BYKdb

Dataset for cluster tadcd of phylum cyanobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

392 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K9SLA9          --------------------------------------------------------MNKL
A0A168TT23      -------------------MSNYGIHDGRHLKPIEDQNTALAQYDPYQSKANEDDDAIDL
A0A0M1JWX9      --------------------MQTAPNSQPSSFDQNGKQPQIVPLSYLAEVPDADEEELDL
A0A2T1M1V6      -----------------------------------------------------------M
A0A2G7GCS2      -----------------------------------------------------------M
K9XBH8          -----------------------------------------------------------M
A0A1Z4LJ30      -----------------------------------------------------------M
K9RI76          -----------------------------------------------------------M
A0A352AE27      ----------------------------------------------------------ML
A0A3B8JH60      -----------------------------------------------------------M
A0A3C0N766      -----------------------------------------------------------M
K9W9J7          -----------------------------------------------------------M
A0A139WSU3      -----------------------------------------------------------M
A0A433VN22      ------------------------------------------------------------
Q7NF11          ------------------------------------------------------------
A0A1Z4JCS8      -----------------------------------------------------------M
F4XTX2          -----------------------------------------------------------M
Q7NJN6          -----------------------------------------------------------M
U5QCC3          ------------------------------------------------------------
A0A3S0Y9N9      -------------------------------------------------------MEEYL
A0A433UNK7      -------------------------------------------------------MEEYL
A0A3M1SVZ4      -------------------------------------------------------MESGG
A0A654SFI6      -------------------------------------MQPSIADRGNYPDTPADYREDGL
K9SSQ0          ---------------------------------------------------MKVYSSKVF
A0A2W1JIN9      -------------------------------------------------------MDQSL
A0A318AJV1      ----------------------------------MLKQTSDHRVSHLAPPQDQARLGDAV
A0A1U7N2U4      -------------------------------------------------------METSL
A0A1D9G1F2      -------------------------------------------------------MDTSL
F4XV38          -------------------------------------------------------MDTSL
A0A2P8QIL5      -------------------------------------------------------MEQKY
A0A2T1FLY5      -------------------------------------------------------MEQKY
A0A433W447      -------------------------------------------------------MEQKY
K9U1K8          -------------------------------------------------------MEQKY
A0A4V6P809      -------------------------------------------------------MEQKY
K9UYB2          -------------------------------------------------------MEKSI
A0A218QN17      -------------------------------------------------------MEKGI
K9RKN2          -------------------------------------------------------MEKGI
A0A2I8ADV2      -------------------------------------------------------MGRGI
A0A1W5CKM3      -------------------------------------------------------MGKGI
A0A5Q0GMF5      -------------------------------------------------------MGKGI
Q3MEW0          -------------------------------------------------------MGKGI
A0A1Z4KIC7      -------------------------------------------------------MGKGI
Q8YSM5          -------------------------------------------------------MGKGI
A0A1Q4S1H4      -------------------------------------------------------MEKGV
A0A433VBU6      -------------------------------------------------------MEKGV
A0A1Q4RZJ6      -------------------------------------------------------MEKGF
A0A1Z4SNV3      -------------------------------------------------------MEKGF
A0A2H2XJQ1      -------------------------------------------------------MEKGF
A0A3S5K358      -------------------------------------------------------MEKGF
A0A0T7BPJ4      -------------------------------------------------------MAKGI
A0A0C1QS61      -------------------------------------------------------MEKSV
A0A139X3R8      -------------------------------------------------------MEKSV
A0A1Z4I7C5      -------------------------------------------------------MGKGI
A0A0C2MDK7      -------------------------------------------------------MEKGI
A0A1Y0RCK1      -------------------------------------------------------MEKRI
A0A1Z4PWZ0      -------------------------------------------------------MEKGI
A0A0C2QLT0      -------------------------------------------------------MEKGI
A0A1Z4J2K1      -------------------------------------------------------MEKGI
A0A3S0ZSX0      -------------------------------------------------------MEKGF
A0A2N6K4T3      -------------------------------------------------------MEKGL
A0A370CKT2      -------------------------------------------------------MEKGL
A0A0S3TL97      -------------------------------------------------------MEKGL
A0A2N6M8A0      -------------------------------------------------------MEKGL
A0A2N6M9E1      -------------------------------------------------------MEKGL
A0A2N6KJI4      -------------------------------------------------------MEKGL
A0A2N6MZ77      -------------------------------------------------------MEKGL
A0A2N6KT20      -------------------------------------------------------MEKGL
G6FSN3          -------------------------------------------------------MEKGL
A0A4D9CI02      -------------------------------------------------------MEKGL
A0A328I8B9      ------------------------------------------------------------
A0A4Q9J4Z7      -------------------------------------------------------MEKGL
A0A0M0SU69      -------------------------------------------------------MEKGL
A0A1Z4TIZ8      -------------------------------------------------------MEKGL
A0A0S3TYD7      ----------------------------------------MKQPQNPSQTPASDAIELDL
U5QL42          -------------------------------------------MVNPQASLGPPSDNFNL
K9QF04          ----------------------------------MTQNVENLTLFKPQALPKPQSDPWEL
A0A3C0N2P0      --------------------MGPDGDYQPLLPNGNGKQLSQLSTLNAAEFSVLNEDKFDL
K9TLQ0          ------------------MDIDGNSPPFFQQLNGPFPSGQTPLPSTILPPLNDDADALNL
A0A076HBF2      ----------------MSNLVAAPGQSPDFDARNVQTVRVHEVGT---NEPIGTEDEIDL
A0A354B169      ------------------------------------------------MGAMGVAEEIDL
G4FMX5          ----------------MSNLSAQP--NPQAVDGLLQ---------------VDGSDEIDL
Q0IDT5          ----------------MSNLIARPGQSPDLVPQTIQDVQVRDLGLNLSNLKAEASDEIDL
A0A2D6FCW3      ----------------MSNLIVNPXQTPDFNRHQAQTVNVQDLGRXVVQA-ADNNDEIDX
A3ZA21          ----------------MSNLIPRAGHSPNLAVQGIQTVQVRDLGTSVAAGPAAADDEIDL
A0A140K3H3      ------------------------------------MNNQLVNPNSLYLPTPETESAFSL
K9XUB8          ------------------------------------MNNQLVNSNTLYLPTPETESTFSL
Q7NEU3          ------------------------------------MTKQPFADPVDKPAQVVEESSFDW
A0A352XE00      --------------------MNLNGDGKVLSINGNAQQSLEVPGINSKNVADIPNHQVDM
B4VS56          --------------------MGSNGEYQPLPPNRNGHLPSELSSLSLYELVETEDDKLDL
A0A352AAQ3      --------------------MALTGDYQPLLPTSNGKQLSELMPIYTNGFSEIQEDKLDL
A0A350Y472      --------------------MGPKVDYQPLLVNANDKPSSVSPPIYPSGFSLVEEEKLDL
A0A355DVB4      --------------------MGPKVDYQPLLVNANDKPSSVSPPIYPSGFSLVEEEKLDL
A0A2P8VVX1      -------------------------------------------MVSTSTLPTSTDQEFGY
A0A2P8WHY0      -------------------------------------------MTHAAYQPIPDEPEFGY
A0A2T1CMT9      --------------------------------------------MDQNNWETETQGDLGY
A0A563VQJ3      ----------------------------MTNNGFNYYPPKELESNYYNLPKSRENLDLDL
A0A1D8TX52      --------------------------------------------MKELDLNAAAETDAGY
A0A1U7N5X9      --------------------------------------------MKELDLNAAAETDAGY
A0A1D9G4T2      --------------------------------------------MKELDLNAAGETDAGY
F4XP71          --------------------------------------------MKELDLNAAGETDAGY
A0A2P8QVH5      ----------------------------------MADTSLDNERLSVEHRVENRANATDL
A0A2T1FT70      ----------------------------------MADTSLDNERLSVEHRVENRANATDL
A0A433W4W4      ----------------------------------MADTSLDNERLSVEHRVENRANATDL
K9U5W1          ----------------------------------MADTSLDNERLSVEHRVENRANATDL
A0A2W6ZAV2      ------------MPDPLPSPDELLPPGTLVTLGASSGQVVLIPQEAETQPAPGGSEELKL
A0A2G7GMH8      --------------------------------------------MNKDNFAMATEQEAGY
K9W742          --------------------------------------------MTQSNLNTVPDTDPGY
A0A2T1DWE8      -----------------------------------------MVVVTVGNLANTVETDPGY
A0A1U7I8L3      --------------------------------------MVNVNTNNLNPAA---ETEAGY
A0A2T1DJL8      MPSVASQKASFSSRSIASFRRFVWHRSDELSFAKGVPIVAESHLNLIAAA----DPDPGY
A0A1Z4J9W0      --------------------------------------MAQSNITLFNASPHAQEPDPGY
A0A0N7Z5K9      --------------------------------------MAQGNITLFNPSPPAQEPDPGY
A0A0S3TXC5      ------------------------------------MIVAQGNITLFNPSSPMQEPDPGY
K9SA61          ---------------------------MALVPHTPGNFAPHRSPVTDPRWTDSGDSDGGY
A0A3D1PBA3      ----------------------------------------MARVNEHNLPI-NTETDGGY
K9XPB0          ----------------------------------------MKQIEWE-----ENSSDLGY
A0A350Y7Z1      -------------------------------------------MIQSNLP--GDETNLGY
A0A352X2A7      -------------------------------------------MTQSNLP--ETESDFGY
A0A0D8ZYV0      ----------------------------------------MVRGIENN-PNVANETEPGY
A0A4R4IUM6      ----------------------------------------MVRVNESNMPMIVEESDGGY
A0A2T1FP73      ----------------------------------------MVRVNESNMPMTVEESDGGY
A0A433VMS2      ----------------------------------------MVRVNESNMPMTVEESDGGY
K9TYA7          ----------------------------------------MVRVNESNMPMTVEESDGGY
A0A2P8QUE1      ----------------------------------------MVRVNESNMPMTVEESDGGY
A0A2T1DNG3      ------------------------------------------MTAAQPKLNLSAATDPGY
A0A2P8W9H0      -----------------------------------MASELQLSSKGALHPEGDQEGGLRL
A0A1Z4LN32      ------------------------------------------------MENQNLSEEIDV
A0A2I8A9F5      ------------------------------------------------METQNSAEDIDI
A0A218Q6R8      ------------------------------------------------METKNYPDEIDI
A0A218QGE0      ------------------------------------------------MDTKNYPEEIDV
B8HNB0          ----------------------------------MVQFNAERWLQNQQLLNELYFSASDK
A0A563VS48      --------------------------------------------MNTIEQNVHIDEYLDF
A0A318BJ18      ---------------------------MSFISSNLGSPGAIGSAQSAIASPTIADGPSVL
A0A3B8Y8H9      ----------------------MTDLPNNSLAVNSPQPQVNQTIQSQLREQNEEDISLSV
A0A2W1JVB9      ----------------------------------------------MPAEYQLEEEVIDL
A0A1Z3HMQ0      ---------------------------------------------MDGKTYQDYVEEIDL
A0A1E5QP61      ------------------------------------------------MDSTDYTEGIDF
A0A3M2GIL5      ------------------------------------------------MENQIYTEDIDF
A0A433NM31      ------------------------------------------------MQSNKQEEYIDL
A0A3M1PML8      ----------------------------------------------MSLVSQDYSEEIDF
A0A352X442      ------------------------------------------------MESTEYIEEIDF
A0A0T7BPZ0      ------------------------------------------------MSNPEHIEEIDL
A0A0M0SHU3      ----------------------------------------------MKESEFKEVEEIDF
A0A1D2PBN3      ------------------------------------------------MESKPNFEEIDF
A0A0C2LVR7      ------------------------------------------------MESKPNFEEIDF
A0A1Z4PQB9      ------------------------------------------------MESKPNFEEIDF
A0A1Z4SFN6      ------------------------------------------------MESKQNLEEVDF
K9PGI8          ------------------------------------------------MESIPKFEEIDF
A0A563VLD6      --------------------------------------MNNPINNPEFVQLPSQETGFSL
A0A318BG22      --------------------MIRSLTNDTRPGPIDDLQSRRGAMRPAAEVEQWDGGSISL
A0A2T1E9V8      ---------------------------------------------------MEAPENIQF
A0A3M2GQQ6      -----------------------------------------MQNAIAINPIQDYKNDTDF
K9SGJ5          -------------------------------------------MPEYSLNPGQPEESIDL
L8MYT6          ----------------------------------------MTAYPKATYVGKYVDDSFKL
A0A352JGJ6      ----------------------------------------MTEYPKATYAGKYVDDSFKL
A0A1J5GLS2      ----------------------------------------MTEYPKANYVGKYVDDSFKL
A0A2W4W6M5      ----------------------------------------MSEYPKAISTGKYVDDSFKL
A0A2W7AN33      ----------------------------------------MPAYPKATYVGKYVDNSFKF
A0A256BLV2      ----------------------------------------MTEYPKATYVGKYVDDSFKL
A0A2W6ZXF3      ----------------------------------------MTEYPKANYVGRYVDDSFKL
A0A2Z5WX66      ----------------------------------------MTEYPKANYAGKYIDDSFKL
K9W1T3          --------------------------------------------------------MDEF
A0A1Q4RTR1      -----------------------------------------------MSALNTENDSINF
A0A1Z4SQV2      ------------------------------------------------MQVNAENDSINF
A0A2H2XGN1      ------------------------------------------------MQVNAENDSINF
A0A433UXH8      ------------------------------------------------MAVNTENDSINF
A0A1Z4RMB9      -----------------------------MLSNNSNEQNTNSAYPSIAPKRDSLD--VNF
K1XF69          ----------------------------------------MVMDFSNIEHRESID--LDL
B5W297          ------------------------------------------MDFSNIEHRESID--LDL
H1W7M8          ----------------------------------------MVMDFSNIEHRESID--LDL
A0A5Q4H6A5      ----------------------------------------MVMDFSNIEHRESID--LDL
D5A466          ------------------------------------------MDFSNIEHRESID--LDL
B4WP72          ------------------------------------------------MRDKEYTEEIDL
A0A318B4H2      -------------------MNTNLTYEEAPFDPSAASVVTPVAVDKPAGQRLDERAVSAL
B4WQE3          ------------------------------------MSSANPPVLRDIIQEPDQEGGLRL
A0A2P8W4F7      ------------MPFPPSSTPRETNGHSNGHGNGHGSGRPEFVPMMAPPSLVEKGDDVDL
A0A5Q4E0Z4      ------------MPFSSTPTSEETNGNGNGH------AKHSFVPVSAPSAIVDDSDDFDL
A0A2K3BR24      -----------------------------------------------MPTTTDQEDYIDL
K9YXY1          ---------------------------------MDHQEQLPASSVNPIPTTTDQEDYIDL
U5QJM6          ------------------------------------------------------------
K9SX01          ------------------------------------------------MNQSPAEDKNPL
A0A4P7ZT55      -------------------------------------------------MPAVPDGEINL
A0A1E5QIR9      ------------------------------------------------MTHLEDSDAIDL
A0A1Z4IBC7      ----------------------------------------------MTMESLRSIEEVDI
A0A1W5CPC7      ----------------------------------------------MTMDSLQGFEEVDI
A0A5Q0GKD1      ----------------------------------------------MTMDSLQGFEEVDI
Q3MDC6          ----------------------------------------------MTMDSLQGFEEVDI
A0A1Z4KM73      ----------------------------------------------MTMDSLQGFEEVDI
Q8YNX7          ----------------------------------------------MTMDSLQGFEEVDI
A0A367R4K6      ----------------------------------------------MTMESLPNVEEVNI
A0A1E2WSV8      ----------------------------------------------MTMESLPNFEEVNI
A0A2R5FRT9      ----------------------------------------------MTMESLPHVEEVNI
A0A2K8T1B6      ----------------------------------------------MTMESLPQFEEVNI
A0A235I9I0      ----------------------------------------------MTMESLPNFEEVNI
A0A2D0HQT8      ----------------------------------------------MTMESLPNFEEVNI
A0A2L2NU95      ----------------------------------------------MTMESLPSFEEVNI
A0A367S084      ----------------------------------------------MTMESLPNFEEVNI
A0A0V7ZFJ4      -----------------------------------------MTHNSFDFNQEDDD-FIDL
A0A367RIS1      ----------------------------------------------MPSHQDDQD-LINF
A0A235IXQ2      ----------------------------------------------MLSDQNNQD-LINF
A0A1W5CNX3      ----------------------------------------------MPSHQDDQD-LINF
A0A5Q0GJJ5      ----------------------------------------------MPSHQDDQD-LINF
Q3MEB7          ----------------------------------------------MPSHQDDQD-LINF
A0A1Z4KHN9      ----------------------------------------------MPSQQDDQD-LINF
Q8YT70          ----------------------------------------------MPSQQDDQD-LINF
A0A218Q4C1      ----------------------------------------------MPSYQEDQD-EINL
A0A166IWU6      ----------------------------------------------MPSYQEDQD-EIDL
A0A2S0Q8C0      ----------------------------------------------MPSYQEDQD-EIDL
W6FSX4          ----------------------------------------------MPSYQEDQD-EIDL
A0A0V7ZNJ9      ------------------------------------------MTSSPQVEREDTD-YIDL
A0A0R0M9H9      ----------------------------------------------MAINQEETD-VIDL
A0A1S1ZVW2      ----------------------------------------------MPINQETTD-VIDL
A0A1B7WX82      ----------------------------------------------MSINQEDQDSSIDI
A0A1B7WTD1      ----------------------------------------------MSINQEDQD-SIDI
A0A480ABC0      ----------------------------------------------MSINQEDQD-SIDI
A0A1Z4LRU5      ------------------------------------------MTNEMQVNQEEQD-YIDL
A0A1Z4JVB4      ----------------------------------------------MPTKQEDRD-SIDF
K9PIA4          ----------------------------------------------MPTKQEDRD-TIDL
A0A1Z4M597      ----------------------------------------------MPTKQEERE-VIDV
A0A1Z4MWT1      ----------------------------------------------MPTKQEERE-VIDV
A0A1Z4TX53      ----------------------------------------------MPTKQEERE-VIDV
A0A1Z4HVE1      ----------------------------------------------MPTKQEERE-VIDV
A0A252ECZ1      ----------------------------------------------MPTKRDDRD-LIDF
A0A1Z4G5Y1      ----------------------------------------------MPTKRDDRD-LIDF
A0A252DNA2      ----------------------------------------------MPTKRDDRD-LIDF
A0A252E1Q4      ----------------------------------------------MPTKRDDRD-LIDF
A0A5P8VSD1      ----------------------------------------------MPSHQDEQDL-INF
A0A2A2TNQ5      ----------------------------------------------MPSHEEDTDY-INL
A0A3S1C4K5      ----------------------------------------------MPSNQEDQNE-VDF
A0A1X4G3D5      -------------------------------------------MPINQVNQEESDV-IDL
D4TNI2          -------------------------------------------MPINQVNQEESDV-IDL
A0A1Z4H6Z8      -----------------MNVIGAIILFVGTEGSDSPNYIWYFGTLFMPTKQDDRDL-IDF
A0A1Z4NPM1      ----------------------------------------------MASEYEEQDY-IDI
A0A3F3KPR9      -----------------------------MLIFCVMVEPVIATGVYMPINKKETDV-IDL
D4TGN7          -----------------------------MLIFCVMVEPVIATGVYMPINKKETDV-IDL
A0A1Z4UZW9      ----------------------------------------------MSINQEDQDSSIDI
A0A0K2M5H0      ----------------------------------------------MSINQEDQDSPIDI
A0A1B7VSH4      ----------------------------------------------MSINQETQDSSVDI
A0A1B7W126      ----------------------------------------------MSINQETQDSSVDI
A0A3D4C6Q6      ----------------------------------------------MSINQETQDSSVDI
A0A1B7UVJ4      ----------------------------------------------MSINQEDQDSSIDI
A0A1B7UTR1      ----------------------------------------------MSINQEDQDSSLDI
A0A5C0DRW9      ----------------------------------------------MSINQEDQDSSFDI
K7W0A4          ----------------------------------------------MSINQEDQDSSFDI
A0A1U7HGH0      -----------------------------------------------MEVTE-----LDL
K9XJD3          -----------------------------------------------MEVTE-----LDL
A0A2T1CIL7      --------------------------------------------MIPTIVPSTHEEQIDF
A0A1Z4RPC6      ------------------------------------MTNLQTTNSLSSNHREELD--INI
A0A2T1CMZ0      ------------------------------------MTNLQRNNVYNPNRRAEFD--INI
L8M4F7          -------------------------MFKIPNNNSAYSSQTEGEANASINSRDSID--LDI
A0A140K2P2      ---------------------------MTNNYPANNSNNYNYPSETLSASREAID--VNI
K9XWX4          ---------------------------MTNNYPANNSNNYNYPSEVSSASREAID--VNI
A0A140KB14      --------------------MSNFTGMSNGQTPENLSLNNSY-----TASRESID--VNL
K9XX88          --------------------MSNFTGMSNGQTPENLSLNNSY-----TASRENID--VNL
A0A563VSV6      -------------------------MVNSLTNNGGSQPDNSYPNYGLEESRESTD--IEI
L8LZE9          -----------------------MYPVNNSSSNG------SYTQGNYPESKEKFE--VEI
A0A433V7A0      ----------------------------------------MKYPKHTTTIDSREPEEIDF
A0A1Z4NDS1      ---------------------------------------------MDSVTSTTNVEEIDL
K9F4D9          ---------------------------------------------MASQDNSVKEIEIDL
U9VXM0          ---------------------------------------------MASQENSVKEVEIDL
A0A2T1FTR8      --------------------------------------------------------MDEI
K9UA41          --------------------------------------------------------MDEI
A0A0C2LBE2      ---------------------------------------------MSAMEPVPNSEEIDF
A0A433NN38      ---------------------------------------------MDSIKHTHSLEEIDF
A0A2N6K0T2      -----------------------------------------------MKESEFHVEEIDF
A0A2N6ML72      -----------------------------------------------MKESEFHVEEIDF
G6FQZ6          -----------------------------------------------MKESEFHVEEIDF
A0A2N6MQX9      -----------------------------------------------MKESEFHVEEIDF
A0A2N6KXT6      -----------------------------------------------MKESEFHVEEIDF
A0A2N6KGB9      -----------------------------------------------MKESEFHVEEIDF
A0A2N6L3Y5      -----------------------------------------------MKESEFHVEEIDF
A0A0S3TIS7      -----------------------------------------------MKESEFHVEEIDF
A0A1U7GW28      -----------------------------------------------MKESEFHVEEIDF
A0A2N6LW63      -----------------------------------------------MKESEFHVEEIDF
A0A328IH74      -----------------------------------------------MKESEFKVEEIDF
A0A4D9CIB0      -----------------------------------------------MKESEFKVEEIDF
A0A1Z4TQ63      -----------------------------------------------MKESEYQLEEIDV
A0A4Q9J8G2      -----------------------------------------------MKESEYQLEEIDV
A0A1Z4SMD6      -------------------------------------------------MNQGFIEEIDV
A0A2H2Y096      -------------------------------------------------MNQGFIEEIDV
K9S8M8          -----------------------------------------------MEFQHYPEE-IDF
A0A1Z4NFV0      -----------------------------------------------MENPSYLEE-IDV
B0CAX4          ----------------------------------------------MPMSNEYSHESIDV
U5DPF5          -------------------------------------------MEAIDRNLRQDDDFLDL
A0A350Y0P6      -----------------------------------------------MESKQYVED-IDF
A0A352X940      -----------------------------------------------MESKQYVED-IDF
B8HTN4          -------------------------------------------------MQALEDDRIDL
A0A2A2TPF8      -----------------------------------------------MEKQSNS-DDLDL
A0A1Z4R0P8      -----------------------------------------------MEKQSYP-DELDL
A0A0T7BUI3      -----------------------------------------------MEKQKAL-EELDI
A0A1Z4LP32      -----------------------------------------------MQNKKNN-QEVDI
K9REP9          -----------------------------------------------MKNKNNA-QEIDI
A0A1Z4SIJ3      -----------------------------------------------MENEGYPLQEAEI
A0A2H2XPG4      -----------------------------------------------MENEGYPLQEAEI
K9V3C7          --------------------------------------MLINQEKPDMKPQHYT-EEIDL
A0A1Z4T6Y7      ----------------------------------------------MEQQNNRS-EDIDI
A0A2H2Y561      ----------------------------------------------MEQQNNRS-EDIDI
A0A1Q4S362      ----------------------------------------------MEQQHNRS-EDIDI
A0A3S1CIN8      ----------------------------------------------MEQQHNRS-EDIDI
A0A2A2TC28      -----------------------------------------------METKGYL-EEIDI
A0A0C1NCB0      ----------------------------------------------MEETKGHQ-EEIDI
A0A2N6K7Q9      -----------------------------------------------METNSYT-QEAEI
A0A2N6MXH6      -----------------------------------------------METNSYT-QATEI
A0A2N6M5A8      -----------------------------------------------MENNSYT-QATEI
A0A2N6LL61      -----------------------------------------------METNSYT-QATEI
A0A0S3TP66      -----------------------------------------------METNSYT-QATEI
G6FP91          -----------------------------------------------MENNSYT-QATEI
A0A1U7GYR5      -----------------------------------------------METNSYT-QATEI
A0A2N6KY52      -----------------------------------------------METNSYT-QATEI
A0A2N6KMP5      -----------------------------------------------METNSYT-QATEI
A0A2N6MA45      -----------------------------------------------METNSYT-QATEI
A0A4Q9J9V9      -----------------------------------------------METNSYT-QETEI
A0A328IGA1      -----------------------------------------------METNSYT-QETEI
A0A4D9CE41      -----------------------------------------------METNSYT-QETEI
A0A0M0SFT2      -----------------------------------------------METNNYT-QETEI
A0A1Z4TLC8      -----------------------------------------------METNSYT-QETEI
A0A0C2LFH0      -----------------------------------------------METRGYQ-EEVEI
A0A1Z4IYV4      -----------------------------------------------METKGYQ-EEVDI
A0A1Z4Q0T6      -----------------------------------------------METKGYQ-EEIDI
A0A0C2PT44      -----------------------------------------------METKGYQ-EEIDI
A0A1D2P6J4      -----------------------------------------------METKGYQ-EEVDI
A0A4R4IQ40      ------------------------------------------MQERLIETSENLD--LDF
A0A433W533      ------------------------------------------MQERLIETSENLD--LDF
A0A2P8QWJ3      ------------------------------------------MQERLIETSENLD--LDF
A0A2T1FKP8      ------------------------------------------MQEQLIETSENLD--LDF
K9U6L7          ------------------------------------------MQEQLIETSENLD--LDF
A0A3M9ZEU1      -----------------------------------------------MHPKDHLEE-VDL
A0A1Z4JK72      ------------------------------------------MTSMKMETKQYSED-FDL
A0A0N7Z489      ------------------------------------------MTSMNIETKRYSED-FDL
A0A0S3TXS2      ------------------------------------------MTSMNIETKRYSED-FDL
A0A1Z4RN12      -----------------------------------------------MDSNLHLEEYIDF
A0A2T1CMF9      -----------------------------------------------MDSNLPIGEHIDF
Q7NDC5          ---------------------------------------------------------MGL
U5QGK3          ---------------------------------------------------------MGL
A0A2W4UY24      ------------------------------------------------MPQKELE--IDF
A0A2T1GMT4      -----------------------------------------------MESQESID--LNL
K9UI51          -----------------------------------------------MESQESID--LNL
K9QM62          ------------------------------------MKAKTLEVDSTIKSREAID--LDF
A0A1Z4FWI3      -----------------------------------------------MESRESID--LDF
A0A1Z4JYE7      -----------------------------------------------MESRESID--LDL
A0A2T1FXY4      -----------------------------------------------MESRESID--LDL
A0A4V2X3N2      -----------------------------------------------MESRESID--LDL
K9TYI2          -----------------------------------------------MESRESID--LNL
A0A1Z4QL41      -----------------------------------------------MESREAVD--LDF
A0A252D4T4      -----------------------------------------------MESRESID--FDL
A0A252DJH5      -----------------------------------------------MESRESID--FDL
A0A252EB80      -----------------------------------------------MESRESID--FDL
A0A1Z4HPW5      -----------------------------------------------MESRESID--FDF
A0A1Z4MSN1      -----------------------------------------------MESRESID--FDL
A0A1Z4U1C2      -----------------------------------------------MESRESID--FDL
A0A0D6KV51      ------------------------------------------------------------
A0A1Z4MKF8      -----------------------------------------------MESRESID--FDL
A0A2C6WC43      -----------------------------------------------MESRETLD--LDL
A0A1Z4L5A1      -----------------------------------------------MESRETID--LDL
A0A367QD86      -----------------------------------------------MESRETID--LDL
A0A235IZ96      -----------------------------------------------MESRESID--LDL
A0A2L2NGP0      -----------------------------------------------MESRESID--LDL
A0A2K8SM78      ------------------------------------------------------------
A0A2R5FPC0      -----------------------------------------------MESRESID--LDL
A0A5P8W5T6      -----------------------------------------------MESRESID--LDL
A0A140KBA0      -----------------------------------------------MESNLYIDEYLDF
K9XSG1          -----------------------------------------------MESNLYTDEYLNF
A0A0F5YE28      -----------------------------------------------MEDRESID--LDI
U7QEH7          -----------------------------------------------MEDRESID--LDI
A0A3S1ATK5      ------------------------------------------MSKTPMESREDID--LDL
A0A2Z6CPH0      ------------------------------------------MAKNIMESRESLD--LDF
A0A1Z4GT50      -----------------------------------------------MESRESID--LDL
A0A1Z4GIX0      ------------------------------------------MSKNSMESRETID--LDI
A0A2H6LC24      ------------------------------------------MSKNSMESRETID--LDI
B2J6N5          ------------------------------------------MSAKSTESRESID--LDL
A0A367RMI4      ------------------------------------------MSEKSMESRESID--LDL
A0A235HUM0      ------------------------------------------MSEKSMESRESID--LDL
A0A2L2NW47      ------------------------------------------MSEKSMESRESID--LDL
A0A1E2WUR1      ------------------------------------------MSEKSMESRESID--LDL
A0A235IKU3      ------------------------------------------MSEKSMESRESID--LDL
F4XKF3          -------------------MAGLVANSHQYQKLFYCAIYLGGAPEELMESRSSID--LDL
A0A1D9FX10      -----------------------------------------------MESRSSID--LDL
A0A1D8TNX9      -----------------------------------------------MESRSSID--LDI
A0A1U7MYU6      -----------------------------------------------MESRSSID--LDI
A0A3C0NJ41      -----------------------------------------------MESRESLD--LDF
A0A352AG88      -----------------------------------------------MDSAESLD--LDL
A0A350Y374      -----------------------------------------------MQSTDSPD--LDF
A0A355DPX0      -----------------------------------------------MQSTDSPD--LDF
A0A0D8ZUV2      --------------------------------------------------MEFID--ADI
A0A433VDI0      ----------------------------------------MEPTKPIVEYSESIN--IDF
A0A3D1PG43      -----------------------------------------------MESREAID--INL
A0A2P8QQ72      -------------------------------------------MESRVESREAVD--INL
K9TZQ7          -------------------------------------------MESRVESREAVD--INL
A0A2G7GPR0      -----------------------------------------------MESNETID--IDL
K9XH68          -----------------------------------------------MESNETID--IDP
A0A1U7HW70      -----------------------------------------------MQSNDTID--IDL
A0A2S6VEJ8      -----------------------------------------------MESNETID--IDL
                                                                            

K9SLA9          NRGWV------ALRQH---KFPALVAFGIIFGGAALVTV--RI----Q---PIYEAKGQV
A0A168TT23      LEIWR------TILKRKWVVVSILAVFIATAALSSWLTI------------PVYRATAVV
A0A0M1JWX9      GQLFA------VIRRR---AFVILGVAIAVTGAVWVWTD--NQ----T---PQYEGKFQL
A0A2T1M1V6      NHALS------VVRRH---WPPLLALNLLLIAATVYVIT--NIEKFVS---PTWKANAQL
A0A2G7GCS2      NHIVN------IIRRH---WMPLLLLNGVILAGTLYAVI--YTKTNVA---PVWKASAKL
K9XBH8          NHIVN------IIRRH---WMPLLLLNGVVLAATLYAVI--YSKTSVP---PVWKANAEL
A0A1Z4LJ30      NRIAK------IAIRH---WKLLLAWNILILGITAINIK--VA----P---RVWSSQAQL
K9RI76          SRIAT------IAIRH---WKLLLAWNILLIGITAINIK--LT----P---RVWEGKAQL
A0A352AE27      ARIAT------ITARH---WKFLLALNVLVLAAAASNYV--TS----P---KVWTAKAQL
A0A3B8JH60      GKIAA------IASRH---WKSLLVLNLLVLAATAGKLA--TS----P---KVWTANAQL
A0A3C0N766      GKIAA------IASRH---WKSLLVLNLLVLAATAGKLA--TS----P---KVWTANAQL
K9W9J7          GKVAA------IATRH---WKSLFILNLLVIAATAGKLA--TS----P---KVWTATAQL
A0A139WSU3      NKLVT------ISTKH---WKSLIAFNVLVVLATAVAVS--NA----K---PVWIAKTQL
A0A433VN22      ---MT------IAARH---WKSLLVLNALVVSATIAAYS--TS----K---PVWTTTAQL
Q7NF11          MHVIQ------VLKRH---WRPLLVLNGLVLAATIGVAC--YY----P---RTWTATTRI
A0A1Z4JCS8      KKIAL------IASRH---WKALLGLNAVVIFGTLGAML--TT----P---KVWTAQAQL
F4XTX2          KKVVA------ILNRH---WILLLVFNSLVLAASFGAFS--LL----K---PFWIAKAQL
Q7NJN6          SSIVA------IGRRH---WRPLLALNTVLLAATVGIAV--FY----P---RTWTASAQL
U5QCC3          MSTLA------IARRH---LRPLLILNGAILTTAIGIAL--FF----P---KSWTATTQL
A0A3S0Y9N9      QYWL-------IFKRR---WLPVSIVFFTVVALSIVKTL--LE----T---PIYQATAQL
A0A433UNK7      RYWS-------ILKRR---WLPTSIVFLSLLALSIVKTV--LE----T---PIYQAGGQL
A0A3M1SVZ4      ESTIQLDRAFPIVKRR---WLPASVVFAAIFTVFYIAAQ--KD----R---PVYIAEGEI
A0A654SFI6      HIDLARYWIEARALRF---WIAAIIAL-ALIAGLVVTLL--ST----P----LYRAGAR-
K9SSQ0          SPLLSTFLVRRLVRKH---LVTVISTTALTLGGAAIYTF--NQ----P---FLYESKGSL
A0A2W1JIN9      SRLPL------VFSRH---RWSALAAFSAVMCGLCLYVV--FA----P---RLYTSKVRL
A0A318AJV1      AAAKR------MLRRR---WATMLGVSSVVFVVALSVVA--CL----P---PRYVAVARI
A0A1U7N2U4      SSLPL------ALRRR---LLAALATFTSVIGGGMAYLV--VT----P---PVYQVKARL
A0A1D9G1F2      SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
F4XV38          SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A2P8QIL5      ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
A0A2T1FLY5      ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
A0A433W447      ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
K9U1K8          ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
A0A4V6P809      ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
K9UYB2          SSVFT------ILKRR---SFPALLMFAAVLGGAYAYIS--TA----P---KMYESAIRL
A0A218QN17      SSLLA------ILKRR---ALPALVTFTAVIGGAVAYLT--VT----P---RLYEASARL
K9RKN2          SSLLT------IVMRR---SLPALATFVAVMGGAFAYLS--IT----P---RVYETSARL
A0A2I8ADV2      STLFA------VLRRR---GLPAVSTLAAVIGASVAYLA--IT----P---RFYATSAKM
A0A1W5CKM3      STLLG------VLGRR---GFPAVTVFASVIGASFAYLA--VT----P---RLYETSARL
A0A5Q0GMF5      STLLG------VLGRR---GFPAVTVFASVIGASFAYLA--VT----P---RLYETSARL
Q3MEW0          STLLG------VLGRR---GFPAVTVFASVIGASFAYLA--VT----P---RLYETSARL
A0A1Z4KIC7      STLLG------VLGRR---GFPAVTVFAAVIGASFAYLA--VT----P---RLYETSARL
Q8YSM5          STLLG------VLGRR---GFPAVTVFAAVIGASFAYLA--VT----P---RLYETSARL
A0A1Q4S1H4      SSLWT------VAKRR---SLPAFLTLSAVIAGAVTYLA--VA----P---RMYETSSRL
A0A433VBU6      SSLWA------VVRRR---SLPAFLTLSAVMAGAVTYLA--VA----P---RMYETSSRL
A0A1Q4RZJ6      WSVLS------VLKRR---GLPALITFTAVIGGAVAYLK--VT----P---RLYESSSRL
A0A1Z4SNV3      WSVLA------VIKRR---GLPALITFTAVISGAVAYLK--VT----P---RLYETSARL
A0A2H2XJQ1      WSVLA------VIKRR---GLPALITFTAVISGAVAYLK--VT----P---RLYETSARL
A0A3S5K358      WSVLS------VLKRR---GLPALITFTAVIGGAVAYLK--VT----P---RLYESSSRL
A0A0T7BPJ4      SSLVA------VLKRR---GLPAAAAFVAVMGAAGAYLL--LS----P---KLYEASARM
A0A0C1QS61      SSVLG------VLKRR---SLPAVAAFVATIGGAIAYLA--VT----P---SQYEASARL
A0A139X3R8      SSVLS------VLKRR---SLPAVAAFVAAIGGAIAYLA--VT----P---SQYEASARL
A0A1Z4I7C5      STLLA------VLGRR---GFPAITVFAAVIGTSFAYLQ--VT----P---RLYESSARL
A0A0C2MDK7      SSVLA------VLRRR---SLPAVAAFVAVMGGAIAYLA--VT----P---SKYEAYARL
A0A1Y0RCK1      SNVLA------VLKRR---SAPAIAAFAAVIGGAIAYLA--VT----P---SKYEAYARL
A0A1Z4PWZ0      SSVIG------VLRRR---SLPAIAAFVAVIGGAMAYLT--VT----P---SKYAASARV
A0A0C2QLT0      SSVIG------VLRRR---SLPAIAAFVAVIGGAIAYLA--VT----P---SKYEAYARL
A0A1Z4J2K1      SSVIA------VLRRR---SLPAIAAFVAVIGGAIAYLA--VT----P---SKYEASARL
A0A3S0ZSX0      SSLLL------IFKRR---AFPALATFAAVIGGAIAYLQ--VT----P---HRYQTSARL
A0A2N6K4T3      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--MT----P---RQYQTSTRL
A0A370CKT2      SSLPS------ILKRR---ALPALVTFAAVISGAIAYLQ--IT----P---RQYQTSTRL
A0A0S3TL97      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---HQYQTSTRL
A0A2N6M8A0      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---HQYQTSTRL
A0A2N6M9E1      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---RQYQTSTRL
A0A2N6KJI4      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---RQYQTSTRL
A0A2N6MZ77      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---RQYQTSTRL
A0A2N6KT20      SSLPS------ILKRR---ALPALVTFAAVISGAIAYLQ--IT----P---RQYQTSTRL
G6FSN3          SSLPS------ILKRR---ALPALVTFAAVISGAIAYLQ--IT----P---RQYQTSTRL
A0A4D9CI02      SSLPF------ILKRR---ALPALVTFAAVIGGAIAYLL--IT----P---RLYEISTRL
A0A328I8B9      --------------------LPALVTFAAVIGGAIAYLI--IT----P---RLYEISTRL
A0A4Q9J4Z7      SSLPF------ILKRR---ALPALVTFAAVIGGAIAYLI--IT----P---RLYEISTRL
A0A0M0SU69      SSLPF------ILKRR---ALPALATFIAVIGGAIIYLQ--IT----P---RLYETSTRL
A0A1Z4TIZ8      SSLLF------ILKRR---TLPALATFAAVIGGAIAYLQ--IT----P---RLYETSTRL
A0A0S3TYD7      RKTFM------MLTRY---WLPATLAFSLVTVPAAVFLM--TR----K---SSYQATGAV
U5QL42          LSIWR------TLRKR---KLLSLSVAVAVFGGVAAFTY--TR----P---YIYESETLI
K9QF04          HQLGA------IARRR---LVVFIAVSGVIIAGVICKQW--LQ----K---PIYKQQFQL
A0A3C0N2P0      RRLLA------VARRR---IILVAGVAIAVTSGVAAKVL--RQ----V---PIYEGSFQL
K9TLQ0          RHLLS------VARRR---IFVFAGVSIAVACGVLVKVL--TQ----T---PIYEGNFRL
A0A076HBF2      RELWR------ALQRR---KKLVGVTAGSIIVLAALFTT--YQ----RLFRPVYEGSFSL
A0A354B169      RELWL------ALRRR---RKLVTVTASTVLALTVMVTA--YQ----RIFTPVYLGSFSL
G4FMX5          RDLWR------ALKRR---KKLVGVTAAGVISLTCVSTA--YQ----RIFRPVYQGSFAL
Q0IDT5          RELWR------ALKRR---KKIVGFTAAAVLVLSGVVTT--YQ----RLFMPVYEGSFAL
A0A2D6FCW3      RELWR------ALRRR---KNLVGVTAAGVLALSGLNTA--YQ----RIFRPVYQGSFAL
A3ZA21          RELWR------ALKRR---KKLVGVTAAAVVALAGMVTA--YQ----RIFRPVYQGSFAL
A0A140K3H3      TELKQ------TLSRQ---WKPALLVASTVCAGIFLSTV--LQ----N---PKYQSQTLI
K9XUB8          TELKQ------TLSRQ---WKPALLVASTVCIGMFLSTV--LQ----T---PKYRSQTLL
Q7NEU3          QTYAR------TIWRR---RYAFIGVFVATFSLAAAYTF--LS----N---PVYEGEMLL
A0A352XE00      RQIIA------IARRR---FILTAGVAVAVTSGVATRVL--QQ----V---PKYEGKFQL
B4VS56          RQILA------VARRR---ALVVAGMAIAVTSGIVTKVL--QQ----T---PNYEGKFQL
A0A352AAQ3      GQILG------VVRRR---FIVIAGVAIAVTSGIVARVL--KQ----T---PNYEGKFQL
A0A350Y472      RQILA------VAQRR---AIIIAGVAIAVSGGIVSQVL--KQ----E---PNYEGKFQL
A0A355DVB4      RQILA------VAQRR---AIIIAGVAIAVSGGIVSQVL--KQ----E---PNYEGKFQL
A0A2P8VVX1      GQLFQ------ILLRR---WPWIIASLGVATAGAVFVSL--RQ----E---PIYRSNMQL
A0A2P8WHY0      GQLLG------ILLRR---WPWIAGTLVLSVAGAVLVFL--RE----D---PTYRSSMQL
A0A2T1CMT9      GELFS------KLWHR---RLWFIGAFTGVLAIAVPLAL--LK----P---AVYQSYMQI
A0A563VQJ3      GQYLL------KLKRR---WKPAILVFLATLGGSVFLSL--FL----Q---NSYQAAGKL
A0A1D8TX52      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTI--KK----E---PNYISSLQL
A0A1U7N5X9      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PNYISSLQL
A0A1D9G4T2      GQLLA------VLWRR---RLWIISVLLTSLPIAFYITL--KK----E---PNYISSLQL
F4XP71          GQLLA------VLWRR---RLWIISVLLTSLPIAFYITL--KK----E---PNYISSLQL
A0A2P8QVH5      RQLFT------VLLRR---RLLILSLFCIPLSASSFLAL--MA----K---PTYQSSMQL
A0A2T1FT70      RQLFT------VLLRR---RLLILSLFCIPLSASSFLAL--MA----K---PTYQSSMQL
A0A433W4W4      RQLFT------VLLRR---RLLILSLFCIPLSASSFLAL--MA----K---PTYQSSMQL
K9U5W1          RQLFT------VLLRR---RLLILSLFCIPLSASSFLAL--MA----K---PTYQSSMQL
A0A2W6ZAV2      GNLLP------ILRRR---QRLLVAVFAATVAIGAAATL--FQ----RVVSPVYQGDFRL
A0A2G7GMH8      GQLLS------VLMRR---RFLLLSVFFGILSMATVLTI--IT----K---PTYKSSMQL
K9W742          GQLFA------ILIRR---RLWLLGILCLALGIATFKAF--TT----K---STYVSSLQL
A0A2T1DWE8      GQLVA------ALFRR---KLWLLGIFLTVLSAVTIYTL--LK----K---PIYQSSMQL
A0A1U7I8L3      GQLLA------ILLRR---RYWLLGIFSVVLAITAIVTI--TT----K---PTYKSSMQL
A0A2T1DJL8      GQLLS------VLMRR---RLWLIGGLGLSLIGAALFTL--FS----K---PTFRSSMQL
A0A1Z4J9W0      GQLFG------VLLRR---KLWFLGALAGTLALAAGVTA--VL----P---PTYRSTMQL
A0A0N7Z5K9      GQLFG------VLMRR---KIWFLGAVAGTIALAAAVTA--FM----P---PTYRSTMQM
A0A0S3TXC5      GQLFG------VLMRR---KIWFLGALAGTIALAAGVTA--FM----P---PTYRSTMQM
K9SA61          GQIFA------VLARR---RLWLLGVFGSVVAAAAGLTF--LT----T---PVYQSSLQL
A0A3D1PBA3      GQLFS------VLMRR---RFWLLGVLGSVLTIATVFTL--IS----K---PTYQSTMQL
K9XPB0          GQLLG------ILWRR---RFWIGGVFLGVLAVAIPLAL--MK----Q---PLYMSQMQL
A0A350Y7Z1      GQLFS------ILLRR---RFWMLGVFCGVLAIAIPIAL--NK----E---PTYQSSMQL
A0A352X2A7      GQLFA------ILLRR---KFWLLGVFCSVLAIAIPIAL--KK----E---PTYQSSIQL
A0A0D8ZYV0      GQLFA------VLSRR---RYWLLGVLGGVLTIATALTL--TA----E---PTFQSTMQI
A0A4R4IUM6      GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
A0A2T1FP73      GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
A0A433VMS2      GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
K9TYA7          GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
A0A2P8QUE1      GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
A0A2T1DNG3      GQLFA------ILKRH---YLWVLAAGTVSVAIAFAYTL--KQ----E---STYISGMQF
A0A2P8W9H0      DRFVA------ALRRH---LLLIAGITTLTASAAVLKAI--TD----A---PTYQSSFDI
A0A1Z4LN32      QKYLL------VLKRR---WLIASVVFAGFASFGVLHWV--SQ----K---PAYQATGKL
A0A2I8A9F5      QKYLL------VLKRR---WLVIAGVFVLFATLGGTLAL--KQ----P---KSYEATGKL
A0A218Q6R8      QKYWL------VLKRR---WLIIAAVSTACAALGGVNFF--IQ----P---TTYQASGKL
A0A218QGE0      QKYLL------VLKRR---WLIASGVFAVFATLGGINFV--IQ----P---PVYEASGKL
B8HNB0          VELLR------TLKKR---WIPALATAVTVFAGCYIYSA--LQ----T---PLYRSEALI
A0A563VS48      QKYWL------VLKRR---WLPATLTLCGVLGISLGYAL--SQ----E---QIYEAEAKV
A0A318BJ18      RHYLR------IAMRW---RWVILGVTIACVLLGLVVTL--LM----T---PTYTATATV
A0A3B8Y8H9      SQIVP------WLRRR---FWLIGSISLAVSLSAVSYAF--TR----A---PVYEESFQI
A0A2W1JVB9      GKYWL------ILKRR---WLPATIIFLLMFSTATLAAF--LK----A---PIYQSQGTL
A0A1Z3HMQ0      QRYWL------VLKRR---WLPASLVFAACVVAAALVGL--SQ----K---DTYQASGKL
A0A1E5QP61      QKYWL------VLKRH---WLPASSVFALIVTLATYKAA--TA----D---PVYEAQGKL
A0A3M2GIL5      QKYWL------VLKRH---WLPSSCVFLLIFALAFAFAY--TR----K---PTYEASGKL
A0A433NM31      RQYWL------ILKRR---WLPASAVFGFVLLLTALVTF--LQ----K---PVYQAQGKL
A0A3M1PML8      QKYWN------VLKRR---WLPATSVFLTLTLLSAAVAI--RQ----K---SSYQAETLL
A0A352X442      QKYWL------VLKRR---WLPAVGVFGGIVAVAGLAVI--RQ----V---PSYQAQGTI
A0A0T7BPZ0      TKYWL------ILQRR---WLPTLGIVGIALTMAFGYVL--SI----K---PTYKAQGSI
A0A0M0SHU3      QKYLL------VLQRR---WMTAVGIFGAVVTLALLYAF--SL----K---PTYTAQASL
A0A1D2PBN3      QKYLL------VLQRR---WVSAVGVFGVVVTVASLYAF--SL----K---PTYNAEGSL
A0A0C2LVR7      QKYLL------VLQRR---WVPAVGVFGAVVTLVSLYAF--SL----K---PTYNAEGSL
A0A1Z4PQB9      QKYLL------VLQRR---WVPAVGVFGVAVTLVSLYAF--SL----K---PTYKAEGSL
A0A1Z4SFN6      QSYLL------VVQRR---WLAAVSVFGVVVALASLQAF--SS----K---PSYEAQGSL
K9PGI8          QKYLL------ILQRR---WIPAAGVFGVVVTLAFLYAV--SL----K---PAYKAEGSL
A0A563VLD6      SELKQ------IIFRR---WKPALIVGTTVFAGIFIPTM--LQ----T---PKYQSETFI
A0A318BG22      QRYVA------TLTKH---RLLILGTTIAAALLALIVTM--LT----E---PRYVARTTF
A0A2T1E9V8      YNYWC------IFKRH---WLPALAIFSTITGGSYLYTS--AK----T---PIYSAQGQI
A0A3M2GQQ6      VELGR------TLVKR---WSIIAIVMTSVFATVAVSTL--RT----T---PQYRSETLI
K9SGJ5          SRFLR------TLRKR---WLVVASISATLFATVAAYTY--IK----E---PVYQSETSL
L8MYT6          AKFLR------VLRKR---WIVIVAVSVTVFAGNTYYTI--TR----I---PQYRSSASL
A0A352JGJ6      AKFFR------VLRKR---WIVIVAVSASVFVGNAYYTF--TR----T---PQYRSSASL
A0A1J5GLS2      AKFFR------ILRKR---WIVIVAVSASVFAGTTYYTF--TR----V---PQYKAGAAL
A0A2W4W6M5      AKFFR------VLRKR---WIVVAAVSVTVFAGNAYYTF--SR----T---PQYRSNASL
A0A2W7AN33      AKVLR------VFRDR---WTVIATVSVTMLAGSALYTF--TR----T---PQYRSIASL
A0A256BLV2      AKFFR------VLRKR---WIVIVAVSVSVFAGNTYYTF--TR----T---PQYRSSASL
A0A2W6ZXF3      AKFFR------VLRKR---WIVIVAVSASVFAGTTYYTF--TR----T---PQYKAGAAL
A0A2Z5WX66      AKFFR------VLRKR---WMVIVAVSVTVFAGNTYYTF--TR----T---PQYRSNASL
K9W1T3          TQYWF------IFKRR---WLPASLVFTLVLGVTALVTF--QQ----K---PIYQAQGQI
A0A1Q4RTR1      RQAWR------ILKRR---WLAVTIVISSAIGVTGAITF--SQ----T---PIYEAEGKL
A0A1Z4SQV2      RQAWR------IMKRR---WLAVTVVLSSVVGITGAVTF--SQ----T---PIYEAEGKL
A0A2H2XGN1      RQAWR------IMKRR---WLAVTVVLSSVVGITGAVTF--SQ----T---PIYEAEGKL
A0A433UXH8      RQAWR------IMKRR---WLAVTIVLSSVVGITGAVTF--SQ----T---PIYEAEGKL
A0A1Z4RMB9      NEYLL------KVKRR---WKPALGVFLLTLGVTGALSL--LQ----T---KTYQAEGKI
K1XF69          GRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSGKI
B5W297          GRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSGKI
H1W7M8          GRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSGKI
A0A5Q4H6A5      GRYLQ------TLKRR---WFWLLGVFVLTVSGAVYATQ--FL----S---PTYQNSGKI
D5A466          GRYLQ------TLKRR---WFWLLGVFVLTVSGAVYATQ--FL----S---PTYQNSGKI
B4WP72          QKYWC------VLRRR---WRLATFVFSSSICLTVLALA--SQ----E---AEYEATGKL
A0A318B4H2      ERYWR------AMLNR---RLLILAVLLASMTVGVIVYL--MA----T---PQYLATARI
B4WQE3          GRVVD------VLKRH---VFLITGITALATSAVVARAL--TE----T---PLYRADFEL
A0A2P8W4F7      KRLLG------VFKRR---AGVFLGVAALSFGGLTLWHL--SQ----P---PAYSGSVNL
A0A5Q4E0Z4      GHLIG------VLKRR---VGVFVGVAALSFGGLTLWHL--SR----P---PVYSGTANL
A0A2K3BR24      QQYWM------ALKRR---SLSAIIVFASTIGIAAAYSF--QQ----E---PIYQAKAKL
K9YXY1          QQYWM------ALKRR---SLSAIIVFASTIGITAAYSF--QQ----E---PIYQAKAKL
U5QJM6          -----------------------MMTMAATFTLAVAYTF--LS----Q---PVYKSEMLM
K9SX01          FELLS------IVRRY---WFLEISIFSLVFGVSAFLTF--QE----K---PIYQATGSL
A0A4P7ZT55      KEIWM------ALRRRRRWFLAGFGVTLAITGVLTLGQR--LF----R---PTYEGSFTL
A0A1E5QIR9      KQYGL------VFKRR---FFPAAIVFCAAIGATAAITF--LQ----K---PTYQAQGEL
A0A1Z4IBC7      HKYIE------VLQRR---WLAVVGVFGLSLALGCLYAF--SL----K---PSYKADGSL
A0A1W5CPC7      HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
A0A5Q0GKD1      HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
Q3MDC6          HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
A0A1Z4KM73      HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
Q8YNX7          HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
A0A367R4K6      QKYLE------VLQRR---WLTVIGIFSIAVTLGCLYAF--SL----K---PSYKAEGSL
A0A1E2WSV8      QKYLE------VIQRR---WLPLVGIFSIAVTLGCLYAF--SL----K---PSYKAEGSL
A0A2R5FRT9      QKYLE------VIQRR---WLPLVGIFGITVTLGCLYAF--SL----K---PSYKAEGSL
A0A2K8T1B6      QKYLE------VIQRR---WLPLVGIFGISVTLGCLYAF--SL----K---PSYKAEGSL
A0A235I9I0      QKYLE------VFQRR---WLPLVGIFAISVSLGCLYAF--SL----K---PSYKAEGSL
A0A2D0HQT8      QKYLE------VFQRR---WLPLVGIFAISVSLGCLYAF--SL----K---PSYKAEGSL
A0A2L2NU95      QKYLE------VIQRR---WLPLVGIFAISVTLGCLYAF--SL----K---PSYKAEGSL
A0A367S084      QKYLE------VFQRR---WLPLVGIFAISVSLGCLYAF--SL----K---PSYKAEGSL
A0A0V7ZFJ4      QQYWL------TLKRR---WLPALIVSSSVFGMAAFNTL--KQ----E---PIYSAEGKL
A0A367RIS1      QQYWR------ILKRR---WFLIAIIMGSVFGVTGLVAF--SK----K---PIYESEGKL
A0A235IXQ2      QQYWL------TVKRR---WFLILIIIGSVFGVTGVVTF--SE----K---PIYEAEGKL
A0A1W5CNX3      QQYWL------IAKRR---WLLIATIMGSVFGVTGLLTF--SQ----K---PIYEAEGKL
A0A5Q0GJJ5      QQYWL------IAKRR---WLLIATIMGSVFGVTGLLTF--SQ----K---PIYEAEGKL
Q3MEB7          QQYWL------IAKRR---WLLIATIMGSVFGVTGLLTF--SQ----K---PIYEAEGKL
A0A1Z4KHN9      QQYWL------IVKRR---WLLIAAIIGSVFGVTGLVTF--SQ----K---PIYEADGKL
Q8YT70          QQYWL------IVKRR---WLLIAAIIGSVFGVTGLVTF--SQ----K---PIYEADGKL
A0A218Q4C1      QQYWL------TVKRR---WLLIATIITSVFGFTAFVTF--SQ----K---PIYQAEGKL
