIVSLKE----------EATYAVANIAELDKKISQTRSDLEDVAA----RSAALQ
A0A6P0VDM0      FKEQNNIVSLKE----------EATYAVANIAELDNKISQTRSELEDVAA----RSAALQ
A0A6M0G142      FKEQNNIVSLEE----------EASFAVENIAELDKKISQTQSELEDVAA----RSSALQ
A0A6P0MR53      FKEQNNIVSLEE----------EASFAVENIAELDRKISQTQSEMEDAAA----RSTALQ
A0A3M2GIL5      FKERNNIVELEE----------EARSAVFVMGEIETEKSKKEAALADATA----RSAALQ
A0A6H1TSJ9      FKERNNIVELEE----------EARSAVFVMGEIETEKSKKEAALADATA----RSAALQ
A0A3M1PML8      FKEANGVVLLES----------EAQEAVNIISKLEDQVTQARAELSDTSA----RLSQLQ
A0A6M8BE85      FKEENGVVLLES----------EAQEAVNIISKLEDQVTQARAELSDTSA----RLAQLQ
A0A0T7BPZ0      FQERNKIIILQE----------QESNAVKMISSLEDEIAQAEIKLTEVNA----QLDKLR
A0A352X442      FKEQNKIVDLVN----------EAKSSVETVADLDTQIAQTQAKLAEATA----QTETLR
A0A6B3NF44      FKEENRVVALQE----------EASASVSIISSLDNQIAQAQARLADVTA----RSTQLR
A0A6M0EPL4      FKEENRVVALQE----------EASASVSIISSLDNQIAQAQARLADVTA----RSTQLR
A0A6P0K6L6      FKEENRVVALQE----------EASASVSIISSLDNQIAQAQARLADVTA----RSTQLR
A0A6P0MRR9      FKEENKVVSLVA----------EATATVDNIARLDRTIAETQAELANISS----QVSELQ
A0A6P0UX57      FKEENKVVSLVD----------EATQTVKSIALLDQQIAAKKAELANISS----QVAEVE
A0A6P0X1X4      FKEENKVVSLVD----------EATQTIRTIAILDQQITQKEAELANVSS----QVAEVE
A0A0M0SHU3      FKEKNKVIVLQE----------EATAAVNTISKLEDEIAEAQAQLVDANA----RLEKLQ
A0A1D2PBN3      FKEENKVIALQE----------EATAAVNEISKLEEQISQAQAQLADVSA----RSQKLQ
A0A0C2LVR7      FKEENKVIALQE----------EATAAVNEISKLEEQISQAEAQLADVTA----KSQKLQ
A0A1Z4PQB9      FKEENKVIALQE----------EATAAVNEISKLEEQISQAQAQLADVSA----RSQKLQ
A0A1Z4SFN6      FKEENKIINLES----------EAGLAVERISNLEQQLAQAQAEYANVTA----KSQKLQ
K9PGI8          FKEENKIIALQE----------EASTAVQVISRLEEQINQTQAKLVEVGA----RTKKLQ
K9TLQ0          FRQHYNLIDPGQ----------SGQILSQQIGSLVNERQETESQLVQAQA----LYGKLR
K9QF04          FRRQNNLVDPEK----------QSQVLTERLSNIIQQRQETQALLGETQS----TIKDLQ
K9W1T3          FKEQNKVLDLAG----------EATSTTEVLNNLTQQISEAQSKYAAETS----RVQGLQ
K9SGJ5          FREKYKIVDPDT----------YAASVYTMKQDLDTQAQQLQIQMAQTQR----QFKELQ
A0A6N2JS94      FRKTYNIVDPDT----------YAASVYKMREALENQAQDLQIKIAQVQQ----QYEALS
A0A6C2DSN4      FRKTYNIVDPDT----------YAAAVFKMREALETQAQELQIKIAQSQQ----QYEALS
L8MYT6          FRKTYNIVDPDT----------YAAAVFKMREALETQAQELQIKIAQSQQ----QYEALS
A0A352JGJ6      FRKTYNIVDPET----------YAAAVFKMREVLEVQAQELQIKIAQTQQ----QYKSLS
A0A1J5GLS2      FRKSYNIVDPET----------YAASVYSMREALEKQAQELQIRIAQVEQ----QFEILS
A0A2W4W6M5      FRKTYNIVDPET----------YAASVYKMREALEVKAQELQIQIAQVQQ----QYKALS
A0A2W7AN33      FRKTYNIVDPDI----------YAASVYKMREALETQAQDLQIKIAQVQQ----QYEVLS
A0A256BLV2      FRKTYNIVDPDT----------YAASVYKMREALENQAQDLQIKMAQVQQ----QYEALS
A0A2W6ZXF3      FRKTYNIVDPET----------YAASVYSMREALEKQAQDLQIRIAQLQQ----QFEILS
A0A2Z5WX66      FRKTYNIVDPEV----------YAAAVFKMREALEAQAQDLQIKIAQFQQ----QYKSLS
Q7NEU3          FRRQYSILDPQV----------QGTELAATLNTLNRDYEQSKAELEASKE----HYWALS
A0A3C0N2P0      LRENYKIVDPES----------QGQQLSNRASEIVKQRQDTESQLSEAQK----LYTELQ
A0A6P0JR04      FRQENNLLDPEV----------QGQKVADRLNQIQQQRQETQAELKAKQA----LYDKLK
A0A6B3M6M6      FRQRYNLTDPET----------QGKLLTSRLSTIVGQRQETTTTFRETQE----LYSRLQ
A0A6P0KD09      FRQRYNLTDPET----------QGKLLTSRLSTIVEQRQTTDTTLQETQE----LYSRLQ
A0A6B3NIJ0      FRQRYNLTDPET----------QGKLLTSRLSTIVEQRQTTDTTLQETQE----LYSRLQ
A0A6M0F053      FRQRYNLTDPET----------QGKLLTSRLSTIVEQRQTTDTTLQETQE----LYSRLQ
A0A6P2ATU9      FRQRHNILDPDV----------QGQSVAERLNRLSEESRAARTTLNEVRS----LTQTLQ
A0A352XE00      FRQAYNLIDPDS----------QAQLLTQRATSIVQQRQDAQSQLAEAKA----LYNQLE
A0A6P0QC14      LREDYRIVDPET----------QGSLLTNRISDVVKQRQEAQTQLDESKQ----LYVELQ
B4VS56          FRQQYNLVNPDS----------QGQLLTSRVSTIVQERQNTQTQLDEART----LAVQLQ
A0A352AAQ3      LRQNYKIVDPET----------QGQLLTNRVSEIVKQRQETESQLVEAQR----LYTELQ
A0A350Y472      LRQTYQIVDPET----------QGQLLTNRVSDIVKQRQETQSQLIESQQ----LYAELQ
A0A355DVB4      LRQTYQIVDPET----------QGQLLTNRVSDIVKQRQETQSQLIESQQ----LYAELQ
A0A1Z4RMB9      FRTQNNIVDIEE----------EKRGVVESIGALNQQISTTGSELQGLKA----QTAALE
A0A318B4H2      YASGKGIVSFSSGSTEKGGGGGERTLVTDDLSSLNTALNAAVAERVAAES----------
B4WQE3          LRQNSNLIDPLA----------QGDQLSQQMAQFTSDHLNLQVEIAQTTE----LYNDLQ
A0A2K3BR24      FKEENNIIALSQ----------EASSTVDILASLDQQLIQAQASLDDAQT----RLEKLT
K9YXY1          FKEENDIIALSQ----------EASSTVSILASLDQQLIQAQASLDDAQT----RLEKLT
A0A1Q4RTR1      FKEKNRVVELQQ----------EAKTSIANQSDLADEIIKTEATLVDTSS----KIISLQ
A0A1Z4SQV2      FKEKNRVVELQE----------EAKTSIKNQSDLADQIIKSEAQLVDISS----QIQALQ
A0A2H2XGN1      FKEKNRVVELQE----------EAKTSIKNQSDLADQIIKSEAQLVDISS----QIQALQ
A0A433UXH8      FKEKNRIVELQE----------EAKTSIKNQSDLADEIIKSEAQLVNISS----QIQALQ
A0A0V7ZFJ4      FKEKNGIVALEQ----------EAQTGVEALKDLSEEIVKAQAYLGEVTT----RSEGLQ
A0A0V7ZNJ9      FKEENKVVALKE----------EAQFGVEGLKDSLQELNQAEAKLAAANE----RSQALQ
A0A367RIS1      FKEKYEVVSLEV----------EAQEGVRSLNELSNQITQLRARLVDARS----RSGALQ
A0A235IXQ2      FKEKYEVVSLEE----------EAKEGVKRLNELSSQITELRARLVDARS----RSGALQ
A0A1W5CNX3      FKEKYEVVSLQE----------EAIQGVKRLNDLSGQVTQLRAQLVDART----RSGALQ
A0A5Q0GJJ5      FKEKYEVVSLQE----------EAIQGVKRLNDLSGQVTQLRAQLVDART----RSGALQ
Q3MEB7          FKEKYEVVSLQE----------EAIQGVKRLNDLSGQVTQLRAQLVDART----RSGALQ
A0A1Z4KHN9      FKEKYEVVSLQE----------EAIQGVKRLNELSGQVTLLRAQLVDART----RSGALQ
Q8YT70          FKEKYEVVSLQE----------EAIQGVKRLNELSGQVTLLRAQLVDART----RSGALQ
A0A166IWU6      FKEKYEVVLLEE----------EAKQGVERLYQISNQLTLLRARLIDASS----RSDALQ
A0A2S0Q8C0      FKEKYEVVLLEE----------EAKQGVERLYQISNQITLLRARLIDASS----RSDALQ
W6FSX4          FKEKYEVVLLEE----------EAKQGVERLYQISNQITLLRARLIDASS----RSDALQ
A0A218Q4C1      FKERNEVVALEE----------EAKQGVERVYEISNQITLLRARLVDASS----RSSALQ
A0A6P1ZT04      FKERNEVVALEE----------EAKKGVERVYEISNQITLLRARLVDASS----RSGALQ
A0A5P8VSD1      FKEKHEVVSLEA----------EAIEGVKRLNELSSQMTQLHAQLVDFRS----RSGALQ
A0A1S1ZVW2      FKEVNRVVALDA----------EAKVGIESLGRIDEVITQAQGQLAAAYT----RSLALQ
A0A0R0M9H9      FKEINRVVALDA----------EAKVGIETLGKIDEVITQAQGQLAAAST----RSLALQ
A0A7H0F4U6      FKEINRVVALDA----------EAKVGIETLGRIDEVITQAQGQLAAAST----RSLALQ
A0A1B7WX82      FKENNRVAVLDV----------EAKTGLESLAKLDQAIIESQGELVAAST----RSLALQ
A0A1B7WTD1      FKEKNRVVALDV----------EARVSLESLGRLTESITQSQGELAAAYT----RSVALQ
A0A480ABC0      FKEKNRVVALDV----------EARVSLESLGNLTEAITQSQGELAAAYT----RSVALQ
A0A1Z4LRU5      FKEQNNVVALEE----------EAKFGVESLKDLSENITQSQANLVEAMT----RSEALQ
A0A1Z4JVB4      FKEKNRVVALDE----------EAKVGVEGLNQLSQEIISTQGQLVAAKT----WSVGLQ
K9PIA4          FKEKNKVIALEI----------EAKAGVEGLKDLAAIITKVEAELVGANT----RSLALQ
A0A1Z4HVE1      FKEKNRVVALDV----------EAKVGVEGLKDLLEEITKAQANLVDANT----RTQALQ
A0A252ECZ1      FKEKNRVVALDI----------EAKAGVEGLKDLLEEITTAQAELADANT----RTRALQ
A0A1Z4G5Y1      FKEQNKVVALEV----------EAKTGVEGLKDLLGEITKAQAGLADATS----RTKALQ
A0A252DNA2      FKEQNRVVALDV----------EAKAGVEGLKDLLEEITKAQAELADAST----RTRALQ
A0A252E1Q4      FKEQNRVVALDV----------EAKAGVEGLKDLLEEITKAQAELADAST----RTRALQ
A0A6G9SK36      FKEKNKVIALDV----------EAKVGVEALKDLAEEITKTQGELIAAKT----RSQSLQ
A0A1Z4M597      FKEKNRVVALDV----------EAKVGVEGLKELAEEITRTQGELTAAKT----RSLALQ
A0A1Z4MWT1      FKEKNRVVALDV----------EAKVGVEGLKELAEEITRTQGQLTAAKT----RSLALQ
A0A1Z4TX53      FKEKNRVVALDV----------EAKVGVEGLKELAEEITRTQGQLTAAKT----RSLALQ
A0A2A2TNQ5      FKDDNKVVSLAE----------EAKVGVEGMRNIAEESTRALAVLEEAKS----RSGTLQ
A0A3S1C4K5      FKDENKVVSLPE----------EAKYGVEALKDLSGDITKAQALLSDASS----RSVALQ
A0A1X4G3D5      FKESNEIISLEA----------EAESGMKNVSTVDAAINQAQAELAVVYT----RSSALQ
D4TNI2          FKESNEIISLEA----------EAESGMKNVSTVDAAINQAQAELAVVYT----RSSALQ
A0A1Z4H6Z8      FKEKNRVVALEV----------EAKVGVEGLKDLAEEITTAQGELVAAKT----RSVALQ
A0A1Z4NPM1      FKDENRVVELTE----------EAKVGVEAMRNLSAELTRAQAALAEKNT----RVQTLQ
A0A3F3KPR9      FKEINRVVALDA----------EAKVGIETLGRINEVITQAQGQLAAAYT----RSLALQ
D4TGN7          FKEINRVVALDA----------EAKVGIETLGRINEVITQAQGQLAAAST----RSLALQ
A0A1Z4UZW9      FKENNRVVALDV----------EAKTGLESLGKLDEAITKSQGELAAVLT----RSVALQ
A0A0K2M5H0      FKENNRVVALDV----------EAKTGLESLGKLNEAITQSQGELAAALT----RSVALQ
A0A1B7VSH4      FKENNRVVALDV----------EAKTGLESLGRLNEAITQSQGQLAAALT----RSVALQ
A0A1B7W126      FKENNRVVALDV----------EAKTGLESLGRLNEAITQSQGQLAAALT----RSVALQ
A0A3D4C6Q6      FKENNRVVALDV----------EAKTGLESLGRLNEAITQSQGQLAAALT----RSVALQ
A0A1B7UVJ4      FKENNRVAVLDV----------EAKTGLESLAKLDQAIIESQGELVAAST----RSLALQ
A0A1B7UTR1      FKENNRVVALDV----------EARTGLESLGKLDEAITRSQGELAAAYT----RSVALQ
K7W0A4          FKENNRVVALDV----------EAKTGLESLGKLDEAITRSQGELAAAYT----RSVALQ
A0A5C0DRW9      FKENNRVVALDV----------EAKTGLESLGKLDEAITRSQGELAAAYT----RSVALQ
A0A6H2C088      FKENNRVVALDV----------EAKTGLESLGKLDEAITRSQGELAAAYT----RSVALQ
A0A1U7HGH0      FKEKNQLTNIEQ----------SQTALAANIERVGSQIDAVEAQLVDLNS----RTQSLQ
K9XJD3          FKEKNQLTNIEQ----------SQTALAANIERVGSQIDTVEAQLVDLNS----RAQSLQ
K9SX01          FKEVNKAYLPEA----------EAQSAVAAVTSLDTQITASKSDLAKVNS----EINDIR
A0A4P7ZT55      FRRANALLIPED----------RAKQIELERADLEARERQLQQGQAQLVG----LQASVR
A0A1E5QIR9      FKENNRIVALDQ----------EASATVTLLGGLEGEITQAKVALNSANT----RVAALR
A0A6P1A9A0      FRQQYDLIEPQS----------QGQQLSGKLSAIKQQQQETQAQLAEIQS----LSVRLS
A0A1Z4IBC7      FKEINKIVALEQ----------EATVAVDTVSKLSNQISQAQAQLNDVKG----RLEQLR
A0A1W5CPC7      FKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVTG----RLEQLR
A0A5Q0GKD1      FKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVTG----RLEQLR
Q3MDC6          FKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVTG----RLEQLR
A0A1Z4KM73      FKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVKG----RLEQLR
Q8YNX7          FKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVKG----RLEQLR
A0A367R4K6      FKEKNKVIVLDQ----------EASAAVDTISKLDNQIYQAQAQLDDVKG----RLEQLR
A0A1E2WSV8      FKETNKIVVLEQ----------EATAAVDTISKLGNQISQALAQLDDVKG----RLEQLR
A0A7D7L9Y1      FKETNKIVVLEQ----------EATAAVDTISKLGNQISQALAQLDDVKG----RLEQLR
A0A2R5FRT9      FKEKNKVVVLGQ----------EASAAVDTISKLGNQISQALAQLDDVKG----RLEQLS
A0A2K8T1B6      FKEKNKVVVLGQ----------EASAAVDTISKLGNQISQALAQLDDVKG----RLEQLR
A0A235I9I0      FKETNKVVVLDQ----------EAAAAVDTISKLGNQISQALAQLDDVKG----RLEQLS
A0A2D0HQT8      FKETNKVVVLEQ----------EAAAAVDTISKLGNQISQALAQLDDVKG----RLEQLS
A0A2L2NU95      FKETNKVVVLEQ----------EAAAAVDTISKLGNQISQALAQLDDVKG----RLEQLS
A0A367S084      FKETNKVVVLEQ----------EAAAAVDTISKLGNQISQALAQLDDVKG----RLEQLS
A0A1Z4SMD6      FKNQFQIIELKD----------ESTAAINNVAKIDEEMNQVKAAIAEAIA----QETQLR
A0A2H2Y096      FKNQFQIIELKD----------ESTAAINNVAKIDEEMNQVKAAIAEAIA----QETQLR
K9S8M8          FKERNGVISLNE----------EARTAVESIATLSTMIAQSEAMLQDATA----RSGQLQ
A0A1Z4NFV0      FRTQNQIANLPE----------EAKTTVESIAKLTDELNSTQAELAQVTS----QMGQLR
A0A3M9ZEU1      FKEANQIVALDT----------EATAAVNIIASIDQQIADTEAELAKMVA----RSSALR
A0A1Z4JK72      FRTQNQIVDLER----------ESAANINSLSLLQDQLNQARSQLADVAR----QEQVVR
A0A0N7Z489      FRARNGIVDLER----------ESAANINSAAVLQDQLSQARAQLADVGR----QERAVA
A0A0S3TXS2      FRAQNGIVDLER----------ESAANINSAAVLQDQLSQARAQLADVGR----QERAVA
A0A2A2TPF8      FKEQNQIINLEE----------ESNETVKTIGELDKQLNETRGQLAEATS----QQTELR
A0A1Z4R0P8      FKERNQIINLEE----------ESNETVKTIGELDKQLNEAQGQLAEVIS----QYQELR
A0A0T7BUI3      FKNKNKIVQLEQ----------ESSSAITSMAKLDEEINQATANLAETLA----QESQVG
A0A1Z4LP32      FKNQNQVIQLAE----------EATAAIQNISKLDDEINQARALLADVSA----QESRVA
K9REP9          FKNKNQVIQLPE----------EATAAIQNISTLDGEINQARASLAELTA----QESQLA
A0A1Z4SIJ3      FKTENKIIQLSQ----------ESTAGINNIAQLDEQINQSKASLADISA----QEALIA
A0A2H2XPG4      FKTENKIIQLSQ----------ESTAGINNIAQLDEQINQSKASLADISA----QEALIA
K9V3C7          FKARNQIISLKE----------ESDSTVKIIEELSNKLNEARGQLADVAS----QQAEVR
A0A1Z4T6Y7      FKTNNKVINLDK----------ETEETVKNIGELDKQLNEVKGQLAEVTS----QQAELR
A0A2H2Y561      FKTNNKVINLDK----------ETEETVKNIGELDKQLNEVKGQLAEVTS----QQAELR
A0A1Q4S362      FKAANQVINLEK----------ETEETVKNIGELDKQLNEVKGQLAEVTS----QQAELR
A0A3S1CIN8      FKAANQVINLEQ----------ETEETVKSIGELDKQLNEVKGQLAEVTS----QQAELR
A0A2A2TC28      FKIQNNIVQLPQ----------EATAAITNISNLNEQVSQNQAALADIIA----QETELK
A0A0C1NCB0      FKTSNKIVELKQ----------EATSAISNVAQLDDTINQAQAELAEVSA----EQAKVL
A0A2N6K7Q9      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A2N6MXH6      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A2N6M5A8      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A2N6LL61      FKIQNKVIQLAE----------ESTAAIDIIAKLDQEINQVKAALADVSA----QEQQIA
A0A0S3TP66      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
G6FP91          FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A1U7GYR5      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A2N6KY52      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A2N6KMP5      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVST----QEQQIA
A0A2N6MA45      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A4Q9J9V9      FKIQNRVIQLAE----------ESSAAIDIISKLDQEMNQIKAALADVTA----QEAQIA
A0A328IGA1      FKIQNRVIQLAE----------ESSAAIDIISKLDQEMNQIKAALADVTA----QEAQIA
A0A4D9CE41      FKIQNRVIQLAE----------ESSAAIDIISKLDQEMNQIKAALADVTA----QEAQIA
A0A0M0SFT2      FKIQNRVIQLAE----------ESTAAIEIISKLDQEMNQIKAALSDVSA----QEAQIA
A0A1Z4TLC8      FKIQNRVIQLAE----------ESTAAIDIISKLDQEMNQIKAALADVSA----QEAQIA
A0A0C2LFH0      FKTRYKIIELPE----------EASAAVQNVASIDEEINQARAALADTSA----QEEKIR
A0A1Z4IYV4      FKIQYKIIELPE----------EASAAVKNLGQIDQEINQARAALADVSA----QEAKMN
A0A1Z4Q0T6      FKIQYKIIQLPE----------EASAAVQNLGQIDQEINQARAALADVSA----QEAKMN
A0A0C2PT44      FKTRYKIIELPE----------EASAAVQNLGQIDQEINQARAALADVSA----QEAKIN
A0A1D2P6J4      FKTRYKIIELPE----------EASAAVKNLGEIDQEINQARAALADVSA----QEAKIN
B4WP72          FKEENGVVDLEQ----------EAAQAVDSIGNLDTQIDQAKTELANVNA----RLLELR
A0A2T1CIL7      FKTKNKIANLAQ----------EASNNINATKSLESEIDAVRANLKDVNG----RFEQLR
A0A433V7A0      FKELNQVVDLNQ----------EATSTVKVIEDLEKAITQTQAELAEVNNYYQILQNQIQ
A0A2T1FTR8      FKEQYNVVDLPT----------ESVKAVETITSLNKEITSASAQLAAETS----RLEGLK
K9UA41          FKEQYNVVDLPT----------ESVKAVETITSLNKEITSASAQLAAETS----RLEGLK
A0A0C2LBE2      FKENNKIITLQE----------EASAAVQAIAKLNEQISQAQAQLEDVTA----RSQKLQ
A0A433NN38      FKEANKVVVLQQ----------EAAEAVSTISKLEDNIATAQAQLVNVTA----QSQKLK
A0A2N6K0T2      FKERNKIIVLQE----------EATAAVNTISKLEDEIAQAQAQLVDVNA----RLEKLQ
A0A2N6ML72      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
G6FQZ6          FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A2N6MQX9      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A2N6KXT6      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A2N6KGB9      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A2N6L3Y5      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLQKLQ
A0A0S3TIS7      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A1U7GW28      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A2N6LW63      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A328IH74      FKEKNKVIVLQE----------EATAAVNSISKLEDEIAEAQAQLVDANA----RLEKLQ
A0A4D9CIB0      FKEKNKVIVLQE----------EATAAVNSISKLEDEIAEAQAQLVDANA----RLEKLQ
A0A1Z4TQ63      FKEKNKVIVLQE----------EATAAVNTISKLEDEIAQAQAQLVDANA----RLEKLQ
A0A4Q9J8G2      FKEKNKVIVLQE----------EATAAVNTISKLEDEIAQAQAQLVDANA----RLEKLQ
A0A350Y0P6      FKEQHNIVSIDE----------EGTAAVEIMADLDKKISETKAQLQEKTT----TATELQ
A0A352X940      FKEENNIVAIEE----------EAKSAVQAMAELDSKLSQTKSNLEDATA----RSIAIQ
B8HTN4          FKETHGIVDLPT----------EQIESVKFKSLLARDLAQAKSLLATAQA----RATGLS
A0A6P1AFJ5      FRQENNFIEPSA----------QAQTLSSTLNNLAVAKEENQTQLAEMES----LATNLQ
B0CAX4          FKETNGIIALEE----------EAKVSVEVEGNFYQEAAKMQSLLINARA----KSRALR
A0A1Z4RN12      FKNRNRTINLDE----------ETASTIESISTIENQIDQVEAELSDINA----RYSRLQ
A0A2T1CMF9      FKNRNGISDLQG----------QITADIDSVAQVENQINQVSADLNDVNA----RYNRLQ
Q7NDC5          FKEQYGSVALAE----------EQQAAVRLLSEFRSQQAQADVALSEAGA----RVRAID
U5QGK3          FKERYGSVALPE----------EQQAVVKQLAEFKSEQAQAAVKLAEAQT----RAGAIA
A0A2W4UY24      FKEANGIVNLEE----------ESQNTVKTLSTVTDSITQLRSDLADKNA----QFAQIQ
A0A0D8ZUV2      FKEQNQIVSLDE----------EVKSAVGIIKELESQINTTEAALANANA----RYATLQ
A0A433VDI0      FKEQNRVVNLDE----------EAKSAVEIIQELESQINQSQTALAGANA----RHTSLY
A0A3D1PG43      FKEQNQVVNLDE----------EGKSAVEVIKQLEDQVTATQAALVQAKT----RSANLQ
A0A2P8QQ72      FKERHQIVSLEH----------EAISAVEVLKELQDQITLAEAALVQTQG----RATKLQ
K9TZQ7          FKERHQIVSLEH----------EAISAVEVLKELQDQITLAEAALVQTQG----RATKLQ
A0A6N8G584      FKEQNQVVALDE----------EAKTAVAAIKQLENQITETQAQLADTTT----RSATLQ
A0A2G7GPR0      FKEQNQVVALDE----------EAKTAVAAVKQLENQITETQAQLADTTT----RSATLQ
K9XH68          FKEQNQVVALDE----------EAKTAVAAIKQLENQITETQAQLADTTT----RSATLQ
A0A1U7HW70      FKEQNQVVALDE----------EAKTAVAAIKQLENQITETQAQLADTTT----RSATLQ
A0A2S6VEJ8      FKEQNQVVALDE----------EAKTAVAAIKQLENQITETQAQLADTTT----RSATLQ
A0A140KBA0      FKNENQIANLSE----------ETTTLIETSKLVDTQIDQVAAELGDVNA----RYTSLS
K9XSG1          FKNENQIANLSE----------ETTTLIETSKLVDTQIDQVAAQLQDVNA----RYASLS
A0A2T1GMT4      FKQQNNIVDLSE----------EAKSAVSVIGNLDNNINAVRSELEQANA----QSQELY
K9UI51          FKQQNNIVDLSE----------EAKSAVGVIGNLENNINAVRSELEQANA----QSQELY
A0A1Z4QL41      FKQQNSVVDLSE----------ETKSAVTIIGNLDNEINTIRAQLADFNA----QTDALR
A0A2T1FXY4      FKQKNNIVDLSE----------EAKTAVANIGSLDNQIDNLKAELDQANT----QTKELR
K9TYI2          FKQKNNIVDLSE----------EAKTAVANIGSLDNQIDNLKAELDQANT----QTNELR
A0A252D4T4      FKQKYNIVDLVE----------ETRSAVAIIGNLDNGINTAKADLDQATA----QTNELR
A0A252DJH5      FKQKYNIVDLVE----------ETRSAVAIIGNLDNGINTAKADLDQATA----QTNELR
A0A252EB80      FKQKYNIVDLVE----------ETRSAVAIIGNLDNGINTAKADLDQATA----QTRELR
A0A6G9SKZ9      FKQKYKIVDLAE----------ETRSAVAIIGNLDNNINTAKADLDQATA----QTNELR
A0A1Z4HPW5      FKQKYNIVDLAE----------ETRSAVAIIGNLDNNINGVRADLDQATA----QTNELR
A0A1Z4MSN1      FKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKADFDQATA----QTNELR
A0A1Z4U1C2      FKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKADFDQATA----QTNELR
A0A0D6KV51      FKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKADFDQATA----QTNELR
A0A1Z4MKF8      FKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKADFDQATA----QTNELR
A0A2C6WC43      FKQKNRIADLTE----------ETKSAVGIIGNLNNEINTVQAQLDEVNA----QTNELR
A0A1Z4L5A1      FRQKNRIADLTE----------ETKSAVSIIGNLNTEINTVQAQLDEVNA----QTNELR
A0A367QD86      FKQKNRIADLTE----------ETKSAVGIIGNLNNEINTVQAQLDEVNA----QTNELR
A0A2K8SM78      FKQKHQIANLSE----------ETRSAVETIGNLDNEMNTVRAQLDEVNA----QTNELR
A0A2R5FPC0      FKQKHQIADLSE----------ETRSAVATIGNLDNEMNTVKAQLDEVNA----QTNELR
A0A5P8W5T6      FKQKHQIADLSE----------ETKSAVATIGNLDSEMNTVQAQLDEVNA----QTNELR
A0A7D7LDT7      FKQKHQIADLSE----------ETRSAVATIGNLDNEMNSVKAQLNEVNA----QTNQLR
A0A235IZ96      FKQKHQIADLSE----------ETKSAVATIGNLDNEMNTVKAQLDEINA----QTNELR
A0A2L2NGP0      FKQKHQIADLSE----------ETKSAVATIGNLDNEMNTVKAQLDEINA----QTNELR
K9QM62          FKQQNNIVDLTE----------EARSAVTIIGGLDTEINTVKASLNEITA----QSNELR
A0A1Z4FWI3      FKQSNNIVDLIE----------ETRSAVAIIGNLDNSINATRAELDQATA----QSNELR
A0A1Z4JYE7      FREQNNIVDLAE----------ETKTSVGVITGIDNEINAVKAQLADLVA----QRNQLS
A0A0F5YE28      FKEKNQVLDLEE----------EFRTAVLEQAELNRKITVLESELSGVNA----LAESLQ
U7QEH7          FKEKNQVLDLDA----------EFRTAVTELAELNRKITVLESELSGVNA----LAESLQ
A0A3S1ATK5      FKQENRIVDLPE----------ETKSAVGIIGNLENEINTVKAQLEDLNG----QTETLR
A0A2Z6CPH0      FRQKNNIADLSE----------ETKSSVGIIANLDNEINAIQAQLAEVNA----QSSELR
A0A1Z4GT50      FKEKHNIVDLSE----------EAKSGVAIIGNLNNEIHTIQAQLDEVNA----QSNELR
A0A1Z4GIX0      FRQKNNIADLTE----------ETRSGVGIIGNLDNEINTVNSQLAEVTA----QSNELR
A0A2H6LC24      FRQKNNIADLTE----------ETRSGVGIIGNLDNEINTVNSQLAEVTA----QSNELR
B2J6N5          FKQKYQIADLSE----------ETKSAVATIGNLDNEMNTVKAQLDEVNA----QTNELR
A0A367RMI4      FKQKHQIADLSE----------ETRSAVATIGNLDNEMNTVKAQLDEVNA----QTNELR
A0A235HUM0      FKQKHQIADLSE----------ETRSAVATIGNLDNEMNTVKAQLNEVNA----QTSELR
A0A2L2NW47      FKQKHQIADLAE----------ETRSAVATIGNLDNEMNTVKAQLDEVNA----QTNELR
A0A1E2WUR1      FKQKHQIADLSE----------ETRSAVATIGNLDNEMNSVKAQLNEVNA----QTNQLR
A0A235IKU3      FKQKHQIADLSE----------ETKSAVATIGNLDNEMNTVKAQLDEINA----QTNELR
A0A1U7MYU6      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A1D8TNX9      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A6P0L6C2      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A6P0MVH0      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A6P0KJV0      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A6L9ZJG4      FKERNQVVSLTE----------ESRSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
F4XKF3          FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A1D9FX10      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A6P0Q0T0      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A6P0W5I0      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A3C0NJ41      FKQENQVIALDE----------EAKSAVGVMANLEQQITQVQAELQQANA----QTAALQ
A0A352AG88      FKEVNKVVSLEE----------ESRAAVDTLAKLDQQITEVKSQFKDANA----RSAELR
A0A350Y374      FKERNQVVALDT----------EATTAVEVIAKLDEQIAQVQSDLKNINS----QSAALR
A0A355DPX0      FKERNQVVALDA----------EATTAVEVIAKLDEQIAQVQADLKNINS----QSAALR
                                                                            

K9SLA9          Q---SL------GMDAGL-------------------S----VAWSSP-SAQ--------
A0A168TT23      Q-----------GRGDSI-------------------R----PVVNDG-QIA--------
A0A0M1JWX9      Q---QV------GLDPDV-AIAS--------------S----VLSEAP-SYQ--------
A0A2T1M1V6      A---QL------GMNPQH-ALNS--------------L----RLAENK-EYQ--------
A0A2G7GCS2      Q---RL------GINAQQ-AMNS--------------L----RLGENR-EYQ--------
K9XBH8          G---RL------GMNAQQ-AMNS--------------L----RLAENK-EYQ--------
A0A1Z4LJ30      A---RI------EMSPST-AVNS--------------V----KLKENK-EYQ--------
K9RI76          N---RI------ALSPAA-AVNS--------------V----RLKEYK-EFQ--------
A0A352AE27      N---RL------GLTPDQ-AIRS--------------L----GLAENP-DYQ--------
A0A3B8JH60      A---PL------SLTPDQ-AIKS--------------L----GLGENQ-NYQ--------
A0A3C0N766      A---RL------SLTPDQ-AIKS--------------L----GLGENQ-NYQ--------
K9W9J7          S---RL------SLTPNQ-AIRS--------------L----GLGENQ-NYQ--------
A0A139WSU3      I---RL------SLTPNE-AIRS--------------L----GLGENK-EYQ--------
A0A433VN22      E---RI------NMAPAS-AVRS--------------L----SLSENQ-EFK--------
Q7NF11          A---RL------GMDAPQ-AMRA--------------L----RLGESK-EYQ--------
A0A1Z4JCS8      T---RL------NLSPTD-AVQA--------------L----GLDQNE-DYK--------
A0A6P0PI80      T---RL------GLTPKQ-AIRS--------------L----GLAENR-DYQ--------
A0A6P0WGT6      T---RL------GLTPKQ-AIRS--------------L----GLAENR-DYQ--------
F4XTX2          T---RL------GLTPKQ-AIRS--------------L----GLAENR-DYQ--------
Q7NJN6          Q---AV------GMDLRR-ATAA--------------L----NLGEDK-GLQ--------
U5QCC3          Q---AV------GMDLRR-ATSA--------------L----RVGEDK-EYQ--------
A0A0S3TYD7      N---QV------GTSNEI-GVAQ--------------V----ALSQST-GVQ--------
A0A2T1DNG3      Q---KV------NLSPQQAVLTA-------------------RLNQSG-RYQ--------
A0A3S0Y9N9      Q---LF------GVNSQE-AVVA--------------G----FASESP-STS--------
A0A433UNK7      K---LF------GVASQD-AVVA--------------G----FVGESP-STV--------
A0A6P0ZKB8      K---IF------GVTSQD-AVLS--------------G----FVGESP-STT--------
U5QL42          A---QV------GEDPDI-ALSM--------------T----ILSQDP-TYT--------
A0A140K3H3      R---QLRDL---GQNPET-IVAY--------------T----LLSQDQ-VYQ--------
K9XUB8          R---QLREL---GQNPET-IVAY--------------T----LLSQDQ-VYQ--------
A0A6H2NHD5      D---QV------GFQPST-AIRV--------------A----NLSESP-TYQ--------
A0A2P8W4F7      D---QV------GFDPDT-AIRV--------------A----NLNESP-TYQ--------
A0A5Q4E0Z4      R---QV------GFEPTV-AIGV--------------A----NLNESP-TYQ--------
A0A2P8VVX1      Q---QL------NLSPQS-GVIA--------------A----RLSQSP-RIQ--------
A0A2P8WHY0      Q---RT------QLSPAN-ALLA--------------A----RLSQSQ-RVQ--------
A0A2T1CMT9      E---QL------GVSVEN-ALAL--------------S----RLSQSP-RYQ--------
A0A7G8J1V5      T---EINNGTLSIRGFQD-AIGPS----GASQSGGTGG----GLSISD-PDQ--------
A0A354B169      A---EISSGRLSARGFQE-AISTG---SGGSSSDNSGK----GLSVGD-VDQ--------
Q0IDT5          Q---DIASGSLSARGFQE-AISTG--SGGVVTGNQQSQ----GLAVSD-ADQ--------
A0A7G8FZD9      Q---EIAYGTLTARGFQE-AIGGL---GNGLTAGGGVQ----GLTISD-VDQ--------
G4FMX5          E---EIANGTLTARGFQE-AIGGM---GNGLTAGGGVQ----GLTISD-VDQ--------
A0A7G8FAU7      A---EIAAGTLSARGFQE-AISTG-SGGGGQSAQ--------GLSVSD-ADQ--------
A3ZA21          A---EIAAGTLSARGFQE-AISTG-SGGGGQSAQ--------GLSVSD-ADQ--------
A0A076HBF2      G---EIASGTLTARGFQE-AIGQN--NGGGQANS--------GLTVSD-VDQ--------
A0A7G8FP50      S---EISRGTLTARGFQE-AIGSS---------G--------GLTVSD-VDQ--------
A0A7G8E8K7      D---GIASGTLSARGFQE-AIGNNTDPGGGQANS--------GLTVSD-VDQ--------
A0A7G8GAH0      G---EIASGTLTARGFQE-AIGNK---GGGQVNS--------GLTVSD-VDQ--------
A0A7G8GNR2      D---EISGGTLTARGFQE-AIGNT---GGAQANS--------GLTVSD-VDQ--------
A0A7G8ICD3      G---EIASGTLTARGFQE-AIGNT---GGGQANS--------GLTVSD-VDQ--------
A0A2D6FCW3      Q---EIANGTLTARGFQE-AIGGL---GNGTTAGGDVQ----GLTISD-VDQ--------
A0A7G7KJ95      Q---EIANGTLTARGFQE-AIGGM---GNGTTAGGGVQ----GLTISD-VDQ--------
A0A7G8EAN3      Q---EIANGTLTARGFQE-AIGGL---GNGTTASGSVQ----GLTISD-VDQ--------
A0A563VQJ3      S---QL------GLNLQQ-AIAA--------------N----QLGNTP-AVK--------
A0A1D8TX52      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A1D9G4T2      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6P0PR27      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6P0WER7      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
F4XP71          Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6L9YR57      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6P0KZ31      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6P0LPB8      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6P0SEV1      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6B3N2I8      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6M0B891      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6P0IJQ1      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6P0J8J8      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6P0ZSH6      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A1U7N5X9      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6L9Z1V0      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6P0LC12      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A6P0MVJ3      Q---KL------ARSPQN-ALTS--------------S----RLSQSG-RYQ--------
A0A2W6ZAV2      S---GM------LTGPQV-QGSAG---DPGSGSQDKPA----QGTMTT-TTS--------
K9W742          Q---QV------ARSPQD-ALVS--------------S----RLSQST-RYQ--------
A0A3D1PBA3      Q---QL------ARSPQQ-ALAA--------------S----RLSQSS-RYQ--------
K9XPB0          Q---EL------GLSAEN-SVAM--------------T----RLNQSS-QYQ--------
A0A350Y7Z1      Q---QL------ERSPQE-ALTS--------------S----RLSQSP-RYQ--------
A0A352X2A7      K---QL------NRSTSE-ALTS--------------S----RLSQSP-RYQ--------
A0A0D8ZYV0      Q---QV------GSTPQV-ALSS--------------S----RLSQSP-RYQ--------
A0A2T1FP73      Q---QL------ARSPQQ-ALVA--------------S----RLSQSS-RYQ--------
A0A433VMS2      Q---QL------ARSPQQ-ALVA--------------S----RLSQSS-RYQ--------
K9TYA7          Q---QL------ARSPQQ-ALVA--------------S----RLSQSS-RYQ--------
A0A2P8QUE1      Q---QL------ARSPQQ-ALVA--------------S----RLSQSS-RYQ--------
K9SA61          R---QL------GRSPQA-ALLA--------------S----RLSEST-RYQ--------
A0A2G7GMH8      Q---QL------ARTPRN-ALVS--------------S----RLSQSQ-RYQ--------
A0A6N8FU92      Q---QI------ARSPRN-ALVS--------------S----RLSQSQ-RYQ--------
A0A2T1DWE8      Q---EL------ALSPQQ-ALIA--------------A----RLSQSS-RYQ--------
A0A1U7I8L3      Q---QV------KRSPQD-AVVS--------------S----RLSEST-RYQ--------
A0A2T1DJL8      Q---QL------ARSPQQ-ATIA--------------A----RLSQSP-RYQ--------
A0A1Z4J9W0      Q---QL------QRSPGQ-ATVA--------------A----RLSQSK-QYQ--------
A0A0N7Z5K9      Q---QL------ARSPEQ-ATIA--------------S----RLSQSN-QYQ--------
A0A0S3TXC5      Q---QL------ARSPEQ-ATIA--------------S----RLSQSR-QYQ--------
B8HNB0          QQLADL------KVNPSQ-AVPI--------------S----VLLQDS-NYQ--------
A0A563VS48      S---QL------GISWEK-ASAI--------------A----TLSQSL-AVQ--------
A0A318BJ18      A---EAR-----SQQGGRAGASA--------------E----ALRN--------------
A0A3B8Y8H9      Q---QL------AMGEQE-AIDL--------------T----ALSESP-RYM--------
A0A2W1JVB9      K---QL------GIDKQK-SIAS--------------T----TLSQSP-GVQ--------
A0A3M1SVZ4      N---QL------GMNPKQ-AAQR--------------T----VISQST-TIQ--------
A0A6H1U102      RQMVAA------GQNPDT-ALVN--------------S----MLAEDS-VYQ--------
A0A7C3ZEJ3      LQVSKA------GQNPDA-ALPA--------------A----ILSQDT-VYQ--------
A0A563VLD6      FQLQQL------GQEPDT-ILAS--------------T----VLSQDG-VYR--------
A0A2P8W9H0      Q-----------TLNNDGELAAN--------------S----ALLNSN-RYQ--------
A0A6I5P386      Q-----------ELARGEELAST--------------S----ALLENE-RYQ--------
A0A654SFI6      -------------------SVLS--------------G----EFPAAD-ARN--------
A0A318BG22      E---QAW-----NLARSPRADSL--------------P----EVRDNV-QIA--------
K9SSQ0          R---QV------G-RPADVAISS--------------A----ILSQDA-NYQ--------
A0A2W1JIN9      T---LT------NAGSINNTYTS--------------V----RTGQDP-ELQ--------
A0A318AJV1      G---QV------RSGNVD---AV--------------V----GVQGSN-VIR--------
A0A6P0IC70      Q---LT------GFNTINNAYVG--------------G----RVGQDE-QLD--------
A0A6B3MUB5      Q---LT------GFNTINNAYVG--------------G----RVGQDE-QLD--------
A0A6M0B7N4      Q---LT------GFNTINNAYVG--------------G----RVGQDE-QLD--------
A0A6P0J9W3      Q---LT------GFNTINNAYVG--------------G----RVGQDE-QLD--------
A0A6P0ZWE1      Q---LT------GFNTINNAYVG--------------G----RVGQDE-QLD--------
A0A1U7N2U4      T---IT------SLNNTQNAYIA--------------G----RIGQDQ-ELQ--------
A0A1D9G1F2      T---IT------SLNNTQNAYIA--------------G----RIGQDQ-ELQ--------
A0A6P0PNZ7      T---IT------SLNNTQNAYIA--------------G----RIGQDQ-ELQ--------
F4XV38          T---IT------SLNNTQNAYIA--------------G----RIGQDQ-ELQ--------
A0A6P0W137      T---IT------SLNNTQNAYIA--------------G----RIGQDQ-ELQ--------
A0A6L9Y9E2      T---IT------SLNNTQNAYIA--------------G----RIGQDQ-ELQ--------
A0A6P0SGR0      T---IT------SLNNTQNAYIA--------------G----RIGQDQ-ELQ--------
A0A6M0BK48      T---IT------SLNNTQNAYIA--------------G----RIGQDQ-ELQ--------
A0A6L9YZL1      T---IT------SLNNAQNAYIA--------------G----RIGQDE-ELQ--------
A0A6P0KYM4      T---IT------SLNNTQNAYIA--------------G----RIGQDQ-ELQ--------
A0A6P0LSD6      T---IT------SLNNTQNAYIA--------------G----RIGQDQ-ELQ--------
A0A6P0X384      Q---TT------GL-NLEDAYVG--------------G----RIGQDE-ELV--------
A0A2P8QIL5      Q---VT------DSSTLKNTYAT--------------V----RSGQNE-QLQ--------
A0A2T1FLY5      Q---VT------DSSTLKNTYAT--------------V----RSGQNE-QLQ--------
A0A433W447      Q---VT------DSSTLKNTYAT--------------V----RSGQNE-QLQ--------
K9U1K8          Q---VT------DSSTLKNTYAT--------------V----RSGQNE-QLQ--------
K9UYB2          R---IT------DTSTLNNAYTT--------------V----RGGQDD-ELK--------
A0A218QN17      Q---IT------SAKSLDKAYAS--------------V----RGGQDE-QLK--------
K9RKN2          Q---IT------NADSLNSAYSS--------------V----RSGSDE-ELV--------
A0A2I8ADV2      Q---LT------ATKNINNAYTS--------------V----RSGQDE-QLR--------
A0A1W5CKM3      Q---VT------DAKNINTAYAS--------------V----REGQDE-QLK--------
A0A5Q0GMF5      Q---VT------DAKNINTAYAS--------------V----REGQDE-QLK--------
Q3MEW0          Q---VT------DAKNINTAYAS--------------V----REGQDE-QLK--------
A0A1Z4KIC7      Q---VT------DAKNINTAYAS--------------V----REGQDE-QLK--------
Q8YSM5          Q---VT------DAKNINTAYAS--------------V----REGQDE-QLK--------
A0A1Q4S1H4      Q---VT------NSSNLGNAYAS--------------V----RSGQDE-QIK--------
A0A433VBU6      Q---VT------NSSNLGSAYAS--------------V----RSGQDE-QIK--------
A0A1Q4RZJ6      Q---VT------QSKGLDTAYES--------------V----RGGQDQ-ELQ--------
A0A1Z4SNV3      Q---IT------QAKGLDRAYES--------------V----RSGQDQ-ELQ--------
A0A2H2XJQ1      Q---IT------QAKGLDRAYES--------------V----RSGQDQ-ELQ--------
A0A3S5K358      Q---VT------QAKGLDTAYES--------------V----RGGQDQ-ELQ--------
A0A0T7BPJ4      K---IT------KTTSLDKAYSA--------------V----RTGQDE-EVK--------
A0A0C1QS61      Q---IT------NATALKSAYAS--------------V----RGGQDE-QLK--------
A0A139X3R8      Q---IT------NSTAVKSAYAS--------------V----RGGQDE-QLK--------
A0A1Z4I7C5      Q---VT------DAKNITAAYAS--------------V----REGQDE-QLK--------
A0A0C2MDK7      Q---IT------NAGNLNNAYSS--------------V----RSGQDD-EIK--------
A0A1Y0RCK1      Q---IT------NTENLNNAYSS--------------V----RSGQDE-EIK--------
A0A1Z4PWZ0      Q---IT------DSATLNKAYSS--------------V----RSGQDD-EIK--------
A0A0C2QLT0      Q---IT------NTENLNKAYSS--------------V----RSGQDD-EIK--------
A0A1Z4J2K1      Q---IT------DAGNLNKAYSS--------------V----RSGQDD-EIK--------
A0A3S0ZSX0      Q---VT------DAKALDQAYAS--------------V----RGGQNE-ELK--------
A0A2N6K4T3      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A370CKT2      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A0S3TL97      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A2N6M8A0      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A2N6M9E1      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A2N6KJI4      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A2N6MZ77      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A2N6KT20      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
G6FSN3          Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A4D9CI02      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A328I8B9      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A4Q9J4Z7      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A0M0SU69      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A1Z4TIZ8      Q---VT------DAKALNQAYAA--------------V----RGGQDE-ELK--------
A0A2T1E9V8      Q---KL------GMSPQE-AIVT--------------A----SVSQSS-AVQ--------
A0A1Z4LN32      S---QL------NLPLNK-AVDI--------------S----SLSQVK-GVQ--------
A0A2I8A9F5      N---QI------NLPADQ-AVDI--------------S----SLSQAA-GVQ--------
A0A218Q6R8      G---QL------NLPAEQ-ALAI--------------T----SLSQES-GVQ--------
A0A218QGE0      R---QM------NLRVDR-AVDI--------------T----SLSQVP-RVQ--------
A0A3M2GQQ6      SQMVEA------GQNPDT-ALVH--------------S----LLSQDS-VYQ--------
A0A6H1U2X0      SQMVEA------GQNPDT-ALVH--------------S----LLSQDS-VYQ--------
K1XF69          N---QV------GLNLEE-AIAV--------------N----TLSQSP-VVR--------
B5W297          N---QV------GLNLEE-AIAV--------------N----TLSQSP-VVR--------
A0A6H2AL05      N---QV------GLNLEE-AIAV--------------N----TLSQSP-VVR--------
H1W7M8          N---QV------GLNLEE-AIAV--------------N----TLSQSP-VVR--------
A0A5Q4H6A5      N---QV------GLNLEE-AIAI--------------N----TLSQSP-VVR--------
D5A466          N---QV------GLNLEE-AIAV--------------N----TLSQSP-VVR--------
U5QJM6          S---RL------GSSPEQ-ALAA--------------A----TLSEDK-IYQ--------
A0A1Z4RPC6      N---QL------GLDLKQ-AIAA--------------N----QLGSTP-QVQ--------
A0A2T1CMZ0      N---QL------GLNLKQ-AIST--------------V----QLGNTP-QVQ--------
L8M4F7          A---KI------GLSLEQ-AIAA--------------D----QLGSTP-VVK--------
A0A140K2P2      S---QL------NLNLNQ-AIAA--------------N----QLGASP-VVD--------
K9XWX4          S---QL------NLNLNQ-AIAA--------------N----QLGASP-VVD--------
A0A140KB14      Q---QL------GLNLNQ-ALAA--------------N----QLGGTP-VVE--------
K9XX88          Q---QL------GLNLNQ-ALAA--------------N----QLGGTP-VVE--------
A0A563VSV6      K---QL------GLSLNQ-AIAV--------------S----QLGNSP-TVQ--------
L8LZE9          Q---EL------GLSLEQ-AISA--------------N----QLGRTP-IVQ--------
A0A433NM31      R---EI------GINVEQ-AKVI--------------N----ALSQSA-GVQ--------
A0A1Z4NDS1      E---QA------NINSQQ-AITS--------------S----SLSQIP-GIQ--------
U9VXM0          Q---KL------KLSSQE-AYAV--------------G----LVSESP-GIQ--------
A0A6M0RI13      Q---KL------KLSSDE-AYAV--------------G----LVSESP-GIQ--------
A0A6M0S1N5      Q---KL------KLSSDE-AYAV--------------G----LVSESP-GIQ--------
K9F4D9          Q---KL------KLSSDE-AYAV--------------G----LVSESP-GIQ--------
A0A6I5QPI5      G---QL------GVNVSE-GIAL--------------S----SLNQSE-GVQ--------
A0A1Z3HMQ0      R---QL------GIPLAQ-ARQV--------------D----SLSQSP-GVQ--------
A0A433W533      Q---QV------GMDTDT-SLNL--------------N----ALNQAR-GVQ--------
A0A2P8QWJ3      Q---QV------GMDTDT-SLNL--------------N----ALNQAR-GVQ--------
A0A2T1FKP8      Q---QV------GMDTDT-SLNL--------------N----ALNQAR-GVQ--------
K9U6L7          Q---QV------GMDTDT-SLNL--------------N----ALNQAR-GVQ--------
A0A1E5QP61      S---QM------GLNPQQ-ALAI--------------N----TLSQSA-AIQ--------
U5DPF5          A---QL------GLSSAE-ALAA--------------S----ALTQSR-AVR--------
A0A6P0X488      A---KL------GLNSQQ-ALAI--------------S----SLSQSR-AVQ--------
A0A6P0UVD5      G---KL------GLNSQQ-ALAL--------------S----SLSQSR-GVQ--------
A0A6P0VDM0      G---KL------GLNSQQ-ALAL--------------S----SLSQSR-GVQ--------
A0A6M0G142      A---QL------GLNAEQ-ALAL--------------N----SLSQSR-AVQ--------
A0A6P0MR53      G---KL------GLNAQQ-ALAI--------------S----SLSQSR-AVQ--------
A0A3M2GIL5      Q---QM------GLNSAQ-AIAL--------------G----AIGESM-AVQ--------
A0A6H1TSJ9      Q---QM------GLNSAQ-AIAL--------------G----AIGESM-AVQ--------
A0A3M1PML8      G---RV------GADPRR-ATVI--------------A----ALSQSP-GVQ--------
A0A6M8BE85      G---RV------GADPRR-ATVI--------------A----ALSQSA-GVQ--------
A0A0T7BPZ0      S---QA------KIDTWQ-AVTL--------------T----ELSKEP-RTQ--------
A0A352X442      S---QV------GLNSKT-AVAV--------------N----SLNQSA-GVN--------
A0A6B3NF44      N---QL------QLNSQQ-AVAL--------------S----SLSQSP-AVQ--------
A0A6M0EPL4      N---QL------QLNSQQ-AVAL--------------S----SLSQSP-AVQ--------
A0A6P0K6L6      N---QL------QLNSQQ-AVAL--------------S----SLSQSP-AVQ--------
A0A6P0MRR9      Q---QL------DLTPEE-ALSA--------------S----FLSQST-EVK--------
A0A6P0UX57      Q---QL------GLSPEE-AVAA--------------S----TLSQST-PVK--------
A0A6P0X1X4      Q---QV------GLSPEE-AVAA--------------S----TLSQST-VVQ--------
A0A0M0SHU3      N---QA------RVNSQE-AISA--------------V----DLSQVA-GTQ--------
A0A1D2PBN3      N---QA------KIDSQQ-GVTF--------------T----SLSQTP-GIQ--------
A0A0C2LVR7      N---QA------KIDSQQ-GVTF--------------T----SLSQTP-GIQ--------
A0A1Z4PQB9      N---QA------KIDSQQ-GVTF--------------T----SLSQTP-GIQ--------
A0A1Z4SFN6      N---QG------SIDSPQ-SVTF--------------A----SLSQIP-GIQ--------
K9PGI8          K---QA------NVNSQQ-AVTL--------------A----SLSQIP-GVQ--------
K9TLQ0          G---QL------GLELEQ-AMLA--------------T----SLSDSP-RYQ--------
K9QF04          Q---QL------GIDFKQ-AVAL--------------S----VLGEDP-NYL--------
K9W1T3          Q---LF------GNDLNA-TVVA--------------A----SVGESP-TTQ--------
K9SGJ5          R---QV------GGSTDL-VLGK--------------A----ILAEDI-TYQ--------
A0A6N2JS94      R---QV------GKSPEA-AIGS--------------A----ILQQDA-PYQ--------
A0A6C2DSN4      R---QV------GKSAES-AIGG--------------A----ILQQDP-TYQ--------
L8MYT6          R---QV------GKSAES-AIGG--------------A----ILQQDP-TYQ--------
A0A352JGJ6      R---QV------GKSPDA-AISG--------------V----ILQQDT-PYQ--------
A0A1J5GLS2      R---QV------GKTPDA-AISG--------------A----ILQQDI-PYQ--------
A0A2W4W6M5      R---QV------GKSPDA-AIGG--------------A----ILQQDI-PYQ--------
A0A2W7AN33      R---QV------GKSPEA-AISS--------------A----ILQQDA-PYQ--------
A0A256BLV2      R---QV------GKSPEA-AIGS--------------A----ILQQDT-PYQ--------
A0A2W6ZXF3      R---QV------GKTPDA-AIGS--------------A----ILQQDV-PYQ--------
A0A2Z5WX66      S---QV------GKSPNA-AISS--------------A----ILQQDT-PYQ--------
Q7NEU3          E---RL------GISPGQ-ALAS--------------A----TLSKDG-PYQ--------
A0A3C0N2P0      TQLSQL------GVTPNQ-AIAS--------------S----ALSEAP-RYQ--------
A0A6P0JR04      S---QL------EVDLDT-AMTA--------------T----ALSQAP-RYQ--------
A0A6B3M6M6      T---QL------GLSTEQ-ALAA--------------A----TLSEAP-RYQ--------
A0A6P0KD09      T---QL------GLSTEQ-ALTA--------------A----TLSEAP-RYQ--------
A0A6B3NIJ0      T---QL------GLSTEQ-ALTA--------------A----TLSEAP-RYQ--------
A0A6M0F053      T---QL------GLSTEQ-ALTA--------------A----TLSEAP-RYQ--------
A0A6P2ATU9      ---GQL------DLDLNQ-AMVV--------------A----ALSEAP-RYQ--------
A0A352XE00      SQLAEL------GVSPDR-AIAA--------------S----ALSEAP-RYQ--------
A0A6P0QC14      SQLGQL------GVTPDQ-AIAA--------------T----ALSEGP-RYQ--------
B4VS56          SQLGEL------GLSPKQ-AIAA--------------S----ALSEAP-RYQ--------
A0A352AAQ3      DQLGQL------GVTPDQ-AIAA--------------A----ALSEAP-RYQ--------
A0A350Y472      TQLGQL------GVTPDG-AIAA--------------S----ALSEAP-RYQ--------
A0A355DVB4      TQLGQL------GVTPDG-AIAA--------------S----ALSEAP-RYQ--------
A0A1Z4RMB9      G---QL------GLNLNQ-AVAA--------------N----QLGASP-EVQ--------
A0A318B4H2      -------------------AVRA--------------A----SVSPNS-ASQ--------
B4WQE3          Q---EL------SRIDNE-YAST--------------S----ALAQSA-RYQ--------
A0A2K3BR24      E---QL------GLPPEQ-ALAA--------------G----ALSQSE-AVQ--------
K9YXY1          E---QL------GLPPEQ-ALAA--------------G----ALSQSE-AVQ--------
A0A1Q4RTR1      N---QL------GLNSQK-AIAL--------------N----ALSQSK-AVQ--------
A0A1Z4SQV2      N---QL------SLNSRQ-AVAL--------------N----TLSQST-AVQ--------
A0A2H2XGN1      N---QL------SLNSRQ-AVAL--------------N----TLSQST-AVQ--------
A0A433UXH8      N---QL------GFNSRT-AVAL--------------Y----SLSQST-AVQ--------
A0A0V7ZFJ4      K---QL------QLETQE-AVAI--------------S----TLNQSP-IVQ--------
A0A0V7ZNJ9      R---EL------DIEKQK-AVEL--------------S----ELSQSP-AVQ--------
A0A367RIS1      N---QL------ALNTKQ-AMAL--------------S----TLSQSR-AVQ--------
A0A235IXQ2      N---QL------ALNTQQ-AMAL--------------S----SLSQSR-AVQ--------
A0A1W5CNX3      N---QL------ALNTKQ-AMAL--------------S----SLSQSN-AVQ--------
A0A5Q0GJJ5      N---QL------ALNTKQ-AMAL--------------S----SLSQSN-AVQ--------
Q3MEB7          N---QL------ALNTKQ-AMAL--------------S----SLSQSN-AVQ--------
A0A1Z4KHN9      N---QL------ELNTKQ-AMAL--------------S----SLSQSN-AVQ--------
Q8YT70          N---QL------ELNTKQ-AMAL--------------S----SLSQSN-AVQ--------
A0A166IWU6      N---QL------ALNTQK-ATAL--------------S----TLSQSR-AVQ--------
A0A2S0Q8C0      N---QL------ALNTQK-ATAL--------------S----TLSQSR-AVQ--------
W6FSX4          N---QL------ALNTQK-ATAL--------------S----TLSQSR-AVQ--------
A0A218Q4C1      N---QL------QLNTEQ-ATAL--------------S----TLSQSR-AVQ--------
A0A6P1ZT04      N---QL------ELNTEQ-ATAL--------------S----TLSQSR-AVQ--------
A0A5P8VSD1      N---QL------ALSTQQ-AMAL--------------T----SLSQSI-AVQ--------
A0A1S1ZVW2      N---EL------QLSTQQ-AVAL--------------S----SLSQIP-GVQ--------
A0A0R0M9H9      N---EL------QLSTQQ-AVAL--------------S----NISQIP-GVQ--------
A0A7H0F4U6      N---EL------QLTTQQ-AVAL--------------S----NISQIP-GVQ--------
A0A1B7WX82      Y---EM------KLDTRQ-AVDL--------------S----TLSQSP-GVQ--------
A0A1B7WTD1      N---EM------KLTTQQ-AVDL--------------S----SLSQSP-GVQ--------
A0A480ABC0      N---EM------KLTTQQ-AVDL--------------S----SLSQSP-GVQ--------
A0A1Z4LRU5      N---QL------KLQPQQ-AVAL--------------S----SLSQSP-AVQ--------
A0A1Z4JVB4      D---QM------ALSTKQ-AVEL--------------T----TLSQSP-GIQ--------
K9PIA4          N---QI------ELNTNQ-AVAL--------------N----TLNESP-GIQ--------
A0A1Z4HVE1      N---QI------ALNTQQ-AVEL--------------S----TLSQSP-GVQ--------
A0A252ECZ1      S---QM------ALNTQQ-AVEL--------------S----TLSQSP-GIQ--------
A0A1Z4G5Y1      S---QI------ALNTQQ-AVEF--------------S----TLSQSP-GIQ--------
A0A252DNA2      S---QI------ALNTQQ-AVEL--------------S----TLSQSP-GIQ--------
A0A252E1Q4      S---QI------ALNTQQ-AVEL--------------S----TLSQSP-GIQ--------
A0A6G9SK36      N---QM------QLSSEK-AVEL--------------T----TLSQSP-AVQ--------
A0A1Z4M597      N---QM------KLNTDT-AVEL--------------T----TLSQSP-GVQ--------
A0A1Z4MWT1      N---QM------KLNTDT-AVEL--------------T----TLSQSP-GVQ--------
A0A1Z4TX53      N---QM------KLNTDT-AVEL--------------T----TLSQSP-GVQ--------
A0A2A2TNQ5      K---QL------DLTTQK-AVEL--------------S----TLSQTP-GIQ--------
A0A3S1C4K5      K---EL------ELTTQQ-AVEL--------------A----NLNQST-GVQ--------
A0A1X4G3D5      N---EL------QLNKQQ-AVLV--------------S----TLSQIP-GVQ--------
D4TNI2          N---EL------QLNKQQ-AVLV--------------S----TLSQIP-GVQ--------
A0A1Z4H6Z8      S---QM------ELNPHQ-AVEL--------------S----TLSQSP-GIQ--------
A0A1Z4NPM1      N---QL------ELNRQQ-AVEL--------------S----TLNQSQ-GVQ--------
A0A3F3KPR9      N---EL------QLTTQQ-AVAL--------------S----NISQIP-GVQ--------
D4TGN7          N---EL------QLTTQQ-AVAL--------------S----NISQIP-GVQ--------
A0A1Z4UZW9      N---EM------KLGTQQ-AVDL--------------S----SLSQSP-GVQ--------
A0A0K2M5H0      N---EM------KLGTQQ-AVDL--------------S----TLSQSP-GVQ--------
A0A1B7VSH4      N---EM------KLDRQQ-AVDL--------------S----TLSQSR-GVQ--------
A0A1B7W126      N---EM------KLDRQQ-AVDL--------------S----TLSQSR-GVQ--------
A0A3D4C6Q6      N---EM------KLDRQQ-AVDL--------------S----TLSQSR-GVQ--------
A0A1B7UVJ4      Y---EM------KLDTRQ-AVDL--------------S----TLSQSP-GVQ--------
A0A1B7UTR1      D---KM------KATTQE-AVDL--------------S----ALSQSP-GVQ--------
K7W0A4          Y---EM------KSTTQE-AVDL--------------S----ALSQSR-GVQ--------
A0A5C0DRW9      D---KM------KSTTQE-AVDL--------------S----ALSQSP-GVQ--------
A0A6H2C088      D---KM------KSTTQE-AVDL--------------S----ALSQSP-GVQ--------
A0A1U7HGH0      R---QL------GMNPQQ-AMTI--------------A----TISQSS-AIQ--------
K9XJD3          R---QL------GMTPQQ-AMTI--------------A----KISQSS-AIQ--------
K9SX01          T---RL------GFTSEQ-AIIL--------------T----KLSASK-PVQ--------
A0A4P7ZT55      R---GQ------LFSPQFQGASG--------------VSGGGGLKPAT-GADLSGALASG
A0A1E5QIR9      S---QT------GIDSQQ-AIAL--------------S----ALSQSE-GVQ--------
A0A6P1A9A0      E---QL------GLEMNE-AITA--------------S----ALSAAP-RYQ--------
A0A1Z4IBC7      A---QA------QVNSQQ-GVIA--------------S----ELSQAP-GVQ--------
A0A1W5CPC7      A---QA------QVDSQQ-GVIA--------------S----ELSQAP-GVQ--------
A0A5Q0GKD1      A---QA------QVDSQQ-GVIA--------------S----ELSQAP-GVQ--------
Q3MDC6          A---QA------QVDSQQ-GVIA--------------S----ELSQAP-GVQ--------
A0A1Z4KM73      T---QA------QVDSQQ-GVIA--------------S----ELSQAP-GVQ--------
Q8YNX7          T---QA------QVDSQQ-GVIA--------------S----ELSQAP-GVQ--------
A0A367R4K6      A---QA------QVNSQQ-GVIA--------------S----ELSQAP-GVQ--------
A0A1E2WSV8      S---EA------QVDSQQ-GVIA--------------S----DLSQAP-GVQ--------
A0A7D7L9Y1      S---EA------QVDSQQ-GVIA--------------S----DLSQAP-GVQ--------
A0A2R5FRT9      S---EA------KIDSKQ-GVIA--------------S----ELTQAP-GVQ--------
A0A2K8T1B6      S---EA------KIDSQQ-GVIA--------------S----ELTQAP-GVQ--------
A0A235I9I0      S---EA------QVDSRQ-GVIE--------------S----ELSQAP-GVQ--------
A0A2D0HQT8      S---EA------QVDSRQ-GVIE--------------S----ELSQAP-GVQ--------
A0A2L2NU95      S---EA------QVDSRQ-GVIE--------------S----ELSQAP-GVQ--------
A0A367S084      S---EA------QVDSRQ-GVIE--------------S----ELSQAP-GVQ--------
A0A1Z4SMD6      S---QL------NIAQNQPVVEI--------------A----SLNQIP-GVQ--------
A0A2H2Y096      S---QL------NIAQNQPVVEI--------------A----SLNQIP-GVQ--------
K9S8M8          R---SL------GMDARQ-AIAM--------------N----AVGESP-AVQ--------
A0A1Z4NFV0      S---QM------NISSEQ-AVDI--------------S--------TP-GVQ--------
A0A3M9ZEU1      N---QL------GMDSRQ-AALL--------------A----SLSQTP-GVQ--------
A0A1Z4JK72      D---QL------GLETGQ-AIDL--------------A----SLSQSP-GVQ--------
A0A0N7Z489      D---QL------GLELGQ-AIDL--------------A----SLSQSA-GVQ--------
A0A0S3TXS2      D---QL------GLELGQ-AIDL--------------A----SLSQSA-GVQ--------
A0A2A2TPF8      S---QL------KIKSDR-AVDV--------------A----SLSLIP-GVQ--------
A0A1Z4R0P8      S---QV------KIPSET-AVDV--------------A----SLSLIP-GVQ--------
A0A0T7BUI3      N---QI------KTVKNQ-AIEI--------------T----SLNQIP-GVQ--------
A0A1Z4LP32      S---KL------DFSTNE-AVEI--------------T----SLNQIS-GVQ--------
K9REP9          S---KL------DFSANQ-AVEI--------------T----SLNQIS-GVQ--------
A0A1Z4SIJ3      S---QL------NMQSKE-AVEV--------------A----SVSQMS-GVQ--------
A0A2H2XPG4      S---QL------NMQSKE-AVEV--------------A----SVSQMS-GVQ--------
K9V3C7          L---SA------NIPRDR-TVTQ--------------TVNVSSLSVNP-GVQ--------
A0A1Z4T6Y7      A---QI------KIPSNE-AVDR--------------T----SLSLIP-GVQ--------
A0A2H2Y561      A---QI------KIPSNE-AVDR--------------T----SLSLIP-GVQ--------
A0A1Q4S362      S---QI------KIPSSE-AVDR--------------T----SLSLIP-GVQ--------
A0A3S1CIN8      S---QI------KIPSSE-AVDR--------------T----SLSLIP-GVQ--------
A0A2A2TC28      K---QL------NLVGEE-AVNI--------------T----SLSQIP-GVQ--------
A0A0C1NCB0      N---QL------KLAGQD-AVEI--------------T----SLNQIP-GVQ--------
A0A2N6K7Q9      S---QL------NVSENQ-AVTV--------------T----SLSQIP-GVQ--------
A0A2N6MXH6      S---QL------NVSENQ-AVTV--------------T----SLSQIP-GVQ--------
A0A2N6M5A8      S---QL------NVSENQ-AVTV--------------T----SLSQIP-GVQ--------
A0A2N6LL61      S---QL------NVSENQ-AVTV--------------T----SLSQIP-GVQ--------