A0A166IWU6      RQYWL------AVKRR---WLLIVIIIGSVFGITSFVTF--NQ----K---QIYEAEGKL
A0A2S0Q8C0      RQYWL------AVKRR---WFLIVIIIGSVFGITSFVTF--NQ----K---PIYEAEGKL
W6FSX4          RQYWL------AVKRR---WFLIVIIIGSVFGITSFVTF--NQ----K---PIYEAEGKL
A0A0V7ZNJ9      EQYWL------ILKRR---WVPASVVAGSVVGLAALVTF--MQ----K---PIYEAKAEL
A0A0R0M9H9      QVYWL------ILKRR---WLVILLVMASVLGAAISYTY--SQ----K---PVYQAKGKL
A0A1S1ZVW2      QVYWL------ILKRR---WLVILLVMASVLGAAISYTY--SQ----K---PVYQAKGKL
A0A1B7WX82      QQYWL------IFKRR---WLVSSIVFASVFGITAFVTY--TT----K---PVYESEGKL
A0A1B7WTD1      QQYWL------ILKRR---WFVASVVMASVISATAFMTY--TQ----K---PVYESQGKL
A0A480ABC0      QQYWL------ILKRR---WFVASVVMASVISATAFMTY--TQ----K---PVYESQGKL
A0A1Z4LRU5      GQYWL------ILKRR---WLPALLVTSSIFGLAAFVTF--RQ----K---PVYQAEGKL
A0A1Z4JVB4      QQYWL------ILKRR---WLLTSFVTGSVFGLAALLTF--LQ----K---PAYESPAKL
K9PIA4          QHYWT------VLKRR---WLVTSIVISTVFGLTALVTF--LK----T---PVYESKAKL
A0A1Z4M597      QQYWT------VLKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A1Z4MWT1      QQYWT------VLKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A1Z4TX53      QQYWT------VLKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A1Z4HVE1      QQYWT------VLKRR---WPVTTVVIGSVFGLTCLFTF--LQ----K---PVYESQAKL
A0A252ECZ1      HQYWP------ILKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A1Z4G5Y1      QEYWP------ILKRR---WPVTAVVIGSVFGLTALVTF--VQ----K---PVYESQAKL
A0A252DNA2      QEYWP------ILKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A252E1Q4      QEYWP------ILKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A5P8VSD1      QQYWL------TLKRR---WLLIITIMGSVFGVTGLVTF--IQ----K---PIYEAESKL
A0A2A2TNQ5      QEYLL------VLKRR---WLAAAIVMGSVFGITAFVTY--SQ----K---PIYEASGKL
A0A3S1C4K5      QQYLR------ILKRR---WLVTAGVMGSVFGLTALVTF--SQ----K---PVYESQGKL
A0A1X4G3D5      QLYWM------ILRRR---WLVVLLVMASVLGGAISYTL--FQ----K---PVYQAKGKL
D4TNI2          QLYWM------ILRRR---WLVVLLVMASVLGGAISYTL--FQ----K---PVYQAKGKL
A0A1Z4H6Z8      QEYWP------ILKRR---WPVTAVVIGSVFGMTALVTF--LQ----K---PVYESQAKL
A0A1Z4NPM1      QQYWL------ILRRR---WLVILLVLGSVFGLAAFYTF--TL----K---PVYEAGGKL
A0A3F3KPR9      QIYWL------ILKRR---WLVILLVIASVLGAAISYTY--SQ----K---PVYQAKGKL
D4TGN7          QIYWL------ILKRR---WLVILLVIASVLGAAISYTY--SQ----K---PVYQAKGKL
A0A1Z4UZW9      QQYWL------IFKGR---WPMASIVFAVVFGVTALVTY--ST----K---PVYESEGKL
A0A0K2M5H0      QQYWL------IFKRR---WPVASVVFAFVFGVTALVTY--ST----K---PVYESEGKL
A0A1B7VSH4      QQYWL------IFKRR---WLVASIVFASVFGATALVTY--LT----K---PVYESEGKL
A0A1B7W126      QQYWL------IFKRR---WLVASIVFASVFGATALVTY--LT----K---PVYESEGKL
A0A3D4C6Q6      QQYWL------IFKRR---WLVASIVFASVFGATALVTY--LT----K---PVYESEGKL
A0A1B7UVJ4      QQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PVYESEGKL
A0A1B7UTR1      QQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PVYESEGKL
A0A5C0DRW9      QQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PVYESEGKL
K7W0A4          QQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PIYESEGKL
A0A1U7HGH0      HKYWY------ILKRR---WLPAVAAFGTVMGITYLHTL--SR----V---PIYQAQGEL
K9XJD3          HKYWC------ILKRR---WLPAVAAFGTVMGITYLHTL--SR----V---PIYQAQGEL
A0A2T1CIL7      QKYWL------VLKRR---WLPATMIFTGVTGIFVLSAL--SK----P---PTYMAEAQL
A0A1Z4RPC6      GNYLQ------KLKRR---WIPALAVFIVTVGTTAFLSG--FL----E---KNYKSEGKI
A0A2T1CMZ0      EEYLL------KLKRR---WLPALSVFVVTVGTTLFLTS--FL----E---KTYKSEGKI
L8M4F7          GEYLL------KLKRR---WKIASALFLLTVGAAGLLST--KL----S---TKYEAEGKL
A0A140K2P2      SQYLI------KLRRR---WKLALAVFLLTAGITTALSL--LL----Q---KTYQAQGKL
K9XWX4          SGYLI------KLRRR---WKLALAVFLLTAGVTTALSL--LL----Q---KTYQAQGKL
A0A140KB14      YNYLQ------KLSRR---WKPALAVFLLTVGSMAALST--LL----K---KSYQAEGKL
K9XX88          YNYLQ------KLRRR---WKPALAVFLLTVGSVAALST--LL----K---KSYQAEGKL
A0A563VSV6      ASYFQ------KLKRR---WKPALAVFLLTVVSTFAATS--LL----E---EKYQAEGKI
L8LZE9          LSYLQ------KIQRR---WKPALAVFLLTAGSIGLASV--FL----T---TKYQAGGKI
A0A433V7A0      QKGWL------TIKRH---WKPALGIFGVVFIITGIGVL--MK----S---PSYTAYGKL
A0A1Z4NDS1      QKYVQ------VLQRR---WLPGLAIFGTCVTLATIYAF--SL----Q---PSYKAEGNL
K9F4D9          QKYWR------VLKRR---WLIALTVFGLTTTAAVGVGI--TQ----K---PEYQAESKL
U9VXM0          QKYWR------VLKRR---WLIALTIFGLTTTAAVGVGI--TQ----K---PEYEAEAKL
A0A2T1FTR8      AQYWL------VLKRR---WMPAALVFALTTAVATVWTF--KQ----Q---EIFQAKGQV
K9UA41          AQYWL------VLKRR---WMPAALVFALTTAVATVWTF--KQ----Q---EIFQAKGQV
A0A0C2LBE2      QKYWL------ILQRR---WLPAVGVCGVVVSLASLLAF--SS----K---PTFKAEGSL
A0A433NN38      QKYWL------VLQRR---WLPAVGIFGTVLTLASVYAF--SL----K---PYYQAQASL
A0A2N6K0T2      QKYLL------VLQRR---WMTAVGVFGVIVSLALLYAL--ST----K---PTYTAQASL
A0A2N6ML72      QKYLL------VLQRR---WMTAVGVFGVIVTLALLHAL--ST----K---PTYTAQASL
G6FQZ6          QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--SI----K---PTYTAQASL
A0A2N6MQX9      QKYLL------VLQRR---WMTAVGVFGVVFTLALLHAL--ST----K---PTYTAQASL
A0A2N6KXT6      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A2N6KGB9      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A2N6L3Y5      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A0S3TIS7      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A1U7GW28      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A2N6LW63      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A328IH74      QKYLL------VLQRR---WLTAVGICGVVLSLALLYAF--SL----K---PTYTAQASL
A0A4D9CIB0      QKYLL------VLQRR---WMTAVGICGVVLSLALLYAF--SL----K---PTYTAQASL
A0A1Z4TQ63      QKYLL------VLQRR---WMTAVGVFGAVVTLALLYAF--SL----K---PTYTAQASL
A0A4Q9J8G2      QKYLL------VLQRR---WMTAVGVFGVVLTLALLYAL--SS----K---PTYTAQASL
A0A1Z4SMD6      QNYWL------VLKRR---WLIAAGVLLTFVGLSGVAIY--MQ----K---PEYEASGML
A0A2H2Y096      QNYWL------VLKRR---WLIAAGVLLTFVGLSGVAIY--MQ----K---PEYEASGML
K9S8M8          QKYWL------ILKRH---WLPATGAFLLAVCGAAAMAF--TA----E---PIYEAQGKL
A0A1Z4NFV0      HRYWL------VLKRR---WLVVVGILAASTALSGFVLS--TQ----R---PQFEAIGQL
B0CAX4          RNYFR------ILRRR---WIPATAVFGSVFVLTALATF--LQ----K---PVYEAEGKL
U5DPF5          QKYWS------ILKRR---WLPASLVTISTIGLTGIYSA--RQ----T---PIYEARARL
A0A350Y0P6      QKYWL------ILRRR---WLPSTVVFGFIFTLATTVAF--VK----K---PSYSAYGKL
A0A352X940      QKYWL------ILKRR---WLPATMVFLLSIGVAVGVAY--TR----Q---PIYEAGGKL
B8HTN4          GKYLT------ILKRR---WLGGAIAFGSILSLVIAYTL--LQ----K---PVYQAQGLL
A0A2A2TPF8      QNYWL------VLKRR---WLIASGIFLTSVALSGFVIS--LQ----R---ANYEAKGKL
A0A1Z4R0P8      QNYWL------VLKRR---WPIALGIFLTSVALSGFAIS--LQ----K---ANYEAEGKI
A0A0T7BUI3      QQYFL------VLQRR---WKILLALIITSVGFSGFAIL--RQ----K---PQYQATGML
A0A1Z4LP32      QQYWL------IIKRR---WLFIVAAMLGSIGLSWFVIL--QQ----K---PQYQANGLL
K9REP9          QQYWL------IVKRR---WLFLVAAMLGSIGLSWLLIL--RQ----K---PEYQATGLL
A0A1Z4SIJ3      QKYWL------VLKRR---WLFVAVTVAASVGVAGIFIV--RQ----H---PEYRANGML
A0A2H2XPG4      QKYWL------VLKRR---WLFVAVTVAASVGVAGIFIV--RQ----H---PEYRANGML
K9V3C7          KNYWL------VLKRR---WLIAAGIFLTSVAMSGFVIS--LQ----K---ATYEASGKL
A0A1Z4T6Y7      RNYWL------ALKRR---WLVASGIFITTVALSGFAIS--LQ----R---PTYQASGKL
A0A2H2Y561      RNYWL------ALKRR---WLVASGIFITTVALSGFAIS--LQ----R---PTYQASGKL
A0A1Q4S362      RSYWL------VLKRR---WLVASGILFTSIALSGFAIS--LQ----R---PTYQASGKL
A0A3S1CIN8      RSYWL------VLKRR---WLIASGILFTSIALSGFAIS--LQ----R---PTYQASGKL
A0A2A2TC28      QQYWL------VLKRR---WLIAATVFCASVGLSGLVVL--RQ----K---PQYEASGML
A0A0C1NCB0      QKYLL------VIQRR---WHIVAGVMLVSMVLSGLGIY--LQ----K---PKYQATGIL
A0A2N6K7Q9      QQYLL------ILKRR---WRLIAAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6MXH6      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6M5A8      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6LL61      QQYLL------ILQRR---WRLITTIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A0S3TP66      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
G6FP91          QQYLL------ILKRR---WRLITTIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A1U7GYR5      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6KY52      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6KMP5      QQYLL------ILKRR---WQLITTIIVASIGLSGSVLF--MQ----K---PEYQADGIL
A0A2N6MA45      QQYLL------ILQRR---WRLITTIIVASIGLSGSALF--MQ----K---PEYQADGIL
A0A4Q9J9V9      QQYIL------VLKRR---WQLIASIIIASIGLSGLALF--MQ----K---PEYQADGIL
A0A328IGA1      QQYIL------VLKRR---WQLIASIILASIGLSGLALF--MQ----K---PEYQADGIL
A0A4D9CE41      QQYIL------VLKRR---WQLIASIILASIGLSGLALF--MQ----K---PEYQADGIL
A0A0M0SFT2      QQYIL------VLKRR---WRLIASIVLAAIGLSGLALF--MQ----K---PEYQADGIL
A0A1Z4TLC8      QQYIL------VLKRR---WRLIASIIIASIGLSGLALF--MQ----K---PEYQADGIL
A0A0C2LFH0      QKYWL------VLKRR---WPIVVGVLLASIGFSSFLIF--LQ----K---PEYQASGML
A0A1Z4IYV4      QKYWL------VLKRR---WPIVAGVVLASVGLSSFAVF--LQ----K---PKYQASGML
A0A1Z4Q0T6      QKYWL------VLKRR---WPIVAGVVLASIGLTTFAVF--LQ----K---PEYQATGML
A0A0C2PT44      QKYWL------VLKRR---WPIVAGSVLTSIGLTTFAVF--LQ----K---PEYQATGML
A0A1D2P6J4      QKYWL------VLKRR---WPIVAGVVLASVGLSSFAVF--LQ----K---PEYQATGML
A0A4R4IQ40      SKLWL------ILKRR---WLPGTGVFSIILGLTIIAVC--LQ----K---PVYEATGKL
A0A433W533      SKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATGKL
A0A2P8QWJ3      SKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATGKL
A0A2T1FKP8      SKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATGKL
K9U6L7          SKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATGKL
A0A3M9ZEU1      QKYWL------VLKRR---WLPATGVFGTVVALSTLAAV--MQ----K---PTYTATASL
A0A1Z4JK72      QNYWL------ILKRR---WLTAATVLAATVGLVGLATS--MQ----R---PSFEANGRL
A0A0N7Z489      QSYWL------VLKRR---WLVAAGVFAATVGVAGLATS--LQ----R---PNYEANGRA
A0A0S3TXS2      QSYWL------VLKRR---WLVAAGVFAATVGLAGLATS--LQ----R---PNYEATGRV
A0A1Z4RN12      NKYWQ------VLKRR---WLPATATFTGVVLLSLIAAL--SS----Q---KVYEAEAQL
A0A2T1CMF9      SRYWQ------VVRRH---WIPASATFAGVLALSLIAAL--AS----K---NIYQAEARL
Q7NDC5          REYLR------ILNRH---WPYAAGTALAVVTVVTVWTF--AL----P---PVWEAQGRL
U5QGK3          RDYLR------VLNRH---RLYAGGVFVLVVAGVAVWTF--TS----P---SVWEAKGRL
A0A2W4UY24      QKYWL------VLKRH---WLLALAVCGLTTAAAAFLGS--TQ----A---LLYKAEGKL
A0A2T1GMT4      SHYLF------AVKRH---WIPAVSIFAATVALSIAATS--LL----K---PSYQAEGRL
K9UI51          SHYLF------AVKRH---WIPAVSIFAATVALSIAAAS--LL----K---PSYQAEGRL
K9QM62          HRYLL------MLKRR---WILTVGIFFATAGFGVFATT--LM----K---PSYEAAGKL
A0A1Z4FWI3      GRYLS------VLKRQ---WIPATTIFASTVAVSVMATT--FM----K---PSYESEGKL
A0A1Z4JYE7      KIYLY------LLRRR---WISVTSIFLGTVSLSILATT--LL----K---PAYESSGKL
A0A2T1FXY4      SQYLL------SLKRR---WLPAVSIFATTVTLSVVAAT--LM----R---PSYEGEGQL
A0A4V2X3N2      SQYWL------SLKRR---WLPTVSIFATTVTLSIVAAA--FM----K---PSYEGEGKL
K9TYI2          SQYLL------SLKRR---WLPAVSIFATTVTLSVVAAA--FM----K---PSYEGEGKL
A0A1Z4QL41      GRYLS------SVKRH---WIPATCIFATTVILSALAST--RL----K---PSYESEGKL
A0A252D4T4      GRYLS------IVKRQ---WLPAVTIFASTVALSAVATT--FL----K---PTYEAEGKL
A0A252DJH5      GRYLS------IVKRQ---WLPAVTIFASTVALSAVATT--FL----K---PTYEAEGKL
A0A252EB80      GRYLS------IVKRQ---WIPAVTIFASTVALSAVATT--FL----K---PTYQAEGKL
A0A1Z4HPW5      GRYLS------IVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A1Z4MSN1      SRYLS------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A1Z4U1C2      SRYLS------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A0D6KV51      -----------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A1Z4MKF8      SRYLS------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A2C6WC43      NRYLL------MLKRW---WVPAATIFIATVMLSAVATR--FI----K---PSYEAEGKL
A0A1Z4L5A1      NRYLL------MLKRW---WIPAATIFLATVMLSAVATR--FM----K---PSYEAEGKL
A0A367QD86      NRYLL------MLKRW---WIPAATIFIATVMLSAVATR--FM----K---PSYEAEGKL
A0A235IZ96      NRYLL------ILKRW---WIPAVGIFVGTVMLSAISTT--FM----K---PSYEAEGKL
A0A2L2NGP0      NRYLL------ILKRW---WIPAVGIFVGTVMLSAISTT--FM----K---PSYEAEGKL
A0A2K8SM78      ------------------------------------------M----K---PSYEAEGKL
A0A2R5FPC0      SRYLL------ILKRW---WLPGTAIFAATVMLSAVATQ--FM----K---PSYEAEGKL
A0A5P8W5T6      GRYLL------ILKRW---WLPATAIFAATVMLSAIATQ--FM----K---PSYEAEGKL
A0A140KBA0      KKYWL------VLKRR---IVPASITCLGVMTLSLVTAL--SL----E---QVYQAEGQV
K9XSG1          QKYWL------VVKRR---IVPASVTCLGVITLSLVTAL--SL----E---QIYEAEGQV
A0A0F5YE28      GKYLQ------TVKRY---WLIVISVFLLCVGLSVYGTK--YL----K---PTYAASGKL
U7QEH7          GKYFK------TVQRY---WLVVIGVFALCVGLSVYGTK--YL----E---PTYAASGKL
A0A3S1ATK5      SRYLL------MIKRQ---WIPAASIFVATIALSALATT--RL----Q---PSYEAEGKL
A0A2Z6CPH0      SHYLM------ILKRR---WLCVTSIVIGTIALSALAAT--LI----K---PSYEAEGKL
A0A1Z4GT50      SRYLL------MLKRQ---WLPANSIFAATVAMSALATT--YM----K---PSYEAQGKL
A0A1Z4GIX0      NRYLL------VLRRR---WILILSILAASVGLSVAATT--LL----K---ASYEAEAKL
A0A2H6LC24      NRYLL------VLRRR---WILILSILAASVGLSVAATT--LL----K---ASYEAEAKL
B2J6N5          SRYLL------ILKRW---WLPATVIFTATVILSAIATQ--FM----K---PSYEAEGKL
A0A367RMI4      NRYLL------ILKRW---WLPAFSVFVATVILSAISTQ--FL----K---PDYEAEGKL
A0A235HUM0      NRYLL------ILKRW---WVPAFSIFVATVILSAISTK--FL----K---PDYEAEGKL
A0A2L2NW47      SRYLL------ILKRW---WLPAFSIFVATVILSAISTQ--FL----K---PDYEAEGKL
A0A1E2WUR1      NRYLL------ILKRW---WLPAVSIFVATVILSAVSTR--FM----K---PDYEAEGKL
A0A235IKU3      NRYLL------ILKRW---WIPAVGIFVGTVMLSAISTT--FM----R---PSYEAEGKL
F4XKF3          SQYKL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A1D9FX10      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A1D8TNX9      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A1U7MYU6      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A3C0NJ41      QKLWL------ALKRR---WLPGVAVFAVVVGLTVPLALSKKQ----K---TDYEAKGKL
A0A352AG88      QKLGL------VIKRR---WLIGAVVFLGMVGLTIPMALLQSQ----Q---TSYEAKGKL
A0A350Y374      YKLWL------VIKRR---WLVGGGVFVLMVGLTIPVALTQMQ----K---GDYEAQGKL
A0A355DPX0      YKLWL------VIKRR---WLVGGGVFVLMVGLTIPVALAQMQ----K---GDYEAQGKL
A0A0D8ZUV2      HKLWL------ILKRR---WLPAAGVFSCVVGLSVVAAM--MP----K---SSYQAEGKL
A0A433VDI0      QKYWS------ILKRR---WLPAVIVFSGVVGLSVVVVL--LQ----K---PVYQAEGKL
A0A3D1PG43      QNLWL------SIKRR---WLPAAGIFGCVLGCSALAAS--LQ----Q---PMYQAQGKI
A0A2P8QQ72      QNLQL------AIKRR---WLAAAGVFGFVLGLSTIVTL--LQ----A---PLYQAEGKL
K9TZQ7          QNLQL------AIKRR---WLAAAGVFGFVLGLSTIVTL--LQ----A---PLYQAEGKL
A0A2G7GPR0      KRVWL------ILKRR---WLPAAGVFGVVVAAAAALAS--MQ----R---PVYEAQGKL
K9XH68          KRVWL------ILKRR---WLPAAGVFGVVVAAATAFAS--MQ----R---PVYEAQGKL
A0A1U7HW70      KRVWL------ILKRR---WLPAAGVFGVVVAAATAFAS--MQ----R---PVYEAQGKL
A0A2S6VEJ8      KRVWL------ILKRR---WLPAAGVFGVVVAAATALAS--MQ----R---PVYEAQGKL
                                                                     :      

K9SLA9          LIESTIESTTGSVAAPTTTASIPNPNQDNIAS------SEGLPPLPTDTAISTIPPGDR-
A0A168TT23      QINHE---------------------------------TANILRIEDFEAAPR--SWQGV
A0A0M1JWX9      LVEPVTGEGANSL-------------------------SSRLGALAGGLGMGIPGSSGSG
A0A2T1M1V6      NI----PIKG-DKL------------------------NANLGTLGNLSDGGS--DFTRE
A0A2G7GCS2      NL----PQPT-TRL------------------------DTNLGTLGQLQNSAL--GFTRE
K9XBH8          NL----PQST-NSI------------------------NASLGTLGQLQNSGL--GFSRE
A0A1Z4LJ30      IL----PNVT-NDS------------------------DADLGKLGSVRDGGV--VFSQQ
K9RI76          IL----PNVT-NQS------------------------DADLGKLGNVRDEGI--VFSQQ
A0A352AE27      IL----PDTT-SSL------------------------DANLGTLGSLTNDEP--VFSNQ
A0A3B8JH60      IL----PNTT-GDL------------------------DANLGTLGSLRNGGS--GFSTE
A0A3C0N766      IL----PNTT-GDL------------------------DANLGTLGSLRNGGS--GFSTE
K9W9J7          IL----PQKS-GNL------------------------DANLGTLGSLRNGDP--GFSSE
A0A139WSU3      IL----PKTT-SNL------------------------DANLGTLGSLRNGDS--AFSSE
A0A433VN22      IL----PKTT-SNL------------------------DASLGTLGTFKNGNL--DFSPE
Q7NF11          IL----PSTN-KNA------------------------EISLGALGEVRETGT--SFSSE
A0A1Z4JCS8      IL----PSSNGGNL------------------------DANLGTLGSYRNSDP--SFSPQ
F4XTX2          IL----PET--GKL------------------------QASLGTLGSLTKGDS--ELSAK
Q7NJN6          IL----PNAS-SNL------------------------SANLGPLGNIQQQGL--PFSNE
U5QCC3          IL----PDTS-SNL------------------------SASLGPLGNLQQQGL--TFSTE
A0A3S0Y9N9      VLKK-NATSSLTGV------------------------GSQLGQLEN----SVSG--KP-
A0A433UNK7      VLKK-NSTSSLTGV------------------------GNQLGQLES----SVSG--RP-
A0A3M1SVZ4      LIEKVSSTPSVTGV------------------------GSEVGLLDP----LTKE-NSP-
A0A654SFI6      --------IEISQI------------------------SANVTSLDP----LENESRVSE
K9SSQ0          LIEN-AP-----------------------------------------------TDGNS-
A0A2W1JIN9      ILDG-TPSTSVSDF------------------------GSTIAQQP---------GNGA-
A0A318AJV1      RIDP-SLNPMSQDQ------------------------GQGVI------------GAET-
A0A1U7N2U4      MLEN-KK-VSVSEL------------------------GRNLSQVPA----NTPGEASP-
A0A1D9G1F2      MLDN-KK-VSVSEL------------------------GDNLSQVPA----NTPGGADP-
F4XV38          MLDN-KK-VSVSEL------------------------GDNLSQVPA----NTPGGADP-
A0A2P8QIL5      MLDG-KQLSLAGET------------------------GRDLTQESA----RLD--SNP-
A0A2T1FLY5      MLDG-KQLSLAGET------------------------GRDLTQESA----RLD--SNP-
A0A433W447      MLDG-KQLSLAGET------------------------GRDLTQESA----RLD--SNP-
K9U1K8          MLDG-KQLSLAGET------------------------GRDLTQESA----RLD--SNP-
A0A4V6P809      MLDG-KQLSLAGET------------------------GRDLTQESA----RLD--SNP-
K9UYB2          MVDE-KRGTSVSEL------------------------GRNLTQV------SNSPGNSP-
A0A218QN17      MQDD-RR-VSVSEL------------------------GRDLTQVSS----GAPGGPSP-
K9RKN2          MLDE-KQ-ISVSEL------------------------GRDLTQVAN----STPGGPSP-
A0A2I8ADV2      MVDA-KG-VSVSEL------------------------GRDLTQP-S----VVGRSSNP-
A0A1W5CKM3      MLDD-KK-ASVSEL------------------------GRDLTQI-N----STAIGRNP-
A0A5Q0GMF5      MLDD-KK-ASVSEL------------------------GRDLTQI-N----STAIGRNP-
Q3MEW0          MLDD-KK-ASVSEL------------------------GRDLTQI-N----STAIGRNP-
A0A1Z4KIC7      MLDD-KK-ASVSEL------------------------GRDLTQI-T----PTGVGRNP-
Q8YSM5          MLDD-KK-ASVSEL------------------------GRDLTQI-T----PTGVGRNP-
A0A1Q4S1H4      MVDD-KG-VSVSDF------------------------GRSITQLNA----GTPGGASA-
A0A433VBU6      MLDS-KS-VSVSAL------------------------GRDITQLDA----GTPGGASP-
A0A1Q4RZJ6      IFDD-RR-TSVSEL------------------------GRDLSQTSI----TSAG-NSP-
A0A1Z4SNV3      IFDD-KR-VSVSEL------------------------GRDLSQTSV----SGSG-NSA-
A0A2H2XJQ1      IFDD-KR-VSVSEL------------------------GRDLSQTSV----SGSG-NSA-
A0A3S5K358      IFDD-RR-TSVSEL------------------------GRDLSQTSV----TSPG-NSP-
A0A0T7BPJ4      MLDD-KR-VSVSDL------------------------GRDLTQVTS----TTPGGPSP-
A0A0C1QS61      MLDS-KQ-TSVSEL------------------------GRNLSQVSS----NTPGGPSP-
A0A139X3R8      MLDN-KQ-TSISEL------------------------GRDLSQVSS----NTPGGPSP-
A0A1Z4I7C5      MLED-KK-ASVSEL------------------------GRDLTQINS----SSVG-RNP-
A0A0C2MDK7      MLDD-KR-VSVSEL------------------------GRDLTQVSA----NAPG-ISP-
A0A1Y0RCK1      MLDD-KR-VSVSEL------------------------GRDLTQVSS----NSPG-NSP-
A0A1Z4PWZ0      MLDD-KR-VSVSEL------------------------GRDLTQVSS----NAPG-ISP-
A0A0C2QLT0      MQDD-KR-VSVSEL------------------------GRDLTQVSS----NAPG-ISP-
A0A1Z4J2K1      MQDD-KR-VSVSEL------------------------GRDLTQVSS----SGPG-ISP-
A0A3S0ZSX0      MLDD-KR-VSVSEL------------------------GRDLTQMPT----NIPGGPSP-
A0A2N6K4T3      MLDQ-KR-VSVSEL------------------------GRDLTQLSS----DTPGGSNP-
A0A370CKT2      MLDQ-KR-VSVSEL------------------------GRDLTQLNS----GTPGGSNP-
A0A0S3TL97      MLDQ-KR-VSVSEL------------------------GRDLTQLNS----GTPGGSNP-
A0A2N6M8A0      MLDQ-KR-VSVSEL------------------------GRDLTQLNS----GTPGGSNP-
A0A2N6M9E1      MLDQ-KR-VSVSEL------------------------GRDLTQLNS----GTPGGSNP-
A0A2N6KJI4      MLDQ-RR-VSVSEL------------------------GRDLTQLNS----GTPGGSNP-
A0A2N6MZ77      MLDQ-KR-VSVSEL------------------------GRDLTQLNS----GTPGGSNP-
A0A2N6KT20      MLDQ-KR-VSVSEL------------------------GRDLTQLNS----GTPGGSNP-
G6FSN3          MLDQ-KR-VSVSEL------------------------GRDLTQLNS----GTPGGSNP-
A0A4D9CI02      ILDQ-KR-VSVSEL------------------------GRDLTQLSP----GTSGNSNP-
A0A328I8B9      ILDQ-KR-VSVSEL------------------------GRDLTQLSP----GTSGNSNP-
A0A4Q9J4Z7      ILDQ-KR-VSVSEL------------------------GRDLTQLSP----GTSGNSNP-
A0A0M0SU69      ILDQ-KR-VSVSEL------------------------GRDLTQLSS----ATPGGSNP-
A0A1Z4TIZ8      ILDQ-KR-VSVSEL------------------------GRDLTQLSP----GTPGGSNP-
A0A0S3TYD7      LV----KKQASTTSVLGL--------------------QVDVGEIESLD------KSGP-
U5QL42          LVDNR------------------------------------QQIPVVQTTESALPSAAN-
K9QF04          MLDSATSDSDSNP---------------------------LADSPRRSAV--VPLQFRD-
A0A3C0N2P0      LVGPVSSSEDKLGKLA----------------------QSLNEGGG------SSSNTPD-
K9TLQ0          LVEPIKGQDNLEQ------------------------------LNQALTRNSGKGEILD-
A0A076HBF2      LITDP-ISNEGGG-RS----------------------GMANVEGTMFEQLARNTTSND-
A0A354B169      LITDP-ISSENSNGNS----------------------NATALSGTMFEQLARNTTSND-
G4FMX5          LITDP-ISNDSGNNSA----------------------SAGGLNGSMFEELARNTTSND-
Q0IDT5          LITDP-ISNEGGNNSA----------------------ASSAASGTVFEQLARNTTQND-
A0A2D6FCW3      LITDP-LNNESGN-RA----------------------AAAALDGGMFEELARNTTSND-
A3ZA21          LITDP-ISNEGGNGRN----------------------AAFAASGTMFEQLARNTTQND-
A0A140K3H3      LLENQKTQQSASV----------------------------SPEQQSLAT--GYYNLKD-
K9XUB8          LLENNKTQQSALV----------------------------SPGQQSLNT--GYSNLKD-
Q7NEU3          LLEDRNSQPKVLA-----------------------------DEASPMSY--FASNSAD-
A0A352XE00      LIGPVSGGDRLDE---------------------------LSQSLAQNTG--SQGNAPD-
B4VS56          LVGSVSGEDQLEQ---------------------------ISESLNQSAG--VQTNSID-
A0A352AAQ3      LVGSVSGEDRVEQ---------------------------LTEALSKTAN--IQVEGPD-
A0A350Y472      LVGSPSGEDQAEQ---------------------------LTEALSKTGT--VQVQGPD-
A0A355DVB4      LVGSPSGEDQAEQ---------------------------LTEALSKTGT--VQVQGPD-
A0A2P8VVX1      LVEPN-YQQELNS-----------------------------SDLSSFAD--QDPRDAD-
A0A2P8WHY0      IVEPN-YEDDVTA-----------------------------RELDGLAN--ASDQSID-
A0A2T1CMT9      LAESN-YQAKDLQ-------------------------DNQRDSEEQFAD--ANVEL-D-
A0A563VQJ3      LFRQN-TAASLTG---------------------------IGEDISSLDS--IGVNETP-
A0A1D8TX52      LVEPN-YIDKTRG------------------------------IESQFTE--STVDI-D-
A0A1U7N5X9      LVEPN-YIDKTRG------------------------------IESQFTE--STVDI-D-
A0A1D9G4T2      LVEPN-YIDKTRG------------------------------IESQFTE--STVDI-D-
F4XP71          LVEPN-YIDKTRG------------------------------IESQFTE--STVDI-D-
A0A2P8QVH5      LVSSNLYQGQNSN-------------------------AQGGVEESDFTD--SNLKV-D-
A0A2T1FT70      LVSSNLYQGQNSN-------------------------AQGGVEESDFTD--SNLKV-D-
A0A433W4W4      LVSSNLYQGQNSN-------------------------AQGGVEESDFTD--SNLKV-D-
K9U5W1          LVSSNLYQGQNSN-------------------------AQGGVEESDFTD--SNLKV-D-
A0A2W6ZAV2      LVSDP-IDASSTE-------------------------GAADSSLRALAL--QPQDRAN-
A0A2G7GMH8      LVEPN-YQGKTDQ-------------------------GQGKTTESEFAD--SNVEV-D-
K9W742          LVEPN-YQSKRQD--------------------------GQEGAEKQIVD--PNIQV-D-
A0A2T1DWE8      LVEPN-YQSKKDS---------------------------GAGSENQFAD--SNVEI-D-
A0A1U7I8L3      LVEPN-YQGKQEG---------------------------SKNAENDFAD--SNVEI-D-
A0A2T1DJL8      LSESN-YRSRKTD---------------------------NPATPS-FAD--SNVEI-D-
A0A1Z4J9W0      MVESN-YRERRSP---------------------------NDTRPS-FAD--PNVET-D-
A0A0N7Z5K9      LVESN-YRERRAP---------------------------GDNSPS-FAD--PNVES-D-
A0A0S3TXC5      LIESN-YRERRTP---------------------------GDNSVS-FAD--PNVET-D-
K9SA61          LVESN-YQGRDQN--------------------------GDRASEGQFTD--SNVKL-D-
A0A3D1PBA3      LIEPN-YQGKRDT--------------------------DAQRPSQQYAE--SGVKIDD-
K9XPB0          LIESN-YQTKDSTRGN----------------------DNNQYLEEEFAD--SSIEI-D-
A0A350Y7Z1      LIEPY-VQQKQEG---------------------------KPQTEEQFTD--SNVEV-D-
A0A352X2A7      LIEPL-VQEKQQR---------------------------RSE-ENQFTE--SNIEV-D-
A0A0D8ZYV0      LIEAN-YQGRKD---------------------------IQPGADSEFTD--ANVEI-D-
A0A4R4IUM6      LIEPN-YQGKKDG--------------------------TTPRQGEQYAD--SGVTIDD-
A0A2T1FP73      LIEPN-YQGKKDG--------------------------TTPRQGEQYAD--SGVTIDD-
A0A433VMS2      LIEPN-YQGKKDG--------------------------TTPRQGEQYAD--SGVTIDD-
K9TYA7          LIEPN-YQGKKDG--------------------------TTPRQGEQYAD--SGVTIDD-
A0A2P8QUE1      LIEPN-YQGKKDG--------------------------TTPRQGEQYAD--SGVTIDD-
A0A2T1DNG3      LV----EPNYQGKNSG----------------------ADPFTD-------AT--VEVD-
A0A2P8W9H0      LTP---SSTLETQIIS----------------------TLNPNALSNQ---TEFGNSTI-
A0A1Z4LN32      LF----RTDRTSSLTG-A--------------------GEEIGHLESI---KR--EANP-
A0A2I8A9F5      LF----QMNRTSSLTG-I--------------------GGKIGDLESI-------GSNP-
A0A218Q6R8      LF----QLNRTSSLTG-V--------------------GGRIGDLESI-------GANP-
A0A218QGE0      LF----QSNQTSSLTG-V--------------------GEKIGHLESI---KP--EANP-
B8HNB0          LT----GKEQSTPL------------------------GEEINSTSSY---SN--WSNP-
A0A563VS48      LI----KSNKTDTLSG-F--------------------ENETGNIEVI---SE--ESDP-
A0A318BJ18      EI----ARE-----------------------------ASQVTNFQGVERQSSLVDQEF-
A0A3B8Y8H9      LVDT--PGDSNRGLPGGI--------------------NSSLGNFLGVS--TN--SDNY-
A0A2W1JVB9      RI----KESQSGLT------------------------ELDLGGISPL---SG--DSSP-
A0A1Z3HMQ0      LF----QVDRSTSL-TGV--------------------GDEIGDLEAVN--PV--NSDP-
A0A1E5QP61      LFK---KQNTTSALVTDA--------------------GAKIGQLDTLT---Q--FNNP-
A0A3M2GIL5      LIK---KRNTTSALVTEA--------------------GAKLGELDSVY---Q--LNSP-
A0A433NM31      LLK---RTGSTSTV-TGL--------------------GKELGQLDSLVDSPE--SNYP-
A0A3M1PML8      QV----RSSGAAKL-TGV--------------------GEGLGELEKLT---L--QSNP-
A0A352X442      LI----QKDRSASL-TGL--------------------DEALSQFDKLA---Q--KSDP-
A0A0T7BPZ0      LI----RTNRTSSL-TGL--------------------GGDIGRLESLT---Q--TNNP-
A0A0M0SHU3      LI----KTNRTSSL-TGL--------------------GEDIGRIESLV---R--ENSP-
A0A1D2PBN3      LI----KTNRTSSL-TGL--------------------GEALGRLESLG---V--NNNP-
A0A0C2LVR7      LI----KTNRTSSL-TGL--------------------GEALGRLESLG---V--NNNP-
A0A1Z4PQB9      LI----KTNRTSSL-TGL--------------------GEALGRLESLG---V--NNNP-
A0A1Z4SFN6      LV----KTNRSTSL-TGL--------------------GESIGRIESLT---N--TNNP-
K9PGI8          LI----KTNRSASL-TGL--------------------GEGIGQVDSLV---N--TNSP-
A0A563VLD6      LLENP-QTKESARIVP--------------------------GNMTRG---SAFSSLRD-
A0A318BG22      EV----QREAPRVLDV----------------------NSAESDSRPS-------DSMF-
A0A2T1E9V8      LF----KQDKTSSLIG-L--------------------DSDAQAMDSQ-------SNSS-
A0A3M2GQQ6      LV----DDRSSVPVVP--------------------------GLESPY---PG--PQKD-
K9SGJ5          LI----DDATISVSNL----------------------PVND----GL---DKYSKEPS-
L8MYT6          LI----NNSTIPVSDI----------------------QVPNAPSSGL---PA-SPVIN-
A0A352JGJ6      LI----NNSTIAISDI----------------------QVP-----GL---PG-SSLIN-
A0A1J5GLS2      LI----NNSTIAVSDI----------------------QIP-----GL---PG-TSSIN-
A0A2W4W6M5      LI----NNSTIAVSDI----------------------QVP-----GL---PS-ASLIN-
A0A2W7AN33      LI-----NSTISAPNI----------------------QPT-----GA---ST-SSMVD-
A0A256BLV2      LV-----NSTIAVSDI----------------------QLP-----GL---ST-SSLVN-
A0A2W6ZXF3      LI----NNSTIAVSDI----------------------QVP-----GL---PG-ASSIN-
A0A2Z5WX66      LI----NNSTIAVSDI----------------------QVP-----GL---PG-TSLIN-
K9W1T3          LI----KKNNSTSLLL------------------------NLDKIDGS---AG--AGNQ-
A0A1Q4RTR1      TFN---KANLYSSLTG----------------------ITGGQELEMLGRGAN--AGNP-
A0A1Z4SQV2      LFN---RANLYSSLTG----------------------ITESQNIDV--PGIN--STNP-
A0A2H2XGN1      LFN---RANLYSSLTG----------------------ITESQNIDV--PGIN--STNP-
A0A433UXH8      LFN---KANLYSSLTG----------------------ITEGQNIDV--PGIN--SNNP-
A0A1Z4RMB9      LF----KQTSAASYTG-I--------------------GEEAGTLKPI---LN--DQTP-
K1XF69          LF----KVDRTSSLAG-I--------------------GEGLGELKAL---LA--DQTP-
B5W297          LF----KVDRTSSLAG-I--------------------GEGLGELKAL---LA--DQTP-
H1W7M8          LF----KVDRTSSLAG-I--------------------GEGLGELKAL---LA--DQTP-
A0A5Q4H6A5      LF----KVDRTSSLAG-I--------------------GEGLGELKAL---LA--DQTP-
D5A466          LF----KVDRTSSLAG-I--------------------GEGLGELKAL---LA--DQTP-
B4WP72          LI----KGGRTSSLTG-L--------------------NVDIGELEAL---DS-LQKDP-
A0A318B4H2      EI----QRSQAKVVNV------------------------GGLEMEDR---SR--DLQF-
B4WQE3          LTP---LVTLETQIIS----------------------TISPDALSNQSESVG--VGLL-
A0A2P8W4F7      LVE---PVTNAPPVGL----------------------EEVVGAQGNR---GA----LD-
A0A5Q4E0Z4      LVE---PVTAVNPLGL----------------------EAMVGVAGAR---NT--SGLD-
A0A2K3BR24      LF------------------------------------QGESQALALPTLEQQ-GNAGP-
K9YXY1          LF------------------------------------QGESQALALPTLEQQ-GNAGP-
U5QJM6          LLED--KSSQTQVLED----------------------AAQQIQLGGG---AD--FTTQ-
K9SX01          LFK---SQRQSNTLTG----------------------VNSVAQISDT---VA---GDP-
A0A4P7ZT55      LVSDP-LSEDRQLGGP----------------------SNQLSDLALV---NP--GTVD-
A0A1E5QIR9      LF----KKNNVTTNVTVV--------------------GKEVPEIHSP-------PTNP-
A0A1Z4IBC7      MI----MTNRTFSLTG-L--------------------PQDIGKLEPL---NV--NDNP-
A0A1W5CPC7      MI----KTNRTSSLTG-L--------------------PQDIGRLEPL---NV--NDNP-
A0A5Q0GKD1      MI----KTNRTSSLTG-L--------------------PQDIGRLEPL---NV--NDNP-
Q3MDC6          MI----KTNRTSSLTG-L--------------------PQDIGRLEPL---NV--NDNP-
A0A1Z4KM73      MI----KTNRTSSLTG-L--------------------PQDIGRLEPL---NV--NDNP-
Q8YNX7          MI----KTNRTSSLTG-L--------------------PQDIGRLEPL---NV--NDNP-
A0A367R4K6      MI----KTNRTSSLTG-L--------------------PEDIGRLEAL---NV--NDNP-
A0A1E2WSV8      MI----KTNRSSSLTG-L--------------------PQDIGRLEAL---NV--NDNP-
A0A2R5FRT9      MI----KTNRSSSLTG-L--------------------SEDIGRLEAL---NV--NDNP-
A0A2K8T1B6      MI----KTNRSSSLTG-L--------------------SQDIGRLEAL---NV--NDNP-
A0A235I9I0      MI----KTNRSSSLTG-L--------------------PDDIGRLEAL---NV--NDNP-
A0A2D0HQT8      MI----KTNRSSSLTG-L--------------------PDDIGRLEAL---NV--NDNP-
A0A2L2NU95      MI----KTNRSSSLTG-L--------------------PDDIGRLEAL---NV--NDNP-
A0A367S084      MI----KTNRSSSLTG-L--------------------PDDIGRLEAL---NV--NDNP-
A0A0V7ZFJ4      RF----NSDRVSALTA-L--------------------NSQMGEVAAI---TG--KGNP-
A0A367RIS1      LFN---KESGLSSLTG-V--------------------NEQLGQLSGV---TN--LSNP-
A0A235IXQ2      LFN---KQSGVSSLTG-V--------------------NEQLGQLSGV---TN--VSNP-
A0A1W5CNX3      LFN---KQSGVSSLTG-V--------------------SEQLGQLSGV---TN--LSNP-
A0A5Q0GJJ5      LFN---KQSGVSSLTG-V--------------------SEQLGQLSGV---TN--LSNP-
Q3MEB7          LFN---KQSGVSSLTG-V--------------------SEQLGQLSGV---TN--LSNP-
A0A1Z4KHN9      LFN---KQSGVSSLTG-V--------------------SEQLGQLSGV---TN--LSNP-
Q8YT70          LFN---KQSGVSSLTG-V--------------------SEQLGQLSGV---TN--LSNP-
A0A218Q4C1      IFD---KQSSVSSLTG-V--------------------SERVGELSRL---TN--LSNP-
A0A166IWU6      IFD---KQNSVSSLTG-V--------------------SEGVGELSGL---TS--SSNP-
A0A2S0Q8C0      IFD---KQNSVSSLTG-V--------------------SEGVGELSGL---TN--SSNP-
W6FSX4          IFD---KQNSVSSLTG-V--------------------SEGVGELSGL---TS--SSNP-
A0A0V7ZNJ9      LFN---KQSNVSSLTG-L--------------------SGAVGELSGI---TN--LSNP-
A0A0R0M9H9      LFE---KKDGVSSLTS-L--------------------ATSVGELGGI---GN--NSNP-
A0A1S1ZVW2      LFE---KKDGVSSLTS-L--------------------ATSVGELGGV---GN--NSNP-
A0A1B7WX82      VFT---KKGVASSLTTNI--------------------SQQMGELGGL---TN--LSNP-
A0A1B7WTD1      VFT---KKDAASSLSS-L--------------------SDKMGELGGL---TN--LSNP-
A0A480ABC0      VFT---KKDAASSLSS-L--------------------SDKMGELGGL---TN--LSNP-
A0A1Z4LRU5      RFD---KNNNVSSLSG-L--------------------GGQIGELSGI---TN--LSNP-
A0A1Z4JVB4      IFN---KQNGISSFSD-I--------------------AAKAGELRGL---TS--FSNP-
K9PIA4          LFN---KQNGVSSLTG-F--------------------SSKMGELGGL---TN--LSNP-
A0A1Z4M597      LFN---KQNGVSSLTG-L--------------------SSQVGELSGL---TN--LSNP-
A0A1Z4MWT1      LFN---KQNGVSSLTG-L--------------------SSQVGELSGL---TN--LSNP-
A0A1Z4TX53      LFN---KQNGVSSLTG-L--------------------SSQVGELSGL---TN--LSNP-
A0A1Z4HVE1      LFN---KQNGVSSLTG-L--------------------SSQVGELSGL---TN--LSNP-
A0A252ECZ1      LFN---KQSGVSSLSG-L--------------------SSQVGELSGL---TN--LSNP-
A0A1Z4G5Y1      LFN---KQSGVSSLTG-L--------------------SSQVGELSGL---TN--LSNP-
A0A252DNA2      LFN---KQSGVSSLTG-L--------------------SSQVGELSGL---TN--LSNP-
A0A252E1Q4      LFN---KQSGVSSLTG-L--------------------SSQVGELSGL---TN--LSNP-
A0A5P8VSD1      LF----NNQSPSSLTA-V--------------------SQQLGQLTGL---TT--NSNL-
A0A2A2TNQ5      LL----KQNEASNLTG-L--------------------NQKLGELSGL---TN--TSNP-
A0A3S1C4K5      LI----KNNGASSLTG-L--------------------SEKVGALSAL---TN--TSSP-
A0A1X4G3D5      LFEGD-RVSSLTRLGG-L--------------------AELAQLTGAT---GS--GGSG-
D4TNI2          LFEGD-RVSSLTRLGG-L--------------------AELAQLTGAT---SS--GGSG-
A0A1Z4H6Z8      LFN---KQSGASSLSG-L--------------------SSQVGELSGL---TN--LSNP-
A0A1Z4NPM1      ML----KQNSSSSLIG-L--------------------SDKLGELSGL---TN--TSNP-
A0A3F3KPR9      LFE---KKDGVSSLTS-L--------------------ATSVGELGGL---GN--NSNP-
D4TGN7          LFE---KKDGVSSLTS-L--------------------ATSVGELGGL---GN--NSNP-
A0A1Z4UZW9      VFT---KKSGASSLTS-L--------------------SQQMGELGAL---TN--LSNP-
A0A0K2M5H0      VFT---KKSGASSLSS-L--------------------SQQMGELGAL---TN--LSNP-
A0A1B7VSH4      VFT---KKSGASSLSG-L--------------------SQQMGELGAL---TN--LSNP-
A0A1B7W126      VFT---KKSGASSLSG-L--------------------SQQMGELGAL---TN--LSNP-
A0A3D4C6Q6      VFT---KKSGASSLSG-L--------------------SQQMGELGAL---TN--LSNP-
A0A1B7UVJ4      VFT---KRSGASSLAD-I--------------------SQSMGELGGL---TN--LSNP-
A0A1B7UTR1      VFT---KRSGASSLAD-I--------------------SQSMGELGGL---TN--LSNP-
A0A5C0DRW9      VFT---KKSGASSLAG-L--------------------SQSLGELGGL---TN--LSNP-
K7W0A4          VFT---KKSGASSLAG-L--------------------SQSLGELGGL---TN--LSNP-
A0A1U7HGH0      LF----RQDRSSSLIG----------------------LQSATQANPT---TQ--NDTS-
K9XJD3          LF----RQDRSSSLIG----------------------LQSATQANPT---TQ--NDTS-
A0A2T1CIL7      LI----RIDKSSQLVG-L--------------------EEERGQIEVI---GK--DSNP-
A0A1Z4RPC6      LF----KKNSVDSFLD-L--------------------QSKPEQLNSI---LP--DQTP-
A0A2T1CMZ0      LF----KKNTPNELLN-L--------------------SENTNEFNSL---LN--TQTP-
L8M4F7          LF----KSSSLASLTG-V--------------------AKNSSALETLNYSLG--QQSP-
A0A140K2P2      LF----KQNSTASLTG-V--------------------GKNVGELKPL---LV--NQSP-
K9XWX4          LF----KQNSTASLTG-V--------------------GENVGELKPL---LV--NQSP-
A0A140KB14      LF----KQNNTASLTK-V--------------------GQGVGELKPL---LN--DQSP-
K9XX88          LF----KQNNTASLTK-V--------------------GQGIGELKPL---LN--DQSP-
A0A563VSV6      LF----KQKN--NLLP-V--------------------GEGVGELTTF---LN--NQTP-
L8LZE9          LF----EPQD--NLTD-L--------------------GNPSNDLQSL---TV--GATP-
A0A433V7A0      LF----RVDTTPFLIG-IKTK-----------------DENVSPLVPL---TF--EGNP-
A0A1Z4NDS1      LI----KTNNTPSLTG-L--------------------GEAIGKLESL---TR--DSNP-
K9F4D9          LF----ELSNQASALV-GL-------------------EGGNRELRAL---TN--LDNP-
U9VXM0          LF----ELSNQTSSLV-GF-------------------EGGTRELRAL---TN--LDNP-
A0A2T1FTR8      IL----KKTNKTSALL-SSATNAAS-------------GGAIGELEGL---TG---STP-
K9UA41          IL----KKTNKTSALL-SSATNAAS-------------GGAIGELEGL---TG---STP-
A0A0C2LBE2      LI----KTNRTSSLTG-L--------------------GEAIGRLDTL---TM--ESNP-
A0A433NN38      LI----KTNRTSSLTG-L--------------------GEDLGRLEAL---VS--QSSP-
A0A2N6K0T2      LI----KTNRTSSLTG-L--------------------GEDLGRLESL---VQ--DNSP-
A0A2N6ML72      LI----KTSRTSSLTG-L--------------------GEDLGRLESL---VQ--DNSP-
G6FQZ6          LI----KTSRTSSLTG-L--------------------GEDLGRLESL---VQ--NNSP-
A0A2N6MQX9      LI----KTSRTSSLTG-L--------------------GEDLGRLESL---VQ--DNSP-
A0A2N6KXT6      LI----KTSRTSSLTG-L--------------------GEDLGRLESL---VQ--NNSP-
A0A2N6KGB9      LI----KTSRTSSLTG-L--------------------GEDLGRLESL---VQ--DNSP-
A0A2N6L3Y5      LI----KTSRTSSLTG-L--------------------GEDLGRLESL---VQ--DNSP-
A0A0S3TIS7      LI----KTSRTSSLTG-L--------------------GEDLGRLESL---VQ--DNSP-
A0A1U7GW28      LI----KTSRTSSLTG-L--------------------GEDLGRLESL---VQ--DNSP-
A0A2N6LW63      LI----KTSRTSSLTG-L--------------------GEDLGRLESL---VQ--DNSP-
A0A328IH74      LI----KTNRTSSLTG-L--------------------GEDIGRLESL---VR--ENSP-
A0A4D9CIB0      LI----KTNRTSSLTG-L--------------------GEDIGRLESL---VR--ENSP-
A0A1Z4TQ63      LI----KTNRASSLTG-L--------------------GEDIGRLESL---AE--NNTP-
A0A4Q9J8G2      LI----KTNRASSLTG-L--------------------GEDLGRLESL---AE--KDSP-
A0A1Z4SMD6      LF----QSNRTSSLTK-V--------------------GEKIGDLESV---MR--EGNP-
A0A2H2Y096      LF----QSNRTSSLTK-V--------------------GEKIGDLESV---MR--EGNP-
K9S8M8          LL----KKKNTTSALV-TDA------------------SAKVGELDTL---SD--KDTP-
A0A1Z4NFV0      LF----QSNRTSAYTK-I--------------------GENTGSLESL---RH--ESNP-
B0CAX4          LL----KKQGGATIAD-LEIG-------------------GLGGLEAL---SS--KSSP-
U5DPF5          LL----QTADGAIPFA-GFSGGSST------------------------------SNTL-
A0A350Y0P6      LL----QKRSATSALV-TEA------------------GEKIGQLEAL---NN-FINTP-
A0A352X940      LL----QKKNKTSALV-TKA------------------GEKIGELDSL---NA-FINTP-
B8HTN4          LL----KDSENPLASM-G--------------------ATSVGNLVAL---GG--KSSP-
A0A2A2TPF8      LF----QANRTNSLTG-V--------------------DGKFRDLESI---RR--EANP-
A0A1Z4R0P8      LF----QANRTNSLTG-V--------------------DGKFRDLESI---RR--EANP-
A0A0T7BUI3      LF----KSDRISSLTK-A--------------------GEKIGDLESL---IR--ENNP-
A0A1Z4LP32      LF----KSDRISSLTK-A--------------------GEKIGDLESL---MR--EGNP-
K9REP9          LF----KSDRISSLTK-A--------------------GEKIGDLESL---MR--EGNP-
A0A1Z4SIJ3      LF----KSDRISSLTK-A--------------------GEKIGDLESL---MR--QGNP-
A0A2H2XPG4      LF----KSDRISSLTK-A--------------------GEKIGDLESL---MR--QGNP-
K9V3C7          LF----QTNRTSSLTG-V--------------------GEKIGSLESF---RN--EANP-
A0A1Z4T6Y7      LF----QTNRASFLTG-V--------------------GEKIGDLETV---RR--EANP-
A0A2H2Y561      LF----QTNRASFLTG-V--------------------GEKIGDLETV---RR--EANP-
A0A1Q4S362      LF----QANRASLLTG-V--------------------GEKVGDLESV---RR--EANP-
A0A3S1CIN8      LF----QANRASLLTG-V--------------------GEKVGDLESV---RR--EANP-
A0A2A2TC28      LF----KSDRTSSLTK-V--------------------GEKIGDLESL---MR--EGNP-
A0A0C1NCB0      LI----QSDRTSSLTK-A--------------------GEKIGHLESL---MR--EGNP-
A0A2N6K7Q9      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A2N6MXH6      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A2N6M5A8      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A2N6LL61      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A0S3TP66      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
G6FP91          LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A1U7GYR5      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A2N6KY52      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A2N6KMP5      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A2N6MA45      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A4Q9J9V9      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A328IGA1      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A4D9CE41      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A0M0SFT2      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A1Z4TLC8      LF----KSDRTSSLTK-V--------------------GEKIGDLEAL---MR--EGNP-
A0A0C2LFH0      LF----KSDRTSSLTK-V--------------------GEKIGDLESL---MR--EGNP-
A0A1Z4IYV4      LF----QSDRTSSLTK-V--------------------GEKIGDLESL---MR--EGNP-
A0A1Z4Q0T6      LF----KSDRTSSLTK-V--------------------GEKIGDLESL---MR--EGNP-
A0A0C2PT44      LF----KSDRTSSLTK-V--------------------GEKIGDLESL---MR--EGNP-
A0A1D2P6J4      LF----KSDRTSSLTK-V--------------------GEKIGDLESL---MR--EGNP-
A0A4R4IQ40      LI----KKNDQTAALT-GL-------------------GQGIGDLEGL---NL--QSNP-
A0A433W533      IV----KKNDQTAALT-GL-------------------GQGIGDLEGL---NL--QSNP-
A0A2P8QWJ3      IV----KKNDQTAALT-GL-------------------GQGIGDLEGL---NL--QSNP-
A0A2T1FKP8      IV----KKNDQTAALT-GL-------------------GQGIGDLEGL---NL--QSNP-
K9U6L7          IV----KKNDQTAALT-GL-------------------GQGIGDLEGL---NL--QSNP-
A0A3M9ZEU1      LV----KADRSSSL--------VGLT------------KVETGELQAL---TT--ANSP-
A0A1Z4JK72      LV----QSNRTTSL--------TGVG------------E-KVGTLESL---KR--EGNP-
A0A0N7Z489      LV----QSNRTTSL--------TGVG------------E-RVGTLEAL---RR--EGNP-
A0A0S3TXS2      LV----QSNRTTSL--------TGVG------------E-RVGTLEAL---RR--EGNP-
A0A1Z4RN12      LI----KPDRTSKLIG-ID-------------------T-NPEEIKGL---TQ--DKDP-
A0A2T1CMF9      LI----EPEQTSRRIG-IE-------------------D-GNPEVKKT---VL--EKDP-
Q7NDC5          LF----KQKDTAIDNP-T-AVGLR--------------G-ALGQMGS----VA--YGNP-
U5QGK3          LF----KQKDTAVGSE-NPARSLR--------------G-SLGQLDS----VA--FGNP-
A0A2W4UY24      LF----ESSKPVTAIV-GLD------------------T-GEGNLTPL---TS--QSNP-
A0A2T1GMT4      LF----KNSTFRVIGP-NLIPNSMEG------------S-ESGDLKSL---VS--TQNP-
K9UI51          LF----KNSTFRVIGP-NLIPSNMEG------------S-ESGDLKSL---VS--NQNP-
K9QM62          LF----RIPAFNIVGS-NLLPNSSEG------------E-FRG-LRAL---VS--TQNP-
A0A1Z4FWI3      LF----KSPSFNVVGT-NLLPNGSEG------------Q-ATGDLKSL---VS--NQNP-
A0A1Z4JYE7      WF----RIPSFKTIGT-NLLPNNNEG------------D-AAGDLKSL---VS--TQNP-
A0A2T1FXY4      LF----KTPSFNVVGS-NLLPSISEG------------Q-ETGDLRAL---VS--TQNP-
A0A4V2X3N2      LF----KIPSFNVVGS-NLLPSISEG------------Q-ETGDLRAL---VS--TQNP-
K9TYI2          LF----KTPSFNVVGS-NLLPSISEG------------Q-ETGDLRAL---VS--TQNP-
A0A1Z4QL41      LF----KVPSFQILGT-NLLPNSSEG------------G-GIGDLKPL---VS--TQNP-
A0A252D4T4      LF----KTPSFNVVGT-NLLPSDSEG------------G-TSGDLKPL---VS--TQNP-
A0A252DJH5      LF----KTPSFNVVGT-NLLPSDSEG------------G-TSGDLKPL---VS--TQNP-
A0A252EB80      LF----KTPSFNVVGT-NLLPSDSEG------------G-GSGDLKPL---VS--TQNP-
A0A1Z4HPW5      LF----KTPSFNVVGT-ELLPTETQ---------------ARGDLRPL---VS--TQNP-
A0A1Z4MSN1      LF----KTPSFNVVGS-ELLPSESQ---------------ARGDLRPL---VS--TQNP-
A0A1Z4U1C2      LF----KTPSFNVVGS-ELLPSESQ---------------ARGDLRPL---VS--TQNP-
A0A0D6KV51      LF----KTPTFNVVGS-ELLPSESQ---------------ARGDLRPL---VS--TQNP-
A0A1Z4MKF8      LF----KTPTFNVVGS-ELLPSESQ---------------ARGDLRPL---VS--TQNP-
A0A2C6WC43      LF----RIPSFKVVGS-NLLPTTTEG------------G-STGDLKSL---IA--SQNP-
A0A1Z4L5A1      LF----RIPSFKVVGS-NLLPTTTEG------------G-STGDLKSL---IA--SQNP-
A0A367QD86      LF----RIPSFKVVGS-NLLPTTTEG------------G-STGDLKSL---IA--SQNP-
A0A235IZ96      LF----RVPSFKVAGS-NLSPGSSEG------------G-DSGDLKAL---VA--TQNP-
A0A2L2NGP0      LF----RVPSFKVAGS-NLSPGSSEG------------G-DSGDLKAL---VA--TQNP-
A0A2K8SM78      LF----RIPSFKVVGS-NLFPTNAEG------------G-DPGDLKSL---LA--TQNP-
A0A2R5FPC0      LF----RIPSFKVVGS-NLFPTNAEG------------G-DPGDLKSL---LA--TQNP-
A0A5P8W5T6      LF----RIPSFKVVGS-NLLPTNTEG------------G-DAGDLKSL---LA--TQNP-
A0A140KBA0      MI----KTNKSAKL--------TGLE------------N-DIGKIEVL---TN--ESDP-
K9XSG1          MI----KTNKSAKL--------TGLE------------N-DIGKIEVL---TN--ESDP-
A0A0F5YE28      LF----KVDRTSSL--------AGIG------------E-GLGELKAL---LA--DQTP-
U7QEH7          LF----KVDRTSSL--------AGIG------------E-GLGELKAL---LA--DQTP-
A0A3S1ATK5      LF----KLPSFQVLGN-NLLRSNSEG------------E---GDLKSL---VS--TQNP-
A0A2Z6CPH0      LF----RMPSFKTVGT-NLLPNNNEG------------D-QAGDLKSL---VS--TQNP-
A0A1Z4GT50      LF----KTPSFKVIGS-NLLPNNSEG------------E-EA-DLKPL---VS--TQNP-
A0A1Z4GIX0      LF----RMPSFNVVGT-NLLPSNNEG------------E-ETGDLRSL---VS--TQNP-
A0A2H6LC24      LF----RMPSFNVVGT-NLLPSNNEG------------E-ETGDLRSL---VS--TQNP-
B2J6N5          LF----RIPSFKVVGS-NLLPTNTEG------------G-DAGDLKSL---LA--TQNP-
A0A367RMI4      LF----RVPSFKVAGN-NLYPDTSEG------------G-DAGDLKPL---VA--TQNP-
A0A235HUM0      LF----RVPSFKVAGN-NLSPGTSEG------------G-DSGDLKPL---VA--TQNP-
A0A2L2NW47      LF----RVPSFKVGGN-NLSPGTAEG------------G-DSGDLKPL---VA--TQNP-
A0A1E2WUR1      LF----RLPSFKVAGT-NLSPGSSEG------------G-DSGDLKPL---VA--TQNP-
A0A235IKU3      LF----RVPSFKVAGS-NLSPGSSEG------------G-DSGDLKAL---VA--TQNP-
F4XKF3          LF----KIDRTAFL--------TGLG------------E-EIDQLRPL---VD--AQNP-
A0A1D9FX10      LF----KIDRTAFL--------TGLG------------E-EIDQLRPL---VD--AQNP-
A0A1D8TNX9      LF----KIDRTAFL--------TGLG------------E-EIDQLRPL---VD--AQNP-
A0A1U7MYU6      LF----KIDRTAFL--------TGLG------------E-EIEQLRPL---VD--AQNP-
A0A3C0NJ41      LF----KVNRTASL--------TGVGQVERLEGGQTAQQ-PVGGLGAL---TQ--TGNP-
A0A352AG88      LF----KVSRTADL--------TGVG------------Q-QVGELAPL---TT--NSNP-
A0A350Y374      LF----KVNRTTSL--------TGLG------------K-EVGNFAPL---TT--DSNP-
A0A355DPX0      LF----KVNRTTSL--------TGLG------------K-EVGNFAPL---TT--DSNP-
A0A0D8ZUV2      LL----KRVNETSAAT-GLGS-------------------QIGELDTL---AQ--QTNP-
A0A433VDI0      ML----KKVDWASAAT-GVGE-------------------QIGELDTL---AQ--QSNP-
A0A3D1PG43      LL----KKIDNASSVT-ELSQ-----------------T-DNSELEPL---SQ--LGNP-
A0A2P8QQ72      LL----KKPSETSSLN---PE-----------------K-YEPRLEPL---SA--ESNP-
K9TZQ7          LL----KKPSETSSLN---PE-----------------K-YEPRLEPL---SA--ESNP-
A0A2G7GPR0      LF----KRADRTTAIS-GLKD-----------------I-NVGELEAI---AT--KANP-
K9XH68          LF----RKADRTTAIS-GLKD-----------------I-NVGELEAL---AT--KANP-
A0A1U7HW70      LF----RKADRTTAIS-GLKD-----------------I-NVGELEAI---AT--KANP-
A0A2S6VEJ8      LF----RKADRTAAIS-GLKD-----------------I-NVGELEAL---AA--KANP-
                                                                            

K9SLA9          ---LANEAAVIKSNAIAKEVVGV-------LN----------------------------
A0A168TT23      EQFYQTQYEILRGRQLAENVVEK-------LE----------------VWDHPELSGEIS
A0A0M1JWX9      VD-YQSQIALLRSPKLMEPIIQQ-------LK----------------------------
A0A2T1M1V6      VNPLYTQSAILMSDSVLGRVLTVDPEKSE-FS----------------------------
A0A2G7GCS2      LNPLQIQMTILTSDTVMERALAVDPEKSL-YP----------------------------
K9XBH8          LNPLQTQLSILTSDTVMQRVLSVDPEKSS-YL----------------------------
A0A1Z4LJ30      INPLNILSSVAMSDRVIQEVWQNDPEKAD-FS----------------------------
K9RI76          LNPLNILSSIATSDHVVEEVWQNDPEKSE-YS----------------------------
A0A352AE27      LNPLKVQAYILTSDALMQRLWASDTENSQ-FG----------------------------
A0A3B8JH60      VNPLKVQASILTSDELLQKARAIDPEKNK-AP----------------------------
A0A3C0N766      VNPLKVQASILTSDELLQKARAIDPEKNK-AP----------------------------
K9W9J7          VNPLKVQASILTSDALLEQVLVSDPQKTK-FS----------------------------
A0A139WSU3      VNPLNVQASILTSDTLLEKVLASDPERGK-FN----------------------------
A0A433VN22      LNPLKVQTSILMSDALLEKVLDSDPEKNK-FK----------------------------
Q7NF11          VNALKVQSAILTSSEVLSKAWQADPQREK-YP----------------------------
A0A1Z4JCS8      VNPLKIQEAILTSDAILEKAWAADPERDA-AN----------------------------
F4XTX2          SHPLNMQASILKSDALMRRLLESDPEKTD-FQ----------------------------
Q7NJN6          LNPTSIQSNILLSSDVLRPVWQKDPERTEKFT----------------------------
U5QCC3          LSPTTIQSNILLSDSVLRRVWLKDPEKQEKFP----------------------------
A0A3S0Y9N9      ---MGTEVAVLRSLPIAERTINA-------LS----------------------------
A0A433UNK7      ---LGTEVAVLRSLPLAEQTINA-------IR----------------------------
A0A3M1SVZ4      ---LDTEAEIISSVPIVEQTIAA-------LQ----------------------------
A0A654SFI6      LQYLNTQYELLESRFMATRVADA-------AS----------------------------
K9SSQ0          ---LSTQAAILASRPLIETALPK-------IP----------------------------
A0A2W1JIN9      ---LANQEEIVSSKRLLERAL---------------------------------------
A0A318AJV1      ---METEAGLMASRGLAVAVVRK-------LH----------------------------
A0A1U7N2U4      ---IATQAELVGSQRVLQGALYQ-------IG----------------------------
A0A1D9G1F2      ---IATQAELVGSERLLQGALDE-------IA----------------------------
F4XV38          ---IATQAELVGSERLLQGALDE-------IA----------------------------
A0A2P8QIL5      ---VATQAELALSQKVLRQAIYE-------AY----------------------------
A0A2T1FLY5      ---VATQAELALSQKVLRQAIYE-------AY----------------------------
A0A433W447      ---VATQAELALSQKVLRQAIYE-------AY----------------------------
K9U1K8          ---VATQAELALSQKVLRQAIYE-------AY----------------------------
A0A4V6P809      ---VATQAELALSQKVLRQAIYE-------AY----------------------------
K9UYB2          ---LANQAEVVKSERVLQKALEI-------AS----------------------------
A0A218QN17      ---LANEAELVKSQRVLERAIAL-------AS----------------------------
K9RKN2          ---LADQAELVKSQRVLEKAIKI-------FS----------------------------
A0A2I8ADV2      ---LADQAELVKSQAVLDQAIKT-------LA----------------------------
A0A1W5CKM3      ---LADQAELLKSQTVLQLAISK-------LN----------------------------
A0A5Q0GMF5      ---LADQAELLKSQTVLQLAISK-------LN----------------------------
Q3MEW0          ---LADQAELLKSQTVLQLAISK-------LN----------------------------
A0A1Z4KIC7      ---LADQAELLKSQTVLQLAISK-------LN----------------------------
Q8YSM5          ---LADQAELLKSQTVLQLAISK-------LN----------------------------
A0A1Q4S1H4      ---LGDQAELIKSQQVLEKALTA-------LK----------------------------
A0A433VBU6      ---LADQAELIKSQQVLEKALTA-------LK----------------------------
A0A1Q4RZJ6      ---LANQAELIKSERILTQALAI-------AG----------------------------
A0A1Z4SNV3      ---LANQAELIKSERILNQALAI-------------------------------------
A0A2H2XJQ1      ---LANQAELIKSERILNQALAI-------------------------------------
A0A3S5K358      ---LANQAELIKSERILTQALAI-------VG----------------------------
A0A0T7BPJ4      ---LADQAELVKSEKVLEKAIAA-------TY----------------------------
A0A0C1QS61      ---LADQAELVKSQRVLNRALQI-------FK----------------------------
A0A139X3R8      ---LADQAELAKSQRVLNRALQI-------FQ----------------------------
A0A1Z4I7C5      ---LADQAEFLKSQPVLQLAISK-------LN----------------------------
A0A0C2MDK7      ---LADQAELIKSQRVLERAIAI-------AF----------------------------
A0A1Y0RCK1      ---LADQAELIKSQRVLERAIAI-------AF----------------------------
A0A1Z4PWZ0      ---LADQAELVKSQRVLERAIAI-------AF----------------------------
A0A0C2QLT0      ---LADQAELIKSQRVLERAIAI-------AF----------------------------
A0A1Z4J2K1      ---LADQAELIKSQRVLEQAVAI-------AF----------------------------
A0A3S0ZSX0      ---LADQAELIKSQRVLRRAIAR-------VI----------------------------
A0A2N6K4T3      ---LADQAELIKSQRVLQRALTE-------VT----------------------------
A0A370CKT2      ---LADQAELIKSQRVLQRALTE-------VT----------------------------
A0A0S3TL97      ---LADQAELIKSQRVLQRALTE-------VT----------------------------
A0A2N6M8A0      ---LADQAELIKSQRVLQRALTE-------VT----------------------------
A0A2N6M9E1      ---LADQAELIKSQRVLQRALTE-------VT----------------------------
A0A2N6KJI4      ---LADQAELIKSQRVLQRALTE-------VT----------------------------
A0A2N6MZ77      ---LADQAELIKSQRVLQRALTE-------VT----------------------------
A0A2N6KT20      ---LADQAELIKSQRVLQRALTE-------VT----------------------------
G6FSN3          ---LADQAELIKSQRVLQRALTE-------VT----------------------------
A0A4D9CI02      ---LADQAELIKSQRVLQKALAK-------VA----------------------------
A0A328I8B9      ---LADQAELIKSQRVLQKALAK-------VA----------------------------
A0A4Q9J4Z7      ---LADQAELIKSQRVLQKALAK-------VA----------------------------
A0A0M0SU69      ---LADQAELIKSQRILQKALTK-------VA----------------------------
A0A1Z4TIZ8      ---LADQAELIKSQRVLQKALAK-------VS----------------------------
A0A0S3TYD7      ---LTTQAELIKSLPIVQRTIED-------LN---------------------LQDD---
U5QL42          ---LETEIQILKSRSLIGRAIHR-------LA---PPF-------------NIL------
K9QF04          ---FKTEIEVLASYKVISPLLPT-------IQ---SRY-------------PDI------
A0A3C0N2P0      ---YDTQIQVLWSPQVLSKIVKE-------IQ---TRY-------------PDI------
K9TLQ0          ---YETQMEVLLSSPIINPIFTN-------IQ---QNY-------------PEL------
A0A076HBF2      ---IPTLIEVLQSPVLLQPVADK-------FE---LTT-------------DAL------
A0A354B169      ---LPTLIEVLRSPMLLNPIAQH-------FD---LTY-------------LNL------
G4FMX5          ---LPTLIELLQSPLLLSPIAER-------FD---LSE-------------NGL------
Q0IDT5          ---IPTLIEVLESPLLLAPIAKR-------FD---VSE-------------NEL------
A0A2D6FCW3      ---IPTLIELLQSPLLLSPIAQR-------YD---LNA-------------NAL------
A3ZA21          ---IPTLIEVLQSPLLLAPIAKR-------FD---LAE-------------NAL------
A0A140K3H3      ---LSTEVLVLRSYPLIAKAVKQ-------VQ---QKY-------------GDL------
K9XUB8          ---LSTEILVLRSYPLIAKAVEK-------VQ---QEY-------------SDL------
Q7NEU3          ---INTQIEVLLRRPLIEKALRV-------LR---PKF-------------PELLDQ---
A0A352XE00      ---YETQIQVLWSSQIMIPIVKK-------IQ---AQY-------------PEI------
B4VS56          ---YETQIQVLWSPQVMTPIVEQ-------IQ---SRY-------------PEI------
A0A352AAQ3      ---YETQIQVLWSPQVMAPIVKK-------IQ---ARY-------------PTV------
A0A350Y472      ---YETQIQVLWSPQVMAPIVAQ-------IQ---SRY-------------PEV------
A0A355DVB4      ---YETQIQVLWSPQVMTPIVKQ-------IQ---SRY-------------PEV------
A0A2P8VVX1      ---YATQLALMRSGQFLQEAVDV-------LR---TDY-------------PEI------
A0A2P8WHY0      ---YNTQLTLMRSEQFLREAVAS-------LE---AEY-------------PDL------
A0A2T1CMT9      ---YTTQIKVLTSHEILQRVVNQ-------LKLKDQRSEQASSSYGGVISDSEA------
A0A563VQJ3      ---LKNEIEKITASPVLQETIDQ-------LELTDGEG-------------EPL------
A0A1D8TX52      ---YATQLQLMGSSELIQRAVDL-------LR---DDY-------------PDI------
A0A1U7N5X9      ---YATQLQLMRSSELMKRAVEL-------LR---DDY-------------PNI------
A0A1D9G4T2      ---YATQLQLMRSSELIQRAVDL-------LR---DDY-------------PDI------
F4XP71          ---YATQLQLMRSSELIQRAVDL-------LR---DDY-------------PDI------
A0A2P8QVH5      ---YTAQLSVMTSPKLVERAVEL-------LR---PEY-------------PNI------
A0A2T1FT70      ---YTAQLSVMTSPKLVERAVEL-------LR---PEY-------------PNI------
A0A433W4W4      ---YTAQLSVMTSPKLVERAVEL-------LR---PEY-------------PNI------
K9U5W1          ---YTAQLSVMTSPKLVERAVEL-------LR---PEY-------------PNI------
A0A2W6ZAV2      ---TPVLIEVLTSPLLLEPIAQR-------L---------------------NV------
A0A2G7GMH8      ---IATQINLMSSSILLQRAVSL-------LQ---PEY-------------PDI------
K9W742          ---SATQLNLMQGSQLLQKALDL-------LR---PDY-------------PDL------
A0A2T1DWE8      ---YSTQLTQMRSSQLLQKAVVL-------LQ---AEY-------------PKL------
A0A1U7I8L3      ---YATQLNLMRSSQLIQKAVDL-------LR---PQY-------------PKI------
A0A2T1DJL8      ---NATQLNLMRSSQLLQRAVDQ-------LK---LNG-------------SNL------
A0A1Z4J9W0      ---AATQVNLMRSGQLLQRAVDQ-------LK---PRY-------------SDI------
A0A0N7Z5K9      ---TATQVNLMRSTQLLQRAVDE-------LQ---PRY-------------SDI------
A0A0S3TXC5      ---TATQVNLMRSTPLLQRAVDE-------LK---PRY-------------SDI------
K9SA61          ---YSTQLQLMKSSQLLQRAVDQ-------LK---PTY-------------PDI------
A0A3D1PBA3      ---YATQINVMRSSLLLQRAADI-------LR---PEY-------------PTI------
K9XPB0          ---YPTQLKLMRSSYLLKKVVKK-------LG---VEG-------------SDA------
A0A350Y7Z1      ---YATQLNLMRSSQLIQKAVDR-------LH---PKY-------------PEI------
A0A352X2A7      ---YTTQINLMRSSQLIQRAVNL-------LQ---DKY-------------PTI------
A0A0D8ZYV0      ---YATQINVMRSTLLLQRAVDL-------LK---PEY-------------PDM------
A0A4R4IUM6      ---YATQINVMRSSLLIQRAVDI-------LR---SEY-------------PTL------
A0A2T1FP73      ---YATQINVMRSSLLIQRAVDI-------LR---SEY-------------PTL------
A0A433VMS2      ---YATQINVMRSSLLIQRAVDI-------LR---SEY-------------PTL------
K9TYA7          ---YATQINVMRSSLLIQRAVDI-------LR---SEY-------------PTL------
A0A2P8QUE1      ---YATQINVMRSSLLIQRAVDI-------LR---SEY-------------PTL------
A0A2T1DNG3      ---YATQISLMQSSNLLKKAMTL-------LQ-------------------TEYPEL---
A0A2P8W9H0      ---DETRLRILTSPRVIEPILKE-------LQ----------------------------
A0A1Z4LN32      ---LDTQAIILQSEPIIKDVVKS-------LE---------------------LKGN---
A0A2I8A9F5      ---LDTQALLVRSKPILEEVVNT-------LN---------------------LKDK---
A0A218Q6R8      ---LDTQALLVRSTPIIEDVINT-------LE---------------------LKDQ---
A0A218QGE0      ---LDTQAIVMQSEPVMQDAIET-------LK---------------------LKDK---
B8HNB0          ---LINEIQVLQSSSLVTKAQQQ-------LK-------------------PPHNKT---
A0A563VS48      ---LATEAEILRSRPILEKLIKE-------LD---------------------LRDE---
A0A318BJ18      ---YETQYGLLRSRALSERVATQ-------LR--------------------LVDDPKFY
A0A3B8Y8H9      ---FLTQIQILYSYKIIAPVLEK-------LN-------------------KVFPPE---
A0A2W1JVB9      ---LDTEIETILSVPVLQEALKQ-------LK---------------------LTDD---
A0A1Z3HMQ0      ---LSTQAAILSSLPVLQEAVNA-------LD---------------------LQDA---
A0A1E5QP61      ---LDTEAEVISSMPIVKETVEA-------LN---------------------FRDD---
A0A3M2GIL5      ---LDTEAEIISSTPIIEQTIAE-------LQ---------------------LKGP---
A0A433NM31      ---VNTQAEIINSVAFAQRTINE-------LD---------------------LKNE---
A0A3M1PML8      ---VDSQAQIIQSAPIVSEVIRS-------LD---------------------LRDE---
A0A352X442      ---IATAAAIVKSRPIAEKTVAE-------LN---------------------LRDE---
A0A0T7BPZ0      ---VETQAKIVASVPVIQKTIRS-------LD---------------------LKDN---
A0A0M0SHU3      ---VDTQAKIVISVPVIQETITS-------LS---------------------LKND---
A0A1D2PBN3      ---SDTQAKIVASVPVIQETITE-------LD---------------------LRDN---
A0A0C2LVR7      ---SDTQAKIVASVPVIQETITE-------LD---------------------LRDK---
A0A1Z4PQB9      ---SDTQAKIVVSVPVIQETITE-------LD---------------------LRDD---
A0A1Z4SFN6      ---LETQAKIVESVPVIQETIRT-------LN---------------------LKDD---
K9PGI8          ---SDTQAKIVVSVPVIQETIRV-------LK---------------------LKNE---
A0A563VLD6      ---LSTEILVLRSNSLISQAIAQ-------YP---------------------NTFK---
A0A318BG22      ---METQLAFIRSRAMAEGIVKR-------LH---------------------LDQN---
A0A2T1E9V8      ---LNTESRLILSENILRKILDI-------VN---------------------ENSS---
A0A3M2GQQ6      ---LSTEIQILRSHALVAKAIAA-------LG---------------------DTDN---
K9SGJ5          ---LDTEIAILKSRSLIEPAVAQ-------LD---------------------NIDP---
L8MYT6          ---LGTEIGILKSRPLIESAIAK-------MR---------------------QSSD---
A0A352JGJ6      ---LGTEIGILRSRPLIEVAVTK-------IK---------------------QSSA---
A0A1J5GLS2      ---LGTEIGILRSRPLIEVAVAK-------MK---------------------QSPT---
A0A2W4W6M5      ---LGTEIGILRSRPLIEVAVSK-------MR---------------------QSPS---
A0A2W7AN33      ---LGTEIAILKSRPLIETAVCK-------MQ---------------------QSPT---
A0A256BLV2      ---LGTEVAILKSRPLIEIAVSK-------MQ---------------------QSPS---
A0A2W6ZXF3      ---LGTEIGILRSRPLIEIAVAK-------MR---------------------QSPT---
A0A2Z5WX66      ---LGTEIGILRSRPLIEVAVAK-------LQ---------------------QSAS---
K9W1T3          ---INTQAELINSIPVAQETIAT-------LN---------------------LS-----
A0A1Q4RTR1      ---LETQAEIIRSQPVIQKTIDI-------LE---------------------LKNK---
A0A1Z4SQV2      ---LETQAEIIRSQPLVQKTIDT-------LE---------------------LRNN---
A0A2H2XGN1      ---LETQAEIIRSQPLVQKTIDT-------LE---------------------LRNN---
A0A433UXH8      ---LETQAELIRSQPLVQKTIDA-------LE---------------------LKNS---
A0A1Z4RMB9      ---LTTQIQVLRSEPVVQQVIDQ-------LK---------------------LTDN---
K1XF69          ---LSTQIELMYSNPLLETVIER-------LN---------------------LTNE---
B5W297          ---LSTQIELMYSNPLLETVIER-------LN---------------------LTNE---
H1W7M8          ---LSTQIELMYSNPLLETVIER-------LN---------------------LTNE---
A0A5Q4H6A5      ---LSTQIELMHSNPLLETVIER-------LN---------------------LTNE---
D5A466          ---LSTQIELMHSNPLLETVIER-------LN---------------------LTNE---
B4WP72          ---LRTQAEIIQSLPTLEKAIAT-------AE---------------------AAVI---
A0A318B4H2      ---YETQYNLLKARSLAERVARV-------LG---------------------LQNDDKF
B4WQE3          ---DDTKLKILTSPRVLVSAVEE-------LE---------------------KTYP---
A0A2P8W4F7      ---YDSQIRVLRGPAVIEPILAD-------IQ---------------------RRYP---
A0A5Q4E0Z4      ---YTSQIRVLRGPDVINPILAN-------IQ---------------------RQYP---
A0A2K3BR24      ---LTNQSQIMQSAPMLQEVIDR-------LG---------------------LKND---
K9YXY1          ---LTNQSQIMQSAPMLQEVVDR-------LG---------------------LKND---
U5QJM6          ---INTQLQVLLSRPLVNKAVVR-------LS---------------------KKYP---
K9SX01          ---RYTQLQVIRSTPVVAQTIKA-------L-----------------------------
A0A4P7ZT55      ---LPNLIEVLTSPMLLQPLAN--------------------------------------
A0A1E5QIR9      ---LDTEVAIVRSVATSEGVMQA-------LD---------------------LRDE---
A0A1Z4IBC7      ---LETQVRIIGSNPVLERTINT-------LN---------------------LKEA---
A0A1W5CPC7      ---LETQVRIIGSNPVLEQTIKA-------LN---------------------LKDK---
A0A5Q0GKD1      ---LETQVRIIGSNPVLEQTIKA-------LN---------------------LKDK---
Q3MDC6          ---LETQVRIIGSNPVLEQTIKA-------LN---------------------LKDK---
A0A1Z4KM73      ---LETQVRIIGSNPVLQQTIKA-------LN---------------------LKDQ---
Q8YNX7          ---LETQVRIIGSNPVLQQTIKA-------LN---------------------LKDQ---
A0A367R4K6      ---LETQVKIVGSNPVLEQTIKE-------LN---------------------LTDN---
A0A1E2WSV8      ---LETQVRVIGSNPVIEKTINS-------LK---------------------LKDS---
A0A2R5FRT9      ---LETQVRVIGSNPVIEKTINS-------LN---------------------LKDS---
A0A2K8T1B6      ---LETQVRVIGSNPVIEETINS-------LN---------------------LKDS---
A0A235I9I0      ---LETQVRVIGSNPVIEKTINS-------LN---------------------LKDG---
A0A2D0HQT8      ---LETQVRVIGSNPVIEKTINS-------LN---------------------LKDS---
A0A2L2NU95      ---LETQVRVIGSNPVIEKTINS-------LN---------------------LKDS---
A0A367S084      ---LETQVRVIGSNPVIEKTINS-------LN---------------------LKDS---
A0A0V7ZFJ4      ---LATEAQIIRSRPIIQKTISK-------LN---------------------LRDS---
A0A367RIS1      ---LETEAEIIRSNPLTQKTIAE-------LH---------------------LKDK---
A0A235IXQ2      ---LETEAEIIRSYPLTKKTIAE-------LQ---------------------LKDK---
A0A1W5CNX3      ---LETEAEIIRSNPIIQKTIAE-------SQ---------------------LKDE---
A0A5Q0GJJ5      ---LETEAEIIRSNPIIQKTIAE-------SQ---------------------LKDE---
Q3MEB7          ---LETEAEIIRSNPIIQKTIAE-------SQ---------------------LKDE---
A0A1Z4KHN9      ---LETEAEIIRSNPIIQKTIAE-------SQ---------------------LKDE---
Q8YT70          ---LETEAEIIRSNPIIQKTIAE-------SQ---------------------LKDE---
A0A218Q4C1      ---LDTQAEIIRSHPLIQQTIDN-------LQ---------------------LKNQ---
A0A166IWU6      ---LETQAEIIRSHPLIQKTIVD-------LQ---------------------LKDQ---
A0A2S0Q8C0      ---LETQAEIIRSHPLIQKTIVD-------LQ---------------------LKDQ---
W6FSX4          ---LETQAEIIRSHPLIEKTIVD-------LQ---------------------LKDQ---
A0A0V7ZNJ9      ---LETEAKVIRSNPIIQKTIDK-------FN---------------------LRDD---
A0A0R0M9H9      ---IDTEAEVIRSHPLITKTINQ-------LG---------------------IKNT---
A0A1S1ZVW2      ---IDTEAEVIRSHPLITKTINQ-------LG---------------------TKNT---
A0A1B7WX82      ---VDTESEIIRSYPIIIKTITT-------LK---------------------LTDD---
A0A1B7WTD1      ---VDTEAEVIRSNPIISKTIND-------LK---------------------LKGK---
A0A480ABC0      ---VDTEAEVIRSNPIVTKTITE-------LK---------------------LKGR---
A0A1Z4LRU5      ---LDTEAEVIQSHPLIKETITK-------LN---------------------LINE---
A0A1Z4JVB4      ---VDTEAEVIRSYPIIQKTITT-------LK---------------------LKDK---
K9PIA4          ---VDTEAEVIRSYPIINKTITT-------LN---------------------LKDE---
A0A1Z4M597      ---VDTEAEVIRSNPIVLKTITS-------LD---------------------LKDK---
A0A1Z4MWT1      ---VDTEAEVIRSNPIVLKTITS-------LN---------------------LKDK---
A0A1Z4TX53      ---VDTEAEVIRSNPIVLKTITS-------LN---------------------LKDK---
A0A1Z4HVE1      ---VDTEAEVIRSNPIVLKTITS-------LN---------------------LKDK---
A0A252ECZ1      ---VDTEAEVIRSNPIVQKTITS-------LN---------------------LKDK---
A0A1Z4G5Y1      ---VDTEAEVIRSNPIVQKTIAS-------LN---------------------LKDK---
A0A252DNA2      ---VDTEAEVIRSNSIVQKTITS-------LK---------------------LKDK---
A0A252E1Q4      ---VDTEAEVIRSNSIVQKTITS-------LK---------------------LKDK---
A0A5P8VSD1      ---LETEAEIIRSHPLTQKIIDE-------LH---------------------IKDN---
A0A2A2TNQ5      ---LETEAEIIRSNPLVKKIVNE-------LE---------------------MQDK---
A0A3S1C4K5      ---LDTEAEVIRSNPLVKKTISE-------LE---------------------LKDK---
A0A1X4G3D5      ---LENEAEVIRSRPMLEQLVET-------LE---------------------LQDD---
D4TNI2          ---LENEAEVIRSRPMLEQLVET-------LE---------------------LQDD---
A0A1Z4H6Z8      ---VDTEAEVIRSNPIIQKTITS-------LN---------------------LKDK---
A0A1Z4NPM1      ---LDTEAEVIRSTPSVQKTIEK-------FQ---------------------LRTP---
A0A3F3KPR9      ---IDTEAEVIRSHPLITKTINQ-------LG---------------------IKNT---
D4TGN7          ---IDTEAEVIRSHPLITKTINQ-------LG---------------------IKNT---
A0A1Z4UZW9      ---VDTESEIIRSYPIVNKTITT-------LK---------------------LTDD---
A0A0K2M5H0      ---VDTESEIIRSYPIVIKTITT-------LK---------------------LTDN---
A0A1B7VSH4      ---VDTESEIIRSYPIVIKTITT-------LN---------------------LTDD---
A0A1B7W126      ---VDTESEIIRSYPIVIKTITT-------LN---------------------LTDD---
A0A3D4C6Q6      ---VDTESEIIRSYPIVIKTITT-------LN---------------------LTDD---
A0A1B7UVJ4      ---VDTESEIIRSYPIVIKTITT-------LN---------------------LTND---
A0A1B7UTR1      ---VDTESEIIRSYPIVIKTITT-------LN---------------------LTND---
A0A5C0DRW9      ---VDTESEIIRSYPIVIKTITT-------LN---------------------LTND---
K7W0A4          ---VDTESEIIRSYPIVIKTITT-------LN---------------------LTND---
A0A1U7HGH0      ---LATEAKVIRSIPILQQALEQ-------IN---------------------EASQ---
K9XJD3          ---LATEAKVIRSVPILQQALEQ-------IN---------------------EASQ---
A0A2T1CIL7      ---VVTEAEILRSRPILEKAIKQ-------LN---------------------LKND---
A0A1Z4RPC6      ---LSTEKLRITSEPVLQQTIDQ-------LK---------------------LVDA---
A0A2T1CMZ0      ---LSTEKLRMISEPVLQQTIDQ-------LK---------------------LENS---
L8M4F7          ---LHNQREQIFTSAVLQQTVEN-------LD---------------------LKNE---
A0A140K2P2      ---LSTQIEVITSDPVLQQTIDQ-------LK---------------------LVDD---
K9XWX4          ---LSTQIEVITSTPVIQQTIDK-------LK---------------------LQDD---
A0A140KB14      ---LKTEIERMKAEPILVQTIEK-------LK---------------------LKDE---
K9XX88          ---LKTEIERMKTEPILVQTIEK-------LK---------------------LKDE---
A0A563VSV6      ---LLTQQEVISSAPVLQQTIEI-------LK---------------------LTNE---
L8LZE9          ---LVSQKEILTSSPILQKTIDQ-------LS---------------------LTDA---
A0A433V7A0      ---LSTEAEILLSEPLIRETISA-------LN---------------------LKDE---
A0A1Z4NDS1      ---SDTQVKIITSNQVIQETIQR-------LG---------------------LKDS---
K9F4D9          ---LDTQIEVFRSIPLVQKVIET-------LK---------------------LQDD---
U9VXM0          ---LDTQIEVFGSIPLVQQVIEQ-------LK---------------------LQND---
A0A2T1FTR8      ---VNTQAEILKSLTTIKGAL---------IE---------------------LRDG---
K9UA41          ---VNTQAEILKSLTTIKGAL---------VE---------------------LRDG---
A0A0C2LBE2      ---SETQAKIVASVPVIQETIAE-------LD---------------------LKDD---
A0A433NN38      ---VDTQVKIVTSVPVLQETIKA-------LD---------------------LRDS---
A0A2N6K0T2      ---VDTQAKIVTSVPVIQETITS-------LS---------------------LKND---
A0A2N6ML72      ---VDTQAKIVTSVPVLQETITS-------LS---------------------LKND---
G6FQZ6          ---VDTQAKIVTSVPVLQATITS-------LS---------------------LKND---
A0A2N6MQX9      ---VDTQAKIVTSVPVLQETITS-------LS---------------------LKDD---
A0A2N6KXT6      ---VDTQAKIVTSVPVLQETITS-------LS---------------------LKND---
A0A2N6KGB9      ---VDTQAKIVTSVPVLQETITS-------LS---------------------LKND---
A0A2N6L3Y5      ---VDTQAKIVTSVPVLQATITS-------LS---------------------LKND---
A0A0S3TIS7      ---VDTQAKIVTSVPVLQATITS-------LS---------------------LKND---
A0A1U7GW28      ---VDTQAKIVTSVPVLQATITS-------LS---------------------LKND---
A0A2N6LW63      ---VDTQAKIVTSVPVLQATITS-------LS---------------------LKND---
A0A328IH74      ---VDTQAKIVISVPVIQETITS-------LS---------------------LKNN---
A0A4D9CIB0      ---VDTQAKIVISVPVIQETITS-------LS---------------------LKNN---
A0A1Z4TQ63      ---LDTQAKIVTSVPVIQETITS-------LS---------------------LKND---
A0A4Q9J8G2      ---LDTQAKIVTSVPVIQETITT-------LS---------------------LKDD---
A0A1Z4SMD6      ---LETQAVILNSEPIIQKVINT-------LK---------------------LKDK---
A0A2H2Y096      ---LETQAVILNSEPIIQKVINT-------LK---------------------LKDK---
K9S8M8          ---LDTEAEVIRSTPIAEEVITS-------MG---------------------LRSS---
A0A1Z4NFV0      ---LSTQAVVLQSRPILEQVIAK-------LN---------------------LRDR---
B0CAX4          ---VQTEAEIIRSEPILRQTITA-------LK---------------------LVDD---
U5DPF5          ---LANEAAIIRSLPIGQQVIER-------LD---------------------IRNA---
A0A350Y0P6      ---LDTEAQIITAQPILEKTIAK-------LN---------------------LKTA---
A0A352X940      ---LDTEAQVITSLPLIQKTIER-------LN---------------------LKTE---
B8HTN4          ---IDTEAQIIRSTPIIQELITT-------LQ---------------------LKDP---
A0A2A2TPF8      ---LSTQAVILQSRPILQAVVEK-------LN---------------------LRDK---
A0A1Z4R0P8      ---LSTQAVILQSRPILQAVIER-------LN---------------------LRDD---
A0A0T7BUI3      ---LNTQAVIVNSQPVIKEVIKT-------LN---------------------LKDN---
A0A1Z4LP32      ---LETQAVVIQSEPILQEVIDT-------LN---------------------LKDD---
K9REP9          ---LETQAVIVQSEPILQKVIDT-------LN---------------------LKDD---
A0A1Z4SIJ3      ---LETQAVIVDSEPVLEEVIRT-------LD---------------------LKDK---
A0A2H2XPG4      ---LETQAVIVDSEPVLEEVIRT-------LD---------------------LKDK---
K9V3C7          ---LSTQAAILESRPIVQEVIQA-------LD---------------------LKDN---
A0A1Z4T6Y7      ---LSTQAEILQSRPILEAVIKK-------LD---------------------LRDK---
A0A2H2Y561      ---LSTQAEILQSRPILEAVIKK-------LD---------------------LRDK---
A0A1Q4S362      ---LSTQAEILQSRPILEEVIKK-------LD---------------------LRDK---
A0A3S1CIN8      ---LSTQAEILQSRPIIEEVIKK-------LD---------------------LRDK---
A0A2A2TC28      ---LQTQAVIVNSQPILQEVINN-------LN---------------------LKDK---
A0A0C1NCB0      ---SDTQAVVVTSAPILQQVIDK-------LA---------------------LKNN---
A0A2N6K7Q9      ---LETQAVIVNSHPMLQEVITS-------LQ---------------------LKDE---
A0A2N6MXH6      ---LETQAVIVNSHPMLQEVITA-------LQ---------------------LKDD---
A0A2N6M5A8      ---LETQAVIVNSHPMLQEVITA-------LQ---------------------LKDD---
A0A2N6LL61      ---LETQAVIVNSHPMLQEVITA-------LQ---------------------LKDD---
A0A0S3TP66      ---LETQAVIVNSHPMLQEVITA-------LQ---------------------LKDD---
G6FP91          ---LETQAVIVNSHPMLQEVITA-------LQ---------------------LKDD---
A0A1U7GYR5      ---LETQAVIVNSHPMLQEVITA-------LQ---------------------LKDD---
A0A2N6KY52      ---LETQAVIVNSHPMLQEVITA-------LQ---------------------LKDD---
A0A2N6KMP5      ---LETQAVIVNSHPMLQEVITA-------LQ---------------------LKDD---
A0A2N6MA45      ---LETQAVIVNSHPMLQEVITA-------LQ---------------------LKDD---
A0A4Q9J9V9      ---LETQAVIVNSHPMLQEVITA-------LD---------------------LKDE---
A0A328IGA1      ---LETQAVIVNSHPMLQEVITA-------LD---------------------LKDE---
A0A4D9CE41      ---LETQAVIVNSHPMLQEVITA-------LD---------------------LKDE---
A0A0M0SFT2      ---LETQAVIVNSHPMLQEVITA-------LD---------------------LKDE---
A0A1Z4TLC8      ---LETQAVIVNSHPMLQEVITA-------LD---------------------LKNE---
A0A0C2LFH0      ---LETQAVILKSEPILKEVIDT-------LG---------------------LKDK---
A0A1Z4IYV4      ---LETQSVILTSQPILEEVIKT-------LE---------------------LKDK---
A0A1Z4Q0T6      ---LETQAVILQSQPILEEVINT-------LR---------------------LKDK---
A0A0C2PT44      ---LETQAVILKSEPILEEVIKT-------LE---------------------LKDK---
A0A1D2P6J4      ---LETQAVILKSEPILEEVINT-------LG---------------------LKDK---
A0A4R4IQ40      ---VNTEIEVVRSIPLLQKTIAA-------LN---------------------LKDD---
A0A433W533      ---VNTEIEVVRSIPLLQKTIAA-------LN---------------------LKDD---
A0A2P8QWJ3      ---VNTEIEVVRSIPLLQKTIAA-------LN---------------------LKDD---
A0A2T1FKP8      ---VNTEIEVVRSIPLLQKTIAA-------LN---------------------LKDD---
K9U6L7          ---VNTEIEVVRSIPLLQKTIAA-------LN---------------------LKDD---
A0A3M9ZEU1      ---VETQAEIVRSAAIARATIEA-------LD---------------------LRDD---
A0A1Z4JK72      ---LDTQAVVVTSYPILQRVIDT-------LQ---------------------LKNS---
A0A0N7Z489      ---LDTQAAVVTSYPILQRVIDT-------LQ---------------------LKNA---
A0A0S3TXS2      ---LDTQAAVVTSYPILQRVIDT-------LQ---------------------LKNS---
A0A1Z4RN12      ---IETEAKILQSRPIVERLIKE-------LE---------------------LKND---
A0A2T1CMF9      ---IETEAEILGSRTIVEKVIQE-------LD---------------------LKSE---
Q7NDC5          ---LDTQAEILQSRPVAAGVIRD-------LQ---------------------LGDP---
U5QGK3          ---LDTQAEIIQSRPLVEKVIRT-------LQ---------------------LKDP---
A0A2W4UY24      ---LDTQVEIFLSKPIAEKVINQ-------LK---------------------IEDS---
A0A2T1GMT4      ---ITTQMEVIASRPLLQKTADR-------LK---------------------LKND---
K9UI51          ---ITTQMEVIASRPLLQRTADR-------LK---------------------LKND---
K9QM62          ---ISTEVEVITSYPLLQRTIDA-------LK---------------------LKNN---
A0A1Z4FWI3      ---ISSQIEVISSPTLLQRTIDE-------LQ---------------------LKND---
A0A1Z4JYE7      ---ISTQVEVISSPPLLEKVINK-------LE---------------------LTNE---
A0A2T1FXY4      ---ISSQMEVISSPALLQRTIDE-------LQ---------------------LKND---
A0A4V2X3N2      ---ISSQIEVISSPTLLQQTIDE-------LQ---------------------LKNE---
K9TYI2          ---VSSQIEVISSPTLLQQAIDE-------LQ---------------------LKNN---
A0A1Z4QL41      ---ISTQIEVISSPPVLQKTIDK-------LK---------------------LKNQ---
A0A252D4T4      ---ISTQIEVISSPILLQRTIDE-------LQ---------------------LKNA---
A0A252DJH5      ---ISTQIEVISSPILLQRTIDE-------LQ---------------------LKNA---
A0A252EB80      ---ISTQIEVISSPILLQRTIDE-------LQ---------------------LKNA---
A0A1Z4HPW5      ---ITTQIEVITSPLLLQKTIDE-------LQ---------------------LKNN---
A0A1Z4MSN1      ---ITTQIEVITSPLLLQKTIDE-------LQ---------------------LKNK---
A0A1Z4U1C2      ---ITTQIEVITSPLLLQKTIDE-------LQ---------------------LKNK---
A0A0D6KV51      ---ITTQIEVITSPLLLQKTIDE-------LQ---------------------LKNK---
A0A1Z4MKF8      ---ITTQIEVITSPLLLQKTIDE-------LQ---------------------LKNK---
A0A2C6WC43      ---INTQIEVISSPALLQKTIDK-------LQ---------------------LKDQ---
A0A1Z4L5A1      ---INTQIEVISSPALLQKTIDK-------LQ---------------------LKDK---
A0A367QD86      ---INTQIEVISSPPLLQKTIDK-------LQ---------------------LKDK---
A0A235IZ96      ---VSTQIEVITSPSLLQRAIDK-------LK---------------------LKDK---
A0A2L2NGP0      ---VSTQIEVITSPSLLQRAIDK-------LK---------------------LKDK---
A0A2K8SM78      ---INTQIEVISSPNLLQRTIDK-------LQ---------------------LKDE---
A0A2R5FPC0      ---INTQIEVISSPNLLQRTIDK-------LG---------------------LKDE---
A0A5P8W5T6      ---INTQIEVISSPTLLQRTIDK-------LG---------------------LKDD---
A0A140KBA0      ---LTTEVEVVSSRPIIDRVIKE-------LD---------------------LRNK---
K9XSG1          ---LTTEVEVVSSRPIIDRVIKE-------LD---------------------LRNK---
A0A0F5YE28      ---LSTQIEIISSNRLLNQVIEQ-------LN---------------------LVDD---
U7QEH7          ---LSTQIEIIYSNRLLNQVINQ-------LN---------------------LVDS---
A0A3S1ATK5      ---ISTEIEVISSRPLLQQTIDK-------LG---------------------LKNK---
A0A2Z6CPH0      ---ISTQIEVISSPLLLEQIIDK-------IQ---------------------LKDE---
A0A1Z4GT50      ---ISTQIEVITSPPLLQRTIDQ-------LH---------------------LKNN---
A0A1Z4GIX0      ---INTQIEVISSPPLLQRTIDK-------LQ---------------------LKND---
A0A2H6LC24      ---INTQIEVISSPPLLQRTIDK-------LQ---------------------LKND---
B2J6N5          ---INTQIEVISSPTLLQRTIDK-------LQ---------------------LKDQ---
A0A367RMI4      ---ISSQIEVISSPALLQRTIDK-------LQ---------------------LKDN---
A0A235HUM0      ---ISSQIEVISSPALLQRTIDK-------LQ---------------------LKDK---
A0A2L2NW47      ---ISSQIEVISSPALLQRTIDK-------LQ---------------------LKDN---
A0A1E2WUR1      ---ISSQIEVITSPKLLQRTIDK-------LQ---------------------LKDN---
A0A235IKU3      ---VSTQIEVITSPNLLQRAIDK-------LK---------------------LKDK---
F4XKF3          ---LSTEVEVIYSHPLLQQIIDQ-------LN---------------------LTDN---
A0A1D9FX10      ---LSTEVEVIYSHPLLQQIIDQ-------LN---------------------LTDN---
A0A1D8TNX9      ---LSTEVEVIYSHPLLQQIIDQ-------LN---------------------LTDN---
A0A1U7MYU6      ---LSTEVEVIYSHPLLQQIIDQ-------LN---------------------LTDN---
A0A3C0NJ41      ---VSTEMEILHSIPLAQKTIAA-------FN---------------------LKDN---
A0A352AG88      ---ITTEIEILRSVPLAKETIAA-------LN---------------------LKSE---
A0A350Y374      ---ISTEIEILSSLPLLDKTLNT-------LN---------------------LKDD---
A0A355DPX0      ---ISTEIEILSSVPLLDKTLNT-------LN---------------------LKDD---
A0A0D8ZUV2      ---LKTEAAVLSSIPLAQQTITA-------LN---------------------LKDN---
A0A433VDI0      ---LKTETEVLRSIPLVQRTIAE-------LN---------------------LKDE---
A0A3D1PG43      ---SQTEIEIMSSRPLAKETIAA-------LN---------------------LKDK---
A0A2P8QQ72      ---VSTESEIVSSIPLAQKTIAA-------LT---------------------LKDE---
K9TZQ7          ---VSTESEIVSSIPLAQKTIAA-------LT---------------------LKDE---
A0A2G7GPR0      ---LNTEIEIIRSVPFVEKTISA-------LN---------------------LRNS---
K9XH68          ---LNTEIEIIRSVPFLEKTITA-------LN---------------------LRND---
A0A1U7HW70      ---LNTEIEIIRSVPFLEKTIAS-------LN---------------------LRND---
A0A2S6VEJ8      ---LNTEIEIIRSVPFLEKTITA-------LN---------------------LRND---
                                                                            

K9SLA9          -------------------QTATENELEAEQ---------SIESF----LANLQVTNL--
A0A168TT23      QRNLYRELRALPGRLVQLIRSDPPSAQPAAVQSPEAARAAAIRSAGGRLRARISVSPR--
A0A0M1JWX9      ----------------------------------PKYPEVEYKTLVTGEKPPLIIEQKKE
A0A2T1M1V6      ----------------------------------------NLEDY----KKLFTIEPQ--
A0A2G7GCS2      ----------------------------------------RLSDY----KLAFSATPQ--
K9XBH8          ----------------------------------------RLSDY----KSLFTVSPQ--
A0A1Z4LJ30      ----------------------------------------RLNNF----KKLFEVSPE--
K9RI76          ----------------------------------------RLSQF----KKLFEVTPE--
A0A352AE27      -----------------------------------------LRSY----KKLFEISPQ--
A0A3B8JH60      ----------------------------------------KPSQY----KKLFKVSPQ--
A0A3C0N766      ----------------------------------------KPSQY----KKLFKVSPQ--
K9W9J7          ----------------------------------------RLAKY----KRLFQVKPQ--
A0A139WSU3      ----------------------------------------SISRY----RQLFKVTPQ--
A0A433VN22      ----------------------------------------NLEQY----KALFQVSPQ--
Q7NF11          ----------------------------------------QLGSY----EKLFKAVPQ--
A0A1Z4JCS8      ----------------------------------------KPRNY----GQFFEVTSL--
F4XTX2          ----------------------------------------RLVQY----KQLFAVSPH--
Q7NJN6          ----------------------------------------RLDTY----GKLFKGKPG--
U5QCC3          ----------------------------------------RLEDY----TKLFKSKIE--
A0A3S0Y9N9      -------------------L------------------NLNPLVF----LKELQVKNI--
A0A433UNK7      -------------------L------------------NINPLVF----LKDLEVKNI--
A0A3M1SVZ4      -------------------L--------KNSEGK----LVEYSDV----LKNLKLSKV--
A0A654SFI6      -------------------L--ETDPAFIEAFDLDEETPVTRRDVEQVLLDNIKVTPI--
K9SSQ0          -------------------A-----NLSTNLSKQ----DLIT-------QISDHLTIT--
A0A2W1JIN9      -------------------------QSYRQQWDDPVDIPLSVGEL----KQSLQTGIV--
A0A318AJV1      -------------------L---DRDPEFASPSRLTHRPATPDQIVTRVTKSVGVSRD--
A0A1U7N2U4      -------------------I--------LGSSPE----GLTINTL----RRDLKVKIV--
A0A1D9G1F2      -------------------L--------LGSSQE----GLTIDTL----REDLKVKIV--
F4XV38          -------------------L--------LGSSQE----GLTIDTL----REDLKVKIV--
A0A2P8QIL5      -------------------T-----ANNRNSNAE----PPTVEEL----RKQLKVKTV--
A0A2T1FLY5      -------------------T-----ANNRNSNAE----PPTVEEL----RKQLKVKTV--
A0A433W447      -------------------T-----ANNRNSNAE----PPTVEEL----RKQLKVKTV--
K9U1K8          -------------------T-----ANNRNSNAE----PPTVEEL----RKQLKVKTV--
A0A4V6P809      -------------------T-----ANNRNSNAE----PPTVEEL----RKQLKVKTV--
K9UYB2          -------------------A-----KTSPETLN-----SITTKQL----RRGLRVKVV--
A0A218QN17      -------------------L-----KSYNGSPPS----QITSGDL----SKGLGVKIV--
K9RKN2          -------------------S-----QYKIKNDQNFGKDGLTSEYL----RKNLSVKIV--
A0A2I8ADV2      ----------------------------SKHPQI----QLTPTDI----SSALKVSIL--
A0A1W5CKM3      -------------------P-----PIKDSSTQK----PLTASDI----RSNLKVIIV--
A0A5Q0GMF5      -------------------P-----PIKDSSTQK----PLTASDI----RSNLKVIIV--
Q3MEW0          -------------------P-----PIKDSSTQK----PLTASDI----RSNLKVIIV--
A0A1Z4KIC7      -------------------P-----PIKDSSTQK----PLTPSDI----RSNLKVIIV--
Q8YSM5          -------------------P-----PIKDSSTQK----PLTPSDI----RSNLKVIIV--
A0A1Q4S1H4      -------------------A-----NSQTASQAE----KTTLKKL----SRDLKVKII--
A0A433VBU6      -------------------A-----NPQTASSSE----KLSFKQL----SRDLKVKII--
A0A1Q4RZJ6      -------------------N-----SDGGQNGST----KLTVDEF----SQGIRVKTI--
A0A1Z4SNV3      -------------------------AETSEAGRS----TITTAEL----SRGIRIKTI--
A0A2H2XJQ1      -------------------------AETSEAGRS----TITTAEL----SRGIRIKTI--
A0A3S5K358      -------------------NSDVENSEDGQNGST----KLTVDEL----SQGIRVKTI--
A0A0T7BPJ4      -------------------P-----PG----VKD----SITPEKL----RKKLKVKIV--
A0A0C1QS61      -------------------S-----SYK---STT----QVKIQDL----NKGLGVKIV--
A0A139X3R8      -------------------S-----SHK---TNT----QVKTPDL----SKGLGVKIV--
A0A1Z4I7C5      -------------------R-----QQG-NSTQK----KLSPSDI----KSNLKVVIV--
A0A0C2MDK7      -------------------P-----QTKGNLSLS----PVSTAEL----SHNLKVKIV--
A0A1Y0RCK1      -------------------P-----QIKGNLSQS----PVSTAEL----SHNLKVKIV--
A0A1Z4PWZ0      -------------------P-----EIKGNLSLS----PVTTGEL----SHNLKVTIV--
A0A0C2QLT0      -------------------P-----EIKGNLQRS----PVTTTEL----SRNLKVKIV--
A0A1Z4J2K1      -------------------P-----EIKGNLQRS----PVSTAEL----SHNLKVKIV--
A0A3S0ZSX0      -------------------P-----QLNSSSLST----PLTPEKV----RQGLKVKIV--
A0A2N6K4T3      -------------------A-----ESGFRSPEN----ELTVDQL----TQGLKVKIV--
A0A370CKT2      -------------------A-----ESGFRSPEN----ELTVDQL----SQGLKIKIV--
A0A0S3TL97      -------------------A-----ESGFRSPEN----ELTVDQL----SQGLKIKIV--
A0A2N6M8A0      -------------------A-----ESGFRSPEN----ELTVDQL----SQGLKIKIV--
A0A2N6M9E1      -------------------A-----ESGFRSPEN----ELTVDQL----SQGLKVKIV--
A0A2N6KJI4      -------------------A-----ESGFRSPEN----ELTVDQL----SQGLKIKIV--
A0A2N6MZ77      -------------------A-----ESGFRSPEN----ELTVDQL----SQGLKIKIV--
A0A2N6KT20      -------------------A-----ESGFRSPEN----ELTVDQL----SQGLKIKIV--
G6FSN3          -------------------A-----ESGFRSPEN----ELTVDQL----SQGLKIKIV--
A0A4D9CI02      -------------------A-----ESGFSSPEN----ELTVGQL----SRNLKVKIV--
A0A328I8B9      -------------------A-----ESGFSSLEN----ELTVGQL----SRNLKVKIV--
A0A4Q9J4Z7      -------------------A-----ESGFSSVEN----ELTVGQL----SRNLKVKIV--
A0A0M0SU69      -------------------A-----ESGFSLPEN----ELTVGQL----SQNLKVKIV--
A0A1Z4TIZ8      -------------------A-----ESGFSPPGN----ELTVEQL----SQNLKVKIV--
A0A0S3TYD7      -------------------D-------NAPL---------KVEDF----LKRLKVTPV--
U5QL42          ----------------------------------------NSTTA----ADNISISQI--
K9QF04          ----------------------------------------DYRQL----VKQLKIKHK--
A0A3C0N2P0      ----------------------------------------DANTL----RSQLQISRL--
K9TLQ0          ----------------------------------------KFEEL----IKNLSVRRL--
A0A076HBF2      -------------------------------------------------RSRVDISTG--
A0A354B169      -------------------------------------------------SSRLKISIG--
G4FMX5          -------------------------------------------------ASRITITTG--
Q0IDT5          -------------------------------------------------AERINITTG--
A0A2D6FCW3      -------------------------------------------------AKRITITTG--
A3ZA21          -------------------------------------------------ASRIEISTG--
A0A140K3H3      ----------------------------------------TVTDV----MENLSITQA--
K9XUB8          ----------------------------------------TVGNV----IGNLSIIQA--
Q7NEU3          ----------------------------------------DAEDI----TKRLEIIRE--
A0A352XE00      ----------------------------------------DYNLL----RTKLTISRL--
B4VS56          ----------------------------------------DYNTL----RSQLAINQL--
A0A352AAQ3      ----------------------------------------DYDTL----RTKLIISRL--
A0A350Y472      ----------------------------------------DYSAL----RTKLTISRL--
A0A355DVB4      ----------------------------------------DYSAL----RTKLTISRL--
A0A2P8VVX1      ----------------------------------------TVDEL----RAGFTLARL--
A0A2P8WHY0      ----------------------------------------DVDQV----VNTFSLQRV--
A0A2T1CMT9      ----------------------------------------TTAAIIAALRESIGVYQV--
A0A563VQJ3      ----------------------------------------KPKNF----AQNLTVELV--
A0A1D8TX52      ----------------------------------------TIRDI----RGSLRLAQV--
A0A1U7N5X9      ----------------------------------------TVGDI----RGSLRLAQV--
A0A1D9G4T2      ----------------------------------------TVGDI----RGSLRLAQV--
F4XP71          ----------------------------------------TVGDI----RGSLRLAQV--
A0A2P8QVH5      ----------------------------------------TVEEINGK-PAKVKQSPL--
A0A2T1FT70      ----------------------------------------TVEEINGK-PAKVKQSPL--
A0A433W4W4      ----------------------------------------TVEEINGK-PAKVKQSPL--
K9U5W1          ----------------------------------------TVEEINGK-PAKVKQSPL--
A0A2W6ZAV2      ----------------------------------------SPDKI----ASGLKIVSG--
A0A2G7GMH8      ----------------------------------------DIKSL----RKSLTLSPV--
K9W742          ----------------------------------------TLKEL----RKSLSVFQV--
A0A2T1DWE8      ----------------------------------------EAAEL----QKALVLTQV--
A0A1U7I8L3      ----------------------------------------KVKDI----KEALVVNQL--
A0A2T1DJL8      ----------------------------------------DVGDL----QKGLTVSQV--
A0A1Z4J9W0      ----------------------------------------DVDRL----RKRLNIAQV--
A0A0N7Z5K9      ----------------------------------------DVDRL----RNRLNIAQV--
A0A0S3TXC5      ----------------------------------------DVDRL----TRRLNIVQV--
K9SA61          ----------------------------------------TVGHL----KEALIVTQV--
A0A3D1PBA3      ----------------------------------------TAKEI----KANLKLRQV--
K9XPB0          ----------------------------------------EIAEIVEQLKSSLSVYQV--
A0A350Y7Z1      ----------------------------------------QVTDI----KESFSLTGV--
A0A352X2A7      ----------------------------------------KVEEI----REFLTITRI--
A0A0D8ZYV0      ----------------------------------------TVKEL----KQTLVLTPL--
A0A4R4IUM6      ----------------------------------------TVAEV----KKNLVLKQV--
A0A2T1FP73      ----------------------------------------TVAEV----KKNLVLKQV--
A0A433VMS2      ----------------------------------------TVAEV----KKNLVLKQV--
K9TYA7          ----------------------------------------TVAEV----KKNLVLKQV--
A0A2P8QUE1      ----------------------------------------TVAEV----KKNLVLKQV--
A0A2T1DNG3      -------------------D------PDNPG---------SVGGF----RGALTIVQVGT
A0A2P8W9H0      -------------------K-------SQPSV--------SYGQL----ITNLKIVPN--
A0A1Z4LN32      -------------------N-------GKPL---------DPNSI------SIGTGSI--
A0A2I8A9F5      -------------------K-------GERL---------KIESV------DIQVEAI--
A0A218Q6R8      -------------------E-------NNLL---------RPESI------NINIERI--
A0A218QGE0      -------------------K-------GNPL---------SPDAI------SIKTEAV--
B8HNB0          ----------------------------------------SVGSI----AGGLSITQV--
A0A563VS48      -------------------G-------GELI---------RYQSF----RESFQVRPI--
A0A318BJ18      EMYKFNSDDPAFQLVNGRYT-----STGRAERVRI-----AGEIL----RDNLTIGST--
A0A3B8Y8H9      -------------------T-----EEEKVE---------YQAFI----ENQLSINRP--
A0A2W1JVB9      -------------------E-------GEPL---------KIFDF----EEQLSIKKA--
A0A1Z3HMQ0      -------------------K-------GNSI---------PPDVL----RRGLTIAPL--
A0A1E5QP61      -------------------Q-------GKFI---------PPGDF----LSQLNVKKI--
A0A3M2GIL5      -------------------E-------GNLI---------PPGGL----LSGLGVKGI--
A0A433NM31      -------------------Q-------GEPL---------KIKEF----QQRLEVKNI--
A0A3M1PML8      -------------------K-------GEPV---------LVKDF----LSKLKANSI--
A0A352X442      -------------------T-------GNPI---------KPEVV----LQGLQVKPV--
A0A0T7BPZ0      -------------------Q-------GKPL---------TIEDL----TKNIKVEVV--
A0A0M0SHU3      -------------------E-------GEPL---------TVEEL----LEDLKVESV--
A0A1D2PBN3      -------------------K-------GKPL---------TIQEL----SKKLKIKGD--
A0A0C2LVR7      -------------------R-------GKPL---------TIQEL----SKKLKIKGD--
A0A1Z4PQB9      -------------------K-------GKPL---------TIQEL----SKELKIKGD--
A0A1Z4SFN6      -------------------E-------GQLL---------TIPNF----TAKLKTKNY--
K9PGI8          -------------------R-------GKFI---------QTQDL----SHKLKVESS--
A0A563VLD6      ---------------------------GLSV---------GEVIS----KLSINTQEV--
A0A318BG22      -------DAFVDDAATGGGD-------GKAPAVRQRRIDAATAVV----MRNIEAAPL--
A0A2T1E9V8      -------------------Q-------KTPL---------SVGDL----QAGLEVINI--
A0A3M2GQQ6      -----------------------------PI---------GVKQV----ASNLSIHKA--
K9SGJ5          -------------------T-----MT-QDQ---------MVSYV----LENLYIRQE--
L8MYT6          -------------------G-----SS-KPI---------DASSV----INGLDIRPE--
A0A352JGJ6      -------------------S-----SKIKDI---------DAVTI----MSGLEIRPE--
A0A1J5GLS2      -------------------A-----SAYREI---------DAGTI----MGGLEIRPE--
A0A2W4W6M5      -------------------A-----NTYKEI---------DAGTI----MGGLEIRPE--
A0A2W7AN33      -------------------A-----IPYKDI---------DTLAI----MDGLDIQPE--
A0A256BLV2      -------------------A-----LSFKDL---------DPLTI----MNGLDIRPE--
A0A2W6ZXF3      -------------------A-----SSYKEI---------DAGTI----MNGLEIRPE--
A0A2Z5WX66      -------------------S-----NASKDI---------DAVTI----MNGLEIRPE--
K9W1T3          -------------------Q--------------------KPESF----LKPLKVTNI--
A0A1Q4RTR1      -------------------K-------GQPL---------AFEEF----SKNLKVSGV--
A0A1Z4SQV2      -------------------N-------GQPL---------TVEEF----SQKLKVAGV--
A0A2H2XGN1      -------------------N-------GQPL---------TVEEF----SQKLKVAGV--
A0A433UXH8      -------------------K-------GQPL---------TIEEF----SQKLKVTGV--
A0A1Z4RMB9      -------------------E-------DKPL---------KPEDF----RKKLVTEVV--
K1XF69          -------------------D-------GEPV---------APEDI----RRNLDMRII--
B5W297          -------------------D-------GEPV---------APEDI----RRNLDMRII--
H1W7M8          -------------------D-------GEPV---------APEDI----RRNLDMRII--
A0A5Q4H6A5      -------------------D-------GDPI---------YPEDI----RRNLDIRII--
D5A466          -------------------D-------GDPI---------YPEDI----RRNLDIRII--
B4WP72          ---------------------------EEAL---------TPTSL----KEGLEVKAI--
A0A318B4H2      FAMYGGEEPSAAAPRTRSAQ-----EQGKRLDQ-------AASIL----LDNITVEPI--
B4WQE3          -------------------D----------I---------SYDSL----KNNLTITPN--
A0A2P8W4F7      -------------------N----------I---------TYNAL----LSRLSIVQE--
A0A5Q4E0Z4      -------------------E----------I---------TYTTL----LNDLVISQE--
A0A2K3BR24      -------------------E-------GEPL---------TPGGM----RKNLNVTRL--
K9YXY1          -------------------E-------GEPL---------TPGGV----RKNLNVTRL--
U5QJM6          -------------------K-----LKDD-----------DIDDV----IKRLEIEQV--
K9SX01          ---------------------------ALPL---------DNDVF----LKPLSLDVI--
A0A4P7ZT55      ---------------------------AQGL---------EPDAL----VGRVTARSV--
A0A1E5QIR9      -------------------E-------GQPL---------KRKDF----LRRLSISTL--
A0A1Z4IBC7      -------------------N-------GKKL---------SIRIF----AQQLKIEGI--
A0A1W5CPC7      -------------------N-------GKPL---------SIRIF----AKQLKIEGI--
A0A5Q0GKD1      -------------------N-------GKPL---------SIRIF----AKQLKIEGI--
Q3MDC6          -------------------N-------GKPL---------SIRIF----AKQLKIEGI--
A0A1Z4KM73      -------------------N-------GKPL---------SIRIF----AKQLKIEGI--
Q8YNX7          -------------------N-------GKPL---------SIRIF----AKQLKIEGI--
A0A367R4K6      -------------------H-------GKLL---------SIRDL----AQQLKVEGI--
A0A1E2WSV8      -------------------Q-------GKPL---------SIPDL----AKQLKIEGI--
A0A2R5FRT9      -------------------K-------GKLL---------SIPDL----AKQLKIEGI--
A0A2K8T1B6      -------------------K-------GKRL---------SIPDL----AKKLKIEGI--
A0A235I9I0      -------------------Q-------GKLL---------SIPDL----AKQLKIEGI--
A0A2D0HQT8      -------------------Q-------GKLL---------SIPDL----AKQLKIEGI--
A0A2L2NU95      -------------------Q-------GKLL---------SIPDL----AKQLKIEGI--
A0A367S084      -------------------Q-------GKLL---------SIPNL----AKQLKIEGI--
A0A0V7ZFJ4      -------------------K-------GKLL---------KPSVL----ISKLRVNAV--
A0A367RIS1      -------------------L-------GQPL---------EIDTF----LSNLKIKSI--
A0A235IXQ2      -------------------L-------GQPL---------EIDDF----LHNLKIKSV--
A0A1W5CNX3      -------------------Q-------GQPL---------EIDDF----LRSLKIKSV--
A0A5Q0GJJ5      -------------------Q-------GQPL---------EIDDF----LRSLKIKSV--
Q3MEB7          -------------------Q-------GQPL---------EIDDF----LRSLKIKSV--
A0A1Z4KHN9      -------------------Q-------GQPL---------EIDDF----LRNLKIKSV--
Q8YT70          -------------------Q-------GQPL---------EIDDF----LRNLKIKSV--
A0A218Q4C1      -------------------E-------GEPL---------GVGSF----LGKLKVTTI--
A0A166IWU6      -------------------E-------GEPL---------RIDNF----LGSLKVNAV--
A0A2S0Q8C0      -------------------E-------GEPL---------KIDHV----LGSLKVQAI--
W6FSX4          -------------------E-------GEPL---------KIDHV----LGSLKVQAI--
A0A0V7ZNJ9      -------------------D-------NEPI---------SIEDF----LKQLKVKSA--
A0A0R0M9H9      -------------------K-------GEPI---------EIDRF----LKQLKLQTI--
A0A1S1ZVW2      -------------------K-------GEPI---------EIDVF----LKQLKLQII--
A0A1B7WX82      -------------------K-------GGQI---------SLENF----LKKLKLKSI--
A0A1B7WTD1      -------------------K-------GAPM---------TTDAF----LKTLKLKTI--
A0A480ABC0      -------------------K-------GAPM---------TTGDF----LKILKLKTI--
A0A1Z4LRU5      -------------------E-------GETL---------SHEAF----LKLLQVKSI--
A0A1Z4JVB4      -------------------K-------GQPL---------SIEDF----LKNLKLKTI--
K9PIA4          -------------------T-------GEYL---------PIETF----LKILQLKTI--
A0A1Z4M597      -------------------S-------GKPL---------TIEKF----LKLLKLKTI--
A0A1Z4MWT1      -------------------S-------GKPL---------SIEKF----LKLLKLKTI--
A0A1Z4TX53      -------------------S-------GKPL---------SIEKF----LKLLKLKTI--
A0A1Z4HVE1      -------------------S-------GKPL---------TIEKF----LKLLKLKTI--
A0A252ECZ1      -------------------S-------GKLV---------SIERF----LKVLKLKTI--
A0A1Z4G5Y1      -------------------S-------GKPL---------SIEKF----LKKLKLKTI--
A0A252DNA2      -------------------S-------GKPL---------SIEKF----LKLLKLKTI--
A0A252E1Q4      -------------------S-------GKPL---------SIEKF----LKLLKLKTI--
A0A5P8VSD1      -------------------L-------GQPL---------ELRDF----LRNLKIKNI--
A0A2A2TNQ5      -------------------K-------GKPL---------EIDDF----LKNLKVKSV--
A0A3S1C4K5      -------------------K-------GKPL---------KVEPF----LKLLKVKSV--
A0A1X4G3D5      -------------------E-------GKPL---------DPDVI----LGNLKLQTV--
D4TNI2          -------------------E-------GKPL---------DPDVI----LGNLKLQTV--