A0A0S3TP66      S---QL------NVSENQ-AVTV--------------T----SLSQIP-GVQ--------
G6FP91          S---QL------NVSENQ-AVTV--------------T----SLSQIP-GVQ--------
A0A1U7GYR5      S---QL------NVSENQ-AVTV--------------T----SLSQIP-GVQ--------
A0A2N6KY52      S---QL------NVSENQ-AVTV--------------T----SLSQIP-GVQ--------
A0A2N6KMP5      S---QL------NVSENQ-AVTV--------------T----SLSQIP-GVQ--------
A0A2N6MA45      S---QL------NVSENQ-AVTV--------------T----SLSQIP-GVQ--------
A0A4Q9J9V9      S---QL------NVSENQ-AVTV--------------A----SLSQIP-GVQ--------
A0A328IGA1      S---QL------NVSENQ-AVTV--------------A----SLSQIP-GVQ--------
A0A4D9CE41      S---QL------NVSENQ-AVTV--------------A----SLSQIP-GVQ--------
A0A0M0SFT2      S---QL------NVSENQ-AVTV--------------A----SLSQIP-GVQ--------
A0A1Z4TLC8      S---QL------NVSENQ-AVTV--------------A----SLSQIP-GVQ--------
A0A0C2LFH0      S---QL------NLAGSQ-AVEI--------------T----SISQIP-GVQ--------
A0A1Z4IYV4      S---QL------NLAGDQ-AVEV--------------T----SISQIP-GVQ--------
A0A1Z4Q0T6      S---QL------NLAGDQ-AVEV--------------T----SISQIP-GVQ--------
A0A0C2PT44      T---QL------NLAGDQ-AVEV--------------A----SISQIP-GVQ--------
A0A1D2P6J4      T---QL------NLAGDQ-AVEV--------------T----SISQIP-GVQ--------
B4WP72          R---QL------GMELET-AIEL--------------N----TLSQSP-GVQ--------
A0A2T1CIL7      S---QL------NISWEE-AVAI--------------S----SLSQS--AVP--------
A0A433V7A0      S---QI------GMSVQD-ALAR--------------S----TLSQSA-GVQ--------
A0A2T1FTR8      N---LFG-----GRDAQA-TIQS--------------G----LVSESP-GLQ--------
K9UA41          N---LFG-----GRDAQA-TIQS--------------G----LVSESP-GLQ--------
A0A0C2LBE2      N---QA------KIDSQQ-TVTN--------------S----SLTQAS-GIQ--------
A0A433NN38      E---QI------EVESQK-AITY--------------A----ELSQIP-GTQ--------
A0A2N6K0T2      T---QA------RVNSQE-AVSA--------------V----NLSQVP-GTQ--------
A0A2N6ML72      T---QA------RVNSQE-AVSA--------------V----DLSQVP-GTQ--------
G6FQZ6          T---QA------RVNSQE-AVSA--------------V----DLSQVP-GTQ--------
A0A2N6MQX9      T---QA------RVNSQE-AVSA--------------V----DLSQVP-GTQ--------
A0A2N6KXT6      T---QA------RVNSQE-AVSA--------------V----DLSQVP-GTQ--------
A0A2N6KGB9      T---QA------RVNSQE-AVSA--------------V----DLSQVP-GTQ--------
A0A2N6L3Y5      T---QA------RVNSQE-AVSA--------------V----DLSQVP-GTQ--------
A0A0S3TIS7      T---QA------RVNSQE-AVSA--------------V----DLSQVP-GTQ--------
A0A1U7GW28      T---QA------RVNSQE-AVSA--------------V----DLSQVP-GTQ--------
A0A2N6LW63      T---QA------RVNSQE-AVSA--------------V----DLSQVP-GTQ--------
A0A328IH74      N---QA------RVSSQE-AVSA--------------V----DLSQVA-GTQ--------
A0A4D9CIB0      N---QA------RVSSQE-AVSA--------------V----DLSQVA-GTQ--------
A0A1Z4TQ63      N---QA------RVNSQE-AVSA--------------V----DLSQVA-GTQ--------
A0A4Q9J8G2      N---QA------RVNSQE-AVSA--------------V----DLSQVA-GTQ--------
A0A350Y0P6      D---KL------GLNSQQ-AIAL--------------N----KLNQSR-AVQ--------
A0A352X940      N---QL------NLNENE-AVAL--------------N----SLSQSR-AVQ--------
B8HTN4          Q---QV------GMSIDL-ARFS--------------N----AVSQSK-GVQ--------
A0A6P1AFJ5      A---QL------ELDLDQ-AVTI--------------S----ALSAAP-RYQ--------
B0CAX4          N---KL------GLTPQQ-GEDI--------------N----ALSQST-VVQ--------
A0A1Z4RN12      S---QL------GMNWRE-ASAV--------------S----ALSQSP-GVQ--------
A0A2T1CMF9      S---QL------GVSWQE-ASAI--------------S----SLSQSI-SLQ--------
Q7NDC5          A---RMG-----GLSEPE-ALVA--------------G----ALSGSD-GMR--------
U5QGK3          S---RMG-----GLSEKE-ALVA--------------G----ALSSSD-GMS--------
A0A2W4UY24      Q---QL------RLNPQE-AYAV--------------G----LVSESP-GVQ--------
A0A0D8ZUV2      Q---QV------GMSSAQ-AVAT--------------N----SLNQAG-GIQ--------
A0A433VDI0      K---KV------GMSSEQ-AIAT--------------N----SLNQSS-GVQ--------
A0A3D1PG43      K---EI------GINSSD-IIAV--------------N----SLNQPAGGAQ--------
A0A2P8QQ72      K---EI------ALTSQD-VVPI--------------N----SLKESP-GIQ--------
K9TZQ7          K---EI------ALTSQD-VVPI--------------N----SLKESP-GIQ--------
A0A6N8G584      Q---QV------GMNPQE-GITL--------------T----SLNQSP-GIQ--------
A0A2G7GPR0      Q---QV------GMNPQE-GITL--------------T----SLNQSP-GIQ--------
K9XH68          Q---QV------GMNPQE-GITL--------------T----ALNQSP-GIQ--------
A0A1U7HW70      Q---QV------GMNPQE-GITL--------------T----ALNQSP-GIQ--------
A0A2S6VEJ8      Q---QV------GMNPQE-GITL--------------T----ALNQSP-GIQ--------
A0A140KBA0      S---QL------GMNVSE-AAAI--------------S----SLNQSV-AVQ--------
K9XSG1          S---QL------GMGVSE-AAAI--------------S----SLNQSV-AVQ--------
A0A2T1GMT4      K---KV------NLNSQD-ALAV--------------S----AISQSP-AIQ--------
K9UI51          K---KV------NLNSQD-ALAV--------------S----AISQSP-AIQ--------
A0A1Z4QL41      Q---KI------GLNSQQ-AIVV--------------S----SLSNSP-AIQ--------
A0A2T1FXY4      Q---KV------GLNPQQ-ASAV--------------S----ALSQSP-AVQ--------
K9TYI2          Q---KV------GLNPQQ-ASTV--------------S----ALSQSP-AVQ--------
A0A252D4T4      Q---KV------ALSSQE-ALSA--------------S----TLSQSP-AVQ--------
A0A252DJH5      Q---KV------ALSSQE-ALSA--------------S----TLSQSP-AVQ--------
A0A252EB80      Q---KV------ALSSQE-ALSA--------------S----TLSQSP-GVQ--------
A0A6G9SKZ9      Q---KV------NLNSQE-ALSA--------------S----AVSQSP-AVQ--------
A0A1Z4HPW5      Q---KV------NLNSQE-ALSA--------------S----AVSQSP-AVQ--------
A0A1Z4MSN1      Q---KV------NLNSQE-ALSA--------------S----AVSQSP-AVQ--------
A0A1Z4U1C2      Q---KV------NLNSQE-ALSA--------------S----AVSQSP-AVQ--------
A0A0D6KV51      Q---KV------NLNSQE-ALSA--------------S----AVSQSP-AVQ--------
A0A1Z4MKF8      Q---KV------NLNSQE-ALSA--------------S----AVSQSP-AVQ--------
A0A2C6WC43      Q---KV------NLSSQN-AIAV--------------S----ALSQSP-AVQ--------
A0A1Z4L5A1      Q---KV------NLSSQN-AIAV--------------S----ALSQSP-AVQ--------
A0A367QD86      Q---KV------NLSSQN-AIAV--------------S----ALSQSP-GVQ--------
A0A2K8SM78      Q---KV------ELNSQE-AIAV--------------S----ALSQSP-AVQ--------
A0A2R5FPC0      Q---KV------ELNSQE-AIAV--------------S----ALSQSP-AVQ--------
A0A5P8W5T6      Q---KV------ELNSQE-AIAV--------------S----ALSQSP-AVQ--------
A0A7D7LDT7      Q---KV------ELNSQE-AIAV--------------S----ALSQSP-AVQ--------
A0A235IZ96      Q---KV------ELNSQQ-AIAV--------------S----ALSQSP-AVQ--------
A0A2L2NGP0      Q---KV------ELNSQQ-AIAV--------------S----ALSQSP-AVQ--------
K9QM62          K---KV------GLDSPQ-AIAM--------------S----TLSQSP-AVQ--------
A0A1Z4FWI3      Q---KV------ALNSQQ-ALSA--------------S----AVSQSP-AVQ--------
A0A1Z4JYE7      Q---QL------GLTTQQ-AIAV--------------T----TLSQSP-AVQ--------
A0A0F5YE28      T---QA------GFDLEE-AIAI--------------N----TLSQSP-VLI--------
U7QEH7          T---QA------GFDLEE-AIAI--------------N----TLSQSP-VLI--------
A0A3S1ATK5      Q---KI------ALNSQQ-AIAV--------------S----SLNNSP-AIR--------
A0A2Z6CPH0      Q---KL------GLNSQN-ALAV--------------S----ALSQSP-AVQ--------
A0A1Z4GT50      Q---KV------NLNSPE-AITV--------------M----AISQSP-AIQ--------
A0A1Z4GIX0      Q---KI------NLNSQQ-AIAV--------------S----TLSQSP-AVQ--------
A0A2H6LC24      Q---KI------NLNSQQ-AIAV--------------S----TLSQSP-AVQ--------
B2J6N5          Q---KV------ELNSQE-AIAV--------------S----ALSQSP-AVQ--------
A0A367RMI4      Q---KV------ELNSQE-AIAV--------------S----ALSQSP-AVQ--------
A0A235HUM0      K---KV------ELNSQE-AIAV--------------S----ALSQSP-AVQ--------
A0A2L2NW47      Q---KV------ELNSQE-AIAV--------------S----ALSQSP-AVQ--------
A0A1E2WUR1      Q---KV------ELNSQE-AIAV--------------S----ALSQSP-AVQ--------
A0A235IKU3      Q---KV------ELNSQQ-AIAV--------------S----ALSQSP-AVQ--------
A0A1U7MYU6      N---QV------GLNPQQ-AIAI--------------S----ALSQST-SVQ--------
A0A1D8TNX9      N---QV------GLNPQQ-AIAI--------------S----ALSQST-SVQ--------
A0A6P0L6C2      N---QV------GLNPQQ-AIAI--------------S----ALSQST-SVQ--------
A0A6P0MVH0      N---QV------GLNPQQ-AIAI--------------S----ALSQST-SVQ--------
A0A6P0KJV0      N---QV------GLNPQQ-AIAI--------------S----ALSQST-SVQ--------
A0A6L9ZJG4      N---QV------GLNPQQ-AIAI--------------S----ALSQST-SVQ--------
F4XKF3          N---QV------GLNPQQ-AIAI--------------S----ALSQST-SVQ--------
A0A1D9FX10      N---QV------GLNPQQ-AIAI--------------S----ALSQST-SVQ--------
A0A6P0Q0T0      N---QV------GLNPQQ-AIAI--------------S----ALSQST-SVQ--------
A0A6P0W5I0      N---QV------GLNPQQ-AIAI--------------S----ALSQST-SVQ--------
A0A3C0NJ41      N---KV------GMNSQE-AINT--------------T----ALSQSA-GVQ--------
A0A352AG88      D---QV------GMNSQE-AIVA--------------S----SLSQSP-GVQ--------
A0A350Y374      D---KV------GMDAQE-AIAI--------------T----SLNQSP-GVQ--------
A0A355DPX0      D---KV------GMDAQQ-AIAI--------------T----SLNQSP-GVQ--------
                                                                            

K9SLA9          ---QLLE--ELQAIEQQIALES----TRYGAEHPSIIDLRAQREALQVVLQGRVGEDLLE
A0A168TT23      ---ELRS--RKAELETEISGLL----QRFMEDYPVIVELRSQINEIDTQIRERADTIIGN
A0A0M1JWX9      ---SQLS--KLRELENQIAKEL----TRFTINSPQIQTMLEQRQQLEGMLSQEAQRALGR
A0A2T1M1V6      ---SIRD--KLSATEIELSESR----GIYTDKMPQVKSLLLKRDELRREANRQMAQVLPG
A0A2G7GCS2      ---AIRQ--KLSDAETALAEAR----SRYTDESPQVQSLLSQRDELMQIMNQQIAIAAPG
K9XBH8          ---ATRQ--QLSEVETALAEAR----SRYTDESPQVQSLLARRQQLMQTMNQQLAVALPN
A0A1Z4LJ30      ---LFRD--KLSEVEVALVEAR----GKLTNSHPQIQELVYQQRVLRSQLRQYLANTSS-
K9RI76          ---LIRD--KLSQIEVALIEAQ----GKLTSNHPEVQNLLYQRSVLRQQLNQFIAASRAN
A0A352AE27      ---FIRQ--KLTEVEAKLVEAK----ATYTMENPRVEGLVIQRDELQRQLQQYITQAAGD
A0A3B8JH60      ---FVRNXXKLAEVNANLIRTR----ATFTDNHPTVQKLISERDDLQRQLQGYIAQSAAG
A0A3C0N766      ---FVRN--KLAEVNANLIRTR----ATFTDNHPTVQKLISERDDLQRQLQGYIAQSAAG
K9W9J7          ---FVRN--KLAEVDANLVKLR----ATFTDNHPAVRKLISERDELQRQLQGYVAQAAAG
A0A139WSU3      ---FVRQ--QLSEVEASLRQKQ----AIFTDVHPEVKTLLAQRESLQRKIQEHIRQTSAG
A0A433VN22      ---AVRK--ELSEVEAKLVQKQ----AIFTINHPEVQTLLAQRSTLRRQIGAYITQVAGN
Q7NF11          ---AMRL--KLSSLDTALAEAR----GLYTEKHARVQSLLVQREELQRSLRELLAKVVPA
A0A1Z4JCS8      ---ELRS--KLTEVESTLGKLR----STFTDRSPQVQRAIVERDTLRNQLQQYV-GQAAG
A0A6P0PI80      ---FVRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLLQREQLQQQIQQYI-FLAAG
A0A6P0WGT6      ---FVRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLLQREQLQQQIQQYI-FLAAG
F4XTX2          ---FVRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLLQREQLQQQIQQYI-FLAAG
Q7NJN6          ---ALRQ--RLADIESQLAQAR----GLYTGKNLRVKSLELQREELLGKIKQQVGSIVPD
U5QCC3          ---SLRQ--KLTDIETQLAQAR----GIYTEKNQRIQSLLLQREELLSKIKLQLSKLVPD
A0A0S3TYD7      ---ETLK--RSQELQNQLAVTL----GRYRAGHPKVTELQRQVSELQELLQQRVATVVGQ
A0A2T1DNG3      ---AVLN--EIQKTELAIQQQR----VRFKENTLNMQPLLDQRQRQLKQLQLEASRLLGS
A0A3S0Y9N9      ---LVLG--QLKETQQKIEMAR----LRLTDNHPTVINLKEQETVLKQELKRHIEQSFIG
A0A433UNK7      ---AVLG--QLQDVQQKIQVIG----LRLTDTHPTIMDLKKEEVILRQELKKRIEQSFIG
A0A6P0ZKB8      ---EVLG--KLQNLQQRIAVTS----LRLTDDHPTMIDLKKEEIILREELEERIEQSFIG
U5QL42          ---RLVS--KYKDAEADYVSQR----AKFKDAYKPVGDLKKQRDIYLRLLQEQATSVLGS
A0A140K3H3      ---SLAS--QLKELETQYALGS----VNFYDSYHVMEDIKLKQAELRTLMQERSQQILGD
K9XUB8          ---NLTS--RLKELESQYGLGS----VNFHDSYHVMEEFKLKQVELRKLMKERAQQILGD
A0A6H2NHD5      ---RLLS--DLRQVEQSIASEL----ARFQADTPMVEALEDQRQQLLPLLETEANRVLAA
A0A2P8W4F7      ---ALLG--DLRELEQTIAAES----ARFQTDTPMIEALEDQRQQLLPLLEAEAQRLVGE
A0A5Q4E0Z4      ---SLLG--DLRAIEQTIAAES----ARFQSDTPMIGALEDQRQQLLPLLAAEAQRLVGS
A0A2P8VVX1      ---SLLN--SLQEAELALADRQ----ILFTDEDPNVQVLKQQRENQLAQLRAEISAISRQ
A0A2P8WHY0      ---QLLN--DIQESELALADRQ----LIFTDQDATVQMLRQELDNNRKQLRQEIAAAIRR
A0A2T1CMT9      ---NLLN--NLKQMEQDLATQQ----TKFTNYNPALKSAIEEKKILQDLLSEEAERILGE
A0A7G8J1V5      ---GLLE--QLAQVENELAEAR----AKFNPNSSMVTSLEERLNQLKPLLRS--------
A0A354B169      ---SLLQ--LLLKVESELAAAR----SKYKPSSSMVQGIEARQRQLQPMLLR--------
Q0IDT5          ---SLLQ--QLLKVETELAEAR----SKFVNNSSMVLSLEARLEQLQPLLRE--------
A0A7G8FZD9      ---SLLQ--QLLKVETELAEAR----STYLPSSSMVMGLEERINQLKPLLLK--------
G4FMX5          ---SLLQ--QLLKVETELAEAR----STYKPNSSMVTGLEERINQLKPLLLR--------
A0A7G8FAU7      ---SLLQ--QLLKVETELAEAR----AKYNPNSSMVLSLEARLNQLQPLLRQ--------
A3ZA21          ---SLLQ--QLLKVETELAEAR----AKYNPNSSMVLSLEARLNQLQPLLRQ--------
A0A076HBF2      ---SLLQ--QLLKVETELAEAR----SRYNPGSSMVLGLEERLNQLRPLLRQ--------
A0A7G8FP50      ---SLLQ--QLLKVETELAGAR----SRYTPGSSMVQGLEERLKQLRPLLRQ--------
A0A7G8E8K7      ---SLLQ--QLLKVETELAEAR----SRYTPGSSMVRGLEERLNQLRPLLRQ--------
A0A7G8GAH0      ---SLLQ--QLLKVETELAEAR----SRYNPGSSMVLGLEERLNQLRPLLRL--------
A0A7G8GNR2      ---SLLQ--QLLKVETELAEAR----SRYNPGSSMVLGLEERLNQLRPLLRQ--------
A0A7G8ICD3      ---SLLQ--QLLKVETELAEAR----SRYNPGSSMVIGLEERLNQLRPLLRQ--------
A0A2D6FCW3      ---SLLQ--QLLKVETELAEAR----AKYNPDSSMVRGLEARLNQLQPLLRK--------
A0A7G7KJ95      ---SLLQ--QLLKVETELAEAR----SKYNPDSSMVQGLEARLNQLKPLLRK--------
A0A7G8EAN3      ---SLLQ--QLLKVETELAEAR----SKYNPDSSMVQGLEARLNQLKPLLRK--------
A0A563VQJ3      ---STLT--ELSDTEAAIAKER----QRFKDNHPSIVSLQEKKANLRQQLEQSIAETVGI
A0A1D8TX52      ---NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQ
A0A1D9G4T2      ---NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQ
A0A6P0PR27      ---NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVLGQ
A0A6P0WER7      ---NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVLGQ
F4XP71          ---NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVLGQ
A0A6L9YR57      ---NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQ
A0A6P0KZ31      ---NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQ
A0A6P0LPB8      ---NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQ
A0A6P0SEV1      ---NLLN--EIQRIELALVEQS----RIYTEAHPTIQKLIEQRQSVFALLQEETRRVLGQ
A0A6B3N2I8      ---NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQ
A0A6M0B891      ---NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQ
A0A6P0IJQ1      ---NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQ
A0A6P0J8J8      ---NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQ
A0A6P0ZSH6      ---NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQ
A0A1U7N5X9      ---NLLN--EIQRIELALVEQS----RIYTEAHPTIQKLIEQRQSVFALLQEETRRVLGQ
A0A6L9Z1V0      ---NLLN--EIQRIELALVEQS----RIYTEAHPTIQKLIEQRQSVFALLQEETRRVLGQ
A0A6P0LC12      ---NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQ
A0A6P0MVJ3      ---NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLGQ
A0A2W6ZAV2      ---SLLG--DLTDLEKQLAEAE----ASFSPTSPQVRSLRSRVNQLRPLLQRR-------
K9W742          ---SLLD--EIQKTDLALAEQR----KRFTDDNPTIQKLLFQRQQQLALLEKEGERAVGK
A0A3D1PBA3      ---TLLN--ELQKTELALSQRR----VTFTDEDPQVKKLLEQRQNTIEMLKSEGGRVVGK
K9XPB0          ---SLLN--KLQQIEIELADKQ----ARFTDDNPVVKDLLAQKNTQTTLLLQEVKKILGA
A0A350Y7Z1      ---ALLN--ELQKTELAIAQQR----VKFTDAEPRVEQLLEQRQRQLALLQEEAQRVLGE
A0A352X2A7      ---SLLD--ELQKTELALAERR----TRFTDADPSVQKLMEQQSRQYRMLQEEGERVLGR
A0A0D8ZYV0      ---SLLN--ELQRTDLLLAARR----GTFTDADPGVQKLIELRQSQQALLQAEQARVVGA
A0A2T1FP73      ---TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVLGE
A0A433VMS2      ---TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVLGE
K9TYA7          ---TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVLGE
A0A2P8QUE1      ---TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVLGE
K9SA61          ---ALLN--EIQKTEIELAQQR----LRFKDASPYVQQVIDKRQRQLALLQQEAQRVLSS
A0A2G7GMH8      ---NLLN--EIQKTELALAQQR----LRYTDSSPQVELLLSQRDTQRELLQQEMQTVVGE
A0A6N8FU92      ---NLLN--EIQKTELALAQER----LRYNDSSPQVELLIEQREKQHQLVQEEMQRVLGE
A0A2T1DWE8      ---SLLN--EIQKSELAIAQQR----LRFKAASPYVQQAIDQRQRQRDLLAAEVQRILGN
A0A1U7I8L3      ---TLLS--EIQKIELELAKER----QRFTDSNPVIQNLLEQRQSQLALLQKEQQLVQGN
A0A2T1DJL8      ---ALLN--EIQKTEVAIVQQR----LRFK-KGPFIDQLSEQRQKQQALLQQEVQRILGA
A0A1Z4J9W0      ---ALLA--EIQKTEVELAQMQ----TKFTSNTPQVQQLAEQRQRQVSLLQQEAQRILGS
A0A0N7Z5K9      ---ALLA--EIQKTEVALAQQQ----TRFTSKTPFVQQLLDQRQRQVALLQQEAQRVLGA
A0A0S3TXC5      ---ALLA--EIQKTEVALAQQQ----TRFTAKTPFVQQLLDQRERQVALLQQEAQRVLGS
B8HNB0          ---KLTT--RLQEVELSLAQQS----LTLQNNHPTIENLRAERADLLKLMRQRANGLL--
A0A563VS48      ---TIYE--RLQQVKVELASTR----NYLSNNAPQVISLQEEAAELEQVLNQEIAQTLGG
A0A318BJ18      ---QAIN--NLRQRRAELSAEYQRLMVQFEPGYPAALAIQNQIDQLDRSIAREESRV---
A0A3B8Y8H9      ---NLLE--KLREVDTKLAEES----TRFTEDNPTIKKLRQQRRNLVPLIEEEAQAIL-G
A0A2W1JVB9      ---VVLQ--QLQEVEGQLAVEG----TRLTPENPILQDLQEQASTLRATLQNRVGEAL-G
A0A3M1SVZ4      ---EARQ--QLQEAEAQLAVEK----TRLTENHPTIIDLQDKVATLRSMLQSRVGDVS-G
A0A6H1U102      ---QLAS--QLKAVEAKYMEER----ARFHDTHPVVKNLQMQRDNLFNLLQYRSARVL-G
A0A7C3ZEJ3      ---QLAT--QLKEIEAKYTEES----SRFYDTHPVVQNLLRQRESMRQLLQYRSQRVL-G
A0A563VLD6      ---KLAT--QLSGLETQYLLNS----TNFKDTFPIMQDLKDKGQELQELLRERATQVL-G
A0A2P8W9H0      ---ALLN--QLLEVDSQLAADL----TLYLENSPEIEVVESRRENLQPLIEREGLRVQR-
A0A6I5P386      ---SLLD--RLTEIDSRLAEEL----SLYLEGSPEIEVIRDYRDNLQPLIEKEGVRVQD-
A0A654SFI6      ---SLRA--DLAKAEAQLATLN----ANYGPMYPPLVEKAAEVASLRASLGGEARAAL--
A0A318BG22      ---ALTG--QLATLEADYQQKR----QTYKPGYAPMEALAAQIASVRGQIATLRGRIVGG
K9SSQ0          ---ALVK--QFQEAQTNYFLER----ARFQDAYPKVQALRDRRDQIYNLMQAQAQAIL--
A0A2W1JIN9      ---NLKS--AVTNLESQVAARR----TELTDSHPIVIQLVQELDAARTLYNQRLSQL---
A0A318AJV1      ---DLRS--QRADIVRNLGEVE----GRYGPKHPESIRAHQQLADIDQQIRDEAQRVVG-
A0A6P0IC70      ---KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIAP-
A0A6B3MUB5      ---KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIAP-
A0A6M0B7N4      ---KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIAP-
A0A6P0J9W3      ---KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIAP-
A0A6P0ZWE1      ---KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIAP-
A0A1U7N2U4      ---ALRA--QLVNLERELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLLPT
A0A1D9G1F2      ---ALRA--QLVELDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLLP-
A0A6P0PNZ7      ---ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLLP-
F4XV38          ---ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLLP-
A0A6P0W137      ---ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLLP-
A0A6L9Y9E2      ---ALRA--QLVDLDRELAKMR----SRLTDQNPAVISLVQERYELLALYNQKLSRLLPT
A0A6P0SGR0      ---ALRA--QLVDLERELAKMR----SRLTDQNPAMISLVQERYELLALYNQKLSRLLPT
A0A6M0BK48      ---ALRA--QLVDLDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLLPT
A0A6L9YZL1      ---ALRA--QLVNLERELAKAR----SRLTDQNPAVISLVQERYELLGLYNQKLSRLLPT
A0A6P0KYM4      ---ALRA--QLVDLDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLLPT
A0A6P0LSD6      ---ALRA--QLVDLDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLLPT
A0A6P0X384      ---NLRT--KLAELDEQLTAAR----SRFTDENPTVISLLEEQEALLALYEEKVARLLP-
A0A2P8QIL5      ---ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET--
A0A2T1FLY5      ---ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET--
A0A433W447      ---ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET--
K9U1K8          ---ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET--
K9UYB2          ---KLRA--KLAESETKLIEAR----LKFTESNPIVIQLSEERDALRNLYSQGLNRVSP-
A0A218QN17      ---TLRA--KLTELNTKLIEAR----LRLTENHPSVIALVEQRDKVNKLYTEQLAIVSP-
K9RKN2          ---KMRA--NLAELEREFVEAR----LRFTFNHPKLIELSQKRNAFRQMYEQQLANVSN-
A0A2I8ADV2      ---SLRA--KLTEIETQLIEAR----LQFTDNHPKVVSLLGQREQIRALYAQQVGRVSA-
A0A1W5CKM3      ---VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQQRDEIRALYGQQMARVSS-
A0A5Q0GMF5      ---VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQQRDEIRALYGQQMARVSS-
Q3MEW0          ---VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQQRDEIRALYGQQMARVSS-
A0A1Z4KIC7      ---VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVEQRNEIRALYGQQMARVSS-
Q8YSM5          ---VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVEQRNEIRALYGQQMARVSS-
A0A1Q4S1H4      ---NLRA--RLTELETQIVALQ----QRFTPEHPELNSLIQQRDTLRAMYQQELARISN-
A0A433VBU6      ---NLRV--KLTELQTQIVALQ----QRFTPEHPELNSLIQQRDTLRAVYQQELARVSS-
A0A1Q4RZJ6      ---KLRA--KLAEQETQLIEAR----LKFTDSHPTVVKMLQQRDALRSLYAQELSRVAP-
A0A1Z4SNV3      ---KLRA--KLADQETLLIEAR----LRFTDSHPTVAKLLQQRDALRSLYAQQLARVAP-
A0A2H2XJQ1      ---KLRA--KLADQETLLIEAR----LRFTDSHPTVAKLLQQRDALRSLYAQQLARVAP-
A0A3S5K358      ---KLRA--KLAEQETQLIEAR----LKFTDSHPTVVKMLQQRDALRNLYAQELSRVAP-
A0A0T7BPJ4      ---KLRS--KLTELEQQVIQAK----LKFTEEHPTVTKLVQERDAVKAMYEQEVARVSP-
A0A0C1QS61      ---ELRT--KLTELETKLAESR----AKYTEDHPDVRSLLYQRNTIRNLYIQGLNRVSS-
A0A139X3R8      ---ELRT--KLTEFETKLAESR----AKYTENHPDVQSLLYQRNSVRNLYIQGLNRISS-
A0A1Z4I7C5      ---ALRT--KLTDIETKLIEAR----TKFKEAHPTVVDLVQQRDEIKALYGQQMARVSS-
A0A0C2MDK7      ---KLRA--KLSELENKIIEAR----LRFTENHPVVANLVGERDALRKVLSEQLARVST-
A0A1Y0RCK1      ---KLRA--KLSELENKIIEAR----LRFTEEHPNVRNLVGERDALRAIYSEQLARVSS-
A0A1Z4PWZ0      ---KLRA--KLSELENKIIEAR----LRFTEEHPTVTNLVGERDALRAIYSEQVARVSP-
A0A0C2QLT0      ---KLRA--NLSELENKIVEAR----LRFTDEHPNVTNLVGQRDALRAMYSEQLARVSS-
A0A1Z4J2K1      ---KLRA--KLSDVENQLIEAR----LRFTDEHPNVTNLVGERDALRAMYSEQVARVSP-
A0A3S0ZSX0      ---MLRA--KLAELEAKVIETR----LYFTENHPTVIKLVEQRDGLRAFYQKELARVSP-
A0A2N6K4T3      ---ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVSP-
A0A370CKT2      ---ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVSP-
A0A0S3TL97      ---ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVSP-
A0A2N6M8A0      ---ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVSP-
A0A2N6M9E1      ---ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVSP-
A0A2N6KJI4      ---ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVSP-
A0A2N6MZ77      ---ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVSP-
A0A2N6KT20      ---ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVSP-
G6FSN3          ---ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVSP-
A0A4D9CI02      ---ALRT--KLAEIETNLVEAR----LSLTDSHPTVMNLLGQRNGLRALYFQGLARVSP-
A0A328I8B9      ---ALRT--KLAEIETKLVQAR----LSLTDSHPTVMNLLGQRNGLRALYFQGLARVSP-
A0A4Q9J4Z7      ---ALRT--KLAEIETKLVQAR----LSLTDSHPTVMNLLGQRNGLRALYFQGLARVSP-
A0A0M0SU69      ---ALRT--KLAEIETKLVQAR----LSLTDSHPTVINMLGQRNGLRALYFQGLARVSP-
A0A1Z4TIZ8      ---ALRN--KLAEIETKLIQAR----LYLTESHPTVINLLGQRNGLRGLYLQGLARVSP-
A0A2T1E9V8      ---GVIK--ELQEVQRKLANAR----SLYKDDHPIIVQFKEKEAQLNILLNSETTRILQG
A0A1Z4LN32      ---EVLS--ELQKVQTELTTLK----TRMTNAHPSILDLQDKEAALNNLLQTRIMESV-G
A0A2I8A9F5      ---DAFI--ELQKIQTQLKIQQ----TRYTDANPIVINLKNQEKALNSLLKQRITEYL-G
A0A218Q6R8      ---EVLG--ELQKVQTNLAIQQ----TRYTDQNPHIANLKNQEAALASLLQQRITESL-G
A0A218QGE0      ---GLLA--ELQKVETQLAALK----ARYTERHPAIVDLESQKANINSLLQQQISQSL-G
A0A3M2GQQ6      ---QLAS--ELKAVEAQYTLEA----SRFYETHPVVKNLAIQRDNLFRQLQQRSRRVL-G
A0A6H1U2X0      ---QLAS--ELKAVEAQYTLEA----SRFYETHPVVKNLAIQRDNLFRQLQQRSRRVL-G
K1XF69          ---AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL-G
B5W297          ---AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL-G
A0A6H2AL05      ---AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL-G
H1W7M8          ---AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL-G
A0A5Q4H6A5      ---SALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLESLLQREIQVYL-G
D5A466          ---SALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLESLLQREIQVYL-G
U5QJM6          ---DVLK--QYQDTETQLALEK----TRFRDDYPTVQNLKDKRDSLQKRLNEQAGVLL-G
A0A1Z4RPC6      ---SILD--QLATTETELAQER----QRFNDNHPTVISLNDKKQALNSQLQQLITQYV-G
A0A2T1CMZ0      ---SILD--QLSTTETELSQER----QRFKDNHPAVISLQEKKQNLNSQLQGLISQYV-G
L8M4F7          ---SIID--EMTRTENQLIQER----RRFKEDHPNIVSLQGKKAALNRQLQSLMSQTI-G
A0A140K2P2      ---GLLK--EMATVESELAKEK----QRFLDNHPSIQSLEEKKASLNKELKDLISQNV-G
K9XWX4          ---GLLK--EMATVESELAKER----QRFLDNHPSIKSLEEKKASLNQELKNLISQNV-G
A0A140KB14      ---SIFK--DLADVETELAQQR----QRFRDNHPMIQSLLEKKQDLNQKLQGLITETV-G
K9XX88          ---SIFK--DLADVETELAQQR----QRFRDNHPMVQSLLEKRQDLNQKLEGLITETV-G
A0A563VSV6      ---SILT--ELGNTEIELAQER----QRFKDSHPSISSLLEKKANLRQDIEQQVAQAV-G
L8LZE9          ---SIVT--ELGNTESQLSQER----QRFNDNHPEIVSLLDTKASLRRELQQQIAQKV-G
A0A433NM31      ---KALA--DYQEVESKLANER----SRYQENTPVIADLKLKQASLREVLEKRVQQVF-K
A0A1Z4NDS1      ---KVLS--QLQEVQSQLALQQ----TRFHPEHPSIQDLQARVATLQNLLQQRINQVD-G
U9VXM0          ---NALE--QLQTVQSDLALAR----TRYREEHPEIVTLRNQESSLQALLQQRLDITL-G
A0A6M0RI13      ---TVLA--QLQTVQSDLTLAR----TRYRDEHPEIITLRNQEAGLQALLQERLDVTL-G
A0A6M0S1N5      ---TVLA--QLQTVQSDLTLAR----TRYRDEHPEIITLRNQEAGLQALLQERLDVTL-G
K9F4D9          ---TVLE--QLQTVQSDLTLAR----TRYRDEHPEIITLRNQEAGLQALLQERLDVTL-G
A0A6I5QPI5      ---EALS--QLQQVQTQLSNER----ARYREGHPAIERLELQQAEIEALLSDRIQEVL-G
A0A1Z3HMQ0      ---RILE--DLQAVQTELASQR----SRYTASHPLIANLEREQASLQTLLNRRVGEVL-G
A0A433W533      ---RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV-G
A0A2P8QWJ3      ---RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV-G
A0A2T1FKP8      ---RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV-G
K9U6L7          ---RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV-G
A0A1E5QP61      ---QVLT--EYQKVQDQLAVQR----TRYQSQHPIITNLERREAALSDLLQERVAQVL-G
U5DPF5          ---DALE--SYQSIESELAVAE----SRYQPQHPAIVSLVESRDALRQVLNERIQTVL-S
A0A6P0X488      ---QVLL--EVEQIEDQLNVQR----TRYEEKHPVIVNLKDRKAAREALLGERVEQVL-G
A0A6P0UVD5      ---QALL--EVEQIEDQLNVQR----TRYEEKHPVIVNLKDRKAAREILLAERVEQVL-G
A0A6P0VDM0      ---QALL--EVEQIEDQLNVQR----TRYEEKHPVIVNLKDRKAAREILLAERVEQVL-G
A0A6M0G142      ---QVLL--EVEQIEEQLNVQR----TRYEEKHPVIVNLKDRKAARTGLLGDRIEQVL-G
A0A6P0MR53      ---QVLL--EVEQIQEQLNVQR----TRYEEKHPVIVNLRDRKAAREALLGERVEQVL-G
A0A3M2GIL5      ---NLFR--ELQQVENDLAVQR----TRYQSKHPIIANLTRKRVSLQALLQERIRDIL-G
A0A6H1TSJ9      ---NLFR--ELQQVENDLAVQR----TRYQSKHPIIANLTRKRVSLQALLQERIRDIL-G
A0A3M1PML8      ---EALT--QLQLAQQELAVER----TRYTEDHPAIANLQRRVRSLEDMLQSRAVSVA-K
A0A6M8BE85      ---EALT--QLQAAQQELAVER----TRYTEDHPAIANLQRRVQSLEELLRNRAVSVA-R
A0A0T7BPZ0      ---QMLT--QLREAETKLAVEQ----NRYLPGHPTLVNLQEQIASLKKLLQQRIKQVA-G
A0A352X442      ---QALA--ELQKVQSQLAVER----GRFLEEAPIVQKLKEQETKLQTLVNQRIGENL-G
A0A6B3NF44      ---QALT--QLQEVQAELAVER----TRYKEGYPTIENLKRKEAALETLVQKQVAQVL-G
A0A6M0EPL4      ---QALT--QLQEVQAELAVER----TRYKEGYPTIENLKRKEAALETLVQKQVAQVL-G
A0A6P0K6L6      ---QALT--QLQEVQAELAVER----TRYKEGYPTIENLKRKEAALETLVQKQVAQVL-G
A0A6P0MRR9      ---NIRI--QLQKVISQLEIER----ARYKPGHPTVKNLERQAANLRILLKEKIRLVL-G
A0A6P0UX57      ---NLRV--QLQEIQSELKIER----ARYKPGHPTIKNLERQATNLKSLLEEQIRLAL-G
A0A6P0X1X4      ---NLRI--QLKDTMSELAMER----ASYKSGHPKIKNLERQATNLRALLEQQIRLVL-G
A0A0M0SHU3      ---QVLK--ELQEAQTKLTVAR----TRYLPGHPTVSNLEEQVSALKNLLQQRVEQVG-G
A0A1D2PBN3      ---QVLT--QLQEAQSQLAVER----TRLQPEHPIVINLEEKVAALNSLLQQRLKQVV-G
A0A0C2LVR7      ---QVLT--QLQEAQSQLAVER----TRLQPEHPIIINLEEKVAALNSLLQQRLKQAV-G
A0A1Z4PQB9      ---QVLT--QLQEAQSQLAVER----TRLQPEHPIIINLEEKVAALNSLLQQRLKQAV-G
A0A1Z4SFN6      ---QVLT--QLQEAQNQLTIEQ----TRLQPGHPTIINLEEKIAALNSLLEERIKQVV-G
K9PGI8          ---QVLT--QRQEAQSQLAIEL----IRLRPNHPTIINLKEKIAVLNLLLKGRIEEGV-G
K9TLQ0          ---DLLN--RFHEIETKLAQES----TRFTVQSPAMQVLIDERNSLLPLLQEEALLVL-G
K9QF04          ---ALLE--KLQRVDAKIASES----VKLSDEHPSLIALREERQHLLSLIQQQVINLL-G
K9W1T3          ---KLLS--NLQDIQEKLATER----TRFQEGHPVIEDLKSKEANLKALLQQQLQQTFLG
K9SGJ5          ---NLVK--QFQEAETHYYLER----TRFQDDHPEVQVAKDRRDQLYKLMQVQAETVL-G
A0A6N2JS94      ---SLVK--QFQEVETNYFLER----TRFRGDHPSVVALKDRRDELYRLLETRAQSVV-G
A0A6C2DSN4      ---SLVK--QFQDVETNYFLER----TRFREDYPSVLALKDRRDELYRLLEARAQSVV-G
L8MYT6          ---SLVK--QFQDVETNYFLER----TRFREDYPSVLALKDRRDELYRLLEARAQSVV-G
A0A352JGJ6      ---SLVK--QFREVETNYFLER----TRFREDHPTVQALKDRRNELYKLLETRAQALV-G
A0A1J5GLS2      ---SLVK--QFQEVETNYFLER----TRFREDHPNVLALKDRRDELYRLLETRAQSVV-G
A0A2W4W6M5      ---SLVK--QFQDVETSYFLER----TRFREDHPNVQALKDRRDELYKLLETRAQSVV-G
A0A2W7AN33      ---SLVK--QFQEVETNYFLEQ----TRFRGDHPSVIALKDRRDELYRLLETRAQSVV-G
A0A256BLV2      ---SLVK--QFQEVETNYFLER----TRFREDHPTVIALKDRRDELYRLLETRAQSVV-G
A0A2W6ZXF3      ---SLVR--QFQEVETNYFLER----TRFREDHPNVLALKDRRDELYRLLETRAQSVV-G
A0A2Z5WX66      ---SLVK--QFQETETNYFLER----TRFREDHPTVKALKDRRDELYKLLETRAQSVV-G
Q7NEU3          ---ENLT--QLQKVETQLALEQ----ARFRDDYPAVQSLKSKRDRLRQVLASQAQQILGD
A0A3C0N2P0      ---ALLN--QLSEVESKLAKES----ARLTEDHPTILKLREEQRRLKPLVDQEAATVMGN
A0A6P0JR04      ---SLLN--QLQEIETQIALES----ARFTEQNPTLQALRDRKENLLPLIREEAIAVLGQ
A0A6B3M6M6      ---ELLN--QLAEVERQIAMES----ARFTAESPTIAALEEQRQNLLPLLNQEVAKVVPN
A0A6P0KD09      ---ELLN--QLAEVERQIAMES----ARFTTDSPAIAALEEQRQNLLPLLNQEVAKVVPK
A0A6B3NIJ0      ---ELLN--QLAEVERQIAMES----ARFTTDSPAIAALEEQRQNLLPLLNQEVAKVVPK
A0A6M0F053      ---ELLN--QLAEVERQIAMES----ARFTTDSPAIAALEEQRQNLLPLLNQEVAKVVPK
A0A6P2ATU9      ---NLLN--QLQDIETQLALES----ARFTAGNPTIVGLRAQREKLLPLIQAEAQAVLGE
A0A352XE00      ---DLLN--KLSEVETKIAVES----ARFTEESPTIQALRDEQKNLLPLLEKEAGTALSS
A0A6P0QC14      ---ELLN--QLTELDTKIATES----ARFTEENPIVQRLLEERERLLPLIEKEASTVIGN
B4VS56          ---QLLN--QLTEIESKIASES----ARFTEQSPTIQALREKQQNLLPLLSQEAGTVLGA
A0A352AAQ3      ---QLLN--QLSEVESKIAAES----ARFTEDSPTIQALREKQQRLLPLIEAEAANVVGS
A0A350Y472      ---DLLN--QLSEVESQIATEL----ARFKEENPAIETLREKKERLLPLIEEEAANVVGN
A0A355DVB4      ---DLLN--QLSEVESQIATEL----ARFKEENPAIETLREKKERLLPLIEEEAANVVGN
A0A1Z4RMB9      ---SILD--QLAQTESDLSKER----QRFNDAHPSVVSLNAKKNDLTQQLEGLVANAV-G
A0A318B4H2      ---GTIA--SLRQKRAELSARYSALLTKFEPGYPEAEALRTEIMGLDKAIAQ--------
B4WQE3          ---SLLD--QLLVVDSELADNL----TVYVEDSPEVEVIEERRANLEPLLERE------G
A0A2K3BR24      ---KVLT--EYQAVEQELTLKR----SRYQPEHPIIKRLEEQEATLANLLQERVNAVL--
K9YXY1          ---KVLT--EYQAVEQELTLNR----SRYQPEHPIIKRLEEQEATLANLLQERVNAVL--
A0A1Q4RTR1      ---QLLD--EFRSTQNKLAVER----IRFSDEHPTIIDLADKVQVLRQQLQQRIIQTL-G
A0A1Z4SQV2      ---PLLN--EFRSSQDKLAVER----TRYSDEHPIIIDLANKIQVLRQQLQLRIVQIL-G
A0A2H2XGN1      ---PLLN--EFRSSQDKLAVER----TRYSDEHPIIIDLANKIQVLRQQLQLRIVQIL-G
A0A433UXH8      ---QLLN--EFRSSQDKLAMER----TRYSDEHPIVIDLANKVQVLRQQLELRVVQTL-G
A0A0V7ZFJ4      ---EALT--QYQKVQDELAVAQ----TQFTSEHPMVISLLGKEQALRNQLGKRVGQLI-D
A0A0V7ZNJ9      ---QALQ--EYQKVQDRLAVAR----TRLTNQHPTVIDLSNKERALRNQLEKRVGQVV-N
A0A367RIS1      ---EVLS--EYQKVQDLLAVER----SRFTDGHPVITSLLSKEQALKEQLERRVTQTL-G
A0A235IXQ2      ---QVLS--EYQKVQDQLTVER----SRFTDEHPVITNLLSKEQALKEQLKGRVSQTL-G
A0A1W5CNX3      ---QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKEQLEGRVSKTL-G
A0A5Q0GJJ5      ---QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKEQLEGRVSKTL-G
Q3MEB7          ---QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKEQLEGRVSKTL-G
A0A1Z4KHN9      ---QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKAQLEGRVSKTL-G
Q8YT70          ---QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKAQLEGRVSKTL-G
A0A166IWU6      ---QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNKEQALKEQLEGRITQTL-G
A0A2S0Q8C0      ---QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNKEQALKEQLEGRITQTL-G
W6FSX4          ---QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNKEQALKEQLEGRITQTL-G
A0A218Q4C1      ---QVLL--EYQKVQDQLAVER----SRLTDEHPVVVNLLNEEEALRIQLEGRVTQTL-G
A0A6P1ZT04      ---QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNEEEALRIQLEGRVTQTL-G
A0A5P8VSD1      ---QVLL--EYHKVQDLLAVER----SRLTDEHPVITSLLNKEQALRKQLEARVSQTL-S
A0A1S1ZVW2      ---QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQSI-G
A0A0R0M9H9      ---QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL-G
A0A7H0F4U6      ---QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL-G
A0A1B7WX82      ---QVLT--EYQKTQYDLAIAR----TLYTNDNPKVVDLIMKEASLKTVLKERVAQTV-G
A0A1B7WTD1      ---QVLT--EYQKTQHELAIAR----TLYTNDNPKVVDLLLKEAAQKKELEARVTETV-G
A0A480ABC0      ---QVLT--EYQKTQHDLAIAR----TLYTNDNPKVVDLLLKEAAQKKELEARVTETV-G
A0A1Z4LRU5      ---QVLT--EFQKTQKELAVAR----TKLTDQHPTVINLSKKLEALKNQLEGKVGQIV-G
A0A1Z4JVB4      ---SVLK--EYQKAEDDLAVAK----TRYTNDNPTIINLEQKAQALRSQLEGRVSQTI-G
K9PIA4          ---QVLT--EYQKVQDELAVAR----TRYTNNNPNILNLVEKEAALRNQVEGRVAQSL-G
A0A1Z4HVE1      ---QVLT--DYQKTQDELAVAR----TRFSDEHPLVINLDKKATALRSQLEGRVSKIV-G
A0A252ECZ1      ---QVLT--DYQKTEDELAVAR----TRFSDEHPTVINLDKKAAALRSQLEGRVSQTI-G
A0A1Z4G5Y1      ---QVLT--EYQKAEDELAVAR----TRFSEEHPIVINLAQKAAALRSQLEGRVSQTI-G
A0A252DNA2      ---QVLE--EYQKAEDELAVAR----TRFSEEHPIVINLDKKAAALRSQLEGRVSQTI-G
A0A252E1Q4      ---QVLE--EYQKAEDELAVAR----TRFSEEHPIVINLDKKAAALRSQLEGRVSQTI-G
A0A6G9SK36      ---QVLT--EYQKVQDELAVAQ----TRFTEDNPTIINLERKEIALRKQLEGRVAQTI-G
A0A1Z4M597      ---QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLENQAVALKNQLEGRVAQTI-G
A0A1Z4MWT1      ---QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLENQEVALRNQLEGRVAQTI-G
A0A1Z4TX53      ---QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLENQEVALRNQLEGRVAQTI-G
A0A2A2TNQ5      ---QVLA--EYQKVQDDLAVAR----SRFTEEHPSVRNLVAKEQAFRQQMEKRVGRVI-G
A0A3S1C4K5      ---QVLA--EYQKAQDELAVLQ----TRFTAEHPKVRDSEAKVQALREQLEKRVGKIV-D
A0A1X4G3D5      ---EVLK--EYQKNEQELAVAQ----TTYTNDNPKVVSLTAKGQVLKKQLQERIYQSV-G
D4TNI2          ---EVLK--EYQKNEQELAVAQ----TTYTNDNPKVVSLTAKGQVLKKQLQERIYQSV-G
A0A1Z4H6Z8      ---QVLK--EYQKAEDEVAVAR----TRLTDDNPTLINLEQKQAALRNQLEGRVAQTI-G
A0A1Z4NPM1      ---QVLA--EYQKTQDELAVAK----TRLTNDHPTVINLTEKVNALRSQLEQRVGKVI-G
A0A3F3KPR9      ---QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL-G
D4TGN7          ---QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL-G
A0A1Z4UZW9      ---QVLT--EYQKTQSELAIAR----SLYTNDNPKVVDLVMKEASLKNVLKERVAQTV-G
A0A0K2M5H0      ---QVLT--EYQKTQSELAVAR----SLYTGDNPKVVDLVMKEASLKNVLEQRVSQTV-G
A0A1B7VSH4      ---QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVMKEASLKKLLEERVGQTV-G
A0A1B7W126      ---QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVMKEASLKKLLEERVGQTV-G
A0A3D4C6Q6      ---QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVMKEASLKKLLEERVGQTV-G
A0A1B7UVJ4      ---QVLT--EYQKTQYDLAIAR----TLYTNDNPKVVDLIMKEASLKTVLKERVAQTV-G
A0A1B7UTR1      ---QVLT--EYQKTQYDLAKAR----TLYTSDNPKVVNLVMQEASLKDLLEKRVAQTI-G
K7W0A4          ---QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLVLKEASLKKLLEERVTQTI-G
A0A5C0DRW9      ---QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLLMQEASLKDLLEKRVAQTI-G
A0A6H2C088      ---QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLVMQEASLKDLLEKRVAQTI-G
A0A1U7HGH0      ---GVLA--ELQTVQRQIADAR----SRYRDDHPILDSLQEREARFQQLLQTQTNQVLQG
K9XJD3          ---GILT--ELQTVQRQITDAR----SRYRDDHPILDSLQEREARFKQLLQTQINQVLQG
K9SX01          ---ETLS--DLQKIDSQLVTLR----ATYTDNYPTITVLMEQRAPIQKLLQQRIKETL-G
A0A4P7ZT55      AFSQLLA--DLTDVEKQLAEAS----GTFRSSSPLVRSLTAQRNKLRPLLQRR-------
A0A1E5QIR9      ---KAIA--ELQAIENRLELER----SRFLDEAPIIIDLETKQARLRGVLERRIIEVL-G
A0A6P1A9A0      ---ELLN--QLQQIETQIALES----ARLTEISPQMQRLQEQRANLLPLLQQEARAVL-G
A0A1Z4IBC7      ---KVLA--ELQETQSKLAIER----TRFEPEHPAITALEEKVAVLEKLLKERTGEVA-G
A0A1W5CPC7      ---KVLA--ELQETESKLAVER----TRFESEHPAITSLEEKIVVLKNLLKDRTGQVA-G
A0A5Q0GKD1      ---KVLA--ELQETESKLAVER----TRFESEHPAITSLEEKIVVLKNLLKDRTGQVA-G
Q3MDC6          ---KVLA--ELQETESKLAVER----TRFESEHPAITSLEEKIVVLKNLLKDRTGQVA-G
A0A1Z4KM73      ---KVLA--ELQEAESKLAVER----TRFEAEHPAITSLEEKIVVLKNLLKDRTGQVA-G
Q8YNX7          ---KVLA--ELQEAESKLAVER----TRFEAEHPAITSLEEKIVVLKNLLKDRTGQVA-G
A0A367R4K6      ---KVLA--QLQEAESQLALER----TRFQSGHPTIINLEGKVTALRSLLKERIEQVA-G
A0A1E2WSV8      ---KVLI--QLQETESQLALER----TRFEPEHPTITNLEEKVTALKSLLKERVGQVA-G
A0A7D7L9Y1      ---KVLI--QLQETESQLALER----TRFEPEHPTITNLEEKVTALKSLLKERVGQVA-G
A0A2R5FRT9      ---KVLA--QLQETESQLALER----TRFSPEHPTITNLQEKVAALQSLLKERIGQFA-G
A0A2K8T1B6      ---KVFA--QLQDTESQLALER----TRFSPEHPTITNLQEKVVALQSLLKERIGQFA-G
A0A235I9I0      ---KVLA--ELQETESKLAIER----TRFSPEHPTITNLEEKVVALKNLLKERTGQVA-G
A0A2D0HQT8      ---KVLA--QLQETESQLALER----TRFSPEHPTITNLEEKVLALKNLLKERTGQVA-G
A0A2L2NU95      ---KVLA--QLQETESQLALER----TRFSPEHPTITSLEEKVAALNNLLKERTGQVA-G
A0A367S084      ---KVLA--QLQETESQLALER----TRFSPEHPTITNLEEKVLALKNLLKERTGQVA-G
A0A1Z4SMD6      ---EVLS--ELQKAQTQLAVQR----TRYTEDHPSITSLKNQEINLNNLLRSRIEQVL-G
A0A2H2Y096      ---EVLS--ELQKAQTQLAVQR----TRYTEDHPSITSLKNQEINLNNLLRSRIEQVL-G
K9S8M8          ---QALS--ELQQIEDELAVAR----TRYQEQHPTIAGLRRKQAALQSLVQERVGQVL-N
A0A1Z4NFV0      ---DAIT--ELQKLQRQLANER----SRYTEFHPKILNLKQEIAQVQGLIQQRVNASS-G
A0A3M9ZEU1      ---EVLS--QYQNVQSQLAIEQ----ARYRSSHPTVANLQRQADQLRTLLQERVQQAI-G
A0A1Z4JK72      ---EALS--QLQQVQTRLVTEQ----ARFKSTTPQIQTLQQQEQDLNALLQSRVSEAV-G
A0A0N7Z489      ---DVLS--QLQTVESRLVTES----SRFKDTTPQIQTLKQQRDDLNALLQARVSEAV-G
A0A0S3TXS2      ---DVLA--QLQSVESRLVTEQ----ARFKDTTPQIQTLKQQRDDLNALLQTRVSDAV-G
A0A2A2TPF8      ---EVLG--ELQKVQSKLATAQ----SRYTSTHPSIANLKEEEKALTNLLQQRVSQSV-P
A0A1Z4R0P8      ---EVLS--ELQKVQTKLATEK----SRYNSTHPSVINLEEQEKALASLLQQRASQSV-G
A0A0T7BUI3      ---EVLS--ELQKTQSRLALER----VKYTNNHPNVVYLENQEKTLKSLLNRRTQEIT-G
A0A1Z4LP32      ---EVLT--ELQKVQTELAAER----ANYTQIHPLIRKLESQESALNALLQQRKSEAS-G
K9REP9          ---EVLG--ELQKVQTQLASER----ANYTSAHPLIRKLENQATLLQSLLQQRKQEAS-G
A0A1Z4SIJ3      ---DVLS--ELQKVETKLAAER----GRYTNQHPSIVYLKNQQAALKSILNERAGKAL-G
A0A2H2XPG4      ---DVLS--ELQKVETKLAAER----GRYTNQHPSIVYLKNQQAALKSILNERAGKAL-G
K9V3C7          ---GTLA--ELQKVENNLAVAR----ARYTENSPIVMDLREQQATLKQLLQERVADSS-G
A0A1Z4T6Y7      ---ESLG--ELQKIQSQLATEA----TTYTSNHPKIISLRQKEAALNNLLQQRASQSL-G
A0A2H2Y561      ---ESLG--ELQKIQSQLATEA----TTYTSNHPKIISLRQKEAALNNLLQQRASQSL-G
A0A1Q4S362      ---EALG--ELQKVQTQIATQR----ALYTSDNPIMITLREKEASLNKLLQQRASQSL-G
A0A3S1CIN8      ---EALG--ELQKVQSQIATQQ----ALYTSDNPIMITLREKEASLSQLLQQRASQSL-G
A0A2A2TC28      ---EVLG--EQQKVQAKLATLK----ARYTDEHPAIADLKSQELALNSLVKQRVEQSL-G
A0A0C1NCB0      ---DVLT--ELQKVQTKLANER----ARYTEKHPSVVNLENEEVTLKALLKQRVGETA-G
A0A2N6K7Q9      ---EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-G
A0A2N6MXH6      ---EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-G
A0A2N6M5A8      ---EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-G
A0A2N6LL61      ---EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-G
A0A0S3TP66      ---EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-G
G6FP91          ---EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-G
A0A1U7GYR5      ---EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-G
A0A2N6KY52      ---EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-G
A0A2N6KMP5      ---EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-G
A0A2N6MA45      ---EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-G
A0A4Q9J9V9      ---EVLT--ELQKVQTKLANAR----AIYTEKNPIIIDLKNQQSTLNSLLQQRTQQYS-G
A0A328IGA1      ---EVLT--ELQKVQTKLANAR----AIYTERNPIIIDLKNQQSTLNSLLQQRTQQYS-G
A0A4D9CE41      ---EVLT--ELQKVQTKLANAR----AIYTERNPIIIDLKNQQATLNSLLQQRTQQYS-G
A0A0M0SFT2      ---EVLT--ELQKVQTKLANAR----AIYTEQHPIITDLKNQQATLNALLQQRTQQYS-G
A0A1Z4TLC8      ---EVLT--ELQKIQTKLANAR----AIYTEQHPTITDLKNQQATLNSLLQQRTQQYS-G
A0A0C2LFH0      ---EVLT--ELQKVQTKLANER----ARYTSEHPAITELKNKEITLNALLQQRVEQVL-G
A0A1Z4IYV4      ---EVLS--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL-G
A0A1Z4Q0T6      ---EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL-G
A0A0C2PT44      ---EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL-G
A0A1D2P6J4      ---EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL-G
B4WP72          ---EVLT--ELQAVQSQLAIEQ----ARYQSTHPAVLNLQRQVNSLESLLRQRIRTVTTN
A0A2T1CIL7      ---QLIS--ELQQVRIDLIEQR----DRFSDNAPQVNSLVKREVELEALLENQIEQIQ-G
A0A433V7A0      ---DILK--KIQQVQSELAVQQ----TRLSNDHPSINNLKKQETALKSLLEDRVKAVVMQ
A0A2T1FTR8      ---KSLK--ELQEVEAKIATER----TRFSDNDPSILNLKEKRQALVEILQKRFKQSLVG
K9UA41          ---KSLK--ELQEVEAKIATER----TRFSDNDPSILNLKEKRQALVEILQKRFKQSLIG
A0A0C2LBE2      ---QVLT--QLQEAQSQLAVER----SRLKPEHPIIVNLEEKVAALNSVLQQRMKQVT-G
A0A433NN38      ---QLLS--QLQKTQADLEVAR----TRFQPEHPQIVNLEEQISALSQVLQQRVEQVA-G
A0A2N6K0T2      ---KVLT--ELQEAQSQLTVAR----TRYQPGHPTVIDLEEKVAALRNLLQERVGQVA-G
A0A2N6ML72      ---KVLT--ELQEAQSELTVAR----TRYQPGHPTVVNLEEKVSALRSLLQQRVQQVG-G
G6FQZ6          ---KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG-G
A0A2N6MQX9      ---KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG-G
A0A2N6KXT6      ---KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG-G
A0A2N6KGB9      ---KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG-G
A0A2N6L3Y5      ---KVLT--ELQEAQSELTVAR----TRYQPGHPTVVNLEEKVSALRSLLQQRIQQVG-G
A0A0S3TIS7      ---KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRVEQVG-G
A0A1U7GW28      ---KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRVEQVG-G
A0A2N6LW63      ---KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRVEQVG-G
A0A328IH74      ---EVIK--ELQEAQTELAVAR----TRYLPGHPTVSQLAEKVSALKNLLQQRVEQVG-G
A0A4D9CIB0      ---EVIK--QLQEAQTELAVAR----TRYLPGHPTVSQLAEKVSALKNLLQQRVEQVG-G
A0A1Z4TQ63      ---QVLK--ELQEAQTELTVAR----TRYLPGHPTVSNLEEKVSALKSLLQQRVEQVG-G
A0A4Q9J8G2      ---EVIK--ELQEAQTDLAVAR----TRYLPGHPTVSQLEEKVSALKNLLRQRVEQVG-G
A0A350Y0P6      ---QALI--ELEQVQEQLNIEG----TRFQNEAPIIVSLKEKEAARQRLLNQRVEQVI-G
A0A352X940      ---QILV--DIEQIEAQLTVQR----TRYQEEHPIIQNLKRREDAQKSLLQERISKVL-G
B8HTN4          ---VVLD--QYQQVEAELAVAR----TELQPDHPKIKTLEEQLTELNTILRERVRDVAQA
A0A6P1AFJ5      ---ELLD--RLQQIEQQIALES----ARFTEISPLIQKLQEQKQNLLPLLAAEARAVL-G
B0CAX4          ---QALA--DYQENERELAEAL----KVFQPTHPTVLDLKEKRIALKGVLGEQTSQII-E
A0A1Z4RN12      ---RALS--QLQDVKVALAQKQ----AFLSNNAPQIVSLKQEEADLTSLLEQQIASTL-G
A0A2T1CMF9      ---ETLA--QLQKIKVELAQKS----NVLSDSSPQIISLKEEQADLEDLLRQEVAGTL-G
Q7NDC5          ---DLRK--TLLEIESKLAVAR----AQYQDSYPEVEQLIKRRGALRALLASEADRLL-G
U5QGK3          ---ELRK--DLVEVESKLALAR----AQYQDNYPDVDRLIKQRNALRALLKTEAGRLL-G
A0A2W4UY24      ---EVIT--TLQAVQSQLAIAL----TRYREGHPEIASLRSQEVALLTLLQTRVGLALGS
A0A0D8ZUV2      ---KLLE--ESQQLEDRLATER----TRLQEDHPTIVNLKLRQAALKALLDKRV------
A0A433VDI0      ---KTLE--ELRQVEDQLVVQR----TRLQEDHPAIVNLELKKNAFKAQLQGLVK----D
A0A3D1PG43      ---KVVA--ELQQVEADLVVLQ----TRFLDGHPKIAELQNKKAALKALLQQRITQTL-G
A0A2P8QQ72      ---KTLA--ELQRVEGDLVVLQ----TRFEDTYPEVQKLQQKRNALKQLLEGRIGQML-G
K9TZQ7          ---KTLA--ELQRVEGDLVVLQ----TRFEDTYPEVQKLQQKRNALKQLLEGRIGQML-G
A0A6N8G584      ---KVLT--EYQQVEAELAVQQ----TRFIGDHPTILGLTERRDALRALLEERVQGAI-G
A0A2G7GPR0      ---KVLT--EYQQVEAELAVQQ----TRFVGEHPTILGLQERRDALRALLEERVQGAI-G
K9XH68          ---KVLA--EYQQVEAELAVQQ----TRFVGDHPTLLSLTERRDALRALLEERVQGAI-G
A0A1U7HW70      ---KVLA--EYQQVEAELAVQQ----TRFVGDHPTLLGLTERRDALRALLEERVQGAIGG
A0A2S6VEJ8      ---KVLQ--EYQQVEAELAVQQ----TRFVGDHPTILSLTERRDALRALLEERVQGAI-G
A0A140KBA0      ---KALT--QLQNVKVELASKR----NLFGENAPQIISLKEQEAELTALLEQQIRQTL-G
K9XSG1          ---KALT--QLQDVKVQLATKR----NLFGENAPQIISLKEQEAELTALLEQQIQQTL-G
A0A2T1GMT4      ---GILT--QLQDVDRQLATES----SRFSDDNPIIVSLKEKQSKLKTLLSQQIRNTI-G
K9UI51          ---GILT--QLQDVDRQLATES----SRFSDDNPIIVGLKEKQSKLKALLEQQIRSTI-G
A0A1Z4QL41      ---AILT--QLQEIDRQLAVER----SRFLDENPVIINLEAKRFNLKNLLQKQIEQTI-G
A0A2T1FXY4      ---GVLI--QLQDTERQLASQR----SRYLNNNPIIVDLEAKKSNLEALLKKQIKQTV-G
K9TYI2          ---GVLT--QLQDTERQLASQR----SRYLNDNPIIVDLEAKKYNLEALLQKQIKQTV-G
A0A252D4T4      ---GILT--QIQEVDRQLATER----SRFQEENPVIVNLVARRANLQALLKQEVGQNG-G
A0A252DJH5      ---GILT--QIQEVDRQLATER----SRFQEENPVIVNLVARRANLQALLKQEVGQNG-G
A0A252EB80      ---AILT--QLQEVDRQLATER----SRFQDENPVIVNLVAKKANLQALLKQEVGQNG-G
A0A6G9SKZ9      ---GIVT--QLQDIDRQLATER----SRFLDDNPVIINLEQRKANLQALLNKELKQTG-A
A0A1Z4HPW5      ---GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQRKANLQALLKKEIGQTD-A
A0A1Z4MSN1      ---GILT--QLQDIDRQLASER----SRFLDDNPVIVNLEQRKANLQALLKKEIGQTG-A
A0A1Z4U1C2      ---GILT--QLQDIDRQLASER----SRFLDDNPVIVNLEQRKANLQALLKKEIGQTG-A
A0A0D6KV51      ---GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQRKTNLQALLKQEIGQTG-A
A0A1Z4MKF8      ---GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQRKTNLQALLKQEIGQTG-A
A0A2C6WC43      ---GILT--QLQDIERQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTV-G
A0A1Z4L5A1      ---GILT--QLQDIERQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTV-G
A0A367QD86      ---GILT--QLQDIDRQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTI-G
A0A2K8SM78      ---GVLT--QLQDTDRQLAIER----SRFLDDNPVIINLEAKKASLKSLLQQQIGQTV-G
A0A2R5FPC0      ---GVLA--QLQDTDRQLAIER----SRFLDDNPVIINLQAKKASLQSLLQQQIGQTV-G
A0A5P8W5T6      ---GVLT--QLQDTDRQLAVER----SRFLDDNPVIINLEAKKASLKSLLQQQIGQTV-G
A0A7D7LDT7      ---GVLT--QLQETDRQLAVER----SRFLDDNPIIINLEARKASLNSLLQQQIGQTI-G
A0A235IZ96      ---GVLV--QLQETDRQLAIER----SRFLDDNPVIINLEAKKANLKSLLQQQIGQTI-G
A0A2L2NGP0      ---GVLV--QLQETDRQLAIEH----SRFLDDNPVIINLEAKKANLKSLLQQQIGQTI-G
K9QM62          ---GALT--QYQDIERQLATER----SRFSEAHPTIVNLEARKSNLKTLLQQQINQTL-G
A0A1Z4FWI3      ---GIVT--QLQDVERQLATER----SRFQDENPVIINLEAKKANLKALLQQEIGQAG-G
A0A1Z4JYE7      ---GILS--QLQELERQLANER----SRFTDDNPIIVSLEAKKDNLNNLLQLQIAKTV-G
A0A0F5YE28      ---GILT--ELENVESELVNER----KRFKDQNPRIIALKQKRDSLNAALQEQVEQVL-G
U7QEH7          ---GILT--ELENVESELVNER----KRFKDQNPRIIALNQKRDSLNAALQEQVEQTL-G
A0A3S1ATK5      ---EIVI--QLHEIERQLATER----SRYFDNNPVIISLEAKKANLNNLLQTQIKATI-G
A0A2Z6CPH0      ---GVLT--QLQDVERQLANER----SRFLDDNPVIVGLEARKANLTNLLQQQITQTL-G
A0A1Z4GT50      ---GILA--QLQDLERQLATER----SRFYDDNPVITNLEAKKTTLQTLLQKQIEQIV-G
A0A1Z4GIX0      ---GVLT--QLQEVERQLANER----SRFLDDNPIIVSLEARKANLTALLQQQVGQTL-G
A0A2H6LC24      ---GVLT--QLQEVERQLANER----SRFLDDNPIIVSLEARKANLTALLQQQVGQTL-G
B2J6N5          ---GVLT--QLQETERQLAIER----SRFLDDNPVIINLEAKKASLKSLLQQQIGQTV-G
A0A367RMI4      ---GILT--QLQETDRQLAVER----SRFLDDNPIIINLEAKKANLKSLLQQQVGQTV-G
A0A235HUM0      ---GILT--QLQETDRQLAVER----SRFLDDNPIIINLEAKKTNLKSLLQQQVGQTV-G
A0A2L2NW47      ---GILT--QLQETDRQLAVER----SRFLDDNPIIINLEAKKANLKSLLQQQVGQTI-G
A0A1E2WUR1      ---GVLT--QLQETDRQLAVER----SRFLDDNPVIINLEARKASLNSLLQQQIGQTI-G
A0A235IKU3      ---GVLV--QLQETDRQLAIER----SRFLDDNPVIINLEAKKANLKSLLQQQIGQTI-G
A0A1U7MYU6      ---GVLQ--ELQEVERQLAVGN----NRYGKNHPVMIRLTKQQSSLRGHLQQQIDQIL-G
A0A1D8TNX9      ---GVLQ--ELQEVERQLAVGR----NRYGKNHPIMIRLTKQQRSLTGHLQQQINQIL-G
A0A6P0L6C2      ---GVLQ--ELQEVERQLAVGK----NRYGKNHPVMIRLTKQQRSLRGHLQQQINQIL-G
A0A6P0MVH0      ---GVLQ--ELQEVERQLAVGR----NRYGKNHPVMIRLSKQQRSLRGHLQQQINQIL-G
A0A6P0KJV0      ---GVLQ--ELQEVERQLAVGR----NRYGKNHPVMVRLTKQQRSLRGHLQQQIDQIL-G
A0A6L9ZJG4      ---GVLQ--ELQEVERQLAVGK----NRYGKNHPVMIRLTKQQRSLRGHLQQQINQIL-G
F4XKF3          ---GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL-G
A0A1D9FX10      ---GVLQ--ELQEVERQLAVSK----NRYGKNHPVMIRLTKQQRSLRGHLQQQIDQIL-G
A0A6P0Q0T0      ---GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL-G
A0A6P0W5I0      ---GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL-G
A0A3C0NJ41      ---EVLK--QYQDIQAQLTLQR----TRFLDDSPVIVSLKEKEASLKSLLQDRVSQTV-G
A0A352AG88      ---QVLQ--EFQQVQSKLRVEQ----TRFQDEDPTIISLKEREAALRNLLQERVVQTI-G
A0A350Y374      ---DILK--EFQKVQADLTIQR----TRFQEADPTIISLKQKEAALKSLLEERVGQTI-G
A0A355DPX0      ---DILK--EFQTVQADLTIQR----TRFQEADPTIISLKQKEAALKSLLEERVGQTI-G
                                                                            

K9SLA9          N----------------------------LTTQNL----------------------RIS
A0A168TT23      V-----------------------------------------------------------
A0A0M1JWX9      E---------------------IVTVARVPEA-------------------------QAF
A0A2T1M1V6      V----------------------------------------------------S-SSQVD
A0A2G7GCS2      A----------------------------------------------------S-ANQID
K9XBH8          A----------------------------------------------------A-SNQVD
A0A1Z4LJ30      -------------------------------------------------------VAGVD
K9RI76          -------------------------------------------------------AGGVN
A0A352AE27      -------------------------------------------------------A-SID
A0A3B8JH60      -------------------------------------------------------T-RVD
A0A3C0N766      -------------------------------------------------------T-RVD
K9W9J7          -------------------------------------------------------T-QVD
A0A139WSU3      -------------------------------------------------------T-KVD
A0A433VN22      -------------------------------------------------------I-PVD
Q7NF11          S----------------------------------------------------RTERALD
A0A1Z4JCS8      -------------------------------------------------------RISAN
A0A6P0PI80      -------------------------------------------------------DTLVD
A0A6P0WGT6      -------------------------------------------------------DTLVD
F4XTX2          -------------------------------------------------------DTLVD
Q7NJN6          -------------------------------------------------------ASKVN
U5QCC3          -------------------------------------------------------SEKVD
A0A0S3TYD7      T-----------------------TAPRATED-------------------------DLQ
A0A2T1DNG3      S-----------------------------SP-------------------------GSG
A0A3S0Y9N9      EAGRLNKSKDSESIV------------------------------------------QLK
A0A433UNK7      KSGRLNQSVEPEKIV------------------------------------------QLR
A0A6P0ZKB8      KAGRLNQVKDAENIV------------------------------------------QLR
U5QL42          AKVAKLGLKSGAVPALGDSAITGSGGANPPVAPAASAPTPATVASKGEPAPPAAPTSKAP
A0A140K3H3      AVSQV----------------------------------------------NLEAIIVSQ
K9XUB8          AVSQV----------------------------------------------NLEAIIVNQ