A0A1Z4H6Z8      -------------------S-------GKPL---------TIEKF----LKLLKLKTI--
A0A1Z4NPM1      -------------------K-------GKPL---------SVEDF----LKNLKVKSV--
A0A3F3KPR9      -------------------K-------GEPI---------EIDRF----LKQLKLQTI--
D4TGN7          -------------------K-------GEPI---------EIDRF----LKQLKLQTI--
A0A1Z4UZW9      -------------------Q-------GKQL---------SLEVF----LKKLKLKTI--
A0A0K2M5H0      -------------------Q-------GKQL---------SLEVF----LKKLKLKTV--
A0A1B7VSH4      -------------------Q-------GKQL---------SLEVF----LKKLKLKTV--
A0A1B7W126      -------------------Q-------GKQL---------SLEVF----LKKLKLKTV--
A0A3D4C6Q6      -------------------Q-------GKQL---------SLEVF----LKKLKLKTV--
A0A1B7UVJ4      -------------------Q-------GKQI---------SLENF----LTKLKLKTI--
A0A1B7UTR1      -------------------Q-------GKQI---------SLENF----LTKLKLKTI--
A0A5C0DRW9      -------------------Q-------GKQI---------SLENF----LKKLKLKTI--
K7W0A4          -------------------Q-------GKQI---------SLENF----LKKLKLKTI--
A0A1U7HGH0      -------------------N--------TTL---------SLESL----RQGLDIVAV--
K9XJD3          -------------------N--------TAL---------SLESL----RQGLDIVDV--
A0A2T1CIL7      -------------------Q-------GNFL---------KYQEI----LANLEVKPI--
A0A1Z4RPC6      -------------------A-------GKPL---------KTEDF----KKKLTVEIV--
A0A2T1CMZ0      -------------------L-------GEPL---------KVKEF----KEKLAIEIV--
L8M4F7          -------------------N-------GEFI---------DPNGL----RPQLKVKLL--
A0A140K2P2      -------------------Q-------GKPI---------KPKDF----EKKLSIELV--
K9XWX4          -------------------Q-------GKPI---------KPKDF----EKKLNIELV--
A0A140KB14      -------------------E-------GKAL---------KPEVL----NNKLKIEII--
K9XX88          -------------------E-------GKAL---------KPEAL----NKKLKIEIV--
A0A563VSV6      -------------------E-------GETL---------TAKDL----RRKLQVGLV--
L8LZE9          -------------------E-------GEPL---------TPEKM----TKKLKADLV--
A0A433V7A0      -------------------Q-------DNAR---------LETNL----KKQFQVKNI--
A0A1Z4NDS1      -------------------E-------GNPL---------QIKAF----RSKLKVDSA--
K9F4D9          -------------------E-------GELL---------QPEDL----LKGLTVTGV--
U9VXM0          -------------------E-------GELL---------QPDEL----LRDLTITGI--
A0A2T1FTR8      -------------------K-----YANRPERKRLDKFINKNESF----VQQLKVSSI--
K9UA41          -------------------K-----YANRPERKRLDKFINKNESF----VQQLKVSSI--
A0A0C2LBE2      -------------------K-------GKAI---------TIEEL----TNTLKISSL--
A0A433NN38      -------------------L-------GNPL---------RIEDL----AAALSVVSV--
A0A2N6K0T2      -------------------D-------GEPL---------RVEDV----QKNLKVEGV--
A0A2N6ML72      -------------------E-------GEPL---------KVEDL----QKKLKVEGV--
G6FQZ6          -------------------E-------GEPL---------KVEDL----QKKLKVEGV--
A0A2N6MQX9      -------------------E-------GEPL---------KVEDL----QKKLKVEGV--
A0A2N6KXT6      -------------------E-------GEPL---------KVEDL----QKKLKVEGV--
A0A2N6KGB9      -------------------E-------GEPL---------KVEDL----QKKLKVEGV--
A0A2N6L3Y5      -------------------E-------GEPL---------KVEDL----QKKLKVEGV--
A0A0S3TIS7      -------------------E-------GEPL---------KVEDL----QKKLKVEGV--
A0A1U7GW28      -------------------E-------GEPL---------KVEDL----QKKLKVEGV--
A0A2N6LW63      -------------------E-------GEPL---------KVEDL----QKKLKVEGV--
A0A328IH74      -------------------E-------GEPL---------TVEEL----LENLKVEGV--
A0A4D9CIB0      -------------------E-------GEPL---------TVEEL----LENLKVEGV--
A0A1Z4TQ63      -------------------E-------GEPL---------KIEDL----LKNLKVEGL--
A0A4Q9J8G2      -------------------E-------GEPL---------KIKDL----LKNLKVEGL--
A0A1Z4SMD6      -------------------K-------GKLL---------NPELV------KVKVETI--
A0A2H2Y096      -------------------K-------GKLL---------NPELV------KVKVETI--
K9S8M8          -------------------S-------GKPM---------KPESF----LRGLEVKTI--
A0A1Z4NFV0      -------------------N-------GKLL---------DPDLL------KIKVEPV--
B0CAX4          -------------------E-------DQPL---------ETKDF----IEALTVFNV--
U5DPF5          -------------------D-------GTPM---------APQNI----VGNLKVYEV--
A0A350Y0P6      -------------------E-------GTPV---------QPSSI----GAGLKVEGI--
A0A352X940      -------------------N-------GSPI---------KPENL----LGRLTVKGL--
B8HTN4          -------------------Q-------GQLL---------KPEAF----LESLSVNNI--
A0A2A2TPF8      -------------------T-------GKLI---------EPESL------IIKVEPI--
A0A1Z4R0P8      -------------------T-------GKLV---------DPKSL------IIKVEPV--
A0A0T7BUI3      -------------------Q-------GKFR---------NPETL------LIKVEPI--
A0A1Z4LP32      -------------------D-------GKPL---------EPESL------PMEVEAL--
K9REP9          -------------------D-------GKPL---------EPEAL------DLEIEPL--
A0A1Z4SIJ3      -------------------K-------GHPL---------DPDQL------KIKIEAI--
A0A2H2XPG4      -------------------K-------GHPL---------DPDQL------KIKIEAI--
K9V3C7          -------------------K-------GRSL---------VPEAF------KIKVEAV--
A0A1Z4T6Y7      -------------------N-------GNLV---------KPESL------NIKVEPI--
A0A2H2Y561      -------------------N-------GNLV---------KPESL------NIKVEPI--
A0A1Q4S362      -------------------N-------GELL---------EPESI------NIKIEPI--
A0A3S1CIN8      -------------------N-------GELL---------KPESI------NIKIDPI--
A0A2A2TC28      -------------------D-------GKPV---------DVELF------KVLVEPV--
A0A0C1NCB0      -------------------D-------GTPL---------QPEDL------EIKVDPV--
A0A2N6K7Q9      -------------------Q-------GKLI---------APELL------KVNVKPI--
A0A2N6MXH6      -------------------Q-------GKLI---------EPELL------KVNVKPI--
A0A2N6M5A8      -------------------Q-------GKLI---------DPELL------KVNVKPI--
A0A2N6LL61      -------------------Q-------GKLI---------DPELL------KVNVKPI--
A0A0S3TP66      -------------------Q-------GKLI---------DPELL------KVNVKPI--
G6FP91          -------------------Q-------GKLI---------DPELL------KVNVKPI--
A0A1U7GYR5      -------------------Q-------GKLI---------DPELL------KVNVKPI--
A0A2N6KY52      -------------------Q-------GKLI---------DPELL------KVNVKPI--
A0A2N6KMP5      -------------------Q-------GKLI---------DPELL------KVNVKPI--
A0A2N6MA45      -------------------Q-------GKLI---------DPELL------KVNVKPI--
A0A4Q9J9V9      -------------------Q-------GKII---------DPELL------KINVKPI--
A0A328IGA1      -------------------Q-------GKII---------DPELL------KINVKPI--
A0A4D9CE41      -------------------Q-------GKII---------DPELL------KINVKPI--
A0A0M0SFT2      -------------------Q-------GKLI---------DPELL------KINVKPI--
A0A1Z4TLC8      -------------------Q-------GKLI---------DPELL------KINVKPI--
A0A0C2LFH0      -------------------K-------GNAL---------DPESL------KIKVEPI--
A0A1Z4IYV4      -------------------K-------GNTL---------DPESL------KIKVEPI--
A0A1Z4Q0T6      -------------------K-------GNTL---------EPESL------KIKVEPI--
A0A0C2PT44      -------------------K-------GETL---------DSESL------KIKVEPI--
A0A1D2P6J4      -------------------K-------GATL---------EPESL------KIKVEPI--
A0A4R4IQ40      -------------------R------TNEPL---------KPEDF----IDKLKLKNI--
A0A433W533      -------------------R------TSEPL---------KPADI----IGKLKLKNI--
A0A2P8QWJ3      -------------------R------TSEPL---------KPADI----IGKLKLKNI--
A0A2T1FKP8      -------------------R------TSEPL---------KPADI----IGKLKLKNI--
K9U6L7          -------------------R------TSEPL---------KPADI----IGKLKLKNI--
A0A3M9ZEU1      -------------------N-------GKRL---------QPQDI----SKQLKVKNI--
A0A1Z4JK72      -------------------K-------GRPM---------DPEEL----SKQLKVEAV--
A0A0N7Z489      -------------------Q-------GRPL---------EPDEL----SRQIKVEPV--
A0A0S3TXS2      -------------------Q-------GRPM---------EPEEL----SRQVKVEAV--
A0A1Z4RN12      -------------------D-------GEPL---------TYKSV----STALSVEPI--
A0A2T1CMF9      -------------------K-------GEPL---------TYKTV----KKALKVEPV--
Q7NDC5          -------------------R-----RPGELL---------ATTDF----LRALKVEAL--
U5QGK3          -------------------Q-----RRGQLL---------RPEKF----LKALKVETL--
A0A2W4UY24      -------------------E-------GAPL---------EANAL----LQDMSVRAI--
A0A2T1GMT4      -------------------R-------GKLI---------AASDL----HSGLTTKIV--
K9UI51          -------------------R-------GKLL---------TASDI----HTGLTTKII--
K9QM62          -------------------Q-------GKPL---------TVKAL----AKNLDLKIV--
A0A1Z4FWI3      -------------------K-------GEPL---------TVEAL----KQRLTLKIV--
A0A1Z4JYE7      -------------------K-------GEPL---------TVEEL----QEKLTLKII--
A0A2T1FXY4      -------------------R-------GELQ---------EVEAF----KKAVKLKIV--
A0A4V2X3N2      -------------------R-------GEPQ---------EVEAF----KKAVKLKIV--
K9TYI2          -------------------R-------GEPQ---------EIEAF----KKAVKLKIV--
A0A1Z4QL41      -------------------K-------GEPL---------EVEDL----VKDLTLKII--
A0A252D4T4      -------------------I-------GEPL---------TVEAL----KKAINLKII--
A0A252DJH5      -------------------I-------GEPL---------TVEAL----KKAINLKII--
A0A252EB80      -------------------I-------GEPL---------TVESL----KKAINLKII--
A0A1Z4HPW5      -------------------Q-------GQLL---------TPEAL----KKALNLKII--
A0A1Z4MSN1      -------------------E-------GKPL---------TTEAL----KKALSIKII--
A0A1Z4U1C2      -------------------E-------GKPL---------TTEAL----KKALSIKII--
A0A0D6KV51      -------------------E-------GKPL---------TPEVL----KKALNIKII--
A0A1Z4MKF8      -------------------E-------GKPL---------TPEVL----KKALNIKII--
A0A2C6WC43      -------------------E-------GQPL---------TVKAL----QKSLILKII--
A0A1Z4L5A1      -------------------E-------GQPL---------TVKAL----QKSLVLKII--
A0A367QD86      -------------------E-------GQPL---------TVKAL----QKSLVLKII--
A0A235IZ96      -------------------E-------DKPL---------EVQAL----QKSLTLKIV--
A0A2L2NGP0      -------------------E-------DKPL---------EVKAL----QKSLTLKIV--
A0A2K8SM78      -------------------E-------GKPL---------EVEKL----RNSLTLKIV--
A0A2R5FPC0      -------------------E-------GKPI---------EVEKL----RKAVILKII--
A0A5P8W5T6      -------------------E-------GKPI---------EVEKL----RKAVIMKIV--
A0A140KBA0      -------------------Q-------DELY---------RYKDL----INKLEIKPV--
K9XSG1          -------------------Q-------DELY---------RYKDL----INNLEIKAL--
A0A0F5YE28      -------------------E-------GKLI---------DPESI----RKSLEVKII--
U7QEH7          -------------------E-------GKLR---------EAESI----RKSLEVKII--
A0A3S1ATK5      -------------------K-------GEVL---------EVEDL----QKSLTLKIV--
A0A2Z6CPH0      -------------------N-------GESL---------KVEEL----QKKLKLKII--
A0A1Z4GT50      -------------------N-------GEVL---------AVEEL----AEALELKIV--
A0A1Z4GIX0      -------------------K-------GEPL---------KVEEL----QKNLTLKIV--
A0A2H6LC24      -------------------K-------GEPL---------KVEEL----QKNLTLKIV--
B2J6N5          -------------------E-------GKPL---------EVEKL----RKSLTLKIV--
A0A367RMI4      -------------------D-------GEPL---------EVKKL----LKLLNLKVI--
A0A235HUM0      -------------------E-------GEPL---------EVKAL----QKALNLKIV--
A0A2L2NW47      -------------------E-------GEPL---------EVKEL----LKVLNLKIV--
A0A1E2WUR1      -------------------E-------GIPL---------EVQAL----KKALNLKII--
A0A235IKU3      -------------------E-------DKPL---------EVQAL----QKSLTLKIV--
F4XKF3          -------------------E-------GLPL---------QPEAL----KRKLTVKIV--
A0A1D9FX10      -------------------E-------GLPL---------EPEAL----KKKLTVKIV--
A0A1D8TNX9      -------------------E-------GLPL---------EPEAL----KRRLTIKIV--
A0A1U7MYU6      -------------------E-------GLPL---------EPEAL----KRRLTIKIV--
A0A3C0NJ41      -------------------K-------GKSL---------TPEDF----QKKLKAKIV--
A0A352AG88      -------------------D-------GTPL---------SPEAL----HEKLTIENL--
A0A350Y374      -------------------Q-------GEPI---------SPESL----QKKLKIKTI--
A0A355DPX0      -------------------Q-------GEPI---------SPESL----QKKLKIKTI--
A0A0D8ZUV2      -------------------D-------GEVL---------LPEGF----LKKQNIKQL--
A0A433VDI0      -------------------A-------GVPL---------EPEDF----IKELKVKQL--
A0A3D1PG43      -------------------K-------GATV---------QPTEL----LGKLKLKNV--
A0A2P8QQ72      -------------------E-------GKPL---------KPTAL----ISQLTLKNI--
K9TZQ7          -------------------E-------GKPL---------KPTAL----ISQLTLKNI--
A0A2G7GPR0      -------------------G-------GSLM---------KPQTL----ATRINAKNV--
K9XH68          -------------------G-------GSLI---------KPQAL----AGKMSAKNI--
A0A1U7HW70      -------------------S-------GSLI---------KPQAL----AGKMSARNI--
A0A2S6VEJ8      -------------------N-------GSLL---------KPQVL----ASRVNARNI--
                                                                            

K9SLA9          P--D-------------SEILEISYHDPDPKRAASIVNTVSKIYIASDLETKSLEAKSLL
A0A168TT23      E--N-------------SRLVYVSVNSFDPAFAAQLANAVVEEYVRSTMQRRYDAGQEAR
A0A0M1JWX9      A----------------TKIIEVRYQDEDPEKIDFILKKLAENYLRYSFEDRQTNTRKGI
A0A2T1M1V6      T--Q-------------TTVIDLEVEATSPELAYQRVKTLMNSYQKRLNELRQQDVKSQD
A0A2G7GCS2      E--Q-------------STIINLQVKASSPEIAQKRLSNLINVYQLRLNELRHQDTNVRK
K9XBH8          E--Q-------------TTIIALEVKASSPEIAQQRLNNLINIYQLRLNELRYQDTSVRE
A0A1Z4LJ30      K--E-------------STVISVSVEGSSPELAQQRANGLIKAFRDRLQELRKDEAQQRS
K9RI76          K--E-------------STVISLEVQGSSPELAKNRAAALIAAFSNRLQELRLDEAKQRS
A0A352AE27      E--Q-------------STTISLTVKGSSPELAHQRAIALIEAYQQRLNELRQTDGVARA
A0A3B8JH60      E--Q-------------STIISLAVNGSTPEVARQRAIALLKVYQARLNELRQADGMSRK
A0A3C0N766      E--Q-------------STIISLAVNGSTPEVARQRAIALLKVYQARLNELRQADGMSRK
K9W9J7          E--Q-------------STIISLAVSGSTPELAKGRANNLLQVYQQRLNQLRQADSASRK
A0A139WSU3      E--Q-------------STIMLLTVSGSSPKLANQRAIAITEAYQNRLNELRQANSRTRQ
A0A433VN22      E--Q-------------STVLSLTVSGSQPDLATLRTQNLIKAYQARLDELREGNSKERQ
Q7NF11          S--Q-------------TTILAVEAKGNAPEVAEARADLVVRSYVARLEELRNAYAASRD
A0A1Z4JCS8      E--Q-------------TSVMLLSVTGSSPDIAKQRAEAILNAYRQRLSELRQANNNTRD
F4XTX2          Q--E-------------STTIWLNATGASPELARDRVRALISAYQERLNELRQADGTTRV
Q7NJN6          D--Q-------------STIVQLEAKGSSPELAQQRAEWVLQSYQTRLNALRLDDARRRD
U5QCC3          D--Q-------------STIVQVQVKGSSPEIAKNRANALLQSYQRRLNELRLDDARRRD
A0A3S0Y9N9      E--Q-------------TDILEISYADTNPRMAASIVNTLMKIYIENDIDINRAQTRSAR
A0A433UNK7      E--N-------------TDILEVYYTSTDPRTAASVVNTLMKVYIENDINANRAQTRSAR
A0A3M1SVZ4      Q--S-------------SDILTISYQDENPKKAATFVNSLIEVYLEDDILRKRAELTATR
A0A654SFI6      S--Q-------------SSLVDIEFSSPSPEISSKISNLWADEFIRANYEKRFGANIDAR
K9SSQ0          P--D-------------AKVLNISYSDRNPKTAATIL----QGLLETYKAYGANKANQAT
A0A2W1JIN9      P--G-------------TDIFQLQYTSSDPELASRMLNSIAQTVVQENTETIQAEAKSAR
A0A318AJV1      Q--L-------------SYIISLGFKSRDAAKSSRIANAFADTYLDMRVHGEASSSVQQA
A0A1U7N2U4      P--A-------------TNILELSYQSQNPELATTVLNAVANAMVSESAQGIRSEARAVR
A0A1D9G1F2      P--A-------------TNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVR
F4XV38          P--A-------------TNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVR
A0A2P8QIL5      P--A-------------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSAR
A0A2T1FLY5      P--A-------------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSAR
A0A433W447      P--A-------------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSAR
K9U1K8          P--A-------------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSAR
A0A4V6P809      P--A-------------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSAR
K9UYB2          P--A-------------TNIIDLSYQSEDSQLAANLVNSVAMAMIRDHVQAISSEATKIR
A0A218QN17      P--A-------------TNILELSYKSKDPELAAQLLNAVSQAMIEENTKTISSEATKVR
K9RKN2          P--A-------------TNILQISYENQDPLLAARLLNAVSSAMVEYDIKAISSEATKVK
A0A2I8ADV2      P--A-------------TNILQLNYFHQDPQFAADVLNAVSQAMVEENIQAISSEATKVR
A0A1W5CKM3      P--A-------------TNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVR
A0A5Q0GMF5      P--A-------------TNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVR
Q3MEW0          P--A-------------TNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVR
A0A1Z4KIC7      P--A-------------TNILDLRYQSPEPNQAAQVLNAVSQAMVEENIKTISSEATKVR
Q8YSM5          P--A-------------TNILDLRYQSPEPNQAAQVLNAVSQAMVEENIKTISSEATKVR
A0A1Q4S1H4      P--A-------------TNILELSYKASDPVFAARLLNAVSNAMVEENIKTISSEATKVR
A0A433VBU6      P--A-------------TNILELRYKAADPVFATRLVNAVTDAMVEENIKTMSSEATKVR
A0A1Q4RZJ6      P--A-------------TNILEISYQSKNPDLAATYANAVAMATIRDNIKSISSEATKVR
A0A1Z4SNV3      P--A-------------TSILEISYQSKNPELAATYVNAVAMATIRDNTKSISTEATKVR
A0A2H2XJQ1      P--A-------------TSILEISYQSKNPELAATYVNAVAMATIRDNTKSISTEATKVR
A0A3S5K358      P--A-------------TNILEISYQSKNPDLAAAYANAVAMATIRDNIKSISSEATKVR
A0A0T7BPJ4      P--A-------------TNILEFKYEARDAQLAAKLLNVIAQTMVEENTRTISSQATKVR
A0A0C1QS61      P--A-------------TNILQLSYQSKNPKLAAQLLNSVARAMEEESANTIRQEAANVR
A0A139X3R8      P--A-------------TNILQLSYQSKDPILAAQLLNAVSRAMEEESANTIRQEAANVR
A0A1Z4I7C5      P--A-------------TNILELRYQSPNPEQTAQVLNAVSQAMVEENIKTINSEATKVR
A0A0C2MDK7      P--A-------------TNILELSYQSRDPQLAAKVLNAVSQAMVEDNVKSIGLEATKVK
A0A1Y0RCK1      P--A-------------TNILELNYQSKNPQLAAQLLNAISQAMVEDNTKSINSEATKVK
A0A1Z4PWZ0      P--A-------------TNILELSYQSEYPKLAARLLNAVAQAMVEDNIKAISSEATKVK
A0A0C2QLT0      P--A-------------TNILELSYQSKDPRLAAKLLNAISQAMVEDNTKAISSEATKVK
A0A1Z4J2K1      P--A-------------TNILELSYQSKDPQLAAKLLNAISQAMVEDNTKAISSEATKVK
A0A3S0ZSX0      P--A-------------TNILEVSYEHKDPALASKLVNAVSQAMVEDNTQIIRQEAANVR
A0A2N6K4T3      P--A-------------TNILEVSYLNKDPILATKVVNAVSKAMVEDNTQVIRQEAANVR
A0A370CKT2      P--A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVR
A0A0S3TL97      P--A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVR
A0A2N6M8A0      P--A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVR
A0A2N6M9E1      P--A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVR
A0A2N6KJI4      P--A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVR
A0A2N6MZ77      P--A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVR
A0A2N6KT20      P--A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVR
G6FSN3          P--A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVR
A0A4D9CI02      P--A-------------TNILEVSYLNKDPTLATKVVNAVSQAMVEDNTQVIRQEAANVR
A0A328I8B9      P--A-------------TNILEVSYLNKDPTLATKVVNAISQAMVEDNTQVIRQEAANVR
A0A4Q9J4Z7      P--A-------------TNILEVSYLNKDPTLATKVVNAISQAMVEDNTQVIRQEAANVR
A0A0M0SU69      P--A-------------TNILEVSYLNKDPTLATRVVNAVSQAMVEDNTQVIRQEAANVR
A0A1Z4TIZ8      P--A-------------TNILEVSYLNKNPTLATKVVNAISQAMVEDNTQVIRQEAANVR
A0A0S3TYD7      N--R-------------SDILRVEYRSNDPMEAAEVVNHLMQLYVQDNLTANRAEAKSAR
U5QL42          G--D-------------AGVLRVAYRDTNPERAKAVLTALGATYVEYSLESKRGQADNAI
K9QF04          E--N-------------TAIVEVSYQDTDPEKIEFVLDKLAEGYTAYYLEKLQTSSKQAL
A0A3C0N2P0      G--E-------------TKILEVRYQDSNPEKIQFVLERVAQGYVNYSAKEQQDSVTQGL
K9TLQ0          K--S-------------TKILDIRYQDTDPQKIQIILKELATGYIHYSEMEQQTTLRQGL
A0A076HBF2      G--AKRKEA--------EGVLNVRLTGRNPIEDERLLNALSNTYLQAALQQRQQRLADGL
A0A354B169      G--EKSQEA--------EGVLNVSLTGHDPVQDELVLKAISAAYLHAALEQRQKRLADGL
G4FMX5          G--EKRTEA--------EGILRVSLVGRDKDEDQQLLTALSDTYLKVALQERQQRLADGL
Q0IDT5          G--AKRKEA--------EGVLKVSLTGRNPKEDGQLLEAISAAYLQTALQQRQKRLTDGI
A0A2D6FCW3      G--EKRKEA--------EGILNVSVTGRDPVEDKQLLDDLSSTYLQAALQQRQQRLSDGL
A3ZA21          G--AKRKEA--------DGVLNVSLTGRDPEQDEVLLQAISTAYLQAALQQRQQRLADGI
A0A140K3H3      A--VNEMP---------TDVLVVSYTDTNPERAKAVLDALGSTYVEYSLNRQRSQAGNAI
K9XUB8          N--VNEIP---------TDVLVVSYIDSNPERAKAVLEALGSTYVEYSLNRQRSQAANAI
Q7NEU3          E--R-------------TQVAVVSFEDTDPQVVKAILDELSRTYIDYSLEIQKSKLDGAI
A0A352XE00      Q--Q-------------TKILEIRYQDSDPEKIKFILDQVANGYINYSRQEQQTTTQQGI
B4VS56          Q--E-------------TKILEVRYQDSDPEKIQFILEQIATGYVNYSLSEQQTSTRQGI
A0A352AAQ3      Q--Q-------------TKILEVRYQDSDPEKIRFILEQVADGYVKYSETEQRTAVTQGL
A0A350Y472      Q--E-------------TKILEVRYQDSDPNKIQFILEQVANGYVQYSEAEQRTAVTQGL
A0A355DVB4      Q--E-------------TKILEVRYQDSDPDKIQFILEQVANGYVKYSEAEQRTAVTQGL
A0A2P8VVX1      S----EGRTG-------TRIFQASYTANDPTQPQRVLAALQDIYLNYNQEQQAQRLSRGL
A0A2P8WHY0      G--GEERDKA-------TRVFQATYVDSDPIKTQRLLEALKEAYLEFNEAQQARRLERGL
A0A2T1CMT9      L--DESTDSNKDSA---TKIIQVSYVGSSPVETKKVLTAIQEVYLKYNLEQQEKRLRDAL
A0A563VQJ3      G--G-------------SDVIEVGYNADRPEIAAEIVNTLMTIYVREQIRNNQAEPANAK
A0A1D8TX52      L--Q----GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGL
A0A1U7N5X9      L--Q----GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGL
A0A1D9G4T2      L--Q----GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGL
F4XP71          L--Q----GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGL
A0A2P8QVH5      K--VTQVESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGL
A0A2T1FT70      K--VTQVESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGL
A0A433W4W4      K--VTQVESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGL
K9U5W1          K--VTQVESGTKTLQTLSQVFEVTFVAGDPIKSQKVLQALQNVYQIYNLEQQKLRLTNGL
A0A2W6ZAV2      G--DA------------SGVMDVSLLWDDRREGQQILEAISAEYLAFSMRQRQERLAQGL
A0A2G7GMH8      Q--G----QDGTGKKVRTKIVEVLYTDNDPQRTQNVLNAMQQVYQDYNLEQQKLRLAKGL
K9W742          E--GSQDDSK-------TKIFAANYTANDPVKTQKVLQAVQRVYLNYNREQQRLRLAKGL
A0A2T1DWE8      E--E----DKVK-----TKIFQAVYTSDDPEKTQKVLMAVQQVYKDYNREQQKLRLTRGL
A0A1U7I8L3      Q--E----DKVN-----TKIFEVTYIDNDPIKTQTVLETIKRVYQDYNREQQQLRLTKGL
A0A2T1DJL8      I--EQRGNDKIN-----TSIFEMVYTGHDRQQTQAVLQAIQQVYQQYNLEQQKARLTKGL
A0A1Z4J9W0      Q--ELRGNERVT-----TNLVEVTYIDHDRIKTREVLKALEKVYQDYNLEQQRNRLTKGL
A0A0N7Z5K9      Q--ELRGSERVN-----TSIVEMSYIDYDRVKTREVLKSLQRVYQDYNLEQQRNRLAKGL
A0A0S3TXC5      Q--ELRGNERVN-----TNIVEMSYIDHDRVKTREVLKALQRVYQDYNLEQQRNRLAKGL
K9SA61          E--D----DKTK-----TKIFEAIYTGDDPEKTQAVLQAVQKVYQDYNREQQELRLSRGL
A0A3D1PBA3      L--E----EK-----VNTKIVEATYTANDPVKAEKVLEAVYKVYQIYNREQQQQRLQKGL
K9XPB0          I--D----ESEDNKGTETKIIEVAYVSQDYNDSKKILEAIEQVYIEYNVEQQEKRLRDGL
A0A350Y7Z1      Q--E----EDTDIKDTQTKIVKVVYTSNDPIQTQDVLAAIQTVYQDYNLQQQQVRLTEGL
A0A352X2A7      I--E----DETE-----TKIVKIDYISKDPIQTQEVLKAIQKIYQNYNLEQQKQRLVDGL
A0A0D8ZYV0      V--E----ENSNTKY--TKIVEANYVSNDPVKTQKVLQTIYQVYQSYNREQQEQRLKKGL
A0A4R4IUM6      V--E----EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGL
A0A2T1FP73      V--E----EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGL
A0A433VMS2      V--E----EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGL
K9TYA7          V--E----EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGL
A0A2P8QUE1      V--E----EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGL
A0A2T1DNG3      KKVD-------------TKIFSITYTSNDPIKTQKVLQAVQKVYQDYNLQQQQDRLTRGL
A0A2P8W9H0      Q--D-------------GEILTVTYSSEDPEQVTDVLEVVMAGYLRYSLEDRQNDIFRGL
A0A1Z4LN32      V--G-------------TDILRVSYTSGKPELAIKVVDKVMEAYIKKNIYTNRSEAIAAR
A0A2I8A9F5      P--G-------------TDGLKVGYVSEDPYLAKAIVNQVMKSYIANNILTNRSEVMAAG
A0A218Q6R8      M--G-------------TDGLQVSYVSEEPQLAKEVVNQVMKSYIANNILANRSEAIAAA
A0A218QGE0      V--G-------------TDVLKVSYTSDNPESAKAIVDQVMKSYIANNILSNRTQAISAG
B8HNB0          G--D-------------SDVLKVTYTGTDPKTVQAILDALNKTYIDYSLEKRRSQVSSGV
A0A563VS48      T--G-------------TDILNIRYEGNDPEVVASVVNQALMLYKDQDRLSNRTEAVAAR
A0A318BJ18      R--L-------------SRLVDITFSSPDPDFSARIANAWAENFIQTNLERKIQATSYGR
A0A3B8Y8H9      K--D-------------TNIIIVSYQDIDPRKVTFILNELAKVYLDYSLNDPRMKKTQGL
A0A2W1JVB9      R--A-------------GDVIELAYESEDPEEAALVINTLMKVYLADNLRINRLEASSAR
A0A1Z3HMQ0      E--G-------------TDVLRVAYQSPNGELSAAVVNQVMTSYIERNITMNRSEATAAR
A0A1E5QP61      E--G-------------TDVLMIAFKSQYPKEAADAVNKLMDVYINNNILVNRREATAAR
A0A3M2GIL5      K--G-------------TDVLLITYQAGNPEEAATVVNKVMEVYIENNILVNRSEAAAAR
A0A433NM31      K--G-------------TDTLLISYKSTVPEQAQAVVNKLMDSYLRNNMMATRTEAIAAR
A0A3M1PML8      P--A-------------TDLLRVTYASEDPEETAAVINRLVDIYTKNNVLVNRAEAAAAR
A0A352X442      A--G-------------TDVMTLTYQSKKPDVAAAVVNKVMEVYIADDIQANRAKAAAAR
A0A0T7BPZ0      K--G-------------SEVMQISFTHENAQLAANVVNQVMDNYITENIRANRAEAESAR
A0A0M0SHU3      K--G-------------TDVLEISYTNENPQLAAKVINKVVDTYIKQNIQANREEATSAG
A0A1D2PBN3      K--G-------------TEVLEVSYTDTNPTLAAKVVNKLMQAYIKNNIEANREEAVSAR
A0A0C2LVR7      K--G-------------TEVLEVSYTDTNPTLAAKVVNKLMQAYIKNNIRANREEAVSAR
A0A1Z4PQB9      K--G-------------TEVLEVSYTDTNPTLAAKVVNKLMQAYIKNNIGANREEAVSVR
A0A1Z4SFN6      K--G-------------TEVLDIYYKDEDPYLAAKVVNQMMEVYIKNNIEANRAEAVSAR
K9PGI8          K--G-------------TDILQISYTDKDPTLAAKVVNKVMDAYIRNNIEANRAEAVSAR
A0A563VLD6      NEIP-------------TDVLTVSFIDSSPQRAKEVLDALGKVYVQYSLDKQRSQAANAI
A0A318BG22      V--G-------------SSVIELRYTSNDARLSAAIANAAVDQFIESTTQRQYAASSYAR
A0A2T1E9V8      E--G-------------TDILQVTYKSNNPEIASLVVNQLMNVYVNRNLLGNRAAAISAG
A0A3M2GQQ6      G--E-------------ADVLIVSYTDTDPARAKAILDVLGKTYVDYSLERQVSQASNAI
K9SGJ5          K--G-------------ASVLWLIYRDPDPQRAKDVLDSLASAYSQYSLKDRRSRSSTAI
L8MYT6          K--D-------------ALILRLTYTDSDPKRAREVLGALSQTYVEYSLKDRRTKSSNAI
A0A352JGJ6      K--D-------------ALILRLNYIDSDPKRAREVLNALAQTYVEYSLKDRRTKSSTAI
A0A1J5GLS2      K--D-------------ALILRLIYTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAI
A0A2W4W6M5      K--D-------------ALILRLTYTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAI
A0A2W7AN33      K--N-------------AMVLRLIYTDSNPKRAQEVLNALSQTYVEYSLNNRRTNSSTAI
A0A256BLV2      K--D-------------TMVLRLTYTDSDPKRAREVLTALTQTYVEYSLKDRRTKSSTAI
A0A2W6ZXF3      R--D-------------ALILRLIFTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAI
A0A2Z5WX66      K--D-------------ALILRLTYTDSNPKRAREVLTALSETYVEYSLKDRRTKSSTAI
K9W1T3          R--S-------------TDILQVSYTDTDPAKAAKIINTVMSIYIKSDVNAQRSEAKAAR
A0A1Q4RTR1      K--G-------------TDILQISYRSPDKKMAAAVVDSVIKNYLENDIRANRTEVVSAR
A0A1Z4SQV2      K--G-------------TDVLEVSYRSPDAKQAANIVNTLIKNYLENDIRTNRTEAVAAR
A0A2H2XGN1      K--G-------------TDVLEVSYRSPDAKQAANIVNTLIKNYLENDIRTNRTEAVAAR
A0A433UXH8      K--G-------------TEVLQISYRSSNPKLAANVVNTLIKNYLENDIRTNRTEVVAAR
A0A1Z4RMB9      G--G-------------TDVVDVKYRHPNPKTASEVVNALMDVYVKEQIRGNQSQPAAAK
K1XF69          G--G-------------TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAK
B5W297          G--G-------------TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAK
H1W7M8          G--G-------------TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAK
A0A5Q4H6A5      G--G-------------TDIVLLTYQSKNPQEVADVINTIMEVYIDANVSGIRQEASGAK
D5A466          G--G-------------TDIVLLTYQSKNPQEVADVINTIMEVYIEANVSGIRQEASGAK
B4WP72          P--G-------------TDILEISYQSPDDQTAPVIVNALMEAYIENNVETNREEAIAAR
A0A318B4H2      G--A-------------SALVDITFKSPSAELSSKVANSWAAEYIQSNLDRRFATTADAR
B4WQE3          D--N-------------GKTLTVQYRSDDPYKVTTVLEVVLQTYLNYSLEDRQNDIYRGV
A0A2P8W4F7      G--E-------------SKVLRVTYNGADPAVVSFVLNQVVEGFVDYSVQDRQGDLRRGL
A0A5Q4E0Z4      G--E-------------SKVLRITYKNSDPEVVTTVISEVVKGFVAYSVQDRQGELRRGL
A0A2K3BR24      S--D-------------TEILEIAYEHPEPEKAATIVNELMNVYRENNVLNNRSEATAAR
K9YXY1          S--D-------------TEILEIAYEHPDPEKAATIVNELMNVYRENNVLNNRSEATAAR
U5QJM6          T--R-------------TQVVSVAFKDTDRQLVQDMLKELAKIYIDYSQDVQKSQVSGAI
K9SX01          K--Y-------------TDVIQVSYLSSSPQDAAKIVNGLMKSYIDNDLLTNREDTASAR
A0A4P7ZT55      QRDA-------------DGVLKVSLQWRNPQQGEQLLKALSQSYLAYSLRQRQEKLSQGL
A0A1E5QIR9      K--D-------------TDVLQISFKSNDPQEAVDVVNRLMQFYQENDIQTNRAQAAAVR
A0A1Z4IBC7      K--G-------------TDVVQISYKSNNAEQAAKVVNTVIKSYIDLNIQANQDEAVTAK
A0A1W5CPC7      K--G-------------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAK
A0A5Q0GKD1      K--G-------------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAK
Q3MDC6          K--G-------------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAK
A0A1Z4KM73      K--G-------------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAK
Q8YNX7          K--G-------------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAK
A0A367R4K6      K--G-------------TDVVQLSYQSNNPELAAKIINQVIDNYIDLNIKANQNEAFAAK
A0A1E2WSV8      K--G-------------TDVVQLSYKGGDPELAAKIVNEVIDSYIDLNIKANQNEALTAK
A0A2R5FRT9      K--G-------------TDVVQISYKGGNPELAAKIVNEVIDSYIELNIKANQNEALIAK
A0A2K8T1B6      K--G-------------TDVVQLSYKGSDPELAAKIVNEVIDSYIDLNIKANQNEALTAK
A0A235I9I0      K--G-------------TDVVQLSYKGGDPKLAAKIVNEVIDSYIDLNIKANQNEARTAK
A0A2D0HQT8      K--G-------------TDVVQLSYKGGDPKLAAKIVNEVIDSYIDLNIKANQNEARTAK
A0A2L2NU95      K--G-------------TDVVQLSYKGGDPELAAKIINEVIDSYIDLNIKANQNEARTAK
A0A367S084      K--G-------------TDVVQLSYKGGDPELAAKIVNEVIDSYIDLNIKANQNEARTAK
A0A0V7ZFJ4      G--D-------------TDILNLSYESNDPQKAAAIVNSLMKDYQENNISTNTAEARSAR
A0A367RIS1      R--G-------------TDILQLSYRSANPQQATAIINKLMSAYLENNVRINRSQARAAR
A0A235IXQ2      R--G-------------TDILQLSYRSTNPQEATAIINRLMSAYLANNVRINRSEARAAR
A0A1W5CNX3      R--G-------------TDILQLTYRSANPEEATAIINRLMNTYLENNVRNNRSEATAAR
A0A5Q0GJJ5      R--G-------------TDILQLTYRSANPEEATAIINRLMNTYLENNVRNNRSEATAAR
Q3MEB7          R--G-------------TDILQLTYRSANPEEATAIINRLMNTYLENNVRNNRSEATAAR
A0A1Z4KHN9      R--G-------------TDILQLSYRSADPKEATAIVNKLMSAYLENNVRNNRSEATAAR
Q8YT70          R--G-------------TDILQLSYRSADPKEATAIVNKLMSAYLENNVRNNRSEATAAR
A0A218Q4C1      R--G-------------TDVLQLSYNSIDPQEAQSTVNQLMAAYLNNNVLNNRSQAAAAR
A0A166IWU6      R--G-------------TDVLQLSYRSVDPELAKAIVNKLMNVYIDDNVMTNRSQATAAR
A0A2S0Q8C0      R--G-------------TDLLQLSYRSVDPEVGKAVVNKLMNVYIDDNVMTNRSQATAAR
W6FSX4          R--G-------------TDLLQLSYRSVDPEVGKAVVNKLMNVYIDDNVMTNRSQATAAR
A0A0V7ZNJ9      K--G-------------TDVLEISYKGTDPQQAAAIVNSLMQDYIDNNIRVNTAEARAAR
A0A0R0M9H9      R--G-------------TDVMELSYNSTNPQEAADTVNTLMKYYLDNNILINRSEATAAR
A0A1S1ZVW2      R--G-------------TDVMELSYNSTNPQEAADTVNTLMKYYLDNNILINRSQATAAR
A0A1B7WX82      R--G-------------TDVLQVSYSSTNPQEAANVVNSLMKYYLESNILNNRTEARSAR
A0A1B7WTD1      R--G-------------TDVMELSYKSTDKQEAANVVNSLMKHYLASNINTNRAEAIAAR
A0A480ABC0      R--G-------------TDVMELSYKSTDKREAANVVNSLMKHYLASNVSTNRAEAIAAR
A0A1Z4LRU5      R--G-------------TDVLQLSYKSTDPKEAANVVNSLMGDYMENNVETNTAEVRAAR
A0A1Z4JVB4      R--G-------------TDVMQISYRSKNPQESADVVNFLMKSYIESNISNNRTEARSLR
K9PIA4          R--G-------------TDVMQLSYRSPNPKEAADVINTLMKYYLESNVRTNRSTAKSAR
A0A1Z4M597      R--G-------------TDVMQLSYRSTNPQEAASVINSLMNYYLENNVRTNRAEARSAR
A0A1Z4MWT1      R--G-------------TDVMQLSYRSTNPQEAASVINSLMSYYLENNVRTNRAEARSAR
A0A1Z4TX53      R--G-------------TDVMQLSYRSTNPQEAASVINSLMSYYLENNVRTNRAEARSAR
A0A1Z4HVE1      R--G-------------TDVMQLSYRSTNPQEAASVINSLMNYYLESNVRTNRAEARSAR
A0A252ECZ1      R--G-------------TDVMQLSYRSTNPQEAASVINSLMNYYLESNVRTNSAEARSAR
A0A1Z4G5Y1      R--G-------------TDVMQLSYNSTNPEEAATVLNSLMNYYLESNVRTNRAEARSAR
A0A252DNA2      R--G-------------TDVMQLSYRSTNPQEAATVINSLMNYYLESNVRTNRAEARSAR
A0A252E1Q4      R--G-------------TDVMQLSYRSTNPQEAATVINSLMNYYLESNVRTNRAEARSAR
A0A5P8VSD1      R--G-------------TNILQLSYRSANPQEATAILNRLMSAYLENNIRINRSEATATR
A0A2A2TNQ5      K--G-------------TDVMELTYRGTNPLETAKVINTLMNNYLENNIRSNRTEVTAAR
A0A3S1C4K5      K--G-------------TDVLEMTYRDTDPKVAADVINTLVKYYIENNIRVNRLDATSAR
A0A1X4G3D5      R--G-------------TNVMEFTYDSKIPDEAAKIVNGLMNEYLLSNIVINNSASSKAR
D4TNI2          R--G-------------TNVMEFTYDSKIPDEAAKVVNGLMNEYLLSNIVINNSASAKAR
A0A1Z4H6Z8      R--G-------------TDVMQLSYRSTNAQEAATVINSLMNYYLESNVRTNRAEARSAR
A0A1Z4NPM1      R--G-------------TDVMELSYRSTDPQEAANVINFLMKSYLEGNILNNRAEATAAK
A0A3F3KPR9      R--S-------------TDVMELSYNSTNPQEAADTVNTLMKYYLDNNILINRSEATAAR
D4TGN7          R--G-------------TDVMELSYSSTNPQEAADTVNTLMKYYLDNNILINRSEATAAR
A0A1Z4UZW9      R--G-------------TDVMQLSYRSTNPQEAAKVVNSIMKYYLESNVRTNRTEARSAR
A0A0K2M5H0      R--G-------------TDVMQLSYRSTNPQEAADVVNSLMKYYLESNVRTNRTEARSAR
A0A1B7VSH4      R--G-------------TDVMQLSYKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAR
A0A1B7W126      R--G-------------TDVMQLSYKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAR
A0A3D4C6Q6      R--G-------------TDVMQLSYKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAR
A0A1B7UVJ4      R--G-------------TDVLQVSYSSTNPQEAANVVNSLMKYYLESNILNNRTEARSAR
A0A1B7UTR1      R--G-------------TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAR
A0A5C0DRW9      R--G-------------TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAR
K7W0A4          R--G-------------TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAR
A0A1U7HGH0      E--G-------------TEILQVVYRGEEPEQAALIVNQLMNVYVSKNLLNNRAAAISAG
K9XJD3          E--G-------------TEILQVVYRGEDPAQAALVVNQLMNIYVNKNLLNNRAAAISAG
A0A2T1CIL7      V--G-------------TDVLQVFYQDSDPKRAASIVNEVIDLYVQEDTLSNRAAPASAR
A0A1Z4RPC6      G--G-------------TDVIQIAYKDPDPVIASKVINTLMDVYIKEQVNSNKKATASAD
A0A2T1CMZ0      G--G-------------SDVISIEYKDPDPIIASKVVNTLMGVYIKEHVRSNKSATVSAD
L8M4F7          P--G-------------TDLIQILYKDPNPKFAADIVNSLMNVYVEAQIRGNQSDPAVAK
A0A140K2P2      G--G-------------SDVIEITYAHPNPKVAADVVNTLMNTYINEQIRTNQSEPASAR
K9XWX4          G--G-------------SDVVEITYAHPNPKVAADVVNTLMNTYINEQIRANQSEPASAR
A0A140KB14      G--G-------------TDVISVRYQDQDPYTAADVINTLMKLYLDEQVKSTQAETANAD
K9XX88          S--G-------------TDVISLRYQDQDPYTAADVINTLMKLYLDEQVKSTQAETANAD
A0A563VSV6      G--G-------------SDVIEIIYKDSDPIQASQVVNTLMDVYIKNQVRSNQAETENAD
L8LZE9          G--A-------------SDVIEITYEDKDPQIASNVVNTLMNIFLENKIANNQKDTESAD
A0A433V7A0      A--G-------------ADVMQISYTSKDPQESASVVNQLMSIYIKNNISANRLQAVAAR
A0A1Z4NDS1      K--G-------------TDIIQVSYQDNDPELAAKVVNKLMEVYVQNNIRENRAEASAAG
K9F4D9          P--G-------------TDVLKVTYTSEEPEIAATVVNTLADIYIENDIQTNRAAALAAQ
U9VXM0          P--G-------------TDVLKVTYTSDDPELAANVVNTLTDIYIENDIQTNRAAAVAAQ
A0A2T1FTR8      K--N-------------TDLLEVTFQDPSRELSRDVVEKIMEIYIRDDRTNQRREAEAAR
K9UA41          K--N-------------TDLLEVTFQDPSRELARDVVEKIMEIYIRDDRTNQRREAEAAR
A0A0C2LBE2      K--G-------------TEILQVSYIDKDPKLAAKVVNKVMQAYIKNNIEANRQEAVSAR
A0A433NN38      K--G-------------TDLLEIYYADSDPIMAAKVVNKLVEIYIKQNIQTNRAEAVSAR
A0A2N6K0T2      K--G-------------TDVLEVSYTHEDPQLAAKVINKVVDTYIKQNIQVNREEAISAG
A0A2N6ML72      K--G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAG
G6FQZ6          K--G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAG
A0A2N6MQX9      K--G-------------TDVLEVSYTHEDPQLAAKVINKIVEEYTKQNIQANREEAISAG
A0A2N6KXT6      K--G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAG
A0A2N6KGB9      K--G-------------TDVLEVSYTHEDPQLAAKVINKIVEEYTKQNIQANREEAISAG
A0A2N6L3Y5      K--G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAG
A0A0S3TIS7      K--G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAG
A0A1U7GW28      K--G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAG
A0A2N6LW63      K--G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAG
A0A328IH74      K--G-------------TDVLEISYTDENPELAAKVINKIVDTYIQQNIQANREEATSAG
A0A4D9CIB0      K--G-------------TDVLEISYTDENPELAAKVINKIVDTYIQQNIQANREEATSAG
A0A1Z4TQ63      K--G-------------TDVLEISYTDENPQLAAKIINRVVDTYIKQNIQANREEATSAG
A0A4Q9J8G2      K--G-------------TDVLEISYTDENPQLAAKVINKVVDAYIKQNIQANREEATSAG
A0A1Z4SMD6      T--G-------------TDVLKISYSSKDPEVASSVVNQVMKTYVEKNIESNRSQVFAAG
A0A2H2Y096      T--G-------------TDVLKISYSSKDPEVASSVVNQVMKTYVEKNIESNRSQVFAAG
K9S8M8          R--G-------------TDVLLITYTSDDPQEAANVVNVLMEIYIKENIRANRAEATAAR
A0A1Z4NFV0      M--G-------------TDVLKVSHISDNPNLAAAVVNQVMESYVESNIQSNRAEAQSAG
B0CAX4          R--D-------------TDVLKVTYKSIDPKESADVVNRLMDDYLKNNIETNRAEAASAR
U5DPF5          P--N-------------THILELTYQSTDPEEAARVVDSFMEVYRDNDVRINRSEAAAAR
A0A350Y0P6      K--G-------------TDVMEVSFTSDNPKKAAAVVNQLMNVYVENNILTNRAEAVAAG
A0A352X940      K--G-------------TDVMTVSVKSQKPKEAAAIVNKLMEVYLENNIQTNRSEAVAAR
B8HTN4          R--G-------------TDLLQVSYRSTDPKQAVAIVDLLIKIYKRNNILANRLETTNSR
A0A2A2TPF8      A--G-------------TDVLDVVYISENGKEAAAIVNQLMRSYVENNIRNNRSEALAAR
A0A1Z4R0P8      A--G-------------TDVLNVSFISDKPKEAAAIVNQLMRSYVDNNIKNNRSEALAAR
A0A0T7BUI3      V--G-------------TDVLKVSHASDNPKLAAKIVNQVMATYAENNVESNRTQVTAAG
A0A1Z4LP32      V--G-------------TDVINVSYTSEKPRLAAAIVNQVMRTYVKNNIESNRAQVVAAG
K9REP9          V--G-------------TDVINVSYTSDKPRLAASIVNQVMESYVDNNIESNRAQVVAAG
A0A1Z4SIJ3      P--G-------------TDVLKVSYVSINPELAKKVVNQVMQTYVDKNIESNRTQVYAAG
A0A2H2XPG4      P--G-------------TDVLKVSYVSINPELAKKVVNQVMQTYVDKNIESNRTQVYAAG
K9V3C7          P--G-------------TDILNVSFTWDNPEIASAVVNKLMDVYVANNLANSRSEAVSAG
A0A1Z4T6Y7      I--G-------------ADVLNVSHISSDSRLAADVINYVMRSYVENNIQTNRLEAVSAR
A0A2H2Y561      I--G-------------ADVLNVSHISSDSRLAADVINYVMRSYVENNIQTNRLEAVSAR
A0A1Q4S362      P--G-------------TDVLNVAHISGESKKAADVVNQIMRSYVNSNIQNNRQETIAAR
A0A3S1CIN8      P--G-------------TDVLKVAHISGESKKAADVVNQIMRSYVNSNIQNNRQETIAAR
A0A2A2TC28      V--G-------------TDVIKVSYQSNNPEMTAEVVNQVMNTYIKNNIQSNRTQVFAAG
A0A0C1NCB0      V--G-------------TDVLKVSYTAKAPNLAANVVNLVMQAYVNNNIQSNQEQVLAAG
A0A2N6K7Q9      V--G-------------TDVLRVSYASNDPELAAAVVNQLMKSYVENNIQTNRAQVSAAG
A0A2N6MXH6      V--G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAG
A0A2N6M5A8      V--G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAG
A0A2N6LL61      V--G-------------TDVLRVSYASNDPKLAAAVVNQLMKSYVENNIQTNRAQVSAAG
A0A0S3TP66      V--G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAG
G6FP91          V--G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAG
A0A1U7GYR5      V--G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAG
A0A2N6KY52      V--G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAG
A0A2N6KMP5      V--G-------------TDVLRVSYTSNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAG
A0A2N6MA45      V--G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAG
A0A4Q9J9V9      V--G-------------TDVLKVSYASNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAG
A0A328IGA1      V--G-------------TDVLKVSYASNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAG
A0A4D9CE41      V--G-------------TDVLKVSYTSNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAG
A0A0M0SFT2      V--G-------------TDVLKVSYTSNDPELAAAIVNQLMKSYVQNNIQNNRAQVSAAG
A0A1Z4TLC8      V--G-------------TDVLKVSYASNDPELAAAVVNQLMKSYVENNIQTNRAQVSAAG
A0A0C2LFH0      V--G-------------TDVLKVSYTSENPELTASVVNQVMKSYVAKNIQYNRTQVVAAG
A0A1Z4IYV4      V--G-------------TDVLQVSYTSENPELAASVVNQLMKSYVANNIQSNRSQVFAAG
A0A1Z4Q0T6      V--G-------------TDVLKVSYISENPELAASVVNQLMKSYVANNIQSNRVQVFAAG
A0A0C2PT44      V--G-------------TDVLKVSYTSENPELAASVVNQLMKSYVANNIQSNRAQVFAAG
A0A1D2P6J4      V--G-------------TDVLKVSYTSENAELAASVVNQLMKSYVANNIQSNRAQVFAAG
A0A4R4IQ40      G--G-------------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAG
A0A433W533      G--G-------------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAG
A0A2P8QWJ3      G--G-------------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAG
A0A2T1FKP8      G--G-------------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAG
K9U6L7          G--G-------------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAG
A0A3M9ZEU1      P--S-------------TDVLHLAYTDSDPERAAKVVNQVINVYIENNVAANRAEAAAAR
A0A1Z4JK72      P--T-------------TDILNLKYSDNDAEMAANVVNQIMKAYIDNNLKTNQEEANKAG
A0A0N7Z489      P--T-------------TDILDVKYADDDPEMAANVVNQVLKAYIDNNLKTNQEEANKAG
A0A0S3TXS2      P--T-------------TDILELKYADDDPEMAANVINQIVKAYIDSNLKTNQEEANKAG
A0A1Z4RN12      I--G-------------TDLLKITFTDQDPEVALAFVNRAIELYSEDYASYNRSETASAR
A0A2T1CMF9      I--G-------------TDLLQISYENSDPDVAVSFVNRAVELYSDGYALFNSEAALKDG
Q7NDC5          R--R-------------TDLLVIKYRDRDPAVATRVVNTLARHYIDLNMQQNRAEAASTR
U5QGK3          R--R-------------TDLLVIRYREFNPELAAKVVNTLAQAYIVENVQQNRAEASSTR
A0A2W4UY24      P--G-------------TDVLAVSYESTSPALAQAVVNAMMAAFIQANVQANRTAAIAAQ
A0A2T1GMT4      G--G-------------ADILQVSFKGRNPKDAANIVNTLMNVYLENDIQASQLEAETAR
K9UI51          G--G-------------SDILQIGFKGRNSKDAANIVNTLMNVYLENDIQASRLEAENAR
K9QM62          G--G-------------TDVLQITYKSRNPEEAAAVVNSVMNVYLENDILTNRTEVEATR
A0A1Z4FWI3      G--G-------------TDVLLVSYKSPDPETAAAVVNTVMNIYLENDSNTNRAEAEATR
A0A1Z4JYE7      G--G-------------TDVLEITYQSNDPKQAAAVVNALMNVYVDNDISTNREEAEATR
A0A2T1FXY4      G--G-------------TDVLRITYKHHDPEKAAAVVNKIMELYLENDILTSRSEAEATR
A0A4V2X3N2      G--G-------------TDVLRITYKHHNPEKAAAVVNKIMELYLENDILTSRSEAEATR
K9TYI2          G--G-------------TDVLQITYKHHDPEKAAAVVNKIMELYLENDILTSRSEAEATR
A0A1Z4QL41      G--G-------------TDVLKITYKSNKPEEAAEVVNTIMNFYIENDISTNRAEAEETR
A0A252D4T4      G--G-------------TDVLLVSYNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATR
A0A252DJH5      G--G-------------TDVLLVSYNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATR
A0A252EB80      G--G-------------TDVLLVSYNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATR
A0A1Z4HPW5      G--G-------------ADVLQISYKSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATR
A0A1Z4MSN1      G--G-------------TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATR
A0A1Z4U1C2      G--G-------------TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATR
A0A0D6KV51      G--G-------------TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATR
A0A1Z4MKF8      G--G-------------TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATR
A0A2C6WC43      G--G-------------TDVLRVTYASLNAEEAAAVVNTVMNVYLENDILTNRSEAASTR
A0A1Z4L5A1      G--G-------------TDVLRITYSSLDPEEAASVVNTVMNVYVESDILTSRSEAASTR
A0A367QD86      G--G-------------TDVLRITYSSLNPEEAAAVVNTVMNVYVENDILTNRSEAASTR
A0A235IZ96      G--G-------------TDVLKITYSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATR
A0A2L2NGP0      G--G-------------TDVLRITYSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATR
A0A2K8SM78      N--G-------------TDVLRISYTSRDPEQSAAVVNTIMSLYLENDILTNRSEAAATR
A0A2R5FPC0      N--G-------------TDVLRISYASRDPEQAAAVVNTIMNLYLENDILTNRSEAAATR
A0A5P8W5T6      N--G-------------TDVLRISYTSRDPKQSADVVNTIMNLYLENDILTNRSEAAATR
A0A140KBA0      T--G-------------GNVIKISYEDSDAERAALVVNKIIELYQEKDTENNRSEAIAAR
K9XSG1          T--G-------------SNVIKIAYEDSDPERAALVVNKIIELYQEKDTENNRSEAIAAR
A0A0F5YE28      G--G-------------TDIVSLSYESPDPLEAANIVNTLMEVYIQTNVNMNQDEAREAR
U7QEH7          G--G-------------TDIVSLSYESKDPKEAADIINTLMEVYMQTNVDMNQEDAIEAR
A0A3S1ATK5      G--G-------------TDVLKLTYKSRDPKEAAVVVNTVMNFYLENDIETNRAEAETTY
A0A2Z6CPH0      G--G-------------TDVLRVSYQSNNPEEAAAVVNTLMNLYLENDILTSRAEAEATR
A0A1Z4GT50      G--G-------------TDVLQLNYKSRNPEEAAAVVNTIMKMYVENDITTSRAEAEDTR
A0A1Z4GIX0      G--G-------------TDVLRIAYKSTNPEEASAVVNTIIDAYLENDILTSRSEAEATR
A0A2H6LC24      G--G-------------TDVLRIAYKSTNPEEAAAVVNTIIDAYLENDILTSRSEAEATR
B2J6N5          S--A-------------TDVLRISYTSPDPEQSAAVVNTIMSLYLDNDILTNRSEAAATR
A0A367RMI4      G--G-------------TDVLRISYKSHNPEEAAAVVNTIMRFYLENDILTNRSEAGAAR
A0A235HUM0      G--G-------------TDVLRISYSSHDPEEAAAVVNTVMRFYLENDVLTNRSEAGATR
A0A2L2NW47      G--G-------------TDVLRIAYRSHDPEEAAAVVNTIMRFYLENDILTNRSEAGATR
A0A1E2WUR1      G--G-------------TDVLLISYSSSDPEEAAAVVNTIMNFYLENDILTNRSEAAAAR
A0A235IKU3      G--G-------------TDVLKITYSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATR
F4XKF3          G--G-------------TDVVRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAR
A0A1D9FX10      G--G-------------TDVVRLSYKGKNSEKGAAVINKLMRLYIENQILSKKSEAAKAR
A0A1D8TNX9      G--G-------------TDVVRLSYKGNNSDKGAAVINQLMRLYIENQILSKKSEAAKAR
A0A1U7MYU6      G--G-------------TDVVRLSYKGNNSDKGAAVINQLMRLYIENQILSKKSEAAKAR
A0A3C0NJ41      G--G-------------TDVVELSYKGANPQQIAAVVNKLMSLYIEDNLRTNRAELVAAQ
A0A352AG88      A--E-------------TDVLELAYESSNPQEAAAVVNYLMNLYIKNNVKANRAEVVAAV
A0A350Y374      G--A-------------TDVIEIIYKNKDAKTAAAVVNQLMKLYIENNLRNNRTELVTAQ
A0A355DPX0      G--A-------------TDVIEITYKNKDAKTAAAVVNELMKLYIENNLRNNRTELVTAQ
A0A0D8ZUV2      A--A-------------TDVLEVTYKSNDPQEAAAVVNKLMSLYIENNVLSNRTAAVEAS
A0A433VDI0      S--A-------------TDILQLAYKSTNPEEATAVVNKLMNLYIENNILTNRDQAVEAV
A0A3D1PG43      P--A-------------TDVVQVAYESKNPEEAAAVVNKLMSLYVQNNIQSNRAQTTAVG
A0A2P8QQ72      P--A-------------TDVLQVAYESKDPQEAAAVVNKLMSAYVDYNIQSNRAEASAAE
K9TZQ7          P--A-------------TDVLQVAYESKDPQEAAAVVNKLMSAYVDYNIQSNRAEASAAE
A0A2G7GPR0      P--L-------------TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAG
K9XH68          P--L-------------TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAG
A0A1U7HW70      P--L-------------TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAG
A0A2S6VEJ8      P--L-------------TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAG
                                                                            

K9SLA9          QFVERQ-LPTSKSALESAEIKLRQFKENYRLVDLEI-------EKV----TTVKAIKEI-
A0A168TT23      EFLEGQ-LADMRIALERADQNLIDFAQANGVADLEE-------RVD----MSQSSVRTL-
A0A0M1JWX9      QFIEEQ-LPQLRQRVDTLQGQLQKFRQDYNLIDPKI-------QGE----QLAGQITKI-
A0A2T1M1V6      QFAENA-LKKAQNNLILAQNKLTQFQQSTGLFESET-------QTQ----ELMQSINKL-
A0A2G7GCS2      QFSQTD-LEDAQAQLAKAQAELANFQQSTGLTEVTE-------QTR----SLINQQREL-
K9XBH8          EFSRGD-IEKARQQLEQAQAALASFQEATGISEAVE-------QTR----SLIAQLRDL-
A0A1Z4LJ30      QFMQDE-VKQAYQKLFKTQKNLSEFKQKTNLVSSEE-------QTK----EIVSTINAL-
K9RI76          QFMQGE-VKLANTKLLKAQKALSEFKQKTNLVSSEE-------QTQ----QIVSAINTL-
A0A352AE27      QFSQKQ-LEQAQQRLNQAQMELAQFQKSSGLVNSEE-------QTR----GLVQSISEL-
A0A3B8JH60      QFSQKE-LEQAKERLAQAQMALAQFKQSSGLVNSEA-------QTE----GIVTTINNL-
A0A3C0N766      QFSQKE-LEQAKERLAQAQMALAQFKQSSGLVNSEA-------QTE----GIVTTINNL-
K9W9J7          QFSQKE-LNQAKARLDQAQRAVAQWKQSTGLVNSEA-------QTQ----GIVTTINNL-
A0A139WSU3      KFSQIE-LEQAKLKLAQAQSKLTIFKQSSGLINNED-------QAK----GIVDSISTL-
A0A433VN22      KFNVKE-LEQAKAKLSNAQTKIARFKQATGIVNNDA-------QTQ----GIVTTINAL-
Q7NF11          TLSQKE-LDRARRELTRAEAALARFKRSTGLVNTDQ-------QTG----GLVGVISSL-
A0A1Z4JCS8      GFSQKQ-LEQAQRRLTEAQTALAQFKQSTGLVNNEE-------QTK----GLVGTINTL-
F4XTX2          EFNKKA-LDRAKQKLDQSQEALAKFQESSGLVNSEA-------QTE----GLVRAITDL-
Q7NJN6          EFSRVE-TAKAQNNLQTAQVELYGYQRRTGLVNADD-------QTR----GIVETLNSL-
U5QCC3          QFSHEE-LERAKRTLQQTQSELASYQQTTGLVNVDE-------QTR----GLVETLNTL-
A0A3S0Y9N9      SFIAQQ-LPLSKAALQAAEKKLQDFKQQYKVLDLKS-------EAT----SSVTILTDL-
A0A433UNK7      DFIAQQ-LPLRKAALQTSERRLQFFKQQNRVLDLKA-------EAS----ASVAILTDL-
A0A3M1SVZ4      EFIEAK-LPDAEYTLSQAEQELRQFKEENNFFALQE-------EAA----AATQLMTGL-
A0A654SFI6      EFLNKQ-IEELRERLSISERDLVEYANENEILVLETGNREEGSGTA----SQTLIATDL-
K9SSQ0          QLIQAQ-IPDAKKQLDQNSTALTRFRQQYNITDPDT-------YAA----SIFSTKQGL-
A0A2W1JIN9      EFLEGQ-IPQRRQELLQVEARMSKFKQEYGYVTLSA-EGNNNEANQ----LLVNSYAQL-
A0A318AJV1      AFFRQR-LDELARQVNDADTRLAAYRAGTGLSADGA-------GSN----VVDQQIATL-
A0A1U7N2U4      EFLEKE-VPLRRLEVEATEAALNKFKQTTGLVSPEE-------QTQ----LLVRSLATL-
A0A1D9G1F2      EFLEKE-VPLRRLEVAAAEAALNKFKQTTGLVSPEE-------QTQ----LLVRSLATL-
F4XV38          EFLEKE-VPLRRLEVAAAEAALNKFKQTTGLVSPEE-------QTQ----LLVRSLATL-
A0A2P8QIL5      QFLAVE-VPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTT----SIVESLAQI-
A0A2T1FLY5      QFLAVE-VPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTT----SIVESLAQI-
A0A433W447      QFLAVE-VPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTT----SIVESLAQI-
K9U1K8          QFLAVE-VPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTT----SIVESLAQI-
A0A4V6P809      QFLAVE-VPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTT----SIVESLAQI-
K9UYB2          EFLETKELPKARQALMVAEMEESAYRERTGIISFDE-------QTK----SLVQSLAAL-
A0A218QN17      EFLENNEIPNARKRLATAEQNESNYRHISGIISFEE-------QTK----SAVESLATL-
K9RKN2          DFLENKQLPIARKKLREAEATESQYRQASGIVSFAE-------QTE----SLVENLSSL-
A0A2I8ADV2      KFLEKE-VPVARNRLQQAEVAESRYRQKSGVVADTD-------QTK----SLVQSLTNL-
A0A1W5CKM3      EFLAEK-VPIARQRLLQAELAETKYRQQSGVVATDD-------QTR----SLVNSLAEL-
A0A5Q0GMF5      EFLAEK-VPIARQRLLQAELAETKYRQQSGVVATDD-------QTR----SLVNSLAEL-
Q3MEW0          EFLAEK-VPIARQRLLQAELAETKYRQQSGVVATDD-------QTR----SLVNSLAEL-
A0A1Z4KIC7      EFLAEK-VPIARQRLLQAELAETKYRQQSGVVATDD-------QTR----SLVGSLAEL-
Q8YSM5          EFLAEK-VPIARQRLLQAELAETKYRQQSGVVATDD-------QTR----SLVGSLAEL-
A0A1Q4S1H4      QFLEKNEVPNAQQRLKVAEIKENKYRQTSGIVSFDD-------QSK----SLVTSLANL-
A0A433VBU6      EFLEKKEVPNAQQRLKAAEIKENKYRQTSGVVSFDE-------QSK----SLVTSLANL-
A0A1Q4RZJ6      QFLQQQ-LPQARTQLQAAEVAENNYRQQSSIVDFDE-------QTK----SLVQSVASL-
A0A1Z4SNV3      QFLQQQ-LPQARAQLQAAEAAENKYRQASIIVNYDE-------QTK----SLVQSVASL-
A0A2H2XJQ1      QFLQQQ-LPQARAQLQAAEAAENKYRQASIIVNYDE-------QTK----SLVQSVASL-
A0A3S5K358      QFLQQQ-LPQARTQLQAAEAAENNYRQQSSIVDFDE-------QTK----SLVQSVASL-
A0A0T7BPJ4      EFLEKKEVPAAQRNLTVAEANENRQKQASGIVSFDE-------QSK----SVVTSLASL-
A0A0C1QS61      KFLEME-VPKAREKLENAELTENRYRRSSGIISFTK-------QSE----SLVDSLAAL-
A0A139X3R8      KFLATE-VPKARQNLEDAELKENKYRQSSGIISFTK-------QSE----SLVDSLATL-
A0A1Z4I7C5      EFLSQK-VPQARQRLQQAELAETRYRQQSGVVAADD-------QTK----SLVGSLADL-
A0A0C2MDK7      QFLEQKQVPEAEKKLLQAEDLENKYRKSSGIVSVEE-------QTK----SLVQSIATL-
A0A1Y0RCK1      EFLEEKQVPEADKQLRQAEAQENKYRQLSGIVSLEE-------QTK----SLVQSIATV-
A0A1Z4PWZ0      AFLEKKQVPSAEKQLLQAEEKENKYRKSSGIVSFEE-------QTK----SLVQSIATV-
A0A0C2QLT0      KFLEEKQVPEADKQLRLAEATENKYRKLSGIVSLEE-------QTK----SLVQSIATV-
A0A1Z4J2K1      KFLEEKQVPEADKQLRLAEATENKYRKLSGIVSLEE-------QTK----SLVQSIATV-
A0A3S0ZSX0      KFLQQQ-VPEARQRLEKAELIENKYRQDSGIVSFDE-------QTK----SLVNSLATL-
A0A2N6K4T3      KFLETK-VPDARKRLQEAEQKENRYRQSSGIVSFDE-------QTK----SIVESLATL-
A0A370CKT2      KFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTK----SLVESLANL-
A0A0S3TL97      KFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTK----SLVESLATL-
A0A2N6M8A0      KFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTK----SLVESLATL-
A0A2N6M9E1      KFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTK----SLVESLATL-
A0A2N6KJI4      KFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTK----SLVESLANL-
A0A2N6MZ77      KFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTK----SLVESLANL-
A0A2N6KT20      KFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTK----SLVESLANL-
G6FSN3          KFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTK----SLVESLANL-
A0A4D9CI02      KFLEKK-VPDARKRVEEAEQKENKYRQSSGIVSFDE-------QTK----SLVNSLATV-
A0A328I8B9      KFLEKK-VPDARKRVEEAEQKENKYRQSSGIVSFDE-------QTK----SLVNSLATV-
A0A4Q9J4Z7      KFLEKK-VPDARKRVEEAEQKENKYRQSSGIVSFDE-------QTK----SLVNSLATV-
A0A0M0SU69      KFLEKK-VPDARKRVEEAEQKENKYRQSSGIVSFDE-------QTK----SLVNSLAIV-
A0A1Z4TIZ8      KFLEKK-VPDARKRVEEAEQKENKYRQSSGIVSFDE-------QTK----SLVNSLATL-
A0A0S3TYD7      EFIQSQ-LPEVERNVRQVEGEIRAFKENNQIVALDQ-------EQR----NSVEITSDF-
U5QL42          KFIEAK-LPRAKKVLNQTAIAIREFRKRYDIPDPDG-------YAT----SVAEVQQSL-
K9QF04          KLVEAL-SPQQRQRVDQLQVQLQRFRRQNNLVDPEK-------QSQ----VLTERLSNI-
A0A3C0N2P0      GFVNEQ-TKNLQKRVNELQKSIQSLRENYKIVDPES-------QGQ----QLSNRASEI-
K9TLQ0          EFVETQ-LPRLQQRVDTLQEYLEKFRQHYNLIDPGQ-------SGQ----ILSQQIGSL-
A0A076HBF2      AFLNKQ-APSLQTRLDQLQGELADFRTRYSLLEPTA-------EGG----ALKKRETAM-
A0A354B169      TFLNKN-APTLQQKTSQLQSDLAKFRERHNLIEPTE-------EGG----AIKGRLAQL-
G4FMX5          NFLNKQ-APALEAKTEQIQSEVAAFRIKHSLLEPTA-------EGG----ALRQQEAGL-
Q0IDT5          AFLDLQ-APALQAKADAIQGELAEFRRRHSLLEPAI-------EGT----ALKQREATL-
A0A2D6FCW3      NFLNKQ-APALEAKTEEIQSEVSDFRQRHSLLEPTT-------EGG----ALKQREAAI-
A3ZA21          DFLNKQ-APALQQKTEAIQNELAAFRRQHSLLEPTA-------EGG----ALKDRETAV-
A0A140K3H3      NFIDEQ-LPKAQAELNEVAKAIRNFRQTYNIVDPDE-------YAL----RVIQFRDGL-
K9XUB8          NFIDQQ-LPKAQAELDDVAKKIRNFRQSYHIVDPNE-------YAS----RVIQFRDGL-
Q7NEU3          AFIENE-LPPVRKEVERAEEQLRTFRRQYSILDPQV-------QGT----ELAATLNTL-
A0A352XE00      QFVKDQ-LPKLQERVNQLQAQLQEFRQAYNLIDPDS-------QAQ----LLTQRATSI-
B4VS56          QFVEEQ-LPKLQGRVDSLQQKLQRFRQQYNLVNPDS-------QGQ----LLTSRVSTI-
A0A352AAQ3      AFVNKQ-AKELQGIVNDLQQKVQDLRQNYKIVDPET-------QGQ----LLTNRVSEI-
A0A350Y472      AFVNKQ-TQKLQELVNDLQQQIQNLRQTYQIVDPET-------QGQ----LLTNRVSDI-
A0A355DVB4      AFVNKQ-TQKLQELVNDLQQQIQNLRQTYQIVDPET-------QGQ----LLTNRVSDI-
A0A2P8VVX1      DNVNNR-LANTQQNLRDSQSALEQFRINQNLIDPNS-------QAI----SVVESLNQV-
A0A2P8WHY0      EHTNNR-LDNTQKNLQQAQAALEKFRQSQNLIDPTL-------QSQ----AVVTSLNEV-
A0A2T1CMT9      TFINQQ-IPQARKELTQTETNLTKLTKENNLVSPEA-------EAT----SVKENIRQI-
A0A563VQJ3      EFINRQ-LPEIEVKVETAESELEQFRTENSIIDLQE-------EKR----TIVQDAGAI-
A0A1D8TX52      AFINQQ-LPKARKDLEQAEQQLEQFRKSKNLIDPSQ-------QAV----AVSQTLNGI-
A0A1U7N5X9      AFINQQ-LPKARKDLEQAEQQLEQFRKSKNLIDPSQ-------QAV----AVSQTLNGI-
A0A1D9G4T2      AFINQQ-LPTARNNLEQAEQRLEQFRKSKNLIDPSQ-------QAL----AVSQTLNGI-
F4XP71          AFINQQ-LPTARNNLEQAEQRLEQFRKSKNLIDPSQ-------QAL----AVSQTLNGI-
A0A2P8QVH5      AFVNEQ-LPKIRKDVSQAEANLENFRKQNKLLDPEV-------QAK----NLLDALAAV-
A0A2T1FT70      AFVNEQ-LPKIRKDVSQAEANLENFRKQNKLLDPEV-------QAK----NLLDALAAV-
A0A433W4W4      AFVNEQ-LPKIRKDVSQAEANLENFRKQNKLLDPEV-------QAK----NLLDALAAV-
K9U5W1          AFVNEQ-LPKIRKDVSQAEANLENFRKQNKLLDPEV-------QAK----NLLDALAAV-
A0A2W6ZAV2      EFLDTQ-APVLQQGVVELQQQLSSFRRQNSFLDPSS-------QGE----AIQTQRQAL-
A0A2G7GMH8      TFINEQ-LPVIKDRVNQAENALELFRESNNLIDPEL-------QAK----ALTDALNNV-
K9W742          AFIDEQ-LPKARLSVTQSEAALEKFRKTQNLIEPDA-------QTT----ALTTALNAI-
A0A2T1DWE8      AFVDEQ-LPLVEKQVDRAEDAMERFRKSQNLVDPEV-------QSR----ALIDALSNL-
A0A1U7I8L3      SFIDAQ-LPSLRESTVRTEAALEKFRKSQNLIQPEL-------QAK----ALIESLKDI-
A0A2T1DJL8      GFINEQ-IPQVEARVNQAEAALERFRKNQDLIDPEL-------QSK----SMVDSLAAV-
A0A1Z4J9W0      SFIDRQ-IPEVQAKVNQAESNLERFRSTSNLVDPEV-------QAK----SLVDSLKEL-
A0A0N7Z5K9      SFIDRQ-IPQVQEKVNKAEADLERFRKSSNLVDPED-------QSR----ALIESLREL-
A0A0S3TXC5      SFIDRQ-IPQVQAKVDKAEADLEQFRKSSNLVDPED-------QSR----ALVESLREL-
K9SA61          AFINDQ-LPKVQAEVREAEAALEAFRKNQNLIDPEA-------QSQ----TILEALSRT-
A0A3D1PBA3      KFINEQ-IPVVSKTVDQAENKLEQFRKNYNLIDPEQ-------QAT----AVSQSLNAI-
K9XPB0          AFIAKQ-IPAAQQEVAAIEAKLTQLRSENNLVSPQG-------ESE----SIKAVLNNI-
A0A350Y7Z1      AFINDQ-LPTARDNVIQAEKALEQFRETQNLIDPVQ-------QAT----TITDALSTV-
A0A352X2A7      SFIDNQ-LVTAANNVNKAERSLEEFRENQNLIDPLQ-------EAS----NVGETLTKI-
A0A0D8ZYV0      KFINEQ-IPGVRNQVAQSEAQLEKFRTNQNLIDPEQ-------QAA----AINNSLNAV-
A0A4R4IUM6      KFINEQ-IPAVTKTVDQAENKLEEFRKNNNLIDPEQ-------QAA----TVNNSLNAI-
A0A2T1FP73      KFINEQ-IPAVTKTVDQAENKLEEFRKNNNLIDPEQ-------QAA----TVNNSLNAI-
A0A433VMS2      KFINEQ-IPAVTKTVDQAENKLEDFRKNNNLIDPEQ-------QAA----TVNNSLNAI-
K9TYA7          KFINEQ-IPAVTKTVDQAENKLEEFRKNNNLIDPEQ-------QAA----TVNNSLNAI-
A0A2P8QUE1      KFINEQ-IPAVTKTVDQAENKLEEFRKNNNLIDPEQ-------QAA----TVNNSLNAI-
A0A2T1DNG3      AFVDKQ-LPQVEGKVKDAEAALEQFRRDQSLIEPSA-------EAA----AQTEMLNRL-
A0A2P8W9H0      DFLDEQ-LPEVRERVSSLEAELEDLRQRSNLIDPLK-------QGE----QLSTQTAKF-
A0A1Z4LN32      SFIEKQ-LPSAKRGLSKVTEELRDFKQKNKVIELKE-------ETT----KAVQIIHEI-
A0A2I8A9F5      DFIAKQ-LPGAKTELEEAQKALLQFKTQNKIVNLEE-------ESS----GLVKNAITI-
A0A218Q6R8      TFIQQQ-LPQAKKELEEITEALRQFKTQNQIVDLQE-------EKN----ATVTIVLAL-
A0A218QGE0      AFIEKE-LPRAKAQLEKAAEALRKFKLKNQILELAE-------ETK----ASVKNISDV-
B8HNB0          RFIEEQ-LPAAQAKLAQSAQAVRNFRKQYGLVTPDA-------YAE----AVVSTRMEL-
A0A563VS48      TFITEQ-LPQVKANVQEAESELRKFKNQYQIANLTE-------ETS----ATINSISNI-
A0A318BJ18      NLLQRQ-LALQKERLDDSQRQLVAYASAQQIINLPA-------PGSGIGGTTTVERSIV-
A0A3B8Y8H9      QFVEDQ-LPKLDQEVSSLQKELERFRKKHNFIDPQS-------QSR----ILSSNLTNI-
A0A2W1JVB9      QYIDQE-LPKTREKIENLEEQLRRFKETNKIVAIDK-------EAE----VAVEAVIRL-
A0A1Z3HMQ0      QFVQEQ-LPKAEAEVEQAAEALRQFKDQNQIIALES-------EAN----AAVSMINNL-
A0A1E5QP61      EFIMQQ-LPDTEETVRQAEAALRAFKEENSVVSLQD-------EAT----SAVISISNL-
A0A3M2GIL5      EFINKE-LPEIEARLSRAEAELRNFKERNNIVELEE-------EAR----SAVFVMGEI-
A0A433NM31      NFIESQ-LPKSKISVQKAEAQLREFKERNNILDLEN-------EAK----AAVTLVTDL-
A0A3M1PML8      DFIAKE-LPKTEAAVKAADSDLRRFKEANGVVLLES-------EAQ----EAVNIISKL-
A0A352X442      EFITEQ-LPRLKQNVSIADAELRNFKEQNKIVDLVN-------EAK----SSVETVADL-
A0A0T7BPZ0      KFIISQ-LPISESSVRAAESAFRQFQERNKIIILQE-------QES----NAVKMISSL-
A0A0M0SHU3      RFILQQ-LPKTEEAVQKAELALRRFKEKNKVIVLQE-------EAT----AAVNTISKL-
A0A1D2PBN3      KFIQRQ-LPATETSVKRAEAELRRFKEENKVIALQE-------EAT----AAVNEISKL-
A0A0C2LVR7      KFIQKQ-LPATEISVKRAEAQLRRFKEENKVIALQE-------EAT----AAVNEISKL-
A0A1Z4PQB9      KFIQKQ-LPATERSVKRAEAELRRFKEENKVIALQE-------EAT----AAVNEISKL-
A0A1Z4SFN6      KFIMKE-LPATELSVRAAESTLRKFKEENKIINLES-------EAG----LAVERISNL-
K9PGI8          KFISQQ-LPATEISVRGAELALRKFKEENKIIALQE-------EAS----TAVQVISRL-
A0A563VLD6      DFIDEQ-LPDSQLDLDKVAYDIRSFRQENNLVDPNI-------YAS----DVSKFRQSL-
A0A318BG22      SFVGNR-LTQQRARLEESERQLVAYAEQNGIISVTD-------AKT----AGTGSGAQS-
A0A2T1E9V8      NFITSQ-LPKVKANVYNADAAIRKFKEKYKLTDLAQ-------TQR----SVAENIERI-
A0A3M2GQQ6      EFIEEQ-LPKAQQELSESALAIQSFRQTYGIVDPES-------YAN----QVLDIKQSL-
K9SGJ5          QFIEDK-LPQVKKDLDESALTVTKFREKYKIVDPDT-------YAA----SVYTMKQDL-
L8MYT6          KFIQDK-LPQVKQKLEKSALAVTQFRKTYNIVDPDT-------YAA----AVFKMREAL-
A0A352JGJ6      KFIQDK-LPQVKQQLDKSALAVTRFRKTYNIVDPET-------YAA----AVFKMREVL-
A0A1J5GLS2      KFIQEK-LPQVKQQLEKSALAVTQFRKSYNIVDPET-------YAA----SVYSMREAL-
A0A2W4W6M5      KFIQDK-LPQVKQQLDKSALAVTQFRKTYNIVDPET-------YAA----SVYKMREAL-
A0A2W7AN33      KFIQDK-LPQVKQQLDKSALAVTQFRKTYNIVDPDI-------YAA----SVYKMREAL-
A0A256BLV2      KFIQDK-LPQVKQQLDKSALAVTQFRKTYNIVDPDT-------YAA----SVYKMREAL-
A0A2W6ZXF3      KFIQEK-LPQVKQQLDKSALAVTQFRKTYNIVDPET-------YAA----SVYSMREAL-
A0A2Z5WX66      KFIQGK-LPQVKQQLDKSALAVTQFRKTYNIVDPEV-------YAA----AVFKMREAL-
K9W1T3          EFVEKQ-LPIIEVTVRQAEQDLRKFKEQNKVLDLAG-------EAT----STTEVLNNL-
A0A1Q4RTR1      EFISKQ-LPEVEAKVRQAEVSLRLFKEKNRVVELQQ-------EAK----TSIANQSDL-
A0A1Z4SQV2      EFISKQ-LPEVETKVRSAEYGLRQFKEKNRVVELQE-------EAK----TSIKNQSDL-
A0A2H2XGN1      EFISKQ-LPEVETKVRSAEYGLRQFKEKNRVVELQE-------EAK----TSIKNQSDL-
A0A433UXH8      EFISKE-LPEVETKVRSAEYGLRQFKEKNRIVELQE-------EAK----TSIKNQSDL-
A0A1Z4RMB9      DFITKE-LPSIESKVQQAESQISAFRTQNNIVDIEE-------EKR----GVVESIGAL-
K1XF69          EFIQEQ-LPRVQQELFLAEKSIQDFKERNEIVDLGT-------EFA----ISVQEMAQL-
B5W297          EFIQEQ-LPRVQKELFLAEKSIQDFKERNEIVDLGT-------EFA----ISVQEMAQL-
H1W7M8          EFIQEQ-LPRVQKELFLAEKSIQDFKERNEIVDLGT-------EFA----ISVQEMAQL-
A0A5Q4H6A5      EFIQEQ-LPRVQQELFLAEKSIQDFKERNYVVDLGT-------EFA----ISVQEMAQL-
D5A466          EFIQEQ-LPRVQQELFLAEKSIQNFKERNEIVDLGT-------EFA----ISVQEMAQL-
B4WP72          RFIAGQ-LPQTESAVSAAEANLRQFKEENGVVDLEQ-------EAA----QAVDSIGNL-
A0A318B4H2      GFLEQR-LAQLRSRLEASERELVAYASGKGIVSFSS-------GST----EKGGGGGERT
B4WQE3          DFVNDQ-LPAVRARVNELEAELEALRQNSNLIDPLA-------QGD----QLSQQMAQF-
A0A2P8W4F7      TFLDEQ-LQEKWQEVEAIESDLSEFQKRYDIVDVNA-------TSE----SVTQRLNQM-
A0A5Q4E0Z4      EFLDEQ-LQEKWQEVDTIESGLSDFQKRYDLVNVTT-------TTE----SVTQRLNQM-
A0A2K3BR24      EFIEEQ-LPKTEQSVQAAEEKFREFKEENNIIALSQ-------EAS----STVDILASL-
K9YXY1          EFIEEQ-LPKTEQSVQAAEEKFREFKEENDIIALSQ-------EAS----STVSILASL-
U5QJM6          TFINAE-LPRVRMNVEASEEALRDFRSKNNILDPEE-------QAK----ALSGVMSDL-
K9SX01          KFIDEQ-LPKLQISLRQAEAALRRFKEVNKAYLPEA-------EAQ----SAVAAVTSL-
A0A4P7ZT55      KFLDEQ-APGLQERVSQIQQELANFRRANALLIPED-------RAK----QIELERADLE
A0A1E5QIR9      RFIEEQ-LPKSEFTVQEAEANLRVFKENNRIVALDQ-------EAS----ATVTLLGGL-
A0A1Z4IBC7      QVILRE-IPKAEESVKKAESELRIFKEINKIVALEQ-------EAT----VAVDTVSKL-
A0A1W5CPC7      QVLIAE-IPKAETSVKKAESELRIFKEINKIIALEQ-------EAT----VAVDTVSKL-
A0A5Q0GKD1      QVLIAE-IPKAETSVKKAESELRIFKEINKIIALEQ-------EAT----VAVDTVSKL-
Q3MDC6          QVLIAE-IPKAETSVKKAESELRIFKEINKIIALEQ-------EAT----VAVDTVSKL-
A0A1Z4KM73      QVLIAE-IPKAETSVKKAESELRIFKEINKIIALEQ-------EAT----VAVDTVSKL-
Q8YNX7          QVLIAE-IPKAETSVKKAESELRIFKEINKIIALEQ-------EAT----VAVDTVSKL-
A0A367R4K6      QVLVAE-LPKAEEIVSRAESQLRLFKEKNKVIVLDQ-------EAS----AAVDTISKL-
A0A1E2WSV8      QVLVTE-VPKAEEIVRRAESKLRLFKETNKIVVLEQ-------EAT----AAVDTISKL-
A0A2R5FRT9      EVLVTE-VPKAEEIVRRTESKLRLFKEKNKVVVLGQ-------EAS----AAVDTISKL-
A0A2K8T1B6      EVLVTE-VPKAEEIVRRAESKLRLFKEKNKVVVLGQ-------EAS----AAVDTISKL-
A0A235I9I0      QVLVTE-VPKAEEVVRRAESKLRVFKETNKVVVLDQ-------EAA----AAVDTISKL-
A0A2D0HQT8      QVLVTE-VPKAEEVVRRAESKLRVFKETNKVVVLEQ-------EAA----AAVDTISKL-
A0A2L2NU95      QVLVTE-VPKAEEVVRRAESKLRLFKETNKVVVLEQ-------EAA----AAVDTISKL-
A0A367S084      QVLVTE-VPKAEEVVRRAESKLRLFKETNKVVVLEQ-------EAA----AAVDTISKL-
A0A0V7ZFJ4      EFLNKQ-LPEVEQRLIRAEAELREFKEKNGIVALEQ-------EAQ----TGVEALKDL-
A0A367RIS1      EFLNKQ-LPLVEAKVAEGEAALRQFKEKYEVVSLEV-------EAQ----EGVRSLNEL-
A0A235IXQ2      EFLNKQ-LPLVEAKVTEEEAALRRFKEKYEVVSLEE-------EAK----EGVKRLNEL-
A0A1W5CNX3      EFLSKQ-LPLVEAKVTEAEAALRRFKEKYEVVSLQE-------EAI----QGVKRLNDL-
A0A5Q0GJJ5      EFLSKQ-LPLVEAKVTEAEAALRRFKEKYEVVSLQE-------EAI----QGVKRLNDL-
Q3MEB7          EFLSKQ-LPLVEAKVTEAEAALRRFKEKYEVVSLQE-------EAI----QGVKRLNDL-
A0A1Z4KHN9      EFLSKQ-LPLVEAKVTEAEAALRRFKEKYEVVSLQE-------EAI----QGVKRLNEL-
Q8YT70          EFLSKQ-LPLVEAKVTEAEAALRRFKEKYEVVSLQE-------EAI----QGVKRLNEL-
A0A218Q4C1      EFLTEQ-LPLVEAKVSEAELALRRFKERNEVVALEE-------EAK----QGVERVYEI-
A0A166IWU6      EFLNKQ-LPLVEKQVAESELALRQFKEKYEVVLLEE-------EAK----QGVERLYQI-
A0A2S0Q8C0      EFLNKQ-LPLVEKQVAESELALRQFKEKYEVVLLEE-------EAK----QGVERLYQI-
W6FSX4          EFLNKQ-LPLVEKQVAESELALRQFKEKYEVVLLEE-------EAK----QGVERLYQI-
A0A0V7ZNJ9      EFLNNQ-LPEVESRVVKAEAELRKFKEENKVVALKE-------EAQ----FGVEGLKDS-
A0A0R0M9H9      KFLSQE-LPRIEKQVIKAELELRRFKEINRVVALDA-------EAK----VGIETLGKI-
A0A1S1ZVW2      KFLSQE-LPRIEKQVTKAELELRRFKEVNRVVALDA-------EAK----VGIESLGRI-
A0A1B7WX82      EFLAKQ-LPEVERQVTKAEMSLRRFKENNRVAVLDV-------EAK----TGLESLAKL-
A0A1B7WTD1      EFLSQE-LPKVERRVTEAEIALRRFKEKNRVVALDV-------EAR----VSLESLGRL-
A0A480ABC0      EFLSKE-LPKVERRVTEAEIALRRFKEKNRVVALDV-------EAR----VSLESLGNL-
A0A1Z4LRU5      EFLQKE-LPQVEGRVVQAEAALRQFKEQNNVVALEE-------EAK----FGVESLKDL-
A0A1Z4JVB4      EFLSKQ-LPEVENRVLRAEMALRRFKEKNRVVALDE-------EAK----VGVEGLNQL-
K9PIA4          EFLNKE-LPQVEKRVMKAEMSLREFKEKNKVIALEI-------EAK----AGVEGLKDL-
A0A1Z4M597      EFLNRQ-LPEVEKRVLKAEMALRRFKEKNRVVALDV-------EAK----VGVEGLKEL-
A0A1Z4MWT1      EFLNRQ-LPEVEKRVLKAEMALRRFKEKNRVVALDV-------EAK----VGVEGLKEL-
A0A1Z4TX53      EFLNRQ-LPEVEKRVLKAEMALRRFKEKNRVVALDV-------EAK----VGVEGLKEL-
A0A1Z4HVE1      EFLNRQ-LPEVEKRVLKAEMALRRFKEKNRVVALDV-------EAK----VGVEGLKDL-
A0A252ECZ1      EFLNRQ-LPEVEKRVLKAEMALRRFKEKNRVVALDI-------EAK----AGVEGLKDL-
A0A1Z4G5Y1      EFLNRQ-LPEVEKRVLKAEMALRRFKEQNKVVALEV-------EAK----TGVEGLKDL-
A0A252DNA2      EFLNRQ-LPEVEKRVLKAEMSLRRFKEQNRVVALDV-------EAK----AGVEGLKDL-
A0A252E1Q4      EFLNRQ-LPEVEKRVLKAEMSLRRFKEQNRVVALDV-------EAK----AGVEGLKDL-
A0A5P8VSD1      EFLNKQ-LPLVQAKLAESQAALRRFKEKHEVVSLEA-------EAI----EGVKRLNEL-
A0A2A2TNQ5      DFLRKQ-LPEIENKVVQAEATLRRFKDDNKVVSLAE-------EAK----VGVEGMRNI-
A0A3S1C4K5      EFLSKQ-LPNIEGRVIAAEAGLRKFKDENKVVSLPE-------EAK----YGVEALKDL-
A0A1X4G3D5      QVLAKK-LPRVERELAKAETDLRQFKESNEIISLEA-------EAE----SGMKNVSTV-
D4TNI2          QVLAKK-LPRVERELAKAETDLRQFKESNEIISLEA-------EAE----SGMKNVSTV-
A0A1Z4H6Z8      EFLNRQ-LPEVEKRVLKAEMALRRFKEKNRVVALEV-------EAK----VGVEGLKDL-
A0A1Z4NPM1      EFLSKQ-VPQLERRVVVAEADLRRFKDENRVVELTE-------EAK----VGVEAMRNL-
A0A3F3KPR9      KFLSQE-LPRIEKQVIKAELELRRFKEINRVVALDA-------EAK----VGIETLGRI-
D4TGN7          KFLSQE-LPRIEKQVIKAELELRRFKEINRVVALDA-------EAK----VGIETLGRI-
A0A1Z4UZW9      EFLSKQ-LPEVEKRVTKAEMNLRRFKENNRVVALDV-------EAK----TGLESLGKL-
A0A0K2M5H0      EFLSKE-LPEVEHRVTKAEMNLRRFKENNRVVALDV-------EAK----TGLESLGKL-
A0A1B7VSH4      EFLSKQ-LPEVESRVTKAEMNLRRFKENNRVVALDV-------EAK----TGLESLGRL-
A0A1B7W126      EFLSKQ-LPEVESRVTKAEMNLRRFKENNRVVALDV-------EAK----TGLESLGRL-
A0A3D4C6Q6      EFLSKQ-LPEVESRVTKAEMNLRRFKENNRVVALDV-------EAK----TGLESLGRL-
A0A1B7UVJ4      QFLAKQ-LPEVERQVTKAEMSLRRFKENNRVAVLDV-------EAK----TGLESLAKL-
A0A1B7UTR1      EFLDKQ-LPEVEKRVTKAEMTLRRFKENNRVVALDV-------EAR----TGLESLGKL-
A0A5C0DRW9      EFLDKQ-LPEVEKRVIKAEMTLRRFKENNRVVALDV-------EAK----TGLESLGKL-
K7W0A4          EFLDKQ-LPEVEKRVTKAEMTLRRFKENNRVVALDV-------EAK----TGLESLGKL-
A0A1U7HGH0      NFITAQ-LPKVKANLQRADLAVRNFKEKNQLTNIEQ-------SQT----ALAANIERV-
K9XJD3          NFITAQ-LPKVKANLQRADLAVRNFKEKNQLTNIEQ-------SQT----ALAANIERV-
A0A2T1CIL7      EFIKAQ-LPKVELTVAKAEEDLRRFKTKNKIANLAQ-------EAS----NNINATKSL-
A0A1Z4RPC6      SFVTST-IPKIEDKLQTLESRLQNFYERNQVVDLQE-------EKR----ILVGEVGNL-
A0A2T1CMZ0      SFISST-IPKIETKLNSLEANLQSFYEKNQVVDLQE-------EKK----SLVDEIGTL-
L8M4F7          KFINQQ-IPTLKAKVESAESALAKFRADNKIVDLQQ-------EKQ----TVIEETANL-
A0A140K2P2      EFINKQ-LPQIESQVSQAESELRNFKESNQVVNLTK-------EAE----STVMQMAEM-
K9XWX4          EFINKQ-LPQIESQVSQAESELRNFKESNQVVNLTR-------EAE----STVVQMANL-
A0A140KB14      SFISNQ-LPQIEQKLSKAESDLRRFKEANRVVNLAK-------EKE----TLVLELGNL-
K9XX88          GFISNQ-LPQIEQKLSQAESDLRRFKEANRVVNLAK-------EKE----TLVVELANL-
A0A563VSV6      SFVTTQ-IPQVEDKLKQNESILQEFRTKHKIVDLQE-------EKK----VLVAELGTL-
L8LZE9          FFVESQ-LPQVEKRLEEYESILQNIRERNNIVDLTQ-------EKR----VLVQEIGTL-
A0A433V7A0      KFISSQ-LPTSEADVVRAEMALRKFKELNQVVDLNQ-------EAT----STVKVIEDL-
A0A1Z4NDS1      TFLDDQ-RPNAARIVQAAELELRRFKEENKVINLQE-------EAT----ASVNAIARL-
K9F4D9          EFITAQ-LPESEEAVEEAEASLRRFKEGNNIVDLEE-------ESR----NLVESLFTL-
U9VXM0          EFISAQ-LPESEAAVNEAEEALRQFREGNSIVDLEE-------ESR----NLVESLFTL-
A0A2T1FTR8      KFVAQE-LPKIENEVKQAENDLRLFKEQYNVVDLPT-------ESV----KAVETITSL-
K9UA41          KFVAQE-LPKIETEVKQAENDLRLFKEQYNVVDLPT-------ESV----KAVETITSL-
A0A0C2LBE2      KFIQKQ-LPTTEVSVKQAESALRQFKENNKIITLQE-------EAS----AAVQAIAKL-
A0A433NN38      KFMWEQ-VPKTEQAVKQAEANLRKFKEANKVVVLQQ-------EAA----EAVSTISKL-
A0A2N6K0T2      KFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EAT----AAVNTISKL-
A0A2N6ML72      KFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EAT----AAVNTISRL-
G6FQZ6          KFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EAT----AAVNTISRL-
A0A2N6MQX9      KFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EAT----AAVNTISRL-
A0A2N6KXT6      KFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EAT----AAVNTISRL-
A0A2N6KGB9      KFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EAT----AAVNTISRL-
A0A2N6L3Y5      KFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EAT----AAVNTISRL-
A0A0S3TIS7      KFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EAT----AAVNTISRL-
A0A1U7GW28      KFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EAT----AAVNTISRL-
A0A2N6LW63      KFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EAT----AAVNTISRL-
A0A328IH74      RFILQQ-LPKTEEAVQKAELALRRFKEKNKVIVLQE-------EAT----AAVNSISKL-
A0A4D9CIB0      RFILQQ-LPKTEEAVQKAELALRRFKEKNKVIVLQE-------EAT----AAVNSISKL-
A0A1Z4TQ63      RFILQQ-LPKTEEAVQKAELALRRFKEKNKVIVLQE-------EAT----AAVNTISKL-
A0A4Q9J8G2      KFILQQ-LPKTEEAVQKAELALRRFKEKNKVIVLQE-------EAT----AAVNTISKL-
A0A1Z4SMD6      SFIKKQ-LPDSKAELEQAAEALRQFKNQFQIIELKD-------EST----AAINNVAKI-
A0A2H2Y096      SFIKKQ-LPDSKAELEQAAEALRQFKNQFQIIELKD-------EST----AAINNVAKI-
K9S8M8          KFITEL-LPKTEASLRQAEAQLRDFKERNGVISLNE-------EAR----TAVESIATL-
A0A1Z4NFV0      KFIEQQ-LPRARAELEKSAEELRKFRTQNQIANLPE-------EAK----TTVESIAKL-
B0CAX4          VFIEKQ-VPEVAAKLKNLDLSLRRFKETNGIIALEE-------EAK----VSVEVEGNF-
U5DPF5          EFIEEQ-LPLTERSVREAEEALRRFKERNRIIVLNE-------EAQ----TTVRLLGSI-
A0A350Y0P6      EFIAKQ-LPQIQNRVRQAESALRNFKEQHNIVSIDE-------EGT----AAVEIMADL-
A0A352X940      KFIERQ-LPKTESTVRQAEAALRRFKEENNIVAIEE-------EAK----SAVQAMAEL-
B8HTN4          EFIERK-LPDVTEQLRGLDRQIRSFKETHGIVDLPT-------EQI----ESVKFKSLL-
A0A2A2TPF8      KFIEAQ-LPRAKGELDKTAEESRRFKEQNQIINLEE-------ESN----ETVKTIGEL-
A0A1Z4R0P8      KFIEAQ-LPRAKGELDKTTEDLRRFKERNQIINLEE-------ESN----ETVKTIGEL-
A0A0T7BUI3      EFIKKQ-LPSSRKELESAAEALRQFKNKNKIVQLEQ-------ESS----SAITSMAKL-
A0A1Z4LP32      QFLKQQ-VPLSRLELENATEALLQFKNQNQVIQLAE-------EAT----AAIQNISKL-
K9REP9          EFLKKQ-VPLSKIELEQATQALLQFKNKNQVIQLPE-------EAT----AAIQNISTL-
A0A1Z4SIJ3      EFIKKQ-LPFSRAELESASEALRRFKTENKIIQLSQ-------EST----AGINNIAQL-
A0A2H2XPG4      EFIKKQ-LPFSRAELESASEALRRFKTENKIIQLSQ-------EST----AGINNIAQL-
K9V3C7          KFIELQ-IPQAKIELDKTSEALRNFKARNQIISLKE-------ESD----STVKIIEEL-
A0A1Z4T6Y7      KFIENQ-LPRAEQELNKTTEELRSFKTNNKVINLDK-------ETE----ETVKNIGEL-
A0A2H2Y561      KFIENQ-LPRAEQELNKTTEELRSFKTNNKVINLDK-------ETE----ETVKNIGEL-
A0A1Q4S362      KFIEGQ-LPRAEGQLNRATEDLRSFKAANQVINLEK-------ETE----ETVKNIGEL-
A0A3S1CIN8      KFIEGQ-LPRAEGELNRATEQLRSFKAANQVINLEQ-------ETE----ETVKSIGEL-
A0A2A2TC28      DFIRKR-LPSSRAELERATEALRRFKIQNNIVQLPQ-------EAT----AAITNISNL-
A0A0C1NCB0      EFIKKQ-LPYARADLERASEALRQFKTSNKIVELKQ-------EAT----SAISNVAQL-
A0A2N6K7Q9      EFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------EST----AAIDIISKL-
A0A2N6MXH6      EFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------EST----AAIDIISKL-
A0A2N6M5A8      EFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------EST----AAIDIISKL-
A0A2N6LL61      EFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------EST----AAIDIIAKL-
A0A0S3TP66      EFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------EST----AAIDIISKL-
G6FP91          EFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------EST----AAIDIISKL-
A0A1U7GYR5      EFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------EST----AAIDIISKL-
A0A2N6KY52      EFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------EST----AAIDIISKL-
A0A2N6KMP5      EFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------EST----AAIDIISKL-
A0A2N6MA45      EFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------EST----AAIDIISKL-
A0A4Q9J9V9      EFIKEQ-LPNSRRELERAAEALRQFKIQNRVIQLAE-------ESS----AAIDIISKL-
A0A328IGA1      EFIKEQ-LPNSRRELERAAEALRQFKIQNRVIQLAE-------ESS----AAIDIISKL-
A0A4D9CE41      DFIKEQ-LPNSRRELERAAEALRQFKIQNRVIQLAE-------ESS----AAIDIISKL-
A0A0M0SFT2      EFIKEQ-LPNSRRELERAAEALRQFKIQNRVIQLAE-------EST----AAIEIISKL-
A0A1Z4TLC8      EFIKEQ-LPNSRRELERAAEALRQFKIQNRVIQLAE-------EST----AAIDIISKL-
A0A0C2LFH0      EFIKKQ-LPQARVELNQAAEALREFKTRYKIIELPE-------EAS----AAVQNVASI-
A0A1Z4IYV4      EFIKKQ-LPYARAELDRSAEALRQFKIQYKIIELPE-------EAS----AAVKNLGQI-
A0A1Z4Q0T6      EFIKKQ-LPYARAELDRSAEALRQFKIQYKIIQLPE-------EAS----AAVQNLGQI-
A0A0C2PT44      EYIKKQ-LRYARAELERSAEALRQFKTRYKIIELPE-------EAS----AAVQNLGQI-
A0A1D2P6J4      EFIKKQ-LPYARAELDRSAEALRQFKTRYKIIELPE-------EAS----AAVKNLGEI-
A0A4R4IQ40      DFIAKQ-IPDVEARVRRAESALRRFKEKNHLIALEV-------EAQ----GAVTVIQTL-
A0A433W533      DFIAKQ-IPDVEARVRRAESALRRFKEQNHLIALEV-------EAQ----GAVTVIQTL-
A0A2P8QWJ3      DFIAKQ-IPDVEARVRRAESALRRFKEQNHLIALEV-------EAQ----GAVTVIQTL-
A0A2T1FKP8      DFIAKQ-IPDVEARVRRAESALRRFKEQNHLIALEV-------EAQ----GAVTVIQTL-
K9U6L7          DFIAKQ-IPDVEARVRRAESALRRFKEQNHLIALEV-------EAQ----GAVTVIQTL-
A0A3M9ZEU1      EFISRE-IPRVEAAVRQAERALREFKEANQIVALDT-------EAT----AAVNIIASI-
A0A1Z4JK72      RFIESQ-LPRAEAELQKASEELRLFRTQNQIVDLER-------ESA----ANINSLSLL-
A0A0N7Z489      RFIDNQ-IPPAEEALNRASEDLKNFRARNGIVDLER-------ESA----ANINSAAVL-
A0A0S3TXS2      RFIDSQ-IPPAEEALNKASEDLRNFRAQNGIVDLER-------ESA----ANINSAAVL-
A0A1Z4RN12      DFIAKQ-LPKAEENVREAEANLRIFKNRNRTINLDE-------ETA----STIESISTI-
A0A2T1CMF9      DFIKQQ-LPKLETEVENAEANLRNFKNRNGISDLQG-------QIT----ADIDSVAQV-
Q7NDC5          GFVEAQ-LPAMEQRLRASERKLRSFKEQYGSVALAE-------EQQ----AAVRLLSEF-
U5QGK3          TFVESQ-LPKMEQRLRDSERRLREFKERYGSVALPE-------EQQ----AVVKQLAEF-
A0A2W4UY24      SFVASQ-LPASKAKVGKIESDLRAFKEANGIVNLEE-------ESQ----NTVKTLSTV-
A0A2T1GMT4      QFIEQQ-MPKTLAAVNAAESAVRSFKQQNNIVDLSE-------EAK----SAVSVIGNL-
K9UI51          QFIEQQ-MPKTLAAVNSAESAVRNFKQQNNIVDLSE-------EAK----SAVGVIGNL-
K9QM62          RFMARQ-LPQTQAAVSTAEVALRKFKQQNNIVDLTE-------EAR----SAVTIIGGL-
A0A1Z4FWI3      RFMAKQ-LPNTRAAVQEAEGALRRFKQSNNIVDLIE-------ETR----SAVAIIGNL-
A0A1Z4JYE7      KFMERQ-LPQTQAAVNYAEAVLRKFREQNNIVDLAE-------ETK----TSVGVITGI-
A0A2T1FXY4      LFMAKQ-LPKTQADVHQAEVKLRIFKQKNNIVDLSE-------EAK----TAVANIGSL-
A0A4V2X3N2      LFMGKQ-LPKSQAAVHQAEVKLRIFKQKNNIVDLSE-------EAK----TAVANIGSL-
K9TYI2          LFMAKQ-LPKSQAAVHQAEVKLRIFKQKNNIVDLSE-------EAK----TAVANIGSL-
A0A1Z4QL41      QFLDKQ-LPKTQTAVQTAEAALRRFKQQNSVVDLSE-------ETK----SAVTIIGNL-
A0A252D4T4      KFMAKQ-LPNTKNAVQEAEAALRIFKQKYNIVDLVE-------ETR----SAVAIIGNL-
A0A252DJH5      KFMAKQ-LPNTKNAVQEAEAALRIFKQKYNIVDLVE-------ETR----SAVAIIGNL-
A0A252EB80      KFMAKQ-LPNTKNAVQEAEAALRIFKQKYNIVDLVE-------ETR----SAVAIIGNL-
A0A1Z4HPW5      KFMAKQ-LPNNRSAVQDAEAALRIFKQKYNIVDLAE-------ETR----SAVAIIGNL-
A0A1Z4MSN1      KFMAKQ-LPNNRSAVQDAEAALRIFKQKYNIVDLAE-------ETR----SAVAIIGNL-
A0A1Z4U1C2      KFMAKQ-LPNNRSAVQDAEAALRIFKQKYNIVDLAE-------ETR----SAVAIIGNL-
A0A0D6KV51      KFMAKQ-LPNNRSAVQDAEAALRIFKQKYNIVDLAE-------ETR----SAVAIIGNL-
A0A1Z4MKF8      KFMAKQ-LPNNRSAVQDAEAALRIFKQKYNIVDLAE-------ETR----SAVAIIGNL-
A0A2C6WC43      QFIARQ-LPKTQEAVDKAERELRIFKQKNRIADLTE-------ETK----SAVGIIGNL-
A0A1Z4L5A1      QFIARQ-LPKTQEAVDKAERELRIFRQKNRIADLTE-------ETK----SAVSIIGNL-
A0A367QD86      QFIARQ-LPKTQEAVDKAERELRIFKQKNRIADLTE-------ETK----SAVGIIGNL-
A0A235IZ96      QFMAKQ-LPKTQAAVNNAEVALRIFKQKHQIADLSE-------ETK----SAVATIGNL-
A0A2L2NGP0      QFMAKQ-LPKTQAAVNNAEVALRIFKQKHQIADLSE-------ETK----SAVATIGNL-
A0A2K8SM78      QFMAKQ-LPKTQEAVNNAEVALRIFKQKHQIANLSE-------ETR----SAVETIGNL-
A0A2R5FPC0      QFMAKQ-LPKTQEAVNNAEVALRIFKQKHQIADLSE-------ETR----SAVATIGNL-
A0A5P8W5T6      QFIAKQ-LPKTQQAVNNAEVALRIFKQKHQIADLSE-------ETK----SAVATIGNL-
A0A140KBA0      QFISEE-LPEVEAKVAQAEADLRNFKNENQIANLSE-------ETT----TLIETSKLV-
K9XSG1          EFISQE-LPEVEAKVAQAEADLRNFKNENQIANLSE-------ETT----TLIETSKLV-
A0A0F5YE28      EFISQQ-LPPVQQEVFRAEQALRSFKEKNQVLDLEE-------EFR----TAVLEQAEL-
U7QEH7          EFISQQ-LPKVQEEVFRAEQALRSFKEKNQVLDLDA-------EFR----TAVTELAEL-
A0A3S1ATK5      KFMARQ-LPKTQAAVYAAEVALRKFKQENRIVDLPE-------ETK----SAVGIIGNL-
A0A2Z6CPH0      KFMAKQ-LPISQASVNRAEVALRVFRQKNNIADLSE-------ETK----SSVGIIANL-
A0A1Z4GT50      EFMSKQ-LPKMQAAVREAEVALRKFKEKHNIVDLSE-------EAK----SGVAIIGNL-
A0A1Z4GIX0      KFMAKQ-LPNTQAAVHKAEVALRIFRQKNNIADLTE-------ETR----SGVGIIGNL-
A0A2H6LC24      KFMAKQ-LPNTQAAVHKAEVALRIFRQKNNIADLTE-------ETR----SGVGIIGNL-
B2J6N5          QFIAKQ-LPKTQEVVNNTEVALRIFKQKYQIADLSE-------ETK----SAVATIGNL-
A0A367RMI4      QFMAKQ-LPTTQAAVNNAEVALRIFKQKHQIADLSE-------ETR----SAVATIGNL-
A0A235HUM0      QFMAKQ-LPTTQAAVNNAEVALRIFKQKHQIADLSE-------ETR----SAVATIGNL-
A0A2L2NW47      QFMAKQ-LPTTQAAVDNAEVALRIFKQKHQIADLAE-------ETR----SAVATIGNL-
A0A1E2WUR1      QFMAKQ-LPKTQAAVNNAEVALRIFKQKHQIADLSE-------ETR----SAVATIGNL-
A0A235IKU3      QFMAKQ-LPKTQAAVNNAEVALRIFKQKHQIADLSE-------ETK----SAVATIGNL-
F4XKF3          EFITNQ-LPQSEANVRQAEAALRQFKERNQVVSLTE-------EAR----SLVAVMADL-
A0A1D9FX10      EFITNQ-LPQSEANVRQAEAALRQFKERNQVVSLTE-------EAR----SLVAVMADL-
A0A1D8TNX9      EFITNQ-LPQSEANVRQAEAALRQFKERNQVVSLTE-------EAR----SLVAVMADL-
A0A1U7MYU6      EFITNQ-LPQSEANVRQAEAALRQFKERNQVVSLTE-------EAR----SLVAVMADL-
A0A3C0NJ41      DFIAKQ-LPKAETNVGQAETSLRRFKQENQVIALDE-------EAK----SAVGVMANL-
A0A352AG88      KFLNEQ-LPKAEANVNQAEMALRQFKEVNKVVSLEE-------ESR----AAVDTLAKL-
A0A350Y374      EFITKQ-LPKAEANVNQAEAAVQEFKERNQVVALDT-------EAT----TAVEVIAKL-
A0A355DPX0      EFITKQ-LPKAEANVNQAEAAVQEFKERNQVVALDA-------EAT----TAVEVIAKL-
A0A0D8ZUV2      KFIANQ-LPKTEARVRQAEAALRQFKEQNQIVSLDE-------EVK----SAVGIIKEL-
A0A433VDI0      EFIAKQ-LPRTETTVRQAEAALRQFKEQNRVVNLDE-------EAK----SAVEIIQEL-
A0A3D1PG43      EFIAKQ-LPTVQGTLRQAEAKLRRFKEQNQVVNLDE-------EGK----SAVEVIKQL-
A0A2P8QQ72      DFIVKQ-LPQTESTVRAAEASLRRFKERHQIVSLEH-------EAI----SAVEVLKEL-
K9TZQ7          DFIVKQ-LPQTESTVRAAEASLRRFKERHQIVSLEH-------EAI----SAVEVLKEL-
A0A2G7GPR0      EFIAKQ-LPQMEATVRQAELALRQFKEQNQVVALDE-------EAK----TAVAAVKQL-
K9XH68          EFIAKQ-LPQMETTVRQAELALRQFKEQNQVVALDE-------EAK----TAVAAIKQL-
A0A1U7HW70      EFIAKQ-LPQMETTVRQAELALRQFKEQNQVVALDE-------EAK----TAVAAIKQL-
A0A2S6VEJ8      EFIAKQ-LPQMEATVRQAEQALRQFKEQNQVVALDE-------EAK----TAVAAIKQL-
                                                                            

K9SLA9          --EAQMLGLQAELAEVGA----RSKQLQQSL----------GM---DAGLSVAW------
A0A168TT23      --NDRLSAARGDLVQLRA----FSQLIDQGR----------GD---SIRPVVND------
A0A0M1JWX9      --DDQLLEAQTALIQQQQ----LYTTLRQQV----------GL---DPDVAIAS------
A0A2T1M1V6      --RATQTEISSEAESHAT----QARVAAAQL----------GM---NPQHALNS------
A0A2G7GCS2      --RTTYTNVLSQAQANQA----QAQAASQRL----------GI---NAQQAMNS------
K9XBH8          --KTNYTTILAQAQGSQA----QAIEASGRL----------GM---NAQQAMNS------
A0A1Z4LJ30      --ETEQAQTIAQAQEFQS----RAKMLSARI----------EM---SPSTAVNS------
K9RI76          --NTQQAQAIAEAESAAA----RVRMLSNRI----------AL---SPAAAVNS------
A0A352AE27      --TTAQAQAQAQALASIN----EVRTLSNRL----------GL---TPDQAIRS------
A0A3B8JH60      --STAQAQAQALAQAGQN----RVSVLSAPL----------SL---TPDQAIKS------
A0A3C0N766      --STAQAQAQALAQAGQN----RVSVLSARL----------SL---TPDQAIKS------
K9W9J7          --TSVQAQALAQAQASEN----RIQVLSSRL----------SL---TPNQAIRS------
A0A139WSU3      --TTVRAQVLATAEASEN----RAKALSIRL----------SL---TPNEAIRS------
A0A433VN22      --VGSRAQALSLAQASAS----RSKVLSERI----------NM---APASAVRS------
Q7NF11          --TTSQAQAVAEGTADKA----RAQMLTARL----------GM---DAPQAMRA------
A0A1Z4JCS8      --EAAQAQVQAESQATRD----RANTLATRL----------NL---SPTDAVQA------
F4XTX2          --SISQAQAQAEAQASQH----QLQILSTRL----------GL---TPKQAIRS------
Q7NJN6          --RSTQTLTLAQAEAAAR----RATALEQAV----------GM---DLRRATAA------
U5QCC3          --RSSATLAQAQAKAAED----RSRSLEQAV----------GM---DLRRATSA------
A0A3S0Y9N9      --EKQVAETISELASQTA----KMKSIKQLF----------GV--NSQEAVVAG------
A0A433UNK7      --DKQVAATRSDLSSQTA----RMQSIQKLF----------GV--ASQDAVVAG------
A0A3M1SVZ4      --QQRITDTQSQIASTNS----RYNALQNQL----------GM--NPKQAAQRT------
A0A654SFI6      ----------AALNEALA----QAVTDRISA----------EA--SVLSGEFPA------
K9SSQ0          --ATQIQDLQIKMAQTQR----QLQELQRQV-----------G--RPADVAISS------
A0A2W1JIN9      --EGQIRDLTSQIQEVDA----RNLSLSTLT----------NA--GSINNTYTS------
A0A318AJV1      --SGQLANAEAEAAGARS----SASVAQGQV----------RS--GNVD---AV------
A0A1U7N2U4      --EDQERAVSIQLQDAKT----RSQELQTIT----------SL--NNTQNAYIA------
A0A1D9G1F2      --EDQERAVSIQLQDAKT----RSQELQTIT----------SL--NNTQNAYIA------
F4XV38          --EDQERAVSIQLQDAKT----RSQELQTIT----------SL--NNTQNAYIA------
A0A2P8QIL5      --EEQERTTLAQLQEVKA----RNSSLEQVT----------DS--STLKNTYAT------
A0A2T1FLY5      --EEQERTTLAQLQEVKA----RNSSLEQVT----------DS--STLKNTYAT------
A0A433W447      --EEQERTTLAQLQEVKA----RNSSLEQVT----------DS--STLKNTYAT------
K9U1K8          --EEQERTTLAQLQEVKA----RNSSLEQVT----------DS--STLKNTYAT------
A0A4V6P809      --EEQERTTLAQLQEVKA----RNSSLEQVT----------DS--STLKNTYAT------
K9UYB2          --EDQQRTLGTQLQEARS----RGESIRRIT----------DT--STLNNAYTT------
A0A218QN17      --EDQERALTAQLQEAKG----RDASLRQIT----------SA--KSLDKAYAS------
K9RKN2          --EEQERTLSALLEQVRS----QENSLRQIT----------NA--DSLNSAYSS------
A0A2I8ADV2      --EDQERTLIAQLQEARS----REASLRQLT----------AT--KNINNAYTS------
A0A1W5CKM3      --ENQERILAVQLQETRS----RDASLRQVT----------DA--KNINTAYAS------
A0A5Q0GMF5      --ENQERILAVQLQETRS----RDASLRQVT----------DA--KNINTAYAS------
Q3MEW0          --ENQERILAVQLQETRS----RDASLRQVT----------DA--KNINTAYAS------
A0A1Z4KIC7      --ENQERTLAVQLQETRS----RDASLRQVT----------DA--KNINTAYAS------
Q8YSM5          --ENQERTLAVQLQETRS----RDASLRQVT----------DA--KNINTAYAS------
A0A1Q4S1H4      --EDQERMLFAQLQEARS----RDSSLRQVT----------NS--SNLGNAYAS------
A0A433VBU6      --EDQERMLFAQLQEARS----RDASLRQVT----------NS--SNLGSAYAS------
A0A1Q4RZJ6      --EDQQRNLATQLQEANS----RLDSLRQVT----------QS--KGLDTAYES------
A0A1Z4SNV3      --EDQQRTLATQLQDANS----RGESLRQIT----------QA--KGLDRAYES------
A0A2H2XJQ1      --EDQQRTLATQLQDANS----RGESLRQIT----------QA--KGLDRAYES------
A0A3S5K358      --EDQQRTLATQLQEANS----RLDSLRQVT----------QA--KGLDTAYES------
A0A0T7BPJ4      --EDQERTALAQLQELRS----RAASLEKIT----------KT--TSLDKAYSA------
A0A0C1QS61      --ENQERTLSAQLRELRS----QDASLRQIT----------NA--TALKSAYAS------
A0A139X3R8      --ENQERTLSAQLQELRS----QDASLRQIT----------NS--TAVKSAYAS------
A0A1Z4I7C5      --ENQERTLAAQLQEARS----RDASLRQVT----------DA--KNITAAYAS------
A0A0C2MDK7      --EHQERTLSAQLQEIKT----KDASLGQIT----------NA--GNLNNAYSS------
A0A1Y0RCK1      --EDQERTLSAQLQEIKA----RDVSLRQIT----------NT--ENLNNAYSS------
A0A1Z4PWZ0      --EDQERTLSAQLQEIKA----RDASLRQIT----------DS--ATLNKAYSS------
A0A0C2QLT0      --EDQERTLSTQLQEIKA----RDASLRQIT----------NT--ENLNKAYSS------
A0A1Z4J2K1      --EDQERTLSAQLQEIKA----RDASLRQIT----------DA--GNLNKAYSS------
A0A3S0ZSX0      --EEQEGTLSAQLQELRS----KEVSLRQVT----------DA--KALDQAYAS------
A0A2N6K4T3      --EEQENTLSAQLQELRS----KEASLQQVT----------DA--KALNQAYAA------
A0A370CKT2      --EQQENTLSAQLQELRS----KEASLQQVT----------DA--KALNQAYAA------
A0A0S3TL97      --EQQENTLSAQLQELRS----KEASLQQVT----------DA--KALNQAYAA------
A0A2N6M8A0      --EQQENTLSAQLQELRS----KEASLQQVT----------DA--KALNQAYAA------
A0A2N6M9E1      --EEQENTLSAQLQELRS----KEASLQQVT----------DA--KALNQAYAA------
A0A2N6KJI4      --EEQENTLSAQLQELRS----KEASLQQVT----------DA--KALNQAYAA------
A0A2N6MZ77      --EEQENTLSAQLQELRS----KEASLQQVT----------DA--KALNQAYAA------
A0A2N6KT20      --EQQENTLSAQLQELRS----KEASLQQVT----------DA--KALNQAYAA------
G6FSN3          --EQQENTLSAQLQELRS----KEASLQQVT----------DA--KALNQAYAA------
A0A4D9CI02      --EEQENTLVAQLQELRS----KEGSLRQVT----------DA--KALNQAYAA------
A0A328I8B9      --EEQENTLVAQLQELRS----KEGSLRQVT----------DA--KALNQAYAA------
A0A4Q9J4Z7      --EEQENTLVAQLQELRS----KEGSLRQVT----------DA--KALNQAYAA------
A0A0M0SU69      --EEQENTLVAQLQELRS----KEASLRQVT----------DA--KALNQAYAA------
A0A1Z4TIZ8      --EEQENTLVAQLQELRS----KEASLRQVT----------DA--KALNQAYAA------
A0A0S3TYD7      --NKRIEDTRAKLVGAIQ----KVNALKNQV----------GT---SNEIGVAQ------
U5QL42          --QQRIQDLQINLAQTQR----QYSELRAQV----------GE---DPDIALSM------
K9QF04          --IQQRQETQALLGETQS----TIKDLQQQL----------GI---DFKQAVAL------
A0A3C0N2P0      --VKQRQDTESQLSEAQK----LYTELQTQL----------SQLGVTPNQAIAS------
K9TLQ0          --VNERQETESQLVQAQA----LYGKLRGQL----------GL---ELEQAMLA------
A0A076HBF2      --AAQVLGLEADRNRLLK----VRGEIASGT----------LTARGFQEAIGQNNGGG--
A0A354B169      --ESQLLGLEAERNRLQR----VRAEISSGR----------LSARGFQEAISTGSGGS-S
G4FMX5          --SSQVLALQAGRNRLSK----VREEIANGT----------LTARGFQEAIG-GMGNGLT
Q0IDT5          --ATQIFGFEAERSRLKR----VRQDIASGS----------LSARGFQEAISTGSGGVVT
A0A2D6FCW3      --AAQVLDLEAGRNRLLR----VRQEIANGT----------LTARGFQEAIG-GLGNGTT
A3ZA21          --ATEILGLEAERSRLQR----VRAEIAAGT----------LSARGFQEAISTGSGGG--
A0A140K3H3      --EQQEKQAEIALARTQR----QYQEINRQL----------RDLGQNPETIVAY------
K9XUB8          --EQQEKQAEISLAAAQR----RYEEINRQL----------RELGQNPETIVAY------
Q7NEU3          --NRDYEQSKAELEASKE----HYWALSERL----------GI---SPGQALAS------
A0A352XE00      --VQQRQDAQSQLAEAKA----LYNQLESQL----------AELGVSPDRAIAA------
B4VS56          --VQERQNTQTQLDEART----LAVQLQSQL----------GELGLSPKQAIAA------
A0A352AAQ3      --VKQRQETESQLVEAQR----LYTELQDQL----------GQLGVTPDQAIAA------
A0A350Y472      --VKQRQETQSQLIESQQ----LYAELQTQL----------GQLGVTPDGAIAA------
A0A355DVB4      --VKQRQETQSQLIESQQ----LYAELQTQL----------GQLGVTPDGAIAA------
A0A2P8VVX1      --QTQQQQLMVELSGLEQ----QYATLEQQL----------NL---SPQSGVIA------
A0A2P8WHY0      --QSEQRQLMSQLTELKS----RYQTLEQRT----------QL---SPANALLA------
A0A2T1CMT9      --AQEREALKAQVGEIAG----SSSALQEQL----------GV---SVENALAL------
A0A563VQJ3      --NRQIATLGASYQGKQA----QTKAMQSQL----------GL---NLQQAIAA------
A0A1D8TX52      --EQERRAIRAQYMETQT----RYEAVQQKL----------AR---SPQNALTS------
A0A1U7N5X9      --EQERRAIRAQYMETQT----RYEAVQQKL----------AR---SPQNALTS------
A0A1D9G4T2      --EQERRAIRAQYMETQT----RYEAVQQKL----------AR---SPQNALTS------
F4XP71          --EQERRAIRAQYMETQT----RYQAVQQKL----------AR---SPQNALTS------
A0A2P8QVH5      --ESERRTIRAQFQDQQA----RYNKLQQQI----------SR---SPQQALIA------
A0A2T1FT70      --ESERRTIRAQFQDQQA----RYNKLQQQI----------SR---SPQQALIA------
A0A433W4W4      --ESERRTIRAQFQDQQA----RYNKLQQQI----------SR---SPQQALIA------
K9U5W1          --ESERRTIRAQFQDQQA----RYNKLQQQI----------SR---SPQQALIA------
A0A2W6ZAV2      --NVRLDDLRQTEAKLLG----MASAVGSGM----------LT---GPQVQGSAGDPGSG
A0A2G7GMH8      --KQEQRTNRNQIQQTQS----RLHNLQQQL----------AR---TPRNALVS------
K9W742          --QDERRRNQAQYRELQA----SYNTLQQQV----------AR---SPQDALVS------
A0A2T1DWE8      --QKEQQTNQAQIREVQG----RYQTLQQEL----------AL---SPQQALIA------
A0A1U7I8L3      --QYELRTARAQYQEAQS----RFQTLQQQV----------KR---SPQDAVVS------
A0A2T1DJL8      --QKDQRANRTELQDLQA----RYGALQQQL----------AR---SPQQATIA------
A0A1Z4J9W0      --QQNQQENRGLLASSRA----KFIALQQQL----------QR---SPGQATVA------
A0A0N7Z5K9      --QKDQQSNRGELASAQA----RFLALQQQL----------AR---SPEQATIA------
A0A0S3TXC5      --QKDQQSNRGELASAQA----RFSALQQQL----------AR---SPEQATIA------
K9SA61          --RQEQQTNQAELQATQA----QFASLQRQL----------GR---SPQAALLA------
A0A3D1PBA3      --AQERQVIRAQYKDLQA----RYNALQQQL----------AR---SPQQALAA------
K9XPB0          --QQERATLKAEQKQTQG----NYRQLQQEL----------GL---SAENSVAM------
A0A350Y7Z1      --EQEQQAIRAQYQETQA----RYRVLQQQL----------ER---SPQEALTS------
A0A352X2A7      --EQERQAVRAQYQETLA----RYNSLQKQL----------NR---STSEALTS------
A0A0D8ZYV0      --VQQRQVLRAQFQDTEA----RYRVLQQQV----------GS---TPQVALSS------
A0A4R4IUM6      --AQEREVIRAQYNDLQA----RYGQLQQQL----------AR---SPQQALVA------
A0A2T1FP73      --AQEREVIRAQYNDLQA----RYGQLQQQL----------AR---SPQQALVA------
A0A433VMS2      --AQEREVIRAQYNDLQA----RYGQLQQQL----------AR---SPQQALVA------
K9TYA7          --AQEREVIRAQYNDLQA----RYGQLQQQL----------AR---SPQQALVA------
A0A2P8QUE1      --AQEREVIRAQYNDLQA----RYGQLQQQL----------AR---SPQQALVA------
A0A2T1DNG3      --QADKQATLVQIRELQT----RYGDLQQKV----------NL---SPQQAVLT------
A0A2P8W9H0      --TAEQFDLRLQLEQSQQ----LYQELQQTL----------NN---DGELAANS------
A0A1Z4LN32      --DKELTEARSELADVGG----QEKEVSSQL----------NL---PLNKAVDI------
A0A2I8A9F5      --DSEINNARAQLAETIT----REKQILNQI----------NL---PADQAVDI------
A0A218Q6R8      --DEELNNARALLADVSA----QEKQIIGQL----------NL---PAEQALAI------
A0A218QGE0      --EIELAKARSELADARA----QEIQIRRQM----------NL---RVDRAVDI------
B8HNB0          --EKQGKDAEIAVKTTQR----QLEEVNQQL-------ADLKV---NPSQAVPI------
A0A563VS48      --RSQIDTIEAELEDVNA----RYSALNSQL----------GI---SWEKASAI------
A0A318BJ18      --ADDLAALNASLAQATA----ERIQAEARS----------QQ---GGRAGASA------
A0A3B8Y8H9      --IQKKQENQSLLQEQEI----RYRNLQQQL----------AM---GEQEAIDL------
A0A2W1JVB9      --AEKINEAQGRAISAQA----QSDSLRKQL----------GI---DKQKSIAS------
A0A1Z3HMQ0      --ETQIGQAQAQLASAIT----RTGELRRQL----------GI---PLAQARQV------
A0A1E5QP61      --DSEVIKAQAQYEDATA----RSQALQSQM----------GL---NPQQALAI------
A0A3M2GIL5      --ETEKSKKEAALADATA----RSAALQQQM----------GL---NSAQAIAL------
A0A433NM31      --ENQIAQAQINLANANM----RSAALQREI----------GI---NVEQAKVI------
A0A3M1PML8      --EDQVTQARAELSDTSA----RLSQLQGRV----------GA---DPRRATVI------
A0A352X442      --DTQIAQTQAKLAEATA----QTETLRSQV----------GL---NSKTAVAV------
A0A0T7BPZ0      --EDEIAQAEIKLTEVNA----QLDKLRSQA----------KI---DTWQAVTL------
A0A0M0SHU3      --EDEIAEAQAQLVDANA----RLEKLQNQA----------RV---NSQEAISA------
A0A1D2PBN3      --EEQISQAQAQLADVSA----RSQKLQNQA----------KI---DSQQGVTF------
A0A0C2LVR7      --EEQISQAEAQLADVTA----KSQKLQNQA----------KI---DSQQGVTF------
A0A1Z4PQB9      --EEQISQAQAQLADVSA----RSQKLQNQA----------KI---DSQQGVTF------
A0A1Z4SFN6      --EQQLAQAQAEYANVTA----KSQKLQNQG----------SI---DSPQSVTF------
K9PGI8          --EEQINQTQAKLVEVGA----RTKKLQKQA----------NV---NSQQAVTL------
A0A563VLD6      --EQDSRSTEIALARAKS----KYQELYFQL-------QQLGQ---EPDTILAS------
A0A318BG22      --LDSASMAALNDRVAAA----RANRILAEQ----------AW---NLARSPRA------
A0A2T1E9V8      --GSQVDSIEAQLSDLNS----RSKGIQQKL----------GM---SPQEAIVT------
A0A3M2GQQ6      --EKDAQSLEITLTRSQR----LYAELRSQM-------VEAGQ---NPDTALVH------
K9SGJ5          --DTQAQQLQIQMAQTQR----QFKELQRQV----------GG---STDLVLGK------
L8MYT6          --ETQAQELQIKIAQSQQ----QYEALSRQV----------GK---SAESAIGG------
A0A352JGJ6      --EVQAQELQIKIAQTQQ----QYKSLSRQV----------GK---SPDAAISG------
A0A1J5GLS2      --EKQAQELQIRIAQVEQ----QFEILSRQV----------GK---TPDAAISG------
A0A2W4W6M5      --EVKAQELQIQIAQVQQ----QYKALSRQV----------GK---SPDAAIGG------
A0A2W7AN33      --ETQAQDLQIKIAQVQQ----QYEVLSRQV----------GK---SPEAAISS------
A0A256BLV2      --ENQAQDLQIKMAQVQQ----QYEALSRQV----------GK---SPEAAIGS------
A0A2W6ZXF3      --EKQAQDLQIRIAQLQQ----QFEILSRQV----------GK---TPDAAIGS------
A0A2Z5WX66      --EAQAQDLQIKIAQFQQ----QYKSLSSQV----------GK---SPNAAISS------
K9W1T3          --TQQISEAQSKYAAETS----RVQGLQQLF----------GN---DLNATVVA------
A0A1Q4RTR1      --ADEIIKTEATLVDTSS----KIISLQNQL----------GL---NSQKAIAL------
A0A1Z4SQV2      --ADQIIKSEAQLVDISS----QIQALQNQL----------SL---NSRQAVAL------
A0A2H2XGN1      --ADQIIKSEAQLVDISS----QIQALQNQL----------SL---NSRQAVAL------
A0A433UXH8      --ADEIIKSEAQLVNISS----QIQALQNQL----------GF---NSRTAVAL------
A0A1Z4RMB9      --NQQISTTGSELQGLKA----QTAALEGQL----------GL---NLNQAVAA------
K1XF69          --NRNITTLEAELNAVQS----LVNSLGNQV----------GL---NLEEAIAV------
B5W297          --NRNITTLEAELNAVQS----LVNSLGNQV----------GL---NLEEAIAV------
H1W7M8          --NRNITTLEAELNAVQS----LVNSLGNQV----------GL---NLEEAIAV------
A0A5Q4H6A5      --NRNITTLEAELNAVQS----LVNSLGNQV----------GL---NLEEAIAI------
D5A466          --NRNITTLEAELNAVQS----LVNSLGNQV----------GL---NLEEAIAV------
B4WP72          --DTQIDQAKTELANVNA----RLLELRRQL----------GM---ELETAIEL------
A0A318B4H2      LVTDDLSSLNTALNAAVA----E------------------RV---AAESAVRA------
B4WQE3          --TSDHLNLQVEIAQTTE----LYNDLQQEL----------SR---IDNEYAST------
A0A2P8W4F7      --LADQEQLRVDLTAMEP----LYDSLRDQV----------GF---DPDTAIRV------
A0A5Q4E0Z4      --LADQEQLRVQLTALGP----LYENLRRQV----------GF---EPTVAIGV------
A0A2K3BR24      --DQQLIQAQASLDDAQT----RLEKLTEQL----------GL---PPEQALAA------
K9YXY1          --DQQLIQAQASLDDAQT----RLEKLTEQL----------GL---PPEQALAA------
U5QJM6          --MEEAEKAKVELQTSRK----QYLALASRL----------GS---SPEQALAA------
K9SX01          --DTQITASKSDLAKVNS----EINDIRTRL----------GF---TSEQAIIL------
A0A4P7ZT55      ARERQLQQGQAQLVGLQASVR-RGQLFSPQFQGASGVSGGGGL---KPATGADL------
A0A1E5QIR9      --EGEITQAKVALNSANT----RVAALRSQT----------GI---DSQQAIAL------
A0A1Z4IBC7      --SNQISQAQAQLNDVKG----RLEQLRAQA----------QV---NSQQGVIA------
A0A1W5CPC7      --SNRISEAQAQLNDVTG----RLEQLRAQA----------QV---DSQQGVIA------
A0A5Q0GKD1      --SNRISEAQAQLNDVTG----RLEQLRAQA----------QV---DSQQGVIA------
Q3MDC6          --SNRISEAQAQLNDVTG----RLEQLRAQA----------QV---DSQQGVIA------
A0A1Z4KM73      --SNRISEAQAQLNDVKG----RLEQLRTQA----------QV---DSQQGVIA------
Q8YNX7          --SNRISEAQAQLNDVKG----RLEQLRTQA----------QV---DSQQGVIA------
A0A367R4K6      --DNQIYQAQAQLDDVKG----RLEQLRAQA----------QV---NSQQGVIA------
A0A1E2WSV8      --GNQISQALAQLDDVKG----RLEQLRSEA----------QV---DSQQGVIA------
A0A2R5FRT9      --GNQISQALAQLDDVKG----RLEQLSSEA----------KI---DSKQGVIA------
A0A2K8T1B6      --GNQISQALAQLDDVKG----RLEQLRSEA----------KI---DSQQGVIA------
A0A235I9I0      --GNQISQALAQLDDVKG----RLEQLSSEA----------QV---DSRQGVIE------
A0A2D0HQT8      --GNQISQALAQLDDVKG----RLEQLSSEA----------QV---DSRQGVIE------
A0A2L2NU95      --GNQISQALAQLDDVKG----RLEQLSSEA----------QV---DSRQGVIE------
A0A367S084      --GNQISQALAQLDDVKG----RLEQLSSEA----------QV---DSRQGVIE------
A0A0V7ZFJ4      --SEEIVKAQAYLGEVTT----RSEGLQKQL----------QL---ETQEAVAI------
A0A367RIS1      --SNQITQLRARLVDARS----RSGALQNQL----------AL---NTKQAMAL------
A0A235IXQ2      --SSQITELRARLVDARS----RSGALQNQL----------AL---NTQQAMAL------
A0A1W5CNX3      --SGQVTQLRAQLVDART----RSGALQNQL----------AL---NTKQAMAL------
A0A5Q0GJJ5      --SGQVTQLRAQLVDART----RSGALQNQL----------AL---NTKQAMAL------
Q3MEB7          --SGQVTQLRAQLVDART----RSGALQNQL----------AL---NTKQAMAL------
A0A1Z4KHN9      --SGQVTLLRAQLVDART----RSGALQNQL----------EL---NTKQAMAL------
Q8YT70          --SGQVTLLRAQLVDART----RSGALQNQL----------EL---NTKQAMAL------
A0A218Q4C1      --SNQITLLRARLVDASS----RSSALQNQL----------QL---NTEQATAL------
A0A166IWU6      --SNQLTLLRARLIDASS----RSDALQNQL----------AL---NTQKATAL------
A0A2S0Q8C0      --SNQITLLRARLIDASS----RSDALQNQL----------AL---NTQKATAL------
W6FSX4          --SNQITLLRARLIDASS----RSDALQNQL----------AL---NTQKATAL------
A0A0V7ZNJ9      --LQELNQAEAKLAAANE----RSQALQREL----------DI---EKQKAVEL------
A0A0R0M9H9      --DEVITQAQGQLAAAST----RSLALQNEL----------QL---STQQAVAL------
A0A1S1ZVW2      --DEVITQAQGQLAAAYT----RSLALQNEL----------QL---STQQAVAL------
A0A1B7WX82      --DQAIIESQGELVAAST----RSLALQYEM----------KL---DTRQAVDL------
A0A1B7WTD1      --TESITQSQGELAAAYT----RSVALQNEM----------KL---TTQQAVDL------
A0A480ABC0      --TEAITQSQGELAAAYT----RSVALQNEM----------KL---TTQQAVDL------
A0A1Z4LRU5      --SENITQSQANLVEAMT----RSEALQNQL----------KL---QPQQAVAL------
A0A1Z4JVB4      --SQEIISTQGQLVAAKT----WSVGLQDQM----------AL---STKQAVEL------
K9PIA4          --AAIITKVEAELVGANT----RSLALQNQI----------EL---NTNQAVAL------
A0A1Z4M597      --AEEITRTQGELTAAKT----RSLALQNQM----------KL---NTDTAVEL------
A0A1Z4MWT1      --AEEITRTQGQLTAAKT----RSLALQNQM----------KL---NTDTAVEL------
A0A1Z4TX53      --AEEITRTQGQLTAAKT----RSLALQNQM----------KL---NTDTAVEL------
A0A1Z4HVE1      --LEEITKAQANLVDANT----RTQALQNQI----------AL---NTQQAVEL------
A0A252ECZ1      --LEEITTAQAELADANT----RTRALQSQM----------AL---NTQQAVEL------
A0A1Z4G5Y1      --LGEITKAQAGLADATS----RTKALQSQI----------AL---NTQQAVEF------
A0A252DNA2      --LEEITKAQAELADAST----RTRALQSQI----------AL---NTQQAVEL------
A0A252E1Q4      --LEEITKAQAELADAST----RTRALQSQI----------AL---NTQQAVEL------
A0A5P8VSD1      --SSQMTQLHAQLVDFRS----RSGALQNQL----------AL---STQQAMAL------
A0A2A2TNQ5      --AEESTRALAVLEEAKS----RSGTLQKQL----------DL---TTQKAVEL------
A0A3S1C4K5      --SGDITKAQALLSDASS----RSVALQKEL----------EL---TTQQAVEL------
A0A1X4G3D5      --DAAINQAQAELAVVYT----RSSALQNEL----------QL---NKQQAVLV------
D4TNI2          --DAAINQAQAELAVVYT----RSSALQNEL----------QL---NKQQAVLV------
A0A1Z4H6Z8      --AEEITTAQGELVAAKT----RSVALQSQM----------EL---NPHQAVEL------
A0A1Z4NPM1      --SAELTRAQAALAEKNT----RVQTLQNQL----------EL---NRQQAVEL------
A0A3F3KPR9      --NEVITQAQGQLAAAYT----RSLALQNEL----------QL---TTQQAVAL------
D4TGN7          --NEVITQAQGQLAAAST----RSLALQNEL----------QL---TTQQAVAL------
A0A1Z4UZW9      --DEAITKSQGELAAVLT----RSVALQNEM----------KL---GTQQAVDL------