A0A6H2NHD5      NAEVD----------------------------------------------HD-------
A0A2P8W4F7      A--VE----------------------------------------------AN-------
A0A5Q4E0Z4      T--VE----------------------------------------------TD-------
A0A2P8VVX1      ------------------------------------------------------NVTELD
A0A2P8WHY0      ------------------------------------------------------PVETLN
A0A2T1CMT9      LP----------------------------------------------------PNFSSD
A0A7G8J1V5      ------------------------------------------------------------
A0A354B169      ------------------------------------------------------------
Q0IDT5          ------------------------------------------------------------
A0A7G8FZD9      ------------------------------------------------------------
G4FMX5          ------------------------------------------------------------
A0A7G8FAU7      ------------------------------------------------------------
A3ZA21          ------------------------------------------------------------
A0A076HBF2      ------------------------------------------------------------
A0A7G8FP50      ------------------------------------------------------------
A0A7G8E8K7      ------------------------------------------------------------
A0A7G8GAH0      ------------------------------------------------------------
A0A7G8GNR2      ------------------------------------------------------------
A0A7G8ICD3      ------------------------------------------------------------
A0A2D6FCW3      ------------------------------------------------------------
A0A7G7KJ95      ------------------------------------------------------------
A0A7G8EAN3      ------------------------------------------------------------
A0A563VQJ3      G-------------------------------------------------------VEVS
A0A1D8TX52      V--------------------------------------------------PT-QLVSTG
A0A1D9G4T2      V--------------------------------------------------PT-QLVSTG
A0A6P0PR27      V--------------------------------------------------PT-KLVTTG
A0A6P0WER7      V--------------------------------------------------PT-KLVTTG
F4XP71          V--------------------------------------------------PT-KLVTTG
A0A6L9YR57      V--------------------------------------------------PT-QLVSTG
A0A6P0KZ31      V--------------------------------------------------PT-QLVSTG
A0A6P0LPB8      V--------------------------------------------------PT-QLVSTG
A0A6P0SEV1      V--------------------------------------------------PT-QLVTTG
A0A6B3N2I8      V--------------------------------------------------PT-QLVTTG
A0A6M0B891      V--------------------------------------------------PT-QLVTTG
A0A6P0IJQ1      V--------------------------------------------------PT-QLVTTG
A0A6P0J8J8      V--------------------------------------------------PT-QLVTTG
A0A6P0ZSH6      V--------------------------------------------------PT-QLVSTG
A0A1U7N5X9      V--------------------------------------------------PT-QLVTTG
A0A6L9Z1V0      V--------------------------------------------------PT-QLVTTG
A0A6P0LC12      V--------------------------------------------------PT-QLVSTG
A0A6P0MVJ3      V--------------------------------------------------PT-QLVSTG
A0A2W6ZAV2      ------------------------------------------------------------
K9W742          N-----------------------------------------------------SSQLKG
A0A3D1PBA3      E--------------------------------------------------QA-QSGSTG
K9XPB0          V--------------------------------------------------PP-NFAVQL
A0A350Y7Z1      T--------------------------------------------------ST-QIAFST
A0A352X2A7      V--------------------------------------------------AR-GEDLTS
A0A0D8ZYV0      N---------------------------------------------------V-AQANAA
A0A2T1FP73      GQASQ----------------------------------------------AA-AAGNAA
A0A433VMS2      GQASQ----------------------------------------------AA-AAGNAA
K9TYA7          GQASQ----------------------------------------------AA-AAGNAA
A0A2P8QUE1      GQASQ----------------------------------------------AA-AAGNAA
K9SA61          T--------------------------------------------------ST-GTSSQG
A0A2G7GMH8      N--------------------------------------------------AI-ASEEDT
A0A6N8FU92      D--------------------------------------------------VA-ASDEDT
A0A2T1DWE8      N--------------------------------------------------AA-QVNVKG
A0A1U7I8L3      N--------------------------------------------------NPLPPTTTN
A0A2T1DJL8      Q--------------------------------------------------AA-AIAQSG
A0A1Z4J9W0      E--------------------------------------------------AG---AASS
A0A0N7Z5K9      D--------------------------------------------------AG-AIAGSD
A0A0S3TXC5      E--------------------------------------------------AS-SIAGSD
B8HNB0          --------------RTQLNRDLTTLPSSASSG-------------------------SSD
A0A563VS48      E-----------------------QQALLGNTNIL----------------------ALG
A0A318BJ18      ------------------------------------------------------------
A0A3B8Y8H9      N---------------------IPQTSLTDLT-AL----------------------TSP
A0A2W1JVB9      ----------------------VPSSPTQGTG-QL----------------------QVG
A0A3M1SVZ4      SLKSIG---------------------------------------------------NLE
A0A6H1U102      D----------------------AVSQVDLSD-------------------------VAG
A0A7C3ZEJ3      S----------------------AVGQVDITD-------------------------VSG
A0A563VLD6      NTVSQAVLDKAIATSAEIINNTNTTTSITNATESE----------------------STT
A0A2P8W9H0      ---------------------------------------------------------ELA
A0A6I5P386      ---------------------------------------------------------QIA
A0A654SFI6      ---------------------------------------------------------KAA
A0A318BG22      F--------------------------------------------------------RAA
K9SSQ0          ------------------------GTKPADVT-------------------------PEG
A0A2W1JIN9      ------------------------GGGSSVNI-------------------------APE
A0A318AJV1      ------------------------------------------------------------
A0A6P0IC70      ------------------------NPQTISPS-------------------------DVA
A0A6B3MUB5      ------------------------NPQTISPS-------------------------DVA
A0A6M0B7N4      ------------------------NPQTISPS-------------------------DVA
A0A6P0J9W3      ------------------------NPQTISPS-------------------------DVA
A0A6P0ZWE1      ------------------------NPQTISPS-------------------------DVA
A0A1U7N2U4      N-------------QP----TNQLTNQIIPPA-------------------------DVA
A0A1D9G1F2      --------------------TNQSNNQIIAPG-------------------------DVA
A0A6P0PNZ7      --------------------TNQSNNQIIAPG-------------------------DVA
F4XV38          --------------------TNQSNNQIIAPG-------------------------DVA
A0A6P0W137      --------------------TNQSNNQIIAPG-------------------------DVA
A0A6L9Y9E2      N-------------QLTNQSTNQSNNQIIPPA-------------------------DVA
A0A6P0SGR0      N-------------QLTNQSTNQPNNQIIPPA-------------------------DVA
A0A6M0BK48      N-------------QLTNQPTNQLTNQIIPPG-------------------------DVA
A0A6L9YZL1      N-------------QLTNQSTNQSNNQIIPPG-------------------------DVA
A0A6P0KYM4      N-------------QPTNQFT----NQIIPPG-------------------------DVA
A0A6P0LSD6      N-------------QPTNQFT----NQIIPPG-------------------------DVA
A0A6P0X384      ------------------------PNQSISSL-------------------------DIA
A0A2P8QIL5      ------------------------GNPAASTS-------------------------NPA
A0A2T1FLY5      ------------------------GNPAASTP-------------------------NAA
A0A433W447      ------------------------GNPAASTP-------------------------NAA
K9U1K8          ------------------------GNPAASTP-------------------------NAA
K9UYB2          ------------------------DNQSIPDN-------------------------NIA
A0A218QN17      ------------------------ANSSVATN-------------------------SVA
K9RKN2          ------------------------TNNSVRDN-------------------------QIA
A0A2I8ADV2      ------------------------NNQTIPTE-------------------------DVA
A0A1W5CKM3      ------------------------SNQTANFN-------------------------NLS
A0A5Q0GMF5      ------------------------SNQTANFN-------------------------NLS
Q3MEW0          ------------------------SNQTANFN-------------------------NLS
A0A1Z4KIC7      ------------------------SGQTDNFQ-------------------------DLA
Q8YSM5          ------------------------SGQTDNFQ-------------------------DLA
A0A1Q4S1H4      ---------------------------GNAVA-------------------------NIS
A0A433VBU6      ---------------------------GNALT-------------------------SVS
A0A1Q4RZJ6      -----------------------KAGANNSNN-------------------------NIA
A0A1Z4SNV3      --------------------VDTSSSNNSNLN-------------------------NVA
A0A2H2XJQ1      --------------------VDTSSSNNSNLN-------------------------NVA
A0A3S5K358      ------------------------GAGVNNSN-------------------------NIA
A0A0T7BPJ4      ------------------------DGQS-QTT-------------------------NFA
A0A0C1QS61      ------------------------GERPVSPN-------------------------NVA
A0A139X3R8      ------------------------ENQPVSPN-------------------------NVA
A0A1Z4I7C5      ------------------------SNQTANFQ-------------------------DLA
A0A0C2MDK7      ------------------------KDQSVSTK-------------------------NFA
A0A1Y0RCK1      ------------------------ENQNASAK-------------------------NFA
A0A1Z4PWZ0      ------------------------QGQTVSAN-------------------------NFA
A0A0C2QLT0      ------------------------QNQTTSAN-------------------------NFA
A0A1Z4J2K1      ------------------------KDQTSSAN-------------------------NFA
A0A3S0ZSX0      ------------------------QNQAIPTN-------------------------AVA
A0A2N6K4T3      ------------------------RNQSISSG-------------------------SVA
A0A370CKT2      ------------------------RNQSISSG-------------------------SVA
A0A0S3TL97      ------------------------RNQSISSG-------------------------SVA
A0A2N6M8A0      ------------------------RNQSISSG-------------------------SVA
A0A2N6M9E1      ------------------------RNQSISSG-------------------------SVA
A0A2N6KJI4      ------------------------RNQSISSG-------------------------SVA
A0A2N6MZ77      ------------------------RNQSISSD-------------------------SVA
A0A2N6KT20      ------------------------RNQSISSG-------------------------SVA
G6FSN3          ------------------------RNQSISSG-------------------------SVA
A0A4D9CI02      ------------------------RSKSISSS-------------------------SVA
A0A328I8B9      ------------------------RSKSISSS-------------------------SVA
A0A4Q9J4Z7      ------------------------RSKSISSS-------------------------SVA
A0A0M0SU69      ------------------------GNTSISSS-------------------------SVA
A0A1Z4TIZ8      ------------------------GNTSISSS-------------------------SVA
A0A2T1E9V8      Q---------KISSYS-----------------NL----------------------QVG
A0A1Z4LN32      Y------------------------RTQIAPS-SL----------------------QIG
A0A2I8A9F5      Y------------------------PIQIETA-RL----------------------QIG
A0A218Q6R8      Y------------------------PMQIPPT-ML----------------------QMG
A0A218QGE0      Y------------------------KAAIAPG-KL----------------------QMG
A0A3M2GQQ6      D-------------AV--------------AKVDLDE--------------------VTG
A0A6H1U2X0      D-------------AV--------------AKVDLDE--------------------VTG
K1XF69          S-----------------------------SR-PFSR---------G------LL--RVM
B5W297          S-----------------------------SR-PFSR---------G------LL--RVM
A0A6H2AL05      S-----------------------------SR-PFSR---------G------LL--RVM
H1W7M8          S-----------------------------SR-PFSR---------G------LL--RVM
A0A5Q4H6A5      S-----------------------------GR-AFSR---------G------LL--RVM
D5A466          S-----------------------------GR-AFSR---------G------LL--RVM
U5QJM6          G-----------------------------DGKQAESLRDSLAGTLESNRTSSSTADRYG
A0A1Z4RPC6      T--------------------------------KVSE---------G------LL--QAG
A0A2T1CMZ0      A--------------------------------KVSE---------G------LL--QSD
L8M4F7          Q--------------------------------QVSP---------G------LI--KNN
A0A140K2P2      Q-----------------------------GV-EISE---------G------LF--NND
K9XWX4          Q-----------------------------GV-EISE---------G------LF--NND
A0A140KB14      S-----------------------------NT-KISE---------G------LL--RSD
K9XX88          S-----------------------------NT-KISE---------G------LL--RSD
A0A563VSV6      T-----------------------------GV-KVSD---------G------LL--QDN
L8LZE9          S-----------------------------NV-QISD---------G------LL--QSD
A0A433NM31      G-----------------------------QQPLLDQ----------------NL--QIG
A0A1Z4NDS1      N-----------------------------QQIQL-----------D------NL--QLG
U9VXM0          A-----------------------------NQLDLPE---------D------DL--QSG
A0A6M0RI13      A-----------------------------NELNLPS---------D------DL--QSG
A0A6M0S1N5      A-----------------------------NELNLPS---------D------DL--QSG
K9F4D9          A-----------------------------NELNLPS---------D------DL--QSG
A0A6I5QPI5      Q-----------------------------EL-TVPV---------D-SLNVGRL--QLG
A0A1Z3HMQ0      T-----------------------------QA-NISP---------G------DL--QMS
A0A433W533      K-----------------------------TR-TLAD---------G------KL--QIG
A0A2P8QWJ3      K-----------------------------TR-TLAD---------G------KL--QIG
A0A2T1FKP8      K-----------------------------TR-TLAD---------G------KL--QIG
K9U6L7          K-----------------------------TR-TLAD---------G------KL--QIG
A0A1E5QP61      N-----------------------------NQ-AVDR---------R------DL--QIG
U5DPF5          E-----------------------------SP-AAGG-----AIPVDVAIASGTL--QLS
A0A6P0X488      F-----------------------------EQ-LIPG---------D------SL--QMG
A0A6P0UVD5      F-----------------------------EQ-LIPG---------E------SL--QMG
A0A6P0VDM0      F-----------------------------EQ-LIPG---------E------SL--QMG
A0A6M0G142      F-----------------------------RQ-LVPG---------E------NW--QMG
A0A6P0MR53      F-----------------------------EQ-QIPG---------E------SL--QMG
A0A3M2GIL5      S-----------------------------QL-QLPR---------E------SF--EIG
A0A6H1TSJ9      S-----------------------------QL-QLPR---------E------SF--EIG
A0A3M1PML8      S-----------------------------DW-SSIR---------N------DL--QAG
A0A6M8BE85      S-----------------------------DW-NNIR---------N------DL--QAG
A0A0T7BPZ0      E-----------------------------ST-KLSI---------Q------NL--QIG
A0A352X442      S-----------------------------EA-EVAT---------T------NL--QIG
A0A6B3NF44      G-----------------------------KQ-QVPT---------E------NL--QIG
A0A6M0EPL4      G-----------------------------KQ-QVPT---------E------NL--QIG
A0A6P0K6L6      G-----------------------------KQ-QVPT---------E------NL--QIG
A0A6P0MRR9      D-----------------------------KP-EVVNLASGQSQLLE------NV--ELS
A0A6P0UX57      D-----------------------------RP-GVVTLASGQIQSLE------NV--EVS
A0A6P0X1X4      D-----------------------------KP-GFITLASGQIQALE------NL--EFS
A0A0M0SHU3      S-----------------------------NQ-QMST---------A------SL--QMG
A0A1D2PBN3      S-----------------------------GR-QIPT---------L------NL--QTG
A0A0C2LVR7      N-----------------------------SR-QIPT---------L------NL--QTG
A0A1Z4PQB9      S-----------------------------DR-QIPT---------L------NL--QTG
A0A1Z4SFN6      S-----------------------------NQ-QIPL---------ENVQNLQNL--QIG
K9PGI8          S-----------------------------TK-TVIK---------G------NL--QIG
K9TLQ0          P---------------------NVSQFRGDIR-GL----------------------STP
K9QF04          I---------QLFKEI------QQLPGVASPS-KI-------------------------
K9W1T3          Q-------------QP------LP------NR-IV----------------------PLA
K9SGJ5          G---------RAAQVG------ISTAVPASAD-GS-------------------------
A0A6N2JS94      V---------KGNTAN------ITN----EPN-SA-------------------------
A0A6C2DSN4      V---------KGNTTN------IAN----EPS-SL-------------------------
L8MYT6          V---------KGNTVN------IAN----EPS-SL-------------------------
A0A352JGJ6      T---------KG--TN------ITN----EPN-SP-------------------------
A0A1J5GLS2      V---------GANSRN------LTN----EPN-SL-------------------------
A0A2W4W6M5      V---------RGGNVN------LTN----EPN-ST-------------------------
A0A2W7AN33      -----------DSTAN------ITN----QPN-SA-------------------------
A0A256BLV2      V---------RGSTTN------ITN----EPN-SA-------------------------
A0A2W6ZXF3      V---------GVG-NN------FTN----EPN-SP-------------------------
A0A2Z5WX66      L---------KGS-AN------IAR----EPN-ST-------------------------
Q7NEU3          RTVPAIVSGGASLQDS------IAD----SVN-NT----------------------GSP
A0A3C0N2P0      AA------------SG------VPD----NAE-SL----------------------ASP
A0A6P0JR04      DA------------KN-------TD----LGD-LN----------------------TSP
A0A6B3M6M6      GT------------G--------IN----SAE-AL----------------------AAP
A0A6P0KD09      GT------------G--------TN----SAE-AL----------------------AAP
A0A6B3NIJ0      GT------------G--------TN----SAE-AL----------------------AAP
A0A6M0F053      GT------------G--------TN----SAE-AL----------------------AAP
A0A6P2ATU9      AA------------GD------EAK----SLA-------------------------ASP
A0A352XE00      AK------------LT------QSD----NLA-SL----------------------ASP
A0A6P0QC14      ST------------SG------VPS----DAP-SL----------------------ASP
B4VS56          NA------------SA------VPE----NPE-SL----------------------ASP
A0A352AAQ3      GS------------SG------VPN----NAE-SL----------------------ASP
A0A350Y472      AA------------FG------IPN----NPE-SL----------------------ASP
A0A355DVB4      AA------------FG------IPN----NPE-SL----------------------ASP
A0A1Z4RMB9      Q---------G-----------VQV----SQG-LL----------------------EGQ
A0A318B4H2      ---------------------------------------------------------EGG
B4WQE3          V---------R-------------------------------------------------
A0A2K3BR24      --------------QEELPSNALAD----DNF-SL----------------------QLS
K9YXY1          --------------QEELPSNALAD----DNF-SL----------------------QLS
A0A1Q4RTR1      G-------------AP------QGL----NER-DL----------------------NLD
A0A1Z4SQV2      S-------------T-------QAL----NER-DL----------------------QID
A0A2H2XGN1      S-------------T-------QAL----NER-DL----------------------QID
A0A433UXH8      K-------------V-------QNL----NER-DL----------------------QID
A0A0V7ZFJ4      N---------G---NS------IS------ER-NL----------------------QIG
A0A0V7ZNJ9      N---------NSNDSS------IT------ED-NL----------------------QVG
A0A367RIS1      S---------A---QP------IP------DQ-DL----------------------QIG
A0A235IXQ2      S---------S---EP------IP------EQ-DL----------------------QIG
A0A1W5CNX3      S---------W---QP------IP------EQ-DL----------------------QIG
A0A5Q0GJJ5      S---------W---QP------IP------EQ-DL----------------------QIG
Q3MEB7          S---------W---QP------IP------EQ-DL----------------------QIG
A0A1Z4KHN9      S---------S---QP------IP------EQ-DL----------------------QIG
Q8YT70          S---------S---QP------IP------EQ-DL----------------------QIG
A0A166IWU6      S---------S---QP------IP------EQ-DL----------------------QIG
A0A2S0Q8C0      S---------S---QP------IP------EQ-DL----------------------QIG
W6FSX4          S---------S---QP------IP------EQ-DL----------------------QIG
A0A218Q4C1      S---------S---QP------IP------EQ-NL----------------------QIG
A0A6P1ZT04      R---------S---QP------IP------DQ-DL----------------------QIG
A0A5P8VSD1      S---------S---QP------IP------EQ-DL----------------------QIG
A0A1S1ZVW2      N---------V---EV------LQ------QS-NL----------------------QIG
A0A0R0M9H9      N---------A---EV------LQ------QS-NL----------------------QIG
A0A7H0F4U6      N---------A---EV------LQ------QS-NL----------------------QIG
A0A1B7WX82      S---------S---DA------LP------QQ-NL----------------------QIG
A0A1B7WTD1      N---------S---NS------LP------KQ-NL----------------------QIG
A0A480ABC0      N---------S---NS------LP------KQ-NL----------------------QIG
A0A1Z4LRU5      N---------G---VS------VR------EP-DL----------------------QIG
A0A1Z4JVB4      T---------S---AD------VP------EQ-NL----------------------QIG
K9PIA4          N---------S---KY------VP------EQ-KL----------------------QMG
A0A1Z4HVE1      T---------S---ES------VP------EQ-NL----------------------QIG
A0A252ECZ1      N---------S---EF------VP------EQ-NL----------------------QIG
A0A1Z4G5Y1      S---------S---EF------VP------EQ-NL----------------------QIG
A0A252DNA2      S---------S---EF------VP------EQ-NL----------------------QIG
A0A252E1Q4      S---------S---EF------VP------EQ-NL----------------------QIG
A0A6G9SK36      D---------S---EY------MP------EQ-NL----------------------QIG
A0A1Z4M597      N---------S---EY------MP------EQ-NL----------------------QIG
A0A1Z4MWT1      N---------S---EY------TP------EQ-NL----------------------QIG
A0A1Z4TX53      N---------S---EY------TP------EQ-NL----------------------QIG
A0A2A2TNQ5      V---------G---ES------VK------EQ-DL----------------------QIG
A0A3S1C4K5      T---------K---QP------VS------EK-NL----------------------QIG
A0A1X4G3D5      N---------V---GA------LG------ER-SL----------------------YMP
D4TNI2          N---------V---GA------LG------ER-SL----------------------YMP
A0A1Z4H6Z8      S---------S---ES------VP------EQ-NL----------------------QIG
A0A1Z4NPM1      G---------G---VA------VP------ER-DL----------------------QIG
A0A3F3KPR9      N---------A---EV------LQ------QS-NL----------------------QIG
D4TGN7          N---------A---EV------LQ------QS-NL----------------------QIG
A0A1Z4UZW9      S---------S---ES------LP------KQ-NL----------------------HIG
A0A0K2M5H0      S---------S---EF------LS------KQ-NL----------------------QIG
A0A1B7VSH4      N---------F---ES------LS------QQ-NL----------------------QIG
A0A1B7W126      N---------F---ES------LS------QQ-NL----------------------QIG
A0A3D4C6Q6      N---------F---ES------LS------QQ-NL----------------------QIG
A0A1B7UVJ4      S---------S---DA------LS------QQ-NL----------------------QIG
A0A1B7UTR1      S---------S---KS------LP------QQ-NL----------------------QVG
K7W0A4          S---------S---KS------LP------QQ-NL----------------------QVG
A0A5C0DRW9      S---------S---KS------LP------QQ-NL----------------------QVG
A0A6H2C088      S---------S---KS------LP------QQ-NL----------------------QVG
A0A1U7HGH0      Q---------------------TPN----GNN-QL----------------------QVG
K9XJD3          Q---------------------ALN-----NS-QL----------------------QVG
K9SX01          T---------N---EL------IS------DQ-DL----------------------QIG
A0A4P7ZT55      ---------------------------------------------------------QLD
A0A1E5QIR9      N-----------------SPGAIA------PG-NL----------------------QMG
A0A6P1A9A0      T---------D---RV------SQN----AQS-MA----------------------ASP
A0A1Z4IBC7      N---------------------APV----TQG-SL----------------------QVG
A0A1W5CPC7      T---------------------AQV----TQG-SL----------------------QVG
A0A5Q0GKD1      T---------------------AQV----TQG-SL----------------------QVG
Q3MDC6          T---------------------AQV----TQG-SL----------------------QVG
A0A1Z4KM73      T---------------------AQV----TQG-SL----------------------QVG
Q8YNX7          T---------------------AQV----TQG-SL----------------------QVG
A0A367R4K6      E---------------------AQV----TEG-SL----------------------QVG
A0A1E2WSV8      T---------------------AQI----TEG-SL----------------------QVG
A0A7D7L9Y1      T---------------------AQI----TEG-SL----------------------QVG
A0A2R5FRT9      T---------------------AQI----TEG-SL----------------------QVG
A0A2K8T1B6      T---------------------GQI----TEG-SL----------------------QVG
A0A235I9I0      G---------------------AQI----TQG-SL----------------------QVG
A0A2D0HQT8      G---------------------AQI----TQG-SL----------------------QVG
A0A2L2NU95      K---------------------AQI----TQG-SL----------------------QVG
A0A367S084      G---------------------AQI----TQG-SL----------------------QVG
A0A1Z4SMD6      PSGMNLVFGNR---QT------VS------TG-KL----------------------QIG
A0A2H2Y096      PSGMNLVFGNR---QT------VS------TG-KL----------------------QIG
K9S8M8          G-------TPA---SD------IN------PS--Y----------------------QSG
A0A1Z4NFV0      A---------N---FN------TT------PE-RL----------------------EVQ
A0A3M9ZEU1      M---------Q---IP------IS------EG-GL----------------------QLG
A0A1Z4JK72      A---------S---VQ------VA------PG-AL----------------------QVG
A0A0N7Z489      S---------S---VQ------VS------PN-RL----------------------QVG
A0A0S3TXS2      A---------N---VS------VA------PG-AL----------------------QVG
A0A2A2TPF8      S--------KN---VK------ID------PN-SL----------------------QLG
A0A1Z4R0P8      A---------N---VK------IS------PN-SL----------------------QLG
A0A0T7BUI3      N---------Q---LE------VS------LS-NL----------------------QVG
A0A1Z4LP32      R---------Q---QN------IS------NS-RL----------------------QIG
K9REP9          R---------Q---QN------IP------NN-RL----------------------QIG
A0A1Z4SIJ3      T---------T---DN------IS------TN-KL----------------------QVG
A0A2H2XPG4      T---------T---DN------IS------TN-KL----------------------QVG
K9V3C7          S---------S---QQ------IT------PG-NL----------------------QIG
A0A1Z4T6Y7      T---------N---VK------VS------PN-KL----------------------QLG
A0A2H2Y561      T---------N---VK------VS------PN-KL----------------------QLG
A0A1Q4S362      T---------N---VK------VS------PD-KL----------------------QLG
A0A3S1CIN8      T---------N---VK------VS------PD-KL----------------------QLG
A0A2A2TC28      S----GKIGST---KN------IS------PT-NL----------------------QIG
A0A0C1NCB0      S---------Q---RE------IS------TD-KL----------------------QLG
A0A2N6K7Q9      I-------------PI------VS------PG-KL----------------------QIG
A0A2N6MXH6      I-------------PI------VS------PG-KL----------------------QIG
A0A2N6M5A8      I-------------PI------VS------PD-KL----------------------QIG
A0A2N6LL61      I-------------PI------VS------PG-KL----------------------QIG
A0A0S3TP66      I-------------PI------VS------PG-KL----------------------QIG
G6FP91          I-------------PI------VS------PG-KL----------------------QIG
A0A1U7GYR5      I-------------PI------VS------PG-KL----------------------QIG
A0A2N6KY52      I-------------PI------VS------PG-KL----------------------QIG
A0A2N6KMP5      I-------------PI------VS------PG-KL----------------------QIG
A0A2N6MA45      I-------------PI------VS------PG-KL----------------------QIG
A0A4Q9J9V9      I-------------PL------VS------PS-KL----------------------QIG
A0A328IGA1      I-------------PL------VS------PS-KL----------------------QIG
A0A4D9CE41      I-------------PL------VS------PS-KL----------------------QIG
A0A0M0SFT2      I-------------PL------VS------PS-KL----------------------QIG
A0A1Z4TLC8      I-------------PL------VS------PG-KL----------------------QIG
A0A0C2LFH0      PSGVKQVLGTQ---QN------VA------PG-KL----------------------QIG
A0A1Z4IYV4      TKGIKQVLGTQ---KN------VP------PG-KL----------------------QVG
A0A1Z4Q0T6      TKGIKQVLGTQ---QN------VP------PG-KL----------------------QVG
A0A0C2PT44      AKGIKQVLGTQ---QN------VP------PG-KL----------------------QVA
A0A1D2P6J4      TKGIEQVLGTQ---KN------VP------PG-KL----------------------QIG
B4WP72          G---------R---QQ------FE------NS-NM----------------------QLG
A0A2T1CIL7      G---------K---QL------GSL----KSK-LLSI--------------------SDG
A0A433V7A0      Q---------P---IP--------------KG-NF----------------------QFG
A0A2T1FTR8      E---------Q---QFQGKLVELQ---------------------------------PSG
K9UA41          E---------Q---QFQGKLVELQ---------------------------------PSG
A0A0C2LBE2      S---------N---QQ------IS------LG-NL----------------------QNG
A0A433NN38      K---------N---QQ------VS------LK-NL----------------------QIG
A0A2N6K0T2      N---------N---QP------VS------PA-NL----------------------QMG
A0A2N6ML72      N---------N---QQ------IS------TA-NL----------------------QMG
G6FQZ6          N---------N---QQ------IS------TA-NL----------------------QMG
A0A2N6MQX9      N---------N---QQ------IS------TA-NL----------------------QMG
A0A2N6KXT6      N---------N---QQ------IS------TA-NL----------------------QMG
A0A2N6KGB9      N---------N---QQ------IS------TA-NL----------------------QMG
A0A2N6L3Y5      N---------N---QQ------IS------TA-NL----------------------QMG
A0A0S3TIS7      N---------N---QQ------IS------TA-NL----------------------QMG
A0A1U7GW28      N---------N---QQ------IS------TA-NL----------------------QMG
A0A2N6LW63      N---------N---QQ------IS------TA-NL----------------------QMG
A0A328IH74      N---------N---QQ------IS------TA-NL----------------------QMG
A0A4D9CIB0      N---------N---QQ------IS------TA-NL----------------------QMG
A0A1Z4TQ63      N---------N---PQ------IS------TA-NL----------------------QMG
A0A4Q9J8G2      N---------S---QQ------MS------TA-NL----------------------QMG
A0A350Y0P6      L---------K---QS------IP------LN-NL----------------------QSN
A0A352X940      T---------G---EI------LP------TE-NL----------------------QIG
B8HTN4          S---------R---KG------GSL----PTS-NL----------------------QTG
A0A6P1AFJ5      S---------D---NVDSEVQFLA---------------------------------ASP
B0CAX4          T---------K---QP------QP------LR-NL----------------------QAG
A0A1Z4RN12      P---------G---QQG-----LVN----SVN-IA----------------------SLG
A0A2T1CMF9      P---------Q---QQG-----LAG----QIN-IL----------------------RLG
Q7NDC5          R---------R---GLPDSLLDANL----GTG-RTEPAAVPDDLP------------RLD
U5QGK3          Q---------P---GLPDSLVDASV----AAE-AQAPAT-KDNLP------------RLD
A0A2W4UY24      D---------Q---IA------LP------DD-DL----------------------QAG
A0A0D8ZUV2      A---------N---TN------SPV----QGA-NL----------------------QIG
A0A433VDI0      A---------G---VR------RQV----TSQ-QL----------------------QIG
A0A3D1PG43      E--------------P------KQV----PIK-DL----------------------QMG
A0A2P8QQ72      N--------------S------KQV----SNR-NL----------------------EAG
K9TZQ7          N--------------S------KQV----SNR-NL----------------------EAG
A0A6N8G584      N---------A---AA------TEV----SPS-NL----------------------QMG
A0A2G7GPR0      N---------A---AA------TEV----SPS-NL----------------------QMG
K9XH68          N---------A---AA------TEV----SPG-NL----------------------QMG
A0A1U7HW70      N---------A---AA------TEV----SPG-NL----------------------QMG
A0A2S6VEJ8      N---------A---AA------TEV----SPG-NL----------------------QMG
A0A140KBA0      S---------Q---SASSV---AQ------LN-IL----------------------GLG
K9XSG1          S---------Q---SASSV---AQ------LN-IL----------------------GLG
A0A2T1GMT4      S---------Q---AQ------IP------QG-LL----------------------KIG
K9UI51          S---------Q---AQ------IP------QG-LL----------------------KIG
A0A1Z4QL41      S---------Q---TQ------FT------QG-FL----------------------QIG
A0A2T1FXY4      S---------Q---TK------VA------AG-LL----------------------QIG
K9TYI2          S---------Q---TK------VA------AG-LL----------------------QIG
A0A252D4T4      T---------S---AN------IQ------PK-TL----------------------QIG
A0A252DJH5      T---------S---AN------IQ------PK-TL----------------------QIG
A0A252EB80      T---------Q---VN------IQ------PQ-SL----------------------QIG
A0A6G9SKZ9      V---------Q---PN------SQ------PK-TL----------------------QIG
A0A1Z4HPW5      G---------P---VN------YQ------PK-TL----------------------QIG
A0A1Z4MSN1      G---------P---VN------YQ------PK-TL----------------------QIG
A0A1Z4U1C2      G---------P---VN------YQ------PK-TL----------------------QIG
A0A0D6KV51      G---------P---VN------YP------PK-TL----------------------QIG
A0A1Z4MKF8      G---------P---VN------YP------PK-TL----------------------QIG
A0A2C6WC43      S---------N---AQ------VP------QN-LL----------------------QIG
A0A1Z4L5A1      S---------N---AQ------VP------QN-LL----------------------QIG
A0A367QD86      N---------N---AQ------VP------QN-LL----------------------QIG
A0A2K8SM78      N---------Q---TQ------IP------QS-LL----------------------QIG
A0A2R5FPC0      N---------Q---TQ------IP------QR-LL----------------------QIG
A0A5P8W5T6      N---------Q---TQ------IP------QN-LL----------------------QIG
A0A7D7LDT7      N---------R---TP------VP------QS-LL----------------------QIG
A0A235IZ96      N---------Q---TQ------VP------QS-LL----------------------QIG
A0A2L2NGP0      N---------Q---TQ------VP------QS-LL----------------------QIG
K9QM62          K---------R---TT------VS------PK-LL----------------------QIG
A0A1Z4FWI3      N---------P---SN------IQ------PR-TL----------------------QIG
A0A1Z4JYE7      L---------G---QK------LQF----SPT-LL----------------------QIG
A0A0F5YE28      S---------Q---AV------VP------EG-LL----------------------QVP
U7QEH7          S---------Q---AV------VP------EG-LL----------------------QVP
A0A3S1ATK5      S---------S---AK------IP------EE-QLQKTIASIGSGTQ------FPQGQAG
A0A2Z6CPH0      Q---------Q---SQ------FA------PR-LL----------------------QIG
A0A1Z4GT50      N---------Q---VK------IP------QG-QL----------------------QIG
A0A1Z4GIX0      T---------Q---AQ------VP------QR-LL----------------------QIG
A0A2H6LC24      T---------Q---AQ------VP------QR-LL----------------------QIG
B2J6N5          N---------K---TE------VS------QN-LL----------------------QIG
A0A367RMI4      N---------Q---TQ------VP------QN-LL----------------------QIG
A0A235HUM0      N---------Q---TQ------VP------TS-LL----------------------QIG
A0A2L2NW47      N---------Q---TQ------VP------QS-LL----------------------QIG
A0A1E2WUR1      N---------Q---AP------VP------QS-LL----------------------QIG
A0A235IKU3      N---------Q---TQ------IP------QS-LL----------------------QIG
A0A1U7MYU6      S---------Q---SLAGTQIQIT------QG-LL----------------------EVD
A0A1D8TNX9      S---------Q---SLASTQIQIT------QG-LL----------------------EVD
A0A6P0L6C2      S---------Q---SLASTQIQIT------QG-LL----------------------EVD
A0A6P0MVH0      S---------Q---SLAATQIQIT------QG-LL----------------------EVD
A0A6P0KJV0      S---------Q---SLAGTQIQIT------EG-LL----------------------EVD
A0A6L9ZJG4      S---------Q---SLAATQIQIT------QG-LL----------------------EVD
F4XKF3          S---------Q---SLAGTQIQIT------QG-LL----------------------EVD
A0A1D9FX10      S---------Q---SLAGTQIQIT------EG-LL----------------------EVD
A0A6P0Q0T0      S---------Q---SLAGTQIQIT------QG-LL----------------------EVD
A0A6P0W5I0      S---------Q---SLAGTQIQIT------QG-LL----------------------EVD
A0A3C0NJ41      S---------Q---QQ------VP------TG-NL----------------------QIG
A0A352AG88      V---------V---RP------VS------AS-SL----------------------QMG
A0A350Y374      Y---------D---QF------VA------TQ-NL----------------------QIG
A0A355DPX0      Y---------D---QF------VA------TQ-NL----------------------QIG
                                                                            

K9SLA9          DTQA---------------------------------------------QLISNLANLET
A0A168TT23      ---L-------------------------------------------------------A
A0A0M1JWX9      QNSV-------RV------------------------------------GLIQQMVAAAS
A0A2T1M1V6      VTL-GDSSTDSRT------------------------------------AIVADLIRSQS
A0A2G7GCS2      PTLGGNGTRDSRI------------------------------------EMIAELIRSQN
K9XBH8          PTLSGSGTRDSRI------------------------------------DMIAELIRAQN
A0A1Z4LJ30      TSVGQNT-----A------------------------------------ALAEQMILAES
K9RI76          PAIGENT-----A------------------------------------SLAEQVILAES
A0A352AE27      TTMTGER--QGRA------------------------------------TLIQQLILAES
A0A3B8JH60      TTVSTNN--EGRA------------------------------------TLIQQLATAES
A0A3C0N766      TTVSTNN--EGRA------------------------------------TLIQQLATAES
K9W9J7          TTVSTNS--DGRA------------------------------------TLIQQLVLAES
A0A139WSU3      TTVATDS--QGRA------------------------------------ALIQQQVLAES
A0A433VN22      PTIATDS--QGRA------------------------------------VLIQQQLLSES
Q7NF11          DSLAGGGNRDSRI------------------------------------DLILSLLEAER
A0A1Z4JCS8      TDFTTGA--EGRN------------------------------------TLIEQLVLAET
A0A6P0PI80      PTLTDSA--QGRA------------------------------------MLIQQLILAES
A0A6P0WGT6      PTLTDSA--QGRA------------------------------------MLIQQLILAES
F4XTX2          PTLTDSA--QGRA------------------------------------MLIQQLILAES
Q7NJN6          VSLGGNSYRDSRI------------------------------------DLILQLVQSQA
U5QCC3          TTLGGNTYRDSRI------------------------------------DLILQLIQARS
A0A0S3TYD7      MGQF-------RQ------------------------------------QLVTELVMAEI
A0A2T1DNG3      ESLL-------STGQLGGFDQ----------------------------TLIGQFVETQG
A0A3S0Y9N9      PQGL-------QQ------------------------------------GLLTNYASAEA
A0A433UNK7      GQGL-------QQ------------------------------------GLLGNYANVEA
A0A6P0ZKB8      TLGL-------QQ------------------------------------GLLGQFASVEA
U5QL42          AALP-------EARSLAAAPVRQTIQQ----------------------SLASQLLSTQV
A0A140K3H3      GSTS-------QVMGINGADTQAQALNPGQPVDSQGASTQVSGTISTIQSLASMRSQVET
K9XUB8          GSTS-------QIMGINTANTQVSAANTNQAVESQGGSTQVSGTISTIQNLASMRLQVET
A0A6H2NHD5      -----------SLGHQGAVSR----------------------------DLMQQLVNTAN
A0A2P8W4F7      -----------SLGYKGSVSQ----------------------------GLMQQLVNTAN
A0A5Q4E0Z4      -----------ALGYQGSVSR----------------------------GLMQQLVDTAN
A0A2P8VVX1      PTLL-------SYLQLGGIDF----------------------------GLVSQILEADV
A0A2P8WHY0      PDIA-------SLLQLGGVDL----------------------------SLVTDLLEADV
A0A2T1CMT9      LKLL-------QKQGLVGSDT----------------------------GIANTVNDSQA
A0A7G8J1V5      ----------------------------------------------------NQLDAVNL
A0A354B169      ----------------------------------------------------SQLEAVDG
Q0IDT5          ----------------------------------------------------NQLEAVDA
A0A7G8FZD9      ----------------------------------------------------NQLEAVDA
G4FMX5          ----------------------------------------------------NQLEAVDA
A0A7G8FAU7      ----------------------------------------------------NQLEAVDA
A3ZA21          ----------------------------------------------------NQLEAVDA
A0A076HBF2      ----------------------------------------------------NQLEAADA
A0A7G8FP50      ----------------------------------------------------NQLEAVDA
A0A7G8E8K7      ----------------------------------------------------NQLEAVDA
A0A7G8GAH0      ----------------------------------------------------NQLEAVDA
A0A7G8GNR2      ----------------------------------------------------NQLEAADA
A0A7G8ICD3      ----------------------------------------------------NQLEAVDA
A0A2D6FCW3      ----------------------------------------------------NQLEAVDA
A0A7G7KJ95      ----------------------------------------------------NQLEAVDA
A0A7G8EAN3      ----------------------------------------------------NQLEAVDA
A0A563VQJ3      DGLL-------NAGD--NNKE----------------------------TILENFINLKI
A0A1D8TX52      SNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A1D9G4T2      SNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A6P0PR27      NNLL-------TEGQLGGVDL----------------------------NLVNELITSQI
A0A6P0WER7      NNLL-------TEGQLGGVDL----------------------------NLVNELITSQI
F4XP71          NNLL-------TEGQLGGVDL----------------------------NLVNELITSQI
A0A6L9YR57      SNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A6P0KZ31      SNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A6P0LPB8      SNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A6P0SEV1      NNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A6B3N2I8      SNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A6M0B891      SNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A6P0IJQ1      SNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A6P0J8J8      SNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A6P0ZSH6      SNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A1U7N5X9      NNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A6L9Z1V0      NNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A6P0LC12      SNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A6P0MVJ3      SNLL-------TEGQLGGVDI----------------------------NLVNELITSQI
A0A2W6ZAV2      -----------------------------------------------------KLDSIKA
K9W742          ENLL-------TEGQLGETDV----------------------------NLTNKLLELES
A0A3D1PBA3      ENIL-------TQGQLGGIDL----------------------------NLTNQLVDVQT
K9XPB0          QSLL-------RQGELVNSKT----------------------------NFIETITQSQA
A0A350Y7Z1      QNLL-------TEGQLGNNDL----------------------------TLSSQLAEAQT
A0A352X2A7      NTLL-------TEGQLGENDL----------------------------DLSQKLAEAQS
A0A0D8ZYV0      GDLL-------SQGQRGGLDL----------------------------NITAQLAEVQT
A0A2T1FP73      DGIL-------QQGQLGALDL----------------------------NLAGQLIEVQT
A0A433VMS2      DGIL-------QQGQLGALDL----------------------------NLAGQLIEVQT
K9TYA7          DGIL-------QQGQLGALDL----------------------------NLAGQLIEVQT
A0A2P8QUE1      DGIL-------QQGQLGALDL----------------------------NLAGQLIEVQT
K9SA61          DRLL-------TEGQMGELDL----------------------------NLAGQLVETQT
A0A2G7GMH8      T----------TAGQQGQLDI----------------------------NLAGELVEAQT
A0A6N8FU92      T----------TAGQQGQLDI----------------------------DLAGKLVEAQT
A0A2T1DWE8      DGGL-------SVGQLSATDL----------------------------TLANALVDAQV
A0A1U7I8L3      SNLL-------EKGQLGKLDV----------------------------NLSSKLLEEQT
A0A2T1DJL8      DGLV-------AIGQLGENDL----------------------------KFASALVESQV
A0A1Z4J9W0      ESLF-------ATGQLGENDL----------------------------KFASDLTDAQV
A0A0N7Z5K9      SALF-------STGQLGENDL----------------------------KFASDLTQAQV
A0A0S3TXC5      AGLF-------STGQLGENDL----------------------------KFASDLTQAQV
B8HNB0          GS-V-------VQ------------------------------------GLTDKALEAQI
A0A563VS48      ES---------EE------------------------------------GQINEFANLGL
A0A318BJ18      -----------SG------------------------------------SIQAEYREAVQ
A0A3B8Y8H9      -NTI-------RE------------------------------------DILSSLLKAET
A0A2W1JVB9      -E-L-------QQ------------------------------------RATSELVRFET
A0A3M1SVZ4      FSQM-------EQ------------------------------------ELTQELVSLES
A0A6H1U102      YGAI-------QQ------------------------------------GLATQLLQLET
A0A7C3ZEJ3      YGKI-------QQ------------------------------------DLAAQLLEVET
A0A563VLD6      ENSEVNSQGNILA------------------------------------SLGNQLLAAKH
A0A2P8W9H0      -SYI--------------------------------------------------------
A0A6I5P386      -NRI--------------------------------------------------------
A0A654SFI6      ------------------------------------------------------------
A0A318BG22      YE-L--------------------------------------------------------
K9SSQ0          QSSI-------KQ------------------------------------NLATQLFDTQT
A0A2W1JIN9      SARV-------GQ------------------------------------DLSVQLIQGKI
A0A318AJV1      --------------------------------------------------------SLQA
A0A6P0IC70      SDQL-------SQ------------------------------------ELTSRYIISNT
A0A6B3MUB5      SDQL-------SQ------------------------------------ELTSRYIISNT
A0A6M0B7N4      SDQL-------SQ------------------------------------ELTSRYIISNT
A0A6P0J9W3      SDQL-------SQ------------------------------------ELTSRYIISNT
A0A6P0ZWE1      SDQL-------SQ------------------------------------ELTSRYIISNT
A0A1U7N2U4      SDQL-------SQ------------------------------------DFTSRFILAET
A0A1D9G1F2      SDQL-------SQ------------------------------------DFTSRFILAET
A0A6P0PNZ7      SDQL-------SQ------------------------------------DFTSRFILAQT
F4XV38          SDQL-------SQ------------------------------------DFTSRFILAQT
A0A6P0W137      SDQL-------SQ------------------------------------DFTSRFILAQT
A0A6L9Y9E2      SDQL-------SQ------------------------------------DFTSRFILAET
A0A6P0SGR0      SDQL-------SQ------------------------------------DFTSRFILAET
A0A6M0BK48      SDQL-------SQ------------------------------------DFTSRFILAET
A0A6L9YZL1      SDQL-------SQ------------------------------------DFTSRFILAET
A0A6P0KYM4      SDQL-------SQ------------------------------------DFTSRFILSET
A0A6P0LSD6      SDQL-------SQ------------------------------------DFTSRFILAET
A0A6P0X384      SDEL-------SQ------------------------------------TIITKFIEAET
A0A2P8QIL5      TDKL-------SQ------------------------------------DLATQLITGEV
A0A2T1FLY5      TDKL-------SQ------------------------------------DLATQLITGEV
A0A433W447      TDKL-------SQ------------------------------------DLATQLITGEV
K9U1K8          TDKL-------SQ------------------------------------DLATQLITGEV
K9UYB2          DDQI-------SQ------------------------------------QLVSSLITSNI
A0A218QN17      GDQI-------SQ------------------------------------ELTSKLLANET
K9RKN2          SDEI-------SQ------------------------------------ELTSKLITNEI
A0A2I8ADV2      SDQI-------SQ------------------------------------NLTTQLINNEV
A0A1W5CKM3      NDQI-------SQ------------------------------------TLISDLITNDI
A0A5Q0GMF5      NDQI-------SQ------------------------------------TLISDLITNDI
Q3MEW0          NDQI-------SQ------------------------------------TLISDLITNDI
A0A1Z4KIC7      NDQI-------SQ------------------------------------TLISDLITNDI
Q8YSM5          NDQI-------SQ------------------------------------TLISDLITNDI
A0A1Q4S1H4      NDTL-------SQ------------------------------------TLNSQLVTNTV
A0A433VBU6      NDNL-------SQ------------------------------------TLNSQLVTNTV
A0A1Q4RZJ6      GDPI-------SQ------------------------------------DLTSQLITNEI
A0A1Z4SNV3      GDAI-------SQ------------------------------------DLTSKLITNEI
A0A2H2XJQ1      GDAI-------SQ------------------------------------DLTSKLITNEI
A0A3S5K358      GDPI-------SQ------------------------------------DLTSQLITNEI
A0A0T7BPJ4      SDDL-------TK------------------------------------DLTAQLITNQT
A0A0C1QS61      ADQV-------SQ------------------------------------NFSAQLIANDI
A0A139X3R8      ADQV-------SQ------------------------------------NFSAQLIANDI
A0A1Z4I7C5      NDQI-------SQ------------------------------------NLISELITNDI
A0A0C2MDK7      GDQL-------SQ------------------------------------ELNSKFILNRI
A0A1Y0RCK1      GDQL-------SQ------------------------------------DLNSKFIVNRI
A0A1Z4PWZ0      GDQL-------SQ------------------------------------ELNSKFILNRI
A0A0C2QLT0      GDQL-------SQ------------------------------------ELNSKFILNSI
A0A1Z4J2K1      GDQL-------SQ------------------------------------ELNSKFILNSI
A0A3S0ZSX0      SDRI-------SQ------------------------------------DLTSQLLVNDV
A0A2N6K4T3      GDQI-------SQ------------------------------------DLTSQLIINDV
A0A370CKT2      GDQI-------SQ------------------------------------DLTSQLIINDV
A0A0S3TL97      GDQI-------SQ------------------------------------DLTSQLIINDV
A0A2N6M8A0      GDQI-------SQ------------------------------------DLTSQLIINDV
A0A2N6M9E1      GDQI-------SQ------------------------------------DLTSQLIINDV
A0A2N6KJI4      GDQI-------SQ------------------------------------DLTSQLIINDV
A0A2N6MZ77      GDQI-------SQ------------------------------------DLTSQLIINDV
A0A2N6KT20      GDQI-------SQ------------------------------------DLTSQLIINDV
G6FSN3          GDQI-------SQ------------------------------------DLTSQLIINDV
A0A4D9CI02      GDKI-------SQ------------------------------------DLTSELIINDV
A0A328I8B9      GDKI-------SQ------------------------------------DLTSELIVNDV
A0A4Q9J4Z7      GDKI-------SQ------------------------------------DLTSELIVNDV
A0A0M0SU69      GDQI-------SQ------------------------------------DLTSQLIVNDV
A0A1Z4TIZ8      GDKI-------SQ------------------------------------DLTSQLIVNDV
A0A2T1E9V8      -S-I-------QQ------------------------------------DLITTLTKLEI
A0A1Z4LN32      -R-V-------KQ------------------------------------ELISRFVNLRS
A0A2I8A9F5      -E-I-------KR------------------------------------DLSLELGKLQS
A0A218Q6R8      -E-I-------RQ------------------------------------EIVSEFVKLKS
A0A218QGE0      -E-I-------KQ------------------------------------NLTSDFVRLQS
A0A3M2GQQ6      SGAI-------KE------------------------------------SLATQLLQVET
A0A6H1U2X0      SGAI-------KE------------------------------------SLATQLLQVET
K1XF69          -D-V-------KN------------------------------------NKIEEFVNAEI
B5W297          -D-V-------KN------------------------------------NKIEEFVNAEI
A0A6H2AL05      -D-V-------KN------------------------------------NKIEEFVNAEI
H1W7M8          -D-V-------KN------------------------------------NKIEEFVNAEI
A0A5Q4H6A5      -D-V-------KN------------------------------------NQIEEFVNAEI
D5A466          -D-V-------KN------------------------------------NKIEEFVNAEI
U5QJM6          -E-L-------RV------------------------------------SLAGDLVKAEN
A0A1Z4RPC6      -N-V-------RE------------------------------------NQLERFISLKI