A0A0K2M5H0      --NEAITQSQGELAAALT----RSVALQNEM----------KL---GTQQAVDL------
A0A1B7VSH4      --NEAITQSQGQLAAALT----RSVALQNEM----------KL---DRQQAVDL------
A0A1B7W126      --NEAITQSQGQLAAALT----RSVALQNEM----------KL---DRQQAVDL------
A0A3D4C6Q6      --NEAITQSQGQLAAALT----RSVALQNEM----------KL---DRQQAVDL------
A0A1B7UVJ4      --DQAIIESQGELVAAST----RSLALQYEM----------KL---DTRQAVDL------
A0A1B7UTR1      --DEAITRSQGELAAAYT----RSVALQDKM----------KA---TTQEAVDL------
A0A5C0DRW9      --DEAITRSQGELAAAYT----RSVALQDKM----------KS---TTQEAVDL------
K7W0A4          --DEAITRSQGELAAAYT----RSVALQYEM----------KS---TTQEAVDL------
A0A1U7HGH0      --GSQIDAVEAQLVDLNS----RTQSLQRQL----------GM---NPQQAMTI------
K9XJD3          --GSQIDTVEAQLVDLNS----RAQSLQRQL----------GM---TPQQAMTI------
A0A2T1CIL7      --ESEIDAVRANLKDVNG----RFEQLRSQL----------NI---SWEEAVAI------
A0A1Z4RPC6      --NRQIADTGAQLQGAKA----QTESLQNQL----------GL---DLKQAIAA------
A0A2T1CMZ0      --NRAISGVGAQLQGKKA----QTDSLQNQL----------GL---NLKQAIST------
L8M4F7          --NRQIAFIGSQYRGTKA----QTDALQAKI----------GL---SLEQAIAA------
A0A140K2P2      --NSEISKVAAQLQGTMA----QSEALQSQL----------NL---NLNQAIAA------
K9XWX4          --NSEIANVAAQLQGTMA----QSEALQSQL----------NL---NLNQAIAA------
A0A140KB14      --NQQIANVAAQYQGTQA----QTATLNQQL----------GL---NLNQALAA------
K9XX88          --NQQIANVAAQFQGTQA----QTATLNQQL----------GL---NLNQALAA------
A0A563VSV6      --NRQIATTGSQLKGTQA----QTASLQKQL----------GL---SLNQAIAV------
L8LZE9          --NRQISAIGAQLQGAKA----QTGALSQEL----------GL---SLEQAISA------
A0A433V7A0      --EKAITQTQAELAEVNNYYQILQNQIQSQI----------GM---SVQDALAR------
A0A1Z4NDS1      --EDQITQVQAKLVDATA----RVKTLQEQA----------NI---NSQQAITS------
K9F4D9          --DNALIQLKSQLADSSA----QASQLQQKL----------KL---SSDEAYAV------
U9VXM0          --DNALIQLKSELADSTA----QASQLQQKL----------KL---SSQEAYAV------
A0A2T1FTR8      --NKEITSASAQLAAETS----RLEGLKNLF---------GGR---DAQATIQS------
K9UA41          --NKEITSASAQLAAETS----RLEGLKNLF---------GGR---DAQATIQS------
A0A0C2LBE2      --NEQISQAQAQLEDVTA----RSQKLQNQA----------KI---DSQQTVTN------
A0A433NN38      --EDNIATAQAQLVNVTA----QSQKLKEQI----------EV---ESQKAITY------
A0A2N6K0T2      --EDEIAQAQAQLVDVNA----RLEKLQTQA----------RV---NSQEAVSA------
A0A2N6ML72      --EDEIAQAQAQLVDVNA----RLEKLQTQA----------RV---NSQEAVSA------
G6FQZ6          --EDEIAQAQAQLVDVNA----RLEKLQTQA----------RV---NSQEAVSA------
A0A2N6MQX9      --EDEIAQAQAQLVDVNA----RLEKLQTQA----------RV---NSQEAVSA------
A0A2N6KXT6      --EDEIAQAQAQLVDVNA----RLEKLQTQA----------RV---NSQEAVSA------
A0A2N6KGB9      --EDEIAQAQAQLVDVNA----RLEKLQTQA----------RV---NSQEAVSA------
A0A2N6L3Y5      --EDEIAQAQAQLVDVNA----RLQKLQTQA----------RV---NSQEAVSA------
A0A0S3TIS7      --EDEIAQAQAQLVDVNA----RLEKLQTQA----------RV---NSQEAVSA------
A0A1U7GW28      --EDEIAQAQAQLVDVNA----RLEKLQTQA----------RV---NSQEAVSA------
A0A2N6LW63      --EDEIAQAQAQLVDVNA----RLEKLQTQA----------RV---NSQEAVSA------
A0A328IH74      --EDEIAEAQAQLVDANA----RLEKLQNQA----------RV---SSQEAVSA------
A0A4D9CIB0      --EDEIAEAQAQLVDANA----RLEKLQNQA----------RV---SSQEAVSA------
A0A1Z4TQ63      --EDEIAQAQAQLVDANA----RLEKLQNQA----------RV---NSQEAVSA------
A0A4Q9J8G2      --EDEIAQAQAQLVDANA----RLEKLQNQA----------RV---NSQEAVSA------
A0A1Z4SMD6      --DEEMNQVKAAIAEAIA----QETQLRSQL---------NIA---QNQPVVEI------
A0A2H2Y096      --DEEMNQVKAAIAEAIA----QETQLRSQL---------NIA---QNQPVVEI------
K9S8M8          --STMIAQSEAMLQDATA----RSGQLQRSL----------GM---DARQAIAM------
A0A1Z4NFV0      --TDELNSTQAELAQVTS----QMGQLRSQM----------NI---SSEQAVDI------
B0CAX4          --YQEAAKMQSLLINARA----KSRALRNKL----------GL---TPQQGEDI------
U5DPF5          --DEELVKSQTSLNDTQA----RIQELSAQL----------GL---SSAEALAA------
A0A350Y0P6      --DKKISETKAQLQEKTT----TATELQDKL----------GL---NSQQAIAL------
A0A352X940      --DSKLSQTKSNLEDATA----RSIAIQNQL----------NL---NENEAVAL------
B8HTN4          --ARDLAQAKSLLATAQA----RATGLSQQV----------GM---SIDLARFS------
A0A2A2TPF8      --DKQLNETRGQLAEATS----QQTELRSQL----------KI---KSDRAVDV------
A0A1Z4R0P8      --DKQLNEAQGQLAEVIS----QYQELRSQV----------KI---PSETAVDV------
A0A0T7BUI3      --DEEINQATANLAETLA----QESQVGNQI----------KT---VKNQAIEI------
A0A1Z4LP32      --DDEINQARALLADVSA----QESRVASKL----------DF---STNEAVEI------
K9REP9          --DGEINQARASLAELTA----QESQLASKL----------DF---SANQAVEI------
A0A1Z4SIJ3      --DEQINQSKASLADISA----QEALIASQL----------NM---QSKEAVEV------
A0A2H2XPG4      --DEQINQSKASLADISA----QEALIASQL----------NM---QSKEAVEV------
K9V3C7          --SNKLNEARGQLADVAS----QQAEVRLSA----------NI---PRDRTVTQ------
A0A1Z4T6Y7      --DKQLNEVKGQLAEVTS----QQAELRAQI----------KI---PSNEAVDR------
A0A2H2Y561      --DKQLNEVKGQLAEVTS----QQAELRAQI----------KI---PSNEAVDR------
A0A1Q4S362      --DKQLNEVKGQLAEVTS----QQAELRSQI----------KI---PSSEAVDR------
A0A3S1CIN8      --DKQLNEVKGQLAEVTS----QQAELRSQI----------KI---PSSEAVDR------
A0A2A2TC28      --NEQVSQNQAALADIIA----QETELKKQL----------NL---VGEEAVNI------
A0A0C1NCB0      --DDTINQAQAELAEVSA----EQAKVLNQL----------KL---AGQDAVEI------
A0A2N6K7Q9      --DQEINQVKAALADVSA----QEQQIASQL----------NV---SENQAVTV------
A0A2N6MXH6      --DQEINQVKAALADVSA----QEQQIASQL----------NV---SENQAVTV------
A0A2N6M5A8      --DQEINQVKAALADVSA----QEQQIASQL----------NV---SENQAVTV------
A0A2N6LL61      --DQEINQVKAALADVSA----QEQQIASQL----------NV---SENQAVTV------
A0A0S3TP66      --DQEINQVKAALADVSA----QEQQIASQL----------NV---SENQAVTV------
G6FP91          --DQEINQVKAALADVSA----QEQQIASQL----------NV---SENQAVTV------
A0A1U7GYR5      --DQEINQVKAALADVSA----QEQQIASQL----------NV---SENQAVTV------
A0A2N6KY52      --DQEINQVKAALADVSA----QEQQIASQL----------NV---SENQAVTV------
A0A2N6KMP5      --DQEINQVKAALADVST----QEQQIASQL----------NV---SENQAVTV------
A0A2N6MA45      --DQEINQVKAALADVSA----QEQQIASQL----------NV---SENQAVTV------
A0A4Q9J9V9      --DQEMNQIKAALADVTA----QEAQIASQL----------NV---SENQAVTV------
A0A328IGA1      --DQEMNQIKAALADVTA----QEAQIASQL----------NV---SENQAVTV------
A0A4D9CE41      --DQEMNQIKAALADVTA----QEAQIASQL----------NV---SENQAVTV------
A0A0M0SFT2      --DQEMNQIKAALSDVSA----QEAQIASQL----------NV---SENQAVTV------
A0A1Z4TLC8      --DQEMNQIKAALADVSA----QEAQIASQL----------NV---SENQAVTV------
A0A0C2LFH0      --DEEINQARAALADTSA----QEEKIRSQL----------NL---AGSQAVEI------
A0A1Z4IYV4      --DQEINQARAALADVSA----QEAKMNSQL----------NL---AGDQAVEV------
A0A1Z4Q0T6      --DQEINQARAALADVSA----QEAKMNSQL----------NL---AGDQAVEV------
A0A0C2PT44      --DQEINQARAALADVSA----QEAKINTQL----------NL---AGDQAVEV------
A0A1D2P6J4      --DQEINQARAALADVSA----QEAKINTQL----------NL---AGDQAVEV------
A0A4R4IQ40      --EGQIAQVRAELADANT----KLAKLRQQV----------GM---DADNSLNL------
A0A433W533      --EGQIAQVRAELANANT----KLAKLRQQV----------GM---DTDTSLNL------
A0A2P8QWJ3      --EGQIAQVRAELANANT----KLAKLRQQV----------GM---DTDTSLNL------
A0A2T1FKP8      --EGQIAQVRAELANANT----KLAKLRQQV----------GM---DTDTSLNL------
K9U6L7          --EGQIAQVRAELANANT----KLAKLRQQV----------GM---DTDTSLNL------
A0A3M9ZEU1      --DQQIADTEAELAKMVA----RSSALRNQL----------GM---DSRQAALL------
A0A1Z4JK72      --QDQLNQARSQLADVAR----QEQVVRDQL----------GL---ETGQAIDL------
A0A0N7Z489      --QDQLSQARAQLADVGR----QERAVADQL----------GL---ELGQAIDL------
A0A0S3TXS2      --QDQLSQARAQLADVGR----QERAVADQL----------GL---ELGQAIDL------
A0A1Z4RN12      --ENQIDQVEAELSDINA----RYSRLQSQL----------GM---NWREASAV------
A0A2T1CMF9      --ENQINQVSADLNDVNA----RYNRLQSQL----------GV---SWQEASAI------
Q7NDC5          --RSQQAQADVALSEAGA----RVRAIDARM---------GGL---SEPEALVA------
U5QGK3          --KSEQAQAAVKLAEAQT----RAGAIASRM---------GGL---SEKEALVA------
A0A2W4UY24      --TDSITQLRSDLADKNA----QFAQIQQQL----------RL---NPQEAYAV------
A0A2T1GMT4      --DNNINAVRSELEQANA----QSQELYKKV----------NL---NSQDALAV------
K9UI51          --ENNINAVRSELEQANA----QSQELYKKV----------NL---NSQDALAV------
K9QM62          --DTEINTVKASLNEITA----QSNELRKKV----------GL---DSPQAIAM------
A0A1Z4FWI3      --DNSINATRAELDQATA----QSNELRQKV----------AL---NSQQALSA------
A0A1Z4JYE7      --DNEINAVKAQLADLVA----QRNQLSQQL----------GL---TTQQAIAV------
A0A2T1FXY4      --DNQIDNLKAELDQANT----QTKELRQKV----------GL---NPQQASAV------
A0A4V2X3N2      --DNQIDNLKAELDQANT----QTKELRQKV----------GL---NPQQASAV------
K9TYI2          --DNQIDNLKAELDQANT----QTNELRQKV----------GL---NPQQASTV------
A0A1Z4QL41      --DNEINTIRAQLADFNA----QTDALRQKI----------GL---NSQQAIVV------
A0A252D4T4      --DNGINTAKADLDQATA----QTNELRQKV----------AL---SSQEALSA------
A0A252DJH5      --DNGINTAKADLDQATA----QTNELRQKV----------AL---SSQEALSA------
A0A252EB80      --DNGINTAKADLDQATA----QTRELRQKV----------AL---SSQEALSA------
A0A1Z4HPW5      --DNNINGVRADLDQATA----QTNELRQKV----------NL---NSQEALSA------
A0A1Z4MSN1      --DSNINGVKADFDQATA----QTNELRQKV----------NL---NSQEALSA------
A0A1Z4U1C2      --DSNINGVKADFDQATA----QTNELRQKV----------NL---NSQEALSA------
A0A0D6KV51      --DSNINGVKADFDQATA----QTNELRQKV----------NL---NSQEALSA------
A0A1Z4MKF8      --DSNINGVKADFDQATA----QTNELRQKV----------NL---NSQEALSA------
A0A2C6WC43      --NNEINTVQAQLDEVNA----QTNELRQKV----------NL---SSQNAIAV------
A0A1Z4L5A1      --NTEINTVQAQLDEVNA----QTNELRQKV----------NL---SSQNAIAV------
A0A367QD86      --NNEINTVQAQLDEVNA----QTNELRQKV----------NL---SSQNAIAV------
A0A235IZ96      --DNEMNTVKAQLDEINA----QTNELRQKV----------EL---NSQQAIAV------
A0A2L2NGP0      --DNEMNTVKAQLDEINA----QTNELRQKV----------EL---NSQQAIAV------
A0A2K8SM78      --DNEMNTVRAQLDEVNA----QTNELRQKV----------EL---NSQEAIAV------
A0A2R5FPC0      --DNEMNTVKAQLDEVNA----QTNELRQKV----------EL---NSQEAIAV------
A0A5P8W5T6      --DSEMNTVQAQLDEVNA----QTNELRQKV----------EL---NSQEAIAV------
A0A140KBA0      --DTQIDQVAAELGDVNA----RYTSLSSQL----------GM---NVSEAAAI------
K9XSG1          --DTQIDQVAAQLQDVNA----RYASLSSQL----------GM---GVSEAAAI------
A0A0F5YE28      --NRKITVLESELSGVNA----LAESLQTQA----------GF---DLEEAIAI------
U7QEH7          --NRKITVLESELSGVNA----LAESLQTQA----------GF---DLEEAIAI------
A0A3S1ATK5      --ENEINTVKAQLEDLNG----QTETLRQKI----------AL---NSQQAIAV------
A0A2Z6CPH0      --DNEINAIQAQLAEVNA----QSSELRQKL----------GL---NSQNALAV------
A0A1Z4GT50      --NNEIHTIQAQLDEVNA----QSNELRQKV----------NL---NSPEAITV------
A0A1Z4GIX0      --DNEINTVNSQLAEVTA----QSNELRQKI----------NL---NSQQAIAV------
A0A2H6LC24      --DNEINTVNSQLAEVTA----QSNELRQKI----------NL---NSQQAIAV------
B2J6N5          --DNEMNTVKAQLDEVNA----QTNELRQKV----------EL---NSQEAIAV------
A0A367RMI4      --DNEMNTVKAQLDEVNA----QTNELRQKV----------EL---NSQEAIAV------
A0A235HUM0      --DNEMNTVKAQLNEVNA----QTSELRKKV----------EL---NSQEAIAV------
A0A2L2NW47      --DNEMNTVKAQLDEVNA----QTNELRQKV----------EL---NSQEAIAV------
A0A1E2WUR1      --DNEMNSVKAQLNEVNA----QTNQLRQKV----------EL---NSQEAIAV------
A0A235IKU3      --DNEMNTVKAQLDEINA----QTNELRQKV----------EL---NSQQAIAV------
F4XKF3          --DSQITTVQAQLEEANA----QAAGLRNQV----------GL---NPQQAIAI------
A0A1D9FX10      --DSQITTVQAQLEEANA----QAAGLRNQV----------GL---NPQQAIAI------
A0A1D8TNX9      --DSQITTVQAQLEEANA----QAAGLRNQV----------GL---NPQQAIAI------
A0A1U7MYU6      --DSQITTVQAQLEEANA----QAAGLRNQV----------GL---NPQQAIAI------
A0A3C0NJ41      --EQQITQVQAELQQANA----QTAALQNKV----------GM---NSQEAINT------
A0A352AG88      --DQQITEVKSQFKDANA----RSAELRDQV----------GM---NSQEAIVA------
A0A350Y374      --DEQIAQVQSDLKNINS----QSAALRDKV----------GM---DAQEAIAI------
A0A355DPX0      --DEQIAQVQADLKNINS----QSAALRDKV----------GM---DAQQAIAI------
A0A0D8ZUV2      --ESQINTTEAALANANA----RYATLQQQV----------GM---SSAQAVAT------
A0A433VDI0      --ESQINQSQTALAGANA----RHTSLYKKV----------GM---SSEQAIAT------
A0A3D1PG43      --EDQVTATQAALVQAKT----RSANLQKEI----------GI---NSSDIIAV------
A0A2P8QQ72      --QDQITLAEAALVQTQG----RATKLQKEI----------AL---TSQDVVPI------
K9TZQ7          --QDQITLAEAALVQTQG----RATKLQKEI----------AL---TSQDVVPI------
A0A2G7GPR0      --ENQITETQAQLADTTT----RSATLQQQV----------GM---NPQEGITL------
K9XH68          --ENQITETQAQLADTTT----RSATLQQQV----------GM---NPQEGITL------
A0A1U7HW70      --ENQITETQAQLADTTT----RSATLQQQV----------GM---NPQEGITL------
A0A2S6VEJ8      --ENQITETQAQLADTTT----RSATLQQQV----------GM---NPQEGITL------
                                                                            

K9SLA9          -----S--------SP-SAQ--QLLE--ELQAIEQQIALES----TRYGAEHPSIIDLRA
A0A168TT23      -----G-----------QIA--ELRS--RKAELETEISGLL----QRFMEDYPVIVELRS
A0A0M1JWX9      -----S----VLSEAP-SYQ--SQLS--KLRELENQIAKEL----TRFTINSPQIQTMLE
A0A2T1M1V6      -----L----RLAENK-EYQ--SIRD--KLSATEIELSESR----GIYTDKMPQVKSLLL
A0A2G7GCS2      -----L----RLGENR-EYQ--AIRQ--KLSDAETALAEAR----SRYTDESPQVQSLLS
K9XBH8          -----L----RLAENK-EYQ--ATRQ--QLSEVETALAEAR----SRYTDESPQVQSLLA
A0A1Z4LJ30      -----V----KLKENK-EYQ--LFRD--KLSEVEVALVEAR----GKLTNSHPQIQELVY
K9RI76          -----V----RLKEYK-EFQ--LIRD--KLSQIEVALIEAQ----GKLTSNHPEVQNLLY
A0A352AE27      -----L----GLAENP-DYQ--FIRQ--KLTEVEAKLVEAK----ATYTMENPRVEGLVI
A0A3B8JH60      -----L----GLGENQ-NYQ--FVRNXXKLAEVNANLIRTR----ATFTDNHPTVQKLIS
A0A3C0N766      -----L----GLGENQ-NYQ--FVRN--KLAEVNANLIRTR----ATFTDNHPTVQKLIS
K9W9J7          -----L----GLGENQ-NYQ--FVRN--KLAEVDANLVKLR----ATFTDNHPAVRKLIS
A0A139WSU3      -----L----GLGENK-EYQ--FVRQ--QLSEVEASLRQKQ----AIFTDVHPEVKTLLA
A0A433VN22      -----L----SLSENQ-EFK--AVRK--ELSEVEAKLVQKQ----AIFTINHPEVQTLLA
Q7NF11          -----L----RLGESK-EYQ--AMRL--KLSSLDTALAEAR----GLYTEKHARVQSLLV
A0A1Z4JCS8      -----L----GLDQNE-DYK--ELRS--KLTEVESTLGKLR----STFTDRSPQVQRAIV
F4XTX2          -----L----GLAENR-DYQ--FVRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLL
Q7NJN6          -----L----NLGEDK-GLQ--ALRQ--RLADIESQLAQAR----GLYTGKNLRVKSLEL
U5QCC3          -----L----RVGEDK-EYQ--SLRQ--KLTDIETQLAQAR----GIYTEKNQRIQSLLL
A0A3S0Y9N9      -----F-----ASESP-STS--LVLG--QLKETQQKIEMAR----LRLTDNHPTVINLKE
A0A433UNK7      -----F-----VGESP-STV--AVLG--QLQDVQQKIQVIG----LRLTDTHPTIMDLKK
A0A3M1SVZ4      -----V----IS-QST-TIQ--EARQ--QLQEAEAQLAVEK----TRLTENHPTIIDLQD
A0A654SFI6      -----A---------D-ARN--SLRA--DLAKAEAQLATLN----ANYGPMYPPLVEKAA
K9SSQ0          -----A----ILSQDA-NYQ--ALVK--QFQEAQTNYFLER----ARFQDAYPKVQALRD
A0A2W1JIN9      -----V----RTGQDP-ELQ--NLKS--AVTNLESQVAARR----TELTDSHPIVIQLVQ
A0A318AJV1      -----V----GVQGSN-VIR--DLRS--QRADIVRNLGEVE----GRYGPKHPESIRAHQ
A0A1U7N2U4      -----G----RIGQDQ-ELQ--ALRA--QLVNLERELAKMR----SRLTDQNPAMISLVQ
A0A1D9G1F2      -----G----RIGQDQ-ELQ--ALRA--QLVELDRELAKMR----SRLTDQNPAVISLVQ
F4XV38          -----G----RIGQDQ-ELQ--ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQ
A0A2P8QIL5      -----V----RSGQNE-QLQ--ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIE
A0A2T1FLY5      -----V----RSGQNE-QLQ--ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIE
A0A433W447      -----V----RSGQNE-QLQ--ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIE
K9U1K8          -----V----RSGQNE-QLQ--ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIE
A0A4V6P809      -----V----RSGQNE-QLQ--ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIE
K9UYB2          -----V----RGGQDD-ELK--KLRA--KLAESETKLIEAR----LKFTESNPIVIQLSE
A0A218QN17      -----V----RGGQDE-QLK--TLRA--KLTELNTKLIEAR----LRLTENHPSVIALVE
K9RKN2          -----V----RSGSDE-ELV--KMRA--NLAELEREFVEAR----LRFTFNHPKLIELSQ
A0A2I8ADV2      -----V----RSGQDE-QLR--SLRA--KLTEIETQLIEAR----LQFTDNHPKVVSLLG
A0A1W5CKM3      -----V----REGQDE-QLK--VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQ
A0A5Q0GMF5      -----V----REGQDE-QLK--VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQ
Q3MEW0          -----V----REGQDE-QLK--VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQ
A0A1Z4KIC7      -----V----REGQDE-QLK--VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVE
Q8YSM5          -----V----REGQDE-QLK--VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVE
A0A1Q4S1H4      -----V----RSGQDE-QIK--NLRA--RLTELETQIVALQ----QRFTPEHPELNSLIQ
A0A433VBU6      -----V----RSGQDE-QIK--NLRV--KLTELQTQIVALQ----QRFTPEHPELNSLIQ
A0A1Q4RZJ6      -----V----RGGQDQ-ELQ--KLRA--KLAEQETQLIEAR----LKFTDSHPTVVKMLQ
A0A1Z4SNV3      -----V----RSGQDQ-ELQ--KLRA--KLADQETLLIEAR----LRFTDSHPTVAKLLQ
A0A2H2XJQ1      -----V----RSGQDQ-ELQ--KLRA--KLADQETLLIEAR----LRFTDSHPTVAKLLQ
A0A3S5K358      -----V----RGGQDQ-ELQ--KLRA--KLAEQETQLIEAR----LKFTDSHPTVVKMLQ
A0A0T7BPJ4      -----V----RTGQDE-EVK--KLRS--KLTELEQQVIQAK----LKFTEEHPTVTKLVQ
A0A0C1QS61      -----V----RGGQDE-QLK--ELRT--KLTELETKLAESR----AKYTEDHPDVRSLLY
A0A139X3R8      -----V----RGGQDE-QLK--ELRT--KLTEFETKLAESR----AKYTENHPDVQSLLY
A0A1Z4I7C5      -----V----REGQDE-QLK--ALRT--KLTDIETKLIEAR----TKFKEAHPTVVDLVQ
A0A0C2MDK7      -----V----RSGQDD-EIK--KLRA--KLSELENKIIEAR----LRFTENHPVVANLVG
A0A1Y0RCK1      -----V----RSGQDE-EIK--KLRA--KLSELENKIIEAR----LRFTEEHPNVRNLVG
A0A1Z4PWZ0      -----V----RSGQDD-EIK--KLRA--KLSELENKIIEAR----LRFTEEHPTVTNLVG
A0A0C2QLT0      -----V----RSGQDD-EIK--KLRA--NLSELENKIVEAR----LRFTDEHPNVTNLVG
A0A1Z4J2K1      -----V----RSGQDD-EIK--KLRA--KLSDVENQLIEAR----LRFTDEHPNVTNLVG
A0A3S0ZSX0      -----V----RGGQNE-ELK--MLRA--KLAELEAKVIETR----LYFTENHPTVIKLVE
A0A2N6K4T3      -----V----RGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A370CKT2      -----V----RGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A0S3TL97      -----V----RGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A2N6M8A0      -----V----RGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A2N6M9E1      -----V----RGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A2N6KJI4      -----V----RGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A2N6MZ77      -----V----RGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A2N6KT20      -----V----RGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
G6FSN3          -----V----RGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A4D9CI02      -----V----RGGQDE-ELK--ALRT--KLAEIETNLVEAR----LSLTDSHPTVMNLLG
A0A328I8B9      -----V----RGGQDE-ELK--ALRT--KLAEIETKLVQAR----LSLTDSHPTVMNLLG
A0A4Q9J4Z7      -----V----RGGQDE-ELK--ALRT--KLAEIETKLVQAR----LSLTDSHPTVMNLLG
A0A0M0SU69      -----V----RGGQDE-ELK--ALRT--KLAEIETKLVQAR----LSLTDSHPTVINMLG
A0A1Z4TIZ8      -----V----RGGQDE-ELK--ALRN--KLAEIETKLIQAR----LYLTESHPTVINLLG
A0A0S3TYD7      -----V----ALSQST-GVQ--ETLK--RSQELQNQLAVTL----GRYRAGHPKVTELQR
U5QL42          -----T----ILSQDP-TYT--RLVS--KYKDAEADYVSQR----AKFKDAYKPVGDLKK
K9QF04          -----S----VLGEDP-NYL--ALLE--KLQRVDAKIASES----VKLSDEHPSLIALRE
A0A3C0N2P0      -----S----ALSEAP-RYQ--ALLN--QLSEVESKLAKES----ARLTEDHPTILKLRE
K9TLQ0          -----T----SLSDSP-RYQ--DLLN--RFHEIETKLAQES----TRFTVQSPAMQVLID
A0A076HBF2      --QANS----GLTVSD-VDQ--SLLQ--QLLKVETELAEAR----SRYNPGSSMVLGLEE
A0A354B169      SDNSGK----GLSVGD-VDQ--SLLQ--LLLKVESELAAAR----SKYKPSSSMVQGIEA
G4FMX5          AGGGVQ----GLTISD-VDQ--SLLQ--QLLKVETELAEAR----STYKPNSSMVTGLEE
Q0IDT5          GNQQSQ----GLAVSD-ADQ--SLLQ--QLLKVETELAEAR----SKFVNNSSMVLSLEA
A0A2D6FCW3      AGGDVQ----GLTISD-VDQ--SLLQ--QLLKVETELAEAR----AKYNPDSSMVRGLEA
A3ZA21          -GQSAQ----GLSVSD-ADQ--SLLQ--QLLKVETELAEAR----AKYNPNSSMVLSLEA
A0A140K3H3      -----T----LLSQDQ-VYQ--SLAS--QLKELETQYALGS----VNFYDSYHVMEDIKL
K9XUB8          -----T----LLSQDQ-VYQ--NLTS--RLKELESQYGLGS----VNFHDSYHVMEEFKL
Q7NEU3          -----A----TLSKDG-PYQ--ENLT--QLQKVETQLALEQ----ARFRDDYPAVQSLKS
A0A352XE00      -----S----ALSEAP-RYQ--DLLN--KLSEVETKIAVES----ARFTEESPTIQALRD
B4VS56          -----S----ALSEAP-RYQ--QLLN--QLTEIESKIASES----ARFTEQSPTIQALRE
A0A352AAQ3      -----A----ALSEAP-RYQ--QLLN--QLSEVESKIAAES----ARFTEDSPTIQALRE
A0A350Y472      -----S----ALSEAP-RYQ--DLLN--QLSEVESQIATEL----ARFKEENPAIETLRE
A0A355DVB4      -----S----ALSEAP-RYQ--DLLN--QLSEVESQIATEL----ARFKEENPAIETLRE
A0A2P8VVX1      -----A----RLSQSP-RIQ--SLLN--SLQEAELALADRQ----ILFTDEDPNVQVLKQ
A0A2P8WHY0      -----A----RLSQSQ-RVQ--QLLN--DIQESELALADRQ----LIFTDQDATVQMLRQ
A0A2T1CMT9      -----S----RLSQSP-RYQ--NLLN--NLKQMEQDLATQQ----TKFTNYNPALKSAIE
A0A563VQJ3      -----N----QLGNTP-AVK--STLT--ELSDTEAAIAKER----QRFKDNHPSIVSLQE
A0A1D8TX52      -----S----RLSQSG-RYQ--NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIE
A0A1U7N5X9      -----S----RLSQSG-RYQ--NLLN--EIQRIELALVEQS----RIYTEAHPTIQKLIE
A0A1D9G4T2      -----S----RLSQSG-RYQ--NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIE
F4XP71          -----S----RLSQSG-RYQ--NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIE
A0A2P8QVH5      -----S----RLSQSP-RYQ--SLLD--EIQALDVTLEKLR----VQYRDDYPKVQDLLK
A0A2T1FT70      -----S----RLSQSP-RYQ--SLLD--EIQALDVTLEKLR----VQYRDDYPKVQDLLK
A0A433W4W4      -----S----RLSQSP-RYQ--SLLD--EIQALDVTLEKLR----VQYRDDYPKVQDLLK
K9U5W1          -----S----RLSQSP-RYQ--SLLD--EIQALDVTLEKLR----VQYRDDYPKVQDLLK
A0A2W6ZAV2      SQDKPA----QGTMTT-TTS--SLLG--DLTDLEKQLAEAE----ASFSPTSPQVRSLRS
A0A2G7GMH8      -----S----RLSQSQ-RYQ--NLLN--EIQKTELALAQQR----LRYTDSSPQVELLLS
K9W742          -----S----RLSQST-RYQ--SLLD--EIQKTDLALAEQR----KRFTDDNPTIQKLLF
A0A2T1DWE8      -----A----RLSQSS-RYQ--SLLN--EIQKSELAIAQQR----LRFKAASPYVQQAID
A0A1U7I8L3      -----S----RLSEST-RYQ--TLLS--EIQKIELELAKER----QRFTDSNPVIQNLLE
A0A2T1DJL8      -----A----RLSQSP-RYQ--ALLN--EIQKTEVAIVQQR----LRFK-KGPFIDQLSE
A0A1Z4J9W0      -----A----RLSQSK-QYQ--ALLA--EIQKTEVELAQMQ----TKFTSNTPQVQQLAE
A0A0N7Z5K9      -----S----RLSQSN-QYQ--ALLA--EIQKTEVALAQQQ----TRFTSKTPFVQQLLD
A0A0S3TXC5      -----S----RLSQSR-QYQ--ALLA--EIQKTEVALAQQQ----TRFTAKTPFVQQLLD
K9SA61          -----S----RLSEST-RYQ--ALLN--EIQKTEIELAQQR----LRFKDASPYVQQVID
A0A3D1PBA3      -----S----RLSQSS-RYQ--TLLN--ELQKTELALSQRR----VTFTDEDPQVKKLLE
K9XPB0          -----T----RLNQSS-QYQ--SLLN--KLQQIEIELADKQ----ARFTDDNPVVKDLLA
A0A350Y7Z1      -----S----RLSQSP-RYQ--ALLN--ELQKTELAIAQQR----VKFTDAEPRVEQLLE
A0A352X2A7      -----S----RLSQSP-RYQ--SLLD--ELQKTELALAERR----TRFTDADPSVQKLME
A0A0D8ZYV0      -----S----RLSQSP-RYQ--SLLN--ELQRTDLLLAARR----GTFTDADPGVQKLIE
A0A4R4IUM6      -----S----RLSQSS-RYQ--TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLE
A0A2T1FP73      -----S----RLSQSS-RYQ--TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLE
A0A433VMS2      -----S----RLSQSS-RYQ--TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLE
K9TYA7          -----S----RLSQSS-RYQ--TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLE
A0A2P8QUE1      -----S----RLSQSS-RYQ--TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLE
A0A2T1DNG3      -----A----RLNQSG-RYQ--AVLN--EIQKTELAIQQQR----VRFKENTLNMQPLLD
A0A2P8W9H0      -----A----LLNSNR--YQ--ALLN--QLLEVDSQLAADL----TLYLENSPEIEVVES
A0A1Z4LN32      -----S----SLSQVK-GVQ--EVLS--ELQKVQTELTTLK----TRMTNAHPSILDLQD
A0A2I8A9F5      -----S----SLSQAA-GVQ--DAFI--ELQKIQTQLKIQQ----TRYTDANPIVINLKN
A0A218Q6R8      -----T----SLSQES-GVQ--EVLG--ELQKVQTNLAIQQ----TRYTDQNPHIANLKN
A0A218QGE0      -----T----SLSQVP-RVQ--GLLA--ELQKVETQLAALK----ARYTERHPAIVDLES
B8HNB0          -----S----VLLQDS-NYQ--KLTT--RLQEVELSLAQQS----LTLQNNHPTIENLRA
A0A563VS48      -----A----TLSQSL-AVQ--TIYE--RLQQVKVELASTR----NYLSNNAPQVISLQE
A0A318BJ18      -----E----ALRN--------QAIN--NLRQRRAELSAEYQRLMVQFEPGYPAALAIQN
A0A3B8Y8H9      -----T----ALSESP-RYM--NLLE--KLREVDTKLAEES----TRFTEDNPTIKKLRQ
A0A2W1JVB9      -----T----TLSQSP-GVQ--VVLQ--QLQEVEGQLAVEG----TRLTPENPILQDLQE
A0A1Z3HMQ0      -----D----SLSQSP-GVQ--RILE--DLQAVQTELASQR----SRYTASHPLIANLER
A0A1E5QP61      -----N----TLSQSA-AIQ--QVLT--EYQKVQDQLAVQR----TRYQSQHPIITNLER
A0A3M2GIL5      -----G----AIGESM-AVQ--NLFR--ELQQVENDLAVQR----TRYQSKHPIIANLTR
A0A433NM31      -----N----ALSQSA-GVQ--KALA--DYQEVESKLANER----SRYQENTPVIADLKL
A0A3M1PML8      -----A----ALSQSP-GVQ--EALT--QLQLAQQELAVER----TRYTEDHPAIANLQR
A0A352X442      -----N----SLNQSA-GVN--QALA--ELQKVQSQLAVER----GRFLEEAPIVQKLKE
A0A0T7BPZ0      -----T----ELSKEP-RTQ--QMLT--QLREAETKLAVEQ----NRYLPGHPTLVNLQE
A0A0M0SHU3      -----V----DLSQVA-GTQ--QVLK--ELQEAQTKLTVAR----TRYLPGHPTVSNLEE
A0A1D2PBN3      -----T----SLSQTP-GIQ--QVLT--QLQEAQSQLAVER----TRLQPEHPIVINLEE
A0A0C2LVR7      -----T----SLSQTP-GIQ--QVLT--QLQEAQSQLAVER----TRLQPEHPIIINLEE
A0A1Z4PQB9      -----T----SLSQTP-GIQ--QVLT--QLQEAQSQLAVER----TRLQPEHPIIINLEE
A0A1Z4SFN6      -----A----SLSQIP-GIQ--QVLT--QLQEAQNQLTIEQ----TRLQPGHPTIINLEE
K9PGI8          -----A----SLSQIP-GVQ--QVLT--QRQEAQSQLAIEL----IRLRPNHPTIINLKE
A0A563VLD6      -----T----VLSQDG-VYR--KLAT--QLSGLETQYLLNS----TNFKDTFPIMQDLKD
A0A318BG22      -----D----SLPEVRDNVQIAALTG--QLATLEADYQQKR----QTYKPGYAPMEALAA
A0A2T1E9V8      -----A----SVSQSS-AVQ--GVIK--ELQEVQRKLANAR----SLYKDDHPIIVQFKE
A0A3M2GQQ6      -----S----LLSQDS-VYQ--QLAS--ELKAVEAQYTLEA----SRFYETHPVVKNLAI
K9SGJ5          -----A----ILAEDI-TYQ--NLVK--QFQEAETHYYLER----TRFQDDHPEVQVAKD
L8MYT6          -----A----ILQQDP-TYQ--SLVK--QFQDVETNYFLER----TRFREDYPSVLALKD
A0A352JGJ6      -----V----ILQQDT-PYQ--SLVK--QFREVETNYFLER----TRFREDHPTVQALKD
A0A1J5GLS2      -----A----ILQQDI-PYQ--SLVK--QFQEVETNYFLER----TRFREDHPNVLALKD
A0A2W4W6M5      -----A----ILQQDI-PYQ--SLVK--QFQDVETSYFLER----TRFREDHPNVQALKD
A0A2W7AN33      -----A----ILQQDA-PYQ--SLVK--QFQEVETNYFLEQ----TRFRGDHPSVIALKD
A0A256BLV2      -----A----ILQQDT-PYQ--SLVK--QFQEVETNYFLER----TRFREDHPTVIALKD
A0A2W6ZXF3      -----A----ILQQDV-PYQ--SLVR--QFQEVETNYFLER----TRFREDHPNVLALKD
A0A2Z5WX66      -----A----ILQQDT-PYQ--SLVK--QFQETETNYFLER----TRFREDHPTVKALKD
K9W1T3          -----A----SVGESP-TTQ--KLLS--NLQDIQEKLATER----TRFQEGHPVIEDLKS
A0A1Q4RTR1      -----N----ALSQSK-AVQ--QLLD--EFRSTQNKLAVER----IRFSDEHPTIIDLAD
A0A1Z4SQV2      -----N----TLSQST-AVQ--PLLN--EFRSSQDKLAVER----TRYSDEHPIIIDLAN
A0A2H2XGN1      -----N----TLSQST-AVQ--PLLN--EFRSSQDKLAVER----TRYSDEHPIIIDLAN
A0A433UXH8      -----Y----SLSQST-AVQ--QLLN--EFRSSQDKLAMER----TRYSDEHPIVIDLAN
A0A1Z4RMB9      -----N----QLGASP-EVQ--SILD--QLAQTESDLSKER----QRFNDAHPSVVSLNA
K1XF69          -----N----TLSQSP-VVR--AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKG
B5W297          -----N----TLSQSP-VVR--AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKG
H1W7M8          -----N----TLSQSP-VVR--AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKG
A0A5Q4H6A5      -----N----TLSQSP-VVR--SALQ--ELENVEGELAQEQ----RRFRDENPRIISLKG
D5A466          -----N----TLSQSP-VVR--SALQ--ELENVEGELAQEQ----RRFRDENPRIISLKG
B4WP72          -----N----TLSQSP-GVQ--EVLT--ELQAVQSQLAIEQ----ARYQSTHPAVLNLQR
A0A318B4H2      -----A----SVSPNS-ASQ--GTIA--SLRQKRAELSARYSALLTKFEPGYPEAEALRT
B4WQE3          -----S----ALAQSA-RYQ--SLLD--QLLVVDSELADNL----TVYVEDSPEVEVIEE
A0A2P8W4F7      -----A----NLNESP-TYQ--ALLG--DLRELEQTIAAES----ARFQTDTPMIEALED
A0A5Q4E0Z4      -----A----NLNESP-TYQ--SLLG--DLRAIEQTIAAES----ARFQSDTPMIGALED
A0A2K3BR24      -----G----ALSQSE-AVQ--KVLT--EYQAVEQELTLKR----SRYQPEHPIIKRLEE
K9YXY1          -----G----ALSQSE-AVQ--KVLT--EYQAVEQELTLNR----SRYQPEHPIIKRLEE
U5QJM6          -----A----TLSEDK-IYQ--DVLK--QYQDTETQLALEK----TRFRDDYPTVQNLKD
K9SX01          -----T----KLSASK-PVQ--ETLS--DLQKIDSQLVTLR----ATYTDNYPTITVLME
A0A4P7ZT55      -----S----GALASG-AFS--QLLA--DLTDVEKQLAEAS----GTFRSSSPLVRSLTA
A0A1E5QIR9      -----S----ALSQSE-GVQ--KAIA--ELQAIENRLELER----SRFLDEAPIIIDLET
A0A1Z4IBC7      -----S----ELSQAP-GVQ--KVLA--ELQETQSKLAIER----TRFEPEHPAITALEE
A0A1W5CPC7      -----S----ELSQAP-GVQ--KVLA--ELQETESKLAVER----TRFESEHPAITSLEE
A0A5Q0GKD1      -----S----ELSQAP-GVQ--KVLA--ELQETESKLAVER----TRFESEHPAITSLEE
Q3MDC6          -----S----ELSQAP-GVQ--KVLA--ELQETESKLAVER----TRFESEHPAITSLEE
A0A1Z4KM73      -----S----ELSQAP-GVQ--KVLA--ELQEAESKLAVER----TRFEAEHPAITSLEE
Q8YNX7          -----S----ELSQAP-GVQ--KVLA--ELQEAESKLAVER----TRFEAEHPAITSLEE
A0A367R4K6      -----S----ELSQAP-GVQ--KVLA--QLQEAESQLALER----TRFQSGHPTIINLEG
A0A1E2WSV8      -----S----DLSQAP-GVQ--KVLI--QLQETESQLALER----TRFEPEHPTITNLEE
A0A2R5FRT9      -----S----ELTQAP-GVQ--KVLA--QLQETESQLALER----TRFSPEHPTITNLQE
A0A2K8T1B6      -----S----ELTQAP-GVQ--KVFA--QLQDTESQLALER----TRFSPEHPTITNLQE
A0A235I9I0      -----S----ELSQAP-GVQ--KVLA--ELQETESKLAIER----TRFSPEHPTITNLEE
A0A2D0HQT8      -----S----ELSQAP-GVQ--KVLA--QLQETESQLALER----TRFSPEHPTITNLEE
A0A2L2NU95      -----S----ELSQAP-GVQ--KVLA--QLQETESQLALER----TRFSPEHPTITSLEE
A0A367S084      -----S----ELSQAP-GVQ--KVLA--QLQETESQLALER----TRFSPEHPTITNLEE
A0A0V7ZFJ4      -----S----TLNQSP-IVQ--EALT--QYQKVQDELAVAQ----TQFTSEHPMVISLLG
A0A367RIS1      -----S----TLSQSR-AVQ--EVLS--EYQKVQDLLAVER----SRFTDGHPVITSLLS
A0A235IXQ2      -----S----SLSQSR-AVQ--QVLS--EYQKVQDQLTVER----SRFTDEHPVITNLLS
A0A1W5CNX3      -----S----SLSQSN-AVQ--QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLN
A0A5Q0GJJ5      -----S----SLSQSN-AVQ--QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLN
Q3MEB7          -----S----SLSQSN-AVQ--QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLN
A0A1Z4KHN9      -----S----SLSQSN-AVQ--QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLN
Q8YT70          -----S----SLSQSN-AVQ--QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLN
A0A218Q4C1      -----S----TLSQSR-AVQ--QVLL--EYQKVQDQLAVER----SRLTDEHPVVVNLLN
A0A166IWU6      -----S----TLSQSR-AVQ--QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLN
A0A2S0Q8C0      -----S----TLSQSR-AVQ--QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLN
W6FSX4          -----S----TLSQSR-AVQ--QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLN
A0A0V7ZNJ9      -----S----ELSQSP-AVQ--QALQ--EYQKVQDRLAVAR----TRLTNQHPTVIDLSN
A0A0R0M9H9      -----S----NISQIP-GVQ--QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQL
A0A1S1ZVW2      -----S----SLSQIP-GVQ--QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQL
A0A1B7WX82      -----S----TLSQSP-GVQ--QVLT--EYQKTQYDLAIAR----TLYTNDNPKVVDLIM
A0A1B7WTD1      -----S----SLSQSP-GVQ--QVLT--EYQKTQHELAIAR----TLYTNDNPKVVDLLL
A0A480ABC0      -----S----SLSQSP-GVQ--QVLT--EYQKTQHDLAIAR----TLYTNDNPKVVDLLL
A0A1Z4LRU5      -----S----SLSQSP-AVQ--QVLT--EFQKTQKELAVAR----TKLTDQHPTVINLSK
A0A1Z4JVB4      -----T----TLSQSP-GIQ--SVLK--EYQKAEDDLAVAK----TRYTNDNPTIINLEQ
K9PIA4          -----N----TLNESP-GIQ--QVLT--EYQKVQDELAVAR----TRYTNNNPNILNLVE
A0A1Z4M597      -----T----TLSQSP-GVQ--QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLEN
A0A1Z4MWT1      -----T----TLSQSP-GVQ--QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLEN
A0A1Z4TX53      -----T----TLSQSP-GVQ--QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLEN
A0A1Z4HVE1      -----S----TLSQSP-GVQ--QVLT--DYQKTQDELAVAR----TRFSDEHPLVINLDK
A0A252ECZ1      -----S----TLSQSP-GIQ--QVLT--DYQKTEDELAVAR----TRFSDEHPTVINLDK
A0A1Z4G5Y1      -----S----TLSQSP-GIQ--QVLT--EYQKAEDELAVAR----TRFSEEHPIVINLAQ
A0A252DNA2      -----S----TLSQSP-GIQ--QVLE--EYQKAEDELAVAR----TRFSEEHPIVINLDK
A0A252E1Q4      -----S----TLSQSP-GIQ--QVLE--EYQKAEDELAVAR----TRFSEEHPIVINLDK
A0A5P8VSD1      -----T----SLSQSI-AVQ--QVLL--EYHKVQDLLAVER----SRLTDEHPVITSLLN
A0A2A2TNQ5      -----S----TLSQTP-GIQ--QVLA--EYQKVQDDLAVAR----SRFTEEHPSVRNLVA
A0A3S1C4K5      -----A----NLNQST-GVQ--QVLA--EYQKAQDELAVLQ----TRFTAEHPKVRDSEA
A0A1X4G3D5      -----S----TLSQIP-GVQ--EVLK--EYQKNEQELAVAQ----TTYTNDNPKVVSLTA
D4TNI2          -----S----TLSQIP-GVQ--EVLK--EYQKNEQELAVAQ----TTYTNDNPKVVSLTA
A0A1Z4H6Z8      -----S----TLSQSP-GIQ--QVLK--EYQKAEDEVAVAR----TRLTDDNPTLINLEQ
A0A1Z4NPM1      -----S----TLNQSQ-GVQ--QVLA--EYQKTQDELAVAK----TRLTNDHPTVINLTE
A0A3F3KPR9      -----S----NISQIP-GVQ--QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQL
D4TGN7          -----S----NISQIP-GVQ--QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQL
A0A1Z4UZW9      -----S----SLSQSP-GVQ--QVLT--EYQKTQSELAIAR----SLYTNDNPKVVDLVM
A0A0K2M5H0      -----S----TLSQSP-GVQ--QVLT--EYQKTQSELAVAR----SLYTGDNPKVVDLVM
A0A1B7VSH4      -----S----TLSQSR-GVQ--QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVM
A0A1B7W126      -----S----TLSQSR-GVQ--QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVM
A0A3D4C6Q6      -----S----TLSQSR-GVQ--QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVM
A0A1B7UVJ4      -----S----TLSQSP-GVQ--QVLT--EYQKTQYDLAIAR----TLYTNDNPKVVDLIM
A0A1B7UTR1      -----S----ALSQSP-GVQ--QVLT--EYQKTQYDLAKAR----TLYTSDNPKVVNLVM
A0A5C0DRW9      -----S----ALSQSP-GVQ--QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLLM
K7W0A4          -----S----ALSQSR-GVQ--QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLVL
A0A1U7HGH0      -----A----TISQSS-AIQ--GVLA--ELQTVQRQIADAR----SRYRDDHPILDSLQE
K9XJD3          -----A----KISQSS-AIQ--GILT--ELQTVQRQITDAR----SRYRDDHPILDSLQE
A0A2T1CIL7      -----S----SLSQS--AVP--QLIS--ELQQVRIDLIEQR----DRFSDNAPQVNSLVK
A0A1Z4RPC6      -----N----QLGSTP-QVQ--SILD--QLATTETELAQER----QRFNDNHPTVISLND
A0A2T1CMZ0      -----V----QLGNTP-QVQ--SILD--QLSTTETELSQER----QRFKDNHPAVISLQE
L8M4F7          -----D----QLGSTP-VVK--SIID--EMTRTENQLIQER----RRFKEDHPNIVSLQG
A0A140K2P2      -----N----QLGASP-VVD--GLLK--EMATVESELAKEK----QRFLDNHPSIQSLEE
K9XWX4          -----N----QLGASP-VVD--GLLK--EMATVESELAKER----QRFLDNHPSIKSLEE
A0A140KB14      -----N----QLGGTP-VVE--SIFK--DLADVETELAQQR----QRFRDNHPMIQSLLE
K9XX88          -----N----QLGGTP-VVE--SIFK--DLADVETELAQQR----QRFRDNHPMVQSLLE
A0A563VSV6      -----S----QLGNSP-TVQ--SILT--ELGNTEIELAQER----QRFKDSHPSISSLLE
L8LZE9          -----N----QLGRTP-IVQ--SIVT--ELGNTESQLSQER----QRFNDNHPEIVSLLD
A0A433V7A0      -----S----TLSQSA-GVQ--DILK--KIQQVQSELAVQQ----TRLSNDHPSINNLKK
A0A1Z4NDS1      -----S----SLSQIP-GIQ--KVLS--QLQEVQSQLALQQ----TRFHPEHPSIQDLQA
K9F4D9          -----G----LVSESP-GIQ--TVLE--QLQTVQSDLTLAR----TRYRDEHPEIITLRN
U9VXM0          -----G----LVSESP-GIQ--NALE--QLQTVQSDLALAR----TRYREEHPEIVTLRN
A0A2T1FTR8      -----G----LVSESP-GLQ--KSLK--ELQEVEAKIATER----TRFSDNDPSILNLKE
K9UA41          -----G----LVSESP-GLQ--KSLK--ELQEVEAKIATER----TRFSDNDPSILNLKE
A0A0C2LBE2      -----S----SLTQAS-GIQ--QVLT--QLQEAQSQLAVER----SRLKPEHPIIVNLEE
A0A433NN38      -----A----ELSQIP-GTQ--QLLS--QLQKTQADLEVAR----TRFQPEHPQIVNLEE
A0A2N6K0T2      -----V----NLSQVP-GTQ--KVLT--ELQEAQSQLTVAR----TRYQPGHPTVIDLEE
A0A2N6ML72      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVVNLEE
G6FQZ6          -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A2N6MQX9      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A2N6KXT6      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A2N6KGB9      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A2N6L3Y5      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVVNLEE
A0A0S3TIS7      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A1U7GW28      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A2N6LW63      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A328IH74      -----V----DLSQVA-GTQ--EVIK--ELQEAQTELAVAR----TRYLPGHPTVSQLAE
A0A4D9CIB0      -----V----DLSQVA-GTQ--EVIK--QLQEAQTELAVAR----TRYLPGHPTVSQLAE
A0A1Z4TQ63      -----V----DLSQVA-GTQ--QVLK--ELQEAQTELTVAR----TRYLPGHPTVSNLEE
A0A4Q9J8G2      -----V----DLSQVA-GTQ--EVIK--ELQEAQTDLAVAR----TRYLPGHPTVSQLEE
A0A1Z4SMD6      -----A----SLNQIP-GVQ--EVLS--ELQKAQTQLAVQR----TRYTEDHPSITSLKN
A0A2H2Y096      -----A----SLNQIP-GVQ--EVLS--ELQKAQTQLAVQR----TRYTEDHPSITSLKN
K9S8M8          -----N----AVGESP-AVQ--QALS--ELQQIEDELAVAR----TRYQEQHPTIAGLRR
A0A1Z4NFV0      -----S--------TP-GVQ--DAIT--ELQKLQRQLANER----SRYTEFHPKILNLKQ
B0CAX4          -----N----ALSQST-VVQ--QALA--DYQENERELAEAL----KVFQPTHPTVLDLKE
U5DPF5          -----S----ALTQSR-AVR--DALE--SYQSIESELAVAE----SRYQPQHPAIVSLVE
A0A350Y0P6      -----N----KLNQSR-AVQ--QALI--ELEQVQEQLNIEG----TRFQNEAPIIVSLKE
A0A352X940      -----N----SLSQSR-AVQ--QILV--DIEQIEAQLTVQR----TRYQEEHPIIQNLKR
B8HTN4          -----N----AVSQSK-GVQ--VVLD--QYQQVEAELAVAR----TELQPDHPKIKTLEE
A0A2A2TPF8      -----A----SLSLIP-GVQ--EVLG--ELQKVQSKLATAQ----SRYTSTHPSIANLKE
A0A1Z4R0P8      -----A----SLSLIP-GVQ--EVLS--ELQKVQTKLATEK----SRYNSTHPSVINLEE
A0A0T7BUI3      -----T----SLNQIP-GVQ--EVLS--ELQKTQSRLALER----VKYTNNHPNVVYLEN
A0A1Z4LP32      -----T----SLNQIS-GVQ--EVLT--ELQKVQTELAAER----ANYTQIHPLIRKLES
K9REP9          -----T----SLNQIS-GVQ--EVLG--ELQKVQTQLASER----ANYTSAHPLIRKLEN
A0A1Z4SIJ3      -----A----SVSQMS-GVQ--DVLS--ELQKVETKLAAER----GRYTNQHPSIVYLKN
A0A2H2XPG4      -----A----SVSQMS-GVQ--DVLS--ELQKVETKLAAER----GRYTNQHPSIVYLKN
K9V3C7          -----TVNVSSLSVNP-GVQ--GTLA--ELQKVENNLAVAR----ARYTENSPIVMDLRE
A0A1Z4T6Y7      -----T----SLSLIP-GVQ--ESLG--ELQKIQSQLATEA----TTYTSNHPKIISLRQ
A0A2H2Y561      -----T----SLSLIP-GVQ--ESLG--ELQKIQSQLATEA----TTYTSNHPKIISLRQ
A0A1Q4S362      -----T----SLSLIP-GVQ--EALG--ELQKVQTQIATQR----ALYTSDNPIMITLRE
A0A3S1CIN8      -----T----SLSLIP-GVQ--EALG--ELQKVQSQIATQQ----ALYTSDNPIMITLRE
A0A2A2TC28      -----T----SLSQIP-GVQ--EVLG--EQQKVQAKLATLK----ARYTDEHPAIADLKS
A0A0C1NCB0      -----T----SLNQIP-GVQ--DVLT--ELQKVQTKLANER----ARYTEKHPSVVNLEN
A0A2N6K7Q9      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A2N6MXH6      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A2N6M5A8      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A2N6LL61      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A0S3TP66      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
G6FP91          -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A1U7GYR5      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A2N6KY52      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A2N6KMP5      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A2N6MA45      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A4Q9J9V9      -----A----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEKNPIIIDLKN
A0A328IGA1      -----A----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTERNPIIIDLKN
A0A4D9CE41      -----A----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTERNPIIIDLKN
A0A0M0SFT2      -----A----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEQHPIITDLKN
A0A1Z4TLC8      -----A----SLSQIP-GVQ--EVLT--ELQKIQTKLANAR----AIYTEQHPTITDLKN
A0A0C2LFH0      -----T----SISQIP-GVQ--EVLT--ELQKVQTKLANER----ARYTSEHPAITELKN
A0A1Z4IYV4      -----T----SISQIP-GVQ--EVLS--ELQKVQTKLANEK----ARYTSEHPDIAELKN
A0A1Z4Q0T6      -----T----SISQIP-GVQ--EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKN
A0A0C2PT44      -----A----SISQIP-GVQ--EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKN
A0A1D2P6J4      -----T----SISQIP-GVQ--EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKN
A0A4R4IQ40      -----N----ALNQSR-GVQ--RVLT--EYQKTEAELAQLR----TRYAETYPGISNLQQ
A0A433W533      -----N----ALNQAR-GVQ--RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQ
A0A2P8QWJ3      -----N----ALNQAR-GVQ--RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQ
A0A2T1FKP8      -----N----ALNQAR-GVQ--RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQ
K9U6L7          -----N----ALNQAR-GVQ--RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQ
A0A3M9ZEU1      -----A----SLSQTP-GVQ--EVLS--QYQNVQSQLAIEQ----ARYRSSHPTVANLQR
A0A1Z4JK72      -----A----SLSQSP-GVQ--EALS--QLQQVQTRLVTEQ----ARFKSTTPQIQTLQQ
A0A0N7Z489      -----A----SLSQSA-GVQ--DVLS--QLQTVESRLVTES----SRFKDTTPQIQTLKQ
A0A0S3TXS2      -----A----SLSQSA-GVQ--DVLA--QLQSVESRLVTEQ----ARFKDTTPQIQTLKQ
A0A1Z4RN12      -----S----ALSQSP-GVQ--RALS--QLQDVKVALAQKQ----AFLSNNAPQIVSLKQ
A0A2T1CMF9      -----S----SLSQSI-SLQ--ETLA--QLQKIKVELAQKS----NVLSDSSPQIISLKE
Q7NDC5          -----G----ALSGSD-GMR--DLRK--TLLEIESKLAVAR----AQYQDSYPEVEQLIK
U5QGK3          -----G----ALSSSD-GMS--ELRK--DLVEVESKLALAR----AQYQDNYPDVDRLIK
A0A2W4UY24      -----G----LVSESP-GVQ--EVIT--TLQAVQSQLAIAL----TRYREGHPEIASLRS
A0A2T1GMT4      -----S----AISQSP-AIQ--GILT--QLQDVDRQLATES----SRFSDDNPIIVSLKE
K9UI51          -----S----AISQSP-AIQ--GILT--QLQDVDRQLATES----SRFSDDNPIIVGLKE
K9QM62          -----S----TLSQSP-AVQ--GALT--QYQDIERQLATER----SRFSEAHPTIVNLEA
A0A1Z4FWI3      -----S----AVSQSP-AVQ--GIVT--QLQDVERQLATER----SRFQDENPVIINLEA
A0A1Z4JYE7      -----T----TLSQSP-AVQ--GILS--QLQELERQLANER----SRFTDDNPIIVSLEA
A0A2T1FXY4      -----S----ALSQSP-AVQ--GVLI--QLQDTERQLASQR----SRYLNNNPIIVDLEA
A0A4V2X3N2      -----S----ALSQSP-AVQ--GVLI--QLQDTERQLASQR----SRYSDNNPVIIDLTA
K9TYI2          -----S----ALSQSP-AVQ--GVLT--QLQDTERQLASQR----SRYLNDNPIIVDLEA
A0A1Z4QL41      -----S----SLSNSP-AIQ--AILT--QLQEIDRQLAVER----SRFLDENPVIINLEA
A0A252D4T4      -----S----TLSQSP-AVQ--GILT--QIQEVDRQLATER----SRFQEENPVIVNLVA
A0A252DJH5      -----S----TLSQSP-AVQ--GILT--QIQEVDRQLATER----SRFQEENPVIVNLVA
A0A252EB80      -----S----TLSQSP-GVQ--AILT--QLQEVDRQLATER----SRFQDENPVIVNLVA
A0A1Z4HPW5      -----S----AVSQSP-AVQ--GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQ
A0A1Z4MSN1      -----S----AVSQSP-AVQ--GILT--QLQDIDRQLASER----SRFLDDNPVIVNLEQ
A0A1Z4U1C2      -----S----AVSQSP-AVQ--GILT--QLQDIDRQLASER----SRFLDDNPVIVNLEQ
A0A0D6KV51      -----S----AVSQSP-AVQ--GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQ
A0A1Z4MKF8      -----S----AVSQSP-AVQ--GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQ
A0A2C6WC43      -----S----ALSQSP-AVQ--GILT--QLQDIERQLASER----SRFQDDNPAIINLEA
A0A1Z4L5A1      -----S----ALSQSP-AVQ--GILT--QLQDIERQLASER----SRFQDDNPAIINLEA
A0A367QD86      -----S----ALSQSP-GVQ--GILT--QLQDIDRQLASER----SRFQDDNPAIINLEA
A0A235IZ96      -----S----ALSQSP-AVQ--GVLV--QLQETDRQLAIER----SRFLDDNPVIINLEA
A0A2L2NGP0      -----S----ALSQSP-AVQ--GVLV--QLQETDRQLAIEH----SRFLDDNPVIINLEA
A0A2K8SM78      -----S----ALSQSP-AVQ--GVLT--QLQDTDRQLAIER----SRFLDDNPVIINLEA
A0A2R5FPC0      -----S----ALSQSP-AVQ--GVLA--QLQDTDRQLAIER----SRFLDDNPVIINLQA
A0A5P8W5T6      -----S----ALSQSP-AVQ--GVLT--QLQDTDRQLAVER----SRFLDDNPVIINLEA
A0A140KBA0      -----S----SLNQSV-AVQ--KALT--QLQNVKVELASKR----NLFGENAPQIISLKE
K9XSG1          -----S----SLNQSV-AVQ--KALT--QLQDVKVQLATKR----NLFGENAPQIISLKE
A0A0F5YE28      -----N----TLSQSP-VLI--GILT--ELENVESELVNER----KRFKDQNPRIIALKQ
U7QEH7          -----N----TLSQSP-VLI--GILT--ELENVESELVNER----KRFKDQNPRIIALNQ
A0A3S1ATK5      -----S----SLNNSP-AIR--EIVI--QLHEIERQLATER----SRYFDNNPVIISLEA
A0A2Z6CPH0      -----S----ALSQSP-AVQ--GVLT--QLQDVERQLANER----SRFLDDNPVIVGLEA
A0A1Z4GT50      -----M----AISQSP-AIQ--GILA--QLQDLERQLATER----SRFYDDNPVITNLEA
A0A1Z4GIX0      -----S----TLSQSP-AVQ--GVLT--QLQEVERQLANER----SRFLDDNPIIVSLEA
A0A2H6LC24      -----S----TLSQSP-AVQ--GVLT--QLQEVERQLANER----SRFLDDNPIIVSLEA
B2J6N5          -----S----ALSQSP-AVQ--GVLT--QLQETERQLAIER----SRFLDDNPVIINLEA
A0A367RMI4      -----S----ALSQSP-AVQ--GILT--QLQETDRQLAVER----SRFLDDNPIIINLEA
A0A235HUM0      -----S----ALSQSP-AVQ--GILT--QLQETDRQLAVER----SRFLDDNPIIINLEA
A0A2L2NW47      -----S----ALSQSP-AVQ--GILT--QLQETDRQLAVER----SRFLDDNPIIINLEA
A0A1E2WUR1      -----S----ALSQSP-AVQ--GVLT--QLQETDRQLAVER----SRFLDDNPVIINLEA
A0A235IKU3      -----S----ALSQSP-AVQ--GVLV--QLQETDRQLAIER----SRFLDDNPVIINLEA
F4XKF3          -----S----ALSQST-SVQ--GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTK
A0A1D9FX10      -----S----ALSQST-SVQ--GVLQ--ELQEVERQLAVSK----NRYGKNHPVMIRLTK
A0A1D8TNX9      -----S----ALSQST-SVQ--GVLQ--ELQEVERQLAVGR----NRYGKNHPIMIRLTK
A0A1U7MYU6      -----S----ALSQST-SVQ--GVLQ--ELQEVERQLAVGN----NRYGKNHPVMIRLTK
A0A3C0NJ41      -----T----ALSQSA-GVQ--EVLK--QYQDIQAQLTLQR----TRFLDDSPVIVSLKE
A0A352AG88      -----S----SLSQSP-GVQ--QVLQ--EFQQVQSKLRVEQ----TRFQDEDPTIISLKE
A0A350Y374      -----T----SLNQSP-GVQ--DILK--EFQKVQADLTIQR----TRFQEADPTIISLKQ
A0A355DPX0      -----T----SLNQSP-GVQ--DILK--EFQTVQADLTIQR----TRFQEADPTIISLKQ
A0A0D8ZUV2      -----N----SLNQAG-GIQ--KLLE--ESQQLEDRLATER----TRLQEDHPTIVNLKL
A0A433VDI0      -----N----SLNQSS-GVQ--KTLE--ELRQVEDQLVVQR----TRLQEDHPAIVNLEL
A0A3D1PG43      -----N----SLNQPAGGAQ--KVVA--ELQQVEADLVVLQ----TRFLDGHPKIAELQN
A0A2P8QQ72      -----N----SLKESP-GIQ--KTLA--ELQRVEGDLVVLQ----TRFEDTYPEVQKLQQ
K9TZQ7          -----N----SLKESP-GIQ--KTLA--ELQRVEGDLVVLQ----TRFEDTYPEVQKLQQ
A0A2G7GPR0      -----T----SLNQSP-GIQ--KVLT--EYQQVEAELAVQQ----TRFVGEHPTILGLQE
K9XH68          -----T----ALNQSP-GIQ--KVLA--EYQQVEAELAVQQ----TRFVGDHPTLLSLTE
A0A1U7HW70      -----T----ALNQSP-GIQ--KVLA--EYQQVEAELAVQQ----TRFVGDHPTLLGLTE
A0A2S6VEJ8      -----T----ALNQSP-GIQ--KVLQ--EYQQVEAELAVQQ----TRFVGDHPTILSLTE
                                                                            

K9SLA9          QREALQVVLQGRVGEDLLEN---------------------LT------TQNL-------
A0A168TT23      QINEIDTQIRERADTII-GN----------------------------------------
A0A0M1JWX9      QRQQLEGMLSQEAQRAL-GR---------------------EIVTVARVPEAQ-------
A0A2T1M1V6      KRDELRREANRQMAQVLPGV-------------SSSQ-VDVTL-GDSSTDSRT-------
A0A2G7GCS2      QRDELMQIMNQQIAIAAPGA-------------SANQ-IDPTLGGNGTRDSRI-------
K9XBH8          RRQQLMQTMNQQLAVALPNA-------------ASNQ-VDPTLSGSGTRDSRI-------
A0A1Z4LJ30      QQRVLRSQLRQYLANTSSVA-------------G----VDTSVGQNT-----A-------
K9RI76          QRSVLRQQLNQFIAASRANA-------------GG---VNPAIGENT-----A-------
A0A352AE27      QRDELQRQLQQYITQAAGDA--------------S---IDTTMTGER--QGRA-------
A0A3B8JH60      ERDDLQRQLQGYIAQSAAGT--------------R---VDTTVSTNN--EGRA-------
A0A3C0N766      ERDDLQRQLQGYIAQSAAGT--------------R---VDTTVSTNN--EGRA-------
K9W9J7          ERDELQRQLQGYVAQAAAGT--------------Q---VDTTVSTNS--DGRA-------
A0A139WSU3      QRESLQRKIQEHIRQTSAGT--------------K---VDTTVATDS--QGRA-------
A0A433VN22      QRSTLRRQIGAYITQVAGNI--------------P---VDPTIATDS--QGRA-------
Q7NF11          QREELQRSLRELLAKVVPAS-------------RTERALDDSLAGGGNRDSRI-------
A0A1Z4JCS8      ERDTLRNQLQQYVG---QAA-------------GR---ISANTDFTTGAEGRN-------
F4XTX2          QREQLQQQIQQYI-FLAAGD-------------TL---VDPTLTDSA--QGRA-------
Q7NJN6          QREELLGKIKQQVGSIVPDA-------------SK---VNVSLGGNSYRDSRI-------
U5QCC3          QREELLSKIKLQLSKLVPDS-------------EK---VDTTLGGNTYRDSRI-------
A0A3S0Y9N9      QETVLKQELKRHIEQSFIGEAGRLNKSKDSESIVQ-------------------------
A0A433UNK7      EEVILRQELKKRIEQSFIGKSGRLNQSVEPEKIVQ-------------------------
A0A3M1SVZ4      KVATLRSMLQSRVGDV----------SGSLKSIGN-------------------------
A0A654SFI6      EVASLRASLGGEARAALK------------------------------------------
K9SSQ0          RRDQIYNLMQAQAQAIL---------GTKPADVTP-------------------------
A0A2W1JIN9      ELDAARTLYNQRLSQL----------GGGSSVNIA-------------------------
A0A318AJV1      QLADIDQQIRDEAQRVVG------------------------------------------
A0A1U7N2U4      ERYELLTLYNQKLSRLLPTNQPTNQLTNQIIPPAD-------------------------
A0A1D9G1F2      ERYELLTLYNQKLSRLLPTNQS----NNQIIAPGD-------------------------
F4XV38          ERYELLTLYNQKLSRLLPTNQS----NNQIIAPGD-------------------------
A0A2P8QIL5      ERDAARALYQQKIGSET---------GNPAASTSN-------------------------
A0A2T1FLY5      ERDAARALYQQKIGSET---------GNPAASTPN-------------------------
A0A433W447      ERDAARALYQQKIGSET---------GNPAASTPN-------------------------
K9U1K8          ERDAARALYQQKIGSET---------GNPAASTPN-------------------------
A0A4V6P809      ERDAARALYQQKIGNET---------GNPAASAPN-------------------------
K9UYB2          ERDALRNLYSQGLNRVSP--------DNQSIPDNN-------------------------
A0A218QN17      QRDKVNKLYTEQLAIVSP--------ANSSVATNS-------------------------
K9RKN2          KRNAFRQMYEQQLANVSN--------TNNSVRDNQ-------------------------
A0A2I8ADV2      QREQIRALYAQQVGRVSA--------NNQTIPTED-------------------------
A0A1W5CKM3      QRDEIRALYGQQMARVSS--------SNQTANFNN-------------------------
A0A5Q0GMF5      QRDEIRALYGQQMARVSS--------SNQTANFNN-------------------------
Q3MEW0          QRDEIRALYGQQMARVSS--------SNQTANFNN-------------------------
A0A1Z4KIC7      QRNEIRALYGQQMARVSS--------SGQTDNFQD-------------------------
Q8YSM5          QRNEIRALYGQQMARVSS--------SGQTDNFQD-------------------------
A0A1Q4S1H4      QRDTLRAMYQQELARISN-----------GNAVAN-------------------------
A0A433VBU6      QRDTLRAVYQQELARVSS-----------GNALTS-------------------------
A0A1Q4RZJ6      QRDALRSLYAQELSRVAP---K----AGANNSNNN-------------------------
A0A1Z4SNV3      QRDALRSLYAQQLARVAPVDTS----SSNNSNLNN-------------------------
A0A2H2XJQ1      QRDALRSLYAQQLARVAPVDTS----SSNNSNLNN-------------------------
A0A3S5K358      QRDALRNLYAQELSRVAP--------GAGVNNSNN-------------------------
A0A0T7BPJ4      ERDAVKAMYEQEVARVSP--------DGQS-QTTN-------------------------
A0A0C1QS61      QRNTIRNLYIQGLNRVSS--------GERPVSPNN-------------------------
A0A139X3R8      QRNSVRNLYIQGLNRISS--------ENQPVSPNN-------------------------
A0A1Z4I7C5      QRDEIKALYGQQMARVSS--------SNQTANFQD-------------------------
A0A0C2MDK7      ERDALRKVLSEQLARVST--------KDQSVSTKN-------------------------
A0A1Y0RCK1      ERDALRAIYSEQLARVSS--------ENQNASAKN-------------------------
A0A1Z4PWZ0      ERDALRAIYSEQVARVSP--------QGQTVSANN-------------------------
A0A0C2QLT0      QRDALRAMYSEQLARVSS--------QNQTTSANN-------------------------
A0A1Z4J2K1      ERDALRAMYSEQVARVSP--------KDQTSSANN-------------------------
A0A3S0ZSX0      QRDGLRAFYQKELARVSP--------QNQAIPTNA-------------------------
A0A2N6K4T3      QRNGLRALYQQGLARVSP--------RNQSISSGS-------------------------
A0A370CKT2      QRNGLGALYQQGLARVSP--------RNQSISSGS-------------------------
A0A0S3TL97      QRNGLRALYQQGLARVSP--------RNQSISSGS-------------------------
A0A2N6M8A0      QRNGLGALYQQGLARVSP--------RNQSISSGS-------------------------
A0A2N6M9E1      QRNGLRALYQQGLARVSP--------RNQSISSGS-------------------------
A0A2N6KJI4      QRNGLRALYQQGLARVSP--------RNQSISSGS-------------------------
A0A2N6MZ77      QRNGLRALYQQGLARVSP--------RNQSISSDS-------------------------
A0A2N6KT20      QRNGLGALYQQGLARVSP--------RNQSISSGS-------------------------
G6FSN3          QRNGLGALYQQGLARVSP--------RNQSISSGS-------------------------
A0A4D9CI02      QRNGLRALYFQGLARVSP--------RSKSISSSS-------------------------
A0A328I8B9      QRNGLRALYFQGLARVSP--------RSKSISSSS-------------------------
A0A4Q9J4Z7      QRNGLRALYFQGLARVSP--------RSKSISSSS-------------------------
A0A0M0SU69      QRNGLRALYFQGLARVSP--------GNTSISSSS-------------------------
A0A1Z4TIZ8      QRNGLRGLYLQGLARVSP--------GNTSISSSS-------------------------
A0A0S3TYD7      QVSELQELLQQRVATVV-GQ----------------------TTAPRATEDDL-------
U5QL42          QRDIYLRLLQEQATSVL-GS---------------------AKVAKLGLKSGAVPALGDS
K9QF04          ERQHLLSLIQQQVINLL-GI---------------------QLFKEIQQLPGVA------
A0A3C0N2P0      EQRRLKPLVDQEAATVM-GN---------------------AASGVPDNAESLA------
K9TLQ0          ERNSLLPLLQEEALLVL-GP---------------------NVSQFRGDIRGLS------
A0A076HBF2      RLNQLRPLLRQ-------------------------------------------------
A0A354B169      RQRQLQPMLLR-------------------------------------------------
G4FMX5          RINQLKPLLLR-------------------------------------------------
Q0IDT5          RLEQLQPLLRE-------------------------------------------------
A0A2D6FCW3      RLNQLQPLLRK-------------------------------------------------
A3ZA21          RLNQLQPLLRQ-------------------------------------------------
A0A140K3H3      KQAELRTLMQERSQQIL-GD---------------------AVSQVNLEAIIVS------
K9XUB8          KQVELRKLMKERAQQIL-GD---------------------AVSQVNLEAIIVN------
Q7NEU3          KRDRLRQVLASQAQQIL-GD---------------------RTVPAIVSGGASL------
A0A352XE00      EQKNLLPLLEKEAGTAL-SS-----------------------------AKLTQ------
B4VS56          KQQNLLPLLSQEAGTVL-GA-----------------------------NASAV------
A0A352AAQ3      KQQRLLPLIEAEAANVV-GS-----------------------------GSSGV------
A0A350Y472      KKERLLPLIEEEAANVV-GN-----------------------------AAFGI------
A0A355DVB4      KKERLLPLIEEEAANVV-GN-----------------------------AAFGI------
A0A2P8VVX1      QRENQLAQLRAEISAIS-RQ-----------------------------NVTEL------
A0A2P8WHY0      ELDNNRKQLRQEIAAAI-RR-----------------------------PVETL------
A0A2T1CMT9      EKKILQDLLSEEAERIL-GE---------------------LPPNFSS------------
A0A563VQJ3      KKANLRQQLEQSIAETV-GI---------------------G---------VEV------
A0A1D8TX52      QRQSVFALLQEETRRVL-GQ---------------------V----PT-QLVST------
A0A1U7N5X9      QRQSVFALLQEETRRVL-GQ---------------------V----PT-QLVTT------
A0A1D9G4T2      QRQSVFALLQEETRRVL-GQ---------------------V----PT-QLVST------
F4XP71          QRQSVFALLQEETRRVL-GQ---------------------V----PT-KLVTT------
A0A2P8QVH5      QRQNLIGLLRTEAGRSA-DR---------------------L----PA-QLSTT------
A0A2T1FT70      QRQNLIGLLRTEAGRSA-DR---------------------L----PA-QLSTT------
A0A433W4W4      QRQNLIGLLRTEAGRSA-DR---------------------L----PA-QLSTT------
K9U5W1          QRQNLIGLLRTEAGRSA-DR---------------------L----PA-QLSTT------
A0A2W6ZAV2      RVNQLRPLLQRR------------------------------------------------
A0A2G7GMH8      QRDTQRELLQQEMQTVV-GE---------------------N--------AIAS------
K9W742          QRQQQLALLEKEGERAV-GK---------------------N-------SSQLK------
A0A2T1DWE8      QRQRQRDLLAAEVQRIL-GN---------------------N----AA-QVNVK------
A0A1U7I8L3      QRQSQLALLQKEQQLVQ-GN---------------------N----NPLPPTTT------
A0A2T1DJL8      QRQKQQALLQQEVQRIL-GA---------------------Q----AA-AIAQS------
A0A1Z4J9W0      QRQRQVSLLQQEAQRIL-GS---------------------E----AG---AAS------
A0A0N7Z5K9      QRQRQVALLQQEAQRVL-GA---------------------D----AG-AIAGS------
A0A0S3TXC5      QRERQVALLQQEAQRVL-GS---------------------E----AS-SIAGS------
K9SA61          KRQRQLALLQQEAQRVL-SS---------------------T----ST-GTSSQ------
A0A3D1PBA3      QRQNTIEMLKSEGGRVV-GK---------------------E----QA-QSGST------
K9XPB0          QKNTQTTLLLQEVKKIL-GA---------------------V----PP-NFAVQ------
A0A350Y7Z1      QRQRQLALLQEEAQRVL-GE---------------------T----ST-QIAFS------
A0A352X2A7      QQSRQYRMLQEEGERVL-GR---------------------V----AR-GEDLT------
A0A0D8ZYV0      LRQSQQALLQAEQARVV-GA---------------------N-----V-AQANA------
A0A4R4IUM6      QRQNLLSMMKQEGGRVL-GE---------------------GQASQAA-AAGNA------
A0A2T1FP73      QRQNLLSMMKQEGGRVL-GE---------------------GQASQAA-AAGNA------
A0A433VMS2      QRQNLLSMMKQEGGRVL-GE---------------------GQASQAA-AAGNA------
K9TYA7          QRQNLLSMMKQEGGRVL-GE---------------------GQASQAA-AAGNA------
A0A2P8QUE1      QRQNLLSMMKQEGGRVL-GE---------------------GQASQAA-AAGNA------
A0A2T1DNG3      QRQRQLKQLQLEASRLL-GS---------SSPGSG--------------ESLL-------
A0A2P8W9H0      RRENLQPLIE--------------------------------------------------
A0A1Z4LN32      KEAALNNLLQTRIMESV-GY---------R---TQ------IA------PSSL-------
A0A2I8A9F5      QEKALNSLLKQRITEYL-GY---------P---IQ------IE------TARL-------
A0A218Q6R8      QEAALASLLQQRITESL-GY---------P---MQ------IP------PTML-------
A0A218QGE0      QKANINSLLQQQISQSL-GY---------K---AA------IA------PGKL-------
B8HNB0          ERADLLKLMRQRANGLLRTQ---------------------LNRDLTTLPSSA-------
A0A563VS48      EAAELEQVLNQEIAQTL-GG---------------------EQQALLGNTNIL-------
A0A318BJ18      QIDQLDRSIAREESRVS-GS----------------------------------------
A0A3B8Y8H9      QRRNLVPLIEEEAQAIL-GN---------------------IPQTSLTDLTAL-------
A0A2W1JVB9      QASTLRATLQNRVGEAL-G----------------------VPSSPTQGTGQL-------
A0A1Z3HMQ0      EQASLQTLLNRRVGEVL-GT---------Q---AN------ISPG------DL-------
A0A1E5QP61      REAALSDLLQERVAQVL-GN---------N---QA------VDRR------DL-------
A0A3M2GIL5      KRVSLQALLQERIRDIL-GS---------Q---LQ------LPRE------SF-------
A0A433NM31      KQASLREVLEKRVQQVF-KG---------Q---QP------LLDQ------NL-------
A0A3M1PML8      RVRSLEDMLQSRAVSVA-KS---------D---WS------SIRN------DL-------
A0A352X442      QETKLQTLVNQRIGENL-GS---------E---AE------VATT------NL-------
A0A0T7BPZ0      QIASLKKLLQQRIKQVA-GE---------S---TK------LSIQ------NL-------
A0A0M0SHU3      QVSALKNLLQQRVEQVG-GS---------N---QQ------MSTA------SL-------
A0A1D2PBN3      KVAALNSLLQQRLKQVV-GS---------G---RQ------IPTL------NL-------
A0A0C2LVR7      KVAALNSLLQQRLKQAV-GN---------S---RQ------IPTL------NL-------
A0A1Z4PQB9      KVAALNSLLQQRLKQAV-GS---------D---RQ------IPTL------NL-------
A0A1Z4SFN6      KIAALNSLLEERIKQVV-GS---------N---QQ------IPLENVQNLQNL-------
K9PGI8          KIAVLNLLLKGRIEEGV-GS---------T---KT------VIKG------NL-------
A0A563VLD6      KGQELQELLRERATQVL-GNTVSQAVLDKAIATSA----EIIN------NTNTT------
A0A318BG22      QIASVRGQIATLRGRIVGGF-------------RA--------------AYEL-------
A0A2T1E9V8      KEAQLNILLNSETTRILQGQ-------------KI------SS------YSNL-------
A0A3M2GQQ6      QRDNLFRQLQQRSRRVL-GD---------A---VAKVDLDEVT-----------------
K9SGJ5          RRDQLYKLMQVQAETVL-GG---------RAAQVG------ISTAVPASADGS-------
L8MYT6          RRDELYRLLEARAQSVV-GV---------KGNTVN------IAN----EPSSL-------
A0A352JGJ6      RRNELYKLLETRAQALV-GT---------KG--TN------ITN----EPNSP-------
A0A1J5GLS2      RRDELYRLLETRAQSVV-GV---------GANSRN------LTN----EPNSL-------
A0A2W4W6M5      RRDELYKLLETRAQSVV-GV---------RGGNVN------LTN----EPNST-------
A0A2W7AN33      RRDELYRLLETRAQSVV-G-----------DSTAN------ITN----QPNSA-------
A0A256BLV2      RRDELYRLLETRAQSVV-GV---------RGSTTN------ITN----EPNSA-------
A0A2W6ZXF3      RRDELYRLLETRAQSVV-GV---------GVG-NN------FTN----EPNSP-------
A0A2Z5WX66      RRDELYKLLETRAQSVV-GL---------KGS-AN------IAR----EPNST-------
K9W1T3          KEANLKALLQQQLQQTFLGQ-------------QP------LP------NRIV-------
A0A1Q4RTR1      KVQVLRQQLQQRIIQTL-GG-------------AP------QGL----NERDL-------
A0A1Z4SQV2      KIQVLRQQLQLRIVQIL-GS-------------T-------QAL----NERDL-------
A0A2H2XGN1      KIQVLRQQLQLRIVQIL-GS-------------T-------QAL----NERDL-------
A0A433UXH8      KVQVLRQQLELRVVQTL-GK-------------V-------QNL----NERDL-------
A0A1Z4RMB9      KKNDLTQQLEGLVANAV-GQ---------G---VQ------VS------QGLL-------
K1XF69          KRDNLENLLQREIQVYL-GS---------S---RP------FS------RGLL-------
B5W297          KRDNLENLLQREIQVYL-GS---------S---RP------FS------RGLL-------
H1W7M8          KRDNLENLLQREIQVYL-GS---------S---RP------FS------RGLL-------
A0A5Q4H6A5      KRDNLESLLQREIQVYL-GS---------G---RA------FS------RGLL-------
D5A466          KRDNLESLLQREIQVYL-GS---------G---RA------FS------RGLL-------
B4WP72          QVNSLESLLRQRIRTVT------------TNGRQQ------FE------NSNM-------
A0A318B4H2      EIMGLDKAIA--------------------------------------------------
B4WQE3          RRANLEPLLE--------------------------------------------------
A0A2P8W4F7      QRQQLLPLLEAEAQRLV-GE---------A-----------VE------ANSL-------
A0A5Q4E0Z4      QRQQLLPLLAAEAQRLV-GS---------T-----------VE------TDAL-------
A0A2K3BR24      QEATLANLLQERVNAVL----------------QEELPSNALAD----DNFSL-------
K9YXY1          QEATLANLLQERVNAVL----------------QEELPSNALAD----DNFSL-------
U5QJM6          KRDSLQKRLNEQAGVLLGGD-------------GK--------------QAESL------
K9SX01          QRAPIQKLLQQRIKETL-GT---------N---EL------IS------DQDL-------
A0A4P7ZT55      QRNKLRPLLQRRQLDAV--------------------------------ASAL-------
A0A1E5QIR9      KQARLRGVLERRIIEVL-GN---------SPGAIA--------------PGNL-------
A0A1Z4IBC7      KVAVLEKLLKERTGEVA-GN-------------AP------VT------QGSL-------
A0A1W5CPC7      KIVVLKNLLKDRTGQVA-GT-------------AQ------VT------QGSL-------
A0A5Q0GKD1      KIVVLKNLLKDRTGQVA-GT-------------AQ------VT------QGSL-------
Q3MDC6          KIVVLKNLLKDRTGQVA-GT-------------AQ------VT------QGSL-------
A0A1Z4KM73      KIVVLKNLLKDRTGQVA-GT-------------AQ------VT------QGSL-------
Q8YNX7          KIVVLKNLLKDRTGQVA-GT-------------AQ------VT------QGSL-------
A0A367R4K6      KVTALRSLLKERIEQVA-GE-------------AQ------VT------EGSL-------
A0A1E2WSV8      KVTALKSLLKERVGQVA-GT-------------AQ------IT------EGSL-------
A0A2R5FRT9      KVAALQSLLKERIGQFA-GT-------------AQ------IT------EGSL-------
A0A2K8T1B6      KVVALQSLLKERIGQFA-GT-------------GQ------IT------EGSL-------
A0A235I9I0      KVVALKNLLKERTGQVA-GG-------------AQ------IT------QGSL-------
A0A2D0HQT8      KVLALKNLLKERTGQVA-GG-------------AQ------IT------QGSL-------
A0A2L2NU95      KVAALNNLLKERTGQVA-GK-------------AQ------IT------QGSL-------
A0A367S084      KVLALKNLLKERTGQVA-GG-------------AQ------IT------QGSL-------
A0A0V7ZFJ4      KEQALRNQLGKRVGQLI-DN---------G---NS------IS------ERNL-------
A0A367RIS1      KEQALKEQLERRVTQTL-GS---------A---QP------IP------DQDL-------
A0A235IXQ2      KEQALKEQLKGRVSQTL-GS---------S---EP------IP------EQDL-------
A0A1W5CNX3      KEQALKEQLEGRVSKTL-GS---------W---QP------IP------EQDL-------
A0A5Q0GJJ5      KEQALKEQLEGRVSKTL-GS---------W---QP------IP------EQDL-------
Q3MEB7          KEQALKEQLEGRVSKTL-GS---------W---QP------IP------EQDL-------
A0A1Z4KHN9      KEQALKAQLEGRVSKTL-GS---------S---QP------IP------EQDL-------
Q8YT70          KEQALKAQLEGRVSKTL-GS---------S---QP------IP------EQDL-------
A0A218Q4C1      EEEALRIQLEGRVTQTL-GS---------S---QP------IP------EQNL-------
A0A166IWU6      KEQALKEQLEGRITQTL-GS---------S---QP------IP------EQDL-------
A0A2S0Q8C0      KEQALKEQLEGRITQTL-GS---------S---QP------IP------EQDL-------
W6FSX4          KEQALKEQLEGRITQTL-GS---------S---QP------IP------EQDL-------
A0A0V7ZNJ9      KERALRNQLEKRVGQVV-NN---------NSNDSS------IT------EDNL-------
A0A0R0M9H9      KEQALKKQLQERVSQTL-GN---------A---EV------LQ------QSNL-------
A0A1S1ZVW2      KEQALKKQLQERVSQSI-GN---------V---EV------LQ------QSNL-------
A0A1B7WX82      KEASLKTVLKERVAQTV-GS---------S---DA------LP------QQNL-------
A0A1B7WTD1      KEAAQKKELEARVTETV-GN---------S---NS------LP------KQNL-------
A0A480ABC0      KEAAQKKELEARVTETV-GN---------S---NS------LP------KQNL-------
A0A1Z4LRU5      KLEALKNQLEGKVGQIV-GN---------G---VS------VR------EPDL-------
A0A1Z4JVB4      KAQALRSQLEGRVSQTI-GT---------S---AD------VP------EQNL-------
K9PIA4          KEAALRNQVEGRVAQSL-GN---------S---KY------VP------EQKL-------
A0A1Z4M597      QAVALKNQLEGRVAQTI-GN---------S---EY------MP------EQNL-------
A0A1Z4MWT1      QEVALRNQLEGRVAQTI-GN---------S---EY------TP------EQNL-------
A0A1Z4TX53      QEVALRNQLEGRVAQTI-GN---------S---EY------TP------EQNL-------
A0A1Z4HVE1      KATALRSQLEGRVSKIV-GT---------S---ES------VP------EQNL-------
A0A252ECZ1      KAAALRSQLEGRVSQTI-GN---------S---EF------VP------EQNL-------
A0A1Z4G5Y1      KAAALRSQLEGRVSQTI-GS---------S---EF------VP------EQNL-------
A0A252DNA2      KAAALRSQLEGRVSQTI-GS---------S---EF------VP------EQNL-------
A0A252E1Q4      KAAALRSQLEGRVSQTI-GS---------S---EF------VP------EQNL-------
A0A5P8VSD1      KEQALRKQLEARVSQTL-SS---------S---QP------IP------EQDL-------
A0A2A2TNQ5      KEQAFRQQMEKRVGRVI-GV---------G---ES------VK------EQDL-------
A0A3S1C4K5      KVQALREQLEKRVGKIV-DT---------K---QP------VS------EKNL-------
A0A1X4G3D5      KGQVLKKQLQERIYQSV-GN---------V---GA------LG------ERSL-------
D4TNI2          KGQVLKKQLQERIYQSV-GN---------V---GA------LG------ERSL-------
A0A1Z4H6Z8      KQAALRNQLEGRVAQTI-GS---------S---ES------VP------EQNL-------
A0A1Z4NPM1      KVNALRSQLEQRVGKVI-GG---------G---VA------VP------ERDL-------
A0A3F3KPR9      KEQALKKQLQERVSQTL-GN---------A---EV------LQ------QSNL-------
D4TGN7          KEQALKKQLQERVSQTL-GN---------A---EV------LQ------QSNL-------
A0A1Z4UZW9      KEASLKNVLKERVAQTV-GS---------S---ES------LP------KQNL-------
A0A0K2M5H0      KEASLKNVLEQRVSQTV-GS---------S---EF------LS------KQNL-------
A0A1B7VSH4      KEASLKKLLEERVGQTV-GN---------F---ES------LS------QQNL-------
A0A1B7W126      KEASLKKLLEERVGQTV-GN---------F---ES------LS------QQNL-------
A0A3D4C6Q6      KEASLKKLLEERVGQTV-GN---------F---ES------LS------QQNL-------
A0A1B7UVJ4      KEASLKTVLKERVAQTV-GS---------S---DA------LS------QQNL-------
A0A1B7UTR1      QEASLKDLLEKRVAQTI-GS---------S---KS------LP------QQNL-------
A0A5C0DRW9      QEASLKDLLEKRVAQTI-GS---------S---KS------LP------QQNL-------
K7W0A4          KEASLKKLLEERVTQTI-GS---------S---KS------LP------QQNL-------
A0A1U7HGH0      REARFQQLLQTQTNQVLQGQ---------------------TPN----GNNQL-------
K9XJD3          REARFKQLLQTQINQVLQGQ---------------------ALN-----NSQL-------
A0A2T1CIL7      REVELEALLENQIEQIQGGK---------Q---LGSLKSKLLS---------I-------
A0A1Z4RPC6      KKQALNSQLQQLITQYV-GT--------------K------VS------EGLL-------
A0A2T1CMZ0      KKQNLNSQLQGLISQYV-GA--------------K------VS------EGLL-------
L8M4F7          KKAALNRQLQSLMSQTI-GQ--------------Q------VS------PGLI-------
A0A140K2P2      KKASLNKELKDLISQNV-GQ---------G---VE------IS------EGLF-------
K9XWX4          KKASLNQELKNLISQNV-GQ---------G---VE------IS------EGLF-------
A0A140KB14      KKQDLNQKLQGLITETV-GS---------N---TK------IS------EGLL-------
K9XX88          KRQDLNQKLEGLITETV-GS---------N---TK------IS------EGLL-------
A0A563VSV6      KKANLRQDIEQQVAQAV-GT---------G---VK------VS------DGLL-------
L8LZE9          TKASLRRELQQQIAQKV-GS---------N---VQ------IS------DGLL-------
A0A433V7A0      QETALKSLLEDRVKAVV-----------MQ---QP------IP------KGNF-------
A0A1Z4NDS1      RVATLQNLLQQRINQVD-GN-------------QQ------IQ------LDNL-------
K9F4D9          QEAGLQALLQERLDVTLGAN---------E---LN------LP------SDDL-------
U9VXM0          QESSLQALLQQRLDITLGAN---------Q---LD------LP------EDDL-------
A0A2T1FTR8      KRQALVEILQKRFKQSLVGE---------Q---QF--------------QGKLV------
K9UA41          KRQALVEILQKRFKQSLIGE---------Q---QF--------------QGKLV------
A0A0C2LBE2      KVAALNSVLQQRMKQVT-GS---------N---QQ------IS------LGNL-------
A0A433NN38      QISALSQVLQQRVEQVA-GK---------N---QQ------VS------LKNL-------
A0A2N6K0T2      KVAALRNLLQERVGQVA-GN---------N---QP------VS------PANL-------
A0A2N6ML72      KVSALRSLLQQRVQQVG-GN---------N---QQ------IS------TANL-------
G6FQZ6          KVSALRSLLQQRIQQVG-GN---------N---QQ------IS------TANL-------
A0A2N6MQX9      KVSALRSLLQQRIQQVG-GN---------N---QQ------IS------TANL-------
A0A2N6KXT6      KVSALRSLLQQRIQQVG-GN---------N---QQ------IS------TANL-------
A0A2N6KGB9      KVSALRSLLQQRIQQVG-GN---------N---QQ------IS------TANL-------
A0A2N6L3Y5      KVSALRSLLQQRIQQVG-GN---------N---QQ------IS------TANL-------
A0A0S3TIS7      KVSALRSLLQQRVEQVG-GN---------N---QQ------IS------TANL-------
A0A1U7GW28      KVSALRSLLQQRVEQVG-GN---------N---QQ------IS------TANL-------
A0A2N6LW63      KVSALRSLLQQRVEQVG-GN---------N---QQ------IS------TANL-------
A0A328IH74      KVSALKNLLQQRVEQVG-GN---------N---QQ------IS------TANL-------
A0A4D9CIB0      KVSALKNLLQQRVEQVG-GN---------N---QQ------IS------TANL-------
A0A1Z4TQ63      KVSALKSLLQQRVEQVG-GN---------N---PQ------IS------TANL-------
A0A4Q9J8G2      KVSALKNLLRQRVEQVG-GN---------S---QQ------MS------TANL-------
A0A1Z4SMD6      QEINLNNLLRSRIEQVL-GPSGMNLVFGNR---QT------VS------TGKL-------
A0A2H2Y096      QEINLNNLLRSRIEQVL-GPSGMNLVFGNR---QT------VS------TGKL-------
K9S8M8          KQAALQSLVQERVGQVLNGT---------P---AS------DI------NPSY-------
A0A1Z4NFV0      EIAQVQGLIQQRVNASS-GA---------N---FN------TT------PERL-------
B0CAX4          KRIALKGVLGEQTSQII------------E---TK------QPQ----PLRNL-------
U5DPF5          SRDALRQVLNERIQTVLSESPAAGGAIPVD---VA------IA------SGTL-------
A0A350Y0P6      KEAARQRLLNQRVEQVI-GL---------K---QS------IP------LNNL-------
A0A352X940      REDAQKSLLQERISKVL-GT---------G---EI------LP------TENL-------
B8HTN4          QLTELNTILRERVRDVAQAS---------R---KG----GSLP------TSNL-------
A0A2A2TPF8      EEKALTNLLQQRVSQSV-PS--------KN---VK------ID------PNSL-------
A0A1Z4R0P8      QEKALASLLQQRASQSV-GA---------N---VK------IS------PNSL-------
A0A0T7BUI3      QEKTLKSLLNRRTQEIT-GN---------Q---LE------VS------LSNL-------
A0A1Z4LP32      QESALNALLQQRKSEAS-GR---------Q---QN------IS------NSRL-------
K9REP9          QATLLQSLLQQRKQEAS-GR---------Q---QN------IP------NNRL-------
A0A1Z4SIJ3      QQAALKSILNERAGKAL-GT---------T---DN------IS------TNKL-------
A0A2H2XPG4      QQAALKSILNERAGKAL-GT---------T---DN------IS------TNKL-------
K9V3C7          QQATLKQLLQERVADSS-GS---------S---QQ------IT------PGNL-------
A0A1Z4T6Y7      KEAALNNLLQQRASQSL-GT---------N---VK------VS------PNKL-------
A0A2H2Y561      KEAALNNLLQQRASQSL-GT---------N---VK------VS------PNKL-------
A0A1Q4S362      KEASLNKLLQQRASQSL-GT---------N---VK------VS------PDKL-------
A0A3S1CIN8      KEASLSQLLQQRASQSL-GT---------N---VK------VS------PDKL-------
A0A2A2TC28      QELALNSLVKQRVEQSL-GS----GKIGST---KN------IS------PTNL-------
A0A0C1NCB0      EEVTLKALLKQRVGETA-GS---------Q---RE------IS------TDKL-------
A0A2N6K7Q9      QQATLNSLLQQRTQEYS-GI-------------PI------VS------PGKL-------
A0A2N6MXH6      QQATLNSLLQQRTQEYS-GI-------------PI------VS------PGKL-------
A0A2N6M5A8      QQATLNSLLQQRTQEYS-GI-------------PI------VS------PDKL-------
A0A2N6LL61      QQATLNSLLQQRTQEYS-GI-------------PI------VS------PGKL-------
A0A0S3TP66      QQATLNSLLQQRTQEYS-GI-------------PI------VS------PGKL-------
G6FP91          QQATLNSLLQQRTQEYS-GI-------------PI------VS------PGKL-------
A0A1U7GYR5      QQATLNSLLQQRTQEYS-GI-------------PI------VS------PGKL-------
A0A2N6KY52      QQATLNSLLQQRTQEYS-GI-------------PI------VS------PGKL-------
A0A2N6KMP5      QQATLNSLLQQRTQEYS-GI-------------PI------VS------PGKL-------
A0A2N6MA45      QQATLNSLLQQRTQEYS-GI-------------PI------VS------PGKL-------
A0A4Q9J9V9      QQSTLNSLLQQRTQQYS-GI-------------PL------VS------PSKL-------
A0A328IGA1      QQSTLNSLLQQRTQQYS-GI-------------PL------VS------PSKL-------
A0A4D9CE41      QQATLNSLLQQRTQQYS-GI-------------PL------VS------PSKL-------
A0A0M0SFT2      QQATLNALLQQRTQQYS-GI-------------PL------VS------PSKL-------
A0A1Z4TLC8      QQATLNSLLQQRTQQYS-GI-------------PL------VS------PGKL-------
A0A0C2LFH0      KEITLNALLQQRVEQVL-GPSGVKQVLGTQ---QN------VA------PGKL-------
A0A1Z4IYV4      QEVTLNALLQQRIEQVL-GTKGIKQVLGTQ---KN------VP------PGKL-------
A0A1Z4Q0T6      QEVTLNALLQQRIEQVL-GTKGIKQVLGTQ---QN------VP------PGKL-------
A0A0C2PT44      QEVTLNALLQQRIEQVL-GAKGIKQVLGTQ---QN------VP------PGKL-------
A0A1D2P6J4      QEVTLNALLQQRIEQVL-GTKGIEQVLGTQ---KN------VP------PGKL-------
A0A4R4IQ40      KRTALQALLSQRIAQAV-GK---------A---RA------VA------DGKL-------
A0A433W533      KRTALKALLSQRISQAV-GK---------T---RT------LA------DGKL-------
A0A2P8QWJ3      KRTALKALLSQRISQAV-GK---------T---RT------LA------DGKL-------
A0A2T1FKP8      KRTALKALLSQRISQAV-GK---------T---RT------LA------DGKL-------
K9U6L7          KRTALKALLSQRISQAV-GK---------T---RT------LA------DGKL-------
A0A3M9ZEU1      QADQLRTLLQERVQQAI-GM---------Q---IP------IS------EGGL-------
A0A1Z4JK72      QEQDLNALLQSRVSEAV-GA---------S---VQ------VA------PGAL-------
A0A0N7Z489      QRDDLNALLQARVSEAV-GS---------S---VQ------VS------PNRL-------
A0A0S3TXS2      QRDDLNALLQTRVSDAV-GA---------N---VS------VA------PGAL-------
A0A1Z4RN12      EEADLTSLLEQQIASTL-GP---------G---QQ-----GLVN----SVNIA-------
A0A2T1CMF9      EQADLEDLLRQEVAGTL-GP---------Q---QQ-----GLAG----QINIL-------
Q7NDC5          RRGALRALLASEADRLL-GR---------R---GL--------------PDSLL------
U5QGK3          QRNALRALLKTEAGRLL-GQ---------P---GL--------------PDSLV------
A0A2W4UY24      QEVALLTLLQTRVGLALGSD---------Q---IA------LP------DDDL-------
A0A2T1GMT4      KQSKLKTLLSQQIRNTI-GS---------Q---AQ------IP------QGLL-------
K9UI51          KQSKLKALLEQQIRSTI-GS---------Q---AQ------IP------QGLL-------
K9QM62          RKSNLKTLLQQQINQTL-GK---------R---TT------VS------PKLL-------
A0A1Z4FWI3      KKANLKALLQQEIGQAG-GN---------P---SN------IQ------PRTL-------
A0A1Z4JYE7      KKDNLNNLLQLQIAKTV-GL---------G---QK------LQF----SPTLL-------
A0A2T1FXY4      KKSNLEALLKKQIKQTV-GS---------Q---TK------VA------AGLL-------
A0A4V2X3N2      KKSNLEALLQKQIKQTV-GS---------Q---TK------VA------AGLL-------
K9TYI2          KKYNLEALLQKQIKQTV-GS---------Q---TK------VA------AGLL-------
A0A1Z4QL41      KRFNLKNLLQKQIEQTI-GS---------Q---TQ------FT------QGFL-------
A0A252D4T4      RRANLQALLKQEVGQNG-GT---------S---AN------IQ------PKTL-------
A0A252DJH5      RRANLQALLKQEVGQNG-GT---------S---AN------IQ------PKTL-------
A0A252EB80      KKANLQALLKQEVGQNG-GT---------Q---VN------IQ------PQSL-------
A0A1Z4HPW5      RKANLQALLKKEIGQTD-AG---------P---VN------YQ------PKTL-------
A0A1Z4MSN1      RKANLQALLKKEIGQTG-AG---------P---VN------YQ------PKTL-------
A0A1Z4U1C2      RKANLQALLKKEIGQTG-AG---------P---VN------YQ------PKTL-------
A0A0D6KV51      RKTNLQALLKQEIGQTG-AG---------P---VN------YP------PKTL-------
A0A1Z4MKF8      RKTNLQALLKQEIGQTG-AG---------P---VN------YP------PKTL-------
A0A2C6WC43      KKANLRALLQQQISQTV-GS---------N---AQ------VP------QNLL-------
A0A1Z4L5A1      KKANLRALLQQQISQTV-GS---------N---AQ------VP------QNLL-------
A0A367QD86      KKANLRALLQQQISQTI-GN---------N---AQ------VP------QNLL-------
A0A235IZ96      KKANLKSLLQQQIGQTI-GN---------Q---TQ------VP------QSLL-------
A0A2L2NGP0      KKANLKSLLQQQIGQTI-GN---------Q---TQ------VP------QSLL-------
A0A2K8SM78      KKASLKSLLQQQIGQTV-GN---------Q---TQ------IP------QSLL-------
A0A2R5FPC0      KKASLQSLLQQQIGQTV-GN---------Q---TQ------IP------QRLL-------
A0A5P8W5T6      KKASLKSLLQQQIGQTV-GN---------Q---TQ------IP------QNLL-------
A0A140KBA0      QEAELTALLEQQIRQTL-GS---------Q---SA---SSVAQ------LNIL-------
K9XSG1          QEAELTALLEQQIQQTL-GS---------Q---SA---SSVAQ------LNIL-------
A0A0F5YE28      KRDSLNAALQEQVEQVL-GS---------Q---AV------VP------EGLL-------
U7QEH7          KRDSLNAALQEQVEQTL-GS---------Q---AV------VP------EGLL-------
A0A3S1ATK5      KKANLNNLLQTQIKATI-GS---------S---AK------IP------EEQLQ------
A0A2Z6CPH0      RKANLTNLLQQQITQTL-GQ---------Q---SQ------FA------PRLL-------
A0A1Z4GT50      KKTTLQTLLQKQIEQIV-GN---------Q---VK------IP------QGQL-------
A0A1Z4GIX0      RKANLTALLQQQVGQTL-GT---------Q---AQ------VP------QRLL-------
A0A2H6LC24      RKANLTALLQQQVGQTL-GT---------Q---AQ------VP------QRLL-------
B2J6N5          KKASLKSLLQQQIGQTV-GN---------K---TE------VS------QNLL-------
A0A367RMI4      KKANLKSLLQQQVGQTV-GN---------Q---TQ------VP------QNLL-------
A0A235HUM0      KKTNLKSLLQQQVGQTV-GN---------Q---TQ------VP------TSLL-------
A0A2L2NW47      KKANLKSLLQQQVGQTI-GN---------Q---TQ------VP------QSLL-------
A0A1E2WUR1      RKASLNSLLQQQIGQTI-GN---------Q---AP------VP------QSLL-------
A0A235IKU3      KKANLKSLLQQQIGQTI-GN---------Q---TQ------IP------QSLL-------
F4XKF3          QQRSLRGHLQQQINQIL-GS---------Q---SLAGTQIQIT------QGLL-------
A0A1D9FX10      QQRSLRGHLQQQIDQIL-GS---------Q---SLAGTQIQIT------EGLL-------
A0A1D8TNX9      QQRSLTGHLQQQINQIL-GS---------Q---SLASTQIQIT------QGLL-------
A0A1U7MYU6      QQSSLRGHLQQQIDQIL-GS---------Q---SLAGTQIQIT------QGLL-------
A0A3C0NJ41      KEASLKSLLQDRVSQTV-GS---------Q---QQ------VP------TGNL-------
A0A352AG88      REAALRNLLQERVVQTI-GV---------V---RP------VS------ASSL-------
A0A350Y374      KEAALKSLLEERVGQTI-GY---------D---QF------VA------TQNL-------
A0A355DPX0      KEAALKSLLEERVGQTI-GY---------D---QF------VA------TQNL-------
A0A0D8ZUV2      RQAALKALLDKRV------A---------N---TN----SPVQ------GANL-------
A0A433VDI0      KKNAFKAQLQGLVK----DA---------G---VR----RQVT------SQQL-------
A0A3D1PG43      KKAALKALLQQRITQTL-GE--------------P----KQVP------IKDL-------
A0A2P8QQ72      KRNALKQLLEGRIGQML-GN--------------S----KQVS------NRNL-------
K9TZQ7          KRNALKQLLEGRIGQML-GN--------------S----KQVS------NRNL-------
A0A2G7GPR0      RRDALRALLEERVQGAI-GN---------A---AA----TEVS------PSNL-------
K9XH68          RRDALRALLEERVQGAI-GN---------A---AA----TEVS------PGNL-------
A0A1U7HW70      RRDALRALLEERVQGAIGGN---------A---AA----TEVS------PGNL-------
A0A2S6VEJ8      RRDALRALLEERVQGAI-GN---------A---AA----TEVS------PGNL-------
                                                                            

K9SLA9          --------------------------RISD-TQA--------------------------
A0A168TT23      ------------------------------------------------------------
A0A0M1JWX9      --------------------------AFQNSVRV--------------------------
A0A2T1M1V6      ------------------------------------------------------------
A0A2G7GCS2      ------------------------------------------------------------
K9XBH8          ------------------------------------------------------------
A0A1Z4LJ30      ------------------------------------------------------------
K9RI76          ------------------------------------------------------------
A0A352AE27      ------------------------------------------------------------
A0A3B8JH60      ------------------------------------------------------------
A0A3C0N766      ------------------------------------------------------------
K9W9J7          ------------------------------------------------------------
A0A139WSU3      ------------------------------------------------------------
A0A433VN22      ------------------------------------------------------------
Q7NF11          ------------------------------------------------------------
A0A1Z4JCS8      ------------------------------------------------------------
F4XTX2          ------------------------------------------------------------
Q7NJN6          ------------------------------------------------------------
U5QCC3          ------------------------------------------------------------
A0A3S0Y9N9      --------------------------LKPQGLQQ--------------------------
A0A433UNK7      --------------------------LRGQGLQQ--------------------------
A0A3M1SVZ4      --------------------------LEFSQMEQ--------------------------
A0A654SFI6      ------------------------------------------------------------
K9SSQ0          --------------------------EGQSSIKQ--------------------------
A0A2W1JIN9      --------------------------PESARVGQ--------------------------
A0A318AJV1      ------------------------------------------------------------
A0A1U7N2U4      --------------------------VASDQLSQ--------------------------
A0A1D9G1F2      --------------------------VASDQLSQ--------------------------
F4XV38          --------------------------VASDQLSQ--------------------------
A0A2P8QIL5      --------------------------PATDKLSQ--------------------------
A0A2T1FLY5      --------------------------AATDKLSQ--------------------------
A0A433W447      --------------------------AATDKLSQ--------------------------
K9U1K8          --------------------------AATDKLSQ--------------------------
A0A4V6P809      --------------------------AATDKLSQ--------------------------
K9UYB2          --------------------------IADDQISQ--------------------------
A0A218QN17      --------------------------VAGDQISQ--------------------------
K9RKN2          --------------------------IASDEISQ--------------------------
A0A2I8ADV2      --------------------------VASDQISQ--------------------------
A0A1W5CKM3      --------------------------LSNDQISQ--------------------------
A0A5Q0GMF5      --------------------------LSNDQISQ--------------------------
Q3MEW0          --------------------------LSNDQISQ--------------------------
A0A1Z4KIC7      --------------------------LANDQISQ--------------------------
Q8YSM5          --------------------------LANDQISQ--------------------------
A0A1Q4S1H4      --------------------------ISNDTLSQ--------------------------
A0A433VBU6      --------------------------VSNDNLSQ--------------------------
A0A1Q4RZJ6      --------------------------IAGDPISQ--------------------------
A0A1Z4SNV3      --------------------------VAGDAISQ--------------------------
A0A2H2XJQ1      --------------------------VAGDAISQ--------------------------
A0A3S5K358      --------------------------IAGDPISQ--------------------------
A0A0T7BPJ4      --------------------------FASDDLTK--------------------------
A0A0C1QS61      --------------------------VAADQVSQ--------------------------
A0A139X3R8      --------------------------VAADQVSQ--------------------------
A0A1Z4I7C5      --------------------------LANDQISQ--------------------------
A0A0C2MDK7      --------------------------FAGDQLSQ--------------------------
A0A1Y0RCK1      --------------------------FAGDQLSQ--------------------------
A0A1Z4PWZ0      --------------------------FAGDQLSQ--------------------------
A0A0C2QLT0      --------------------------FAGDQLSQ--------------------------
A0A1Z4J2K1      --------------------------FAGDQLSQ--------------------------
A0A3S0ZSX0      --------------------------VASDRISQ--------------------------
A0A2N6K4T3      --------------------------VAGDQISQ--------------------------
A0A370CKT2      --------------------------VAGDQISQ--------------------------
A0A0S3TL97      --------------------------VAGDQISQ--------------------------
A0A2N6M8A0      --------------------------VAGDQISQ--------------------------
A0A2N6M9E1      --------------------------VAGDQISQ--------------------------
A0A2N6KJI4      --------------------------VAGDQISQ--------------------------
A0A2N6MZ77      --------------------------VAGDQISQ--------------------------
A0A2N6KT20      --------------------------VAGDQISQ--------------------------
G6FSN3          --------------------------VAGDQISQ--------------------------
A0A4D9CI02      --------------------------VAGDKISQ--------------------------
A0A328I8B9      --------------------------VAGDKISQ--------------------------
A0A4Q9J4Z7      --------------------------VAGDKISQ--------------------------
A0A0M0SU69      --------------------------VAGDQISQ--------------------------
A0A1Z4TIZ8      --------------------------VAGDKISQ--------------------------
A0A0S3TYD7      --------------------------QMGQ-FRQ--------------------------
U5QL42          AITGSGGANPPVAPAASAPTPATVASKGEP-APPAAPTSKAPAALPEARSLAAAPVRQTI
K9QF04          -------SPSKIR-----------------------------------------------
A0A3C0N2P0      -------SPSSIR-----------------------------------------------
K9TLQ0          -------TPNSLR-----------------------------------------------
A0A076HBF2      ------------------------------------------------------------
A0A354B169      ------------------------------------------------------------
G4FMX5          ------------------------------------------------------------
Q0IDT5          ------------------------------------------------------------
A0A2D6FCW3      ------------------------------------------------------------
A3ZA21          ------------------------------------------------------------
A0A140K3H3      -------QGSTSQ-----------VMGING-ADTQAQALNPGQPVDSQGASTQVSGTIST
K9XUB8          -------QGSTSQ-----------IMGINT-ANTQVSAANTNQAVESQGGSTQVSGTIST
Q7NEU3          -------QDSIADSVNNTGSPKGITDRLGD-LQV--------------------------
A0A352XE00      -------SDNLAS-----------LASPSS-VRL--------------------------
B4VS56          -------PENPES-----------LASPSS-LRL--------------------------
A0A352AAQ3      -------PNNAES-----------LASPSS-LRL--------------------------
A0A350Y472      -------PNNPES-----------LASPSS-IRL--------------------------
A0A355DVB4      -------PNNPES-----------LASPSS-IRL--------------------------
A0A2P8VVX1      -------DPTLLS-----------YLQLGG-IDF--------------------------
A0A2P8WHY0      -------NPDIAS-----------LLQLGG-VDL--------------------------
A0A2T1CMT9      -------DLKLLQ-----------KQGLVG-SDT--------------------------
A0A563VQJ3      -------SDGLLN-----------AGD--N-NKE--------------------------
A0A1D8TX52      -------GSNLLT-----------EGQLGG-VDI--------------------------
A0A1U7N5X9      -------GNNLLT-----------EGQLGG-VDI--------------------------
A0A1D9G4T2      -------GSNLLT-----------EGQLGG-VDI--------------------------
F4XP71          -------GNNLLT-----------EGQLGG-VDL--------------------------
A0A2P8QVH5      -------EKSLPK-----------QLQLGD-SDR--------------------------
A0A2T1FT70      -------EKSLPK-----------QLQLGD-SDR--------------------------
A0A433W4W4      -------EKSLPK-----------QLQLGD-SDR--------------------------
K9U5W1          -------EKSLPK-----------QLQLGD-SDR--------------------------
A0A2W6ZAV2      ------------------------------------------------------------
A0A2G7GMH8      -------EEDTTT-----------AGQQGQ-LDI--------------------------
K9W742          -------GENLLT-----------EGQLGE-TDV--------------------------
A0A2T1DWE8      -------GDGGLS-----------VGQLSA-TDL--------------------------
A0A1U7I8L3      -------NSNLLE-----------KGQLGK-LDV--------------------------
A0A2T1DJL8      -------GDGLVA-----------IGQLGE-NDL--------------------------
A0A1Z4J9W0      -------SESLFA-----------TGQLGE-NDL--------------------------
A0A0N7Z5K9      -------DSALFS-----------TGQLGE-NDL--------------------------
A0A0S3TXC5      -------DAGLFS-----------TGQLGE-NDL--------------------------
K9SA61          -------GDRLLT-----------EGQMGE-LDL--------------------------
A0A3D1PBA3      -------GENILT-----------QGQLGG-IDL--------------------------
K9XPB0          -------LQSLLR-----------QGELVN-SKT--------------------------
A0A350Y7Z1      -------TQNLLT-----------EGQLGN-NDL--------------------------
A0A352X2A7      -------SNTLLT-----------EGQLGE-NDL--------------------------
A0A0D8ZYV0      -------AGDLLS-----------QGQRGG-LDL--------------------------
A0A4R4IUM6      -------ADGILQ-----------QGQLGA-LDL--------------------------
A0A2T1FP73      -------ADGILQ-----------QGQLGA-LDL--------------------------
A0A433VMS2      -------ADGILQ-----------QGQLGA-LDL--------------------------
K9TYA7          -------ADGILQ-----------QGQLGA-LDL--------------------------
A0A2P8QUE1      -------ADGILQ-----------QGQLGA-LDL--------------------------
A0A2T1DNG3      -----------------------STGQLGG-FDQ--------------------------
A0A2P8W9H0      --------------------------REGLRVQR--------------------------
A0A1Z4LN32      --------------------------QIGR-VKQ--------------------------
A0A2I8A9F5      --------------------------QIGE-IKR--------------------------
A0A218Q6R8      --------------------------QMGE-IRQ--------------------------
A0A218QGE0      --------------------------QMGE-IKQ--------------------------
B8HNB0          ----------------------SSGSSDGS-VVQ--------------------------
A0A563VS48      --------------------------ALGE-SEE--------------------------
A0A318BJ18      ------------------------------------------------------------
A0A3B8Y8H9      --------------------------TSPNTIRE--------------------------
A0A2W1JVB9      --------------------------QVGE-LQQ--------------------------
A0A1Z3HMQ0      --------------------------QMSE-LSR--------------------------
A0A1E5QP61      --------------------------QIGE-LQQ--------------------------
A0A3M2GIL5      --------------------------EIGL-VQQ--------------------------
A0A433NM31      --------------------------QIGE-LQQ--------------------------
A0A3M1PML8      --------------------------QAGA-LQQ--------------------------
A0A352X442      --------------------------QIGQ-TKQ--------------------------
A0A0T7BPZ0      --------------------------QIGD-VRY--------------------------
A0A0M0SHU3      --------------------------QMGE-VRQ--------------------------
A0A1D2PBN3      --------------------------QTGE-LRQ--------------------------
A0A0C2LVR7      --------------------------QTGE-LRQ--------------------------
A0A1Z4PQB9      --------------------------QTGE-LRQ--------------------------
A0A1Z4SFN6      --------------------------QIGE-LRQ--------------------------
K9PGI8          --------------------------QIGE-LRQ--------------------------
A0A563VLD6      -------TSITNATESESTTENSEVNSQGN-ILA--------------------------
A0A318BG22      --------------------------ALNQ------------------------------
A0A2T1E9V8      --------------------------QVGS-IQQ--------------------------
A0A3M2GQQ6      --------------------------GSGA-IKE--------------------------
K9SGJ5          -------------------------------IQQ--------------------------
L8MYT6          -------------------------------IQQ--------------------------
A0A352JGJ6      -------------------------------IQQ--------------------------
A0A1J5GLS2      -------------------------------IQQ--------------------------
A0A2W4W6M5      -------------------------------IQQ--------------------------
A0A2W7AN33      -------------------------------IQQ--------------------------
A0A256BLV2      -------------------------------IQQ--------------------------
A0A2W6ZXF3      -------------------------------IQQ--------------------------
A0A2Z5WX66      -------------------------------IQQ--------------------------
K9W1T3          --------------------------PLADGVQQ--------------------------
A0A1Q4RTR1      --------------------------NLDS-LKQ--------------------------
A0A1Z4SQV2      --------------------------QIDP-LKQ--------------------------
A0A2H2XGN1      --------------------------QIDP-LKQ--------------------------
A0A433UXH8      --------------------------QIDP-LKQ--------------------------
A0A1Z4RMB9      --------------------------EGQDGTKE--------------------------
K1XF69          --------------------------RVMD-VKN--------------------------
B5W297          --------------------------RVMD-VKN--------------------------
H1W7M8          --------------------------RVMD-VKN--------------------------
A0A5Q4H6A5      --------------------------RVMD-VKN--------------------------
D5A466          --------------------------RVMD-VKN--------------------------
B4WP72          --------------------------QLGE-LQQ--------------------------
A0A318B4H2      --------------------------QEGGRSRS--------------------------
B4WQE3          --------------------------REGVRVQE--------------------------
A0A2P8W4F7      --------------------------GYKGSVSQ--------------------------
A0A5Q4E0Z4      --------------------------GYQGSVSR--------------------------
A0A2K3BR24      --------------------------QLSS-LKI--------------------------
K9YXY1          --------------------------QLSS-LKI--------------------------
U5QJM6          -------RDSLAGTLESNRTSSSTADRYGE-LRV--------------------------
K9SX01          --------------------------QIGG-AQL--------------------------
A0A4P7ZT55      --------------------------QENA------------------------------
A0A1E5QIR9      --------------------------QMGQ-LQL--------------------------
A0A1Z4IBC7      --------------------------QVGQ-LRQ--------------------------
A0A1W5CPC7      --------------------------QVGQ-LKQ--------------------------
A0A5Q0GKD1      --------------------------QVGQ-LKQ--------------------------
Q3MDC6          --------------------------QVGQ-LKQ--------------------------
A0A1Z4KM73      --------------------------QVGQ-LKQ--------------------------
Q8YNX7          --------------------------QVGQ-LKQ--------------------------
A0A367R4K6      --------------------------QVGQ-LRQ--------------------------
A0A1E2WSV8      --------------------------QVGQ-LRQ--------------------------
A0A2R5FRT9      --------------------------QVGQ-LRQ--------------------------
A0A2K8T1B6      --------------------------QVGQ-LRQ--------------------------
A0A235I9I0      --------------------------QVGQ-LRQ--------------------------
A0A2D0HQT8      --------------------------QVGQ-LRQ--------------------------
A0A2L2NU95      --------------------------QVGQ-LRQ--------------------------
A0A367S084      --------------------------QVGQ-LRQ--------------------------
A0A0V7ZFJ4      --------------------------QIGE-IKQ--------------------------
A0A367RIS1      --------------------------QIGE-LKQ--------------------------
A0A235IXQ2      --------------------------QIGE-LKQ--------------------------
A0A1W5CNX3      --------------------------QIGE-LKQ--------------------------
A0A5Q0GJJ5      --------------------------QIGE-LKQ--------------------------
Q3MEB7          --------------------------QIGE-LKQ--------------------------
A0A1Z4KHN9      --------------------------QIGE-LKQ--------------------------
Q8YT70          --------------------------QIGE-LKQ--------------------------
A0A218Q4C1      --------------------------QIGE-LKQ--------------------------
A0A166IWU6      --------------------------QIGE-LKQ--------------------------
A0A2S0Q8C0      --------------------------QIGE-LKQ--------------------------
W6FSX4          --------------------------QIGE-LKQ--------------------------
A0A0V7ZNJ9      --------------------------QVGE-IKQ--------------------------
A0A0R0M9H9      --------------------------QIGE-LKQ--------------------------
A0A1S1ZVW2      --------------------------QIGE-LKQ--------------------------
A0A1B7WX82      --------------------------QIGE-LKQ--------------------------
A0A1B7WTD1      --------------------------QIGE-LKQ--------------------------
A0A480ABC0      --------------------------QIGE-LKQ--------------------------
A0A1Z4LRU5      --------------------------QIGE-LKQ--------------------------
A0A1Z4JVB4      --------------------------QIGD-LKQ--------------------------
K9PIA4          --------------------------QMGK-LKQ--------------------------
A0A1Z4M597      --------------------------QIGN-LKQ--------------------------
A0A1Z4MWT1      --------------------------QIGN-LKQ--------------------------
A0A1Z4TX53      --------------------------QIGN-LKQ--------------------------
A0A1Z4HVE1      --------------------------QIGQ-LKQ--------------------------
A0A252ECZ1      --------------------------QIGK-LKQ--------------------------
A0A1Z4G5Y1      --------------------------QIGV-LKQ--------------------------
A0A252DNA2      --------------------------QIGK-LKQ--------------------------
A0A252E1Q4      --------------------------QIGK-LKQ--------------------------
A0A5P8VSD1      --------------------------QIGE-LKQ--------------------------
A0A2A2TNQ5      --------------------------QIGE-LKQ--------------------------
A0A3S1C4K5      --------------------------QIGQ-LKQ--------------------------
A0A1X4G3D5      --------------------------YMPS-LKQ--------------------------
D4TNI2          --------------------------YMPD-LKQ--------------------------
A0A1Z4H6Z8      --------------------------QIGE-LKQ--------------------------
A0A1Z4NPM1      --------------------------QIGQ-LKQ--------------------------
A0A3F3KPR9      --------------------------QIGE-LKQ--------------------------
D4TGN7          --------------------------QIGE-LKQ--------------------------
A0A1Z4UZW9      --------------------------HIGE-LKQ--------------------------
A0A0K2M5H0      --------------------------QIGE-LKQ--------------------------
A0A1B7VSH4      --------------------------QIGE-LKQ--------------------------
A0A1B7W126      --------------------------QIGE-LKQ--------------------------
A0A3D4C6Q6      --------------------------QIGE-LKQ--------------------------
A0A1B7UVJ4      --------------------------QIGE-LKQ--------------------------
A0A1B7UTR1      --------------------------QVGE-LKQ--------------------------
A0A5C0DRW9      --------------------------QVGE-LKQ--------------------------
K7W0A4          --------------------------QVGE-LKQ--------------------------
A0A1U7HGH0      --------------------------QVGQ-IQQ--------------------------
K9XJD3          --------------------------QVGE-IQQ--------------------------
A0A2T1CIL7      --------------------------SDGA-SEQ--------------------------