A0A2T1CMZ0      -N-L-------KD------------------------------------NQIEKFINLKI
L8M4F7          -Q-Y-------AP------------------------------------GQLEKFIELKI
A0A140K2P2      -G-L-------KE------------------------------------NQLEKFITLEI
K9XWX4          -G-L-------KE------------------------------------NQLEKFITLEI
A0A140KB14      -G-N-------KE------------------------------------NQLEKYISLEI
K9XX88          -G-N-------KE------------------------------------NPLEKYISLEI
A0A563VSV6      -R-F-------QE------------------------------------NPLEKFINLKI
L8LZE9          LG-Q-------KE------------------------------------NPLERFISLKI
A0A433NM31      -E-L-------QQ------------------------------------KLTEDYVKTEV
A0A1Z4NDS1      -D-L-------RQ------------------------------------KLMEDYARAEA
U9VXM0          -D-L-------EQ------------------------------------ELIAEYLRLDG
A0A6M0RI13      -Q-L-------EQ------------------------------------DLIAEYLRLDG
A0A6M0S1N5      -Q-L-------EQ------------------------------------DLIAEYLRLDG
K9F4D9          -Q-L-------EQ------------------------------------DLIAEYLRLDG
A0A6I5QPI5      -E-L-------RQ------------------------------------NLIAELTSLEI
A0A1Z3HMQ0      -E-L-------SR------------------------------------QLTSQLTEAEV
A0A433W533      -E-S-------KQ------------------------------------KLTEAYIQLEV
A0A2P8QWJ3      -E-S-------KQ------------------------------------KLTEAYIQLEV
A0A2T1FKP8      -E-S-------KQ------------------------------------KLTEAYIQLEV
K9U6L7          -E-S-------KQ------------------------------------KLTEAYIQLEV
A0A1E5QP61      -E-L-------QQ------------------------------------QLTADLVNAEV
U5DPF5          -E-V-------EI------------------------------------QLTGDLVRAEV
A0A6P0X488      -D-L-------EQ------------------------------------SMTEDLVNAEI
A0A6P0UVD5      -E-L-------EQ------------------------------------SMTENLINAEV
A0A6P0VDM0      -E-L-------EQ------------------------------------SMTENLINAEV
A0A6M0G142      -E-L-------EQ------------------------------------SMTEALVNAEV
A0A6P0MR53      -D-L-------EQ------------------------------------SMTEALVNAEV
A0A3M2GIL5      -L-V-------QQ------------------------------------QLLLDLVDSEV
A0A6H1TSJ9      -L-V-------QQ------------------------------------QLLLDLVDSEV
A0A3M1PML8      -A-L-------QQ------------------------------------DLIGELVRLEV
A0A6M8BE85      -A-L-------QQ------------------------------------DLIGELVRLEV
A0A0T7BPZ0      -D-V-------RY------------------------------------ELIADIVKTER
A0A352X442      -Q-T-------KQ------------------------------------DLAAKLVAAEV
A0A6B3NF44      -E-L-------KE------------------------------------ELAAALVDSQV
A0A6M0EPL4      -E-L-------KE------------------------------------ELAAALVDSQV
A0A6P0K6L6      -E-L-------KE------------------------------------ELAAALVDSQV
A0A6P0MRR9      -S-D-------GQ------------------------------------KIIHAYANLEA
A0A6P0UX57      -R-D-------GQ------------------------------------QIMYAYANLEA
A0A6P0X1X4      -R-N-------GQ------------------------------------ETIHAYANLEA
A0A0M0SHU3      -E-V-------RQ------------------------------------KLIEDLANTDK
A0A1D2PBN3      -E-L-------RQ------------------------------------KLLEDYARSEA
A0A0C2LVR7      -E-L-------RQ------------------------------------KLLEDYARSEA
A0A1Z4PQB9      -E-L-------RQ------------------------------------KLLEDYARSEA
A0A1Z4SFN6      -E-L-------RQ------------------------------------NLIQNFATTEA
K9PGI8          -E-L-------RQ------------------------------------GLIADFARSEV
K9TLQ0          -NSL-------RS------------------------------------DLTGKLIETVN
K9QF04          -----------RT------------------------------------EIIEKLIAASN
K9W1T3          -DGV-------QQ------------------------------------SLITDFARASA
K9SGJ5          ---I-------QQ------------------------------------NLAGALFETQT
A0A6N2JS94      ---I-------QQ------------------------------------NLASQLFDAQT
A0A6C2DSN4      ---I-------QQ------------------------------------NLASQLFDAQT
L8MYT6          ---I-------QQ------------------------------------NLASQLFDAQT
A0A352JGJ6      ---I-------QQ------------------------------------TLATQLFEAQT
A0A1J5GLS2      ---I-------QQ------------------------------------TLATQLFETQT
A0A2W4W6M5      ---I-------QQ------------------------------------NLATQLFEAQT
A0A2W7AN33      ---I-------QQ------------------------------------NLASQLFDAQT
A0A256BLV2      ---I-------QQ------------------------------------NLASQLFDAQT
A0A2W6ZXF3      ---I-------QQ------------------------------------GLATQLFETQT
A0A2Z5WX66      ---I-------QQ------------------------------------TLATQLFETQT
Q7NEU3          -KGITDRLGDLQV------------------------------------NLAAELIKAEN
A0A3C0N2P0      -SSI-------RK------------------------------------DLAQKLVDTQN
A0A6P0JR04      -NSI-------RL------------------------------------SLTQNLIETLN
A0A6B3M6M6      -SSV-------RL------------------------------------NLIENLVNASN
A0A6P0KD09      -SSV-------RL------------------------------------NLIENLVNASN
A0A6B3NIJ0      -SSV-------RL------------------------------------NLIENLVNASN
A0A6M0F053      -SSV-------RL------------------------------------NLIENLVNASN
A0A6P2ATU9      -NPI-------RL------------------------------------QLTQDFIGATN
A0A352XE00      -SSV-------RL------------------------------------EITKKLIDTKN
A0A6P0QC14      -SSI-------RQ------------------------------------DLTQKLVETTN
B4VS56          -SSL-------RL------------------------------------ALTQQLVETTN
A0A352AAQ3      -SSL-------RL------------------------------------DLTQKLVETEN
A0A350Y472      -SSI-------RL------------------------------------NLTQKLVETKN
A0A355DVB4      -SSI-------RL------------------------------------NLTQKLVETKN
A0A1Z4RMB9      -DGT-------KE------------------------------------NQLERFITLKI
A0A318B4H2      -R-S-------RS------------------------------------DAEAALRAAQS
B4WQE3          ---V-------QE------------------------------------QLASRIRELNA
A0A2K3BR24      -S-L-------KI------------------------------------DLVGDLVKAQI
K9YXY1          -S-L-------KI------------------------------------GLVGDLVKAQI
A0A1Q4RTR1      -S-L-------KQ------------------------------------NLIAELVKLEV
A0A1Z4SQV2      -P-L-------KQ------------------------------------NLIAELVKLEV
A0A2H2XGN1      -P-L-------KQ------------------------------------NLIAELVKLEV
A0A433UXH8      -P-L-------KQ------------------------------------NLTAELVKLEV
A0A0V7ZFJ4      -E-I-------KQ------------------------------------NLTAELVKSEV
A0A0V7ZNJ9      -E-I-------KQ------------------------------------TLTSELLKSEV
A0A367RIS1      -E-L-------KQ------------------------------------TLTANLVQVEV
A0A235IXQ2      -E-L-------KQ------------------------------------TLTANLVQVEV
A0A1W5CNX3      -E-L-------KQ------------------------------------TLTANLVQVEV
A0A5Q0GJJ5      -E-L-------KQ------------------------------------TLTANLVQVEV
Q3MEB7          -E-L-------KQ------------------------------------TLTANLVQVEV
A0A1Z4KHN9      -E-L-------KQ------------------------------------ALTANLVQVEV
Q8YT70          -E-L-------KQ------------------------------------ALTANLVQVEV
A0A166IWU6      -E-L-------KQ------------------------------------ALTANLVQVEV
A0A2S0Q8C0      -E-L-------KQ------------------------------------ALTANLVQVEV
W6FSX4          -E-L-------KQ------------------------------------ALTANLVQVEV
A0A218Q4C1      -E-L-------KQ------------------------------------ALTANLVQVEV
A0A6P1ZT04      -E-L-------KQ------------------------------------ALTANLVQVEV
A0A5P8VSD1      -E-L-------KQ------------------------------------TLTANLVQLEV
A0A1S1ZVW2      -E-L-------KQ------------------------------------ALTQDLVRSEV
A0A0R0M9H9      -E-L-------KQ------------------------------------GLTQDLVRSEV
A0A7H0F4U6      -E-L-------KQ------------------------------------GLTQDLVRSEV
A0A1B7WX82      -E-L-------KQ------------------------------------SLTEALVKSEV
A0A1B7WTD1      -E-L-------KQ------------------------------------ALTQDLVKSEV
A0A480ABC0      -E-L-------KQ------------------------------------ALTQDLVKSEV
A0A1Z4LRU5      -E-L-------KQ------------------------------------SLTAELIKSEV
A0A1Z4JVB4      -D-L-------KQ------------------------------------NLSQDLVKAEV
K9PIA4          -K-L-------KQ------------------------------------TLTTDLVKSEV
A0A1Z4HVE1      -Q-L-------KQ------------------------------------ILSQDLVKAEV
A0A252ECZ1      -K-L-------KQ------------------------------------NLTEELVKSEV
A0A1Z4G5Y1      -V-L-------KQ------------------------------------NLTEALVKSEV
A0A252DNA2      -K-L-------KQ------------------------------------NLTEELVKSEV
A0A252E1Q4      -K-L-------KQ------------------------------------NLTEELVKSEV
A0A6G9SK36      -K-L-------KQ------------------------------------TLTEELVKSEV
A0A1Z4M597      -N-L-------KQ------------------------------------TLTENLVKSEV
A0A1Z4MWT1      -N-L-------KQ------------------------------------TLTENLVKSEV
A0A1Z4TX53      -N-L-------KQ------------------------------------TLTENLVKSEV
A0A2A2TNQ5      -E-L-------KQ------------------------------------SLTGELVKSEV
A0A3S1C4K5      -Q-L-------KQ------------------------------------TLTLDLVKSEV
A0A1X4G3D5      -S-L-------KQ------------------------------------GLTEELVKSEI
D4TNI2          -D-L-------KQ------------------------------------GLTEELVKSEI
A0A1Z4H6Z8      -E-L-------KQ------------------------------------TLSEDLVKSEV
A0A1Z4NPM1      -Q-L-------KQ------------------------------------SLTADLVRAEA
A0A3F3KPR9      -E-L-------KQ------------------------------------GLTQDLVRSEV
D4TGN7          -E-L-------KQ------------------------------------GLTQDLVRSEV
A0A1Z4UZW9      -E-L-------KQ------------------------------------SLTQDLVKSEV
A0A0K2M5H0      -E-L-------KQ------------------------------------ALTQDLVKSEV
A0A1B7VSH4      -E-L-------KQ------------------------------------TLTQDLVKSEV
A0A1B7W126      -E-L-------KQ------------------------------------TLTQDLVKSEV
A0A3D4C6Q6      -E-L-------KQ------------------------------------TLTQDLVKSEV
A0A1B7UVJ4      -E-L-------KQ------------------------------------SLTQELVKSEV
A0A1B7UTR1      -E-L-------KQ------------------------------------ALTQDLVKSEV
K7W0A4          -E-L-------KQ------------------------------------ALTQDLVKSEV
A0A5C0DRW9      -E-L-------KQ------------------------------------ALTQDLVKSEV
A0A6H2C088      -E-L-------KQ------------------------------------ALTQDLVKSEV
A0A1U7HGH0      -Q-I-------QQ------------------------------------DLISDLIAAEI
K9XJD3          -E-I-------QQ------------------------------------ELISDLIAAEV
K9SX01          -G-A-------QL------------------------------------ELITQLVTKEI
A0A4P7ZT55      -A------------------------------------------------VASALQENAA
A0A1E5QIR9      -Q-L-------QL------------------------------------DLMQQLVNSEV
A0A6P1A9A0      -NPI-------RL------------------------------------QLTQQLIEATN
A0A1Z4IBC7      -Q-L-------RQ------------------------------------SLIADITRAEA
A0A1W5CPC7      -Q-L-------KQ------------------------------------SIIADITRAES
A0A5Q0GKD1      -Q-L-------KQ------------------------------------SIIADITRAES
Q3MDC6          -Q-L-------KQ------------------------------------SIIADITRAES
A0A1Z4KM73      -Q-L-------KQ------------------------------------SLIADITRAES
Q8YNX7          -Q-L-------KQ------------------------------------SLIADITRAES
A0A367R4K6      -Q-L-------RQ------------------------------------SLIADITRAEA
A0A1E2WSV8      -Q-L-------RQ------------------------------------SLIADITRAQA
A0A7D7L9Y1      -Q-L-------RQ------------------------------------SLIADITRAQA
A0A2R5FRT9      -Q-L-------RQ------------------------------------SLIADITRAQA
A0A2K8T1B6      -Q-L-------RQ------------------------------------SLIADITRAQA
A0A235I9I0      -Q-L-------RQ------------------------------------SLIADITRAQA
A0A2D0HQT8      -Q-L-------RQ------------------------------------SLIADITRAQA
A0A2L2NU95      -Q-L-------RQ------------------------------------SLIADITRAQA
A0A367S084      -Q-L-------RQ------------------------------------SLIADITRAQA
A0A1Z4SMD6      -Q-I-------KQ------------------------------------NLASQLSQLQT
A0A2H2Y096      -Q-I-------KQ------------------------------------NLASQLSQLQT
K9S8M8          -E-L-------HR------------------------------------TLTNNLVETEN
A0A1Z4NFV0      -G-L-------RE------------------------------------KLLNEYVQLQA
A0A3M9ZEU1      -T-L-------RE------------------------------------TLTANLIDAEV
A0A1Z4JK72      -D-I-------KR------------------------------------KLAESLATLQS
A0A0N7Z489      -D-I-------KR------------------------------------NLAAALSTLQS
A0A0S3TXS2      -D-I-------KR------------------------------------NLAAALSTLQS
A0A2A2TPF8      -A-L-------KE------------------------------------QLLGESVRLQA
A0A1Z4R0P8      -G-L-------KE------------------------------------QLVGESVRLQA
A0A0T7BUI3      -K-I-------RE------------------------------------DLANQYVQLKT
A0A1Z4LP32      -D-I-------KQ------------------------------------NLVNQLVQLQT
K9REP9          -E-I-------KQ------------------------------------SLVNQLVQVQT
A0A1Z4SIJ3      -K-I-------KQ------------------------------------DLAVQYLQFQG
A0A2H2XPG4      -K-I-------KQ------------------------------------DLAVQYLQFQG
K9V3C7          -D-I-------KQ------------------------------------DLANQYVSLQS
A0A1Z4T6Y7      -Q-L-------KE------------------------------------QLVGESVRLQA
A0A2H2Y561      -Q-L-------KE------------------------------------QLVGESVRLQA
A0A1Q4S362      -Q-L-------KE------------------------------------QLVGESVRLQA
A0A3S1CIN8      -Q-L-------KE------------------------------------QLVGESVRLQA
A0A2A2TC28      -K-I-------KE------------------------------------DLASQYVQLLA
A0A0C1NCB0      -K-I-------KQ------------------------------------DMTVEYANLEK
A0A2N6K7Q9      -K-I-------RE------------------------------------ELTDKYVELKA
A0A2N6MXH6      -K-I-------RE------------------------------------ELTDKYVEFKA
A0A2N6M5A8      -K-I-------RE------------------------------------ELTDKYVEFKA
A0A2N6LL61      -K-I-------RE------------------------------------ELTDKYVEFKA
A0A0S3TP66      -K-I-------RE------------------------------------ELTDKYVEFKA
G6FP91          -K-I-------RE------------------------------------ELTDKYVEFKA
A0A1U7GYR5      -K-I-------RE------------------------------------ELTDKYVEFKA
A0A2N6KY52      -K-I-------RE------------------------------------ELTDKYVEFKA
A0A2N6KMP5      -K-I-------RE------------------------------------ELTDKYVEFKA
A0A2N6MA45      -K-I-------RE------------------------------------ELTDKYVEFKA
A0A4Q9J9V9      -K-I-------RE------------------------------------SLVDNYVQLKA
A0A328IGA1      -K-I-------RE------------------------------------SLVDNYVQLKA
A0A4D9CE41      -K-I-------RE------------------------------------SLVDNYVQLKA
A0A0M0SFT2      -K-I-------RE------------------------------------NLVDNYVQLKA
A0A1Z4TLC8      -K-I-------RE------------------------------------EMVGNYVQLKA
A0A0C2LFH0      -K-I-------KE------------------------------------NLTTQYALIQA
A0A1Z4IYV4      -K-I-------KE------------------------------------NLTSEFAKIQA
A0A1Z4Q0T6      -K-I-------KE------------------------------------NLTSEFARIQA
A0A0C2PT44      -K-I-------KE------------------------------------NLTSEFAKIQA
A0A1D2P6J4      -K-I-------KE------------------------------------NLTSEFAKVQA
B4WP72          -E-L-------QQ------------------------------------SLIELYLQLEV
A0A2T1CIL7      -A-S-------EQ------------------------------------KMVAEYANLGV
A0A433V7A0      -E-T-------HQ------------------------------------KLLEELVKTQA
A0A2T1FTR8      ---I-------QG------------------------------------NLIADYAKSEA
K9UA41          ---I-------QG------------------------------------NLIADYAKSEA
A0A0C2LBE2      -S-L-------RQ------------------------------------KLLEDYAGTEA
A0A433NN38      -G-V-------RQ------------------------------------NLIQDLANTEK
A0A2N6K0T2      -E-V-------RQ------------------------------------RLIEDLANTEK
A0A2N6ML72      -E-V-------RQ------------------------------------KLIEDLANTDK
G6FQZ6          -E-V-------RQ------------------------------------KLIEDLANTDK
A0A2N6MQX9      -E-V-------RQ------------------------------------KLIEDLANTDK
A0A2N6KXT6      -E-V-------RQ------------------------------------KLIEDLANTDK
A0A2N6KGB9      -E-V-------RQ------------------------------------KLIEDLANTDK
A0A2N6L3Y5      -E-V-------RQ------------------------------------KLIEDLANTDK
A0A0S3TIS7      -E-V-------RQ------------------------------------KLIEDLANTDK
A0A1U7GW28      -E-V-------RQ------------------------------------KLIEDLANTDK
A0A2N6LW63      -E-V-------RQ------------------------------------KLIEDLANTDK
A0A328IH74      -E-V-------RQ------------------------------------KLIEDLANTDK
A0A4D9CIB0      -E-V-------RQ------------------------------------KLIEDLANTDK
A0A1Z4TQ63      -E-V-------RQ------------------------------------KLIEDLANTDK
A0A4Q9J8G2      -E-V-------RQ------------------------------------KLIEDLASTDK
A0A350Y0P6      -E-F-------QQ------------------------------------QMMATLVNAEA
A0A352X940      -D-L-------KE------------------------------------SMTKDLVKAEV
B8HTN4          -A-S-------EQ------------------------------------QLVDNFINAEV
A0A6P1AFJ5      -NPL-------RL------------------------------------QLTQSLVETNN
B0CAX4          -E-S-------RQ------------------------------------SLTDALVEAEV
A0A1Z4RN12      -E-L-------KQ------------------------------------SQLAEFAELGL
A0A2T1CMF9      -E-L-------KQ------------------------------------GQLTEFADLGL
Q7NDC5          -A-V-------RQ------------------------------------QLLKDLIAARV
U5QGK3          -L-V-------RQ------------------------------------KLLKDLVDARV
A0A2W4UY24      -E-L-------EQ------------------------------------SLILSFLQLDA
A0A0D8ZUV2      -E-S-------KQ------------------------------------KLNEELVQSEA
A0A433VDI0      -E-S-------QQ------------------------------------KLNEALVKLEE
A0A3D1PG43      -A-L-------KQ------------------------------------KLTEDFATSEV
A0A2P8QQ72      -E-L-------QQ------------------------------------KLAEDLVRAEV
K9TZQ7          -E-L-------QQ------------------------------------KLAEDLVRAEV
A0A6N8G584      -Q-L-------RQ------------------------------------ELTQNYVNSEI
A0A2G7GPR0      -E-I-------RQ------------------------------------ELTQNYVNSEI
K9XH68          -E-I-------RQ------------------------------------ELTQNYVNSEI
A0A1U7HW70      -E-I-------RQ------------------------------------ELTQNYVNSEI
A0A2S6VEJ8      -Q-I-------RQ------------------------------------ELTQNYVNSEI
A0A140KBA0      -R-L-------KQ------------------------------------EQISEFASLGL
K9XSG1          -K-L-------KQ------------------------------------EQISEFANLGL
A0A2T1GMT4      -D-L-------KQ------------------------------------NLITELLRSQV
K9UI51          -D-L-------KQ------------------------------------NLITELLRSQV
A0A1Z4QL41      -E-L-------RQ------------------------------------KLIQDFLQSEV
A0A2T1FXY4      -E-L-------RQ------------------------------------DLIENLLQSDV
K9TYI2          -E-L-------RQ------------------------------------DLIENLLQSDV
A0A252D4T4      -P-T-------KQ------------------------------------DLIKEFLQSEV
A0A252DJH5      -P-T-------KQ------------------------------------DLIKEFLQSEV
A0A252EB80      -E-T-------KQ------------------------------------NLIRDFLQSEV
A0A6G9SKZ9      -E-T-------KQ------------------------------------NLIRDFLQSEV
A0A1Z4HPW5      -E-T-------KQ------------------------------------NLIREFLQSDV
A0A1Z4MSN1      -E-T-------KQ------------------------------------NLIRDFLQSDV
A0A1Z4U1C2      -E-T-------KQ------------------------------------NLIRDFLQSDV
A0A0D6KV51      -E-T-------KQ------------------------------------NLIRDFLQSEV
A0A1Z4MKF8      -E-T-------KQ------------------------------------NLIRDFLQSEV
A0A2C6WC43      -E-L-------RQ------------------------------------TLIQDFLQSEV
A0A1Z4L5A1      -E-L-------RQ------------------------------------NLIRDFLQSEV
A0A367QD86      -E-L-------RQ------------------------------------NLIQDFLQSEV
A0A2K8SM78      -E-L-------RQ------------------------------------NLIQNFLQSEI
A0A2R5FPC0      -D-L-------RQ------------------------------------NLIQSFLQSEI
A0A5P8W5T6      -E-L-------RQ------------------------------------NLIQSFLQSEV
A0A7D7LDT7      -E-L-------RQ------------------------------------NLIQNFLQSEI
A0A235IZ96      -E-L-------RQ------------------------------------GLIQNFLQSEI
A0A2L2NGP0      -E-L-------RQ------------------------------------GLIQNFLQSEI
K9QM62          -E-L-------QQ------------------------------------GLITDFLRSEV
A0A1Z4FWI3      -E-T-------KQ------------------------------------NLINTFLQAEV
A0A1Z4JYE7      -E-V-------RQ------------------------------------NLINNFLQLEL
A0A0F5YE28      -QGQ-------KN------------------------------------NQLERFIANEI
U7QEH7          -QGQ-------KN------------------------------------NQLERFIANEI
A0A3S1ATK5      -E-I-------RQ------------------------------------KFIQDFLQVEV
A0A2Z6CPH0      -E-L-------RQ------------------------------------NLIQNFLQLEV
A0A1Z4GT50      -E-L-------KQ------------------------------------NLIKDFLQSEV
A0A1Z4GIX0      -E-L-------RQ------------------------------------TLIQNFLQLEV
A0A2H6LC24      -E-L-------RQ------------------------------------TLIQNFLQLEV
B2J6N5          -G-L-------KQ------------------------------------NLIQNFLQSEI
A0A367RMI4      -E-L-------RQ------------------------------------SLIQNFLQSEI
A0A235HUM0      -E-L-------RQ------------------------------------SLIQNFLQSEI
A0A2L2NW47      -E-L-------RQ------------------------------------SLIQNFLQSEI
A0A1E2WUR1      -E-L-------RQ------------------------------------NLIQNFLQSEI
A0A235IKU3      -E-L-------RQ------------------------------------GLIQNFLQSEI
A0A1U7MYU6      -Q-L-------KQ------------------------------------KLISDFIESEV
A0A1D8TNX9      -Q-L-------KQ------------------------------------KLINDFIESEV
A0A6P0L6C2      -Q-L-------KQ------------------------------------KLINDFIESEV
A0A6P0MVH0      -Q-L-------KQ------------------------------------KLINDFIESEV
A0A6P0KJV0      -E-L-------KQ------------------------------------KLISDFIESEV
A0A6L9ZJG4      -Q-L-------KQ------------------------------------KLISDFIESEV
F4XKF3          -Q-L-------KQ------------------------------------KLINDFIESEV
A0A1D9FX10      -E-L-------KQ------------------------------------KLINDFIESEV
A0A6P0Q0T0      -Q-L-------KQ------------------------------------KLINDFIESEV
A0A6P0W5I0      -Q-L-------KQ------------------------------------KLINDFIESEV
A0A3C0NJ41      -Q-F-------KE------------------------------------QLTSDFVKAEV
A0A352AG88      -D-F-------RQ------------------------------------ELTLNLVNAEV
A0A350Y374      -E-F-------KN------------------------------------QLIKDFVNSEV
A0A355DPX0      -E-F-------KN------------------------------------QLIKDFVNSEV
                                                                            

K9SLA9          SKYGLRSRLEALSKLHQDYQKRIDSLPKIEQQQSQLERDLTLARVNYDHLLQQQTSLRSQ
A0A168TT23      EYSNLEAEVAALEDEIAANEERILALNQQGVQYNILRREFETNRELYDGMLQRLKEIGVA
A0A0M1JWX9      QIEVLKMRNQVLAQAAGMLSEYREQFPIVIRQYTDLMRELEVASQTLNQLLAQREQLRLE
A0A2T1M1V6      TAQGLKQQASLLEKELDKLNNEVKFIAKNQGILIELQRKYEIAEGVYKGIIAQLSQNKIN
A0A2G7GCS2      NAAGLQQQANQIASEINRVNAELNSITQNRSQLINLQRQYEIAEGVYKSILGQVEQTKTN
K9XBH8          TASGLQQQANQISSEINRVSTELNNITKNRAQLLDLQRRYEIAEGVYKSIIAQVEQAKTN
A0A1Z4LJ30      QAFGMLKKAEQLQPTIDNLIKTLNGLPQKQATLLELQRQYDIAEGVYNGVVAQAEQAKLG
K9RI76          QVIGMQKKAEKLQPQIDKLSASLNSLPQKQAKLLELQRQYDIAEGVYNGVVAQIEQAKLG
A0A352AE27      TASAQQRQATQLQSQAEQLNATLKLIPGHQAKLLELKRQYEVAEGVYKGLVAQIQKVNID
A0A3B8JH60      EASAQQRQADQLKSEIEKLNASLKALPGNQARVLELQRQVDVAEGVYKGLVAQVQKNNID
A0A3C0N766      EASAQQRQADQLKSEIEKLNASLKALPGNQARVLELQRQVDVAEGVYKGLVAQVQKNNID
K9W9J7          EASGQRRQAEQLQNEIQKLSTTLRTFPANQSRLLELQRQVDVAEGIYKGLVAQVQQNNID
A0A139WSU3      EATAQRRQAQQLNNQITQLQTTLKSFPVNQARLVELQRQVDVTEGVYKGLIAQIQQSNID
A0A433VN22      EAEAQFQQARQLEKQITELQRYLNSLPAKQAQLLELQRQLDVAEGIYKGLVAQVQQKSVD
Q7NF11          AAEARSRQSAQLGRTIEQATERLSAISTRQATLLDLQRRYELAEAAYKAIVAQMQQARLS
A0A1Z4JCS8      NANGQQRQAEQLQQQIDQRQKILNQLPANQAKLNALQRQADVAEGVYKGLVAQTQQSNID
A0A6P0PI80      AASGQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLD
A0A6P0WGT6      AASGQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLD
F4XTX2          AASGQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLD
Q7NJN6          ENGALTNQAARIGEKAASLEERLRTLAPQQSRLKELQRRYEIAEGIYRGLVAQVQQAKVN
U5QCC3          EGLAQNSQANQITEKIDSIDSQLRTMAPQQSKLLELNRRYGIAEGVYKAMLAQVQQAKIN
A0A0S3TYD7      EQMSLEGQVESLSGALSAQQQRASTLPRLSTRQAELERRLRASQSTYESLLSKLQEIQVA
A0A2T1DNG3      SLSTAQARYLSLLSSEQKVRAELQRFPQLLAQYERLKPDIELNRDTLKQLLKAQQDLGLE
A0A3S0Y9N9      ERLSLQVRLKALAEMIQSYRQRADTIPQLELQQRQLEREISATESSYQTLLARYQELQVA
A0A433UNK7      ERLSLQVRLKSLAGVIESYRQRANTLPQLELQQRQLEREIAATDLSYQNLLARYQELQVA
A0A6P0ZKB8      ERLSLQVRLTSLADVIESYRARANTLPQLELQQRELEREIVATESSYNSLLNRYQELQVA
U5QL42          TLSVQKAQLASLTKAQNDIVARFKKIPQLQQQYTELQRDYNVNSQIVNGLLTKLEELRIT
A0A140K3H3      EQAALQSQIAGIQQAKTKVEKTFKQIPQLQQYYAEVKRQFDIKSKAVDYLMQRRQELYIE
K9XUB8          EQASLQTQIAGIQRAKTQVENTFNSIPQLQQYYAELTRQFEVKSGAVNYLMQRRQELDIN
A0A6H2NHD5      QVEVLRTQDQATSQVTQQLQGEIQRLADLSRSYQQIARELAVTEDSLNQLLASRQDLRFK
A0A2P8W4F7      QMQVLQTQDQAIGQVVQQLQAEIQRLADLSRSFQQIDRELTVAESSLNQLLASRQELRLQ
A0A5Q4E0Z4      QMQVLETQDQAIGQAVQQLRAEIQRLADLSRSYQQITRELTVAESSLDQLLTSRQDMRLQ
A0A2P8VVX1      TLESLEARMETLASLESILRDEVNRYPSLMAEYDRLQPAVDTERSTLQELLIQREQISAE
A0A2P8WHY0      AIAGISARWESLATQEQSLRQELNRYPSWIAEYDRLQPRVEIERATLQDLLLQREQISAE
A0A2T1CMT9      RLTGIRQRDLSLAQTEAALKQRLVGFPELISQYRNLTQESEIKRQAVQRLLEAKQKLEIE
A0A7G8J1V5      ALSLNAQRLLSAQAQQKTLNDRFLKKPELINQYSKLQGRLKIAELNLSGLVNARETLQLE
A0A354B169      ALKLNAGRLAMARSQQQALTFQFLRQPALIKQFTDIMQDLKIAEENLAGLVSARENFQLE
Q0IDT5          ALGLNANRLATARAQERTLQDNFLKQPALIKQYETLQTKLTLAQENLSGLVSARETFRLE
A0A7G8FZD9      ALNLNQGRLETAQQQEAQLNAQFLKQPALIKQYEALQTRLKLANENLSGLVSARENFQLE
G4FMX5          ALNLNNGRLQTAQQQVAQLNAQFLKQPALIKQYEALQTRLTIANQNLAGLVSARENFQLE
A0A7G8FAU7      ALSLNAGRLATAQAQERQLNVQFLRQPALIKQYEALQTRLKIAQDNLAGLVSARENFQLE
A3ZA21          ALSLNAGRLATAQAQERQLNVQFLRQPALIKQYEALQTRLKIAQDNLAGLVSARENFQLE
A0A076HBF2      ALSLNAGRLATARMQQATLNQQFLQQPGLIKQYEALQQRLEIAKQNLAGLVSAREKFQLE
A0A7G8FP50      ALSLNTGRLATARTQQATLNRQFLQQPGLIKQYEAVQQRLGIAKRNLLGLESAREKFQLE
A0A7G8E8K7      ALSLNAGRVETARTQQATLNRQFLQQPGLIKQYEALQQRLEIAKQNLAGLVSAREKFQLE
A0A7G8GAH0      ALSLNAGRLDTARMQQATLNQQFLKQPGLIKQYEALQQRLEIAKQNLTGLVSAREKFQLE
A0A7G8GNR2      ALSLNAGRLATARMQQATLNQQFLQQPGLIKQYEALRQRLEIAKQNLAGLVTAREKFQLE
A0A7G8ICD3      ALSLNAGRLATARMQQATLNQQFLQQPGLIKQYEALQQRLEIAKQNLAGLVSAREKFQLE
A0A2D6FCW3      ALNLNAGRLETAKAQETSLNNQFLKQPALIKQYEALQTRLKIAQENLTGLVTARENFQLE
A0A7G7KJ95      ALSLNAGRLATARAQEQELNAQFLKQPALIKQYEALQTRLTIAQENLAGLVSARENFQLE
A0A7G8EAN3      ALSLNAGRLATAKAQEQELNAQFLKQPALIKQYEALQTRLTIAQENLAGLVSARENFQLE
A0A563VQJ3      EELSLQQQLSSVSQSQQEYLKRADELPRLEKKEQELMRKADTANKTYTALLESLQQARLA
A0A1D8TX52      NLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIKQNTLQQLLQARQELSIE
A0A1D9G4T2      NLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6P0PR27      NLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6P0WER7      NLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
F4XP71          NLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6L9YR57      NLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIKQNTLQQLLQARQELSIE
A0A6P0KZ31      NLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6P0LPB8      NLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6P0SEV1      NLVSLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6B3N2I8      NLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6M0B891      NLVSLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6P0IJQ1      NLVSLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6P0J8J8      NLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6P0ZSH6      NLVSLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A1U7N5X9      NLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6L9Z1V0      NLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6P0LC12      NLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A6P0MVJ3      NLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIE
A0A2W6ZAV2      TLAENRSEQAEVNRQALQLSRQFATNPNLVKQYEAIEQRLEIARANLSTYIKTREDFRLE
K9W742          SIRGLMAREQTLAEKEQQLRVELERFPSVLADYNRLQPEIKLKRETLDQLEKARQELSLE
A0A3D1PBA3      NLNALRARDVSLEQTQKQLRTDLNRFPVLLAEYNRLQPLLQINRNKLQQLLQAQQELSLE
K9XPB0          DLKGLEERDRSLAQTESELREKLTQFPALIARYDSLTQEANLKKNALQRLLAAKQELEIA
A0A350Y7Z1      TLQALQARDRSLAITQQQLRAKLNRLPELMAEYERLQPEVQIRRDTLQKLLEARQELGIE
A0A352X2A7      SIQGLQARDRSLAQTEQKLRTKINTLPQLMARYERMQPEVQLKRDTLQKLMQARQDLGIE
A0A0D8ZYV0      SLSALQAQDVSLAKTEQGLRSQLNRFPKLLEEYNRLLPIVQINREKLQQLLRAQQELSLE
A0A2T1FP73      NMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLE
A0A433VMS2      NMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLE
K9TYA7          NMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLE
A0A2P8QUE1      NMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLE
K9SA61          RLQALQARGRSLSQTEQQLTGELQRFPQLLAEYGRLEPQLQLRRETLQELLKARQELGLE
A0A2G7GMH8      NLVSLQANAQSLANAEQQLSAEIQRFPTLLAQYNRLLPEVSVNRETLQQLMTARQELGLQ
A0A6N8FU92      NLASLQANAQSLANAEQQLSAELQRFPGLLAQYNRLLPEVAVNRDTLQQLMTARQELGLQ
A0A2T1DWE8      NLVALQGRAQSLNEAERSLQQQLRRFPSLLAEYGRLQPNVQIGRNTLQQLLKARQDIALE
A0A1U7I8L3      NVQGWQARVQSLTQKAQQIQAELQRFPGMLSQYNRLEPEVKLNRDTLEQLLKARQELSLE
A0A2T1DJL8      NLVAAQARDRSLTNNELQLRGELKRFPSLLAEYNRLQPNVQVNRDTLQQLLKARQDLGLE
A0A1Z4J9W0      EFFGARARDQELARTEQQLRGQLQRFPSLLAEYNRLQPLVTLNRDTLDELQKARQDLSLE
A0A0N7Z5K9      DFFAARARDQTLAAEAQRLQSQLQRFPTLLAEYNRLLPTVKLQRDTLDQLEKARQGLGLE
A0A0S3TXC5      DFFAARARDQSLVAEAQRLQAQLQRFPTLLAEYNRLLPTVKLQRDTLDQLEKARQELGLE
B8HNB0          SLATQTAQLNGIRQAQQQVAERFQALPQLQQQYAELQRQLKVNEDVVGRFMERLQELRIA
A0A563VS48      ERKGLQKRLAAFNKIYSSNQERSSILPQLEEEQKELVRRVEASQTTYETLLNKLQEIQIA
A0A318BJ18      RENALQARVNQLKASYLDNRRR-------SIQYNIYQQEVDTNRALYDGLLQRYKEVGVA
A0A3B8Y8H9      QLEELRARQKELIGLENDIRQEIAQLARLTSEYVDLQRKIEIANQSLTSYLVFQQELELE
A0A2W1JVB9      ERLAAEQVAAALATSQTDFQQRTEAIPALEKQLRQLLRDVEISQEIYANLVRKLQEIQVL
A0A3M1SVZ4      ERQGLNSQISALAQLQAGYQERLNVLPQLEQEERRLERQLELAQATYSQLQQKLQEVRLA
A0A6H1U102      ELEAQRSQLQEIRNAQGKVAVQFEQIPQLQQRYADLQREFQVKSQAVNRFLEKLQELQIA
A0A7C3ZEJ3      ELAAQSSQLQSIRQAQAQVENNFEKIPTLQQAYADLEREFKVKSEAVNRFLEKLQELQIS
A0A563VLD6      EIAILESQIGGTDKAKAKVENSFQDVPQLQEAYAELERQLVVKSESLDYLLKRRQELQIS
A0A2P8W9H0      --RELENRDRALSETIVTLNQTTNRLSTVTRQYNALQRELEIATTNLNQFLTKREALRID
A0A6I5P386      --RELSERERALSETIEALNVETKSLSTVARQYNDIQRELDIATANLNQFLTKREALRID
A0A654SFI6      -----STREREIRKKLEEAKNKFLGQQTLTIQYGILKREVETNRQIYDALLQRYKELGAA
A0A318BG22      ----ALNQERALQVQLDQLKGSVSDLQTRSIQYMILQREVDTNRALYDALLQRFKEIGVA
K9SSQ0          RLATQTAELGSLKIAQTQVEQVFAQIPQLQQTYIELQRQLKQASTRLSTLSQKLEEAKSQ
A0A2W1JIN9      ERLSLQERLEAARGSMKQLESRRQQFPILEQWFTQMDRRREALFNSIQLLERKLDEVRVA
A0A318AJV1      QARAGDAQVASLRSTMAGLEAARARNTRNSADAERLERDAASARAQFDKMSAMSLESTQA
A0A6P0IC70      EQLALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQREEATESLKFLQNKLEEARIA
A0A6B3MUB5      EQLALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQREEATESLKFLQNKLEEARIA
A0A6M0B7N4      EQLALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQREEATESLKFLQNKLEEARIA
A0A6P0J9W3      EQLALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQREEATESLKFLQNKLEEARIA
A0A6P0ZWE1      EQLALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQREEATESLKFLQNKLEEARIA
A0A1U7N2U4      ERSALEQKLYLVQTERIKLQNRLGQIPVLQQPFGTLVRRQDEAIASLKLLQNKLEEARIA
A0A1D9G1F2      ERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARIA
A0A6P0PNZ7      ERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARIA
F4XV38          ERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARIA
A0A6P0W137      ERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARIA
A0A6L9Y9E2      ERSALEQKLYLVQTERIKLQNRLGQIPVLQQPFATLVRRQEEAIASLKLLQNKLEEARIA
A0A6P0SGR0      ERSALEQKLYLVQTERIKLQNRLGQIPVLQQPFATLVRRQEEALASLKLLQNKLEEARIA
A0A6M0BK48      ERSVLEQKLYLVQTERIKLQNRLGQIPVLGQPFATLVRRQDEAIASLKLLQNKLEEARIA
A0A6L9YZL1      ERSVLEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEAGIA
A0A6P0KYM4      ERSVLEQKLYLVQTERIKLQNRLGQIPVLRQPFANLVRRQEEAIASLKLLQNKLEEARIA
A0A6P0LSD6      ERSVLEQKLYLVQTERIKLQNRLGQIPVLRQPFANLVRRQEEAIASLKLLQNKLEEARIA
A0A6P0X384      ERLALQEKLKAVQVELTQLQYRLEQLPIAQKPFAALLRQQEEANNSLKFLQSKLEEARIA
A0A2P8QIL5      EASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIA
A0A2T1FLY5      EASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIA
A0A433W447      EASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIA
K9U1K8          EASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIA
K9UYB2          ERAAIENKLTLVNASVSELRSRLNQLPAQQRPLTALTRKREETATSLKFLQDKLEEARIA
A0A218QN17      ERSAIENKLTTVKAQRTQLQVQIAKLPIQQKPLIALTREREDATASLKSLQSKLEEARIT
K9RKN2          ERLAVERKLAVVRAQTADLKARVAQLPIKQQPLTALVRQREESASTLKFLQGKLEEARLA
A0A2I8ADV2      ERVAVENKLQTVQSLRKNLQAQLAVLPLRQQPLTMLTRQREEAAESLKLLQSKLEEARIA
A0A1W5CKM3      TRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIA
A0A5Q0GMF5      TRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIA
Q3MEW0          TRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIA
A0A1Z4KIC7      TRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIA
Q8YSM5          TRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIA
A0A1Q4S1H4      EGTAVANKLRTLQAERVRLQNRLAQLPIKQEPLTALTRAREEAAESFKGLQRKLEEARIA
A0A433VBU6      EGTAIANKLRTLQAERVKLQTRLAQLPIKQEPLTALTRTREQAAESFKALERKLEEARIA
A0A1Q4RZJ6      ERAAVAEKLQLTQNNIAQLRNRLTQLPLQQQPLTALIRKREEAAASLKFLQAKFEEARIA
A0A1Z4SNV3      ERAAITDKLRVTQNNIAQLRNRLTQLPLQQQPLTALVRKREEAAASLKFLQAKFEEARIA
A0A2H2XJQ1      ERAAITDKLRVTQNNIAQLRNRLTQLPLQQQPLTALVRKREEAAASLKFLQAKFEEARIA
A0A3S5K358      ERAAVAQKLQLTQNNIAQLRNRLTQLPLQQQPLTALIRKREEAAASLKFLQAKFEEARIA
A0A0T7BPJ4      ESLAVQKKLRVIQAERANLQARLGKLPLQQQSVAALTRKREEAAESLKTLQRKLEEARIA
A0A0C1QS61      ERTAVENKLKSVQTQRANLQLRLAQLPIQQQNLTPLTRQREEAAETLKLLQGKYEEARIA
A0A139X3R8      ERTAVENKLKSVQAQRANLQTRFEQLPFKQQQLTPLTRQREEAAETLKLLQSKYEEARIA
A0A1Z4I7C5      TRLAVENRLNAIRQMRADIQRRLALIPIRQQPLTVLTRQREEAAESLKFLQSKLEEAQIA
A0A0C2MDK7      EESAVKERLTLLQKKEADLQNRLAQLPIKQQQLTILTRKREEAAASLKFLQGKLEEARLT
A0A1Y0RCK1      EESAVNDRLKLLQTKKVNLQARLAQLPIKQQTLTVLTRKREEAAASLKFLQSKLEEARLT
A0A1Z4PWZ0      EESAVNDRLKLLQTTKTDLQKRLAQLPINQQTLMLLTRKREEAAVSLKFLQSKLEEARLT
A0A0C2QLT0      EESAVNNRLKLLQVKKANLQARLAQLPITQQTLTVLTRKREEAAASLKFLQSKLEEARLT
A0A1Z4J2K1      EESAVNNRLKLLQVKKANLQARLSQLPITQQTLTVLTRKREEAAASLKFLQSKLEEARLT
A0A3S0ZSX0      ERTAVENKLRVVQANRANLQTRLAELPIRQQKLTPLIRQREESAASLKLLQSKLEEARIA
A0A2N6K4T3      ERLAVENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
A0A370CKT2      ERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
A0A0S3TL97      ERLAQENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
A0A2N6M8A0      ERLALENKLKLVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
A0A2N6M9E1      ERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
A0A2N6KJI4      ERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
A0A2N6MZ77      ERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
A0A2N6KT20      ERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
G6FSN3          ERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIA
A0A4D9CI02      ERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIA
A0A328I8B9      ERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIA
A0A4Q9J4Z7      ERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIA
A0A0M0SU69      ERLAVEKRFRSVQAHRANLQARLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIA
A0A1Z4TIZ8      ERLAIENKFRSVQANRANLQTRLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIA
A0A2T1E9V8      DRLGLITQKTTLLKQQAFYQKKAATLPELQQQQGELERQLLASQSTYETLLKSLQEIKVK
A0A1Z4LN32      QRLGLTQKIDSLSDLKNRYKQRADVIPDLEKRQKELEQKLSIAQKNYENLETRLQEIKVA
A0A2I8A9F5      QRLGLEKRITSLSNLKSAYEQRLGAIPDLEKTHGELEQKMLIAQKNYENLLTKYQEIKIV
A0A218Q6R8      QRLGLAEKIQSISNFRNSYSQRVSNLPSLEKRQGELERKLSRAEKNYENLLTRFQDIKIV
A0A218QGE0      QRLGLEKKVEALSAVIASYKRRAQVMPNLEKQEGDLERRLSIAQKSYENLLTRQLEIEVA
A0A3M2GQQ6      EMSAGLSQLARIRQAQQDVAIQFENIPQLQQRYAELQREFKVKSEAFNRFLEKLQELQIA
A0A6H1U2X0      EMSAGLSQLARIRQAQQDVAIQFENIPQLQQRYAELQREFKVKSEAFNRFLEKLQELQIA
K1XF69          RRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVA
B5W297          RRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVA
A0A6H2AL05      RRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVA
H1W7M8          RRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVA
A0A5Q4H6A5      RRMDLTKQLDSLYEARDGLERRASILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVA
D5A466          RRMDLTKQLDSLYEARDGLERRASILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVA
U5QJM6          LYLVQSARVTGLEAAKERLLGKFQLVPGLAKRYQELNRNAVIASDSLNRLLQRLQELEIK
A0A1Z4RPC6      DELSLQTELASLYKYQQVYLDRAKEVPRLEKEEQALLREVESTRSTYNTLLDNKQEIDIL
A0A2T1CMZ0      EELSLQTELSSLYQYQQVYLNRAKQIPSLEQQEQSLLREVDSARSTYKTLLENKSDLDVL
L8M4F7          QELSLRRQNLALAQAQQIASKRAQAIPKLDSKEQELLLELKIADANYKNLLDSLEQVELE
A0A140K2P2      DKINQQRQLSSLYQTQESYLERAQKLPSLEQKEKDLIRKVKAAQNTYETLLTSLQEVQLA
K9XWX4          DKINQQRQLSSLYQTQQSYLERAQKLPSLEQKEKDLIRKVKAAQTTYETLLTSLQEVQLA
A0A140KB14      DRISQQRQLASLYQSQQAYLQRARQLPQIEQQQQDLVRQVEAAEKVYQNLLDSQQELQLL
K9XX88          DRISQQRQLASLSQSQQAYLQRAKQLPQIEQQQQDLLRQVEAAEKVYQNLLDSQQELKLL
A0A563VSV6      EELSLQQQLSSTYDYQQAYLKRAEQLPKLEQREREINQKVETARSTYENLLSTQQELQIL
L8LZE9          DELSLQQQFASMNDYQQAYLQRAKELPRLEKEEQEAIRKVENIRTTYENLLNTQVELDIL
A0A433NM31      ERIVFNNQLSALSKVYSNYKQRAGIIPQLQQKQRELEREVDAAQSTYATLLKKLEEVRIA
A0A1Z4NDS1      ERSGLARQLVSLQKQWLTYKQRANILPRLEQKQRELERKLKAAQTTYENLLNREQEIRIA
U9VXM0          EQSGLQQQVEQLANARLSQQSRARVIPVLEKQERGLERQLDAAQTTYETLLQNLQQAQVL
A0A6M0RI13      ATSGLQQQVEELTTARLGQQSRARVIPVLEKQERALDRQLAAAQTTYETLLQNLQQAQVL
A0A6M0S1N5      ATSGLQQQVEELTTARLGQQSRARVIPVLEKQERALDRQLAAAQTTYETLLQNLQQAQVL
K9F4D9          ATSGLQQQVEELTTARLGQQSRARVIPVLEKQERALDRQLAAAQTTYETLLQNLQQAQVL
A0A6I5QPI5      ERIGLSNRMSQLMEARANYLERANDLPELEKQQRELDRQLEAAQTTYETLLSQLQETRVI
A0A1Z3HMQ0      NRLSLASQVQALLDSRQAYIEWSQAFPALEKRQLELEQRLLAAKTNYETLLVRLQEAQLA
A0A433W533      ERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTYEILLQKLQEVRVA
A0A2P8QWJ3      ERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTYEILLQKLQEVRVA
A0A2T1FKP8      ERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTYEILLQKLQEVRVA
K9U6L7          ERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTYEILLQKLQEVRVA
A0A1E5QP61      QRLGLGSNVSALVRAQGSYRDRANALPRLEQQQRDLQRQLDAAQSAYQILLRNLQEVRIA
U5DPF5          DRLGTSSRLSSLQREREAYQSRASVLPRLEQGQRELERQLNAAQSTYEALLQRLQEVRVT
A0A6P0X488      ERLGLINRVAALDSAKFTNQQRANILPRLQEGLRDLERKLAAAQSTYEILLKNYQEVQIA
A0A6P0UVD5      ERLGLTNRVAALDRAKLTKQQRANILPRLQEGLRDRERKLAAAQSTYEILLKNYQEVQIA
A0A6P0VDM0      ERLGLTNRVAALDRAKFTNQQRANILPRLQEGLRDRERKLAAAQSTYEILLKNYQEVQIA
A0A6M0G142      ERLGLANRVAALDRAKFNNQQRANILPRLQEGLRDRERKLAAAQSTYEILLKNYNEVQIA
A0A6P0MR53      ERLGLANRVAALDRAKFTNQQRANILPKLQEGLRDLQRKLEAAQSTYEILLKNYQEVQIA
A0A3M2GIL5      QRLGLVSQVRALEEARYSQQQRANVLPRLQEGLRELERKVNAAQSTYEILLKNLQEVQIV
A0A6H1TSJ9      QRLGLVSQVRALEEARYSQQQRANVLPRLQEGLRELERKVNAAQSTYEILLKNLQEVQIV
A0A3M1PML8      QRQGIVLRLNTLSEASNAYRQRASALPRLEQQQRELERRLNAAQTTYEALLLRLQEIQVA
A0A6M8BE85      QRQGIVLRLETLAQASNAYRQRAGALPRLEQQQRELERRLNAAQTTYEALLVRLQEIQVA
A0A0T7BPZ0      ERVVLERKLAKQKSTWAKYRERANALPKLAQTQRELERRLKASQTTYETLLTRLQEIHVA
A0A352X442      EQSGLSRQLAVLTTARIAYKERSNSLPRLQEKEKELERRVEATQLTYSQLLQKLDETRLI
A0A6B3NF44      ERSGLGDHLKELQKTRTAYKTRSNALPRLEQKQRELERKLEAAQSTYGILLSKLQETRVA
A0A6M0EPL4      ERSGLGDHLKELQKTRTAYKTRSNALPRLEQKQRELERKLEAAQSTYGILLSKLQETRVA
A0A6P0K6L6      ERSGLGDHLKELQKTRTAYKTRSNALPRLEQKQRELERKLEAAQSTYGILLSKLQETRVA
A0A6P0MRR9      ERLGLASKLTDLANTRATYKEQTRSFPKLEQKLGEMQRKLDIAQSTYQIILGKLQEAQVA
A0A6P0UX57      ERLGLVSELAVLSSTRATYKAQTRAFPRLEQKLGEKERELDIAQSTYQIIEGKLQEAQVA
A0A6P0X1X4      KRLGLASELAALSQKRATYKAQTRSFPRLEQKLGEKERELQIAQSTYQVIEGKLQEAQVA
A0A0M0SHU3      ERAGLEKRIAELKQTWSLYKQRANILPQLEQTQRELERKLKAAQTTYETLLTRLQEINVA
A0A1D2PBN3      ERVGLERQITTLSNKRSAYKQRANVLPKLEQTQRELERKLKAAQTTYETLLTRLQEIQVA
A0A0C2LVR7      ERVGLERQIITLSSKRSAYKQRANVLPKLEQNQRQLERKLKAAQTTYETLLTRLQEIQVA
A0A1Z4PQB9      ERVGLEKKIITLSSKRSAYKQRANVLPKLEQNQRQLERKIKAAQTTYETLLTRLQEIQVA
A0A1Z4SFN6      ERVGLSQQIATLSSKLSSYKQRVNVLPRLEQIQRQLERKLKASQTTYEALLTRLQEVQVA
K9PGI8          ERAGLEGEITTLSNKLSVYKKRANGLPKFEQTQRQLERKLKAAQTTYEALLTKLQEVQVA
K9TLQ0          LMEMTRARQWAIAQAETIVQQQMQEQATLMRQYTDLQRELELGTESLNRFLAVRENLQIE
K9QF04          QFQALLARQKALAIAENQARRNLQQFAGIARQYADLSRDLEIANQSLNRFLVAKENLQIE
K9W1T3          ERASLEKQIYALANVEAAYRERINTLPKLEQQQRELERRLKTAQSTYEILSPKLQEIRVQ
K9SGJ5          TMAVQAAQMGSVKLAQERVSAIFAQIPQLQQRYTELQRQLELDSAVFTSLSEKLEELRIA
A0A6N2JS94      TLAVSQAQLESIRNAQTEVSTAFSKIPQIQQKYVEIQRQLALDSSTYNKLSEKLEELRIS
A0A6C2DSN4      NLAVSQAQLESIRNAQSEVAAVFSKIPQIQQRYVEIQRQLDLDTSTYNKLTEKLEELRIS
L8MYT6          NLAVSQAQLESIRNAQSEVAAVFSKIPQIQQRYVEIQRQLDLDTSTYNKLTEKLEELRIS
A0A352JGJ6      SLAVNQAQLESIRGAQSEVAKAFSQIPQIQQRYIEIQRKLALDTSTYQKLTEKLEELRIS
A0A1J5GLS2      NLAVSEAQLASIRSAQSEVSRAFSGIPQIQQRYVEIQRQLALDTSTYNKLTEKLEELRIS
A0A2W4W6M5      TLAVSQAQLESIRNAQAEVSSAFSKIPQIQQRYVEIQRQLALDTSTYNKLTEKLEELRIS
A0A2W7AN33      TLAVSQAQLQSIRNAQSEVSKAFSQIPQIQQKYVEIQRQLAIDSSTYNKLSEKLEELKVS
A0A256BLV2      TLAVSQAQLESIRNAQSEVATAFSKIPQIQQRYVEIQRQLALDTSTYNKLSEKLEELRIS
A0A2W6ZXF3      TLAVSEAQLESIRSAQSEVSRAFSGIPQIQQRYVEIQRQLALDTSTYNKLTEKLEELRIS
A0A2Z5WX66      SLAVSQAQLESIRSAQAEVAKAFSQIPQIQQKYIEIQRQLALDTSTYNKLTEKLEELRIS
Q7NEU3          AYRVQTARVAGLENVKNRMIGQFKVVPSLAKRYQELVRDSNLASNSLNRLLERLQELRIQ
A0A3C0N2P0      QIQVLEVRRNKIAKAESVVGQQLTALPDIARRYTDLQQQLKVATESLGRFLTVQETLQVE
A0A6P0JR04      QQQVLTVREAALQSAENQAKAEMQKFAVLNRQYTDLQRQLEVATESLKRFLSVQEDLQIE
A0A6B3M6M6      QMRVLEARQTAIAKAESEMKNNLENLAVISRQYTDLQRQLKVSTESLNRFLAVRETLEIE
A0A6P0KD09      QMRVLEARQTSIAKAEGEMKKNLENLAVISRQYTDLQRQLKVSTESLNRFLAVRETLEIE
A0A6B3NIJ0      QMRVLEARQTSIAKAEGEMKKNLENLAVISRQYTDLQRQLKVSTESLNRFLAVRETLEIE
A0A6M0F053      QMRVLEARQTSIAKAEGEMKKNLENLAVISRQYTDLQRQLKVSTESLNRFLAVRETLEIE
A0A6P2ATU9      EKMVLEVRSAALALAENQTRQDLNRFADLSRQYMDLQRQLSVATESLNRFLAVQEDLQIE
A0A352XE00      EIQSLSVREAALERTENLMESQIKQLPIIARQYTDLQRELKVATESLNRFLAVRETLQIE
A0A6P0QC14      QIQLLEVRTREIAAAEGQLNQQLRNLPAIARNYTDYQRDLTAATESLGRFLAVRETLQIE
B4VS56          QINMLEVRSGAIAKAERLMSQQLKNLAVVARQYTDLQRELKVATESLNRFLAVRETLQIE
A0A352AAQ3      QIQVLQVRQTEIADAESRVSQQIKELPIIARRYTDLNRRLNVATESLSRFLAVREKLQIE
A0A350Y472      QIQVLEVRRNEIADAEIRLSQQLKTLPVIARRYGDLQRRLTVATESLNRFLAVQEKLQID
A0A355DVB4      QIQVLEVRRNEIADAEIRLSQQLKTLPVIARRYGDLQRRLTVATESLNRFLAVQEKLQID
A0A1Z4RMB9      DELSRQRQVESLYQSQQEYLKRAKELPSLEKRDRELVRSAEAASKTYQTLLDSLQKAQIA
A0A318B4H2      KEAQFREQVANLTKNFNTQRTNL-------IEYQILQREVDTNRTLYDGLLQRYKEIGVA
B4WQE3          RDQALRESIATL-------DEQIRNLSTVTRSYNSIQRDLEIAATNLNEFLTKRETLRIE
A0A2K3BR24      NYLAQKSRIKGLKAEKADYQARAKILPKLEQRQRELERQLNASQSTYQALLKRLQEVRVA
K9YXY1          NYLAQKSRIKGLKAEKADYQARAKILPKLEQRQRELERQLNASQSTYQALLKRLQEVRVA
A0A1Q4RTR1      ERTGLSNRISTLSNALTLYKQRATSLPRLEQNQSQLERDLQVARQTYEQLLRRFQEVQVI
A0A1Z4SQV2      ERTGLSNRVSTLGNAFTLYKQRAGILPRLEQNQRQLERNLQVARQTYEQLLRRYQEVQVI
A0A2H2XGN1      ERTGLSNRVSTLGNAFTLYKQRAGILPRLEQNQRQLERNLQVARQTYEQLLRRYQEVQVI
A0A433UXH8      ERTGLSNRVATLGNAFNLYKQRAKILPSLEQNQRQLERNLQVARQTYEQLLRRLQEVQVI
A0A0V7ZFJ4      ERLAAANRVGILRKNFITQQGRLRSLPKLEQTQRQLQRKLEVAQLTYTELLKKLQEVQVV
A0A0V7ZNJ9      ERLAVAKQVGVLRKAFALQQARLTVLPKLEQQQRQVERKLQIAQLTYQNLLKKLQEVQVI
A0A367RIS1      ERLGLENQVGVLMKAFVLYQARLRTLPKLEQLQLQRQRQLQVAQTTYEQMLKRLQEVQVL
A0A235IXQ2      EKLGLKNQVSVLMKAFLLYQARLRSLPKLEQEQLEVKRQLEVAQTTYEQMLKRLQEVQVL
A0A1W5CNX3      ERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVV
A0A5Q0GJJ5      ERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVV
Q3MEB7          ERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVV
A0A1Z4KHN9      ERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVV
Q8YT70          ERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVV
A0A166IWU6      ERLGLENQVGVLTNAFKQDRARLRILPKLQQQELQLQRQLQVARITYEQMLRRLQEVQVA
A0A2S0Q8C0      ERLGLENQVGVLTNAFKQDRARLKILPKLEQQQLQLQRQLQVARTTYEQMLRRLQEVQVA
W6FSX4          ERLGLENQVGVLTNAFKQDRARLKILPKLEQQQLQLQRQLQVARTTYEQMLRRLQEVQVA
A0A218Q4C1      ERLGLENQVDVLTQAFTFDQVRLRSLPRLEQQQLQLQRQLQVARNTYEQLLGRLQEVQLV
A0A6P1ZT04      ERLGLENQVDVLTQAFTFDQVRLRSLPRLEQQQLQLQRQLQVARTTYEQLLGRFQEVQLV
A0A5P8VSD1      QRLGLENQVGVLRKDFVLYQARIRSLPKLEQLQLQLQLELEIAQTTYGQMMKRLQETQIL
A0A1S1ZVW2      ERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVL
A0A0R0M9H9      ERLALANQVKALQSVFIINRRRLDSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVL
A0A7H0F4U6      ERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVL
A0A1B7WX82      ERLALTNKIGELQRVFIVNRRRLDSLPRLEQQQLQLQRQLSVAQLTYQEFLKQFQLVAVL
A0A1B7WTD1      ERLALTNQVGELRKVFMVNKSRLDSLPRLEQQQLQLQRQLMVAQTTYQELLRQFQLVQVM
A0A480ABC0      ERLALTNQVGELRKVFIVNKSRLDSLPRLEQQQLQLQRQLMVAQTTYQELLRQFQLVQVM
A0A1Z4LRU5      ERLAATNRVGLLRKAFVSNQARLSVLPKLEQQQRQLQRKLQVAQSTYQQLLKQLQEVQVV
A0A1Z4JVB4      ERLALANRVMELQRAYLLNKRRLDILPALEQQQLQLERQLKVARITYEQVSKQLQESEII
K9PIA4          ERLALARQLADLQQTFILSQKRLNSLPRLEQQQLQLQRQLQVARVTYEQFLRQLQEIQVL
A0A1Z4HVE1      ERLALAKRVAELRQAYLINQRRLDILPRLEQQQLQLQRQLQVARVTYEQLLKQLQEVEVI
A0A252ECZ1      NRLAITNRLAELRQVYIVNQRRLDILPRLEQQQLQLQRQLQVARLTYEQLSKQLQEVEVI
A0A1Z4G5Y1      DRLAFTNRVATLRQVYLTNQRRLDILPRLEQQQLQLQRQLQVAKITYEQLMKQLQEVEVI
A0A252DNA2      DRLAVANRLAELRQVYVVNQRRLDILPRLEQQQLQLQRQLQVARVTYEQLLKQLQEVEVL
A0A252E1Q4      DRLAVANRLAELRQVYVVNQRRLDILPRLEQQQLQLQRQLQVARVTYEQLLKQLQEVEVL
A0A6G9SK36      ERLALANQVGELQQTFIVNKERLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVV
A0A1Z4M597      ERLALTNQVAELKQVLLVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVV
A0A1Z4MWT1      ERLALTNQVAELQQVLIVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVV
A0A1Z4TX53      ERLALTNQVAELQQVLIVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVV
A0A2A2TNQ5      ERLAALQRVQVLRNAYITYETRMRQLPKLEQRQRGLERRLEVAQTTYQQVQKQLQEVEVV
A0A3S1C4K5      DRLAVNNQVQVLQTAYLNYQGRLTAIPRLEQQQRALERKLQVAQSTYQQVLKQLQEVEVV
A0A1X4G3D5      EKLTLSSNINALQNVLSIYKRRLTSLPRLGQQEARLRLRLEIVVTTYKQLQKQLQELEIL
D4TNI2          EKLTLSSNINALQNVLSIYKRRLTSLPRLGQQEARLRLRLEIVVTTYKQLQKQLQELEIL
A0A1Z4H6Z8      EGLALQNRVAELRKAFIINKSRLDILPRLEQQQLQLQRQLQVARVTYEQLVKQLQEVEMI
A0A1Z4NPM1      DRLAAEQQVQVLSRALTDYQNRLAALPKLQQRQRALERKLQVAQSTYQQVLKQLQEVEVA
A0A3F3KPR9      ERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVL
D4TGN7          ERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVL
A0A1Z4UZW9      ERLALTKQVEELQRVFIVNRRRLDSLPRLEQQQLQLQRQLTVAQLTYQELLKQFQFIEVL
A0A0K2M5H0      ERLALTKQIEELQRVFIVNRRRLDSLPRLEQQQQQLQRQLTVAQITYQEFLKQFQLVQVL
A0A1B7VSH4      ERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVL
A0A1B7W126      ERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVL
A0A3D4C6Q6      ERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVL
A0A1B7UVJ4      ERLALTNKIGELQRVFIVKRRRLDSLPRLEQQQLQLQRQLSVAQLTYQEFLKQFQLVAVL
A0A1B7UTR1      ERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITYQEFLKQFQLVQVL
K7W0A4          ERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITYQEFLKQSQLVQVL
A0A5C0DRW9      ERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITYQEFLKQFQLVQVL
A0A6H2C088      ERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITYQEFLKQFQLVQVL
A0A1U7HGH0      ERQGLISQQATLTQQQKAYLQKATNLPRLEQQQRELERELSAAQSTYEALLRSLQEIKVI
K9XJD3          ERQGLISQQATLTQQQEAYLQKATHLPKLEQQQRELERELSAAQSTYEALLRSLQEIKVI
K9SX01          ERVGLEKQIATINDSFIEYQKRLVNIPKLEQQLLVLQRAVEISRTAYEGLLVKQQDIQLT
A0A4P7ZT55      QQAEVQRQLAQLEKAFRV------VGPELVKQYDALNQRLEIASENLSSYLKARESFRLE
A0A1E5QIR9      DRLVVNSQLNELLNEYAIHKQRANALPRLQESQRDLERQVEVAQSTYQTLLTRLQEVRIA
A0A6P1A9A0      QRQILEVRQVAIALAENQARQELQKMAAVIREYTDLQRELQVATESLNRFLTVRETLKIE
A0A1Z4IBC7      QRVGLERQITTLIQQRDAYIKRANYLPKLEQNQRELERRLQAAQGTYETLLKKRQEIDIA
A0A1W5CPC7      QRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERRLQAAQGTYETLLKKRQEIDIA
A0A5Q0GKD1      QRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERRLQAAQGTYETLLKKRQEIDIA
Q3MDC6          QRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERRLQAAQGTYETLLKKRQEIDIA
A0A1Z4KM73      QRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERKLQAAQGTYETLLKKRQEIDIA
Q8YNX7          QRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERKLQAAQGTYETLLKKRQEIDIA
A0A367R4K6      QGVGLERQINTLLQQRYAYARRANYLPKLEQTQRELERRLKAAQTTYETLLKKRQEIDIA
A0A1E2WSV8      ERVGLERQIGTLLRQQDAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDVA
A0A7D7L9Y1      QRVGLERQIGTLLRQQDAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDVA
A0A2R5FRT9      ERVGLERQIATLVRQQEAYIKRANNLPKLEQTQRELERKLQAAQTTYETLLKKRQEIDIA
A0A2K8T1B6      ERVGLERQIATLLRQQDAYIKRANNLPKLEQSQRELERKLQAAQTTYETLLKKRQEIDIA
A0A235I9I0      ERVGLERQIATLKEQQNAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDIA
A0A2D0HQT8      ERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDIA
A0A2L2NU95      ERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDIA
A0A367S084      ERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDIA
A0A1Z4SMD6      QRQGLEKKILALSNIRDSYKQRLSILPNLEKKQGDLERTLSVAQKNYESLVNRSQEIQVA
A0A2H2Y096      QRQGLEKKILALSNIRDSYKQRLSILPNLEKKQGDLERTLSVAQKNYESLVNRSQEIQVA
K9S8M8          QRRGLREQVTALRESQVQYQQRANVLPQLEQRQRDLERQLATYQSTYDILSRNLQQVQII
A0A1Z4NFV0      QQAGLASRVQELSNLHRIYRQRTTIIPNLEKRQGDLERRLGVAQKTYEHLLSRLQEIRVA
A0A3M9ZEU1      ERISLLGQTQTLRNTLSAYRQRASTLPKLAQTQGELARRLQAAQSTYETLLTRLQEVQVA
A0A1Z4JK72      QKLGLEGRVGTLAGLQSSFRSRMAATPTLVKQQSELERKQDLAQKAYENLTSRLQEIQVA
A0A0N7Z489      QRAGLEGRITTLSGLLINYSSRAARTPALIQQESELERRQEIALTAYQNLNARKQEIEVA
A0A0S3TXS2      QRIGLEGRISTLAGLLANYRSRAAQTPALIQQEGELQRRQEIALTAYQNLNARKQEIEVA
A0A2A2TPF8      QRLGFENKVQTLTNLHQEYKKRANILPNLEKKQGDLERRLTVAQESYKQLLTRLQEVRVA
A0A1Z4R0P8      QRLGLANKVQTLTNLHQIYKRRANVLPNLEKKQGDLERRLEVAQESYKNLLTRLQEVRVA
A0A0T7BUI3      KRQGLQKKIAALQGVQQIYQKRLNAIPNLEKKQSDLERKLSVAKLNHENLNARLQEIQVA
A0A1Z4LP32      QKDGLQNKLATLNNIKNDYQRKLAILPNLEKRQQDLERRLSVAQTDYENLITRQQEIELA
K9REP9          QKDGLQTKLQTLTNIRDNYQQKLAILPNLEKQQTELERRLSVAQTDYENLITRLQEIELA
A0A1Z4SIJ3      QRQGLEKKIRAMEAVQANYQQRLNVIPNLEKNLGDLERRQTLAQTNFQNLQDRLQEIEIA
A0A2H2XPG4      QRQGLEKKIRAMEAVQANYQQRLNVIPNLEKNLGDLERRQTLAQTNFQNLQDRLQEIEIA
K9V3C7          QRAGLEEKVQTLSSLHEAYKRRANIFPNLEKQQGELERSLTIAQKTYEELLTRQQAIRLA
A0A1Z4T6Y7      QRLGLENKVQTLSGLHEQFKQRAEVLPNLEKKQGDLERRLMVAQKSYETLLGRLQEIRVA
A0A2H2Y561      QRLGLENKVQTLSGLHEQFKQRAEVLPNLEKKQGDLERRLMVAQKSYETLLGRLQEIRVA
A0A1Q4S362      QRLGLESKVQTLSGIYEQFKQRAQVLPNLEKKQGDLERRLIVAQKTYETLLGRLQEIRVA
A0A3S1CIN8      QRLGLESKVQTLSGLHQQFRQRAQVLPNLEKKQGDLERRVMVAQKTYETLLGRLQEIRVA
A0A2A2TC28      QRQGLEKKVQTLLNIREGYQRKLSILPNLDKLQTDLERKFNIAQTDYQNLVARLQEIEIV
A0A0C1NCB0      KRQGLEEKIKSLSDIRNGYKQRLTVMPNLEKKHGDLERRLDLAQKNYENLTLRLQEIQVA
A0A2N6K7Q9      ERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
A0A2N6MXH6      ERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
A0A2N6M5A8      ERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
A0A2N6LL61      ERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
A0A0S3TP66      ERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
G6FP91          ERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
A0A1U7GYR5      ERQGLEKKIRTLSNIRANYQQQLAMVPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
A0A2N6KY52      ERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
A0A2N6KMP5      ERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
A0A2N6MA45      ERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVA
A0A4Q9J9V9      ERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKLESAKNGYENLVTRLQEIQVA
A0A328IGA1      ERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKLESAKNGYENLVTRLQEIQVA
A0A4D9CE41      ERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKLESAKNGYENLVTRLQEIQVA
A0A0M0SFT2      ERQGLEKKFRTLSNIRANYQQQLAVMPSLEKQQQGLERKLESAKNGYENLVSRLQEIQVA
A0A1Z4TLC8      ERQGLEKKFRTLSNIRANYQQQLAVMPSLEKQQQGLERKLESAKNGYENLVSRLQEIQVA
A0A0C2LFH0      QRQGLENKIQALSNIRGTYKQRLSALPNLEKKQGDLERRLSIAQKNYENLVTRLQDIEVA
A0A1Z4IYV4      QRQGLESKIQALSNIQASYKQRLAMMPNLEKKQGDLERKLSISKKNYENLVSTLQEIEVA
A0A1Z4Q0T6      QRQGLESKIQALSNIQASYKQRLAMMPNLEKKQGDFERKLSISKKNYENLVTRLQEIEVA
A0A0C2PT44      QRQGLESKIQALSKIQASYKERLAMMPNLEKKQGDYERKLSISKKNYENLVTRLQEIEVA
A0A1D2P6J4      QRQGLESKIEALSNIQASYKQRLAMMPNLEKKQGDFERKLSISKKNYENLVSRLQEIEVA
B4WP72          DRVGLSQRVSELSDLQGVYRRRASTLPALEKTQRELERRLQASQTTYEALLTKLQEVQVA
A0A2T1CIL7      ERSGLLGKLAELESNLQVRQQNLEKLPLLEKQQRELERRVEATQSTYQTLLGQLQDTQVA
A0A433V7A0      KNLSLSSRLTSLENAKVRSQRRVSNIPKLEKDQRELQRKLDAAQSTYQLLLQRLQEVRVA
A0A2T1FTR8      QRTSLQKQIAALVYVVDAYKQRMNALPKLEQQQNALGRKLETTRTNYKTLLSKLQEIEIA
K9UA41          QRTSLQKQIAALVYVVDAYKQRMNALPKLEQQQNALGRKLETTRTNYKTLLSKLQEIEIA
A0A0C2LBE2      QRVGLVKQIATLSNQRTVYKERANILPKLEQTQRELERKLKAAQTTYETLLTRLQEVQVA
A0A433NN38      VRLGLEKQIADLNNTLFEYKQRANILPKLEETQRELERKVKAAQTTYENLLTRMQEVDVA
A0A2N6K0T2      ERVGLERRIAELTNTWSVYKQRANVLPKLEQTQRELERKLKAAQTTYETLLTRLQEINVA
A0A2N6ML72      ERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVA
G6FQZ6          ERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVA
A0A2N6MQX9      ERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVA
A0A2N6KXT6      ERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVA
A0A2N6KGB9      ERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVA
A0A2N6L3Y5      ERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVA
A0A0S3TIS7      ERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVA
A0A1U7GW28      ERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVA
A0A2N6LW63      ERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVA
A0A328IH74      ERAGLEKRIADLRNTWSLYKQRANTLPRLEQTQRELERKLKAAQTTYETLLTRLQEINVA
A0A4D9CIB0      ERAGLEQRIADLRNTWSLYKQRANVLPRLEQTQRELERKLKAAQTTYETLLTRLQEINVA
A0A1Z4TQ63      ERAGLEKRLADLRNTWSLYKQRANIMPRLEQTQRELERKLKAAQTTYETLLTRLQEINVA
A0A4Q9J8G2      ERAGLEKRIADLRNTWSLYKQRANTLPRLEQTQRELERKLKAAQTTYETLLTRLQEINVA
A0A350Y0P6      ERLSLAQRVASLEQTKLTYKRRANILPKLQEGLRDLERQLEASQATYDILLKNYQQIRIA
A0A352X940      ERLGFVRQAAYLERAKLAYQQRANLLPRLQEGLRDFERQLGAAQSTYEILLRNYQDVRIA
B8HTN4          ERLALSSQVTSLSRTEQTYQQRMNALPKLEQWLGELERRRVVAQTIYEGLLKTLQSLQIS
A0A6P1AFJ5      KILLLKVREENLAKTELELRNSLDKLAELDRKHTDLQRNLKLKAENLQRFLLLRENLRIQ
B0CAX4          ERLGLEKQVLSLAQTQAENKRRQGIIPKLEQQLIALERDRIVAQTTYEELLKALQQITIS
A0A1Z4RN12      QKEGLDKRLASLRSNYNNYQQRSDNLPQLQEQQRELQRRVDATQSTYKTLLAKLQEAEII
A0A2T1CMF9      RKEGLEQRLASLKNSYNNYQKRSNLSPQLEEQQRQLERKLKSVTENYQTLLSKANEISIR
Q7NDC5          EELAARTRTEALARVSAEYDARVAALPRLEESQRRLARQVEADQEAYRLLQKKFYEYRIL
U5QGK3          EELAARTRTDALNSVSERYSSQVAAMPRLEETQRQLERQVEADSAAYKLLQTKFHEYRIL
A0A2W4UY24      ERAGLQQRLNQLTSAQAAQQSRAQLLPGLEKRNRELERELDAAQTTYETLLASRQQAQVL
A0A0D8ZUV2      ERLGLAKQLALLSSTQDTYKQRANVFPKLEQNQRELERQLQASQSTYQSLLQKLQELKVA
A0A433VDI0      ERSGLTSQLAELSNAQATYKQRVSILPKLEQEQRELERRLAAAQSTYETLLKKIQEVRVA
A0A3D1PG43      ERLSLSSRLAYLSKNLSAYKQRANVIPKLEQQQQELERQVKASQATYEILLRKQQEVKVE
A0A2P8QQ72      ERLSLSNRLKFLAQARTNYRQRATVLPQLEQQQRELERQVRAAQATYELMLKKLQELRVE
K9TZQ7          ERLSLSNRLKFLAQARTNYRQRATVLPQLEQQQRELERQVRAAQATYELMLKKLQELRVE
A0A6N8G584      QRLGLSSRLSSLNNTYNAYRQRVNVLPRLEQTQRELERRLNAAQSTYETLLRRLQEVRVA
A0A2G7GPR0      QRLGLTSRLSSLNNTYSAYRQRINVLPRLEQTQRELERRLEAAQSTYETLLRRLQEVRVA
K9XH68          QRLGLTSRLNSLNNTYNAYRQRVNVLPRLEQTQRELERRLEAAQSTYETLLRRLQEVRVA
A0A1U7HW70      QRLGLTSRLNSLNNTYNAYRQRVNVLPRLEQTQRELERRLEAAQSTYETLLRRLQEVRVA
A0A2S6VEJ8      QRLGLVSRLNSLNNTYNAYRQRANVLPRLEQTQRELERRLEAAQSTYETLLRRLQEVRVA
A0A140KBA0      KKTGLEQKLANLKQTKTDYQQRLSVLPNLEKRQKELERKTKAAQATYQTLLGKLQETQVA
K9XSG1          QKTGLEQKLANLKQTKTNYQQRLAVLPNLEKRQKELERKTKAAQATYQTLLGKLQETQVA
A0A2T1GMT4      QQTGLVNKLNSLQSSRAAYEKRVSVIPKLVQTQRQLERKLEVSQSTYQSLLKKLQELQVA
K9UI51          QQTGLVNKLNSLQSSRAAYEKRVSVIPKLVQTQRQLERQLEVSQATYQSLLKKVQELQVA
A0A1Z4QL41      QRIGLAKRLASLYNSRSAYEQRTKIIPRLAQTQSELERTIEVAQSTYGTLLKKIQALQVA
A0A2T1FXY4      QRRSLAQKLASLSNSRSTYEQRKNIIPQLVQNQHELERRLVVAQSTYQTLLKKVQELQVA
K9TYI2          QRRSLAQKLASLSNSRSTYEQRKNIIPQLVQNQQELERRLVVAQSTYQTLLKKVQELQVA
A0A252D4T4      QRQGLAQKLNSLYNSRSIYEQRVKIIPQLEQQQRELQRRLDVAQSTYQTLLKKVQELQVA
A0A252DJH5      QRQGLAQKLNSLYNSRSIYEQRVKIIPQLEQQQRELQRRLDVAQSTYQTLLKKVQELQVA
A0A252EB80      QRQGLAQKLSSLYNSRSTYEQRVKIIPQLEQQQRELQRRLEVAQSTYQTLLKKVQELQVA
A0A6G9SKZ9      QRRGFEQKLTSLYNSRSVYEQRVKIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLA
A0A1Z4HPW5      QRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLA
A0A1Z4MSN1      QRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLA
A0A1Z4U1C2      QRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLA
A0A0D6KV51      QRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLA
A0A1Z4MKF8      QRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLA
A0A2C6WC43      QRFGLSQRLASLYNSRTNYQKRVQVIPQLIQNQRELERKLEVAESTYQTLLKKVQELQLV
A0A1Z4L5A1      QRFGLSQRLASLYNSRSNYQKRVQVIPQLIQNQRELERKLEVAESTYQTLLKKVQELQLV
A0A367QD86      QRYGLSQRLASLYNSRSNYQKRVQVIPQLIQNQRELERKLEVAESTYQTLLKKVQELQLV
A0A2K8SM78      QRFGLAKRLSSLSNSRSTYEQRVKIIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLV
A0A2R5FPC0      QRFGLAKRLSSLSNSRFTYEQRVKIIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLV
A0A5P8W5T6      QRFGLAKRLSSLSNSRLAYEQRVKIIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLV
A0A7D7LDT7      QRFGLTQRLSSLYNSRSTYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLV
A0A235IZ96      QRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLV
A0A2L2NGP0      QRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLV
K9QM62          QRLGLAQRLTSLSNSRATYEQRMQKMPQLEQTLRELQRTLEVAQSTYQNLLRKTQELQVA
A0A1Z4FWI3      QRQGLAQKLTSLYNSRGAYEKRVKVIPQLEQQQRELERRLEVAQSTYQTLLKKIQELQVA
A0A1Z4JYE7      QSTGLNQKLNSLLNTRSAHEKRMQILPKLAQQQRQLERKVEVAESTYQTLLKKVQELQVA
A0A0F5YE28      QRVELTRQLDSLYASRINYEQRSQNLPQLEQEQQELQRKVQVAQVTYETLLKNLEEVQVA
U7QEH7          QRVELTRQLESLYTSRRNYEQRSQNLPQLEQEQQELQRKVQIAQVTYETLLKNLEEVQVA
A0A3S1ATK5      QRIGLSKRLASLYNSRSGYQRRVKIIPMLVQNQRDLERKVEVAQSTYETILKKAQELQVA
A0A2Z6CPH0      QSFGFKQRLASLYNSRSVYERRMRFIPQLIQTQHELERKVEVDQSTYQNLLKKVQELQLA
A0A1Z4GT50      QRNGLTKKLASLYNSRSAYEQRLKIIPLLVQNQRELEQKLEVAQSTYQTLLKKVQELQVA
A0A1Z4GIX0      QRFGLTNRLASLYNSRSAYERRMKVIPQLAQTQRELERKVDVAESTYQTVLKKVQELQVA
A0A2H6LC24      QRFGLTNRLASLYNSRSAYGRRMKIIPQLAQTQRELERKVDVAESTYQTVLKKVQELQVA
B2J6N5          QRIGLAKRLSSLYNSRSIYEKRVKLIPQLAQNQRELERKAEVAESTYQTLLKKVQELQLV
A0A367RMI4      QRFGLTQRLSSLYNSRVSYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLV
A0A235HUM0      QRFGLTQRLSSLYNSRVSYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLV
A0A2L2NW47      QRFGLTQRLSSLYNSRVKYEQRVKLIPQLAQNQRELDRKVEVAESTYQTLLKKVQELQLV
A0A1E2WUR1      QRFGLTQRLSSLYNSRSTYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLV
A0A235IKU3      QRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLV
A0A1U7MYU6      KRRSLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRLQAARLTYETLLKNLNELKVA
A0A1D8TNX9      KRQSLAEGLATLAKARIGYEQRVNVLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVA
A0A6P0L6C2      KRQSLAEGLSTLANARIAYEQRVNVLPRLEQTQQQLEQRLQAARLTYETLLKNLNELKVA
A0A6P0MVH0      KRQSLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVA
A0A6P0KJV0      KRRSLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRLQAARFTYETLLKNLNELKVA
A0A6L9ZJG4      KRRSLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRIQAARLTYETLLKNLNELKVA
F4XKF3          KRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVA
A0A1D9FX10      KRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRLQAARLTYETLLKNLNELKVA
A0A6P0Q0T0      KRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVA
A0A6P0W5I0      KRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVA
A0A3C0NJ41      ERLGLANRLTQLSNTRSAYKQRLSILPKLEKEQRELQRRVEAAQSTYQALLKKQEELKLA
A0A352AG88      ERLGLASQLNELENVRLAYQQRLTILPKLEKDQRELQRRLDASQSTYEILLKKLQEVRVA
A0A350Y374      NRLGLKSKLDQLTNSRLIYKQRLNTLPKLEKEQRELQRRLDAAQLTYQTLLQKLQELRLA
A0A355DPX0      NRLGLKSKLDQLTNARLIYKQRLNTLPKLEKEQRELQRRLDAAQLTYQTLLQKLQELRLA
                                                                            

K9SLA9          LRQISAGARIVSPATIP--TNA---IAP-NIPLNLSLGAILGLAFAGLVTFILAAIDKSI
A0A168TT23      AGAQENNIAVIDSALRP--GYP---VLP-DISRNLSIALLLGLVVGVGLALLLEFLDSTV
A0A0M1JWX9      AAQSETPWEIIALPEIPRNEDGELIPFSPNLLRNLVLGAMLGLMLGFGAALLVEQLDFVF
A0A2T1M1V6      AFDAYPNVQLIDGPSLN--PKP---LTA--SRKLIALGGLLASLFGSLSVLLLLESRNPL
A0A2G7GCS2      PFSVYPNVQTLDAPVID--PKP---EEP--SKRAIALGGILAGLFGSISLIFFLEKRNPM
K9XBH8          PFNVYPNVQTLDAPTID--PKP---EEP--SRRVIALGGILAALFGSVSLILFLESRNPM
A0A1Z4LJ30      SFSAYPSVQVLDQPIMD--TKP---VGP--KLRLMLLGALLACGFGSAAIILFSENRDPL
K9RI76          AFSAYPSVQVLDKPMVD--NKP---SGP--KLKLMLLGALLASGFGSAAIILFMENRNPL
A0A352AE27      AFNAYPNVQVLDPPTVS--SNP---TDP--KKTLIALNAFVASVVGSIALLLLLEARNPL
A0A3B8JH60      AFNTYPNVQVLDSPTVD--PKP---SSP--KKLLAALNALIASIVGSVALVLFLESRNPL
A0A3C0N766      AFNTYPNVQVLDSPTVD--PKP---SSP--KKLLAALNALIASIVGSVALVLFLESRNPL
K9W9J7          AFDTYPNVQVLDPAKVD--SKP---SGP--KRSIIVLSGLMASIIGSIALVLLLESRNPL
A0A139WSU3      AFDAYPNIQVLDAPQVD--PKP---VSP--KFLLMAVNALLASIIGSIALVLFLESRNPL
A0A433VN22      AFDAYPNVQVLDPPRVN--SKP---ISP--KLFLMAINALLASVIGSIALVLFLESRNPL
Q7NF11          AFNAFPDIEVLDKAYSN--PKE---ANP--RTLLIALGGLVAAVFGSLGLILRKEAINPL
A0A1Z4JCS8      AFNAYPNIQELNAPFVD--AKP---SSP--KKSLIAINALLASVIGSIALILLLEARNPL
A0A6P0PI80      AFSAYPNVQVLDPPTVD--EKP---AGP--KKLLIIANGFLASAVGSIALVLLLERRNPL
A0A6P0WGT6      AFSAYPNVQVLDPPTVD--EKP---AGP--KKLLIIANGFLASAVGSIALVLLLERRNPL
F4XTX2          AFSAYPNVQVLDPPTVD--EKP---AGP--KKLLIIANGFLASAVGSIALVLLLERRNPL
Q7NJN6          AFDAYPNVQILDAPSVD--SKP---S-P--SGLLVAVGGLVAMLSGSIALALWLERRNPM
U5QCC3          AFDTYPNVQVLDPPAVD--PKP---S-P--RLFLIVLGALLAMIAGSVALALLLERRNPL
A0A0S3TYD7      EQQQLGNARITSKALIP--EKPTLLTSALGRSLLLAGSGGAGLLLAFAATVLAYLLDRRI
A0A2T1DNG3      IARGGFAWQVVEQAQIG---AK---TGP-NLQKNLMLGLVVGILLGGVAAVSREVLDDSV
A0A3S0Y9N9      ENLQVSNARVITPALIP--TVP---IKS-RQYINLLQGFIGGILLGVATAFILEKMDKTI
A0A433UNK7      ENLQVSNARIVTPALIP--GVP---IRS-RQYINLLQGLIGGIVLGVATAFVLERLDKTI
A0A6P0ZKB8      ENLQVSNARVVTPALIP--SAP---VRS-RQYINLLQGFIGGIVLAVTTAFVLERLDKTI
U5QL42          EAQETSPWRVLEPPDLP--DTP---VSP-KIDQNLLYGFIASVFLGLGAAFVPDLIDERI
A0A140K3H3      QAQENAPWQILEAPPLP--SIP---ISP-NLERGILLALVAGSLMGVATAFLLQKLDQRV
K9XUB8          KAQENAPWQILEAPRLP--NVP---ISP-NLQRGIFLALMAGGFMGVATAFLLQKLDQRV
A0A6H2NHD5      MAQQTSPWQLVSPLDQA--SVV---PVT-NLPRNLLLSTVISLLLGGGAALLRDKFDQVF
A0A2P8W4F7      MARQASPWEIISPLSES--SIT---QTT-NLPRKLLLSTVIGLMLGGVAALLRDRMDQAF
A0A5Q4E0Z4      MARQTAPWELISPLDES--SIT---EMT-NLPRNLLLSTVVGLLLGGGAALLRDRADTAF
A0A2P8VVX1      LSRGGFSWEVVEPPLPG--QRI---G-P-DPVRPLALGIVAGLFVGGALAFGVESIDQRV
A0A2P8WHY0      LARGGFDWQIVEPPDVG--DQI---G-P-DPLRPIALGVVAGLFVGGGLAFARDSMDKVV
A0A2T1CMT9      LSRGGNNWQVIEPPQAG--LQI---A-P-NLAKDLLLSLVVASFVGGFAAFVKDFTDETI
A0A7G8J1V5      LAQSAAPWRVISPPIVS--RTP---IKP-SLPRGFLQGSMLALAAGVGAGLLRDRLDHVF
A0A354B169      MAQRSVPWRVIAPPQIN--PRP---IEP-SISRNLALGAILGLVAGAFAGLLRDRLDHVF
Q0IDT5          SAQSSVPWRVIDPPEID--PNP---IKP-SIPRNLALGAMLGLVAGVAAGLIRDRFDHVF
A0A7G8FZD9      IAQRSVPWRVIDPPEIN--PTP---IKP-SVPRNLALGTMLGLVAGAGAGLLRDRKDHVF
G4FMX5          IAQRSVPWRVIDPPEIN--PNP---IKP-SIPRNLALGTLLGLVAGAGAGLLRDRKDHVF
A0A7G8FAU7      IAQRSVPWRVIDPPKIN--PDP---IQP-SVPRNLALGAVLGLVAGAGAGLLRDRLDHVF
A3ZA21          IAQRSVPWRVIDPPKIN--PDP---IQP-SVPRNLALGAVLGLVAGAGAGLLRDRLDHVF
A0A076HBF2      IAQRSVPWRVIAEPTIN--PKP---IKP-SVPRNLALGTVLGLVAGAAAGLLRDRMDHVF
A0A7G8FP50      MAQRTVPWRVIAEPTFN--PNP---IKP-SVPKNLALGTVLGLVAGAAAGLLRDRMDHVF
A0A7G8E8K7      IAQRSVPWRVIAPPTID--PKP---IKP-SIPRNLSLGTVLGLVAGAAAGLLRDRMDHVF
A0A7G8GAH0      IAQRSLPWRVIAEPTIN--PDP---IKP-SVRRNLALGTVLGLVAGAAAGLLRDRIDHVF
A0A7G8GNR2      IAQRTVPWRVIAEPTIN--PKP---IKP-SVPRNLALGTVLGLVAGAAAGLLRDRMDHVF
A0A7G8ICD3      IAQRTVPWRVIAEPTIN--PKP---IKP-SVPRNLALGTVLGLVAGAAAGLLRDRMDHVF
A0A2D6FCW3      IAQRSVPWRVIDPPEIN--PNP---IKP-SIPRNLALGAVLGLVAGAAAGLLRDRMDHVF
A0A7G7KJ95      IAQRSVPWRVIDPPEIN--PNP---IKP-SVPRNLALGAMLGLVAGAGAGLLRDRMDHVF
A0A7G8EAN3      IAQRSVPWRVIDPPEIN--PNP---IKP-SVPRNLALGAVLGLVAGAGAGLLRDRMDHVF
A0A563VQJ3      ENQQTGNVDIIEEAIAP--ETG---S-S-GRMALILLGFLSGLFLSNLTAIALEWQDRTV
A0A1D8TX52      LARGGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A1D9G4T2      LARGGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6P0PR27      LARGGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6P0WER7      LARGGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
F4XP71          LARGGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6L9YR57      LARGGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6P0KZ31      LARGGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6P0LPB8      LARGGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6P0SEV1      LARGGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6B3N2I8      LARGGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6M0B891      LARGGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6P0IJQ1      LARGGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6P0J8J8      LARGGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6P0ZSH6      LARGGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A1U7N5X9      LARGGFNWQVVEAPLPG--LKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6L9Z1V0      LARGGFNWQVVEAPLPG--LKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6P0LC12      LARGGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A6P0MVJ3      LARGGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGI
A0A2W6ZAV2      VAQRTRPWRIISPPEFE--DTP---DKP-NLRNSLMLSILIGGVAGVGAALLRDRLDHVF
K9W742          IARGGFDWQVVEQPLLG--EKT---G-P-KKAQIILLGAVAGVMLGGIAAFIRETMDDAV
A0A3D1PBA3      IARGGFDWQALEEPKQG--QQI---G-P-NLKLNLLLGLVAGLMLGGVAAFLREAVDDSV
K9XPB0          LSRGAYNWQVIESPQLG--VQI---A-P-NTTKDILLSLVVASFLGGTTAFIKESLDEQL
A0A350Y7Z1      IARGGFKWQVVEPPKPG--KQM---G-P-DTRRDLMLSVVVGLFLGGLAAFGREALDDAV
A0A352X2A7      IARGGFKWQVVEAPLPG--EQI---G-P-NTKQDIMLAVVVGLFLGGIAAFGREFIDDGV
A0A0D8ZYV0      IARGGFEWQALEQPVLG--LQV---G-P-NIKQNLLLGLVAGLMLGGVAAFLREATDDAV
A0A2T1FP73      IARGGFDWQALEEPRLG--LKV---G-P-NLKLNLLLGLVAGLMLGSLAAFLRDAVDDSV
A0A433VMS2      IARGGFDWQALEEPRLG--LKV---G-P-NLKLNLLLGLVAGLMLGSLAAFLRDAVDDSV
K9TYA7          IARGGFDWQALEEPRLG--LKV---G-P-NLKLNLLLGLVAGLMLGSLAAFLRDAVDDSV
A0A2P8QUE1      IARGGFDWQALEEPRLG--LKV---G-P-NLKLNLLLGLVAGLMLGSLAAFLRDAVDDSV
K9SA61          IARGGFDWQVVEEPRTG--NQI---A-P-NLQRNLLLGAVAGLMLGAVAAFVREGVDDAV
A0A2G7GMH8      LARGGFDWQVVEQPGIG--EQI---S-P-SIKRNLLLGIVVGLTLGCFAAFIREAVDDAV
A0A6N8FU92      LARGGFDWQVVEQPDLG--EQI---S-P-SIKRNILLGVVVGLTLGCFAAFIREAVDDAV
A0A2T1DWE8      IARGGFDWQVVEEPKLG--KQI---G-P-NVKQNILLGAVAGLMLGSVAAFIRDTMDDAV
A0A1U7I8L3      IARGGFDWQMVEEPQLG--LQI---G-P-SMKRNLLLGAVVGLMLGSIVAFIRDMIDDAV
A0A2T1DJL8      IARGGFDWQVVEQPKVG--QQI---G-P-NWLRNLLLGAVGGLMLGGVAAFLREAADDAV
A0A1Z4J9W0      IARGGFDWQMVEQPKLG--RQV---G-P-SWMRNLLIGAAGGLMLGCVAAFLRESADKSI
A0A0N7Z5K9      IARGGFDWQIVEQAKVG--RQV---G-P-NWLRNLLIGGAAGLMLGSVAAFLRESADKSI
A0A0S3TXC5      IARGGFDWQVVEQSKVG--RQV---G-P-NWMRNLMVGAAGGLLLGCVAAFLRESADKSI
B8HNB0          EAQRTTSWRVLEPAYLP--TAP---ISP-NMSRAILLGLFAGVLAGIGLALLIERLDSRI
A0A563VS48      EEQDIGKARVVSEAVVP--EFP---IGP-QKKMMMITGGAIGTLLGIAVAFLIDIRDNTI
A0A318BJ18      GGVGVNNISVVDTADAP--RHP---SSP-KLLINLLLSLLAGLGIGALAAFVLEQMDEAI
A0A3B8Y8H9      RAKTIYPWRLVSEIRTP--EEP---VSG--PLKLSVLGTFMGIVLGMGAGLLAEKLDDTF
A0A2W1JVB9      EQQNLGNARILSPALIP--EEP---IAP-RKLLYIFSGFVLGSLLAFGVALLLDSRDKSV
A0A3M1SVZ4      ESQSLGNASLVSPALVP--DKP---IS--KKSLYQAMGIFLGGLAGVATALLLEVQDRSI
A0A6H1U102      EAQETAPWRILEPPYQP--QNP---ISP-NIRRNLLLGLIAGGLLGVAAVILLERTDQRL
A0A7C3ZEJ3      EAQEIAPWQILEPPYLP--ENP---VSP-NIKRNLLLGLIAGGLLGIGAAILLERTDQRV
A0A563VLD6      LAQETAPWKVLDKPYLP--HKP---ISP-NIQRGLALALAGGGFIGILTAWLLHQLDTRV
A0A2P8W9H0      AAQRQTPWEVLTPPSQP--RAS---AAS--AKRNLLLGTLLGLLLGAGAAIVVDRFSGKI
A0A6I5P386      AAQRQTPWELLTPAETP--RES---SAS--VKQNLLLGSILGLLLGCGAAIAWDRIKSKI
A0A654SFI6      GAGQ-NNIKLIDKADAP--LFP---YAP-SLLQNLLVALITGLIGAGALIYGRVVLSQTI
A0A318BG22      GGSGANNVSVIDTARAP--GAP---ASP-ILWLNLLLAIGFGVLAGVGIAFIIEFVDDSI
K9SSQ0          EVQEATAWQILQSPSLP--SYP---SSP-NVILNLLLAGLAGILVAAIIITVLENSDDRL
A0A2W1JIN9      EAQLLSNFRILDLSEPS--GKP---SDP-NIPVVLILGTLAGAVLSIGTVILLEALNRKL
A0A318AJV1      AHAAIAQAQIIDRADPP--VSP---APP-GKVLLSGLAMLASLGCGLATVIVMEMLQGGL
A0A6P0IC70      EAQLVSNIRIIAEAQVP--SLP---SEP-NKKVVLVLATAAGITLAIGIILLLEVIDNKL
A0A6B3MUB5      EAQLVSNIRIIAEAQVP--SLP---SEP-NKKVVLVLATAAGITLAIGIILLLEVIDNKL
A0A6M0B7N4      EAQLVSNIRIIAEAQVP--SLP---SEP-NKKVVLVLATAAGITLAIGIILLLEVIDNKL
A0A6P0J9W3      EAQLVSNIRIIAEAQVP--SLP---SEP-NKKVVLVLATAAGITLAIGIILLLEVIDNKL
A0A6P0ZWE1      EAQLVSNIRIIAEAQVP--SLP---SEP-NKKVVLVLATAAGITLAIGIILLLEVIDNKL
A0A1U7N2U4      ETQLVNNIQIIERAKLP--SSP---KEP-NPKVVLLIASAAGIALAVGMVLLLEVMDNTL
A0A1D9G1F2      EAQLVSNIQIIERAKLP--SSP---KEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNTL
A0A6P0PNZ7      EAQLVSNIQIIERAKLP--SSP---QEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNTL
F4XV38          EAQLVSNIQIIERAKLP--SSP---QEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNTL
A0A6P0W137      EAQLVSNIQIIERAKLP--SSP---QEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNTL
A0A6L9Y9E2      EAQLVNNIQIIERAKLP--SSP---KEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNTL
A0A6P0SGR0      EAQLVNNIQIIERAKLP--SSP---KEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNSL
A0A6M0BK48      EAQLVNNIQIIERAKLP--SSP---KEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNTL
A0A6L9YZL1      EAQLVSNIQIIERAKLP--SSP---KQP-NPKVVLVIATAAGIALAVGMVLLLEMMDNTL
A0A6P0KYM4      EAQLVSNIQIIERAKLP--SSP---KQP-NPKLVLVIATAAGIALAVGMVLLLEVMDNTL
A0A6P0LSD6      EAQLVSNIQIIERAKLP--SSP---KQP-NPKLVLVIATAAGIALAVGMVLLLEVMDNTL
A0A6P0X384      EAQLFSNLKIIEEAELP--SEP---SGP-NQKAMLVLAIVAGVILAVGIILVLELIDNTL
A0A2P8QIL5      EAQKVSNLRPVDLAEPP--RLP---TWP-NPAIVLVLATVAGGTLALGTVLLQEGLDGTL
A0A2T1FLY5      EAQKVSNLRPVDLAEPP--RLP---TWP-NPAIVLVLATVAGGTLALGTVLLQEGLDGTL
A0A433W447      EAQKVSNLRPVDLAEPP--RLP---TWP-NPAIVLVLATVAGGTLALGTVLLQEGLDGTL
K9U1K8          EAQKVSNLRPVDLAEPP--RLP---TWP-NPAIVLVLATVAGGTLALGTVLLQEGLDGTL
K9UYB2          EAQKVSNILIIDPAKPA--TIP---ASP-KIAVVLALAIAIGIVSAIALIILLEMLDNKL
A0A218QN17      EAQKVSNLRLIEAAKPP--TIA---SSP-KRSAVLALATVFGTVLGTGVMLLLEVLDNTL
K9RKN2          QAQKVSNIRIIESATVP--ESP---SSP-KKPVVLALATIFGGILATGVILLLELMDNTL
A0A2I8ADV2      EAQKVSNLRIIELALVP--TDY---AYP-KRSVVLAIAIFFGSILATGVVLLLELMDNRL
A0A1W5CKM3      EAQKVSNIRIIETAVAP--ELP---TSP-KRTVVLVIAGFFGSILAVGLVLLLELMDNTL
A0A5Q0GMF5      EAQKVSNIRIIETAVAP--ELP---TSP-KRTVVLVIAGFFGSILAVGLVLLLELMDNTL
Q3MEW0          EAQKVSNIRIIETAVAP--ELP---TSP-KRTVVLVIAGFFGSILAVGLVLLLELMDNTL
A0A1Z4KIC7      EAQKVSNIRIIETAVAP--ELP---TSP-KRTVVLVIAGFFGSILAVGLVLLLELMDNTL
Q8YSM5          EAQKVSNIRIIETAVAP--ELP---TSP-KRTVVLVIAGFFGSILAVGLVLLLELMDNTL
A0A1Q4S1H4      EAQKVSNIRIIEVANVP--TLP---SEP-QPAIILAIAGAFGILLSTGMVLLLEMMDNRL
A0A433VBU6      EAQKVSNIRVIEVATVP--TVP---STP-KSTIILAIAGAFGILLSTGMVLLLEMMDNRL
A0A1Q4RZJ6      EAQKVSTLQVIQAAKAA--SIA---SSP-KPNVVLALAGAFGLLLATGVVILLEIMDNTL
A0A1Z4SNV3      EAQKVSNLQVIQVAQPP--TEA---SSP-KPKVVLALAGAFGLLLATGVVILLELMDNTL
A0A2H2XJQ1      EAQKVSNLQVIQVAQPP--TEA---SSP-KPKVVLALAGAFGLLLATGVVILLELMDNTL
A0A3S5K358      EAQKVSTLQVIQAAKAA--SFA---SSP-KPNVVLALAGAFGLLLATGVVILLEVMDNTL
A0A0T7BPJ4      EAQKVSNLSIIEFAKPG--TSP---SSP-KIPVVLVVATVFGTVLATGIILLLEAMDNTL
A0A0C1QS61      EAQQVGNLRIIEEAQPP--TSA---TSP-KKPAVLVLATVLGTLLATSIVLLLEMMDNTL
A0A139X3R8      EAQQVGNIRIIEEALPP--TVA---TSP-RRSSVLVLATALGTLLATSIVLLLEMMDNTL
A0A1Z4I7C5      EAQKVSNIRILETAVVP--ELP---SSP-KRNVILVMATFFGSVLAVGLVLLLELMDNTL
A0A0C2MDK7      EAQKVSNIRAIENAVAP--SSP---SQP-KQKVVLALAAAFGTMLAVGVVLLLEVMDNTL
A0A1Y0RCK1      EAQKVSNIRVIENAVAP--SSP---SEP-KQKVILALASVFGSVLAVGVVLLLELMDNTL
A0A1Z4PWZ0      EAQKVSNIRVIENAVPA--SSP---SDP-KPNVILALASVFGSMLAVGVVLLLEIMDNTL
A0A0C2QLT0      EAQKVSNIRVIENAVAP--SSP---SEP-KPKVILALASVFGTMLAVGIVLLLEVMDNTL
A0A1Z4J2K1      EAQKVSNIRVIENAVAP--SSP---SEP-KPKVILALASVFGSMLAVGVVLLLEMMDNTL
A0A3S0ZSX0      EAQLVGNIQIIEAAQIP--LKP---TSP-HKKAVLAIAIVFGSALATGIVLLLELMDNTL
A0A2N6K4T3      EAQLVGNIQIIEAAQPP--TKP---SLP-NKRSVLAIATLFGTALATGIVLLLELMDHTL
A0A370CKT2      EAQLVGNIQIIEAAQPP--TQP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTL
A0A0S3TL97      EAQLVGNIQIIEAAQPP--TKP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTL
A0A2N6M8A0      EAQLVGNIQIIEAAQPP--KKP---SLP-NKRSVLVIAIVFGTALATGIVLLLELMDHTL
A0A2N6M9E1      EAQLVGNIQIIEAAQPP--TQP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTL
A0A2N6KJI4      EAQLVGNIQIIEAAQPP--TKP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTL
A0A2N6MZ77      EAQLVGNIQIIEAAQPP--TKP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTL
A0A2N6KT20      EAQLVGNIQIIEAAQPP--TQP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTL
G6FSN3          EAQLVGNIQIIEAAQPP--TQP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTL
A0A4D9CI02      EAQLVGNIQIIEAAQPP--KKP---SLP-NKKAVLAIAIVFGTALATGIVLLLELMDHTL
A0A328I8B9      EAQLVGNIQIIEAAQPP--KKP---SLP-NKKAVLAIAIVFGTALATGIILLLELMDHTL
A0A4Q9J4Z7      EAQLVGNIQIIEAAQPP--KKP---SLP-NKKAVLAIAIVFGTALATGIILLLELMDHTL
A0A0M0SU69      EAQLVGNIQIIEAAQPP--KEP---SLP-NKKAVLAIATVFGIALATGIVLLLEFMDHTL
A0A1Z4TIZ8      EAQLVGNIQIIEAAQPP--KEP---SLP-NKKAILAIATVFGTALATGIVLLLELMDHTL
A0A2T1E9V8      ENRTVGNVQIVEYAEIP--VVA---TNA-SNKSSMIAASLAGILVAGAVVYFLELTDKKI
A0A1Z4LN32      ESQTVGNASIVESAKVS--PSP---QVQKQKFIVTFGSIFVGLVLSIGSAYFVDLIDRRL
A0A2I8A9F5      ESQTIGNARILEYAEVD--SSP---KASKKKGLTLMVSVFGGLLVGIAVAFLLDVIDRRL
A0A218Q6R8      ESQTIGNARVLQYAEIG--SNS---SANKKKIIILLGGGFVGLLLGVAAAFFIDLIDRRV
A0A218QGE0      KNQTVGNAKVVEYAKVA--FSP---SVKKKKLVITLGSGFVGLLLGVASAFFVDLIDRRL
A0A3M2GQQ6      EAQETAPWRVLEPPYEP--QLP---ISP-NVRRNLLLGLIAGGLLGVAAAILVERSDQRV
A0A6H1U2X0      EAQETAPWRVLEPPYEP--QLP---ISP-NVRRNLLLGLIAGGLLGVAAAILVERSDQRV
K1XF69          ANKITNNARIIETANVP--DEG---KTA-KVPLLAL-GVMGGLVASTTLLLLMEMGDKSL
B5W297          ANKITNNARIIETANVP--DEG---KTA-KVPLLAL-GVMGGLVASTTLLLLMEMGDKSL
A0A6H2AL05      ANKITNNARIIETANVP--DEG---KTA-KVPLLAL-GVMGGLVASTTLLLLMEMGDKSL
H1W7M8          ANKITNNARIIETANVP--DEG---KTA-KVPLLAL-GVMGGLVASTTLLLLMEMGDKSL
A0A5Q4H6A5      ANKITNNARIIETANVP--DEG---RTA-KIQLLAL-GVMGGLVASTTLLLLMEMGDKSL
D5A466          ANKITNNARIIETANVP--DEG---RTA-KIQLLAL-GVMGGLVASTTLLLLMEMGDKSL
U5QJM6          AAQELSPWRVIEPAVLPDKEKP---VWP-KPLVTLGVGSILSVVFGLLVAVLLETFDDRV
A0A1Z4RPC6      VNQQTGNAEVIELGKVP--DKG---STG-RVFLIAL-GVLMGLFLSNLTVILLEMQDRTL
A0A2T1CMZ0      VNQQTGNAQIIESGIVP--EEG---STG-RLPLIVL-GVLTGLFLANLTAILLEMQDHSL
L8M4F7          LLQETSNVEIVEPALVP--IKG---TSS-KMKLLAL-GVMGGLFFSNAAVLLLETRDRSL
A0A140K2P2      ENQQNGNAQIIELAKLP--EKG---SSG-RMAFMLV-GILLGLLLSNLSVLLVEMQDRSL
K9XWX4          ENQQNGNAQIIELAKLP--EKG---SSG-RIAFMLV-GILLGLLLSNLSVILVEMQDRSL
A0A140KB14      QNQKSGNAQIIELAQLP--EEG---SSG-RLALMVL-GVILGLLLSNLSVLLLEMQDRSL
K9XX88          QNQTTGNAQIIELAQLP--EKG---SSG-RLALMVL-GLILGLLLSNLSVLLLEMQDRSL
A0A563VSV6      RNKQTGNAEIIEQAIAP--ENG---STG-RMALMLL-GILMGLLLSNLTAIYLDMQDRTI
L8LZE9          QNKQTANARIIEPAIAP--EKG---SSG-QLALMAL-GILSGLLLSNLTAIILDKQDRSL
A0A433NM31      ENQNVGNAQIVDVGRVA--EEP---VAP-KKLLNFALGGVAGIILAVFIALARDAVDTSI
A0A1Z4NDS1      ENQNIGNARIVSYALVP--DTP---AGP-KKILIIAAGAIAGFLCGVITAFALDLIDSSL
U9VXM0          ENQNVGNARIVSPALSP--TEP---IGP-SLKLFLLAGGFVGFLLGLIAAFFADIIDQSI
A0A6M0RI13      ENQNIGNARIVSPALIP--NEP---LGP-SLKLFLMTGGFAGLLLGLITAFMADLLDQSV
A0A6M0S1N5      ENQNIGNARIVSPALIP--NEP---LGP-SLKLFLMTGGFAGLLLGLITAFMADLLDQSV
K9F4D9          ENQNIGNARIVSPALIP--NEP---LGP-SLKLFLMTGGFAGLLLGLITAFMADLLDQSV
A0A6I5QPI5      ENQTVGNVRVVSLAQIP--NSP---AGP-DRRMYLVAGGFMGVLLAIATAFLLDLLDSSV
A0A1Z3HMQ0      ENQTVGSAQILEPAAPP--RFP---VGT-STKKYIAAGGAVGLLLGVAMAFFLDLIDKSI
A0A433W533      ENQNMGNARIIESALAP--EKA---LSL-KPMIILAAGILLSVVLSSGTVAVLEIKDTSV
A0A2P8QWJ3      ENQNMGNARIIESALAP--EKA---LLF-KPMIILAAGILLSVVLSSGTVAVLEIKDTSV
A0A2T1FKP8      ENQNMGNARIIESALAP--EKA---LLF-KPMIILAAGILLSVVLSSGTVAVLEIKDTSV
K9U6L7          ENQNMGNARIIESALAP--EKA---LLF-KPMIILAAGILLSVVLSSGTVAVLEIKDTSV
A0A1E5QP61      ENQNVGNARVISYATLP--VNP---VAP-NKKLLVAAGVVGGSMLYVLTAFLLELMDPSI
U5DPF5          ENQNLGNARVVENALVP--INP---IWP-RMQLILMAGGIVGALIGTATAITLDVRDQSL
A0A6P0X488      ENQNVGNARIIAYAQQP--EIA---VGP-NKKLIIGAGVVAGSLLYIITAFVLDLMDPSI
A0A6P0UVD5      ENQNVGNARIIAYAQQP--ELA---VGP-NKKLIIGAGVVAGSLLYIITAFVLDLMDPSI
A0A6P0VDM0      ENQNVGNARIIAYAQQP--ELA---VGP-NKKLIIGAGVVAGSLLYIITAFVLDLMDPSI
A0A6M0G142      ENQNVGNARIIADALVP--EVA---VGP-NKKLIIAGGMIAGSLLYIVTAFVLDLMDPSI
A0A6P0MR53      ENQNVGNARIIAYAQVP--EVP---LGP-KRKLIIAAGVVVGSLLYIVTAFVLDLMDPSI
A0A3M2GIL5      ENQNVGNARVIASASPP--EFP---VGS-GKKLYLAAGIVAGGMLYVVTAFLLELIDPSI
A0A6H1TSJ9      ENQNVGNARVIASASPP--EFP---VGS-GKKLYLAAGIVAGGMLYVVTAFLLELIDPSI
A0A3M1PML8      ENQNIGNVRVVSPAIVP--DDP---LPS-QKKLFLIAGSLAGMLLGVATAFGLDLFDRSI
A0A6M8BE85      ENQNVGNVRVVSSATIP--DEP---LPS-KKKLFLVAGALSGMLLGVATAFGIDLFDRSI
A0A0T7BPZ0      ENQNMGNARIISTALVP--DKP---GNS-RKLLILGGAGFFGLLVGIIAALALDLLDQSV
A0A352X442      ENQNVGNARIVEAAAVP--EKP---TSS-KKKLIAAGGVVVGGLLGIAVAFLVDLIDHSV
A0A6B3NF44      ENQTVGNASIISTAIVP--ENP---TGS-KKKLILAAGGMVGILLGVTTAFLLDLIDSSV
A0A6M0EPL4      ENQTVGNASIISTAIVP--ENP---TGS-KKKLILAAGGMVGILLGVTTAFLLDLIDSSV
A0A6P0K6L6      ENQTVGNASIISTAIVP--ENP---TGS-KKKLILAAGGMVGILLGVTTAFLLDLIDSSV
A0A6P0MRR9      ENQNVGNARIISLATEP--KKP---VAS-KKKLVIAIGGIMGILLGIAIAFLLDLIDGSI
A0A6P0UX57      ENQNVGNAHIISYATEP--EKP---VAS-KKKLVIAAGGVMGILLGLAVAFLLDLIDGSV
A0A6P0X1X4      ENQNVGNAHIISYATEP--EKP---IAS-KKKLVIAAGSIMGILLGLAVAFLLDLIDGSV
A0A0M0SHU3      ENQNIGNARIISPALVP--DEP---SGA-RKALVVLGGGVLGALLGIIAALAADLIDRSI
A0A1D2PBN3      ENQNVGNARIISPALIP--DKP---AGS-RKILMITGGGVLGILLGVIAAFTLDLIDRSV
A0A0C2LVR7      ENQNVGNARIISPALIP--DKP---AGS-QKILVITGGGVLGILLGVIAAFSLDLIDRSV
A0A1Z4PQB9      ENQNVGNARIISPALIP--DKP---AGS-RKILMITGGGVLGILLGVIAAFTLDLIDRSV
A0A1Z4SFN6      ENQNIGNARIISPALVP--DEP---TGP-RKALIIAGGGVLGILLGIMAAFTLDLIDRSL
K9PGI8          ENQNIGNARIISPALIP--DAP---AAS-QKNLIVLGGGIFGAMLGLIAALTLDMIDRSV
K9TLQ0          SAQKAMPWQLISQPEVG--TVP---ISP-NLSRSLLLGGIAGLMAGIGAALLAEKLDTKF
K9QF04          TARKVPPWQVISRIEAP--NKP---ISP-NPVRDLLLGGFAGLLAGIGTAIAVEKFDNKY
K9W1T3          ENQTVGNARIVTPASIP--ERA---IAP-KKAQNLAVGGLLGILLGIAVALALETTDKSI
K9SGJ5          EAQEISSWRVLDAALLP--LQP---IEP-NVLRNLVFGGFAGILFGVAIAMYLERSDERI
A0A6N2JS94      EAQEISSWKVLEPPLIP--IRP---SSP-DIERSLITGAISGLVLGILLALLLNRLDQRI
A0A6C2DSN4      EAQEISSWKILEPPLLP--VRP---SSP-DIERSLFISAIAGLGLGVLIALLLDRLDQRI
L8MYT6          EAQEISSWKILEPPLLP--VRP---SSP-DIERSLFISAIAGLGLGVLIALLLDRLDQRI
A0A352JGJ6      EAQEISSWRILEPPLIP--TRP---SSP-DIEKSLIAGTFIGLTLGILCALLFNRLDQRI
A0A1J5GLS2      EAQEISSWRVLEPPLIP--TRP---SSP-DIERNLMTGAFVGAVLGILSALALDRLDQRI
A0A2W4W6M5      EAQEISSWKVLEPPLIP--TRP---SSP-DIEKGLIAGAFFGLVLGISSALILNRLDQRI
A0A2W7AN33      EAQEISPWKILEPPLIP--TRP---SSP-DILMNLFVGGISGLALGVLLALLLNRLDQRI
A0A256BLV2      EAQEISSWKILEPPLTP--IKP---SSP-DIERSLITGAISGIALGILFALLLNRLDQRI
A0A2W6ZXF3      EAQEISSWRILEPPLIP--TRP---SSP-DIERSLITGAFVGAVLGILSALALDRLDQRI
A0A2Z5WX66      EAQEISSWRVLEPPLIP--IRP---SSP-DIEKSLIIGALGGLVLGVLFALLLNRLDQRI
Q7NEU3          AAQELSPWRVIEPAAIP--EKP---IWP-KPLLTLGGGALLGLVFGLGIASLLESVDDRV
A0A3C0N2P0      KARTSTSWKKISGPQKP--QAP---ISP-NVPRGILLGIVTGLMAGAGVAFLAEKLDKVF
A0A6P0JR04      AAQRTMSWELMNQPHRP--QYP---IAP-NMSRGILLAVVAGLLAGAGAALIAEKLDVRF
A0A6B3M6M6      SAQKTLPWQVIRKPQQP--QEP---ISP-NVPRGMILGVVAGMLAGCGAGLLAEKLDRVF
A0A6P0KD09      SAQKTLPWQVIRKPQQP--QEP---ISP-NVPRGIVLGVVAGMLAGGGAGLLTEKFDRVF
A0A6B3NIJ0      SAQKTLPWQVIRKPQQP--QEP---ISP-NVPRGIVLGVVAGMLAGGGAGLLAEKFDRVF
A0A6M0F053      SAQKTLPWQVIRKPQQP--QEP---ISP-NVPRGIVLGVVAGMLAGGGAGLLAEKFDRVF
A0A6P2ATU9      SAQRTTSWELLNAPDLP--MYP---IAP-DVTRGMAVAVMAGLVAGVGAMLIVEKLDVRF
A0A352XE00      SAQKTLPWQLIAPPQTP--IKP---ISP-NVPRGLVLATVAGLIAGAGAGSLAEKLDKAF
A0A6P0QC14      ASQKTPPWQKLSEPKQP--GAP---ISP-NVPRGLVLSAIAGLLAGAGAGFLAEKLDKVF
B4VS56          AAQKTLPWQLIAEPQQP--QAP---ISP-NIPHGIALGAVAGLLAGAGAGFLAEKLDKVF
A0A352AAQ3      ESQKTPPWQKLSDPQKP--QTP---ISP-NVPRGIVLGTVAGLLAGAGAGMLAEKLDKAF
A0A350Y472      ESQKTPPWQQLSQPQKP--QQP---ISP-NIPRGIALGAIAGLLAGAGAGMLAEKLDKAF
A0A355DVB4      ESQKTPPWQQLSQPQKP--QQP---ISP-NIPRGIALGAIAGLLAGAGAGMLAEKLDKAF
A0A1Z4RMB9      ENQQSGNTDIVEYATVP--DKG---SAG--RVMLMGLGVILGAFLANLSIILLEMQDRSL
A0A318B4H2      -GVGSNNVAIVDAAEVP--GGP---SEP-NLNKTLLVSLLIGLVLAVGLVVLAEEIDQSL
B4WQE3          AAQQQTPWEILTPPSAP----Q---AFSQTGKSSLLVGPILGLLLGSGIALLVDRVKGKI
A0A2K3BR24      ENQNLGNARIIESASIP--TSP---ISP-RIKLNLALGGILGAMLGIATALALDARDRTV
K9YXY1          ENQNLGNARIIESASMP--TSP---ISP-RIKLNLALGGILGAMLGVATALALDARDRTV
A0A1Q4RTR1      ENKTVGNARVVSQALVT--DNP---VSP-KIALNLALGGFLGIILAVGAALTLEALDGTV
A0A1Z4SQV2      ENKTVGNARIVSEAQVT--NRP---VSP-KLYLNLALGGFLGIILAVGAALMSEALDGSV
A0A2H2XGN1      ENKTVGNARIVSEAQVT--NRP---VSP-KLYLNLALGGFLGIILAVGAALMSEALDGSV
A0A433UXH8      ENKTIGNARIVSEAQVT--NRP---VSP-KLYLNLALGGFLGIILAVGAALTLEALDGTV
A0A0V7ZFJ4      ENRSVGNATIISEALVP--EHP---ISP-NITRNLLLGGIGGILLGVGTALLLERTDKSL
A0A0V7ZNJ9      ENQNIGNARIISEALVP--DKK---ISP-RIALNLLLGGFLGILLGAGTALILETMDKSL
A0A367RIS1      ENQNVGNARIVSEALLP--KKP---ISP-RILLNLALGGFLGFFLAIAAALLLEAGDTSV
A0A235IXQ2      ENQNVGNATIVSNALVP--KKR---ISP-RISLNLALGGFLGFFFAIGVALLLEAGDKSV
A0A1W5CNX3      ENQNVGNARIVSEALLP--KTP---VSP-RIVLNLALGGFLGFFLAIGAALLLEAGDKSV
A0A5Q0GJJ5      ENQNVGNARIVSEALLP--KTP---VSP-RIVLNLALGGFLGFFLAIGAALLLEAGDKSV
Q3MEB7          ENQNVGNARIVSEALLP--KTP---VSP-RIVLNLALGGFLGFFLAIGAALLLEAGDKSV
A0A1Z4KHN9      ENQNVGNARIVSEALLP--KTP---VSP-RILLNLALGGFLGFFLAIGAALLLEAGDKSV
Q8YT70          ENQNVGNARIVSEALLP--KTP---VSP-RILLNLALGGFLGFFLAIGAALLLEAGDKSV
A0A166IWU6      ENQNVGNARIVSQALLP--EKS---VSP-RINLNLALGGFLGILLAVGSALFLDALDKSV
A0A2S0Q8C0      ENQNVGNARIVSQALLP--EKS---VSP-RINLNLALGGFLGILLAVGSALLLDALDKSV
W6FSX4          ENQNVGNARIVSQALLP--EKS---VSP-RINLNLALGGFLGILLAVGSALLLDALDKSV
A0A218Q4C1      ENQNVGNARIISEALLP--DKS---ISP-RIKLNLALGGFLGILLAFGSALLLDAVDKSV
A0A6P1ZT04      ENQNVGNARIISKALLP--EKS---VSP-RIALNLALGGFLGIVLAFGSALLLDAVDKSV
A0A5P8VSD1      ENQNVGNARILSEALLP--KKP---VSP-IILLNLALGGFLGFFLGIGAALLLEAEDKSV
A0A1S1ZVW2      ENQNVGNARVISSALIP--EIP---ISP-RTALNIGIGGIVGLVLGVGTALLLETLDKSV
A0A0R0M9H9      ENQNVGNARVISSALVP--EIP---ISP-RTALNIGIGALVGLVLGVGTALLLETLDKSV
A0A7H0F4U6      ENQNVGNARVISSALVP--EIP---ISP-RTALNIGIGALVGVVLGVGTALLLETLDKSV
A0A1B7WX82      ENQNVGNSRIISQALVP--ERP---VSP-KKPLNLAMGGFLGILLGAGTALLLESMNQAL
A0A1B7WTD1      ENQNVGNARIISEALVP--EIA---VSP-KKPLNLALGGFLALLLGAGTALLLESMNQTL
A0A480ABC0      ENQNVGNARVISEALVP--EIA---VSP-KKPLNLALGGFLGLLLGAGTALLLESMNQTL
A0A1Z4LRU5      EKQNVGNAKVIASALVP--NKP---ISP-KIALNLALGGFLGILLGVGTALILEAMDKSL
A0A1Z4JVB4      ENQKVGNARVLSEALVP--DKP---ISP-IIAINLALGGALGILLGIGVAILLEAMDSSL
K9PIA4          ENQNIGNARVISQALVP--NRP---VSP-VIHLNLALGGFLGILLGLGTALVLESMDNSL
A0A1Z4HVE1      ENQNIGNARVISQALVP--DKA---ISP-IIPLNLALGGFMGIMLGLGTALILEAMDNSL
A0A252ECZ1      ENQNIGNARVISEALVP--ERP---VSP-VIPLNLALGGFLGILLGVGTGLLLEAMDTSL
A0A1Z4G5Y1      ENQNIGNSRVISDALVP--EKP---VSP-IVPLNLGLGGVLAIALGVGAALMLEAADNSL
A0A252DNA2      ENQNIGNSRVISEALVP--DKP---VSP-IVPLNLGLGGVLGILLGVGVALMLEATDNSL
A0A252E1Q4      ENQNIGNSRVISEALVP--DKP---VSP-IVPLNLGLGGVLGILLGVGVALMLEATDNSL
A0A6G9SK36      ENQNVGNARIISEALVP--DKS---VFP-VIPLNLALGGLLGIVLGAGTALVLESIDNSL
A0A1Z4M597      ENQNVGNARVISEALVA--DKS---VSP-IIPLNLALGGILGIILGAGTALVLESIDNSL
A0A1Z4MWT1      ENQNVGNARVISEALVP--DKS---VSP-IIPLNLALGGILGIILGAGTALVLESIDNSL
A0A1Z4TX53      ENQNVGNARVISEALVP--DKS---VSP-IIPLNLALGGILGIILGAGTALVLESIDNSL
A0A2A2TNQ5      EQQKVGNARIVSEALVP--EKP---VAP-KIPLNLALGGFLGVLLGAGTALLLEALDKSL
A0A3S1C4K5      EQQKVGNARVVSAAEVP--EIP---VSP-KIPLNLALGGVLGIILGVGAALVLEAMDKSL
A0A1X4G3D5      QGETTGTARVLSSALVP--KRP---VSP-RIPLNIGIGAILGVILGVGTALVLESLDKSV
D4TNI2          QGETTGTARVLSSALVP--KRP---VSP-RIPLNIGIGAILGVILGVGTALVLESLDKSV
A0A1Z4H6Z8      ENQNVGNARVISDALVP--DKA---VSP-IIPLNVALGGFLGILLGVGAALMLEATDNSL
A0A1Z4NPM1      EQQKVGNARIVSPALVP--DKP---VSP-KIMLNLALGGFLGVLLGAGSALLLEALDKTL
A0A3F3KPR9      ENQNVGNARVISSALVP--EIP---ISP-RTALNIGIGALVGVVLGVGTALLLETLDKSV
D4TGN7          ENQNVGNARVISSALVP--EIP---ISP-RTALNIGIGALVGVVLGVGTALLLETLDKSV
A0A1Z4UZW9      ENQNVGNSRIISEALVP--ERP---VSP-KIPLNLALGGFLGIILGAGTALVLESMNQSL
A0A0K2M5H0      ENQNVGNSRIISGALVP--ERP---ISP-KIPLNLALGGFLGVILGAGTALVLESMNQSL
A0A1B7VSH4      ENQNVGNSRVISEALVP--ELP---VSP-KIPLNLALGGFLGVLLGAGTALLLESMNQSL
A0A1B7W126      ENQNVGNSRVISEALVP--ELP---VFP-KIPLNLALGGFLGVLLGAGTALLLESMNQSL
A0A3D4C6Q6      ENQNVGNSRVISEALVP--ELP---VFP-KIPLNLALGGFLGVLLGAGTALLLESMNQSL
A0A1B7UVJ4      ENQNVGNSRIISQALVP--ERP---VSP-KKPLNLAMGGFLGILLGAGTALLLESMNQAL
A0A1B7UTR1      ENQNVGNSRIISEALVP--ERP---VSP-KIPLNLALGGFLGILLGVGTALLLESMNQSL
K7W0A4          ENQNVGNSRIISEALVP--ERP---VSP-KIPLNLALGGFLGILLGAGTALLLESMNQSL
A0A5C0DRW9      ENQNVGNSRIISEALVP--ERP---VSP-KIPLNLALGGFLGILLGAGTALLLESMNQSL
A0A6H2C088      ENQNVGNSRIISEALVP--DRP---VSP-KIPLNLALGGFLGILLGAGTALLLESMNQSL
A0A1U7HGH0      ENRTVGNVQIIEYAQVP--SGA---INA-SNTSALAAGSLAGLMIAGGIVYLLELTDKKI
K9XJD3          ENRTVGNVRIIEYAQVP--SGA---INA-SNTSALAAGSLAGLMIAGAIVYLLELTDKRI
K9SX01          EEQNIGNARILSPAVPS--GVP---ISP-KISNNLTTGAVLGIVAAISVALLLNSRDNLL
A0A4P7ZT55      VAQKTLPWQVISPPEVD--ETP---VKP-NLSRNLMLGLLLGAMAGAGAALLRDRLDHVF
A0A1E5QIR9      EEQNIGNVRVIQAAVFP--ERP---IAP-QKKINFGLGGVVGIFLAVVTALVLDAKDTRI
A0A6P1A9A0      EAQKATPWQLISNPFQP--SAP---ISP-DVPRGLLIGGMAGLLAGIGAAMLAEKFDNRF
A0A1Z4IBC7      QNQKIPNARVISYALVP--DFP---EGP-RKILFVIGGGAVGIFLGIIAAFSIDLIDRSV
A0A1W5CPC7      QNQKIPNARVISYALIP--DFP---EGP-RKILFIIGGGVAGIFLGIIAAFSIDLIDRSV
A0A5Q0GKD1      QNQKIPNARVISYALIP--DFP---EGP-RKILFIIGGGVAGIFLGIIAAFSIDLIDRSV
Q3MDC6          QNQKIPNARVISYALIP--DFP---EGP-RKILFIIGGGVAGIFLGIIAAFSIDLIDRSV
A0A1Z4KM73      QNQKIPNARVISYALIP--DFP---EGP-RKILFIIGGGVAGIFLGIIAAFSIDLIDRSV
Q8YNX7          QNQKIPNARVISYALIP--DFP---EGP-RKILFIIGGGVAGIFLGIIAAFSIDLIDRSV
A0A367R4K6      QNQKIPNARVISYALIP--DKP---EGP-RKLLFIVGGGAIGFFLGIIAAFSLDLIDRSV
A0A1E2WSV8      QNQKIPNARVISYALIP--DKA---EGP-RKILFIVGGGGIGLFLGIIIAFGLDLIDRSV
A0A7D7L9Y1      QNQKIPNARVISYALIP--DKA---EGP-RKILFIVGGGGIGLFLGIIVAFGLDLIDRSV
A0A2R5FRT9      QNQKIPNARVISYALIP--DKA---EGP-RKILFIVGGGGIGLFLGIIVAFGLDLVDRSV
A0A2K8T1B6      QNQKIPNARVISYALIP--DKA---EGP-RKILFIVGGGGVGLFLGIIVAFGLDLIDRSL
A0A235I9I0      QNQKIPNARVISYALIP--DKA---EGP-RKMLFIIGGAGVGFFLGIIVAFTLDLIDRSV
A0A2D0HQT8      QNQKIPNARVISYALTP--DKA---EGP-RKMLFIIGGAGVGFFLGIIVAFTLDLIDRSV
A0A2L2NU95      QNQKIPNARVISYALIP--DKA---EGP-RKMLFIVGGAGVGFFLGIIVAFTLDLIDRSV
A0A367S084      QNQKIPNARVISYALTP--DKA---EGP-RKMLFIIGGAGIGFFLGIIVAFTLDLIDRSV
A0A1Z4SMD6      ERQTVGNARVIQHARVP--NKP---TLSKSTLALAGGGVFGGLLFGVAVAFFIDLIDNSL
A0A2H2Y096      ERQTVGNARVIQHARVP--NKP---TLSKSTLALAGGGVFGGLLFGVAVAFFIDLIDNSL
K9S8M8          ENQNVGNARIVSSASFP--SKP---VGPNKKVVLMGGMVVGGMLY-LIVAFVFELIDPTV
A0A1Z4NFV0      ENQTVGNARIIQAAAPP--PLP---AKSKMSLLIGVGGVFAGLSLGIAAAFLIDLVDRSI
A0A3M9ZEU1      ENQNVGNARVISSAIVP--EEP---SGLSKKVYLLAGGI-VGALLAITTAFLLDLCDRSI
A0A1Z4JK72      RNQQVGNARVLQNALVP--TQP---TGRMRLILLAAGTM-IGLLLGVAAAFFRDMMDKSL
A0A0N7Z489      KNQQVGNARVLQSAMVP--TRP---AGRMRLILLAAGAM-VGLLLGIAAAFLVDTIDKSL
A0A0S3TXS2      KNQQVGNARVLQSAMVP--TRP---AGRMRLILLAAGAM-VGLLLGIAAAFLVDSIDKSL
A0A2A2TPF8      ENQNVGSARIVQDAAVS--NQP---VRSKLTMYLAAGGVFVGLMFGIAAAFLIDIIDRSI
A0A1Z4R0P8      ENQNVGSARIVQEAVVP--NQP---VSSKLTLYLAAGGIFVGLMLGIAAAFLIDIIDRSI
A0A0T7BUI3      EKQTIGNAKIIQPAQIP--ETP---MLSKKSLMLALGSLFAGSLLGIAGAFFVDLIDRSL
A0A1Z4LP32      EKQTIGNSRIIQSARIP--NKT---VLSKMTIMLAGGGVFVGLLLGIAAAFTVDLIDRSL
K9REP9          EKQTIGNSSIIQKARVP--KKP---SLSKMTLLLAGGGVFVGLLFGIAAAFTVDLIDRSL
A0A1Z4SIJ3      EKQTIGNARIIQPARLP--NKP---VLSRLTLLLAAGSAFAGLLFGVSIAFFVDLIDNSL
A0A2H2XPG4      EKQTIGNARIIQPARLP--NKP---VLSRLTLLLAAGSAFAGLLFGVSIAFFVDLIDNSL
K9V3C7          ENQAMGNARVIQNAIAP--NSP---ISSKLTLLLAVGGVFVGVFLGIAAAFLVDSIDKSI
A0A1Z4T6Y7      ENQTVGNARVIQNAVVS--PNP---ARLRMMFLLGAGGIFIGALLGVAAAFLVDVIDKSI
A0A2H2Y561      ENQTVGNARVIQNAVVS--PNP---ARLRMMFLLGAGGIFIGALLGVAAAFLVDVIDKSI
A0A1Q4S362      ENQTIGSARIVQNAVVS--PNP---ARMRMMLLLGAGGIFIGALLGVAAAFVVDVIDKSI
A0A3S1CIN8      ENQTIGSARIVQNAVVS--PNP---ARMRMMLLLGAGGIFIGTLLGVAAAFLVDVIDKSI
A0A2A2TC28      EKQTIGNARVVQPALVP--KIA---AMSKMTLLLLGGGVFVGLLVGIASAFFIDLIDRSL
A0A0C1NCB0      EKQTVGNARIIQPAQLP--QKP---ALSKLTLLLPVGGILGGLLLGVAAAFFVDLVDRSL
A0A2N6K7Q9      EKQTIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSL
A0A2N6MXH6      EKQTIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSL
A0A2N6M5A8      EKQTIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSL
A0A2N6LL61      EKQTIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSL
A0A0S3TP66      EKQTIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSL
G6FP91          EKQTIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSL
A0A1U7GYR5      EKQTIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSL
A0A2N6KY52      EKQTIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSL
A0A2N6KMP5      EKQTIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSL
A0A2N6MA45      EKQTIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSL
A0A4Q9J9V9      EKQTIGNARIVQPAQIP--KKP---VISKTKILLASGSIFAGVLLSIAAAFFVDLIDRSL
A0A328IGA1      EKQTIGNARIVQPAQIP--KKP---VISKTKILLASGSIFAGVLLSIAAAFFVDLIDRSL
A0A4D9CE41      EKQTIGNARIVQPAQIP--KKP---VISKTKILLASGSIFAGVLLSIAAAFFVDLIDRSL
A0A0M0SFT2      EKQTIGNARIVQPAQTP--KKP---VISKTKILLASGSIFAGVLISIAAAFFVDLIDRSL
A0A1Z4TLC8      EKQTIGNARIVQPAQIP--KKS---VISKTKILLATGSIFAGVLLSIAAAFFVDLIDRSL
A0A0C2LFH0      EKQTVGNAKEIQLAQVP--KRP---SVSKITFLLAGGSVFVGLLLGTAAAFFVDLIDRTL
A0A1Z4IYV4      EKQTVGNAKEIQAAKVP--KKP---VLSKVVLLLAGGGVFVGLLLGIAAAFFVDLVDRSL
A0A1Z4Q0T6      EKQTVGNAKEIQPAKVP--KKP---VLSKLVLLLVGGGVFVGLLLGVAAAFFVDLVDRSL
A0A0C2PT44      EKQTVGNAREIQPAKVP--KKP---VLSKVVLLLAGGGVFVGLLLGVAAAFFVDLVDRSL
A0A1D2P6J4      EKQTVGNAKEIQPAQVP--KKP---VISKVVLLLAGGGVFVGLLVGVAAAFFVDLIDRSL
B4WP72          ENQNVGNARVVEAAIAP--ESP---VDS-RRELILIAGILAGSLVGISAAFAQDLLDRSI
A0A2T1CIL7      ENQNVGNVRIIADAIVP--EKP---TSSTQKKLITLIGSAMGVLLATAFAFLLDFKDRSI
A0A433V7A0      ENQNIGNARIIESASIP-RHAS---DFT-IKIIILGLGGLVGTLLATATIFVLELTDKSI
A0A2T1FTR8      ENQTLGNSRILTHAELP--QEA---LSP-KKGQNIAIGGFLGLFLGAATAFLLDGADKRI
K9UA41          ENQTLGNSRILTHAELP--QEA---LSP-KKGQNIAIGGFLGLFLGAATAFLLDGADKRI
A0A0C2LBE2      ENQNIGNARVISPALVP--DKS---TGS-GKILIIGAGGILGVLFGAVAAFALDTIDPSL
A0A433NN38      ENQNVGNATIISPALIP--DKP---SGP-RKTLLIAAGGILGILLGVVAAFSLELVDQSV
A0A2N6K0T2      ENQNVGNARIISPALVP--DEP---SGV-RKALIAAGGGVLGILLGIIAALAADLIDRSI
A0A2N6ML72      ENQNVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSI
G6FQZ6          ENQNVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSI
A0A2N6MQX9      ENQNVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSI
A0A2N6KXT6      ENQNVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSI
A0A2N6KGB9      ENQNVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSI
A0A2N6L3Y5      ENQNVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSI
A0A0S3TIS7      ENQNVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSI
A0A1U7GW28      ENQNVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSI
A0A2N6LW63      ENQNVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSI
A0A328IH74      ENQSIGNARIISPALVP--DEP---SGM-RKALIVFGGGVLGILLGIITALASDLIDRSI
A0A4D9CIB0      ENQSIGNARIISPALVP--DEP---SGM-RKALIVFGGGILGILLGIITALASDLIDRSI
A0A1Z4TQ63      ENQNIGNARIISPALVP--DEP---SGT-RKALIVLGGGVLGILLGIIAALTSDLIDRSI
A0A4Q9J8G2      ENQNIGNARIISPALVP--DEP---SGM-RKALIVFGGGILGILLGIIAALISDLIDRSI
A0A350Y0P6      ENQNVGNARVITYASIP--EAP---VSP-KKKLILVGGIVAGSLLYIVTAFVLDLMDPSI
A0A352X940      ENQNVGNADILARALVP--EDP---VSP-KKKLILGGGIIAGSLLYIIVAFVLDLMDPSI
B8HTN4          EQQNAGNVRLIQAATLS--DEP---VSP-KLLLNLILGTILGSLGAIVVIFILESKDKTL
A0A6P1AFJ5      QAQEALPWQLLDEVKSP--QKN---VSP-SKSRSLLIAAIAGLLAGGGAALVAEKLDRVF
B0CAX4          ENQNIGNVRVIAAALEP--KEP---VSP-RKAFNLAVGFFLGGLLGLGTALLLEALDTSV
A0A1Z4RN12      EQRNTGKVRVTAPAAIA--EDP---VNP-DKKVIVAAGAMMGALFGMALAFLLDLKDNTI
A0A2T1CMF9      QDYKVDKVRVISVAALA--EDP---VNP-DAKVIVAAGAMMGLLFGTALAFLLDLKDNTI
Q7NDC5          EAQNIGNATLIEPAEVP--EIP---AWP-KPLLNLAAGGVLALILAALAAYTREFFDDSL
U5QGK3          EAQNIGNAELIEPAVAP--ELP---AWP-SPLLNLGAGALLGAILAMLVAYGREFFDDSL
A0A2W4UY24      EKQDVGNARTISLADLP--EES---ISP-ALKLYLLAGGVVGALLGIAIAFLADLLETSV
A0A0D8ZUV2      ENQNTGNASIVEPALVP--DKA---SIK-LRVMILGLGVIVSALLAGATIIILEVRDTSV
A0A433VDI0      ANQRIGNAQIIEPAPIP--KKP---SLL-KPAIILALGNMLGILLAAATIVILEVKDTSI
A0A3D1PG43      ENRNIGNASIIETALVP--EQP---TGG-KKLIILGLGSVLATLLATGTILILEISDRTI
A0A2P8QQ72      QNRNIGNASIIETALVP--ETP---LLG-KRVMTLGLGGIAAILLAIATITLLELSDASI
K9TZQ7          QNRNIGNASIIETALVP--ETP---LLG-KRVMTLGLGGIAAILLAIATITLLELSDASI
A0A6N8G584      ENQNMGNARIIEFATVP--ENA---SIR-KRAMILALGNVLALILAILTICILELSDRSV
A0A2G7GPR0      ENQNMGNARIIEFATVP--ENS---SVR-KRAMILALGNVLALILAILTICILELSDRSV
K9XH68          ENQNMGNARIIEFATVP--ENA---SVR-KKAMILALGNILALILAILTICILELSDRSV
A0A1U7HW70      ENQNMGNARIIEFATVP--ENA---SVR-KKAMILALGNILALILAILTICILELSDRSV
A0A2S6VEJ8      ENQNMGNARIIEFATVP--ENA---SVR-KKAMILALGNVLALILAILTICILELSDRSV
A0A140KBA0      EKQNIGTVRVLANAIPP--DEP---TGP-SKKLIVAAGGLLGGLLGIAVAFLLDLKDNSL
K9XSG1          EKQNIGTVRVLANAIPP--DEP---SGP-SKKLIVAAGGLLGGLLGIAVAFLLDLKDNSL
A0A2T1GMT4      RNKSTSNARIISSAAVP--EKP---DPG-PKLIIGILGGLVGALFGTSAIAYLELRDGSL
K9UI51          RNKSTSNARIISSAAIP--EKP---EPG-PKLILGILGGLVGALLGTSAIAYLELRDSSL
A0A1Z4QL41      ENQNTASARIITEAIIP--KKS---SGG-KKLIVLLLGGTLGVFLASSTIFILEMRDSSL
A0A2T1FXY4      ENKTTAHARIIAQALVP--NKP---VLE-QKLIVLVLGTMFGALLSTSTVLFLELRDRSL
K9TYI2          ENKTTAHARIIAQALVP--EKP---VLE-QKLIILALGIMIGALLSTSTVLFLELRDRSL
A0A252D4T4      ENNNTPNARIIAKGLVP--NKA---ALG-LKPFVLVLGILLGAFLATTAVIFLETRDRSL
A0A252DJH5      ENNNTPNARIIAKGLVP--NKA---ALG-LKPFVLVLGILLGAFLATTAVIFLETRDRSL
A0A252EB80      ENNNTPNARIIAKGLVP--TKP---ALG-LKPFVLVLGILLGAFLATTAVVFLETRDRSL
A0A6G9SKZ9      ENNNTPNARIIAKGLVP--KKP---TLG-LKPFVLVLGVLLGAFLATTAVIFLETRDRSL
A0A1Z4HPW5      ENNNTPNARIIAKGSAP--KKP---TLG-LKPFILVLGVLLGAFLATTAVIFLETRDRSL
A0A1Z4MSN1      ENNNTPNARIIAKGSVP--NKP---TLG-LKPFILVLGVLLGAFLATTAVIFLETRDRSL
A0A1Z4U1C2      ENNNTPNARIIAKGSVP--NKP---TLG-LKPFILVLGVLLGAFLATTAVIFLETRDRSL
A0A0D6KV51      ENNNTPNARIIAKGSVP--IKP---TLG-LKPFILVLGVLLGAFLATTAVIFLETRDRSL
A0A1Z4MKF8      ENNNTPNARIIAKGSVP--IKP---TLG-LKPFILVLGVLLGAFLATTAVIFLETRDRSL
A0A2C6WC43      ENTNTASSRIIAQALVP--TDP---VAG-KKFLVLLLGIMLGLFLATTTVLFLGMRDRSL
A0A1Z4L5A1      ENTNTASSRIIAQALVP--ADP---VAG-KKLIVLLLGVMFGLFLATTTVLFLGMRDRSL
A0A367QD86      ENTNTASSRIIAQALMP--TDP---VAG-KKFLVLLLGVMFGLFLATTTVLLLGMRDRSL
A0A2K8SM78      ENTNTASSRIIAQALVP--KDP---VVG-KKIIILLLGVMFGLFLATTTILFLSMRDRSL
A0A2R5FPC0      ENTNTPSSRIIAPAVVP--NKP---VIG-KKIIILLLGVMFGLFLATTTVLFLSMRDRSL
A0A5P8W5T6      ENTNTASSRIIVPALVP--NKP---VTG-KKIIVLLLGVMFGLFLATTAVLFLSMRDRSL
A0A7D7LDT7      ENTNTASSRIIAQALVP--KDP---VAG-KKLIVLVLGVMFGLFFATTTVFLLAMRDRSL
A0A235IZ96      ENTNTASSRIIAQALVP--KDP---IVV-KKIIVLVLGVMFGLFFATTTVLFLAMRDKSL
A0A2L2NGP0      ENTNTASSRIIAQALVP--KDP---IVV-KKIIVLVLGVMFGLFFATTTVLFLAMRDKSL
K9QM62          EHKNTANARIISQALVP--EEP---VLK-KKIIVVVLSVMFGAFLSTTTVLLLEMRDRSL
A0A1Z4FWI3      ENDNTPNARIIARGLVP--TKP---GLG-LKPIVWLLGILLGAFLSTTAVVFLETRDRSL
A0A1Z4JYE7      ENANTANARIIARGSVP--EEP---LAA-KKMLVLVIGAMFGLFLATSTILLLEIKDKSL
A0A0F5YE28      ENKSTNNARVIEEAIVP---EE---GST-AKTKLIALGIMLGLVGATTSVLILAMGDQNI
U7QEH7          ENKSTNNTRIIEEAMVP---EE---GST-AKIQLLALGIMLGLVAATTSVLLLEMGDKYI
A0A3S1ATK5      QNKNTANARIITQAKIP--EKP---ASG-KKPIVVAIGVLLGAFFGTTTILLLEMRDRSL
A0A2Z6CPH0      ENRNTANARIIAQALVP--EKP---TSG-KKLIILVMGVMFGAFLSTTTVLFLEMRDKSL
A0A1Z4GT50      ANKNTANARIIAQASVP--EEA---VLG-KKPIVLSLGVLLGLFLSTSAVAALETRDRSL
A0A1Z4GIX0      ENKTTPNARVVAQATVP--EKP---ESG-KKLIFIALGLTFGAFLSTSAVLFLEMRDKSL
A0A2H6LC24      ENKTTPNARVVAQATVP--EKP---ESG-KKLIFIALGLTFGAFLSTSAVLFLEMRDKSL
B2J6N5          ENTNTASSRIIAQAIVP--DKP---VES-KKIIVLVLGVMFGLFLATTTVLVLGMRDRSL
A0A367RMI4      ENTNAPSSRIIAQALVP--KDP---TLT-KTIIVLVLGVMFGLFFATTTVLFLAMRDRSL
A0A235HUM0      ENTNTPSSRIIAQALVP--KDP---TLG-KKIIVLVLGVMFGLFFATTTILFLAMRDRSL
A0A2L2NW47      ENTNTPSSRIIAQALVP--EDP---TLT-KTIIVLVLGVMFGLFFATTTVLFLAMRDRSL
A0A1E2WUR1      ENTNTASSRIIAQALVP--KDP---VAG-KKIIVLVLGVMFGLFFATTTILLLAMRDRSL
A0A235IKU3      ENTNTASSRIIAQALVP--KDP---ILV-KKIIVLVLGVMFGLFFATTTVLFLAMRDKSL
A0A1U7MYU6      ENQDTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSI
A0A1D8TNX9      ENQDTANARIIEPAIVP--KKP---LGD-KKLKVLALGVMLGVTLATTAILLLEMRDRSI
A0A6P0L6C2      ENQDTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSI
A0A6P0MVH0      ENQDTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSI
A0A6P0KJV0      ENQDTANARIIEPAIVP--KKP---LGD-KKLKVLALGVMLGVTLATTAVLLLEMRDRSI
A0A6L9ZJG4      ENQDTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSI
F4XKF3          ENQDTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSI
A0A1D9FX10      ENQDTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSI
A0A6P0Q0T0      ENQDTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSI
A0A6P0W5I0      ENQDTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSI
A0A3C0NJ41      ENQSIGNARIIEPALVP--ETR---SPI-NAIITLLFGGTAGTLLGMATIILLEVRDVSL
A0A352AG88      ENQNIGNARIIEPAEVPLLPSS---QMV-QTVLPVVGGGALGILLAIVTIITLEVRDTSI
A0A350Y374      ENQNIGNARIVEPAQIP--DSR---SSG-KSVLILLLGAMAGTLLAMATIIILEVRDNSI
A0A355DPX0      ENQNIGNARIVEPAQIP--DSR---SSG-KSVLILLLGAMAGTLLAMATIIILEVRDNSI
                                                         .                  

K9SLA9          KTSEQASDISG-YSLLGIVP--------DFGYVAKHDQMMRKSAKL--------------
A0A168TT23      HRTEDVEKLVG-RPVLGLIP--------IVKLSEQRKKSGTTTRAEDRAVSHYS------
A0A0M1JWX9      HNPEDLKQATD-KPLLGLIP----------------------------------------
A0A2T1M1V6      FNSKDLQQAG--LPLVLRFP----------------------------------------
A0A2G7GCS2      LRPKDLEQVE--FPVLGRIS----------------------------------------
K9XBH8          LSPRDLRQVE--FPVLGRIS----------------------------------------
A0A1Z4LJ30      LSPKDIVQTN--IPVLANIP----------------------------------------
K9RI76          LSPKDIQQAN--IPVLASIP----------------------------------------
A0A352AE27      LSPKDLQTLK--FAIVVRIP----------------------------------------
A0A3B8JH60      LSPKDLQAIK--FPIVVRIP----------------------------------------
A0A3C0N766      LSPKDLQAIK--FPIVVRIP----------------------------------------
K9W9J7          LSPKDLQATK--FPIVVRIP----------------------------------------
A0A139WSU3      LNLKDLQGQK--FAIVQSIP----------------------------------------
A0A433VN22      LSAKDLQEQK--FAIVERIP----------------------------------------
Q7NF11          LGPKDLQSVE--LPVLARLP----------------------------------------
A0A1Z4JCS8      LTPKDLQALK--FSLVARIP----------------------------------------
A0A6P0PI80      LSPKDLQAIK--FPMVVNIP----------------------------------------
A0A6P0WGT6      LSPKDLQAIK--FPMVVNIP----------------------------------------
F4XTX2          LSPKDLQAIK--FPMVVNIP----------------------------------------
Q7NJN6          LGVRELDSTG--LPVLGRIP----------------------------------------
U5QCC3          LAKRDIEVTG--LPVLARLP----------------------------------------
A0A0S3TYD7      RTVQDLKDVFD-YPVLGMIPSFTDSGLSQVMESLTKNLQKLGNLN---------------
A0A2T1DNG3      HSSDELKQQTA-VPLLGTIP----------------------------------------
A0A3S0Y9N9      KTPESARELLG-YNLLGYIP--------PFTNN---------------------------
A0A433UNK7      KTSKSAKDILG-YNLLGYIP--------PFPNG---------------------------
A0A6P0ZKB8      KTPKSAKDLLG-YALLGYIP--------PFPNG---------------------------
U5QL42          KGVEEAKELTG-LPLLGAIP-------------KTE-------------------NLTET
A0A140K3H3      KQVEEVKQMVR-LPLLGTIP--------KVE------------------------KPLIQ
K9XUB8          KQVEQVKQIAR-LPLLGTIP--------KVE------------------------EPVIQ
A0A6H2NHD5      HDVDELAKVTR-LPNLALVP--------EASGLEHR-------------------SLLMN
A0A2P8W4F7      HSTDELIKTTQ-LPNLTTIP--------NAPALQKQ-------------------PLLIE
A0A5Q4E0Z4      HSADELVKATQ-LPNLALVP--------NAPALQKQ-------------------PLLMV
A0A2P8VVX1      RTSDELKKQVP-LPLLGMLP----RRPSSLPPLRRS-------------------EPDAR
A0A2P8WHY0      RTSDDLKRQVP-LPLLGILPVQPIRKGFSLPGRQDG-------------------GPPI-
A0A2T1CMT9      NTSKEIERRTS-LPILGTAP--------GLSISSSN-------------------NLLTR
A0A7G8J1V5      HQPVDVKDDLN-LPLLGHVP--------HVSFFQGV-------------------REDKR
A0A354B169      HTAAEAKADLR-LPLLGHIP--------HVNFFQGV-------------------REGKR
Q0IDT5          HLPAEVKDDLN-LPLLGHIP--------HVAFFKGV-------------------REDKR
A0A7G8FZD9      HNPGEVKAEMGELPLLGHVP--------YVDFFKGV-------------------REDKR
G4FMX5          HSPGEVKAEIGDLPLLGHIP--------YVDFFKGV-------------------REDKR
A0A7G8FAU7      HHPGEVKDDLG-LPLLGHIP--------HVSFFQGV-------------------REDKR
A3ZA21          HHPGEVKDDLG-LPLLGHIP--------HVSFFQGV-------------------REDKR
A0A076HBF2      HHAGEVKDDLG-LPLLGHIP--------HVEFFKGV-------------------REDKR
A0A7G8FP50      HHPGEVKDDLG-LPLLGYIP--------HVDFFKGV-------------------REDKR
A0A7G8E8K7      HHAGEVKDDLN-LPLLGHIP--------HVEFFKGV-------------------REDKR
A0A7G8GAH0      HNVMEVKEDLR-LPLLGHVP--------HVDFFEGV-------------------REDKR
A0A7G8GNR2      HHAGEVKDDLN-LPLLGHIP--------HVEFFKGV-------------------REDKR
A0A7G8ICD3      HHAGEVKDDLG-LPLLGHIP--------HVEFFKGV-------------------REGKR
A0A2D6FCW3      HHAGEVKMDLG-LPLLGHIP--------HVDLFKGV-------------------REDKR
A0A7G7KJ95      HHAGEVKDELG-LPLLGHVP--------YVSFFQGV-------------------REDKR
A0A7G8EAN3      HHAGEVKDELG-LPLLGHVP--------YVSFFQGV-------------------RENKR
A0A563VQJ3      KSIPELKKKLP-YKVLGVIP--------QMDDVKEQ------------------------
A0A1D8TX52      HSSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A1D9G4T2      HSSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A6P0PR27      HTSDDLKNQVA-LPLLGMIP--------QLPEGKIS-------------------KPVLN
A0A6P0WER7      HTSDDLKNQVA-LPLLGMIP--------QLPEGKIS-------------------KPVLN
F4XP71          HTSDDLKNQVA-LPLLGMIP--------QLPEGKIS-------------------KPVLN
A0A6L9YR57      HSSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A6P0KZ31      HSSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A6P0LPB8      HSSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A6P0SEV1      HSSEDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A6B3N2I8      HTSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A6M0B891      HTSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A6P0IJQ1      HTSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A6P0J8J8      HTSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A6P0ZSH6      HTSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A1U7N5X9      HTSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A6L9Z1V0      HTSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A6P0LC12      HSSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A6P0MVJ3      HTSDDLKNQVA-LPLLGMIP--------ELPEGKIS-------------------KPVLN
A0A2W6ZAV2      HQPQDVEDGLG-LPLLGRLP--------FLPVQDGL------------------------
K9W742          RSSDELKQQVA-LPVLGMTP--------VLPKAKKSEPRMLLPFGKSQALEPVGNQPIIK
A0A3D1PBA3      HTSEELEKQVE-LPLLGMTP--------ELPKNKLA-------------------KPQIS
K9XPB0          YNSRQIQEKIA-LPLLGSTP--------GLPLAKHD-------------------QFVVK
A0A350Y7Z1      HSSEELKRQVA-LPLLGIIP--------ELPRTGGS-------------------GLLVH
A0A352X2A7      HTSDQLKRNLT-LPFLGIIP--------ELPKTRSS-------------------SIFVN
A0A0D8ZYV0      HTSDELEKQVS-IPLLGMTP--------EMPQTKAS-------------------EPVVS
A0A2T1FP73      HSSEDLERQFE-LPLLGMTP--------ELPRGRVA-------------------QPEVS
A0A433VMS2      HSSEDLERQFE-LPLLGMTP--------ELPRGRVA-------------------QPEVS
K9TYA7          HSSEDLERQFE-LPLLGMTP--------ELPRGRVA-------------------QPEVS
A0A2P8QUE1      YSSEDLEKQFE-LPLLGMTP--------ELPRGRVA-------------------QPEVS
K9SA61          HTSDDLQKQVP-LPLLGMIP--------ELPRSVSV-------------------AEPTI
A0A2G7GMH8      HSSDELKKQVA-LPLLGLIP--------ELPP-----------------------AKPNG
A0A6N8FU92      HSSDELKKRVE-LPLLGLIP--------ELPP-----------------------AKPSG
A0A2T1DWE8      HNADDL-KQVA-VPLLGMVP--------ALQYEGGL-------------------AALVP
A0A1U7I8L3      HTSDDLKKQVD-LPLLGIIP--------QLNPQTRT-------------------EPIIH
A0A2T1DJL8      RTSEDFKQQVP-LPLLGMVP--------EVPLGEIN-------------------PRSIA
A0A1Z4J9W0      RTSEDLTKEAS-IPLIGMVP--------ELPMSELM-------------------PTTPN
A0A0N7Z5K9      RTSEDLTKQAS-IPLIGMVP--------ELPMSELM-------------------PTT-N
A0A0S3TXC5      RTSEDLTKQAS-IPLIGMVP--------ELPLSELM-------------------PTT-N
B8HNB0          HSVEEVKRASG-LPLLGTVP----------------------------------------
A0A563VS48      KNTREAEQMLP-YPLRGVIP------------DCKGITQGKQQPVLAESSSA--------
A0A318BJ18      ADPIEVTRRLG-LPLLGSVP----------------------------------------
A0A3B8Y8H9      HNAEELKQETR-LPLLATIP----------------------------------------
A0A2W1JVB9      KTLEDIKALFSDYTMLGVIPAIEGVQTKIKEKGASVAA----------------------
A0A3M1SVZ4      KSVGEAKAQLQ-FALLGVIP--------QVRKSNRLLGHR--------------------
A0A6H1U102      QRVDEAKELTG-LPSLGVVP----------------------------------------
A0A7C3ZEJ3      KGVEEAKELTG-LPTLALVP----------------------------------------
A0A563VLD6      KLIDEVKQITQ-LPLLGAVP----------------------------------------
A0A2P8W9H0      YTIDELKAAVR-LPVLGNIP----------------------------------------
A0A6I5P386      NTVEELKDITE-LPVLGAIP----------------------------------------
A0A654SFI6      KDPQDVTRELG-LSLLGTIP----------------------------------------
A0A318BG22      KMPDDVEQKLH-LPLLGITP----------------------------------------
K9SSQ0          QQVSQLQTLSD-LPLLGAVP----------------------------------------
A0A2W1JIN9      YSADEIEELVE-LPVLSTLP----------------------------------------
A0A318AJV1      RTIGEVEARLG-LPVLASVP----------------------------------------
A0A6P0IC70      YDVSDAEVLLK-LPRLGVLP----------------------------------------
A0A6B3MUB5      YDVSDAEVLLK-LPRLGVLP----------------------------------------
A0A6M0B7N4      YDVSDAEVLLK-LPRLGVLP----------------------------------------
A0A6P0J9W3      YDVSDAEVLLK-LPRLGVLP----------------------------------------
A0A6P0ZWE1      YDVSDAEVLLK-LPRLGVLP----------------------------------------
A0A1U7N2U4      HDGSEAEALLK-LPRLGVLP----------------------------------------
A0A1D9G1F2      HDASEAEALLK-LPRLGVLP----------------------------------------
A0A6P0PNZ7      HDASEAEALLK-LPRLGVLP----------------------------------------
F4XV38          HDASEAEALLK-LPRLGVLP----------------------------------------
A0A6P0W137      HDASEAEALLK-LPRLGVLP----------------------------------------
A0A6L9Y9E2      HDASEAEALLN-LPRLGVLP----------------------------------------
A0A6P0SGR0      HDASEAEALLK-LPRLGVLP----------------------------------------
A0A6M0BK48      NDASEAEALLK-LPRLGVLP----------------------------------------
A0A6L9YZL1      HDASEAEALLK-LPRLGVLP----------------------------------------
A0A6P0KYM4      HDASEAEALLK-LPRLGVLP----------------------------------------
A0A6P0LSD6      HDASEAEALLK-LPRLGVLP----------------------------------------
A0A6P0X384      HEDLAVEELLN-LPKLGSLP----------------------------------------
A0A2P8QIL5      RNATEASSLVE-VPIMGVLP----------------------------------------
A0A2T1FLY5      RNATEASSLVE-VPIMGVLP----------------------------------------
A0A433W447      RNATEASSLVE-VPIMGVLP----------------------------------------
K9U1K8          RNATEASSLVE-VPIMGVLP----------------------------------------
K9UYB2          HDQDETEELLQ-LPLLGVLP----------------------------------------
A0A218QN17      KDASEAEELVS-LPLLGVLP----------------------------------------
K9RKN2          RDARDAEQLLN-LPLLGVLP----------------------------------------
A0A2I8ADV2      YEVAEAEELLK-LPLLGILP----------------------------------------
A0A1W5CKM3      RDATEAEELLQ-LPLLGVLP----------------------------------------
A0A5Q0GMF5      RDATEAEELLQ-LPLLGVLP----------------------------------------
Q3MEW0          RDATEAEELLQ-LPLLGVLP----------------------------------------
A0A1Z4KIC7      RDATEAEELLQ-LPLLGVLP----------------------------------------
Q8YSM5          RDATEAEELLQ-LPLLGVLP----------------------------------------
A0A1Q4S1H4      HDVAEAE-LLN-IPLLGILP----------------------------------------
A0A433VBU6      HDVAEAE-LLE-LPLLGVLP----------------------------------------
A0A1Q4RZJ6      HDASEAEELLK-LPLLGVLP----------------------------------------
A0A1Z4SNV3      RDASEAEELLK-LPLLGVLP----------------------------------------
A0A2H2XJQ1      RDASEAEELLK-LPLLGVLP----------------------------------------
A0A3S5K358      HDASEAEELLK-LPLLGVLP----------------------------------------
A0A0T7BPJ4      RSGWEAQDLLK-LQLLGVLP----------------------------------------
A0A0C1QS61      RDASEAEELLK-LSLLGVLP----------------------------------------
A0A139X3R8      HDASEAEDLLK-LSLLGVLP----------------------------------------
A0A1Z4I7C5      RDASEAEELLQ-LPLLGVVP----------------------------------------
A0A0C2MDK7      RDATEAEELLQ-LPLLGILP----------------------------------------
A0A1Y0RCK1      RDATEAEELLQ-LPLLGVLP----------------------------------------
A0A1Z4PWZ0      RDASEAEELLQ-LPLLGVLP----------------------------------------
A0A0C2QLT0      RDASEAEELLQ-LPLLGVLP----------------------------------------
A0A1Z4J2K1      RDASEAEELLQ-LPLLGVLP----------------------------------------
A0A3S0ZSX0      KDASEAEELLD-LPLLGVLP----------------------------------------
A0A2N6K4T3      KDASEAEELLR-LPLLGVLP----------------------------------------
A0A370CKT2      KDASEAEELLK-LPLLGVLP----------------------------------------
A0A0S3TL97      KDASEAEELLK-LPLLGVLP----------------------------------------
A0A2N6M8A0      KDASEAEELLK-LPLLGVLP----------------------------------------
A0A2N6M9E1      KDASEAEELLK-LPLLGVLP----------------------------------------
A0A2N6KJI4      KDASEAEELLK-LPLLGVLP----------------------------------------
A0A2N6MZ77      KDASEAEELLK-LPLLGVLP----------------------------------------
A0A2N6KT20      KDASEAEELLK-LPLLGVLP----------------------------------------
G6FSN3          KDASEAEELLK-LPLLGVLP----------------------------------------
A0A4D9CI02      KDASEAEDLLK-LPLLAVLP----------------------------------------
A0A328I8B9      KDASEAEDLLK-LPLLGVLP----------------------------------------
A0A4Q9J4Z7      KDASEAEDLLK-LPLLGVLP----------------------------------------
A0A0M0SU69      KDASEAEELLK-LPLLGVLP----------------------------------------
A0A1Z4TIZ8      KDASEAEELLK-LPLLGVLP----------------------------------------
A0A2T1E9V8      KTVKEARELFD-YRLLGTIP--------IFNKIAE-------------------------
A0A1Z4LN32      KTAKEAEKLFG-YTLLGLIP--------KFDTNNAKSNHNIPVGKDKIA-----------
A0A2I8A9F5      KTAKEAEELFG-YTLLGLIP--------KFSNNFNTT--QLEDSA--LA-----------
A0A218Q6R8      KTAKEAEELFG-YTLLGLIP--------VFETKNISN--TLDTEEPIVE-----------
A0A218QGE0      KTTKEAEALFG-YTLLGLIP--------KYE-KNTST--FLDRS---LE-----------
A0A3M2GQQ6      KHVDEAKELTG-LPSLGMIP----------------------------------------
A0A6H1U2X0      KHVDEAKELTG-LPSLGMIP----------------------------------------
K1XF69          RTVAETRDLFG-YTLLGIIP-------SFAAPPFYRYLTGGDRS----------------
B5W297          RTVAETRDLFG-YTLLGIIP-------SFAAPPFYRYLTGGDRS----------------
A0A6H2AL05      RTVAETRDLFG-YTLLGIIP-------SFAAPPFYRYLTGGDRS----------------
H1W7M8          RTVAETRDLFG-YTLLGIIP-------SFAAPPFYRYLTGGDRS----------------
A0A5Q4H6A5      RTVAETRDLLG-YTLLGIIP-------SFAAPPFYRYFTGGDRS----------------
D5A466          RTVAETRDLLG-YTLLGIIP-------SFADPPFYRYFTGGDRS----------------
U5QJM6          KTVERAKELMQ-LPLLGAIPYNDELNTTAKSEKQSKEIAKISKKA---------------
A0A1Z4RPC6      KTIPEVKRKFG-YQVLGIVP-------FDSFQDS--------------------------
A0A2T1CMZ0      KTISEIKQKFA-FQVLGIVP-------LDTLQNN--------------------------
L8M4F7          KTIGEIRKKLP-HTILGIIP-------IDDDARS--------------------------
A0A140K2P2      KTVAEIKNKFG-YKVLGLVP-------KHAAEEN--------------------------
K9XWX4          KTVAEIKNKFG-YNVLGLVP-------KHEAEDN--------------------------
A0A140KB14      KTMSEIKQRFP-YKVLGLIP-------QYSDDEP--------------------------
K9XX88          KTIPEIKQRFP-YKVLGLIP-------QYTDDEP--------------------------
A0A563VSV6      KTIADIKKKLP-YKVLGIVP-------INELSDR--------------------------
L8LZE9          KNISEVKKKLP-YKVLGIIP-------ENKFAKR--------------------------
A0A433NM31      KTLREAKEVLG-YTVLGVIP-------NFDKIDKLNSRNENPEQT---------------
A0A1Z4NDS1      KTVQEARELFR-YTLLGVIP-------QIPRNSKRKSEQPERN-----------------
U9VXM0          TTVQEGQELYE-YPLLGIIP-------AWKRNNAKGTD----------------------
A0A6M0RI13      KTVQEGQELYE-YPLLGIIP-------AWKRGNAKGSD----------------------
A0A6M0S1N5      KTVQEGQELYE-YPLLGIIP-------AWKRGNAKGSD----------------------
K9F4D9          KTVQEGQELYE-YPLLGIIP-------AWKRGNAKGSD----------------------
A0A6I5QPI5      KTVKEVKELYG-YTVLGVIP-------LVKGAGRSEAEAADDHP----------------
A0A1Z3HMQ0      KTVKDGEALLG-YTLLGLIP-------KFGLLGNDGPDLELPAGE---------------
A0A433W533      KTLKEARELFG-YTFLGAIP-------SLTKKA----AADGKNAE---------------
A0A2P8QWJ3      KTLKEARELFG-YTFLGAIP-------SLTKKA----AADGKSAE---------------
A0A2T1FKP8      KTLKEARELFG-YTFLGAIP-------SLTKKA----AADGKNAE---------------
K9U6L7          KTLKEARELFG-YTFLGAIP-------SLTKKA----AADGKNAE---------------
A0A1E5QP61      KTAKELRMLFR-YTLLGMIP-------ATKKRFGFLGFSSRRE-----------------
U5DPF5          KTVQEAKNRLG-YVMLGSIP-------LFGR-------FNRPVDG---------------
A0A6P0X488      KTAKEVRQLFN-YTWLGMIP-------DYGKKG----FFGRRKLG---------------
A0A6P0UVD5      KTAKEVRRLFN-YTWLGMIP-------DYGKKG----FFGRKKLG---------------
A0A6P0VDM0      KTAKEVRRLFN-YTWLGMIP-------DYGKKG----FFGRKKLG---------------
A0A6M0G142      KTAKEVRQLFR-YTWLGMIP-------DYRRKG----LFGRRKSG---------------
A0A6P0MR53      KTAKEVRRLFN-YTWLGMIP-------DSRKKG----LFGRRKSE---------------
A0A3M2GIL5      KTAKEVREVFR-YTVLGMIP-------KYRKKG--FFFQNKIDQI---------------
A0A6H1TSJ9      KTAKEVREVFR-YTVLGMIP-------KYRKKG--FFFQNKIDQI---------------
A0A3M1PML8      KTVKEAKEALG-YTLLGVVP-------AFSRNAKSNVPLGALDYP---------------
A0A6M8BE85      KTVKEAREALG-YTLLGVIP-------VFPRSGKSSSALGALDHP---------------
A0A0T7BPZ0      KNVKQAKEIFG-YTLLGVIP-------QMNRSSKSSSGTTEIDRQ---------------
A0A352X442      KNVKEAKELFG-YTLLGVVP-------AFGKLGNRGFSFKKSEAK---------------
A0A6B3NF44      KTVKEAKELFS-TTLLAVIP-------AYGKPGKANYLLGESEHR---------------
A0A6M0EPL4      KTVKEAKELFS-TTLLAVIP-------AYGKPGKANYLLGESEHR---------------
A0A6P0K6L6      KTVKEAKELFS-TTLLAVIP-------AYGKPGKANYLLGESEHR---------------
A0A6P0MRR9      KTVKEAKELFG-YTLLGIIP-------IYGKSRRVRRRLGDVEGS---------------
A0A6P0UX57      KTVREAKELFG-YTLLGIIP-------VYGKSRRTRKRLGELEGG---------------
A0A6P0X1X4      KNVREAKELFR-YTLLGIIP-------VYGKSRRTRKRLGEVEGS---------------
A0A0M0SHU3      KTVKEAREVFQ-YTLLGVIP-------SVSRTGKSGYSVEGLDRP---------------
A0A1D2PBN3      KTVKEARELFK-YTLLGVIP-------SINSNSKKSSFLPGVDQP---------------
A0A0C2LVR7      KTVKEARELFK-YTMLGVIP-------SINSNSKKSSFLPGVDQP---------------
A0A1Z4PQB9      KTVKEARELFK-YTLLGVIP-------SISSNSTKSSFLRGVDQP---------------
A0A1Z4SFN6      KTVKEARELFQ-YTLLGVIP-------LVGGNGKKSYYLPGADQQ---------------
K9PGI8          KTVKEARELLQ-YTLLGVIP-------LVGRNTKNSSLLPGGEQP---------------
K9TLQ0          HSVEDIKDYMG-FPILGTIP---------FEKD---------------------------
K9QF04          HSPEEIQDNTG-LTLLGTIP---------FQKELKAATNQLTHY----------------
K9W1T3          KDPEDAKRILG-YPLLGTIP--------IIEHMDSSTTIRFGNQQ---------------
K9SGJ5          REVEEVRELTH-VPLLGSIP----------------------------------------
A0A6N2JS94      REVGEVREIID-IPLLASIP----------------------------------------
A0A6C2DSN4      REVEEVREIID-VPLLASIP----------------------------------------
L8MYT6          REVEEVREIID-VPLLASIP----------------------------------------
A0A352JGJ6      REVEEVKEIID-IPLLASVP----------------------------------------
A0A1J5GLS2      REVEEVKEIID-VPLLASIP----------------------------------------
A0A2W4W6M5      REVEEVREIID-IPLLASIP----------------------------------------
A0A2W7AN33      RDVGEVREIID-VPLLASIP----------------------------------------
A0A256BLV2      REVEEVRELID-IPLLASIP----------------------------------------
A0A2W6ZXF3      REVEEVKEIID-IPLLASIP----------------------------------------
A0A2Z5WX66      REVEEVKEIID-IPLLASIP----------------------------------------
Q7NEU3          KSISQAKELLN-LPLLGAIP---------FTEEEDLQASSQPQFSK--------------
A0A3C0N2P0      HSPDELKDSTG-LPILGTIP---------FTKKLKEDIGSLSDGSM--------------
A0A6P0JR04      HSPDDLKDSLG-LPLLGIIP---------YRKDFKERKDSLPSFSR--------------
A0A6B3M6M6      HTPDEIKETTA-LPVLGTIP---------FRKELKKGFISPVGDLI--------------
A0A6P0KD09      HTPDEIKEATG-LPVLGTIP---------FHKELKKGLISPVGNLV--------------
A0A6B3NIJ0      HTPDEIKEATG-LPVLGTIP---------FHKELKKGLSSPVGDLV--------------
A0A6M0F053      HTPDEIKEATG-LPVLGTIP---------FHKELKKGLSSPVGDLV--------------
A0A6P2ATU9      HSAEDLKEMVR-IPLLGVIP---------FRKEFRQRRGKTAQSEK--------------
A0A352XE00      HSLDELKDSTG-LPILGTIP---------FDKVVKNSKKQIKTNSKVYQNSQ--------
A0A6P0QC14      HSPDELKDSTG-LPVLGTIP---------FTKQLKTRAKEPGAAAI--------------
B4VS56          HSAEEVKEKTG-LAVLGTIP---------FHKPLKKPSKSAKTAGK--------------
A0A352AAQ3      HSPDELKDSTG-LAVLGTIP---------FGKELKKGIARPVPAAT--------------
A0A350Y472      HSTDELKDTTG-LPLLGTIP---------FSKELKKNITRSATPSK--------------
A0A355DVB4      HSTDELKDSTG-LPLLGTIP---------FSKELKKTITRPATPPK--------------
A0A1Z4RMB9      QSLAEIKKKFA-YNVIGMTP---------LEPP---------------------------
A0A318B4H2      RDPADVQRELG-LPLLGTIP--------KVEDK---------------------------
B4WQE3          CTVRELKDLTN-VPLLATIP---------YNHLLEGSKASILPRYEATRQPI--------
A0A2K3BR24      KTVQEVKDRLG-YTVLGSIP--------LVKTK-----------------MD--------
K9YXY1          KTVQEVKDRLS-YTVLGSIP--------LVKTK-----------------MD--------
A0A1Q4RTR1      KTIEEAQELLG-YALLGTIP--------RLSVS--------------RHYRN--------
A0A1Z4SQV2      RTLSEAQELLG-YSLLGTIP--------RLSIT--------------RPHRN--------
A0A2H2XGN1      RTLSEAQELLG-YSLLGTIP--------RLSIT--------------RPHRN--------
A0A433UXH8      KTIEEAQELLG-YALLGTIP--------RLSVS--------------RHYRN--------
A0A0V7ZFJ4      KTVDKIKQLLD-YPLLGTIP--------KTPKT----------TKGST---D--------
A0A0V7ZNJ9      KTVDQAKRLLN-YPVLGTIP--------QFEGK----------G-------F--------
A0A367RIS1      KTTEEAQELLD-YPLLGTIP--------VFEQK----------DKLAR---G--------
A0A235IXQ2      KTAEEAQHFLD-YPLLGKIP--------VFDQK----------ARLAR---G--------
A0A1W5CNX3      RTQEEAQQLLD-YPLLGTIP--------AFDQK----------ARLAR---G--------
A0A5Q0GJJ5      RTQEEAQQLLD-YPLLGTIP--------AFDQK----------ARLAR---G--------
Q3MEB7          RTQEEAQQLLD-YPLLGTIP--------AFDQK----------ARLAR---G--------
A0A1Z4KHN9      RTLEEAQQLLD-YPLLGTIP--------VFDQK----------VRLAR---G--------
Q8YT70          RTLEEAQQLLD-YPLLGTIP--------VFDQK----------VRLAR---G--------
A0A166IWU6      QTAAEAEQLLD-YPLLGKIP------------------------KMIR---D--------
A0A2S0Q8C0      QTAAEAEQLLD-YPLLGKIP------------------------KMIR---D--------
W6FSX4          QTAAEAEQLLD-YPLLGKIP------------------------KMIR---D--------
A0A218Q4C1      QTAEEAEKLFD-YPLLGKVP------------------------KLLR---D--------
A0A6P1ZT04      QTAEEAEKLLG-YPLLGKVP------------------------KLLR---D--------
A0A5P8VSD1      KTAEEAQQLLD-YPLLGTIP--------LFDQK----------TRLAR---G--------
A0A1S1ZVW2      KNIEELNRILD-LPMLGTIP--------QYENT----------KRRKNQEQE--------
A0A0R0M9H9      KNIEELNRILD-LPMLGTIP--------QYENT----------KRRKNQEQE--------
A0A7H0F4U6      KNIEELNRILD-LPMLGTIP--------QYENT----------KRQKNAGGE--------
A0A1B7WX82      KNVEEANRLLG-FPLLGMIP--------LYGGK----------NPKNQ---E--------
A0A1B7WTD1      KNIEEANRLLG-FPLLGTIP--------LYGEK----------KTKNP---V--------
A0A480ABC0      KNIEEANRFLG-FPLLGTIP--------QYGEK----------KRKNTV--V--------
A0A1Z4LRU5      KTLDEAKKLLG-YPLLGTIP--------RVDE--------------K----D--------
A0A1Z4JVB4      KTVEQAQDLLD-YPLLGIIP--------KVETA----------KGNH----D--------
K9PIA4          KNVEEVKRLLG-YPVLGTIP--------LAEKV----------KGSD----G--------
A0A1Z4HVE1      KTIEEVKRLLG-YPLLGTIP--------LAEKV----------KDSD----G--------
A0A252ECZ1      KTIEEVKHLLD-YPLLGIIP--------LAEKA----------KGSD----G--------
A0A1Z4G5Y1      KTIEEVKRLLD-YPLLGTIP--------LAEKP----------KGVD----G--------
A0A252DNA2      KTIEEVKRLLD-YPLLGTIP--------LAEKP----------KGSD----G--------
A0A252E1Q4      KTIEEVKRLLD-YPLLGTIP--------LAEKP----------KGSD----G--------
A0A6G9SK36      KTVEEAKRILE-YPLLGAIP--------LSEKA----------KNIE----G--------
A0A1Z4M597      KTVEEAKRLLD-YPLLGAIP--------QAEKA----------KGSE----G--------
A0A1Z4MWT1      KTVEEAKRLLD-YPLLGAIP--------LAEKA----------KGSE----A--------
A0A1Z4TX53      KTVEEAKRLLD-YPLLGAIP--------LAEKA----------KGSE----A--------
A0A2A2TNQ5      KNVDEAKRLLG-YPLLGTVP--------NLAEK------------------G--------
A0A3S1C4K5      KSVEEAKRLLG-YPLLGTIP--------QLGGS------------------K--------
A0A1X4G3D5      KNIEEINRLLD-LPLLGSIP--------NFETK----------KRKNKGE-W--------
D4TNI2          KNIEEINRLLD-LPLLGSIP--------NFETK----------KRKNKGE-W--------
A0A1Z4H6Z8      KTIEEVKRLLG-YPLLGTIP--------LAEKP----------KGSN----S--------
A0A1Z4NPM1      RDIDEAKRLLG-LPVLGTIP--------QLMDK----------KGK-----K--------
A0A3F3KPR9      KNIEELNRILD-LPMLGTIP--------QYENT----------KRQKNAGGE--------
D4TGN7          KNIEELNRILD-LPMLGTIP--------QYENT----------KRQKNAGGE--------
A0A1Z4UZW9      KNIEEANRLLG-FPLLGTIP--------LYIGK----------NPKNP---Q--------
A0A0K2M5H0      KNIEEANRLLG-FPLLGTIP--------QYGEK----------NPKNR---Q--------
A0A1B7VSH4      KNIEEANRLLG-FPLLGTIP--------QHGEK----------NPKNP---Q--------
A0A1B7W126      KNIEEANRLLG-FPLLGTIP--------QHGEK----------NPKNR---Q--------
A0A3D4C6Q6      KNIEEANRLLG-FPLLGTIP--------QHGEK----------NPKNR---Q--------
A0A1B7UVJ4      KNVEEANRLLG-FPLLGMIP--------LYGGK----------NPKNQ---E--------
A0A1B7UTR1      KNVEEANRLLG-FPLLGMIP--------LYGGK----------NPKNQ---E--------
K7W0A4          KNVEEANRLLG-FPLLGAIP--------QYGEK----------NPKHR---Q--------
A0A5C0DRW9      KNVEEANRLLG-FPLLGTIP--------QYGEK----------NPKHR---Q--------
A0A6H2C088      KNVEEANRLLG-FPLLGTIP--------QYGKK----------NPKNR---Q--------
A0A1U7HGH0      KTAKEAREIFE-YKLLGTIP--------LFHNE---------------SQTE--------
K9XJD3          KTAKEAREIFE-YKLLGTIP--------LFHND---------------SQTE--------
K9SX01          RSGEDIKRLFG-YPLLGILP--------NFATRKLENLPAFVLRNPESVLSKLYLKIRKS
A0A4P7ZT55      HSPRDVEQGID-QPLLGSIP--------FLPLE------RFQSVNGLWEQLD--------
A0A1E5QIR9      KTVREAREYLG-YTLLGIIP--------NFEKI--------DKGLSYGKDGE--------
A0A6P1A9A0      HSPDDLKEITG-LALLGTIP---------YQKQVKGQTSGDWAKPSTRRGDR--------
A0A1Z4IBC7      KTVKEAKEVLR-YTVLGVIP--------TLGRN--------SKDESPIPGLD--------
A0A1W5CPC7      KTVKEAKEVLR-YTVLGVIP--------TLGRN--------TKDDIPIPGLD--------
A0A5Q0GKD1      KTVKEAKEVLR-YTVLGVIP--------TLGRN--------TKDDIPIPGLD--------
Q3MDC6          KTVKEAKEVLR-YTVLGVIP--------TLGRN--------TKDDIPIPGLD--------
A0A1Z4KM73      KTVKEAKEVLR-YTVLGVIP--------TLGRN--------GKDDTPIPGLD--------
Q8YNX7          KTVKEAKEVLR-YTVLGVIP--------TLGRN--------GKDDTPIPGLD--------
A0A367R4K6      KTVKEAKEVLR-YTVLGVIP--------TLGRN--------GKEHSSIAGLD--------
A0A1E2WSV8      KTVKEAKEVLR-YSVLGVIP--------TQGRN--------GKESSSIAGLD--------
A0A7D7L9Y1      KTVKEAKEVLR-YSVLGVIP--------TQGRN--------AKDPSSIAGLD--------
A0A2R5FRT9      KSVKEAKEVMK-YSVLGVIP--------TQSKN--------GKDNPSIAGLD--------
A0A2K8T1B6      KTVKEAKEVLR-YSVLGVIP--------TQSRN--------GRDHSSIAGLD--------
A0A235I9I0      KTVKEAKEVLR-YSVLGVIP--------TQGRN--------GKDHSSIPGLD--------
A0A2D0HQT8      KTVKEAKEVLR-YSVLGVIP--------TQGRN--------GKDHSSIPGLD--------
A0A2L2NU95      KTVKEAKDVLR-YSVLGVIP--------TQARN--------GKDHSSIAGLD--------
A0A367S084      KTVKEAKEVLR-YSVLGVIP--------AQGRN--------GKDHSSIPGLD--------
A0A1Z4SMD6      KTVKEAEVLFD-LTLLGLIP--------KFEPS-----PSTVPSIK--------------
A0A2H2Y096      KTVKEAEVLFD-LTLLGLIP--------KFEPS-----PSTVPSIK--------------
K9S8M8          KTAKEIRNLYQ-YTLLGMIP--------RSKKKRWWFGSGSNTSV---------------
A0A1Z4NFV0      KSVKEAESVFG-YTLLGLIP--------RFDSS--------VSSNRSEELFA--------
A0A3M9ZEU1      KTVQEAKALFG-YTLLGLIP--------DYTKL--------GASG--RKSAE--------
A0A1Z4JK72      KTVKEAEAQYG-YTMLGLVP--------KFETS--------DTPTIVSPSAD--------
A0A0N7Z489      KTVKDAEAQYG-YTLLGLVP--------RFETS--------DTPTILSPGAD--------
A0A0S3TXS2      KTVKDAEAQYG-YTLLGLVP--------RFETS--------DTPTILSPGAD--------
A0A2A2TPF8      KTIKEAETIFG-YTLLGLIP--------KFETN--------NNAIAQTFIE---------
A0A1Z4R0P8      KTTKEAQNIFG-YTLLGLIP--------KFSTN--------NAAIEQISIE---------
A0A0T7BUI3      KTVKEAENFFG-WTLLGLIP--------RFEAN--------HKSVAANITDD--------
A0A1Z4LP32      KTIKEIEEFFG-YTLIGLIP--------KFEPN--------SKSLDSNFIDD--------
K9REP9          KTVKEIEGFFN-YTLVGLIP--------KFEPD--------SKSTDSNPIVD--------
A0A1Z4SIJ3      KTIKETEAFFE-YPLLGLIP--------KFESN------NQDSSKETRLLGRINGLLAKY
A0A2H2XPG4      KTIKETEAFFE-YPLLGLIP--------KFESN------NQDSSKETRLLGRINGLLAKY
K9V3C7          KTIKEAQTLFG-YTPLGLIP--------KFDAN--------STSLIEEMSGD--------
A0A1Z4T6Y7      KTVKEAQDVFG-YTMLGLIP--------KFE-N--------APTIEQTI--E--------
A0A2H2Y561      KTVKEAQDVFG-YTMLGLIP--------KFE-N--------APTIEQTI--E--------
A0A1Q4S362      KTVKEAQDVFG-YTLLGLIP--------KFDTN--------SASIQQTM--E--------
A0A3S1CIN8      KTVKEAQDVFG-YTLLGLIP--------KFDTN--------SASIEQTM--E--------
A0A2A2TC28      KTVKESEKFFG-YTMLGFIP--------KFEPN------NTHSSLHQ-IMGD--------
A0A0C1NCB0      KTAKEAEEFFK-YTVLGLIP--------TFESSTKSSSESSTKSSSDRLMGE--------
A0A2N6K7Q9      KTVKETETFFG-YTLLGLIP--------KYKPN------NSVSGVQ--EIEA--------
A0A2N6MXH6      KTVKETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIEA--------
A0A2N6M5A8      KTVKETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIEA--------
A0A2N6LL61      KTVKETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIEA--------
A0A0S3TP66      KTVKETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIEA--------
G6FP91          KTVKETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIET--------
A0A1U7GYR5      KTVKETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIEA--------
A0A2N6KY52      KTVKETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIET--------
A0A2N6KMP5      KTVKETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--QIET--------
A0A2N6MA45      KTVKETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--QIEA--------
A0A4Q9J9V9      KTVKETETFFG-YTLLGLIP--------KYKPN------NFVSAVQ--DIED--------
A0A328IGA1      KTVKETETFFG-YTLLGLIP--------KYKPN------NFVSAVQ--DIED--------
A0A4D9CE41      KTVKETETFFG-YILLGLIP--------KYKPN------NFVSAVQ--DIED--------
A0A0M0SFT2      KTIKETETFFG-YTLLGLIP--------KYKPN------NFVNAVQ--DIED--------
A0A1Z4TLC8      KTVKETETFFG-YTLLGLIP--------KYKPN------NFVNAVQDVDVED--------
A0A0C2LFH0      KTVKEAETFFG-YTLLGLIP--------KFESK------KTSAPVN--LMSD--------
A0A1Z4IYV4      KTVKEAETFFG-YTLLGLIP--------KFESN------TTSTPDK--LMSE--------
A0A1Z4Q0T6      KTVKEAETFFG-YTMLGLIP--------KFESN------STSAPTK--LMSE--------
A0A0C2PT44      KTVKEAETFFG-YTMLGLIP--------KFESN------STSAATK--LMSE--------
A0A1D2P6J4      KTVKEAETFFG-YTLLGLIP--------KFESN------STSAPAE--LMSE--------
B4WP72          KTLNDCREQFG-YALLGAIP--------LFNET----SNLHRSKSHSKQLAS--------
A0A2T1CIL7      KNSKEAEEIFG-YPLQGVIPDSGYSAETTVSRG----MQELSFATSRDNNSS--------
A0A433V7A0      KNIEEARKIFD-YTLLGVIP--------YYGSF----EKHSSRH---KEI-E--------
A0A2T1FTR8      KTSEEAKSLLPGYPILGQIP--------VFEKS----RQLPKLS---KGA-A--------
K9UA41          KTSEEAKNLLPGYPILGQIP--------VFEKS----RQLPKLS---KGA-A--------
A0A0C2LBE2      KTVKQAKELFK-YTLLGVIP--------LTGRN----QKKSLRV---PEV-D--------
A0A433NN38      KTLKEAKELFQ-YTLLGVIP--------NLSRY----GKT--LT---GRL-D--------
A0A2N6K0T2      KTVREARELFQ-YTLLGVIP--------SVSKT----SKNNYSV---QGL-D--------
A0A2N6ML72      KTVKEARELFQ-YTLLGVIP--------NVSRN----NKNSYSV---QGL-D--------
G6FQZ6          KTVKEARELFQ-YTLLGVIP--------NVSRN----NKNSYSV---QGL-D--------
A0A2N6MQX9      KTVKEARELFQ-YTLLGVIP--------NVSRN----NKNSYSV---QGL-D--------
A0A2N6KXT6      KTVKEARELFQ-YTLLGVIP--------NVSRN----NKNSYSV---QGL-D--------
A0A2N6KGB9      KTVKEARELFQ-YTLLGVIP--------NVSRN----NKNSYSV---QGL-D--------
A0A2N6L3Y5      KTVKEARELFQ-YTLLGVIP--------NVSRN----NKNSYSV---QGL-D--------
A0A0S3TIS7      KTVKEARELFQ-YTLLGVIP--------NVSRN----TKNSYSV---QGL-D--------
A0A1U7GW28      KTVKEARELFQ-YTLLGVIP--------NVSRN----TKNSYSV---QGL-D--------
A0A2N6LW63      KTVKEARELFQ-YTLLGVIP--------NVSRN----TKNSYSV---QGL-D--------
A0A328IH74      KTVKEARELFQ-YTLLGVIP--------SVSRS----GKNSYSV---EGL-D--------
A0A4D9CIB0      KTVKEARELFQ-YTLLGVIP--------SVSRS----GKSSYSV---EGL-D--------
A0A1Z4TQ63      KTVREARELFQ-YTLLGVIP--------SVSRS----GKSSYSV---EGL-D--------
A0A4Q9J8G2      KTVKEARELFQ-YTLLGVIP--------SVSRS----GKNSYSV---EGL-D--------
A0A350Y0P6      KTAKEIRQLFK-YTWLGMIP--------ESRKK------GFFWR---QKL-N--------
A0A352X940      KTAKEVRQLFR-YTWLGMIP--------NLRKK------GLLSR---RKS-D--------
B8HTN4          KSLEEIQQYFD-YVTLAMIP--------FDKAA----ATANKAFKPTQGL-E--------
A0A6P1AFJ5      HSPEELHKTTN-LPILGTIP--------FQKKI--------------EESPG--------
B0CAX4          KTVQEATGLFD-YTVLGNIP--------LLKDA------EKMTR---KGL-D--------
A0A1Z4RN12      KNTQEVENLFA-YPLHGVVP--------NLNLT------GERKQLQLPGNST--------
A0A2T1CMF9      KNTQEVENMFA-YPLHGVVP--------DLSLG------GNNQQFQLPGSEK--------
Q7NDC5          RSVEEARGLLG-TSLLGSVP--------RWNAQ------------------S--------
U5QGK3          QTVEEATSLLG-TPLLGTIP--------RWTGA------------------E--------
A0A2W4UY24      KTVTEGQKLYD-YPLLGVIP--------DWRKR------TARNR-------E--------
A0A0D8ZUV2      KTLKEAQELFG-YTFLGTIP--------MLGKK------ANSRG---KDA-E--------
A0A433VDI0      KTLEEALELFG-YTLLGVIP--------ALNKK------AIPRG---RDK-E--------
A0A3D1PG43      KTLREVRDAFG-YTVIACIP--------HV-GK----KVGFRNQ---K-Q-E--------
A0A2P8QQ72      KTLREVKQLFG-YTLIGSIP--------QL-GK----FIKLKPG---RQE-D--------
K9TZQ7          KTLREIKQLFG-YTLIGSIP--------QL-GK----FIKLKPE---RQQ-D--------
A0A6N8G584      KTLREARERLD-YTLLGTIP--------HF-GK------RYATR---RNP-E--------
A0A2G7GPR0      KTLREARERLD-YTLLGTIP--------YF-GK------RYANR---RNQ-E--------
K9XH68          KTLREARERLD-YTLLGTIP--------YF-GK------RYANR---RNQ-E--------
A0A1U7HW70      KTLREARERLD-YTLLGTIP--------YF-GK------RYANR---RNQ-E--------
A0A2S6VEJ8      KTLREARERLD-YTLLGTIP--------YFGGK------RFANR---RNQ-E--------
A0A140KBA0      KNSQEIEEIFG-YPLQGVIP--------DLAKE------GSPNL-LVGDV-V--------
K9XSG1          KNSKEIEEIFG-YPLQGVIP--------DLEKE------GSPHL-LVGDV-V--------
A0A2T1GMT4      KTVKEIDKVFG-YTLLGMIP--------ATQRK------KNRAR---ATTPE--------
K9UI51          KTVKEIDKIFG-YTLLGMIP--------ATQKK------KIRSR---ATTPE--------
A0A1Z4QL41      KTVNEVREIFG-YTLLGMMP--------LLAKK------VPFRH---QKA-Q--------
A0A2T1FXY4      KTLEEIRQRFS-YTLLGVIP--------LVGNK------VRSND---WDV-E--------
K9TYI2          KTLEEIRQRFR-YTLLGVIP--------LVANK------VRSND---GYV-E--------
A0A252D4T4      KTLKQIREIFG-YTLLGIVP--------SSTKK------LRSRN---RET-D--------
A0A252DJH5      KTLKQIREIFG-YTLLGIVP--------SSTKK------LRSRN---RET-D--------
A0A252EB80      KTLKQIREIFG-YTLLGIVP--------SSTKK------LRSRN---RET-D--------
A0A6G9SKZ9      KTLKEIREIFG-YTLLGIVP--------SSTKK------IRSRY---RET-E--------
A0A1Z4HPW5      KTLKEIREIFG-YTLLGIVP--------SSTKK------IRSRY---RET-E--------
A0A1Z4MSN1      KTLKEIREIFG-YTLLGIVP--------SSTKK------IRSRY---RET-E--------
A0A1Z4U1C2      KTLKEIREIFG-YTLLGIVP--------SSTKK------IRSRY---RET-E--------
A0A0D6KV51      KTLKEIREIFG-YTLLGIVP--------SSTKK------IRSRY---RET-E--------
A0A1Z4MKF8      KTLKEIREIFG-YTLLGIVP--------SSTKK------IRSRY---RET-E--------
A0A2C6WC43      KTLREVRDIFR-YTLLGIVP--------LSVKK------VRSRF---SSA-E--------
A0A1Z4L5A1      KTLKEVRDVFG-YTLLGIVP--------LSVKK------VRSRF---SSA-E--------
A0A367QD86      KTLKEVRDVFR-YTLLGIIP--------LSVKK------VRSRF---SSA-E--------
A0A2K8SM78      KTLKEVRDVFR-YTLLGIIP--------LSVKK------VRSRY---SNL-E--------
A0A2R5FPC0      KTLKEVRDVFR-YTLLGIIP--------LSVKK------VR-RD---SNV-E--------
A0A5P8W5T6      KTLKEVRDIFR-YTLLGIVP--------LSVKK------VRSRH---SNL-E--------
A0A7D7LDT7      KTLKEVRDIFG-YTLLGIVP--------LSVKK------LRSRY---SDA-E--------
A0A235IZ96      KTLREVRDVFG-YTLLGIVP--------LSVKK------VRSRY---SNL-E--------
A0A2L2NGP0      KTLREVRDVFG-YTLLGIVP--------LSVKK------VRSRY---SNL-E--------
K9QM62          KTLQEIRQVFE-YTLLGIIP--------TSPVS------HKTMSFYLQDT-E--------
A0A1Z4FWI3      KTLNEIREIFGRYTLLGIVP--------SSTKK------LRSRN---REA-E--------
A0A1Z4JYE7      KTLDKVKEAFNGYTLLGIIP--------LLPQK------TISRK---REG-E--------
A0A0F5YE28      RTVEEAKKTFG-YTLLGIIP--------MFKNK------RFSDY---FQG-E--------
U7QEH7          RSVEETKKIFG-YTLLGIIP--------MFKNK------RLSSY---FQG-E--------
A0A3S1ATK5      KTLQEVRDIFG-YTLLGILP--------SLSKK------SLFWH---QNA-D--------
A0A2Z6CPH0      KTLKEIREVFE-YPLLGVIP--------LSAHK------THSRK---LDTKK--------
A0A1Z4GT50      KTLKEVKEIFG-YTLLGMLP--------LSTKK------GRSRN---RDA-E--------
A0A1Z4GIX0      KTLKEIREVFG-YTLLGGIP--------LSTNK------MRSRE---SDG-E--------
A0A2H6LC24      KTLKEIREVFG-YTLLGGIP--------LSTNK------MRSRE---SDG-E--------
B2J6N5          KTLQEIRDIFR-YTLLGIVP--------LSVKK------IHSRY---SNT-E--------
A0A367RMI4      KTLKEIRDVFR-YTLLGIVP--------LSVKK------LRSRY---SNA-E--------
A0A235HUM0      KTLKEIRDVFG-YTLLGIVP--------LSVKK------LRSRD---SNA-E--------
A0A2L2NW47      KTLKEIRDVFG-YTLLGIVP--------LSVKK------LRSRY---SNA-E--------
A0A1E2WUR1      KTLKEVRDIFG-YTLLGIVP--------LSVKK------LRSRY---SDT-E--------
A0A235IKU3      KTLREVRDVFG-YTLLGIVP--------LSVKK------VRSRY---SNL-E--------
A0A1U7MYU6      KTLKEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L--------
A0A1D8TNX9      KTLKEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L--------
A0A6P0L6C2      KTLKEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L--------
A0A6P0MVH0      KTLKEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L--------
A0A6P0KJV0      KTLKEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L--------
A0A6L9ZJG4      KTLKEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L--------
F4XKF3          KTLKEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L--------
A0A1D9FX10      KTLKEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L--------
A0A6P0Q0T0      KTLKEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L--------
A0A6P0W5I0      KTLKEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L--------
A0A3C0NJ41      KTLKEVREQFG-YTLLATIP--------LLGKK------PRRRT---KHQ-E--------
A0A352AG88      KTLREVRELFG-YTLLGVIP--------SLTKK------GISRS---RDL-E--------
A0A350Y374      KTLKEVKDLFG-YTLLATIP--------TFGKK------TVSRF---TAQ-E--------
A0A355DPX0      KTLKEIKDLFG-YTLLATIP--------TFGKK------TVPRL---KAQ-E--------
                                   .                                        

K9SLA9          --------------------------AKGSVLIT----------RDMPQS----------
A0A168TT23      --------------------------------------------ELHPKS----------
A0A0M1JWX9      --------------------------ISDRAKQL----------ASSSWIADSNGRERLQ
A0A2T1M1V6      --------------------------RLRSLSLE----------KGLDEK----------
A0A2G7GCS2      --------------------------RLKRTDME----------RNLSGE----------
K9XBH8          --------------------------RLKRPDME----------RALSAE----------
A0A1Z4LJ30      --------------------------YIKNIHGK----------LEQKLG----------
K9RI76          --------------------------YVRHINAK----------ADRKLG----------
A0A352AE27      --------------------------RLKQSVVG----------LGLTTE----------
A0A3B8JH60      --------------------------RFKQSDRA----------LKLGTD----------
A0A3C0N766      --------------------------RFKQSDRA----------LKLGTD----------
K9W9J7          --------------------------RLRHSNLS----------WQVGTE----------
A0A139WSU3      --------------------------RIKHSDPK----------IEMTSV----------
A0A433VN22      --------------------------RIKHSGVI----------SELAIE----------
Q7NF11          --------------------------RTKGL-------------LPSGDP----------
A0A1Z4JCS8      --------------------------KLKRLAIE----------PNSSFE----------
A0A6P0PI80      --------------------------HLRHAGMG----------LELGTE----------
A0A6P0WGT6      --------------------------HLRHAGMG----------LELGTE----------
F4XTX2          --------------------------HLRHAGMG----------LELGTE----------
Q7NJN6          --------------------------KLKDA--------------ALSAA----------
U5QCC3          --------------------------KFKDN--------------EL-IA----------
A0A0S3TYD7      --------------------------VVDTELVV----------RDAPRS----------
A0A2T1DNG3      ------------------------------ELSLGAMSGKPSLRLSGQTQALLPPITQLT
A0A3S0Y9N9      --------------------------SPIPEVVV----------KNKPDS----------
A0A433UNK7      --------------------------NFIPEVIV----------KNQPDS----------
A0A6P0ZKB8      --------------------------TFTPEVIV----------KKQPDS----------
U5QL42          LVAPSRDGV-------------------VIGDRL----------VTRQYT----------
A0A140K3H3      VNGETNTKA-----------------------------------HYYNYS----------
K9XUB8          INGETHSRA-----------------------------------HYYNYS----------
A0A6H2NHD5      PRLVSTMEEV------------------LVQHQG----------DNSPYT----------
A0A2P8W4F7      PNLAVTMADV------------------LTQSQS----------PEKLYT----------
A0A5Q4E0Z4      PSLIATTADL------------------LAQSQS----------PGNLYS----------
A0A2P8VVX1      GLHPEL----------------------ADSDLM----------KTVMWP----------
A0A2P8WHY0      -LHPEL----------------------ADSDLM----------QIVQWP----------
A0A2T1CMT9      LPFRSISS--------------------DTSSIQ----------NVIQWQ----------
A0A7G8J1V5      FLLQELDQSVQATNSNPIDADINNNAPFESNDNR----------REKRYQ----------
A0A354B169      FQLQELDQLV---AN-------------PASEAF----------EKYRSQ----------
Q0IDT5          FLLNELDQSSNNNAT-------------NAPESR----------KQDRYQ----------
A0A7G8FZD9      FLLKELDSETQ--AD-------------VGETER----------KAARYQ----------
G4FMX5          FPLKELDSETQ--AD-------------VGETER----------KAARYQ----------
A0A7G8FAU7      FLLQELDQSV---SG-------------GDADDR----------REQRYQ----------
A3ZA21          FLLQELDQSV---SG-------------GDADDR----------REQRYQ----------
A0A076HBF2      FLLQELDRSVT--GE-------------DDPEAA----------KQRRYQ----------
A0A7G8FP50      FLLQDLDKSVTSDSD-------------DDPATA----------KKRRYQ----------
A0A7G8E8K7      FLLQELDKSVT--TG-------------DDPEAA----------KQRRYQ----------
A0A7G8GAH0      FLLQELDKSIT--TG-------------EDPDAA----------KQRRYQ----------
A0A7G8GNR2      FLLQELDKSVT--TG-------------EDADTA----------KQRRYQ----------
A0A7G8ICD3      FLLQELDQSVT--RG-------------EDADTA----------KQRRYQ----------
A0A2D6FCW3      FLLQELDINNP--SE-------------EDQNTK----------QKAKYQ----------
A0A7G7KJ95      FMLNELDSQTL--PV-------------SDPQQK----------QEAGYQ----------
A0A7G8EAN3      FMLKELDTQTL--PV-------------SDPQQK----------QEARYQ----------
A0A563VQJ3      ------------------------------GVLV----------KEEPDS----------
A0A1D8TX52      LSLSQSERA---------------------LPMM----------ELLGWR----------
A0A1D9G4T2      LSLSQSEKT---------------------LPMM----------ELLGWR----------
A0A6P0PR27      LGLSQSERT---------------------LPMM----------ELLGWR----------
A0A6P0WER7      LGLSQSERT---------------------LPMM----------ELLGWR----------
F4XP71          LGLSQSERT---------------------LPMM----------ELLGWR----------
A0A6L9YR57      LSLSQSERA---------------------LPMM----------ELLGWR----------
A0A6P0KZ31      LNLSQSERA---------------------LPMM----------ELLGWR----------
A0A6P0LPB8      LNLSQSERA---------------------LPMM----------ELLGWR----------
A0A6P0SEV1      LSLSQSEKA---------------------LPMM----------ELLGWR----------
A0A6B3N2I8      LSLSQSEKA---------------------LPMM----------ELLGWR----------
A0A6M0B891      LSLSQSEKA---------------------LPMM----------ELLGWR----------
A0A6P0IJQ1      LSLSQSEKA---------------------LPMM----------ELLGWR----------
A0A6P0J8J8      LSLSQSEKA---------------------LPMM----------ELLGWR----------
A0A6P0ZSH6      LSLSQSEKA---------------------LPMM----------ELLGWR----------
A0A1U7N5X9      LSLSQSEKA---------------------LPMM----------ELLGWR----------
A0A6L9Z1V0      LSLSQSEKA---------------------LPMM----------ELLGWR----------
A0A6P0LC12      LSLSQSEKT---------------------LPMM----------ELLGWR----------
A0A6P0MVJ3      FNLSQSERA---------------------LPMM----------ELLGWR----------
A0A2W6ZAV2      ------SIT-------------------EVVEGM----------EPEARF----------
K9W742          LPFGKPKVL-------------------A-PWTV----------EVLHWS----------
A0A3D1PBA3      LPFGKPHLL-------------------A-PWTV----------QVSNWP----------
K9XPB0          LPFLSPK---------------------E-SSVQ----------EIINWQ----------
A0A350Y7Z1      LPFRRTQVA-------------------A-ASTL----------PMVYWL----------
A0A352X2A7      LPFRKSSVT-------------------E-ISTS----------HLAYSS----------
A0A0D8ZYV0      LPFGKPNVL-------------------A-PWTV----------QVSNWP----------
A0A2T1FP73      LPFGKPLHL-------------------S-PWTV----------QVRNWP----------
A0A433VMS2      LPFGKPLHL-------------------S-PWTV----------QVRNWP----------
K9TYA7          LPFGKPLHL-------------------S-PWTV----------QVRNWP----------
A0A2P8QUE1      LPFGKPLHL-------------------S-PWTV----------QVRNWP----------
K9SA61          KLPLRRSET-------------------FTTASL----------EVIHWP----------
A0A2G7GMH8      LI---KLNK-------------------QQTQVL----------PMLCLQ----------
A0A6N8FU92      SIINLSLGK-------------------AQPQGL----------SMLCWQ----------
A0A2T1DWE8      F---REVGV-------------------PAPPIM----------QVIHWQ----------
A0A1U7I8L3      LPFRQQPIL-------------------T-SSTI----------ELISWQ----------
A0A2T1DJL8      MPFQKAENL-------------------A-PSMM----------QVIHWA----------
A0A1Z4J9W0      FAFSRNAFE-------------------ENSSML----------QVLHWA----------
A0A0N7Z5K9      FAFGRST---------------------GDTSML----------QVLHWA----------
A0A0S3TXC5      FAFGRSTNA-------------------GDTSML----------QVLHWA----------
B8HNB0          --------------------------RSRSSEPH----------KDTDS-----------
A0A563VS48      --------------------------ITDDGLIL--------------------------
A0A318BJ18      ----------------------KTAEGTTPREQL----------LDRKSN----------
A0A3B8Y8H9      --------------------------QLPRKLLQNKTDFPG---SNPNFS----------
A0A2W1JVB9      --------------------------DVKRDLYV----------RDTPNS----------
A0A3M1SVZ4      --------------------------RSIPQIIV----------RDNPRS----------
A0A6H1U102      --------------------------KVKVPLVEGSRMDGDRYRAHGS------------
A0A7C3ZEJ3      --------------------------RVSAPVIESYRGQNGEAIRYGS------------
A0A563VLD6      ------------------------KVLEPRIVLSNEAEINISKGYNYSYS----------
A0A2P8W9H0      --------------------ISSLLNSGGSVLFAVREINSIGLTSDFSLPPLSYELRTDQ
A0A6I5P386      --------------------HSRLLENGQNLALAMTQLGDLGFNMDLPLSSGPSNL----
A0A654SFI6      --------------------------KSDAADVL----------KDLINS-----A----
A0A318BG22      --------------------------TVEGAEIPAL--------LANKRS----------
K9SSQ0          --------------------------YLATNAKL----------LSPSLE----------
A0A2W1JIN9      --------------------------RLSKNTLN----------LGEPAS----------
A0A318AJV1      --------------------------A------------------EGGRR----------
A0A6P0IC70      --------------------------EIPLSALS----------LKHPEQ----------
A0A6B3MUB5      --------------------------EIPLSALS----------LKHPEQ----------
A0A6M0B7N4      --------------------------EIPLSALS----------LKHPEQ----------
A0A6P0J9W3      --------------------------EIPLSALS----------LKHPEQ----------
A0A6P0ZWE1      --------------------------EIPLSALS----------LKHPEQ----------
A0A1U7N2U4      --------------------------TIPAQALS----------VEQPKG----------
A0A1D9G1F2      --------------------------KIPAQALS----------LEQPNR----------
A0A6P0PNZ7      --------------------------KIPAQALS----------LEQPNR----------
F4XV38          --------------------------KIPAQALS----------LEQPNR----------
A0A6P0W137      --------------------------KIPAQALS----------LEQPNR----------
A0A6L9Y9E2      --------------------------KIPAQALS----------LKQPNR----------
A0A6P0SGR0      --------------------------KIPAQALS----------LEQPNR----------
A0A6M0BK48      --------------------------KIPAQALS----------LKQPNR----------
A0A6L9YZL1      --------------------------KMPAQALS----------LEQPKR----------
A0A6P0KYM4      --------------------------KIPAQALS----------LEQPKR----------
A0A6P0LSD6      --------------------------QIPAQALS----------LEQPKR----------
A0A6P0X384      --------------------------DLPASALV----------LEPPEQ----------
A0A2P8QIL5      --------------------------VISPEVRG----------KEYADA----------
A0A2T1FLY5      --------------------------VISPEVRG----------KEYADA----------
A0A433W447      --------------------------VISPEVRG----------KEYADA----------
K9U1K8          --------------------------VISPEVRG----------KEYADA----------
K9UYB2          --------------------------RLPAKATI----------LQPANF----------
A0A218QN17      --------------------------RLPAKTLV----------LEPAER----------
K9RKN2          --------------------------RLPGKTLV----------LEPSDR----------
A0A2I8ADV2      --------------------------RLPATKLT----------LEPAEK----------
A0A1W5CKM3      --------------------------RLPATKLS----------LEPAEQ----------
A0A5Q0GMF5      --------------------------RLPATKLS----------LEPAEQ----------
Q3MEW0          --------------------------RLPATKLS----------LEPAEQ----------
A0A1Z4KIC7      --------------------------RLPATKLS----------LEPAEQ----------
Q8YSM5          --------------------------RLPATKLS----------LEPAEQ----------
A0A1Q4S1H4      --------------------------RLSKSNLA----------LAEADL----------
A0A433VBU6      --------------------------RLSKSNLA----------LAEADL----------
A0A1Q4RZJ6      --------------------------RLPAKTLA----------LEPADG----------
A0A1Z4SNV3      --------------------------RLPDRTLV----------LNPANR----------
A0A2H2XJQ1      --------------------------RLPDRTLV----------LNPANR----------
A0A3S5K358      --------------------------RLPAKTLA----------LEPADG----------
A0A0T7BPJ4      --------------------------RLPGSTLK----------LQSADT----------
A0A0C1QS61      --------------------------RLPSKTLV----------LEPSQR----------
A0A139X3R8      --------------------------RLPSKTLV----------LEPSHR----------
A0A1Z4I7C5      --------------------------RLPATKLS----------LEPAEQ----------
A0A0C2MDK7      --------------------------RLPAKTLV----------LEPANQ----------
A0A1Y0RCK1      --------------------------RLPAKTLV----------LKPANQ----------
A0A1Z4PWZ0      --------------------------RLSAKTLV----------LEPANR----------
A0A0C2QLT0      --------------------------RLPGKTLV----------LKPANR----------
A0A1Z4J2K1      --------------------------RLPAKTLV----------LEPANR----------
A0A3S0ZSX0      --------------------------RLPAKTLM----------LEPSER----------
A0A2N6K4T3      --------------------------CLPSRAIA----------LEPSVR----------
A0A370CKT2      --------------------------RLPGHAIA----------LEPSAQ----------
A0A0S3TL97      --------------------------RLPGHAIA----------LEPSAQ----------
A0A2N6M8A0      --------------------------RLPGHAIA----------LEPSAQ----------
A0A2N6M9E1      --------------------------RLPGHAIA----------LEPSAQ----------
A0A2N6KJI4      --------------------------RLPGHAIA----------LEPSAQ----------
A0A2N6MZ77      --------------------------RLPGHAIA----------LEPSAQ----------
A0A2N6KT20      --------------------------RLPGHAIA----------LEPSAQ----------
G6FSN3          --------------------------RLPGHAIA----------LEPSAQ----------
A0A4D9CI02      --------------------------SLPADAIA----------LEPSGQ----------
A0A328I8B9      --------------------------SLPAHAIA----------LEPSGQ----------
A0A4Q9J4Z7      --------------------------SLPAHAIA----------LEPSGQ----------
A0A0M0SU69      --------------------------RLPADAIA----------LEPSGR----------
A0A1Z4TIZ8      --------------------------RLPTHAIA----------LESSGR----------
A0A2T1E9V8      --------------------------IGSGAVPV----------IEDPRA----------
A0A1Z4LN32      --------------------------GVSERVIV----------ATSPRT----------
A0A2I8A9F5      --------------------------EPARRVIV----------ETTPRS----------
A0A218Q6R8      --------------------------QFSPRIVV----------ETSPRS----------
A0A218QGE0      --------------------------KVSERIIV----------ATSPRT----------
A0A3M2GQQ6      ------------------------------KVSCPLVSQRKGEGRSLPSYYTE-------
A0A6H1U2X0      ------------------------------KVSCPLVSQRKGEGRSLPSYYTE-------
K1XF69          ----------------------------SVQVPV----------VDTPGS----------
B5W297          ----------------------------SVQVPV----------VDTPGS----------
A0A6H2AL05      ----------------------------SVQVPV----------VDTPGS----------
H1W7M8          ----------------------------SVQVPV----------VDTPGS----------
A0A5Q4H6A5      ----------------------------SVQVPV----------VDTPGS----------
D5A466          ----------------------------SVQVPV----------VDTPGS----------
U5QJM6          --------------------------KSNGRVQN----------PPYTRS----------
A0A1Z4RPC6      ----------------------------HGSIIV----------QREPDS----------
A0A2T1CMZ0      ----------------------------RGGLVV----------QREPDS----------
L8M4F7          ----------------------------KRRVVV----------EQSPDS----------
A0A140K2P2      ----------------------------Q-GIIV----------QKQPDS----------
K9XWX4          ----------------------------Q-GIIV----------HKQPDS----------
A0A140KB14      ----------------------------N-GIVV----------QREPDS----------
K9XX88          ----------------------------N-GIVV----------QREPDS----------
A0A563VSV6      ----------------------------Q-GVLV----------QQEPDS----------
L8LZE9          ----------------------------EDGIMV----------QQDPDS----------
A0A433NM31      ----------------------------LPKIPV----------KCTPRS----------
A0A1Z4NDS1      ----------------------------LPQIVG----------RDTPQF----------
U9VXM0          ----------------------------VPSILV----------RNTEYS----------
A0A6M0RI13      ----------------------------IPSILV----------KNSEYS----------
A0A6M0S1N5      ----------------------------IPSILV----------KNSEYS----------
K9F4D9          ----------------------------VPSILV----------KNSEYS----------
A0A6I5QPI5      ----------------------------YPRLLV----------NQPAHV----------
A0A1Z3HMQ0      --------------------------GISPRVIA----------FSQTQP----------
A0A433W533      --------------------------ATTIALPV----------RDTPRA----------
A0A2P8QWJ3      --------------------------ATTIALPV----------RDTPRA----------
A0A2T1FKP8      --------------------------ATTIALPV----------RDTPRA----------
K9U6L7          --------------------------ATTIALPV----------RDTPRA----------
A0A1E5QP61      ----------------------------IPLLPT----------RDQPTT----------
U5DPF5          --------------------------TRPVTLPV----------RDYPRS----------
A0A6P0X488      --------------------------DLVPLLPV----------RDAPHA----------
A0A6P0UVD5      --------------------------DLVPQLPV----------RDAPHA----------
A0A6P0VDM0      --------------------------DLVPQLPV----------RDAPHA----------
A0A6M0G142      --------------------------DMVPQLPV----------RDAPHA----------
A0A6P0MR53      --------------------------ALIPQLPV----------RDAPHA----------
A0A3M2GIL5      ----------------------------TPDLPV----------RDRPHW----------
A0A6H1TSJ9      ----------------------------TPDLPV----------RDRPHW----------
A0A3M1PML8      ----------------------------APRVVV----------RDMPQS----------
A0A6M8BE85      ----------------------------APRVVV----------QDMPQS----------
A0A0T7BPZ0      ----------------------------IPRVIG----------RDVPSF----------
A0A352X442      ----------------------------DVRLVA----------RDTPGS----------
A0A6B3NF44      ----------------------------APLVFA----------RDLPRS----------
A0A6M0EPL4      ----------------------------APLVFA----------RDLPRS----------
A0A6P0K6L6      ----------------------------APLVFA----------RDLPRS----------
A0A6P0MRR9      ----------------------------ERRIIV----------RDLPHS----------
A0A6P0UX57      ----------------------------EPRILV----------RDLPHS----------
A0A6P0X1X4      ----------------------------EPRILV----------RDLPHS----------
A0A0M0SHU3      ----------------------------VPRVIG----------RDVPHF----------
A0A1D2PBN3      ----------------------------IPRVIG----------TDIPQF----------
A0A0C2LVR7      ----------------------------IPRVIG----------TDIPQF----------
A0A1Z4PQB9      ----------------------------IPRVIG----------TDIPQF----------
A0A1Z4SFN6      ----------------------------IPRVIG----------RDIPHF----------
K9PGI8          --------------------------FAIPRLIG----------RDIPHY----------
K9TLQ0          ---------------------------LKESLTVSDGENLVQASGGYLFS----------
K9QF04          --------------------------------------------GNYTLS----------
K9W1T3          --------------------------RIVPSIVV----------TNTAGS----------
K9SGJ5          --------------------------RTDMLELSPVVEKETALAPSMMHS----------
A0A6N2JS94      --------------------------MTETASLSAISSQ--GILPTSSYY----------
A0A6C2DSN4      --------------------------MTEVASLAPLLSQ--GILPTSSYY----------
L8MYT6          --------------------------MTEVASLAPLLSQ--GILPTSSYY----------
A0A352JGJ6      --------------------------LTEVASLSAMVSQ--GILPTSSYY----------
A0A1J5GLS2      --------------------------ITEVTSLSAMVGQ--SILPSSSYY----------
A0A2W4W6M5      --------------------------MTEVASLSAMISH--GILPTSSYY----------
A0A2W7AN33      --------------------------FTDPVALISM-AK--GQFPNNNYH----------
A0A256BLV2      --------------------------MTEVSSLSAATNQ--GILPSSSYY----------
A0A2W6ZXF3      --------------------------MTEVASLSAMISQ--GILPSSSYY----------
A0A2Z5WX66      --------------------------MTEVASLGAMLSQ--GILPTSSYY----------
Q7NEU3          ---------------------------ERQKPDLPK--------SSLEKS----------
A0A3C0N2P0      --------------------------IDPENLEFQLSAQS----YGYNAS----------
A0A6P0JR04      ---------------------------------------------RYRAS----------
A0A6B3M6M6      --------------------------SESEKVEFN---------HSYISS----------
A0A6P0KD09      --------------------------SESEKVEFN---------NSYISS----------
A0A6B3NIJ0      --------------------------SESEKVEFN---------NSYISS----------
A0A6M0F053      --------------------------SESEKVEFN---------NSYISS----------
A0A6P2ATU9      --------------------------ETTPMLPVPRGDRYGSTGNRYRTT----------
A0A352XE00      --------------------------VNREVLELAFS-GY----SRYRPS----------
A0A6P0QC14      --------------------------PDPSEFQ---GRSY----GGYSAS----------
B4VS56          --------------------------LETPLLASPISQST----YRYHAS----------
A0A352AAQ3      --------------------------PEGQQLESEFNQRS----YRYTAS----------
A0A350Y472      --------------------------SHSEPLELELRRRS----SRYNAS----------
A0A355DVB4      --------------------------SHSEPLELELRRRS----SRYNAS----------
A0A1Z4RMB9      --------------------------SYQGRIIT----------REEPDS----------
A0A318B4H2      --------------------------DVAEELQN----------KKT-------------
B4WQE3          --------------------------YFNEGVQH----------LDRTTG----------
A0A2K3BR24      --------------------------NTSSFLPL----------RDLPQS----------
K9YXY1          --------------------------DTSSFLPL----------RDLPQS----------
A0A1Q4RTR1      --------------------------RHISTLPI----------RDNPWS----------
A0A1Z4SQV2      --------------------------RDISTLPI----------RDNPWS----------
A0A2H2XGN1      --------------------------RDISTLPI----------RDNPWS----------
A0A433UXH8      --------------------------RDISTLPI----------RDNPWS----------
A0A0V7ZFJ4      --------------------------NQEIELPV----------LDNPYS----------
A0A0V7ZNJ9      --------------------------DGNPELPT----------LNNPYS----------
A0A367RIS1      --------------------------ESITELPV----------LNNPYS----------
A0A235IXQ2      --------------------------ENITELPV----------LNNPYS----------
A0A1W5CNX3      --------------------------ESITELPV----------LNNPYS----------
A0A5Q0GJJ5      --------------------------ESITELPV----------LNNPYS----------
Q3MEB7          --------------------------ESITELPV----------LNNPYS----------
A0A1Z4KHN9      --------------------------ESITELPV----------LNNPYS----------
Q8YT70          --------------------------ESITELPV----------LNNPYS----------
A0A166IWU6      --------------------------DNTSELPL----------LNNPYS----------
A0A2S0Q8C0      --------------------------DNTSELPL----------LNNPYS----------
W6FSX4          --------------------------DNTSELPL----------LNNPYS----------
A0A218Q4C1      --------------------------EHTTELPL----------LDNPYS----------
A0A6P1ZT04      --------------------------EGTSELPL----------LDNPYS----------
A0A5P8VSD1      --------------------------ESITELPV----------LNNPYS----------
A0A1S1ZVW2      --------------------------ENQRELPV----------LDNPYS----------
A0A0R0M9H9      --------------------------ENQRELPV----------LDNPYS----------
A0A7H0F4U6      --------------------------ESQRELPI----------LDNPYS----------
A0A1B7WX82      --------------------------ESRRELPL----------LDNIYS----------
A0A1B7WTD1      --------------------------EGLLEVPL----------LDQPYS----------
A0A480ABC0      --------------------------EGLLEVPL----------LDQPYS----------
A0A1Z4LRU5      --------------------------KDRQELPV----------LNNPYS----------
A0A1Z4JVB4      --------------------------ERTAALPV----------LHNPYS----------
K9PIA4          --------------------------EGGAELPV----------LNNPYS----------
A0A1Z4HVE1      --------------------------EEGAELPV----------LNNPYS----------
A0A252ECZ1      --------------------------EGSTELPV----------LNNPYS----------
A0A1Z4G5Y1      --------------------------EGSAELPV----------LHNPYS----------
A0A252DNA2      --------------------------EGSAELPT----------LHNPYS----------
A0A252E1Q4      --------------------------EGSAELPT----------LHNPYS----------
A0A6G9SK36      --------------------------EGEQELPV----------LNNPYS----------
A0A1Z4M597      --------------------------VGEVELPV----------LNNPYS----------
A0A1Z4MWT1      --------------------------ASEQELPV----------LNNPYS----------
A0A1Z4TX53      --------------------------ASEQELPV----------LNNPYS----------
A0A2A2TNQ5      --------------------------KMATEIPA----------RDNPYS----------
A0A3S1C4K5      --------------------------GNGDDLPV----------LKDPYS----------
A0A1X4G3D5      --------------------------EGEGDLPL----------FDQPYS----------
D4TNI2          --------------------------EGEGDLPL----------FDQPYS----------
A0A1Z4H6Z8      --------------------------EAGSELPV----------LNNPYS----------
A0A1Z4NPM1      --------------------------AGDEELPV----------LNNPYS----------
A0A3F3KPR9      --------------------------ESQRELPI----------LDNPYS----------
D4TGN7          --------------------------ESQRELPI----------LDNPYS----------
A0A1Z4UZW9      --------------------------EGRQELPV----------LNNPYS----------
A0A0K2M5H0      --------------------------EGRQELPL----------LDDPYS----------
A0A1B7VSH4      --------------------------EGRQELPL----------LDDPYS----------
A0A1B7W126      --------------------------EGRQELPL----------LDDPYS----------
A0A3D4C6Q6      --------------------------EGRQELPL----------LDDPYS----------
A0A1B7UVJ4      --------------------------ESRGELPL----------LDNIYS----------
A0A1B7UTR1      --------------------------ESRGELPL----------LDNIYS----------
K7W0A4          --------------------------EGRQELPL----------LDNPYS----------
A0A5C0DRW9      --------------------------EGRQELPL----------LDNPYS----------
A0A6H2C088      --------------------------EGRQELPL----------LDNPYS----------
A0A1U7HGH0      --------------------------REQWRVPV----------LAEPRS----------
K9XJD3          --------------------------REEWQVPV----------LAEPRS----------
K9SX01          KAYRSFASSLESFKISILNAVSEPENTTALTVFV----------RDNPRA----------
A0A4P7ZT55      ---------------------------------------------DQQRF----------
A0A1E5QIR9      --------------------------RVKAKLPV----------KDAPRS----------
A0A6P1A9A0      --------------------------ASVLSVTP----------AHYHSS----------
A0A1Z4IBC7      --------------------------RPVPKIIG----------RDIPYF----------
A0A1W5CPC7      --------------------------RAVPKIIG----------RDIPYF----------
A0A5Q0GKD1      --------------------------RAVPKIIG----------RDIPYF----------
Q3MDC6          --------------------------RAVPKIIG----------RDIPYF----------
A0A1Z4KM73      --------------------------RAVPKIIG----------RDIPYF----------
Q8YNX7          --------------------------RAVPKIIG----------RDIPYF----------
A0A367R4K6      --------------------------RPIPKIIG----------RDIPYF----------
A0A1E2WSV8      --------------------------RAIPKIIG----------RDIPYF----------
A0A7D7L9Y1      --------------------------RAIPKIIG----------RDIPYF----------
A0A2R5FRT9      --------------------------RAIPKIIG----------RDIPYF----------
A0A2K8T1B6      --------------------------RPIPKIIG----------RDIPYF----------
A0A235I9I0      --------------------------RAIPKIIG----------RDIPYF----------
A0A2D0HQT8      --------------------------RPIPKIIG----------RDIPYF----------
A0A2L2NU95      --------------------------RPIPKIIG----------RDIPYF----------
A0A367S084      --------------------------RPIPKIIG----------RDIPYF----------
A0A1Z4SMD6      --------------------------GISPRIVI----------GTYPHT----------
A0A2H2Y096      --------------------------GISPRIVI----------GTYPHT----------
K9S8M8          -----------------------------PKVVV----------QEAPHS----------
A0A1Z4NFV0      --------------------------GVSPRVIV----------ATTPRS----------
A0A3M9ZEU1      --------------------------PATLRIFP----------RDLPRS----------
A0A1Z4JK72      --------------------------DISPRVIA----------MTSPRS----------
A0A0N7Z489      --------------------------DISPRVIA----------MSTPRS----------
A0A0S3TXS2      --------------------------DISPRVIA----------MTSPRS----------
A0A2A2TPF8      --------------------------AASPRIIV----------ATLPRS----------
A0A1Z4R0P8      --------------------------GASPRVIV----------GTLPRS----------
A0A0T7BUI3      --------------------------GISERVIV----------NSSPRT----------
A0A1Z4LP32      --------------------------NISPRIIV----------ASSPRT----------
K9REP9          --------------------------TISPRIIV----------ASSPRT----------
A0A1Z4SIJ3      QQKNQIVSLPSTNFDSKLLPIRLVGLEVSNRIIV----------ASAPHT----------
A0A2H2XPG4      QQKNQIVSLPSTNFDSKLLPIRLVGLEVSNRIIV----------ASAPHT----------
K9V3C7          --------------------------GVSPRIIV----------ATSPRT----------
A0A1Z4T6Y7      --------------------------GASPRIVV----------GTLPRS----------
A0A2H2Y561      --------------------------GASPRIVV----------GTLPRS----------
A0A1Q4S362      --------------------------GASPRVIV----------GTLPRS----------
A0A3S1CIN8      --------------------------GASPRVVV----------GTLPRS----------
A0A2A2TC28      --------------------------NVSPRVIV----------ASSPRT----------
A0A0C1NCB0      --------------------------ATSPRVIV----------ATSPRT----------
A0A2N6K7Q9      --------------------------GVYPQVIA----------TTSPRT----------
A0A2N6MXH6      --------------------------GVYPQVIT----------TTSPRT----------
A0A2N6M5A8      --------------------------GVYPQVIT----------TTSPRT----------
A0A2N6LL61      --------------------------GVYPQVIT----------TTSPRT----------
A0A0S3TP66      --------------------------GVYPQVIT----------TTSPRT----------
G6FP91          --------------------------GVYPQVIT----------TTSPRT----------
A0A1U7GYR5      --------------------------GVYPQVIT----------TTSPRT----------
A0A2N6KY52      --------------------------GVYPQVIT----------TTSPRT----------
A0A2N6KMP5      --------------------------GVYPQVIT----------TTSPRT----------
A0A2N6MA45      --------------------------GVYPQVIT----------TTSPRT----------
A0A4Q9J9V9      --------------------------GVYPQVIT----------TTSPRT----------
A0A328IGA1      --------------------------GVYPQVIT----------TTSPRT----------
A0A4D9CE41      --------------------------GVYPQVIT----------TTSPRT----------
A0A0M0SFT2      --------------------------GVYPQVIT----------TTSPRT----------
A0A1Z4TLC8      --------------------------GVYPQVIT----------TTSPRT----------
A0A0C2LFH0      --------------------------KASARIIV----------ATSPRS----------
A0A1Z4IYV4      --------------------------GVSARVIV----------ATSPRS----------
A0A1Z4Q0T6      --------------------------GVSARVIV----------ATSPRS----------
A0A0C2PT44      --------------------------GVSARVIV----------ATSPRS----------
A0A1D2P6J4      --------------------------GVSGRVIV----------ATSPRS----------
B4WP72          --------------------------SVFSNVRT----------RSRNVH-----A----
A0A2T1CIL7      --------------------------LSIPDLNL----------AAVRYN----------
A0A433V7A0      --------------------------QTALNVHV----------RDNSRS----------
A0A2T1FTR8      --------------------------RAPGQLVL----------TGMTTG----------
K9UA41          --------------------------RAPGQLVL----------TGMTTG----------
A0A0C2LBE2      --------------------------QSIPKVIG----------RDIPHF----------
A0A433NN38      --------------------------RPTPRVIG----------RDIHLF----------
A0A2N6K0T2      --------------------------RPIPRVVG----------RDIPHF----------
A0A2N6ML72      --------------------------RPIPRVVG----------RDIPHF----------
G6FQZ6          --------------------------RPIPRVVG----------RDIPHF----------
A0A2N6MQX9      --------------------------RPIPRVVG----------RDIPHF----------
A0A2N6KXT6      --------------------------RPIPRVVG----------RDIPHF----------
A0A2N6KGB9      --------------------------RPIPRVVG----------RDIPHF----------
A0A2N6L3Y5      --------------------------RPIPRVVG----------RDIPHF----------
A0A0S3TIS7      --------------------------RPIPRVVG----------RDIPHF----------
A0A1U7GW28      --------------------------RPIPRVVG----------RDIPHF----------
A0A2N6LW63      --------------------------RPIPRVVG----------RDIPHF----------
A0A328IH74      --------------------------RPVPRVIG----------RDVPHF----------
A0A4D9CIB0      --------------------------RPVPRVVG----------RDVPYF----------
A0A1Z4TQ63      --------------------------RPVPRVVG----------RDIPHF----------
A0A4Q9J8G2      --------------------------RPVPRVVG----------RDVPHF----------
A0A350Y0P6      --------------------------GNVPQLVV----------RDVPHG----------
A0A352X940      --------------------------GDIPQLPV----------RDAPHA----------
B8HTN4          --------------------------RATPQLYL----------RDQPNS----------
A0A6P1AFJ5      --------------------------TSEKNSSR----------GRYQVS----------
B0CAX4          --------------------------RPTPDLVV----------RDSPRS----------
A0A1Z4RN12      --------------------------ANLPEQVT----------TDASML----------
A0A2T1CMF9      --------------------------ANLPEQIV----------SEVSMM----------
Q7NDC5          --------------------------VRGPLMAL----------RD-PLS----------
U5QGK3          --------------------------GPG-LVAQ----------SD-PLS----------
A0A2W4UY24      --------------------------LDAPRIIV----------KQRHRV----------
A0A0D8ZUV2      --------------------------ATIPELPV----------RDMPRS----------
A0A433VDI0      --------------------------WAVPELPV----------RDIPNS----------
A0A3D1PG43      --------------------------WAVPEISV----------LENSLS----------
A0A2P8QQ72      --------------------------CPIPELAV----------RNSPRS----------
K9TZQ7          --------------------------CPVPELAV----------RNSPRS----------
A0A6N8G584      --------------------------WSIPELPV----------INLPRS----------
A0A2G7GPR0      --------------------------WSIPELPV----------INLPRS----------
K9XH68          --------------------------WSIPELPV----------INLPRS----------
A0A1U7HW70      --------------------------WSIPELPV----------INLPRS----------
A0A2S6VEJ8      --------------------------WSIPELPV----------INLPRS----------
A0A140KBA0      --------------------------DTLPQLPA----------GQNDSSHHRHAL----
K9XSG1          --------------------------DTLPQLPA----------SQNAHSNNRHVF----
A0A2T1GMT4      --------------------------QTTLEIAV----------RDTPQS----------
K9UI51          --------------------------QTTLEIAV----------RDTPQS----------
A0A1Z4QL41      --------------------------TNTQNIVV----------RDQPYS----------
A0A2T1FXY4      --------------------------STNPEIAV----------RDKPHS----------
K9TYI2          --------------------------STIPEISV----------RDKPHS----------
A0A252D4T4      --------------------------LINPEIAV----------IDTPHS----------
A0A252DJH5      --------------------------LINPEIAV----------IDTPHS----------
A0A252EB80      --------------------------LINPEIAV----------IDTPHS----------
A0A6G9SKZ9      --------------------------IATQEIAV----------IDSPNS----------
A0A1Z4HPW5      --------------------------IATQEIAV----------IDSPSS----------
A0A1Z4MSN1      --------------------------IATQEIAV----------IDSPTS----------
A0A1Z4U1C2      --------------------------IATQEIAV----------IDSPTS----------
A0A0D6KV51      --------------------------IATQEIAV----------IDSPSS----------
A0A1Z4MKF8      --------------------------IATQEIAV----------IDSPSS----------
A0A2C6WC43      --------------------------SITQKVAV----------RDMPYS----------
A0A1Z4L5A1      --------------------------SITQKVAV----------RDMPHS----------
A0A367QD86      --------------------------SITQKVAV----------RDMPHS----------
A0A2K8SM78      --------------------------SITQKIAV----------RDTPYS----------
A0A2R5FPC0      --------------------------P---KIAV----------RDTPYS----------
A0A5P8W5T6      --------------------------SITQKIAV----------RDTPYS----------
A0A7D7LDT7      --------------------------STVQTIAV----------RDTPHS----------
A0A235IZ96      --------------------------LPTQTVAV----------RDTPYS----------
A0A2L2NGP0      --------------------------LPTQTVAV----------RDTPYS----------
K9QM62          --------------------------SITPSIAV----------RDRPYS----------
A0A1Z4FWI3      --------------------------LAPPEIAV----------IDTPQS----------
A0A1Z4JYE7      --------------------------YQIPRIAV----------RDTPDS----------
A0A0F5YE28      --------------------------RASQQIPV----------VEASDS----------
U7QEH7          --------------------------KATPDIPV----------IEASDS----------
A0A3S1ATK5      --------------------------YITPEIAS----------KDAPQS----------
A0A2Z6CPH0      --------------------------LTTPEIAV----------RDMPHS----------
A0A1Z4GT50      --------------------------SITPEVPV----------RDTPNS----------
A0A1Z4GIX0      --------------------------LASPEIAV----------RDMPHS----------
A0A2H6LC24      --------------------------LASPEIAV----------RDMPHS----------
B2J6N5          --------------------------SINQTIAV----------RDTPYT----------
A0A367RMI4      --------------------------SISQTIAV----------RDTPHS----------
A0A235HUM0      --------------------------FTSQTVAV----------RDTPHS----------
A0A2L2NW47      --------------------------SISQTIAV----------RDTPHS----------
A0A1E2WUR1      --------------------------STVQTIAV----------RDTPHS----------
A0A235IKU3      --------------------------LPTQTVAV----------RDTPYS----------
A0A1U7MYU6      --------------------------FFGGELPV----------TDQPHS----------
A0A1D8TNX9      --------------------------FFGGELPV----------RDQPHS----------
A0A6P0L6C2      --------------------------FFGGELPV----------RDQPHS----------
A0A6P0MVH0      --------------------------FFGGELPV----------RDQPHS----------
A0A6P0KJV0      --------------------------FFGGELPV----------TEQPHS----------
A0A6L9ZJG4      --------------------------FFGGELPV----------TEQPHS----------
F4XKF3          --------------------------FFGGELPV----------TEQPHS----------
A0A1D9FX10      --------------------------FFGGELPV----------TEQPHS----------
A0A6P0Q0T0      --------------------------FFGGELPV----------TEQPHS----------
A0A6P0W5I0      --------------------------FFGGELPV----------TEQPHS----------
A0A3C0NJ41      --------------------------RTVPELPV----------RDTPRS----------
A0A352AG88      --------------------------GTIPELPV----------RDTPRL----------
A0A350Y374      --------------------------RTIPELPV----------RDNPLA----------
A0A355DPX0      --------------------------RTIPELPV----------RDNPLA----------
                                                                            

K9SLA9          ---TL--AET----------------FRILHTNLK-----FL----EP-GKAPKVIAITS
A0A168TT23      ---AV--SEA----------------FRSLRTSLM-----FS----TP-QGMPKTILMTS
A0A0M1JWX9      DDRDFGFLEA----------------FRALNTNIR-----FL----ST-DQPIRAIAVAS
A0A2T1M1V6      -------SEVE---------------FQRLAAIVS-----SF-------ELENRRLMITS
A0A2G7GCS2      -------VAIE---------------LQRLASAV-------L-------MLEHQRLLVTS
K9XBH8          -------VPID---------------LQRLASAV-------L-------MLEHQRILITS
A0A1Z4LJ30      -------GEIE---------------FQRLASAVS-----LM-------QLGSGRLMIAS
K9RI76          -------GEIE---------------FQRLASAVS-----LM-------QLNSGRLMIAS
A0A352AE27      -------TEVE---------------FQRLASAIS-----LQ-------PLKNRRLLVTS
A0A3B8JH60      -------TEVE---------------FQRLASAIS-----LQ-------PLQDHRLLVTS
A0A3C0N766      -------TEVE---------------FQRLASAIS-----LQ-------PLQDHRLLVTS
K9W9J7          -------TEVE---------------FQRLASAIS-----LQ-------PLKDHRLLITS
A0A139WSU3      -------SEVE---------------FQRLASAIS-----LQ-------PLNNRRLLVTS
A0A433VN22      -------TEVE---------------FQRLASAIS-----LQ-------PLENRRLLVTS
Q7NF11          -------PRLE---------------SRQLASTVS-----LM-------DLPNRRLMITS
A0A1Z4JCS8      -------GEIE---------------FQRVASAIS-----LQ-------PLKGIRLLIAS
A0A6P0PI80      -------TDVE---------------FQRLASVIS-----LR-------SGEDRRILITS
A0A6P0WGT6      -------TDVE---------------FQRLASVIS-----LR-------SGEDRRILITS
F4XTX2          -------TDVE---------------FQRLASVIS-----LR-------SGEDRRILITS
Q7NJN6          -------EAEE---------------FRQLASVVS-----LL-------PLPARRLMITS
U5QCC3          -------TAEE---------------FLQLASIVS-----LM-------PLEGQRLMITS
A0A0S3TYD7      ---AP--AAA----------------YQMLQSNLK-----YV----SS-DREARAIVVSS
A0A2T1DNG3      KWRPF--RES----------------LDLLYQNLQ-----LI----NA-TAELHSIVVTS
A0A3S0Y9N9      ---PV--SEA----------------FRILQTNLR-----FF----NS-KQHIKVIVVSS
A0A433UNK7      ---SV--SEA----------------FRMLQTNLR-----FF----NS-EQSIKVIVVSS
A0A6P0ZKB8      ---SI--SEA----------------FRMLQTNLR-----FF----NS-EQTVKVIVVSS
U5QL42          ---RSPFKEA----------------LRSLALSLR-----YL----G-SNNSVKTLLFTS
A0A140K3H3      ---SF--TEG----------------LRTLAMNLR-----YT----LTEKGKINSLALTS
K9XUB8          ---SF--TEG----------------LRALAMNLR-----YT----ITETGKINSLALTS
A0A6H2NHD5      ---SFSFTEA----------------FYSLDANLR-----LL----S-SDAPIQLVVFTS
A0A2P8W4F7      ---SFSFAEA----------------FYSLEANLR-----ML----S-SDVPVQVVALTS
A0A5Q4E0Z4      ---SFSFAEA----------------FYSLEANLR-----ML----S-SDTPVQVVALTS
A0A2P8VVX1      ---QF--RDS----------------LDLIANNLQ-----LL----Q-NSHPSKAIAITS
A0A2P8WHY0      ---TF--REA----------------LDLVANNVQ-----LM----L-KGKGNQAIAVTS
A0A2T1CMT9      ---PF--REA----------------IDLIYENLK-----LAYLNSSLVGSALKSIAITS
A0A7G8J1V5      ---RFFYQEA----------------FRNLYTSIR-----FL----N-AESPLRAIALTT
A0A354B169      ---LFYCQEA----------------FRSLFTSLR-----FL----N-SEKPLRLIAISS
Q0IDT5          ---RFFYQEA----------------FRNLFTSLR-----FL----N-TERPLKAVALTS
A0A7G8FZD9      ---RFFYQEA----------------FRNLFTSLR-----FL----N-SDKPLRSIALTS
G4FMX5          ---RFFYQEA----------------FRNLFTSLR-----FL----N-SDRPLRSIALTS
A0A7G8FAU7      ---RFFYQEA----------------FRNLFTSIR-----FL----N-SDRPLRAIALTS
A3ZA21          ---RFFYQEA----------------FRNLFTSIR-----FL----N-SDRPLRAIALTS
A0A076HBF2      ---RFLYQEA----------------FRNLFTSIR-----FL----N-SDQPLRSIALTS
A0A7G8FP50      ---RFFYQEA----------------FRNLFTSIR-----FL----N-SDQPLRSIALTS
A0A7G8E8K7      ---RFFYQEA----------------FRNLFTSIR-----FL----N-SDQPLRSIALTS
A0A7G8GAH0      ---RFFYQEA----------------FRNLFTSIR-----FL----N-SDQPLRSIALTS
A0A7G8GNR2      ---RFFYQEA----------------FRNLFTSIR-----FL----N-SDQPLRSIALTS
A0A7G8ICD3      ---RFFYQEA----------------FRNLFTSIR-----FL----N-SDQPLRSIALTS
A0A2D6FCW3      ---RFFYQEA----------------FRNLFTSIR-----FL----N-SDQPLRSIAITS
A0A7G7KJ95      ---RFFYQEA----------------FRNLFTSLR-----FL----N-SDRPLRSISLTS
A0A7G8EAN3      ---RFFYQEA----------------FRNLFTSLR-----FL----N-SDRPLLSIALTS
A0A563VQJ3      ---YV--SEL----------------YRMLQANLK-----FM----N-SQRAPKVILVTS
A0A1D8TX52      ---PF--QEA----------------LDMIYVNIQ-----LL----N-PGSEWKSLMVTS
A0A1D9G4T2      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSEWKSLMVTS
A0A6P0PR27      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSELKSLMVTS
A0A6P0WER7      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSELKSLMVTS
F4XP71          ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSELKSLMVTS
A0A6L9YR57      ---PF--QEA----------------LDMIYVNIQ-----LL----N-PGSEWKSLMVTS
A0A6P0KZ31      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSEWKSLMITS
A0A6P0LPB8      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSEWKSLMITS
A0A6P0SEV1      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSEWKSLMVTS
A0A6B3N2I8      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSEWKSLMVTS
A0A6M0B891      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSEWKSLMVTS
A0A6P0IJQ1      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSEWKSLMVTS
A0A6P0J8J8      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSEWKSLMVTS
A0A6P0ZSH6      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSEWKSLMVTS
A0A1U7N5X9      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSEWKSLMVTS
A0A6L9Z1V0      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSEWKSLMVTS
A0A6P0LC12      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSDWKSLMVTS
A0A6P0MVJ3      ---PF--QEA----------------LDMIYVNIQ-----LL----N-SGSEWKSLMVTS
A0A2W6ZAV2      ---GL--RES----------------LRNLFSSFR-----LL----R-ADKVVRLFSVTS
K9W742          ---PS--WQS----------------LDLIYKNIQ-----LL----S-SVSTLRSLMVTS
A0A3D1PBA3      ---PT--WES----------------LDLIYKNIQ-----LM----N-ELASFKSLMVTS
K9XPB0          ---PF--RES----------------LDLIYENLQ-----RL----G-SGFAFKSLLLTS
A0A350Y7Z1      ---PF--RES----------------LDLIYKHIQ-----LL----N-SSATLRSIVVTS
A0A352X2A7      ---AF--RES----------------LDLIYKNIQ-----LV----N-AGRLLKSLAVTS
A0A0D8ZYV0      ---PS--WES----------------LDLIYKNIQ-----LL----NTAVASLQSIMVTS
A0A2T1FP73      ---PS--WES----------------LDLIYRNLQ-----LM----N-EMAAFKSLVVTS
A0A433VMS2      ---PS--WES----------------LDLIYRNLQ-----LM----N-EMAAFKSLVVTS
K9TYA7          ---PS--WES----------------LDLIYRNLQ-----LM----N-EMAAFKSLVVTS
A0A2P8QUE1      ---PS--WES----------------LDLIYRNLQ-----LM----N-EMAAFKSLVVTS
K9SA61          ---PF--RES----------------MDLIYQNIQ-----LL----N-AASPLKSIVVTS
A0A2G7GMH8      ---SF--RDA----------------LDLIYKNIR-----LL------TAFPVKSLAVTS
A0A6N8FU92      ---SF--RDA----------------LDLIYKNIR-----LL----N-SAFPIKSLVITS
A0A2T1DWE8      ---PF--RES----------------LDLIYKNIQ-----LL----P-SAAGLRSLVVTS
A0A1U7I8L3      ---PF--RES----------------LDLIYQNIQ-----LV----N-STGSLKSLVITS
A0A2T1DJL8      ---PF--RES----------------LDLIYKNIQ-----LL----T-AANPLRSLVVTS
A0A1Z4J9W0      ---PF--RES----------------LDLIYKNLQ-----LM----T-DGDPLKSLVVTS
A0A0N7Z5K9      ---PF--RES----------------LDLIYKNLQ-----LM----T-DGDPMRSLVVTS
A0A0S3TXC5      ---PF--RES----------------LDLIYKNLQ-----LM----T-DGSPMRSLVVTS
B8HNB0          ---PF--VEA----------------VRSLGLNLR-----YL----SP-DTELRTIAFTS
A0A563VS48      ---PV--KEA----------------FQDIQINLQ-----LL----DP-KERIKTIAITS
A0A318BJ18      ----L--VDA----------------YLAINTNLG-----FT----TE-HGVPRSFLVTS
A0A3B8Y8H9      ---LF--LEA----------------FLGLQTNLV-----LL----NP-KQTIKSLTISS
A0A2W1JVB9      ---PP--SEA----------------VRMVQSNLK-----YL----NS-DKPLKVIVMTS
A0A3M1SVZ4      ---LI--SEA----------------YRMLQTKLK-----FA----CA-EQSVKTIVVTS
A0A6H1U102      ---PF--TEA----------------IRSLALNLR-----YL----GA-KDEVKTLALTS
A0A7C3ZEJ3      ---AF--TEA----------------VRSLGLNLR-----YL----GA-KDEVKTLAFTS
A0A563VLD6      ---SF--TEA----------------FRAIAMNLG-----YM----MAQSGKIKSLVLTS
A0A2P8W9H0      VAMPF--LEA----------------FRILATNIR-----LS----NP-EQPLKSITVSS
A0A6I5P386      --TPF--LEA----------------FKRLSTNLR-----LN----NP-DTHLKSLAISS
A0A654SFI6      --SDL--SEA----------------YQATRANLA-----FL----TS-DGAPKLLMLTS
A0A318BG22      ---SL--SEA----------------YYSIQTALQ-----LA----TP-GGLPRTLLVTS
K9SSQ0          ---LI--SERAFLPH-----SYNHSAFTEAVNSLALNIQNLA-----A-QRTFKTIAFTS
A0A2W1JIN9      ---FY--ENSAILEA-----------YRALFKALE-----FR-----G-LEEFHTLVVSS
A0A318AJV1      ---WF--RSRGRVSPADLIGVAGATVYSEAIRNLRASLIGVR-----Q-ASGMRVIGFTS
A0A6P0IC70      ---FL--DDLSLVEP-----------YRLLLKKLE-----FR-----T-QQKLKLIVVSS
A0A6B3MUB5      ---FL--DDLSLVEP-----------YRLLLKKLE-----FR-----T-QQKLKLIVVSS
A0A6M0B7N4      ---FL--DDLSLVEP-----------YRLLLKKLE-----FR-----T-QQKLKLIVVSS
A0A6P0J9W3      ---FL--DDLSLVEP-----------YRLLLKKLE-----FR-----T-QQKLKLIVVSS
A0A6P0ZWE1      ---FL--DDLSLVEP-----------YRLLLKKLE-----FR-----T-QQKLKLIVVSS
A0A1U7N2U4      ---FL--EDMRLMEP-----------YRLLLTTME-----LR-----A-QKRLQLIVVSS
A0A1D9G1F2      ---FL--EDMRLMEP-----------YRLLLTTME-----LR-----A-QKRLQLIVVSS
A0A6P0PNZ7      ---FL--EDMRLMEP-----------YRLLLTTME-----LR-----A-QKRLQLIVVSS
F4XV38          ---FL--EDMRLMEP-----------YRLLLTTME-----LR-----A-QKRLQLIVVSS
A0A6P0W137      ---FL--EDMRLMEP-----------YRLLLTTME-----LR-----A-QKTLQLIVVSS
A0A6L9Y9E2      ---FL--ADMRLIEP-----------YRLLLTTME-----LR-----A-QKKLQLIVVSS
A0A6P0SGR0      ---FL--ADMRLMEP-----------YRLLLTTME-----LR-----A-QKKLQLIVVSS
A0A6M0BK48      ---FL--ADMRLIEP-----------YRLLLTTME-----LR-----A-QKRLQLIVVSS
A0A6L9YZL1      ---FL--ADIRLMEP-----------YRLLLTTME-----LR-----A-QNRLQLIVVSS
A0A6P0KYM4      ---FL--ADIRLMEP-----------YRLLLTTME-----LR-----A-QKRLQLIVVSS
A0A6P0LSD6      ---FL--ADIRLMEP-----------YRLLLTTME-----LR-----A-QKRLQLIVVSS
A0A6P0X384      ---FL--DDGKLVEP-----------YRLLLKKLE-----FC----IQ-EEKLQLIVVSS
A0A2P8QIL5      ---LM--QEPAILES-----------YRSLLRSSE-----FA-----A-NEDIKVIVVSS
A0A2T1FLY5      ---LM--QEPAILES-----------YRSLLRSSE-----FA-----A-NEDIKVIVVSS
A0A433W447      ---LM--QEPAILES-----------YRSLLRSSE-----FA-----A-NEDIKVIVVSS
K9U1K8          ---LM--QEPAILES-----------YRSLLRSSE-----FA-----A-NEDIKVIVVSS
K9UYB2          ---FF--NEISLVEP-----------YRMLFKNLE-----FS-----T-AENLHLFVVSS
A0A218QN17      ---FL--DNISLVEP-----------YRMLLKTLE-----FR-----S-NDKVQVIVVSS
K9RKN2          ---FL--DQVGLVEP-----------YRMLFKTLE-----FR-----S-DDELQKIVVSS
A0A2I8ADV2      ---FL--DDVGLVEP-----------YRMLLKNLE-----FR-----S-HEKLQVVVVTS
A0A1W5CKM3      ---FL--DDLGLVEP-----------YRMLLKNLE-----FR-----N-VDNLQVIVVSS
A0A5Q0GMF5      ---FL--DDLGLVEP-----------YRMLLKNLE-----FR-----N-VDNLQVIVVSS
Q3MEW0          ---FL--DDLGLVEP-----------YRMLLKNLE-----FR-----N-VDNLQVIVVSS
A0A1Z4KIC7      ---FL--DDLGLVEP-----------YRMLLKNLE-----FR-----N-VDNLQVIVVSS
Q8YSM5          ---FL--DDLGLVEP-----------YRMLLKNLE-----FR-----N-VDNLQVIVVSS
A0A1Q4S1H4      ---FL--DDMGLVEP-----------YRMLLKTLE-----CR-----S-PGKLHLVVVSS
A0A433VBU6      ---FL--DDMGLVEP-----------YRMLLKTLE-----CR-----S-ASKLHSIVVSS
A0A1Q4RZJ6      ---FL--DNVALVEP-----------YRMLFKSLE-----FR-----T-SE-LQLLVVSS
A0A1Z4SNV3      ---FL--DNVGLVEP-----------YRMLFKSLE-----FR-----T-SE-LQLLVVSS
A0A2H2XJQ1      ---FL--DNVGLVEP-----------YRMLFKSLE-----FR-----T-SE-LQLLVVSS
A0A3S5K358      ---FL--DNVALVEP-----------YRMLFKSLE-----FR-----T-SE-LQLLVVSS
A0A0T7BPJ4      ---FL--DDIGSVEP-----------YRMLLKNIE-----FR-----N-LEDLNSIVISS
A0A0C1QS61      ---FL--DNMSLVEP-----------YRMLFKTLE-----FR-----S--DRMRVIVVSS
A0A139X3R8      ---FL--DNVSLVEP-----------YRMLFKTLE-----FR-----S--DQMRLIVVSS
A0A1Z4I7C5      ---FL--DDLGLVEP-----------YRMLLKNLE-----FR-----S-IDNLQVIVVSS
A0A0C2MDK7      ---FL--DNMELIEP-----------YRTLFKTLE-----FR-----R-SEQLRAIVVSS
A0A1Y0RCK1      ---FL--DNISLVEP-----------YRTLFKTLE-----FR-----S-REQLRLIVVSS
A0A1Z4PWZ0      ---FL--DNIGLVEP-----------YRTLFKTLE-----FR-----S-SEQLRLIVVSS
A0A0C2QLT0      ---FL--DNIGLVEP-----------YRTLFKTLE-----FR-----S-PEQVRLIVVSS
A0A1Z4J2K1      ---FL--DNIGLVEP-----------YRTLFKTLE-----FR-----S-PEQVRLIVVSS
A0A3S0ZSX0      ---FL--DNSALIEP-----------FRMLFKNLE-----FR-----S-SEPLRQIVVSS
A0A2N6K4T3      ---FL--DHVGLVEP-----------YRTLFKNLE-----FR-----S-RESLRSIVVSS
A0A370CKT2      ---FL--DHVGLVEP-----------YRTLFKNLE-----FR-----S-SEPLRSIVVSS
A0A0S3TL97      ---FL--DHVGLVEP-----------YRTLFKNLE-----FR-----S-SEPLRSIVVSS
A0A2N6M8A0      ---FL--DHVGLVEP-----------YRTLFKNLE-----FR-----S-SEPLRSIVVSS
A0A2N6M9E1      ---FL--DHVGLVEP-----------YRTLFKNLE-----FR-----S-SEPLRSIVVSS
A0A2N6KJI4      ---FL--DHVGLVEP-----------YRTLFKNLE-----FR-----S-SEPLRSIVVSS
A0A2N6MZ77      ---FL--DHVGLVEP-----------YRTLFKNLE-----FR-----S-SEPLRSIVVSS
A0A2N6KT20      ---FL--DHVGLVEP-----------YRTLFKNLE-----FR-----S-SEPLRSIVVSS
G6FSN3          ---FL--DHVGLVEP-----------YRTLFKNLE-----FR-----S-SEPLRSIVVSS
A0A4D9CI02      ---FL--DHLGLVEP-----------YRTLLKNLE-----FR-----N-PESLRSIVVSS
A0A328I8B9      ---FL--DHVGLVEP-----------YRTLLKNLE-----FR-----N-PESLGSIVVSS
A0A4Q9J4Z7      ---FL--DHLGLVEP-----------YRTLLKNLE-----FR-----N-PESLRSIVVSS
A0A0M0SU69      ---FL--DHVGLVEP-----------YRTLFKNLE-----FR-----S-TEPLRSIVVSS
A0A1Z4TIZ8      ---FL--DHVGLIEP-----------YRTLFKNLE-----FR-----S-NEPLRSIVVSS
A0A2T1E9V8      ---FI--SES----------------YRMLQFNLE-----VA----S--SKALKVIAITS
A0A1Z4LN32      ---VI--HEA----------------YQMLQANLK-----FI----SL-DRKIRSIAVTS
A0A2I8A9F5      ---MI--HES----------------FGMLQANLK-----FI----SL-DKKIRTIAVTS
A0A218Q6R8      ---VI--HES----------------YQMLQANLK-----FM----SL-DKKVRTIVVTS
A0A218QGE0      ---VI--HEA----------------YQMLQANLK-----FI----SL-DRKVSAIVVTS
A0A3M2GQQ6      ---PF--TEA----------------VRSLALNLR-----YL----GA-EDEAKTLALTS
A0A6H1U2X0      ---PF--TEA----------------VRSLALNLR-----YL----GA-EDEAKTLALTS
K1XF69          ---LI--SEI----------------YRMIQANLK-----FL----GS-DRKVRVIVVSS
B5W297          ---LI--SEI----------------YRMIQANLK-----FL----GS-DRKVRVIVVSS
A0A6H2AL05      ---LI--SEI----------------YRMIQANLK-----FL----GS-DRKVRVIVVSS
H1W7M8          ---LI--SEI----------------YRMIQANLK-----FL----GS-DRKVRVIVVSS
A0A5Q4H6A5      ---LI--SEI----------------YRMIQANLK-----FL----GS-DRKVRVIVVTS
D5A466          ---LI--SEI----------------YRMIQANLK-----FL----GS-DRKVRVIVVTS
U5QJM6          ---AY--EEA----------------FRSLLTNIR-----FL----NS-DKKVNTFVISS
A0A1Z4RPC6      ---FA--SEI----------------YRMIQTNLK-----FL----AV-KRQPKVIVITS
A0A2T1CMZ0      ---FA--SEI----------------YRMIQTNLK-----FL----AV-KQQPKVILMTS
L8M4F7          ---YT--SEI----------------YRMIRTNLT-----AR----SS-QVLPKVILVTS
A0A140K2P2      ---FA--SEV----------------YRMIQANLK-----FM----SL-ENSTQVILVTS
K9XWX4          ---FA--SEV----------------YRMIQANLK-----FM----SL-EHPPQVILVTS
A0A140KB14      ---FN--SEL----------------YRMIQANLK-----IL----NQ-DNPPQVILITS
K9XX88          ---FN--SEI----------------YRMIQANLK-----IL----NQ-DNPPQVVLVTS
A0A563VSV6      ---YA--SET----------------YRMIQANLK-----FM----TT-QRPPKVILITS
L8LZE9          ---YT--SEI----------------YRMIQANLK-----FM----TS-QRPPKVILVTS
A0A433NM31      ---MI--SEI----------------YGMIYANLK-----FL----GS-DQELRVITITS
A0A1Z4NDS1      ---PF--SDA----------------YQMLQANLK-----FL----AS-DNELKTIVVSS
U9VXM0          ---SV--LDA----------------YQSLQANLK-----FS----CV-ESQVKTITITS
A0A6M0RI13      ---SI--LDA----------------YQALQANLK-----FS----CV-DTHVKTVTVTS
A0A6M0S1N5      ---SI--LDA----------------YQALQANLK-----FS----CV-DTHVKTVTVTS
K9F4D9          ---SI--LDA----------------YQALQANLK-----FS----CV-DTHVKTVTVTS
A0A6I5QPI5      ---GV--REA----------------YQMMQANLK-----FL----QS-DTELKTVMITS
A0A1Z3HMQ0      ---MV--TAA----------------YQMLQANLK-----FI----SS-DTPRRALTLTS
A0A433W533      ---PI--AEA----------------FRMLQANLK-----FS----SS-DK-LKVILVTS
A0A2P8QWJ3      ---PI--AEA----------------FRMLQANLK-----FS----SS-DK-LKVILVTS
A0A2T1FKP8      ---PI--AEA----------------FRMLQANLK-----FS----SS-DK-LKVILVTS
K9U6L7          ---PI--AEA----------------FRMLQANLK-----FS----SS-DK-LKVILVTS
A0A1E5QP61      ---YT--SEA----------------YRTLQANLK-----FI----SP-DREIRIIVVTS
U5DPF5          ---SM--SEA----------------FRMLQANLK-----FS----TT-DRKLKVVAVTS
A0A6P0X488      ---VI--SEA----------------YRMLEANLK-----FL----SP-DKELKVIVVTS
A0A6P0UVD5      ---VI--SEA----------------YRMLEANLK-----FL----SP-DKELKVIVVTS
A0A6P0VDM0      ---VI--SEA----------------YRMLEANLK-----FL----SP-DKELKVIVVTS
A0A6M0G142      ---VI--SEA----------------YRMLEANLK-----FL----SP-DKELKVIVVTS
A0A6P0MR53      ---IS--SEA----------------YRMLEANLK-----FL----SP-DKELKVIVVTS
A0A3M2GIL5      ---VV--SET----------------YRMLQANLR-----FL----SP-DKELKTIVVTS
A0A6H1TSJ9      ---VV--SET----------------YRMLQANLR-----FL----SP-DKELKTIVVTS
A0A3M1PML8      ---PI--AAS----------------YQMLQANLK-----FL----SS-DKAVRSFVITS
A0A6M8BE85      ---PI--AAS----------------YQMLQANLK-----FL----SS-DKAVRSFVITS
A0A0T7BPZ0      ---PM--DEV----------------YQMLQANLK-----FL-----S-DRRIKAIAVTS
A0A352X442      ---PI--AQA----------------YQMLRANLK-----FL----SS-DKQIKAIVVTS
A0A6B3NF44      ---PF--NEA----------------YQMLQANLK-----FL----SS-DKQIKSIVVTS
A0A6M0EPL4      ---PF--NEA----------------YQMLQANLK-----FL----SS-DKQIKSIVVTS
A0A6P0K6L6      ---PF--NEA----------------YQMLQANLK-----FL----SS-DKQIKSIVVTS
A0A6P0MRR9      ---PI--SAA----------------YQMLQANLK-----FL----SS-DEPLKAIVVTS
A0A6P0UX57      ---PL--SAA----------------YQMLQANLK-----FL----SS-DKPPKVIVVTS
A0A6P0X1X4      ---PL--SAA----------------YQMLQANLK-----FL----SS-DKPLKAIVITS
A0A0M0SHU3      ---PV--GDA----------------YQMLQANLK-----FL-----S-DKQLKAITVTS
A0A1D2PBN3      ---PV--GDA----------------YQMLQANLK-----FL----SS-DKQLKAIVVTS
A0A0C2LVR7      ---PV--GDA----------------YQMLQANLM-----FL----SS-DNQLKAIVVTS
A0A1Z4PQB9      ---PV--GDA----------------YQMLQANLK-----FL----SS-DNELKAIVVTS
A0A1Z4SFN6      ---PV--GDA----------------YQILQANLK-----FL----SS-DKKLKAIVVSS
K9PGI8          ---PI--GNA----------------YQMLQANLK-----FL----GS-DEELKAIAVTS
K9TLQ0          ---RF--FEA----------------FRSLHADLY-----FM----SP-DRPLKSIVISS
K9QF04          ---HY--WEA----------------YISLQTNLD-----FL----DP-DKPLKSLVISS
K9W1T3          ---PI--SEA----------------YRMIHTSLR-----FM----SL-DNQLKVMVISS
K9SGJ5          ---AF--REA----------------LRSLALNLR-----YL----GG-DLSIKSIAFTS
A0A6N2JS94      ---AF--KEA----------------LGSLALNLR-----YL----GT-DNMMKVIAFTS
A0A6C2DSN4      ---AF--KEA----------------LSSLALNLR-----YL----GT-DNMMKVIAFTS
L8MYT6          ---AF--KEA----------------LSSLALNLR-----YL----GT-DNMMKVIAFTS
A0A352JGJ6      ---AF--KEA----------------LSSLALNLR-----YL----GT-DNTMKVIAFTS
A0A1J5GLS2      ---AF--KEA----------------LSSLALNLR-----YL----GT-DNMMKVIAFTS
A0A2W4W6M5      ---AF--KEA----------------LSSLALNLR-----YL----GT-DNMMKVIAFTS
A0A2W7AN33      ---AF--KEA----------------LGSLALNLR-----HL----GM-DNLMKVIAFTS
A0A256BLV2      ---AF--KEA----------------LGSLALNLR-----YL----GT-DNMMKVIAFTS
A0A2W6ZXF3      ---AF--KEA----------------LSSLALNLR-----YL----GT-DNMMKVIAFTS
A0A2Z5WX66      ---AF--KEA----------------LSSLALNLR-----YL----GT-DNTMKVIAFTS
Q7NEU3          ---ML--REA----------------FRSLLTNLR-----FL----SS-DRKLKVFVVSS
A0A3C0N2P0      ---PL--LES----------------FRSLNTNLQ-----FV----SP-DEAVRSVVISS
A0A6P0JR04      ---PF--VEA----------------FRSLNANLS-----FF----TP-DKPLQTLVISS
A0A6B3M6M6      ---PF--LEA----------------FRSLQVNLH-----FL----GT-DESIRSLVISS
A0A6P0KD09      ---PF--LEA----------------FRSLQVNLH-----FL----GT-DESIRSLVISS
A0A6B3NIJ0      ---PF--LEA----------------FRSLQVNLH-----FL----GT-DESIRSLVISS
A0A6M0F053      ---PF--LEA----------------FRSLQVNLH-----FL----GT-DDPIRSLVISS
A0A6P2ATU9      ---PF--LEA----------------FRSLNANLS-----FL----TP-DKPLQVLVISS
A0A352XE00      ---PF--LEA----------------FRSLHTNLN-----FI----SP-DRPIRSLVMSS
A0A6P0QC14      ---PL--LEA----------------FRSLNTNLQ-----FL----SP-DQPIRSLVLSS
B4VS56          ---PF--LEA----------------FRSLQTNLQ-----FI----SP-DQPIRSVVISS
A0A352AAQ3      ---PV--LEA----------------FRSLHANLH-----FL----SP-DRPIRSLVMSS
A0A350Y472      ---PL--LEA----------------FRSLHANLH-----FL----SP-DKSIRSLVVSS
A0A355DVB4      ---PL--LEA----------------FRSLHANLH-----FL----SP-DKTIRSLVVSS
A0A1Z4RMB9      ---FS--SEI----------------YRMIQANLK-----FL----TS-DKPPKVMLITS
A0A318B4H2      ---QL--YES----------------YLAVRTNLS-----FL----TD-HGAPGVLMLTS
B4WQE3          ---PF--LEA----------------FKLLATNVC-----QG----GS-QDIAKSFSVSS
A0A2K3BR24      ---SA--SEA----------------FRMLQANLK-----FS----SV-DQKMKVIVLTS
K9YXY1          ---SA--SEA----------------FRMLQANLK-----FS----SV-DQKMKVIVLTS
A0A1Q4RTR1      ---PA--SAA----------------FEKLQSTLE-----YT----LP-DQVLKSIVITS
A0A1Z4SQV2      ---PA--SAA----------------FEKLQSTLE-----YT----LP-DQVLKSIVITS
A0A2H2XGN1      ---PA--SAA----------------FEKLQSTLE-----YT----LP-DQVLKSIVITS
A0A433UXH8      ---PA--SAA----------------FEKLQSTLE-----YT----LP-DQVLKTIVITS
A0A0V7ZFJ4      ---SV--TSA----------------FEILQTNLA-----FT----VS-DKTLKVIVVSS
A0A0V7ZNJ9      ---VE--SSA----------------FEMLQTNLS-----FT----SS-DKTLKVLMVTS
A0A367RIS1      ---SV--NAA----------------FEMLQINLG-----FT----FS-DKELKVIVVSS
A0A235IXQ2      ---SV--NAA----------------FEMLQINLG-----FS----FS-DKELKVIVVSS
A0A1W5CNX3      ---SV--NAA----------------FEMLQINLG-----FS----FS-DKKLKVIVVSS
A0A5Q0GJJ5      ---SV--NAA----------------FEMLQINLG-----FS----FS-DKKLKVIVVSS
Q3MEB7          ---SV--NAA----------------FEMLQINLG-----FS----FS-DKKLKVIVVSS
A0A1Z4KHN9      ---SV--NAA----------------FEMLQINLG-----FT----FS-DKKLKVIVVSS
Q8YT70          ---SV--NAA----------------FEMLQINLG-----FT----FS-DKKLKVIVVSS
A0A166IWU6      ---SV--NTA----------------FEMLQINLG-----FT----IS-DKELKVIVVSS
A0A2S0Q8C0      ---SV--NTA----------------FEMLQINLG-----FT----IS-DKELKVIVVSS
W6FSX4          ---SV--NTA----------------FEMLQINLG-----FT----IS-DKELKVIVVSS
A0A218Q4C1      ---SV--NTA----------------FEMLQINLG-----FT----IS-DKKLKVIVVSS
A0A6P1ZT04      ---SV--NTA----------------FEMLQINLG-----FT----IS-DKELKVIVVSS
A0A5P8VSD1      ---SV--NAA----------------FEMLQINLG-----FT----FY-DKELKVVVVSS
A0A1S1ZVW2      ---PV--STS----------------IEMLQTNLG-----FA-----T-DKELQVILVTS
A0A0R0M9H9      ---PV--STS----------------IEMLQTNLG-----FA-----T-DKELRVILLTS
A0A7H0F4U6      ---PV--STS----------------IEMLQTNLG-----FA-----T-DKELRVILLTS
A0A1B7WX82      ---PV--STS----------------FEMLQTNLG-----FT----LS-DKELRVILVTS
A0A1B7WTD1      ---PV--STS----------------LEMLHTNLG-----FT----IS-DKELQVILVTS
A0A480ABC0      ---PV--STS----------------LEMLNTNLG-----FT----IS-DKELQVILVTS
A0A1Z4LRU5      ---PA--STA----------------FEILQTNLG-----FT----MS-DKALKVIVVSS
A0A1Z4JVB4      ---PA--AVA----------------FEMFQTNLG-----FS----IC-EQKLKVIVVSS
K9PIA4          ---PE--SAA----------------FEMLQTNLG-----FS----IS-DKKLKVIVVSS
A0A1Z4HVE1      ---AE--SAA----------------FEMLQANLG-----FS----IS-DKTLKVIALSS
A0A252ECZ1      ---PE--SSA----------------FEMLQANLS-----FS----IS-DKKLKVIVVSS
A0A1Z4G5Y1      ---PE--SAA----------------FEMLQTNLG-----FS----IS-DKTLKVIVLSS
A0A252DNA2      ---PE--SAA----------------FEMLQANLG-----FS----IS-DKTLKVIVLSS
A0A252E1Q4      ---PE--SAA----------------FEMLQANLG-----FS----IS-DKTLKVIVLSS
A0A6G9SK36      ---PV--SSA----------------FEMLQTNLS-----FS----IS-DKMLKVIALSS
A0A1Z4M597      ---PV--SSA----------------FEMLQTNLS-----FS----IS-DKMLKVIAISS
A0A1Z4MWT1      ---PV--SSA----------------FEMLQTNLS-----FS----IS-DKMLKVIAISS
A0A1Z4TX53      ---PV--SSA----------------FEMLQTNLS-----FS----IS-DKMLKVIAISS
A0A2A2TNQ5      ---SG--SMA----------------FEMLMTNLA-----FS----VS-DQELRVIVVTS
A0A3S1C4K5      ---PA--TSA----------------FEMLVTNLS-----FT----LS-DQALRVIAVTS
A0A1X4G3D5      ---PI--SRS----------------FQILQTNLG-----FA-----R-DRELQVMLVTS
D4TNI2          ---PI--SRS----------------FQILQTNLG-----FA-----R-DRELQVMLVTS
A0A1Z4H6Z8      ---PE--STA----------------FEMLQVNLG-----FS----IS-DKTLKVIVVSS
A0A1Z4NPM1      ---PA--SVA----------------FEMLQTNLS-----FT----VS-DNELRVILVTS
A0A3F3KPR9      ---PV--STS----------------IEMLQTNLG-----FA-----T-DKELRVILLTS
D4TGN7          ---PV--STS----------------IEMLQTNLG-----FA-----T-DKELRVILLTS
A0A1Z4UZW9      ---PV--STS----------------FEMLQTNLG-----FT----LS-DKELRVILLTS
A0A0K2M5H0      ---PV--STS----------------FEMLQTNLG-----FT----CS-DKELRVILVTS
A0A1B7VSH4      ---PV--STS----------------FEMLQTNLG-----FT----VS-DKKLRVILVTS
A0A1B7W126      ---PV--STS----------------FEMLQTNLG-----FT----VS-DKELRVILVTS
A0A3D4C6Q6      ---PV--STS----------------FEMLQTNLG-----FT----VS-DKELRVILVTS
A0A1B7UVJ4      ---PV--STS----------------FEMLQTNLG-----FT----LS-DKQLRVILVTS
A0A1B7UTR1      ---PV--STS----------------FEMLQTNLG-----FT----LS-DKQLRVILVTS
K7W0A4          ---PV--STS----------------FEMLQTNLG-----FT----LS-DKELRVILLTS
A0A5C0DRW9      ---PV--TTS----------------FEMLQTNLG-----FT----LS-DKKLRVVLLTS
A0A6H2C088      ---PV--TTS----------------FEMLQTNLG-----FT----LS-DKELRVILLTS
A0A1U7HGH0      ---FI--TES----------------YRMLLANLK-----FP----PSLDRSSRVILVTS
K9XJD3          ---FV--TES----------------YRMLLANLK-----FP----PSLERSSRVILVTS
K9SX01          ---PA--SEA----------------YRMLQTSLR-----FL----NS-DRQIKAIVITS
A0A4P7ZT55      ---GL--RES----------------LRNLYRSLQ-----LV----RA-GGNLRMLAVTS
A0A1E5QIR9      ---LI--SES----------------YRMLYANLK-----FL----GS-DRQVRVIAVTS
A0A6P1A9A0      ---PF--LDA----------------FRSLHANLY-----FI----SP-DRPLRSLAISS
A0A1Z4IBC7      ---PL--GDA----------------YQILQVNLK-----FL----CS-DKPLKSIVVTS
A0A1W5CPC7      ---PL--GDA----------------YQILQVNLK-----FL----CS-DKPLKSIVVTS
A0A5Q0GKD1      ---PL--GDA----------------YQILQVNLK-----FL----CS-DKPLKSIVVTS
Q3MDC6          ---PL--GDA----------------YQILQVNLK-----FL----CS-DKPLKSIVVTS
A0A1Z4KM73      ---PL--GDA----------------YQILQVNLK-----FL----CS-DKPLKSIVVTS
Q8YNX7          ---PL--GDA----------------YQILQVNLK-----FL----CS-DKPLKSIVVTS
A0A367R4K6      ---PL--GDA----------------YQILQVNLK-----FL----CS-DKPLKSIVVTS
A0A1E2WSV8      ---PV--GNA----------------YQILQVNLK-----FL----CS-DKPLKSIVITS
A0A7D7L9Y1      ---PV--GNA----------------YQILQVNLK-----FL----CS-DKPLKSIVITS
A0A2R5FRT9      ---PL--GNA----------------YQVLQVNLK-----FL----CS-DKPLKSIVITS
A0A2K8T1B6      ---PL--GNA----------------YQILQVNLK-----FL----CS-DKPLRSIVITS
A0A235I9I0      ---PV--GNA----------------YQILQVNLK-----FL----CS-DKPLKSIVITS
A0A2D0HQT8      ---PV--GNA----------------YQILQVNLK-----FL----CS-DKPLKSIVITS
A0A2L2NU95      ---PV--GNA----------------YQILQVNLK-----FL----CS-DKPLKSIVITS
A0A367S084      ---PV--GNA----------------YQILQVNLK-----FL----CS-DKPLKSIVITS
A0A1Z4SMD6      ---IV--HDA----------------YQMLQANLK-----FI----S--DKKVRTIAVAS
A0A2H2Y096      ---IV--HDA----------------YQMLQANLK-----FI----S--DKKVRTIAVAS
K9S8M8          ---II--SEN----------------YRMLQANLR-----FL----SP-DRELKVIVVTS
A0A1Z4NFV0      ---VI--HEA----------------YQMLQANLK-----FI----S--HKKVRTIVITS
A0A3M9ZEU1      ---PI--SEA----------------YHMLQANLK-----FL----SS-DQEIRVVVVTS
A0A1Z4JK72      ---MI--HEA----------------YQMLQANLK-----FM----SL-DKKVKTIVISS
A0A0N7Z489      ---MI--HEA----------------YQMLQANLK-----FM----SL-DKPVKTIVISS
A0A0S3TXS2      ---MI--HEA----------------YQMLQANLK-----FM----SL-DKKVKTIVISS
A0A2A2TPF8      ---VI--HEA----------------YQMLQANLN-----FI----S--HKKVRTIVVTS
A0A1Z4R0P8      ---VI--HEA----------------YQMLEANLN-----FI----S--HKRVRTLVVTS
A0A0T7BUI3      ---II--HEA----------------YQMLQANLN-----FI----S--HKKVRAIAITS
A0A1Z4LP32      ---MI--HEA----------------YQMLQANLK-----FI----S--HKEVRTIVVTS
K9REP9          ---MI--HEA----------------YQMLQANLK-----FI----S--HKEVRTIAVTS
A0A1Z4SIJ3      ---VI--HDA----------------YQMLQANLK-----FI----S--HKKVCTLAITS
A0A2H2XPG4      ---VI--HDA----------------YQMLQANLK-----FI----S--HKKVCTLAITS
K9V3C7          ---VI--HEA----------------YQMLRANLK-----FI----S--HKQVRTIVVTS
A0A1Z4T6Y7      ---VI--HEA----------------YQMLQANLK-----FI----S--HKKVRTIVITS
A0A2H2Y561      ---VI--HEA----------------YQMLQANLK-----FI----S--HKKVRTIVITS
A0A1Q4S362      ---VI--HEA----------------YQMLQANLK-----FI----S--HKTVRTIVVTS
A0A3S1CIN8      ---VI--HEA----------------YQMLQANLK-----FI----S--HKTVRTIVVTS
A0A2A2TC28      ---VI--HEA----------------YQMLQANLK-----FI----S--HKKVCTIVVTS
A0A0C1NCB0      ---VV--HEA----------------YQMLQANLK-----FI----S--HKRLRTIVVTS
A0A2N6K7Q9      ---VV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A2N6MXH6      ---VV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A2N6M5A8      ---VV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A2N6LL61      ---VV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A0S3TP66      ---VV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
G6FP91          ---VV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A1U7GYR5      ---VV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A2N6KY52      ---VV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A2N6KMP5      ---VV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A2N6MA45      ---VV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A4Q9J9V9      ---LV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A328IGA1      ---LV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A4D9CE41      ---LV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A0M0SFT2      ---LV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A1Z4TLC8      ---LV--HEA----------------YQMLQANLK-----FI----S--HRKVRKIVVTS
A0A0C2LFH0      ---VV--HEA----------------YQMLQANLK-----FI----S--HRKVRTIVVTS
A0A1Z4IYV4      ---VI--HEA----------------YQMLQANLK-----FI----S--HKKVRTIVVTS
A0A1Z4Q0T6      ---VI--HEA----------------YQMLQANLK-----FI----S--HKKVRTIVVTS
A0A0C2PT44      ---VI--HEA----------------YQMLQANLK-----FI----S--HKKVRTIVVTS
A0A1D2P6J4      ---VV--HEA----------------YQMLQANLK-----FI----S--HKRVRTIVVTS
B4WP72          --SVV--TEA----------------YQMLWSNLK-----SV----TS-RQELKTIVITS
A0A2T1CIL7      --------EA----------------YNMLQANLK-----FL----TT-NWDRKAIAVTS
A0A433V7A0      ---FI--YEL----------------YCMIQANLK-----FL----CS-DKALKVIVITS
A0A2T1FTR8      ---IE--GES----------------FRMLQTNLQ-----FL----NA-DDSLKVVVVSS
K9UA41          ---IE--GES----------------FRMLQTNLQ-----FL----NA-DDSLKVVVVSS
A0A0C2LBE2      ---PV--GDA----------------YQMLQANLK-----FL----SS-DREPRVIVVTS
A0A433NN38      ---AI--RDA----------------YQMLQANLR-----FL-----S-DKQLKAIAVTS
A0A2N6K0T2      ---PV--GDA----------------YQMLQANLK-----FL-----S-DKQLKAITVTS
A0A2N6ML72      ---PV--GDA----------------YQMLQANLK-----FL-----S-YKQLKAITVTS
G6FQZ6          ---PV--GDA----------------YQMLQANLK-----FL-----S-YKQLKAITVTS
A0A2N6MQX9      ---PV--GDA----------------YQMLQANLK-----FL-----S-YKQLKAITVTS
A0A2N6KXT6      ---PV--GDA----------------YQMLQANLK-----FL-----S-YKQLKAITVTS
A0A2N6KGB9      ---PV--GDA----------------YQMLQANLK-----FL-----S-YKQLKAITVTS
A0A2N6L3Y5      ---PV--GDA----------------YQMLQANLK-----FL-----S-YKQLKAITVTS
A0A0S3TIS7      ---PV--GDA----------------YQMLQANLK-----FL-----S-YKQLKAITVTS
A0A1U7GW28      ---PV--GDA----------------YQMLQANLK-----FL-----S-YKQLKAITVTS
A0A2N6LW63      ---PV--GDA----------------YQMLQANLK-----FL-----S-YKQLKAITVTS
A0A328IH74      ---PV--GDA----------------YQMLQANLK-----FL-----S-DKQLKAITVTS
A0A4D9CIB0      ---PV--GDA----------------YQMLQANLK-----FL-----S-DKQLKAITVTS
A0A1Z4TQ63      ---PV--GDA----------------YQMLQANLK-----FL-----S-DKQLKAITVTS
A0A4Q9J8G2      ---PV--GDA----------------YQMLQANLK-----FL-----S-DKQLKAITVTS
A0A350Y0P6      ---IT--SEA----------------YRMLEANLK-----FL----SP-DHVLKRIVVTS
A0A352X940      ---IV--SEA----------------YRMLEANLK-----FL----SP-DKMLKVIVVTS
B8HTN4          ---HL--SEA----------------YRTLQANLK-----FL----SSPDHPIRTIVITS
A0A6P1AFJ5      ---AF--SEA----------------FRSLNTNIQ-----FL----SS-DAKIHSLVVSS
B0CAX4          ---SV--SES----------------YRMLQANLK-----FL----SS-DHHVQVFVVTS
A0A1Z4RN12      ---PL--KEA----------------YQNIQVNLK-----LL----GA-NVETKTIAVTS
A0A2T1CMF9      ---PL--KEA----------------YQNIQVNLN-----LL----DA-DAKKKVIAITS
Q7NDC5          ---PV--SEA----------------YRSIRTHLK-----FL----SS-ERGLRAFVLTS
U5QGK3          ---PM--SEA----------------YRSVRTYLK-----FL----SA-ESPLTAVVFTS
A0A2W4UY24      ---PL--VES----------------YQSLQANLK-----FS----YF-DGSLKAITVTS
A0A0D8ZUV2      ---PL--SEA----------------YRMLQANLK-----FL----SS-DKPLRVIVVTS
A0A433VDI0      ---PI--SEA----------------YRMLQANLK-----FL----GS-DKALKVIVVTS
A0A3D1PG43      ---PI--AEN----------------YRMLQANLK-----FL----SS-ERALKAVVVSS
A0A2P8QQ72      ---LT--AEA----------------YRMLQANLR-----FL----NL-DRPLKAVVVTS
K9TZQ7          ---LT--AEA----------------YRMLQANLR-----FL----NL-DRPLKAVVVTS
A0A6N8G584      ---PI--SEA----------------YRMLQANLK-----FL----SS-DKPLKVIVVTS
A0A2G7GPR0      ---PI--SEA----------------YRMLQANLK-----FL----SS-DKPLKVIVVTS
K9XH68          ---PI--SEA----------------YRMLQANLK-----FL----SS-DKPLKVIVVTS
A0A1U7HW70      ---PI--SEA----------------YRMLQANLK-----FL----SS-DKPLKVIVVTS
A0A2S6VEJ8      ---PI--SEA----------------YRMLQANLK-----FL----SS-DKPLKVIVVTS
A0A140KBA0      --LPI--REA----------------YQILQANLK-----LL----SL-SQARKVIAVTS
K9XSG1          --LPI--REA----------------YQILQANLK-----LL----SL-SQERKVIAVTS
A0A2T1GMT4      ---IT--SEM----------------SRTIQSNLR-----FL----GA-DKPLKTIAITS
K9UI51          ---IT--SEM----------------SRTIQSNLR-----FL----SA-DKPLKIIAITS
A0A1Z4QL41      ---LA--SEM----------------YRMIQANLR-----LV----SS-DQVLKSIVVTS
A0A2T1FXY4      ---LT--SEI----------------YRMIQANLK-----FL----SP-DRVLKTIVVTS
K9TYI2          ---LT--SEI----------------YRMIQANLK-----FL----SP-DRALRTIVITS
A0A252D4T4      ---LT--SEI----------------YRMIQANLR-----FL----SS-DKVLKTIVVSS
A0A252DJH5      ---LT--SEI----------------YRMIQANLR-----FL----SS-DKVLKTIVVSS
A0A252EB80      ---LT--SEI----------------YRMIQANLR-----FL----SS-DKVLKTIVVSS
A0A6G9SKZ9      ---LT--SEI----------------YRMIQANLR-----FL----SS-DKVLKTIVVSS
A0A1Z4HPW5      ---LT--SEI----------------YRMIQANLR-----FL----SS-DKVLKTIVVSS
A0A1Z4MSN1      ---LT--SEI----------------YRMIQANLR-----FL----SS-DKVLKTIVVSS
A0A1Z4U1C2      ---LT--SEI----------------YRMIQANLR-----FL----SS-DKVLKTIVVSS
A0A0D6KV51      ---LT--SEI----------------YRMIQANLR-----FL----SS-DKVLKTIVVSS
A0A1Z4MKF8      ---LT--SEI----------------YRMIQANLR-----FL----SS-DKVLKTIVVSS
A0A2C6WC43      ---LT--SEM----------------YRMIQANLK-----FL----SS-DKVLKTIVVTS
A0A1Z4L5A1      ---LT--SEM----------------YRMIQANLK-----FL----SS-DKVLKTIVVTS
A0A367QD86      ---LT--SEM----------------YRMIQANLK-----FL----SS-DKVLKTIVVTS
A0A2K8SM78      ---LT--SEM----------------YRMIQANLK-----FL----SS-DKVLKTIVVTS
A0A2R5FPC0      ---LT--SEM----------------YRMIQANLK-----FL----SS-DKVLRTIVVTS
A0A5P8W5T6      ---LT--SEM----------------YRMIQANLK-----FL----SS-DKVLKTIVVTS
A0A7D7LDT7      ---LT--SEM----------------YRMIQANLK-----FL----SS-DKVLKTIVVTS
A0A235IZ96      ---LT--SEM----------------YRMIQANLK-----FL----SS-DKALKTIVVTS
A0A2L2NGP0      ---LT--SEM----------------YRMIQANLK-----FL----SS-DKALKTIVVTS
K9QM62          ---LT--SEM----------------YRMLQANLK-----FL----SS-DKELKTIVVTS
A0A1Z4FWI3      ---LT--SEI----------------YRMIQANLR-----FL----SS-DKVLKTIVVSS
A0A1Z4JYE7      ---LT--SEI----------------YRMIQANLK-----FL----SS-DKLLKTIVVTS
A0A0F5YE28      ---FI--SEI----------------YRMLQANLK-----FL----SS-DKRIKTIVVTS
U7QEH7          ---FI--SEI----------------YRMLQANLK-----FL----SS-DKRIKTIVVTS
A0A3S1ATK5      ---LT--SEM----------------YRVIQANLR-----LL----SS-DKVIKSIVVTS
A0A2Z6CPH0      ---LT--SEI----------------YRMIQANLK-----FL----SS-DKVLKTIVVTS
A0A1Z4GT50      ---LT--SEI----------------YRMIQANLR-----FL----SS-DKVVKTIVITS
A0A1Z4GIX0      ---LT--SEM----------------YRMIQANLK-----FL----SS-DKVLKTVVVTS
A0A2H6LC24      ---LT--SEM----------------YRMIQANLK-----FL----SS-DKVLKTVVVTS
B2J6N5          ---LT--SEM----------------YRMIQANLK-----FL----SS-DKVLKTIVVTS
A0A367RMI4      ---LT--SEM----------------YRMIQANLK-----FL----SS-DNVLKTIVITS
A0A235HUM0      ---LT--SEM----------------YRMIQANLK-----FL----SS-DNLLKTIVITS
A0A2L2NW47      ---LT--SEM----------------YRMIQANLK-----FL----SS-DHLLKTIVITS
A0A1E2WUR1      ---LT--SEM----------------YRMIQANLK-----FL----SS-DKVLKTIVVTS
A0A235IKU3      ---LT--SEM----------------YRMIQANLK-----FL----SS-EKALKTIVVTS
A0A1U7MYU6      ---MV--SEV----------------YRMIQANLK-----FL----RS-DHPLKVIVVTS
A0A1D8TNX9      ---MV--SEV----------------YRMIQANLK-----FL----KS-DHPPKVIVVTS
A0A6P0L6C2      ---MV--SEV----------------YRMIQANIK-----FL----KS-DHPPKVIVVTS
A0A6P0MVH0      ---MV--SEV----------------YRMIQANLK-----FL----KS-DHPPKVIVVTS
A0A6P0KJV0      ---MV--SEV----------------YRMIQANLK-----FL----RS-DHPLKVIVVTS
A0A6L9ZJG4      ---MV--SEV----------------YRMIQANLK-----FL----RS-DHPLKVIVVTS
F4XKF3          ---MV--SEV----------------YRMIQANLK-----FL----RS-DHPLKVIVVTS
A0A1D9FX10      ---MV--SEV----------------YRMIQANLK-----FL----RS-DHPLKVIVVTS
A0A6P0Q0T0      ---MV--SEV----------------YRMIQANLK-----FL----RS-DHPLKVIVVTS
A0A6P0W5I0      ---MV--SEV----------------YRMIQANLK-----FL----RS-DHPLKVIVVTS
A0A3C0NJ41      ---PI--SEA----------------YRMLQANLK-----FL----SS-DKPLKVIVVTS
A0A352AG88      ---PI--SEA----------------YRMLQANLK-----FL----SS-DKTPRVIVVTS
A0A350Y374      ---AI--SEV----------------YRMLQANLK-----FL----SS-DKPPKVILVTS
A0A355DPX0      ---AI--SEV----------------YRMLQANLK-----FL----SS-DKPPQVILVTS
                                                                       . .::

K9SLA9          SIAKEGKSTFTANLAI-AAAQMGAKVLLIDADLRKPTQH-QLWQ--VPNSQGLSN-----
A0A168TT23      PGPGDGKTTNAINLAT-VLAQNGARVLLIDADLRKPRLH-RDFS--IQQAPGVTN-----
A0A0M1JWX9      AVAAEGKSTAAVNLAQ-AAATMGQRVLLVDGDLRRPQVH-AKLG--ILNRQGLSN-----
A0A2T1M1V6      ATRSEGKTTLTLGLAW-ALVQLGFRVLLVDADLRQAE---------MSRKLGYPQ-----
A0A2G7GCS2      PTSGEGKTTVTLGLAL-ALVNFGFRVLIVDGDLRQAE---------LSRRLGQLQ-----
K9XBH8          PTAGEGKTTMTLGLAL-ALVNCGFRVLMVDGDLRQAE---------LSRRLGHSK-----
A0A1Z4LJ30      ATTSEGKTTATLGLAN-ALINLGFKVLVVDGDFRKSE---------LSQSLGYQS-----
K9RI76          ANTEEGKTTTTIGLAN-ALLVLGFKVLLVDGDFRRGE---------LSESLGYQP-----
A0A352AE27      ATMGEGKTTVTLGLAT-ALVDLGFRVLLVDGDFRKAQ---------LSHRLGYAR-----
A0A3B8JH60      AIMGEGKTTVTLGLAT-ALADLGFRVLLVDGDFRKAE---------LSRRLGYGR-----
A0A3C0N766      AIMGEGKTTVTLGLAT-ALADLGFRVLLVDGDFRKAE---------LSRRLGYGR-----
K9W9J7          AIMGEGKTTVTLGLAR-ALADLGFRVLLVDGDFRKAE---------LSRRLGYGR-----
A0A139WSU3      ATQGEGKTTVAIGLAY-GLVDLGFRVLLVDGDFRSAE---------LSRSLGYAE-----
A0A433VN22      AIMGEGKTTVAIGLAN-ALVDLGFKVLLVDADFRQAA---------LSRRLGYTQ-----
Q7NF11          STAGEGKTTLTLGLAN-ALAEMGFRVLLVDADFRQAS---------LSRLLGHGP-----
A0A1Z4JCS8      AITGEGKTTVALQLAH-ALTELGFRVLLVDGDFRKAQ---------LSHQLGYLS-----
A0A6P0PI80      AMVSEGKTTVTLGLAT-ALVDLGFRVLVVDGDFRQAT---------LSQRLGHHH-----
A0A6P0WGT6      AMVSEGKTTVTLGLAT-ALVDLGFRVLVVDGDFRQAT---------LSQRLGHHH-----
F4XTX2          AMVSEGKTTVTLGLAT-ALVDLGFRVLVVDGDFRQAT---------LSQRLGHHH-----
Q7NJN6          ANTGEGKTTVTLGLAK-ALRELGFRVLVVDADFRQAG---------LGRKLQVGP-----
U5QCC3          STFGEGKTTVTLGLAR-ALRSLGFRVLVVDADFRQAG---------LGRLLQVNQ-----
A0A0S3TYD7      CIPSEGKSTVSANLAS-AFAQIGKRVLLIDADLRRPRQH-HVWSL-GTNDVGFSD-----
A0A2T1DNG3      TLAGEGKSTLSVGLAI-SAARLHQRVLLIDADLRRPNLH-KLLN--LPNEQGLST-----
A0A3S0Y9N9      AVPQEGKSTIAANLAF-SISQIGRKVLLVDADFRRPSQD-KIWN--IMNHAGLTN-----
A0A433UNK7      SVPKEGKSTIAANLAF-SISQLGRNILLVDADLRNPSQH-KIWE--IPNEVGLSN-----
A0A6P0ZKB8      AVPKEGKSTVAANLAY-SISQLGRNVLLVDADLRHPSQH-KIWE--IPNEVGLSN-----
U5QL42          SIPAEGKSIISYNLGL-VLSEFGKRVLVVDADMRKPNLH-RFLE--LPNSRGLST-----
A0A140K3H3      ATSAEGKTTVTYNLGI-VLAELGLNVLIIDADMRKPKIH-KLAK--LPNDEGLSE-----
K9XUB8          STSAEGKTTVTYNLGL-VLAELGLRVLIVDADMRKPKIH-KLAK--LANDEGLSE-----
A0A6H2NHD5      SVPGEGKSTICAHLAI-ASANMGRRVLLIDGDMRKPSQH-LMFE--VPNHLGLSD-----
A0A2P8W4F7      SVPGEGKSTICAHLAI-AAANMGRRVLLIDGDLRKPSQH-LIFG--QPNRQGLSD-----
A0A5Q4E0Z4      SVPGEGKSTMCAHLAI-AAANMGRRVLLIDGDLRKPSQH-LIFG--RRNGRGLSE-----
A0A2P8VVX1      ALPGEGKTTLTLGLAF-SLARMGQRVLVIDADLRRSGIQ-AGLG--LVAEQGLSG-----
A0A2P8WHY0      SLPSEGKTTVALGLAF-SLARMRQRVLVIDADLRRSGIA-TELG--LSTEGNLAN-----
A0A2T1CMT9      AVAGEGKSTLTLGLAL-SIARDRQKVLVIDADLRSPSLH-KSFA--LTNLSGLTN-----
A0A7G8J1V5      SLPAEGKSLVNVLLAK-TLSELGQRVLLVDADLRKPQMH-RRLG--LNNLSGLSN-----
A0A354B169      SLPREGKSLIIVLLAK-TLAEMGKKILVIDADMRRPQLH-QRLG--LNNLVGLSN-----
Q0IDT5          SLPAEGKSLVNVLLAK-TLAEMGQRVLLVDADLRKPQLH-IRLG--INNLQGLSN-----
A0A7G8FZD9      SLPEEGKSLVNTLLAK-TLAEMGQRVLLIDADLRKPQLH-TRLG--LNNLRGLSN-----
G4FMX5          SLPAEGKSLVNTLLAK-TLAEMGQRVLLIDADLRKPQLH-TRLG--LNNLRGLSN-----
A0A7G8FAU7      SLPAEGKSLVNVLLAK-TLSEMGQRVLLIDADLRKPQMH-TRLG--LNNLSGLSN-----
A3ZA21          SLPAEGKSLVNVLLAK-TLSEMGQRVLLIDADLRKPQMH-TRLG--LNNLSGLSN-----
A0A076HBF2      SLPAEGKSLVNVLLAK-TLSEMGQRILLIDADLRKPQMH-VRLG--LNNLSGLSN-----
A0A7G8FP50      SLPAEGKSLINVLLAK-TLSEMGQRVLLIDADLRKPQMH-VRLG--LNNLSGLSN-----
A0A7G8E8K7      SLPAEGKTLVNVLLAK-TLSEMGQRVLLIDADLRKPQMH-VRLG--LNNLSGLSN-----
A0A7G8GAH0      SLPAEGKSLVNVLLAK-TLSEMGQRVLLIDADLRKPQMH-VRLG--LNNLSGLSN-----
A0A7G8GNR2      SLPAEGKSLVNVLLAK-TLSEMGQRVLLIDADLRKPQMH-VRLG--LNNLSGLSN-----
A0A7G8ICD3      SLPAEGKSLVNVLLAK-TLSEMGQRVLLIDADLRKPQMD-VRLG--LNNLSGLSN-----
A0A2D6FCW3      SLPAEGKSLVNVLLAK-TLSEMGQKVLLIDADLRKPQLH-TRLG--LNNLRGLTN-----
A0A7G7KJ95      SLPTEGKSLVNSLLAK-TLSEMGQRVLLIDADMRKPQLH-TRLG--LNNLRGLSN-----
A0A7G8EAN3      SLPSEGKSLVISLLAK-TLSEMDQRVLLIDADMRKPQLH-TRLG--LNNLRGLSN-----
A0A563VQJ3      SVPGEGKSTITANLAA-AIAQLGRYVLLIDGDLRKPTQN-TLWK--APKTVGLQD-----
A0A1D8TX52      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNYEGLSTLLEDD
A0A1D9G4T2      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNQEGLST-----
A0A6P0PR27      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSHQEGLST-----
A0A6P0WER7      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSHQEGLST-----
F4XP71          ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSHQEGLST-----
A0A6L9YR57      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNYEGLST-----
A0A6P0KZ31      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNQEGLST-----
A0A6P0LPB8      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNQEGLST-----
A0A6P0SEV1      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNQEGLST-----
A0A6B3N2I8      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNQEGLST-----
A0A6M0B891      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNQEGLST-----
A0A6P0IJQ1      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNQEGLST-----
A0A6P0J8J8      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNQEGLST-----
A0A6P0ZSH6      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNQEGLST-----
A0A1U7N5X9      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNQEGLST-----
A0A6L9Z1V0      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNQEGLST-----
A0A6P0LC12      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LSNQEGLST-----
A0A6P0MVJ3      ALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-EQLG--LSNHEGLST-----
A0A2W6ZAV2      TVELEGKSTASALFAQ-TMADLGQRVLLVDADLRRPSLH-RLMS--VANGEGLSN-----
K9W742          AVAGEGKSTLALGLAI-SAARLHQRVLLIDADLRNPTLH-EKLN--LPNDYGLST-----
A0A3D1PBA3      AVAGEGKSTLALGLAL-SAARLHQRVLLIDADLRRPNLH-EMLS--LPNEQGLST-----
K9XPB0          AVAGEGKSTLVLGLAF-SIARHQKRVLVIDADLRCPSLH-EKLG--VENNSGLSD-----
A0A350Y7Z1      ALPSEGKSTLVVGLAF-SAARLHQRVLLIDADLRRPSLH-KQLN--LANEQGLAT-----
A0A352X2A7      ALSGEGKSTLVMGLAL-TAARLQQRVLLIDTDLRFPTLH-RQLN--LPNEEGLST-----
A0A0D8ZYV0      AVAGEGKSTLALGLAL-SAARLHQRVLLIDADLRRPNLH-QMLN--LPNEEGLST-----
A0A2T1FP73      AVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLH-QILN--LPNDYGLST-----
A0A433VMS2      AVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLH-QILN--LPNDYGLST-----
K9TYA7          AVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLH-QILN--LPNDYGLST-----
A0A2P8QUE1      AVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLH-QILN--LPNDYGLST-----
K9SA61          ALAGEGKSTLAMGLAM-SAARLHQRVLLIDADLRRPSLH-KQLN--LPNDRGLSS-----
A0A2G7GMH8      ALAGEGKTTLALGLAI-AAARLHQKVLLIDTDLRRPSLH-KQLE--LSNEQGLST-----
A0A6N8FU92      ALAGEGKTTLALGLAL-TAARLHQKVLLIDIDLRRPSLH-KQLA--LSNEQGLST-----
A0A2T1DWE8      ALAGEGKSTIALGLAI-SAARLHQRVLLVDADLRRPSLH-QQLD--LPNNYGLST-----
A0A1U7I8L3      ALAGEGKSAIALGLAI-SAARLHQRVLLIDADLRRPSLH-KELN--LPNDRGLST-----
A0A2T1DJL8      ALAGEGKSTIALGLAI-SAARLHQRVLIIDADLRRPGLH-KQLE--LPNEQGLST-----
A0A1Z4J9W0      ALAGEGKSTVALGLAI-SAARLHQRVLLIDADLRRPGLH-KQLQ--LPNDHGLST-----
A0A0N7Z5K9      ALAGEGKSTVALGLAI-SAARLHQRVLLIDADLRRPGLH-EQLQ--LPNEHGLST-----
A0A0S3TXC5      ALAGEGKSTVALGLAI-SAARLHQRVLLIDADLRRPGLH-HQLQ--LPNDHGLST-----
B8HNB0          TIPSEGKSTIVYNLGR-MLAELGQKVLIVDADTRNPTIH-QIIE--QPNLRGLTT-----
A0A563VS48      AVAQEGKSSVSANYAI-AQAQCGKRILLIDGDLRRSSQH-DLWQ--IPNQIGLTN-----
A0A318BJ18      TRPAEGKSTTALALAT-MLARAGKRTILVDGDMRSPSVH-QLGG--VDHDHGLSN-----
A0A3B8Y8H9      AIPEEGKSTVAAHLAQ-AAAKMGQKVLLVDGDLRLPQLH-HQPGLTSSNQYSLED-----
A0A2W1JVB9      GIPSEGKSTASANLAM-AMAELGQKVLLVDADLRRPVQH-RTWE--LLNRVGLSD-----
A0A3M1SVZ4      AIAKEGKSTIAANLAA-AISQVGRRVLLVDADLRRPLQH-EIWN--LGNEMGLGN-----
A0A6H1U102      STPSEGKSTLTYNLAR-SLAELGQRVLIVDADMRKPTIH-EFIK--QTNALGLSS-----
A0A7C3ZEJ3      STPSEGKSTLTYNLAR-VLAELGHRVLLVDADMRKPTVH-QMIK--QPNALGLSS-----
A0A563VLD6      STSSEGKSTTAYNLGL-ALTDLGSRVLIVDADMRKPKMH-KLTK--QSNEKGLTE-----
A0A2P8W9H0      AVPNSGKTTVSFHLAY-TMALLGYRTLVVDNDFRRPSLH-TLCH--LPNEKGLSN-----
A0A6I5P386      ATPNSGKSTVSFHLAH-TNATLGQKTLLVDMDLRRPTLH-KFCN--HANDKGLSN-----
A0A654SFI6      SVLAEGKSVSSLALAA-SFARLGKRTLLIDGDLRNSRLM-ALLGGEGADTAGLAA-----
A0A318BG22      AAMAEGKSTTSAALAQ-GVADRGKRVLLVDADLRKPTLH-HRFA--QTNQVGFSN-----
K9SSQ0          SIPSEGKSTIIYNLSL-TLAELGYKVLLVDADMRKPTIH-SLAG--VSNKLGLSQ-----
A0A2W1JIN9      AISGEGKSVVTSYLAA-VAAMLSRRTLIIDADLRRPTIH-KQFQ--LPNKSGLSD-----
A0A318AJV1      ALPGEGKSNTALAFAR-MLAVNGARVLLVDADLRNSKFP-GSMA--IGPGKGLIE-----
A0A6P0IC70      TVSGEGKSIVASHLAA-VSAMLSRQTLIIDADLRKPKQH-RILG--VTPLPGLTD-----
A0A6B3MUB5      TVSGEGKSIVASHLAA-VSAMLSRQTLIIDADLRKPKQH-RILG--VTPLPGLTD-----
A0A6M0B7N4      TVSGEGKSIVASHLAA-VSAMLSRQTLIIDADLRKPKQH-RILG--VTPLPGLTD-----
A0A6P0J9W3      TVSGEGKSIVASHLAA-VSAMLSRQTLIIDADLRKPKQH-RILG--VTPLPGLTD-----
A0A6P0ZWE1      TVSGEGKSIVASHLAA-VSAMLSRQTLIIDADLRKPKQH-RILG--VTPLPGLTD-----
A0A1U7N2U4      AVSGEGKSVVVSHLAA-VSARFSRRTLIIDADWRHPMQH-NLFG--LPPQPKVKD-----
A0A1D9G1F2      AVSGEGKSVVASHLGA-VSVRFSRRTLIIDADWRHPMQQ-DLFG--LSPQPKVTD-----
A0A6P0PNZ7      AVSGEGKSVVASHLGA-VSVRFSRRTLIIDADWRHPMQH-NLFG--LPPKPKVTD-----
F4XV38          AVSGEGKSVVASHLGA-VSVRFSRRTLIIDADWRHPMQH-NLFG--LPPKPKVTD-----
A0A6P0W137      AVSGEGKSVVASHLGA-VSVRFSRRTLIIDADWRHPMQH-NLFG--LPPKPKVTD-----
A0A6L9Y9E2      AVSGEGKSVVASHLAA-VSVRFSWRTLIIDADWRHPMQH-NLFG--LPPQPKVTD-----
A0A6P0SGR0      AVSGEGKSVVASHLAA-VSVRFSRRTLIIDADWRHPMQQ-NLFG--LPPQPKVTD-----
A0A6M0BK48      AVSGEGKSVVASHLAA-VSARFSRRTLIIDGDWRHPMQH-YFFG--LPPQPKVTD-----
A0A6L9YZL1      AVSGEGKSVVASHLAA-VSARFSRRTLIIDADWRHPMQH-NLFG--LPPQPKVTD-----
A0A6P0KYM4      AVSGEGKSVVASHLAA-VSVTFSRRTLIIDADWRHPMQQ-DLFG--LPPQPKVTD-----
A0A6P0LSD6      AVSGEGKSVVASHLAA-VSVTFSRRTLIIDADWRHPMQQ-DLFG--LPPQPKVTD-----
A0A6P0X384      TVSGEGKSVVVSHLAA-VSAMLSQRTLIIDADLRQPRQH-NFLA--VVPEPGLAD-----
A0A2P8QIL5      ALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQH-KLFK--LAAKPGLAE-----
A0A2T1FLY5      ALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQH-KLFK--LAAKPGLAE-----
A0A433W447      ALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQH-KLFK--LAAKPGLAE-----
K9U1K8          ALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQH-KLFK--LAAKPGLAE-----
K9UYB2          TISGEGKSIVTSHLGA-ISAMLSRRTLIIDADLRKPVQH-KLFN--LNPQPGIAE-----
A0A218QN17      TLSGEGKSIVASHLAA-ISAMLSRRTLIIDADLRRPMQH-TLFN--LAPTPGITD-----
K9RKN2          TISGEGKSVVVSHLAA-VSAMLSRKTLVIDADLRRPVQH-TLFN--LPPKPGITE-----
A0A2I8ADV2      TISGEGKSVVVSHLAA-VAAMLFRRTLIIDADLRRPVQH-TLFN--LPPKPGISD-----
A0A1W5CKM3      PLAGEGKSVIVSHLAA-VSAMLSRRTLIIDADLRKPSQH-TLFN--LPPRPGITD-----
A0A5Q0GMF5      PLAGEGKSVIVSHLAA-VSAMLSRRTLIIDADLRKPSQH-TLFN--LPPRPGITD-----
Q3MEW0          PLAGEGKSVIVSHLAA-VSAMLSRRTLIIDADLRKPSQH-TLFN--LPPRPGITD-----
A0A1Z4KIC7      PLSGEGKSVIVSHLAA-VAAMLSRRTLIIDADLRKPSQH-TLFN--LPPRPGITD-----
Q8YSM5          PLSGEGKSVIVSHLAA-VAAMLSRRTLIIDADLRKPSQH-TLFN--LPPRPGITD-----
A0A1Q4S1H4      ALSSEGKSVVVSHLAA-VAAMLSRRTLLIDADLRRPKLH-RAFN--LQAAPGLSD-----
A0A433VBU6      ALSGEGKSVVVSHLAA-VSAMLSRRTLLIDADLRRPKLH-RVFN--LQNAPGLSD-----
A0A1Q4RZJ6      TISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQH-TIFN--LPGKPGITD-----
A0A1Z4SNV3      TISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQH-TIFN--LPAKPGITD-----
A0A2H2XJQ1      TISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQH-TIFN--LPAKPGITD-----
A0A3S5K358      TISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQH-TIFN--LPGKPGISD-----
A0A0T7BPJ4      TISGEGKSVVASHLGA-VSAMLSRKTLIIDADLRRPEQH-RIFH--LEHKPGVAD-----
A0A0C1QS61      SIAGEGKSIVASHLAA-IAGMLSWRTLIIDADLRRPEQH-TLFN--LAGKPGVSD-----
A0A139X3R8      SIAGEGKSIVASHLAA-VAAMLSWRTLVIDADLRRPEQH-TLFN--LSGKPGVTD-----
A0A1Z4I7C5      PLSGEGKSVIVSHLAA-VCAMLSRRTLIIDADLRKPSQH-TLFN--LPPKPGITD-----
A0A0C2MDK7      TISGEGKSVVASHLAA-VVGMLSWRTLIIDADLRRPSQH-TLFN--LAPGPGITD-----
A0A1Y0RCK1      TISGEGKSVVASHLAA-VAAMLSWRTLVIDADLRKPVQH-TLFH--LAPKLGITD-----
A0A1Z4PWZ0      PISGEGKSVVASHLAA-VAAMLSWRTLIIDADLRRPVQH-TLFN--LTPKPGITD-----
A0A0C2QLT0      PISGEGKSVVASHLAA-VAAMLSWRTLIIDADLRRPVQH-TLFN--LTGKPGITD-----
A0A1Z4J2K1      PISGEGKSVVASHLAA-VAAMLSWRTLIIDADLRRPVQH-TLFN--LTPKPGITN-----
A0A3S0ZSX0      TISGEGKSVVASHLAA-VCAMLSRRTLLIDADLRRPAQH-TLFN--LAPQPGITD-----
A0A2N6K4T3      TITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPILH-TLFN--LAPQPGITD-----
A0A370CKT2      TITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LAPRPGITD-----
A0A0S3TL97      TITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LAPRPGITD-----
A0A2N6M8A0      TITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LAPRPGITD-----
A0A2N6M9E1      TITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LAPRPGITD-----
A0A2N6KJI4      TITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LAPRPGITD-----
A0A2N6MZ77      TITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LAPRPGITD-----
A0A2N6KT20      TITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LAPRPGITD-----
G6FSN3          TITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LAPRPGITD-----
A0A4D9CI02      TITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPMLH-TLFN--LAPQPGITD-----
A0A328I8B9      TITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPMLH-TLFN--LAPQPGITD-----
A0A4Q9J4Z7      TITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPMLH-TLFN--LAPQPGITD-----
A0A0M0SU69      TVTGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPVLH-TLFN--LVPQPGITD-----
A0A1Z4TIZ8      SITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPVLH-TLFN--LAPQPGITD-----
A0A2T1E9V8      SVPNEGKSTTCANLAA-VMAQLEHKVLIIDADFRHPSQH-LIWQ--ISNEEGLMN-----
A0A1Z4LN32      SVAGEGKTEVAANLAA-VMAQVGRRVLLVDADMRQPSQH-HLWG--LINSIGLSN-----
A0A2I8A9F5      SIAGEGKSEIAANLAA-VIAQTGRRVLLIDADMRRPSQH-HLWN--LINSAGLSN-----
A0A218Q6R8      SVPGEGKSEVSANLAA-VMAQVGRKVLLVDADMRQPSQH-HLWG--LLNSIGLSN-----
A0A218QGE0      SISGEGKTEVAANLAA-VMSLAGRRVLLVDADMRQPSQH-HLWG--LINSVGLSN-----
A0A3M2GQQ6      ATSGEGKSTLTYNLGR-VLSELGQRVLIVDADMRKPTVH-EFIK--QPNALGLSS-----
A0A6H1U2X0      ATSGEGKSTLTYNLGR-VLSELGQRVLIVDADMRKPTVH-EFIK--QPNALGLSS-----
K1XF69          SVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQH-HIWG--LTNAVGLSD-----
B5W297          SVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQH-HIWG--LTNAVGLSD-----
A0A6H2AL05      SVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQH-HIWG--LTNAVGLSD-----
H1W7M8          SVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQH-HIWG--LTNAVGLSD-----
A0A5Q4H6A5      SVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQH-HIWG--LTNAVGLSD-----
D5A466          SVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQH-HIWG--LTNAVGLSD-----
U5QJM6          SAPGEGKSTVSTNLAR-IAAELNRKVLIIDADLRRPTVA-KRLE--LTNSRGLSS-----
A0A1Z4RPC6      SVPGEGKSTIAANLAA-AMAQLGRKVLLIDGDLRKASQQ-DLWQ--VSNLMGVKD-----
A0A2T1CMZ0      SVPGEGKSLVAANLAA-AMAQLGRKVLLIDGDLRKASQH-DLWQ--ISNKVGVKD-----
L8M4F7          SVPGEGKSTVTANLAA-AISQLGSRVLLVDGDLRRPSQH-LLWN--RNSHQGIKE-----
A0A140K2P2      SVPEEGKSTVSANLAA-AIAQLGKRVLLIDGDLRKPSQH-RLWN--LENFVGLRD-----
K9XWX4          SVPEEGKSTVSANLAT-AIAQLGKRVLLIDGDLRKPSQH-HLWN--LDNFVGLKD-----
A0A140KB14      SVPGEGKSTVAANLAA-AIAQLGRRVLLIDGDLRRATQH-HLWS--MSNHLGFKD-----
K9XX88          SVPGEGKSTIAANLAT-AIAQLGRRVLLIDGDLRRANQH-HLWN--MSNHLGLKD-----
A0A563VSV6      SAPGEGKSTVTANLAA-AIAQLGRRVLLIDGDLRKSSQH-QLWG--VSNQVGIKD-----
L8LZE9          SIPGEGKSTVTANLAA-AISQLGRKVLLIDGDLRKASQH-QLWG--VSNQKGVKE-----
A0A433NM31      AVPKEGKSTVSANLAL-AIAQLGFKVLLVDADMRSPSQH-QFWE--LGNNKGLSN-----
A0A1Z4NDS1      SVSGEGKSEVSANLAV-TVAQLGRRVLLIDADMRCPIQH-HIWG--LNNTIGLSN-----
U9VXM0          AVGGEGKSEVAANLAL-TLAHLGHMVLVVDADMRKPTQH-LIWD--LPNLQGLSN-----
A0A6M0RI13      AVGGEGKSEVAANLAL-TLAHLGHTVLLVDADLRKPTQH-HIWD--LPNVQGLSN-----
A0A6M0S1N5      AVGGEGKSEVAANLAL-TLAHLGHTVLLVDADLRKPTQH-HIWD--LPNVQGLSN-----
K9F4D9          AVGGEGKSEVAANLAL-TLAHLGHTVLLVDADLRKPTQH-HIWD--LPNVQGLSN-----
A0A6I5QPI5      AVPGEGKSEIAANLAA-ALAQVGRRVLLIDADMRYPRQH-HALK--VLNRVGLSH-----
A0A1Z3HMQ0      SVPQEGKSEVAANLAA-TIAQTGKQVLLVDADMRSPWQH-HLWN--VVNQIGLSH-----
A0A433W533      SVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQH-HIWE--KANTEGLSD-----
A0A2P8QWJ3      SVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQH-HIWE--KANTEGLSD-----
A0A2T1FKP8      SVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQH-HIWE--KANTEGLSD-----
K9U6L7          SVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQH-HIWE--KANTEGLSD-----
A0A1E5QP61      AVSQEGKSTVAANLAV-ATAQLGRRVLLIDGDMRHSTQH-QIWN--LTNVAGLSD-----
U5DPF5          SIPREGKSTVSANLGV-ALAELGNRVLVIDADMRRPSQH-QVWE--LANTTGLSN-----
A0A6P0X488      SVSKEGKSTVSANLAI-AMAQLGRRVLLIDADLRHPLQH-HIWG--LVNTQGLSE-----
A0A6P0UVD5      SVSKEGKSTVSANLAI-AMAQLGRRVLLIDADLRHPLQH-HIWG--LVNTQGLSE-----
A0A6P0VDM0      SVSKEGKSTVSANLAI-AMAQLGRRVLLIDADLRHPLQH-HIWG--LVNTQGLSE-----
A0A6M0G142      SVSKEGKSTVSANLAI-AMAQLGRRVLLIDADLRHPLQH-HIWG--LVNTEGLSE-----
A0A6P0MR53      SVSKEGKSTVSANLAI-AMAQLGRRVLLIDADLRHPLQH-HIWG--LVNTQGLSE-----
A0A3M2GIL5      SMAKEGKSAVAANLAL-AIAQLGRRVLLIDADLRHPIQH-HIWD--LTNIAGLSD-----
A0A6H1TSJ9      SMAKEGKSAVAANLAL-AIAQLGRRVLLIDADLRHPIQH-HIWD--LTNIAGLSD-----
A0A3M1PML8      SVAQEGKSEIAANLAA-TMAQLGRKVLLVDADLRRPAQH-HTWN--LVNAAGLTN-----
A0A6M8BE85      SVAQEGKSEIAANLAA-TLAQLGRKVLLVDADLRRPAQH-HTWN--LVNAAGLSN-----
A0A0T7BPZ0      SIPKEGKSEVSANLAV-AMAQVGRKVLLIDADMRHPIQH-HIWG--ITNAKGLSN-----
A0A352X442      SVPQEGKSEVSANLAA-AIAQVGRRVLLVDADMRHPSQH-HLWN--LTNAVGLSN-----
A0A6B3NF44      SVPKEGKSEVCANLAA-AMAQIGRRVLLVDGDMRHPSQH-HIWG--LTNAVGLSN-----
A0A6M0EPL4      SVPKEGKSEVCANLAA-AMAQVGRRVLLVDGDMRHPSQH-HIWG--LTNAVGLSN-----
A0A6P0K6L6      SVPKEGKSEVCANLAA-AMAQIGRRVLLVDGDMRHPSQH-HIWG--LTNAVGLSN-----
A0A6P0MRR9      SVPKEGKSDVCANLAA-AMAQVGRRVLLVDGDMREPSQH-HIWQ--LTNAVGLSN-----
A0A6P0UX57      SVPQEGKSDVCANLAA-AMAQVGRRVLLIDGDMREPSQH-HIWQ--LTNAVGLSN-----
A0A6P0X1X4      SVPKEGKSDVCANLAA-AMAQVGRRVLLIDGDMREPSQH-HIWQ--LTNAVGLSN-----
A0A0M0SHU3      SIPKEGKSEVSANLAV-AMAEVERRVLLVDADMRHPIQH-HIWQ--LSNKRGLSN-----
A0A1D2PBN3      SVAKEGKSEVAVNLAV-AMAQVGRRVLLVDADMRHPVQH-HVWG--MTNAVGLSN-----
A0A0C2LVR7      SVAKEGKSEVAVNLAV-AMAQVGRRVLLVDADMRHPVQH-HVWG--MTNAVGLSN-----
A0A1Z4PQB9      SVPKEGKSEVAANLAV-AMAQVGRRVLLVDADMRHPVQH-HVWG--MTNAVGLSN-----
A0A1Z4SFN6      CVSKEGKSEVAANLAV-AMAQLGHRVLLVDADMRRPVQH-HIWG--MTNAVGLSN-----
K9PGI8          SVAKEGKSEVAANLAV-AIAQLGRRVLLVDADMRHPVQH-HIWG--MTNAVGLSN-----
K9TLQ0          TLPAEGKTTISMKLAE-AASAMGNRVLLVDADLRRPQID-QRMD--LPNVWGLSN-----
K9QF04          ALPGEGKSTIAVYLAQ-VAASMGKRVLLIDADLRRPTIHTRVHS--LTNVWGLSN-----
K9W1T3          SVPKEGKSTTAANLAV-AISQLGQRVLLIDADMRKPSQH-KIWQ--LPNETGLST-----
K9SGJ5          AVPSEGKSTLVFNLAS-ILAELGHKVLVVDADMRKPNVH-HLAK--LRNNYGLST-----
A0A6N2JS94      SVPSEGKSTMTYNLAI-ILSALGYRILLVDADMRKPTVH-KLAG--LSNKVGLST-----
A0A6C2DSN4      SVPSEGKSTLTYNLAM-ILSSLGYRILLVDADLRKPTVH-KLAR--LSNKFGLST-----
L8MYT6          SVPSEGKSTLTYNLAM-ILSSLGYRILLVDADLRKPTVH-KLAR--LSNKFGLST-----
A0A352JGJ6      SVPSEGKSTLTYNLAT-ILAALGYKVLLVDADMRKPTVH-KLSK--LSNKFGLST-----
A0A1J5GLS2      SVPSEGKSTLTYNLST-ILAVLGYRVLLVDADMRKPTIH-KLSK--LPNKVGLST-----
A0A2W4W6M5      SVPSEGKSTLTYNLAT-ILAALGYKVLLVDADMRKPTVH-KLTK--LSNKVGLST-----
A0A2W7AN33      SVPSEGKSTLTYNLAV-ILSSLGYRVLLVDADMRKPTIH-KLAG--LSNKVGLSM-----
A0A256BLV2      SVPSEGKSTLTYNLAT-ILSALGYRVLLVDADMRKPSIH-KLAG--LSNKVGLST-----
A0A2W6ZXF3      SVPSEGKSTLTYNLST-ILAALGYRVLLVDADMRKPTVH-KLSK--LPNKVGLST-----
A0A2Z5WX66      SVPSEGKSTLTYNLST-ILAALGYKVLLVDADMRKPTVH-KLTN--LSNKSGLST-----
Q7NEU3          SMPGEGKSTVATNLAK-VVGGLNRKALLVDADLRRPTVS-NKLE--LSNGPGLST-----
A0A3C0N2P0      ATPGDGKSTITTFLAQ-AAAAMGQRVLLVDADLRRPRIH-ETTD--LPNVWGLSN-----
A0A6P0JR04      SVPLEGKSTTSANLAQ-AAAAMGQRVLLVDADLRRPQIH-AMTD--LPNVWGLSH-----
A0A6B3M6M6      TVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVH-LRMD--LPNVWGLSN-----
A0A6P0KD09      TVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVH-ERMD--LPNVWGLSN-----
A0A6B3NIJ0      TVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVH-ERMD--LPNVWGLSN-----
A0A6M0F053      TVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVH-ERMD--LPNVWGLSN-----
A0A6P2ATU9      SVPLEGKSTTSIHLAQ-TAASMGQRVLLVDADLRRPQVH-VVAD--LPNVWGLSH-----
A0A352XE00      AVPADGKSTTSMFLAQ-AAAAMGEKVLLVDADLRRPQIH-VRMN--LLNMWGLSN-----
A0A6P0QC14      SVPADGKSTVAIYLAQ-AAAAMGQRVLLVDADLRRPQVH-VRTD--LPNVWGLSN-----
B4VS56          AVPADGKSTIATFMAQ-AAAAMGQRVLLVDADLRRPQLH-VRTD--LPNVWGLSH-----
A0A352AAQ3      AVPADGKSTTSAFLAQ-AAAAMGERVLLVDADLRRPQVH-VKTD--LPNVWGLSN-----
A0A350Y472      AVPADGKSTVAAFLSQ-AAAAMGERVLLVDADLRRPQVH-VKTD--LPNVWGLSN-----
A0A355DVB4      AVPADGKSTVAAFLAQ-AAAAMGERVLLVDADLRRPQVH-VKTD--LPNVWGLSN-----
A0A1Z4RMB9      SVPEEGKSTVVANLAA-AIAQLGRSVLLIDADLRRSSQH-TLWG--VDNNLGLKD-----
A0A318B4H2      SRPNEGKSLSAYALSR-LFAETGASVVLIDADMRNTRLD-DLVA--LDARPGLSN-----
B4WQE3          AVPNEGKSTISFYLAH-ASASLGKRTLLVDADLRHPTLH-RLCN--LPNEKGLSD-----
A0A2K3BR24      SIPNEGKSTVSANLGM-ALAELGHRVLIIDADLRRPSQH-QVWE--EPNAVGLSN-----
K9YXY1          SIPSEGKSTISANLGM-ALAELGNKVLIIDGDLRRPSQH-QVWE--EPNAVGLSN-----
A0A1Q4RTR1      AIPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSSQH-EVWK--VENSQGLNE-----
A0A1Z4SQV2      AVPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSRQH-EIWK--VENSQGLNE-----
A0A2H2XGN1      AVPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSRQH-EIWK--VENSQGLNE-----
A0A433UXH8      AIPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSNQH-QIWK--VENSQGLNE-----
A0A0V7ZFJ4      SNPNEGKSFVSANLAV-TLSQLGRKVLLVDADMRRPRQH-RIWR--RPNLIGLSN-----
A0A0V7ZNJ9      SVPGEGKSLVSANLAV-TISQFGQRVLLIDGDMRRPRQH-KLWK--IHSFSGLSN-----
A0A367RIS1      SVMNEGKSFVAANLAV-ATAQMGKRVLLIDADMRRPRQH-EIWQ--KPNLMGLSN-----
A0A235IXQ2      SVINEGKSFIAANLAV-ATAQMGRRVLLIDADMRHPHQH-KMWQ--QPNLMGLSN-----
A0A1W5CNX3      CVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQH-EMWQ--QPNLMGLSN-----
A0A5Q0GJJ5      CVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQH-EMWQ--QPNLMGLSN-----
Q3MEB7          CVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQH-EMWQ--QPNLMGLSN-----
A0A1Z4KHN9      CVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQH-EMWQ--QPNLMGLSN-----
Q8YT70          CVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQH-EMWQ--QPNLMGLSN-----
A0A166IWU6      CLPGEGKSFVAANLAV-ATAQMGRRVLLIDADMRRPRQQ-ELWQ--VRNLMGLSN-----
A0A2S0Q8C0      CLPGEGKSFVAANLAV-ATAQMGRRVLLIDADMRRPRQQ-EVWQ--VRNLMGLSN-----
W6FSX4          CLPGEGKSFVAANLSV-ATAQMGRRVLLIDADMRRPRQR-EVWQ--VRNLMGLSN-----
A0A218Q4C1      CLPGEGKSFITANLAV-ATAQMGQRVLLIDADMRRPSQQ-EVWQ--VRNLIGLSN-----
A0A6P1ZT04      CLPGEGKSFVTANLAV-ATAQMGRRVLLIDADMRRPRQQ-EVWQ--VRNLMGLSN-----
A0A5P8VSD1      SVMNEGKSFIAANLAI-ATAQMGKRVLLIDADMRRPRQH-EMWQ--QPNLMGLSN-----
A0A1S1ZVW2      SSPAEGKSFVSANLAL-AASHLGKRVLIVDADLRRPRQH-KVWG--LPNFVGLSN-----
A0A0R0M9H9      SSPSEGKSFVSANLAL-AASHLGKRVLIVDADLRRPRQH-KVWG--LPNFVGLSN-----
A0A7H0F4U6      SSPGEGKSFVSANLAL-AASHLGKRVLIVDGDLRRPRQH-KVWG--LPNFVGLSN-----
A0A1B7WX82      STAGEGKSFVAANLAL-AAAHVGRRVLLVDADMRRPRQQ-RIWE--TPNLLGLSN-----
A0A1B7WTD1      STSGEGKSFVAGNLAV-AASHVGKRVLLIDCDMRRPRQH-RIWE--IPNLLGMSN-----
A0A480ABC0      TTSGEGKSFVAANLAV-AASHVGKRVLLIDCDMRRPRQH-RIWE--IPNLLGLSN-----
A0A1Z4LRU5      SIPGEGKSFVSSNLAV-AMAQLGRRVLLIDADMRRPTQQ-NIWD--LPNMIGLSN-----
A0A1Z4JVB4      AVPGEGKSFIAANLAT-ATAQLGKKVLLLDADMRRSRQH-KIWQ--QSHLMGLSN-----
K9PIA4          SIPGEGKSFVTANLAV-AIAQLGRRVLLIDADMRRPRQH-KIWE--QSNLIGLSN-----
A0A1Z4HVE1      SIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQH-KIWE--QSNLIGLSN-----
A0A252ECZ1      SVPGEGKSFVAANLAV-AAAQIGHRVLLVDADMRRPRQH-KIWE--QSNLIGLSN-----
A0A1Z4G5Y1      SIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQH-KVWE--QSNLIGLSN-----
A0A252DNA2      SIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQH-KVWE--QSNLIGLSN-----
A0A252E1Q4      SIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQH-KVWE--QSNLIGLSN-----
A0A6G9SK36      SIPGEGKSFVAANLAV-AVAQLGRRVLLVDGDMRRPRQH-KIWE--QNNLVGLSN-----
A0A1Z4M597      SIPGEGKSFVAANLAV-AVAQLGRRVLLVDADMRRPRQH-KIWE--QNNLVGLSN-----
A0A1Z4MWT1      SIPGEGKSFVAANLAV-AVAQLGRRVLLVDADMRRPRQH-KIWE--QNNLVGLSN-----
A0A1Z4TX53      SIPGEGKSFVAANLAV-AVAQLGRRVLLVD