A0A1Z4RPC6      --------------------------QAG-NVRE--------------------------
A0A2T1CMZ0      --------------------------QSD-NLKD--------------------------
L8M4F7          --------------------------KNN-QYAP--------------------------
A0A140K2P2      --------------------------NND-GLKE--------------------------
K9XWX4          --------------------------NND-GLKE--------------------------
A0A140KB14      --------------------------RSD-GNKE--------------------------
K9XX88          --------------------------RSD-GNKE--------------------------
A0A563VSV6      --------------------------QDN-RFQE--------------------------
L8LZE9          --------------------------QSDLGQKE--------------------------
A0A433V7A0      --------------------------QFGE-THQ--------------------------
A0A1Z4NDS1      --------------------------QLGD-LRQ--------------------------
K9F4D9          --------------------------QSGQ-LEQ--------------------------
U9VXM0          --------------------------QSGD-LEQ--------------------------
A0A2T1FTR8      -------EL-----------------QPSG-IQG--------------------------
K9UA41          -------EL-----------------QPSG-IQG--------------------------
A0A0C2LBE2      --------------------------QNGS-LRQ--------------------------
A0A433NN38      --------------------------QIGG-VRQ--------------------------
A0A2N6K0T2      --------------------------QMGE-VRQ--------------------------
A0A2N6ML72      --------------------------QMGE-VRQ--------------------------
G6FQZ6          --------------------------QMGE-VRQ--------------------------
A0A2N6MQX9      --------------------------QMGE-VRQ--------------------------
A0A2N6KXT6      --------------------------QMGE-VRQ--------------------------
A0A2N6KGB9      --------------------------QMGE-VRQ--------------------------
A0A2N6L3Y5      --------------------------QMGE-VRQ--------------------------
A0A0S3TIS7      --------------------------QMGE-VRQ--------------------------
A0A1U7GW28      --------------------------QMGE-VRQ--------------------------
A0A2N6LW63      --------------------------QMGE-VRQ--------------------------
A0A328IH74      --------------------------QMGE-VRQ--------------------------
A0A4D9CIB0      --------------------------QMGE-VRQ--------------------------
A0A1Z4TQ63      --------------------------QMGE-VRQ--------------------------
A0A4Q9J8G2      --------------------------QMGE-VRQ--------------------------
A0A1Z4SMD6      --------------------------QIGQ-IKQ--------------------------
A0A2H2Y096      --------------------------QIGQ-IKQ--------------------------
K9S8M8          --------------------------QSGE-LHR--------------------------
A0A1Z4NFV0      --------------------------EVQG-LRE--------------------------
B0CAX4          --------------------------QAGE-SRQ--------------------------
U5DPF5          --------------------------QLSE-VEI--------------------------
A0A350Y0P6      --------------------------QSNE-FQQ--------------------------
A0A352X940      --------------------------QIGD-LKE--------------------------
B8HTN4          --------------------------QTGA-SEQ--------------------------
A0A2A2TPF8      --------------------------QLGA-LKE--------------------------
A0A1Z4R0P8      --------------------------QLGG-LKE--------------------------
A0A0T7BUI3      --------------------------QVGK-IRE--------------------------
A0A1Z4LP32      --------------------------QIGD-IKQ--------------------------
K9REP9          --------------------------QIGE-IKQ--------------------------
A0A1Z4SIJ3      --------------------------QVGK-IKQ--------------------------
A0A2H2XPG4      --------------------------QVGK-IKQ--------------------------
K9V3C7          --------------------------QIGD-IKQ--------------------------
A0A1Z4T6Y7      --------------------------QLGQ-LKE--------------------------
A0A2H2Y561      --------------------------QLGQ-LKE--------------------------
A0A1Q4S362      --------------------------QLGQ-LKE--------------------------
A0A3S1CIN8      --------------------------QLGQ-LKE--------------------------
A0A2A2TC28      --------------------------QIGK-IKE--------------------------
A0A0C1NCB0      --------------------------QLGK-IKQ--------------------------
A0A2N6K7Q9      --------------------------QIGK-IRE--------------------------
A0A2N6MXH6      --------------------------QIGK-IRE--------------------------
A0A2N6M5A8      --------------------------QIGK-IRE--------------------------
A0A2N6LL61      --------------------------QIGK-IRE--------------------------
A0A0S3TP66      --------------------------QIGK-IRE--------------------------
G6FP91          --------------------------QIGK-IRE--------------------------
A0A1U7GYR5      --------------------------QIGK-IRE--------------------------
A0A2N6KY52      --------------------------QIGK-IRE--------------------------
A0A2N6KMP5      --------------------------QIGK-IRE--------------------------
A0A2N6MA45      --------------------------QIGK-IRE--------------------------
A0A4Q9J9V9      --------------------------QIGK-IRE--------------------------
A0A328IGA1      --------------------------QIGK-IRE--------------------------
A0A4D9CE41      --------------------------QIGK-IRE--------------------------
A0A0M0SFT2      --------------------------QIGK-IRE--------------------------
A0A1Z4TLC8      --------------------------QIGK-IRE--------------------------
A0A0C2LFH0      --------------------------QIGK-IKE--------------------------
A0A1Z4IYV4      --------------------------QVGK-IKE--------------------------
A0A1Z4Q0T6      --------------------------QVGK-IKE--------------------------
A0A0C2PT44      --------------------------QVAK-IKE--------------------------
A0A1D2P6J4      --------------------------QIGK-IKE--------------------------
A0A4R4IQ40      --------------------------QIGE-SKQ--------------------------
A0A433W533      --------------------------QIGE-SKQ--------------------------
A0A2P8QWJ3      --------------------------QIGE-SKQ--------------------------
A0A2T1FKP8      --------------------------QIGE-SKQ--------------------------
K9U6L7          --------------------------QIGE-SKQ--------------------------
A0A3M9ZEU1      --------------------------QLGT-LRE--------------------------
A0A1Z4JK72      --------------------------QVGD-IKR--------------------------
A0A0N7Z489      --------------------------QVGD-IKR--------------------------
A0A0S3TXS2      --------------------------QVGD-IKR--------------------------
A0A1Z4RN12      --------------------------SLGE-LKQ--------------------------
A0A2T1CMF9      --------------------------RLGE-LKQ--------------------------
Q7NDC5          -------DANLGTGRTEPAAVPDDLPRLDA-VRQ--------------------------
U5QGK3          -------DASVAAEAQAPAT-KDNLPRLDL-VRQ--------------------------
A0A2W4UY24      --------------------------QAGE-LEQ--------------------------
A0A2T1GMT4      --------------------------KIGD-LKQ--------------------------
K9UI51          --------------------------KIGD-LKQ--------------------------
K9QM62          --------------------------QIGE-LQQ--------------------------
A0A1Z4FWI3      --------------------------QIGE-TKQ--------------------------
A0A1Z4JYE7      --------------------------QIGE-VRQ--------------------------
A0A2T1FXY4      --------------------------QIGE-LRQ--------------------------
A0A4V2X3N2      --------------------------QIGE-LRQ--------------------------
K9TYI2          --------------------------QIGE-LRQ--------------------------
A0A1Z4QL41      --------------------------QIGE-LRQ--------------------------
A0A252D4T4      --------------------------QIGP-TKQ--------------------------
A0A252DJH5      --------------------------QIGP-TKQ--------------------------
A0A252EB80      --------------------------QIGE-TKQ--------------------------
A0A1Z4HPW5      --------------------------QIGE-TKQ--------------------------
A0A1Z4MSN1      --------------------------QIGE-TKQ--------------------------
A0A1Z4U1C2      --------------------------QIGE-TKQ--------------------------
A0A0D6KV51      --------------------------QIGE-TKQ--------------------------
A0A1Z4MKF8      --------------------------QIGE-TKQ--------------------------
A0A2C6WC43      --------------------------QIGE-LRQ--------------------------
A0A1Z4L5A1      --------------------------QIGE-LRQ--------------------------
A0A367QD86      --------------------------QIGE-LRQ--------------------------
A0A235IZ96      --------------------------QIGE-LRQ--------------------------
A0A2L2NGP0      --------------------------QIGE-LRQ--------------------------
A0A2K8SM78      --------------------------QIGE-LRQ--------------------------
A0A2R5FPC0      --------------------------QIGD-LRQ--------------------------
A0A5P8W5T6      --------------------------QIGE-LRQ--------------------------
A0A140KBA0      --------------------------GLGR-LKQ--------------------------
K9XSG1          --------------------------GLGK-LKQ--------------------------
A0A0F5YE28      --------------------------QVPQGQKN--------------------------
U7QEH7          --------------------------QVPQGQKN--------------------------
A0A3S1ATK5      -------KTIASIGSGTQFP----QGQAGE-IRQ--------------------------
A0A2Z6CPH0      --------------------------QIGE-LRQ--------------------------
A0A1Z4GT50      --------------------------QIGE-LKQ--------------------------
A0A1Z4GIX0      --------------------------QIGE-LRQ--------------------------
A0A2H6LC24      --------------------------QIGE-LRQ--------------------------
B2J6N5          --------------------------QIGG-LKQ--------------------------
A0A367RMI4      --------------------------QIGE-LRQ--------------------------
A0A235HUM0      --------------------------QIGE-LRQ--------------------------
A0A2L2NW47      --------------------------QIGE-LRQ--------------------------
A0A1E2WUR1      --------------------------QIGE-LRQ--------------------------
A0A235IKU3      --------------------------QIGE-LRQ--------------------------
F4XKF3          --------------------------EVDQ-LKQ--------------------------
A0A1D9FX10      --------------------------EVDE-LKQ--------------------------
A0A1D8TNX9      --------------------------EVDQ-LKQ--------------------------
A0A1U7MYU6      --------------------------EVDQ-LKQ--------------------------
A0A3C0NJ41      --------------------------QIGQ-FKE--------------------------
A0A352AG88      --------------------------QMGD-FRQ--------------------------
A0A350Y374      --------------------------QIGE-FKN--------------------------
A0A355DPX0      --------------------------QIGE-FKN--------------------------
A0A0D8ZUV2      --------------------------QIGE-SKQ--------------------------
A0A433VDI0      --------------------------QIGE-SQQ--------------------------
A0A3D1PG43      --------------------------QMGA-LKQ--------------------------
A0A2P8QQ72      --------------------------EAGE-LQQ--------------------------
K9TZQ7          --------------------------EAGE-LQQ--------------------------
A0A2G7GPR0      --------------------------QMGE-IRQ--------------------------
K9XH68          --------------------------QMGE-IRQ--------------------------
A0A1U7HW70      --------------------------QMGE-IRQ--------------------------
A0A2S6VEJ8      --------------------------QMGQ-IRQ--------------------------
                                                                            

K9SLA9          --QLISNLANLETSKYGLRSRLEALSKLHQDYQKRIDSLPKIEQQQSQLERDLTLARVNY
A0A168TT23      ----------VLAEYSNLEAEVAALEDEIAANEERILALNQQGVQYNILRREFETNRELY
A0A0M1JWX9      --GLIQQMVAAASQIEVLKMRNQVLAQAAGMLSEYREQFPIVIRQYTDLMRELEVASQTL
A0A2T1M1V6      --AIVADLIRSQSTAQGLKQQASLLEKELDKLNNEVKFIAKNQGILIELQRKYEIAEGVY
A0A2G7GCS2      --EMIAELIRSQNNAAGLQQQANQIASEINRVNAELNSITQNRSQLINLQRQYEIAEGVY
K9XBH8          --DMIAELIRAQNTASGLQQQANQISSEINRVSTELNNITKNRAQLLDLQRRYEIAEGVY
A0A1Z4LJ30      --ALAEQMILAESQAFGMLKKAEQLQPTIDNLIKTLNGLPQKQATLLELQRQYDIAEGVY
K9RI76          --SLAEQVILAESQVIGMQKKAEKLQPQIDKLSASLNSLPQKQAKLLELQRQYDIAEGVY
A0A352AE27      --TLIQQLILAESTASAQQRQATQLQSQAEQLNATLKLIPGHQAKLLELKRQYEVAEGVY
A0A3B8JH60      --TLIQQLATAESEASAQQRQADQLKSEIEKLNASLKALPGNQARVLELQRQVDVAEGVY
A0A3C0N766      --TLIQQLATAESEASAQQRQADQLKSEIEKLNASLKALPGNQARVLELQRQVDVAEGVY
K9W9J7          --TLIQQLVLAESEASGQRRQAEQLQNEIQKLSTTLRTFPANQSRLLELQRQVDVAEGIY
A0A139WSU3      --ALIQQQVLAESEATAQRRQAQQLNNQITQLQTTLKSFPVNQARLVELQRQVDVTEGVY
A0A433VN22      --VLIQQQLLSESEAEAQFQQARQLEKQITELQRYLNSLPAKQAQLLELQRQLDVAEGIY
Q7NF11          --DLILSLLEAERAAEARSRQSAQLGRTIEQATERLSAISTRQATLLDLQRRYELAEAAY
A0A1Z4JCS8      --TLIEQLVLAETNANGQQRQAEQLQQQIDQRQKILNQLPANQAKLNALQRQADVAEGVY
F4XTX2          --MLIQQLILAESAASGQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLELTRQYDVAAGVY
Q7NJN6          --DLILQLVQSQAENGALTNQAARIGEKAASLEERLRTLAPQQSRLKELQRRYEIAEGIY
U5QCC3          --DLILQLIQARSEGLAQNSQANQITEKIDSIDSQLRTMAPQQSKLLELNRRYGIAEGVY
A0A3S0Y9N9      --GLLTNYASAEAERLSLQVRLKALAEMIQSYRQRADTIPQLELQQRQLEREISATESSY
A0A433UNK7      --GLLGNYANVEAERLSLQVRLKSLAGVIESYRQRANTLPQLELQQRQLEREIAATDLSY
A0A3M1SVZ4      --ELTQELVSLESERQGLNSQISALAQLQAGYQERLNVLPQLEQEERRLERQLELAQATY
A0A654SFI6      ----------------AASTREREIRKKLEEAKNKFLGQQTLTIQYGILKREVETNRQIY
K9SSQ0          --NLATQLFDTQTRLATQTAELGSLKIAQTQVEQVFAQIPQLQQTYIELQRQLKQASTRL
A0A2W1JIN9      --DLSVQLIQGKIERLSLQERLEAARGSMKQLESRRQQFPILEQWFTQMDRRREALFNSI
A0A318AJV1      ---------SLQAQARAGDAQVASLRSTMAGLEAARARNTRNSADAERLERDAASARAQF
A0A1U7N2U4      --DFTSRFILAETERSALEQKLYLVQTERIKLQNRLGQIPVLQQPFGTLVRRQDEAIASL
A0A1D9G1F2      --DFTSRFILAETERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASL
F4XV38          --DFTSRFILAQTERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASL
A0A2P8QIL5      --DLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSL
A0A2T1FLY5      --DLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSL
A0A433W447      --DLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSL
K9U1K8          --DLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSL
A0A4V6P809      --DLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSL
K9UYB2          --QLVSSLITSNIERAAIENKLTLVNASVSELRSRLNQLPAQQRPLTALTRKREETATSL
A0A218QN17      --ELTSKLLANETERSAIENKLTTVKAQRTQLQVQIAKLPIQQKPLIALTREREDATASL
K9RKN2          --ELTSKLITNEIERLAVERKLAVVRAQTADLKARVAQLPIKQQPLTALVRQREESASTL
A0A2I8ADV2      --NLTTQLINNEVERVAVENKLQTVQSLRKNLQAQLAVLPLRQQPLTMLTRQREEAAESL
A0A1W5CKM3      --TLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESL
A0A5Q0GMF5      --TLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESL
Q3MEW0          --TLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESL
A0A1Z4KIC7      --TLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESL
Q8YSM5          --TLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESL
A0A1Q4S1H4      --TLNSQLVTNTVEGTAVANKLRTLQAERVRLQNRLAQLPIKQEPLTALTRAREEAAESF
A0A433VBU6      --TLNSQLVTNTVEGTAIANKLRTLQAERVKLQTRLAQLPIKQEPLTALTRTREQAAESF
A0A1Q4RZJ6      --DLTSQLITNEIERAAVAEKLQLTQNNIAQLRNRLTQLPLQQQPLTALIRKREEAAASL
A0A1Z4SNV3      --DLTSKLITNEIERAAITDKLRVTQNNIAQLRNRLTQLPLQQQPLTALVRKREEAAASL
A0A2H2XJQ1      --DLTSKLITNEIERAAITDKLRVTQNNIAQLRNRLTQLPLQQQPLTALVRKREEAAASL
A0A3S5K358      --DLTSQLITNEIERAAVAQKLQLTQNNIAQLRNRLTQLPLQQQPLTALIRKREEAAASL
A0A0T7BPJ4      --DLTAQLITNQTESLAVQKKLRVIQAERANLQARLGKLPLQQQSVAALTRKREEAAESL
A0A0C1QS61      --NFSAQLIANDIERTAVENKLKSVQTQRANLQLRLAQLPIQQQNLTPLTRQREEAAETL
A0A139X3R8      --NFSAQLIANDIERTAVENKLKSVQAQRANLQTRFEQLPFKQQQLTPLTRQREEAAETL
A0A1Z4I7C5      --NLISELITNDITRLAVENRLNAIRQMRADIQRRLALIPIRQQPLTVLTRQREEAAESL
A0A0C2MDK7      --ELNSKFILNRIEESAVKERLTLLQKKEADLQNRLAQLPIKQQQLTILTRKREEAAASL
A0A1Y0RCK1      --DLNSKFIVNRIEESAVNDRLKLLQTKKVNLQARLAQLPIKQQTLTVLTRKREEAAASL
A0A1Z4PWZ0      --ELNSKFILNRIEESAVNDRLKLLQTTKTDLQKRLAQLPINQQTLMLLTRKREEAAVSL
A0A0C2QLT0      --ELNSKFILNSIEESAVNNRLKLLQVKKANLQARLAQLPITQQTLTVLTRKREEAAASL
A0A1Z4J2K1      --ELNSKFILNSIEESAVNNRLKLLQVKKANLQARLSQLPITQQTLTVLTRKREEAAASL
A0A3S0ZSX0      --DLTSQLLVNDVERTAVENKLRVVQANRANLQTRLAELPIRQQKLTPLIRQREESAASL
A0A2N6K4T3      --DLTSQLIINDVERLAVENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESL
A0A370CKT2      --DLTSQLIINDVERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESL
A0A0S3TL97      --DLTSQLIINDVERLAQENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESL
A0A2N6M8A0      --DLTSQLIINDVERLALENKLKLVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESL
A0A2N6M9E1      --DLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESL
A0A2N6KJI4      --DLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESL
A0A2N6MZ77      --DLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESL
A0A2N6KT20      --DLTSQLIINDVERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESL
G6FSN3          --DLTSQLIINDVERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESL
A0A4D9CI02      --DLTSELIINDVERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKREEAVESL
A0A328I8B9      --DLTSELIVNDVERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKREEAVESL
A0A4Q9J4Z7      --DLTSELIVNDVERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKREEAVESL
A0A0M0SU69      --DLTSQLIVNDVERLAVEKRFRSVQAHRANLQARLAQLPIKQQQLTPLTRKREEAVESL
A0A1Z4TIZ8      --DLTSQLIVNDVERLAIENKFRSVQANRANLQTRLAQLPIKQQQLTPLTRKREEAVESL
A0A0S3TYD7      --QLVTELVMAEIEQMSLEGQVESLSGALSAQQQRASTLPRLSTRQAELERRLRASQSTY
U5QL42          QQSLASQLLSTQVTLSVQKAQLASLTKAQNDIVARFKKIPQLQQQYTELQRDYNVNSQIV
K9QF04          -TEIIEKLIAASNQFQALLARQKALAIAENQARRNLQQFAGIARQYADLSRDLEIANQSL
A0A3C0N2P0      -KDLAQKLVDTQNQIQVLEVRRNKIAKAESVVGQQLTALPDIARRYTDLQQQLKVATESL
K9TLQ0          -SDLTGKLIETVNLMEMTRARQWAIAQAETIVQQQMQEQATLMRQYTDLQRELELGTESL
A0A076HBF2      -----NQLEAADAALSLNAGRLATARMQQATLNQQFLQQPGLIKQYEALQQRLEIAKQNL
A0A354B169      -----SQLEAVDGALKLNAGRLAMARSQQQALTFQFLRQPALIKQFTDIMQDLKIAEENL
G4FMX5          -----NQLEAVDAALNLNNGRLQTAQQQVAQLNAQFLKQPALIKQYEALQTRLTIANQNL
Q0IDT5          -----NQLEAVDAALGLNANRLATARAQERTLQDNFLKQPALIKQYETLQTKLTLAQENL
A0A2D6FCW3      -----NQLEAVDAALNLNAGRLETAKAQETSLNNQFLKQPALIKQYEALQTRLKIAQENL
A3ZA21          -----NQLEAVDAALSLNAGRLATAQAQERQLNVQFLRQPALIKQYEALQTRLKIAQDNL
A0A140K3H3      IQSLASMRSQVETEQAALQSQIAGIQQAKTKVEKTFKQIPQLQQYYAEVKRQFDIKSKAV
K9XUB8          IQNLASMRLQVETEQASLQTQIAGIQRAKTQVENTFNSIPQLQQYYAELTRQFEVKSGAV
Q7NEU3          --NLAAELIKAENAYRVQTARVAGLENVKNRMIGQFKVVPSLAKRYQELVRDSNLASNSL
A0A352XE00      --EITKKLIDTKNEIQSLSVREAALERTENLMESQIKQLPIIARQYTDLQRELKVATESL
B4VS56          --ALTQQLVETTNQINMLEVRSGAIAKAERLMSQQLKNLAVVARQYTDLQRELKVATESL
A0A352AAQ3      --DLTQKLVETENQIQVLQVRQTEIADAESRVSQQIKELPIIARRYTDLNRRLNVATESL
A0A350Y472      --NLTQKLVETKNQIQVLEVRRNEIADAEIRLSQQLKTLPVIARRYGDLQRRLTVATESL
A0A355DVB4      --NLTQKLVETKNQIQVLEVRRNEIADAEIRLSQQLKTLPVIARRYGDLQRRLTVATESL
A0A2P8VVX1      --GLVSQILEADVTLESLEARMETLASLESILRDEVNRYPSLMAEYDRLQPAVDTERSTL
A0A2P8WHY0      --SLVTDLLEADVAIAGISARWESLATQEQSLRQELNRYPSWIAEYDRLQPRVEIERATL
A0A2T1CMT9      --GIANTVNDSQARLTGIRQRDLSLAQTEAALKQRLVGFPELISQYRNLTQESEIKRQAV
A0A563VQJ3      --TILENFINLKIEELSLQQQLSSVSQSQQEYLKRADELPRLEKKEQELMRKADTANKTY
A0A1D8TX52      --NLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIKQNTL
A0A1U7N5X9      --NLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTL
A0A1D9G4T2      --NLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTL
F4XP71          --NLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTL
A0A2P8QVH5      --KLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTLLKYPQLLAEYNRLMPEIAINRKTL
A0A2T1FT70      --KLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTLLKYPQLLAEYNRLMPEIAINRKTL
A0A433W4W4      --KLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTLLKYPQLLAEYNRLMPEIAINRKTL
K9U5W1          --KLVDALVDAQVVWFGLSARDQSLAKSEQQLRSTLLKYPQLLAEYNRLMPEIAINRKTL
A0A2W6ZAV2      ------KLDSIKATLAENRSEQAEVNRQALQLSRQFATNPNLVKQYEAIEQRLEIARANL
A0A2G7GMH8      --NLAGELVEAQTNLVSLQANAQSLANAEQQLSAEIQRFPTLLAQYNRLLPEVSVNRETL
K9W742          --NLTNKLLELESSIRGLMAREQTLAEKEQQLRVELERFPSVLADYNRLQPEIKLKRETL
A0A2T1DWE8      --TLANALVDAQVNLVALQGRAQSLNEAERSLQQQLRRFPSLLAEYGRLQPNVQIGRNTL
A0A1U7I8L3      --NLSSKLLEEQTNVQGWQARVQSLTQKAQQIQAELQRFPGMLSQYNRLEPEVKLNRDTL
A0A2T1DJL8      --KFASALVESQVNLVAAQARDRSLTNNELQLRGELKRFPSLLAEYNRLQPNVQVNRDTL
A0A1Z4J9W0      --KFASDLTDAQVEFFGARARDQELARTEQQLRGQLQRFPSLLAEYNRLQPLVTLNRDTL
A0A0N7Z5K9      --KFASDLTQAQVDFFAARARDQTLAAEAQRLQSQLQRFPTLLAEYNRLLPTVKLQRDTL
A0A0S3TXC5      --KFASDLTQAQVDFFAARARDQSLVAEAQRLQAQLQRFPTLLAEYNRLLPTVKLQRDTL
K9SA61          --NLAGQLVETQTRLQALQARGRSLSQTEQQLTGELQRFPQLLAEYGRLEPQLQLRRETL
A0A3D1PBA3      --NLTNQLVDVQTNLNALRARDVSLEQTQKQLRTDLNRFPVLLAEYNRLQPLLQINRNKL
K9XPB0          --NFIETITQSQADLKGLEERDRSLAQTESELREKLTQFPALIARYDSLTQEANLKKNAL
A0A350Y7Z1      --TLSSQLAEAQTTLQALQARDRSLAITQQQLRAKLNRLPELMAEYERLQPEVQIRRDTL
A0A352X2A7      --DLSQKLAEAQSSIQGLQARDRSLAQTEQKLRTKINTLPQLMARYERMQPEVQLKRDTL
A0A0D8ZYV0      --NITAQLAEVQTSLSALQAQDVSLAKTEQGLRSQLNRFPKLLEEYNRLLPIVQINREKL
A0A4R4IUM6      --NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKL
A0A2T1FP73      --NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKL
A0A433VMS2      --NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKL
K9TYA7          --NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKL
A0A2P8QUE1      --NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKL
A0A2T1DNG3      --TLIGQFVETQGSLSTAQARYLSLLSSEQKVRAELQRFPQLLAQYERLKPDIELNRDTL
A0A2P8W9H0      --ELASYIRELENRDRALSETIVTL-------NQTTNRLSTVTRQYNALQRELEIATTNL
A0A1Z4LN32      --ELISRFVNLRSQRLGLTQKIDSLSDLKNRYKQRADVIPDLEKRQKELEQKLSIAQKNY
A0A2I8A9F5      --DLSLELGKLQSQRLGLEKRITSLSNLKSAYEQRLGAIPDLEKTHGELEQKMLIAQKNY
A0A218Q6R8      --EIVSEFVKLKSQRLGLAEKIQSISNFRNSYSQRVSNLPSLEKRQGELERKLSRAEKNY
A0A218QGE0      --NLTSDFVRLQSQRLGLEKKVEALSAVIASYKRRAQVMPNLEKQEGDLERRLSIAQKSY
B8HNB0          --GLTDKALEAQISLATQTAQLNGIRQAQQQVAERFQALPQLQQQYAELQRQLKVNEDVV
A0A563VS48      --GQINEFANLGLERKGLQKRLAAFNKIYSSNQERSSILPQLEEEQKELVRRVEASQTTY
A0A318BJ18      ---IQAEYREAVQRENALQARVNQLKASYLDNRRR-------SIQYNIYQQEVDTNRALY
A0A3B8Y8H9      --DILSSLLKAETQLEELRARQKELIGLENDIRQEIAQLARLTSEYVDLQRKIEIANQSL
A0A2W1JVB9      --RATSELVRFETERLAAEQVAAALATSQTDFQQRTEAIPALEKQLRQLLRDVEISQEIY
A0A1Z3HMQ0      --QLTSQLTEAEVNRLSLASQVQALLDSRQAYIEWSQAFPALEKRQLELEQRLLAAKTNY
A0A1E5QP61      --QLTADLVNAEVQRLGLGSNVSALVRAQGSYRDRANALPRLEQQQRDLQRQLDAAQSAY
A0A3M2GIL5      --QLLLDLVDSEVQRLGLVSQVRALEEARYSQQQRANVLPRLQEGLRELERKVNAAQSTY
A0A433NM31      --KLTEDYVKTEVERIVFNNQLSALSKVYSNYKQRAGIIPQLQQKQRELEREVDAAQSTY
A0A3M1PML8      --DLIGELVRLEVQRQGIVLRLNTLSEASNAYRQRASALPRLEQQQRELERRLNAAQTTY
A0A352X442      --DLAAKLVAAEVEQSGLSRQLAVLTTARIAYKERSNSLPRLQEKEKELERRVEATQLTY
A0A0T7BPZ0      --ELIADIVKTERERVVLERKLAKQKSTWAKYRERANALPKLAQTQRELERRLKASQTTY
A0A0M0SHU3      --KLIEDLANTDKERAGLEKRIAELKQTWSLYKQRANILPQLEQTQRELERKLKAAQTTY
A0A1D2PBN3      --KLLEDYARSEAERVGLERQITTLSNKRSAYKQRANVLPKLEQTQRELERKLKAAQTTY
A0A0C2LVR7      --KLLEDYARSEAERVGLERQIITLSSKRSAYKQRANVLPKLEQNQRQLERKLKAAQTTY
A0A1Z4PQB9      --KLLEDYARSEAERVGLEKKIITLSSKRSAYKQRANVLPKLEQNQRQLERKIKAAQTTY
A0A1Z4SFN6      --NLIQNFATTEAERVGLSQQIATLSSKLSSYKQRVNVLPRLEQIQRQLERKLKASQTTY
K9PGI8          --GLIADFARSEVERAGLEGEITTLSNKLSVYKKRANGLPKFEQTQRQLERKLKAAQTTY
A0A563VLD6      --SLGNQLLAAKHEIAILESQIGGTDKAKAKVENSFQDVPQLQEAYAELERQLVVKSESL
A0A318BG22      --------------ERALQVQLDQLKGSVSDLQTR-------SIQYMILQREVDTNRALY
A0A2T1E9V8      --DLITTLTKLEIDRLGLITQKTTLLKQQAFYQKKAATLPELQQQQGELERQLLASQSTY
A0A3M2GQQ6      --SLATQLLQVETEMSAGLSQLARIRQAQQDVAIQFENIPQLQQRYAELQREFKVKSEAF
K9SGJ5          --NLAGALFETQTTMAVQAAQMGSVKLAQERVSAIFAQIPQLQQRYTELQRQLELDSAVF
L8MYT6          --NLASQLFDAQTNLAVSQAQLESIRNAQSEVAAVFSKIPQIQQRYVEIQRQLDLDTSTY
A0A352JGJ6      --TLATQLFEAQTSLAVNQAQLESIRGAQSEVAKAFSQIPQIQQRYIEIQRKLALDTSTY
A0A1J5GLS2      --TLATQLFETQTNLAVSEAQLASIRSAQSEVSRAFSGIPQIQQRYVEIQRQLALDTSTY
A0A2W4W6M5      --NLATQLFEAQTTLAVSQAQLESIRNAQAEVSSAFSKIPQIQQRYVEIQRQLALDTSTY
A0A2W7AN33      --NLASQLFDAQTTLAVSQAQLQSIRNAQSEVSKAFSQIPQIQQKYVEIQRQLAIDSSTY
A0A256BLV2      --NLASQLFDAQTTLAVSQAQLESIRNAQSEVATAFSKIPQIQQRYVEIQRQLALDTSTY
A0A2W6ZXF3      --GLATQLFETQTTLAVSEAQLESIRSAQSEVSRAFSGIPQIQQRYVEIQRQLALDTSTY
A0A2Z5WX66      --TLATQLFETQTSLAVSQAQLESIRSAQAEVAKAFSQIPQIQQKYIEIQRQLALDTSTY
K9W1T3          --SLITDFARASAERASLEKQIYALANVEAAYRERINTLPKLEQQQRELERRLKTAQSTY
A0A1Q4RTR1      --NLIAELVKLEVERTGLSNRISTLSNALTLYKQRATSLPRLEQNQSQLERDLQVARQTY
A0A1Z4SQV2      --NLIAELVKLEVERTGLSNRVSTLGNAFTLYKQRAGILPRLEQNQRQLERNLQVARQTY
A0A2H2XGN1      --NLIAELVKLEVERTGLSNRVSTLGNAFTLYKQRAGILPRLEQNQRQLERNLQVARQTY
A0A433UXH8      --NLTAELVKLEVERTGLSNRVATLGNAFNLYKQRAKILPSLEQNQRQLERNLQVARQTY
A0A1Z4RMB9      --NQLERFITLKIDELSRQRQVESLYQSQQEYLKRAKELPSLEKRDRELVRSAEAASKTY
K1XF69          --NKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTY
B5W297          --NKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTY
H1W7M8          --NKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTY
A0A5Q4H6A5      --NQIEEFVNAEIRRMDLTKQLDSLYEARDGLERRASILPQLEQQQQELERKAEVARLTY
D5A466          --NKIEEFVNAEIRRMDLTKQLDSLYEARDGLERRASILPQLEQQQQELERKAEVARLTY
B4WP72          --SLIELYLQLEVDRVGLSQRVSELSDLQGVYRRRASTLPALEKTQRELERRLQASQTTY
A0A318B4H2      --DAEAALRAAQSKEAQFREQVANLTKNFNTQRTNL-------IEYQILQREVDTNRTLY
B4WQE3          --QLASRIRELNARDQALRESIATL-------DEQIRNLSTVTRSYNSIQRDLEIAATNL
A0A2P8W4F7      --GLMQQLVNTANQMQVLQTQDQAIGQVVQQLQAEIQRLADLSRSFQQIDRELTVAESSL
A0A5Q4E0Z4      --GLMQQLVDTANQMQVLETQDQAIGQAVQQLRAEIQRLADLSRSYQQITRELTVAESSL
A0A2K3BR24      --DLVGDLVKAQINYLAQKSRIKGLKAEKADYQARAKILPKLEQRQRELERQLNASQSTY
K9YXY1          --GLVGDLVKAQINYLAQKSRIKGLKAEKADYQARAKILPKLEQRQRELERQLNASQSTY
U5QJM6          --SLAGDLVKAENLYLVQSARVTGLEAAKERLLGKFQLVPGLAKRYQELNRNAVIASDSL
K9SX01          --ELITQLVTKEIERVGLEKQIATINDSFIEYQKRLVNIPKLEQQLLVLQRAVEISRTAY
A0A4P7ZT55      ------------AQQAEVQRQLAQLEKAFRV------VGPELVKQYDALNQRLEIASENL
A0A1E5QIR9      --DLMQQLVNSEVDRLVVNSQLNELLNEYAIHKQRANALPRLQESQRDLERQVEVAQSTY
A0A1Z4IBC7      --SLIADITRAEAQRVGLERQITTLIQQRDAYIKRANYLPKLEQNQRELERRLQAAQGTY
A0A1W5CPC7      --SIIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERRLQAAQGTY
A0A5Q0GKD1      --SIIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERRLQAAQGTY
Q3MDC6          --SIIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERRLQAAQGTY
A0A1Z4KM73      --SLIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERKLQAAQGTY
Q8YNX7          --SLIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERKLQAAQGTY
A0A367R4K6      --SLIADITRAEAQGVGLERQINTLLQQRYAYARRANYLPKLEQTQRELERRLKAAQTTY
A0A1E2WSV8      --SLIADITRAQAERVGLERQIGTLLRQQDAYIKRANNLPRLEQSQRELERKLQAAQTTY
A0A2R5FRT9      --SLIADITRAQAERVGLERQIATLVRQQEAYIKRANNLPKLEQTQRELERKLQAAQTTY
A0A2K8T1B6      --SLIADITRAQAERVGLERQIATLLRQQDAYIKRANNLPKLEQSQRELERKLQAAQTTY
A0A235I9I0      --SLIADITRAQAERVGLERQIATLKEQQNAYIKRANNLPRLEQSQRELERKLQAAQTTY
A0A2D0HQT8      --SLIADITRAQAERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKLQAAQTTY
A0A2L2NU95      --SLIADITRAQAERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKLQAAQTTY
A0A367S084      --SLIADITRAQAERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKLQAAQTTY
A0A0V7ZFJ4      --NLTAELVKSEVERLAAANRVGILRKNFITQQGRLRSLPKLEQTQRQLQRKLEVAQLTY
A0A367RIS1      --TLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRTLPKLEQLQLQRQRQLQVAQTTY
A0A235IXQ2      --TLTANLVQVEVEKLGLKNQVSVLMKAFLLYQARLRSLPKLEQEQLEVKRQLEVAQTTY
A0A1W5CNX3      --TLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTY
A0A5Q0GJJ5      --TLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTY
Q3MEB7          --TLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTY
A0A1Z4KHN9      --ALTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTY
Q8YT70          --ALTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTY
A0A218Q4C1      --ALTANLVQVEVERLGLENQVDVLTQAFTFDQVRLRSLPRLEQQQLQLQRQLQVARNTY
A0A166IWU6      --ALTANLVQVEVERLGLENQVGVLTNAFKQDRARLRILPKLQQQELQLQRQLQVARITY
A0A2S0Q8C0      --ALTANLVQVEVERLGLENQVGVLTNAFKQDRARLKILPKLEQQQLQLQRQLQVARTTY
W6FSX4          --ALTANLVQVEVERLGLENQVGVLTNAFKQDRARLKILPKLEQQQLQLQRQLQVARTTY
A0A0V7ZNJ9      --TLTSELLKSEVERLAVAKQVGVLRKAFALQQARLTVLPKLEQQQRQVERKLQIAQLTY
A0A0R0M9H9      --GLTQDLVRSEVERLALANQVKALQSVFIINRRRLDSLPRLEQQQLQLQRQLQVAQGTY
A0A1S1ZVW2      --ALTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQLQVAQGTY
A0A1B7WX82      --SLTEALVKSEVERLALTNKIGELQRVFIVNRRRLDSLPRLEQQQLQLQRQLSVAQLTY
A0A1B7WTD1      --ALTQDLVKSEVERLALTNQVGELRKVFMVNKSRLDSLPRLEQQQLQLQRQLMVAQTTY
A0A480ABC0      --ALTQDLVKSEVERLALTNQVGELRKVFIVNKSRLDSLPRLEQQQLQLQRQLMVAQTTY
A0A1Z4LRU5      --SLTAELIKSEVERLAATNRVGLLRKAFVSNQARLSVLPKLEQQQRQLQRKLQVAQSTY
A0A1Z4JVB4      --NLSQDLVKAEVERLALANRVMELQRAYLLNKRRLDILPALEQQQLQLERQLKVARITY
K9PIA4          --TLTTDLVKSEVERLALARQLADLQQTFILSQKRLNSLPRLEQQQLQLQRQLQVARVTY
A0A1Z4M597      --TLTENLVKSEVERLALTNQVAELKQVLLVNKNRLDSLPRLEQQQLQLQRQLKVAQVTY
A0A1Z4MWT1      --TLTENLVKSEVERLALTNQVAELQQVLIVNKNRLDSLPRLEQQQLQLQRQLKVAQVTY
A0A1Z4TX53      --TLTENLVKSEVERLALTNQVAELQQVLIVNKNRLDSLPRLEQQQLQLQRQLKVAQVTY
A0A1Z4HVE1      --ILSQDLVKAEVERLALAKRVAELRQAYLINQRRLDILPRLEQQQLQLQRQLQVARVTY
A0A252ECZ1      --NLTEELVKSEVNRLAITNRLAELRQVYIVNQRRLDILPRLEQQQLQLQRQLQVARLTY
A0A1Z4G5Y1      --NLTEALVKSEVDRLAFTNRVATLRQVYLTNQRRLDILPRLEQQQLQLQRQLQVAKITY
A0A252DNA2      --NLTEELVKSEVDRLAVANRLAELRQVYVVNQRRLDILPRLEQQQLQLQRQLQVARVTY
A0A252E1Q4      --NLTEELVKSEVDRLAVANRLAELRQVYVVNQRRLDILPRLEQQQLQLQRQLQVARVTY
A0A5P8VSD1      --TLTANLVQLEVQRLGLENQVGVLRKDFVLYQARIRSLPKLEQLQLQLQLELEIAQTTY
A0A2A2TNQ5      --SLTGELVKSEVERLAALQRVQVLRNAYITYETRMRQLPKLEQRQRGLERRLEVAQTTY
A0A3S1C4K5      --TLTLDLVKSEVDRLAVNNQVQVLQTAYLNYQGRLTAIPRLEQQQRALERKLQVAQSTY
A0A1X4G3D5      --GLTEELVKSEIEKLTLSSNINALQNVLSIYKRRLTSLPRLGQQEARLRLRLEIVVTTY
D4TNI2          --GLTEELVKSEIEKLTLSSNINALQNVLSIYKRRLTSLPRLGQQEARLRLRLEIVVTTY
A0A1Z4H6Z8      --TLSEDLVKSEVEGLALQNRVAELRKAFIINKSRLDILPRLEQQQLQLQRQLQVARVTY
A0A1Z4NPM1      --SLTADLVRAEADRLAAEQQVQVLSRALTDYQNRLAALPKLQQRQRALERKLQVAQSTY
A0A3F3KPR9      --GLTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQLQVAQGTY
D4TGN7          --GLTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQLQVAQGTY
A0A1Z4UZW9      --SLTQDLVKSEVERLALTKQVEELQRVFIVNRRRLDSLPRLEQQQLQLQRQLTVAQLTY
A0A0K2M5H0      --ALTQDLVKSEVERLALTKQIEELQRVFIVNRRRLDSLPRLEQQQQQLQRQLTVAQITY
A0A1B7VSH4      --TLTQDLVKSEVERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITY
A0A1B7W126      --TLTQDLVKSEVERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITY
A0A3D4C6Q6      --TLTQDLVKSEVERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITY
A0A1B7UVJ4      --SLTQELVKSEVERLALTNKIGELQRVFIVKRRRLDSLPRLEQQQLQLQRQLSVAQLTY
A0A1B7UTR1      --ALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITY
A0A5C0DRW9      --ALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITY
K7W0A4          --ALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITY
A0A1U7HGH0      --DLISDLIAAEIERQGLISQQATLTQQQKAYLQKATNLPRLEQQQRELERELSAAQSTY
K9XJD3          --ELISDLIAAEVERQGLISQQATLTQQQEAYLQKATHLPKLEQQQRELERELSAAQSTY
A0A2T1CIL7      --KMVAEYANLGVERSGLLGKLAELESNLQVRQQNLEKLPLLEKQQRELERRVEATQSTY
A0A1Z4RPC6      --NQLERFISLKIDELSLQTELASLYKYQQVYLDRAKEVPRLEKEEQALLREVESTRSTY
A0A2T1CMZ0      --NQIEKFINLKIEELSLQTELSSLYQYQQVYLNRAKQIPSLEQQEQSLLREVDSARSTY
L8M4F7          --GQLEKFIELKIQELSLRRQNLALAQAQQIASKRAQAIPKLDSKEQELLLELKIADANY
A0A140K2P2      --NQLEKFITLEIDKINQQRQLSSLYQTQESYLERAQKLPSLEQKEKDLIRKVKAAQNTY
K9XWX4          --NQLEKFITLEIDKINQQRQLSSLYQTQQSYLERAQKLPSLEQKEKDLIRKVKAAQTTY
A0A140KB14      --NQLEKYISLEIDRISQQRQLASLYQSQQAYLQRARQLPQIEQQQQDLVRQVEAAEKVY
K9XX88          --NPLEKYISLEIDRISQQRQLASLSQSQQAYLQRAKQLPQIEQQQQDLLRQVEAAEKVY
A0A563VSV6      --NPLEKFINLKIEELSLQQQLSSTYDYQQAYLKRAEQLPKLEQREREINQKVETARSTY
L8LZE9          --NPLERFISLKIDELSLQQQFASMNDYQQAYLQRAKELPRLEKEEQEAIRKVENIRTTY
A0A433V7A0      --KLLEELVKTQAKNLSLSSRLTSLENAKVRSQRRVSNIPKLEKDQRELQRKLDAAQSTY
A0A1Z4NDS1      --KLMEDYARAEAERSGLARQLVSLQKQWLTYKQRANILPRLEQKQRELERKLKAAQTTY
K9F4D9          --DLIAEYLRLDGATSGLQQQVEELTTARLGQQSRARVIPVLEKQERALDRQLAAAQTTY
U9VXM0          --ELIAEYLRLDGEQSGLQQQVEQLANARLSQQSRARVIPVLEKQERGLERQLDAAQTTY
A0A2T1FTR8      --NLIADYAKSEAQRTSLQKQIAALVYVVDAYKQRMNALPKLEQQQNALGRKLETTRTNY
K9UA41          --NLIADYAKSEAQRTSLQKQIAALVYVVDAYKQRMNALPKLEQQQNALGRKLETTRTNY
A0A0C2LBE2      --KLLEDYAGTEAQRVGLVKQIATLSNQRTVYKERANILPKLEQTQRELERKLKAAQTTY
A0A433NN38      --NLIQDLANTEKVRLGLEKQIADLNNTLFEYKQRANILPKLEETQRELERKVKAAQTTY
A0A2N6K0T2      --RLIEDLANTEKERVGLERRIAELTNTWSVYKQRANVLPKLEQTQRELERKLKAAQTTY
A0A2N6ML72      --KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTY
G6FQZ6          --KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTY
A0A2N6MQX9      --KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTY
A0A2N6KXT6      --KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTY
A0A2N6KGB9      --KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTY
A0A2N6L3Y5      --KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTY
A0A0S3TIS7      --KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTY
A0A1U7GW28      --KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTY
A0A2N6LW63      --KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTY
A0A328IH74      --KLIEDLANTDKERAGLEKRIADLRNTWSLYKQRANTLPRLEQTQRELERKLKAAQTTY
A0A4D9CIB0      --KLIEDLANTDKERAGLEQRIADLRNTWSLYKQRANVLPRLEQTQRELERKLKAAQTTY
A0A1Z4TQ63      --KLIEDLANTDKERAGLEKRLADLRNTWSLYKQRANIMPRLEQTQRELERKLKAAQTTY
A0A4Q9J8G2      --KLIEDLASTDKERAGLEKRIADLRNTWSLYKQRANTLPRLEQTQRELERKLKAAQTTY
A0A1Z4SMD6      --NLASQLSQLQTQRQGLEKKILALSNIRDSYKQRLSILPNLEKKQGDLERTLSVAQKNY
A0A2H2Y096      --NLASQLSQLQTQRQGLEKKILALSNIRDSYKQRLSILPNLEKKQGDLERTLSVAQKNY
K9S8M8          --TLTNNLVETENQRRGLREQVTALRESQVQYQQRANVLPQLEQRQRDLERQLATYQSTY
A0A1Z4NFV0      --KLLNEYVQLQAQQAGLASRVQELSNLHRIYRQRTTIIPNLEKRQGDLERRLGVAQKTY
B0CAX4          --SLTDALVEAEVERLGLEKQVLSLAQTQAENKRRQGIIPKLEQQLIALERDRIVAQTTY
U5DPF5          --QLTGDLVRAEVDRLGTSSRLSSLQREREAYQSRASVLPRLEQGQRELERQLNAAQSTY
A0A350Y0P6      --QMMATLVNAEAERLSLAQRVASLEQTKLTYKRRANILPKLQEGLRDLERQLEASQATY
A0A352X940      --SMTKDLVKAEVERLGFVRQAAYLERAKLAYQQRANLLPRLQEGLRDFERQLGAAQSTY
B8HTN4          --QLVDNFINAEVERLALSSQVTSLSRTEQTYQQRMNALPKLEQWLGELERRRVVAQTIY
A0A2A2TPF8      --QLLGESVRLQAQRLGFENKVQTLTNLHQEYKKRANILPNLEKKQGDLERRLTVAQESY
A0A1Z4R0P8      --QLVGESVRLQAQRLGLANKVQTLTNLHQIYKRRANVLPNLEKKQGDLERRLEVAQESY
A0A0T7BUI3      --DLANQYVQLKTKRQGLQKKIAALQGVQQIYQKRLNAIPNLEKKQSDLERKLSVAKLNH
A0A1Z4LP32      --NLVNQLVQLQTQKDGLQNKLATLNNIKNDYQRKLAILPNLEKRQQDLERRLSVAQTDY
K9REP9          --SLVNQLVQVQTQKDGLQTKLQTLTNIRDNYQQKLAILPNLEKQQTELERRLSVAQTDY
A0A1Z4SIJ3      --DLAVQYLQFQGQRQGLEKKIRAMEAVQANYQQRLNVIPNLEKNLGDLERRQTLAQTNF
A0A2H2XPG4      --DLAVQYLQFQGQRQGLEKKIRAMEAVQANYQQRLNVIPNLEKNLGDLERRQTLAQTNF
K9V3C7          --DLANQYVSLQSQRAGLEEKVQTLSSLHEAYKRRANIFPNLEKQQGELERSLTIAQKTY
A0A1Z4T6Y7      --QLVGESVRLQAQRLGLENKVQTLSGLHEQFKQRAEVLPNLEKKQGDLERRLMVAQKSY
A0A2H2Y561      --QLVGESVRLQAQRLGLENKVQTLSGLHEQFKQRAEVLPNLEKKQGDLERRLMVAQKSY
A0A1Q4S362      --QLVGESVRLQAQRLGLESKVQTLSGIYEQFKQRAQVLPNLEKKQGDLERRLIVAQKTY
A0A3S1CIN8      --QLVGESVRLQAQRLGLESKVQTLSGLHQQFRQRAQVLPNLEKKQGDLERRVMVAQKTY
A0A2A2TC28      --DLASQYVQLLAQRQGLEKKVQTLLNIREGYQRKLSILPNLDKLQTDLERKFNIAQTDY
A0A0C1NCB0      --DMTVEYANLEKKRQGLEEKIKSLSDIRNGYKQRLTVMPNLEKKHGDLERRLDLAQKNY
A0A2N6K7Q9      --ELTDKYVELKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGY
A0A2N6MXH6      --ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGY
A0A2N6M5A8      --ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGY
A0A2N6LL61      --ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGY
A0A0S3TP66      --ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGY
G6FP91          --ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGY
A0A1U7GYR5      --ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMVPSLEKKQQALERRLEAAKTGY
A0A2N6KY52      --ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGY
A0A2N6KMP5      --ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGY
A0A2N6MA45      --ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGY
A0A4Q9J9V9      --SLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKLESAKNGY
A0A328IGA1      --SLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKLESAKNGY
A0A4D9CE41      --SLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKLESAKNGY
A0A0M0SFT2      --NLVDNYVQLKAERQGLEKKFRTLSNIRANYQQQLAVMPSLEKQQQGLERKLESAKNGY
A0A1Z4TLC8      --EMVGNYVQLKAERQGLEKKFRTLSNIRANYQQQLAVMPSLEKQQQGLERKLESAKNGY
A0A0C2LFH0      --NLTTQYALIQAQRQGLENKIQALSNIRGTYKQRLSALPNLEKKQGDLERRLSIAQKNY
A0A1Z4IYV4      --NLTSEFAKIQAQRQGLESKIQALSNIQASYKQRLAMMPNLEKKQGDLERKLSISKKNY
A0A1Z4Q0T6      --NLTSEFARIQAQRQGLESKIQALSNIQASYKQRLAMMPNLEKKQGDFERKLSISKKNY
A0A0C2PT44      --NLTSEFAKIQAQRQGLESKIQALSKIQASYKERLAMMPNLEKKQGDYERKLSISKKNY
A0A1D2P6J4      --NLTSEFAKVQAQRQGLESKIEALSNIQASYKQRLAMMPNLEKKQGDFERKLSISKKNY
A0A4R4IQ40      --KLTEAYIQLEVERLGLASRLASISGEYKLYKQRANILPKLEQQQRELERQLKAAQSTY
A0A433W533      --KLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTY
A0A2P8QWJ3      --KLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTY
A0A2T1FKP8      --KLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTY
K9U6L7          --KLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTY
A0A3M9ZEU1      --TLTANLIDAEVERISLLGQTQTLRNTLSAYRQRASTLPKLAQTQGELARRLQAAQSTY
A0A1Z4JK72      --KLAESLATLQSQKLGLEGRVGTLAGLQSSFRSRMAATPTLVKQQSELERKQDLAQKAY
A0A0N7Z489      --NLAAALSTLQSQRAGLEGRITTLSGLLINYSSRAARTPALIQQESELERRQEIALTAY
A0A0S3TXS2      --NLAAALSTLQSQRIGLEGRISTLAGLLANYRSRAAQTPALIQQEGELQRRQEIALTAY
A0A1Z4RN12      --SQLAEFAELGLQKEGLDKRLASLRSNYNNYQQRSDNLPQLQEQQRELQRRVDATQSTY
A0A2T1CMF9      --GQLTEFADLGLRKEGLEQRLASLKNSYNNYQKRSNLSPQLEEQQRQLERKLKSVTENY
Q7NDC5          --QLLKDLIAARVEELAARTRTEALARVSAEYDARVAALPRLEESQRRLARQVEADQEAY
U5QGK3          --KLLKDLVDARVEELAARTRTDALNSVSERYSSQVAAMPRLEETQRQLERQVEADSAAY
A0A2W4UY24      --SLILSFLQLDAERAGLQQRLNQLTSAQAAQQSRAQLLPGLEKRNRELERELDAAQTTY
A0A2T1GMT4      --NLITELLRSQVQQTGLVNKLNSLQSSRAAYEKRVSVIPKLVQTQRQLERKLEVSQSTY
K9UI51          --NLITELLRSQVQQTGLVNKLNSLQSSRAAYEKRVSVIPKLVQTQRQLERQLEVSQATY
K9QM62          --GLITDFLRSEVQRLGLAQRLTSLSNSRATYEQRMQKMPQLEQTLRELQRTLEVAQSTY
A0A1Z4FWI3      --NLINTFLQAEVQRQGLAQKLTSLYNSRGAYEKRVKVIPQLEQQQRELERRLEVAQSTY
A0A1Z4JYE7      --NLINNFLQLELQSTGLNQKLNSLLNTRSAHEKRMQILPKLAQQQRQLERKVEVAESTY
A0A2T1FXY4      --DLIENLLQSDVQRRSLAQKLASLSNSRSTYEQRKNIIPQLVQNQHELERRLVVAQSTY
A0A4V2X3N2      --DLIENLLQSDVQRRSLAQKLASLSNSRSTYEQRKNTIPQLVQNQQELERRLVVAQSTY
K9TYI2          --DLIENLLQSDVQRRSLAQKLASLSNSRSTYEQRKNIIPQLVQNQQELERRLVVAQSTY
A0A1Z4QL41      --KLIQDFLQSEVQRIGLAKRLASLYNSRSAYEQRTKIIPRLAQTQSELERTIEVAQSTY
A0A252D4T4      --DLIKEFLQSEVQRQGLAQKLNSLYNSRSIYEQRVKIIPQLEQQQRELQRRLDVAQSTY
A0A252DJH5      --DLIKEFLQSEVQRQGLAQKLNSLYNSRSIYEQRVKIIPQLEQQQRELQRRLDVAQSTY
A0A252EB80      --NLIRDFLQSEVQRQGLAQKLSSLYNSRSTYEQRVKIIPQLEQQQRELQRRLEVAQSTY
A0A1Z4HPW5      --NLIREFLQSDVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTY
A0A1Z4MSN1      --NLIRDFLQSDVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTY
A0A1Z4U1C2      --NLIRDFLQSDVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTY
A0A0D6KV51      --NLIRDFLQSEVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTY
A0A1Z4MKF8      --NLIRDFLQSEVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTY
A0A2C6WC43      --TLIQDFLQSEVQRFGLSQRLASLYNSRTNYQKRVQVIPQLIQNQRELERKLEVAESTY
A0A1Z4L5A1      --NLIRDFLQSEVQRFGLSQRLASLYNSRSNYQKRVQVIPQLIQNQRELERKLEVAESTY
A0A367QD86      --NLIQDFLQSEVQRYGLSQRLASLYNSRSNYQKRVQVIPQLIQNQRELERKLEVAESTY
A0A235IZ96      --GLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKVEVAESTY
A0A2L2NGP0      --GLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKVEVAESTY
A0A2K8SM78      --NLIQNFLQSEIQRFGLAKRLSSLSNSRSTYEQRVKIIPQLAQNQRELERKVEVAESTY
A0A2R5FPC0      --NLIQSFLQSEIQRFGLAKRLSSLSNSRFTYEQRVKIIPQLAQNQRELERKVEVAESTY
A0A5P8W5T6      --NLIQSFLQSEVQRFGLAKRLSSLSNSRLAYEQRVKIIPQLAQNQRELERKVEVAESTY
A0A140KBA0      --EQISEFASLGLKKTGLEQKLANLKQTKTDYQQRLSVLPNLEKRQKELERKTKAAQATY
K9XSG1          --EQISEFANLGLQKTGLEQKLANLKQTKTNYQQRLAVLPNLEKRQKELERKTKAAQATY
A0A0F5YE28      --NQLERFIANEIQRVELTRQLDSLYASRINYEQRSQNLPQLEQEQQELQRKVQVAQVTY
U7QEH7          --NQLERFIANEIQRVELTRQLESLYTSRRNYEQRSQNLPQLEQEQQELQRKVQIAQVTY
A0A3S1ATK5      --KFIQDFLQVEVQRIGLSKRLASLYNSRSGYQRRVKIIPMLVQNQRDLERKVEVAQSTY
A0A2Z6CPH0      --NLIQNFLQLEVQSFGFKQRLASLYNSRSVYERRMRFIPQLIQTQHELERKVEVDQSTY
A0A1Z4GT50      --NLIKDFLQSEVQRNGLTKKLASLYNSRSAYEQRLKIIPLLVQNQRELEQKLEVAQSTY
A0A1Z4GIX0      --TLIQNFLQLEVQRFGLTNRLASLYNSRSAYERRMKVIPQLAQTQRELERKVDVAESTY
A0A2H6LC24      --TLIQNFLQLEVQRFGLTNRLASLYNSRSAYGRRMKIIPQLAQTQRELERKVDVAESTY
B2J6N5          --NLIQNFLQSEIQRIGLAKRLSSLYNSRSIYEKRVKLIPQLAQNQRELERKAEVAESTY
A0A367RMI4      --SLIQNFLQSEIQRFGLTQRLSSLYNSRVSYEQRVKLIPQLAQNQRELERKVEVAESTY
A0A235HUM0      --SLIQNFLQSEIQRFGLTQRLSSLYNSRVSYEQRVKLIPQLAQNQRELERKVEVAESTY
A0A2L2NW47      --SLIQNFLQSEIQRFGLTQRLSSLYNSRVKYEQRVKLIPQLAQNQRELDRKVEVAESTY
A0A1E2WUR1      --NLIQNFLQSEIQRFGLTQRLSSLYNSRSTYEQRVKLIPQLAQNQRELERKVEVAESTY
A0A235IKU3      --GLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKVEVAESTY
F4XKF3          --KLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRVQAARLTY
A0A1D9FX10      --KLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRLQAARLTY
A0A1D8TNX9      --KLINDFIESEVKRQSLAEGLATLAKARIGYEQRVNVLPRLEQTQQQLEQRVQAARLTY
A0A1U7MYU6      --KLISDFIESEVKRRSLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRLQAARLTY
A0A3C0NJ41      --QLTSDFVKAEVERLGLANRLTQLSNTRSAYKQRLSILPKLEKEQRELQRRVEAAQSTY
A0A352AG88      --ELTLNLVNAEVERLGLASQLNELENVRLAYQQRLTILPKLEKDQRELQRRLDASQSTY
A0A350Y374      --QLIKDFVNSEVNRLGLKSKLDQLTNSRLIYKQRLNTLPKLEKEQRELQRRLDAAQLTY
A0A355DPX0      --QLIKDFVNSEVNRLGLKSKLDQLTNARLIYKQRLNTLPKLEKEQRELQRRLDAAQLTY
A0A0D8ZUV2      --KLNEELVQSEAERLGLAKQLALLSSTQDTYKQRANVFPKLEQNQRELERQLQASQSTY
A0A433VDI0      --KLNEALVKLEEERSGLTSQLAELSNAQATYKQRVSILPKLEQEQRELERRLAAAQSTY
A0A3D1PG43      --KLTEDFATSEVERLSLSSRLAYLSKNLSAYKQRANVIPKLEQQQQELERQVKASQATY
A0A2P8QQ72      --KLAEDLVRAEVERLSLSNRLKFLAQARTNYRQRATVLPQLEQQQRELERQVRAAQATY
K9TZQ7          --KLAEDLVRAEVERLSLSNRLKFLAQARTNYRQRATVLPQLEQQQRELERQVRAAQATY
A0A2G7GPR0      --ELTQNYVNSEIQRLGLTSRLSSLNNTYSAYRQRINVLPRLEQTQRELERRLEAAQSTY
K9XH68          --ELTQNYVNSEIQRLGLTSRLNSLNNTYNAYRQRVNVLPRLEQTQRELERRLEAAQSTY
A0A1U7HW70      --ELTQNYVNSEIQRLGLTSRLNSLNNTYNAYRQRVNVLPRLEQTQRELERRLEAAQSTY
A0A2S6VEJ8      --ELTQNYVNSEIQRLGLVSRLNSLNNTYNAYRQRANVLPRLEQTQRELERRLEAAQSTY
                                                                            

K9SLA9          DHLLQQQTSLRSQLRQISAGARIVSPATIP--TN----AIAPNIPL---NLSLGAIL-GL
A0A168TT23      DGMLQRLKEIGVAAGAQENNIAVIDSALRP--GY----PVLPDISR---NLSIALLL-GL
A0A0M1JWX9      NQLLAQREQLRLEAAQSETPWEIIALPEIPRNEDGELIPFSPNLLR---NLVLGAML-GL
A0A2T1M1V6      KGIIAQLSQNKINAFDAYPNVQLIDGPSLN--PK----PLTASRKL----IALGGLL-AS
A0A2G7GCS2      KSILGQVEQTKTNPFSVYPNVQTLDAPVID--PK----PEEPSKRA----IALGGIL-AG
K9XBH8          KSIIAQVEQAKTNPFNVYPNVQTLDAPTID--PK----PEEPSRRV----IALGGIL-AA
A0A1Z4LJ30      NGVVAQAEQAKLGSFSAYPSVQVLDQPIMD--TK----PVGPKLRL----MLLGALL-AC
K9RI76          NGVVAQIEQAKLGAFSAYPSVQVLDKPMVD--NK----PSGPKLKL----MLLGALL-AS
A0A352AE27      KGLVAQIQKVNIDAFNAYPNVQVLDPPTVS--SN----PTDPKKTL----IALNAFV-AS
A0A3B8JH60      KGLVAQVQKNNIDAFNTYPNVQVLDSPTVD--PK----PSSPKKLL----AALNALI-AS
A0A3C0N766      KGLVAQVQKNNIDAFNTYPNVQVLDSPTVD--PK----PSSPKKLL----AALNALI-AS
K9W9J7          KGLVAQVQQNNIDAFDTYPNVQVLDPAKVD--SK----PSGPKRSI----IVLSGLM-AS
A0A139WSU3      KGLIAQIQQSNIDAFDAYPNIQVLDAPQVD--PK----PVSPKFLL----MAVNALL-AS
A0A433VN22      KGLVAQVQQKSVDAFDAYPNVQVLDPPRVN--SK----PISPKLFL----MAINALL-AS
Q7NF11          KAIVAQMQQARLSAFNAFPDIEVLDKAYSN--PK----EANPRTLL----IALGGLV-AA
A0A1Z4JCS8      KGLVAQTQQSNIDAFNAYPNIQELNAPFVD--AK----PSSPKKSL----IAINALL-AS
F4XTX2          NGLVAQMEQVNLDAFSAYPNVQVLDPPTVD--EK----PAGPKKLL----IIANGFL-AS
Q7NJN6          RGLVAQVQQAKVNAFDAYPNVQILDAPSVD--SK----PS-PSGLL----VAVGGLV-AM
U5QCC3          KAMLAQVQQAKINAFDTYPNVQVLDPPAVD--PK----PS-PRLFL----IVLGALL-AM
A0A3S0Y9N9      QTLLARYQELQVAENLQVSNARVITPALIP--TV----PIKSRQYI---NLLQGFIG-GI
A0A433UNK7      QNLLARYQELQVAENLQVSNARIVTPALIP--GV----PIRSRQYI---NLLQGLIG-GI
A0A3M1SVZ4      SQLQQKLQEVRLAESQSLGNASLVSPALVP--DK----P-ISKKSL---YQAMGIFL-GG
A0A654SFI6      DALLQRYKELGAAGAGQ-NNIKLIDKADAP--LF----PYAPSLLQ---NLLVALIT-GL
K9SSQ0          STLSQKLEEAKSQEVQEATAWQILQSPSLP--SY----PSSPNVIL---NLLLAGLA-GI
A0A2W1JIN9      QLLERKLDEVRVAEAQLLSNFRILDLSEPS--GK----PSDPNIPV---VLILGTLA-GA
A0A318AJV1      DKMSAMSLESTQAAHAAIAQAQIIDRADPP--VS----PAPPGKVL---LSGLAMLA-SL
A0A1U7N2U4      KLLQNKLEEARIAETQLVNNIQIIERAKLP--SS----PKEPNPKV---VLLIASAA-GI
A0A1D9G1F2      KLLQNKLEEARIAEAQLVSNIQIIERAKLP--SS----PKEPNPKV---VLVIATAA-GI
F4XV38          KLLQNKLEEARIAEAQLVSNIQIIERAKLP--SS----PQEPNPKV---VLVIATAA-GI
A0A2P8QIL5      EFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RL----PTWPNPAI---VLVLATVA-GG
A0A2T1FLY5      EFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RL----PTWPNPAI---VLVLATVA-GG
A0A433W447      EFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RL----PTWPNPAI---VLVLATVA-GG
K9U1K8          EFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RL----PTWPNPAI---VLVLATVA-GG
A0A4V6P809      EFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RL----PTWPNPAI---VLVLAAVA-GG
K9UYB2          KFLQDKLEEARIAEAQKVSNILIIDPAKPA--TI----PASPKIAV---VLALAIAI-GI
A0A218QN17      KSLQSKLEEARITEAQKVSNLRLIEAAKPP--TI----ASSPKRSA---VLALATVF-GT
K9RKN2          KFLQGKLEEARLAQAQKVSNIRIIESATVP--ES----PSSPKKPV---VLALATIF-GG
A0A2I8ADV2      KLLQSKLEEARIAEAQKVSNLRIIELALVP--TD----YAYPKRSV---VLAIAIFF-GS
A0A1W5CKM3      KFLQSKLEEAQIAEAQKVSNIRIIETAVAP--EL----PTSPKRTV---VLVIAGFF-GS
A0A5Q0GMF5      KFLQSKLEEAQIAEAQKVSNIRIIETAVAP--EL----PTSPKRTV---VLVIAGFF-GS
Q3MEW0          KFLQSKLEEAQIAEAQKVSNIRIIETAVAP--EL----PTSPKRTV---VLVIAGFF-GS
A0A1Z4KIC7      KFLQSKLEEAQIAEAQKVSNIRIIETAVAP--EL----PTSPKRTV---VLVIAGFF-GS
Q8YSM5          KFLQSKLEEAQIAEAQKVSNIRIIETAVAP--EL----PTSPKRTV---VLVIAGFF-GS
A0A1Q4S1H4      KGLQRKLEEARIAEAQKVSNIRIIEVANVP--TL----PSEPQPAI---ILAIAGAF-GI
A0A433VBU6      KALERKLEEARIAEAQKVSNIRVIEVATVP--TV----PSTPKSTI---ILAIAGAF-GI
A0A1Q4RZJ6      KFLQAKFEEARIAEAQKVSTLQVIQAAKAA--SI----ASSPKPNV---VLALAGAF-GL
A0A1Z4SNV3      KFLQAKFEEARIAEAQKVSNLQVIQVAQPP--TE----ASSPKPKV---VLALAGAF-GL
A0A2H2XJQ1      KFLQAKFEEARIAEAQKVSNLQVIQVAQPP--TE----ASSPKPKV---VLALAGAF-GL
A0A3S5K358      KFLQAKFEEARIAEAQKVSTLQVIQAAKAA--SF----ASSPKPNV---VLALAGAF-GL
A0A0T7BPJ4      KTLQRKLEEARIAEAQKVSNLSIIEFAKPG--TS----PSSPKIPV---VLVVATVF-GT
A0A0C1QS61      KLLQGKYEEARIAEAQQVGNLRIIEEAQPP--TS----ATSPKKPA---VLVLATVL-GT
A0A139X3R8      KLLQSKYEEARIAEAQQVGNIRIIEEALPP--TV----ATSPRRSS---VLVLATAL-GT
A0A1Z4I7C5      KFLQSKLEEAQIAEAQKVSNIRILETAVVP--EL----PSSPKRNV---ILVMATFF-GS
A0A0C2MDK7      KFLQGKLEEARLTEAQKVSNIRAIENAVAP--SS----PSQPKQKV---VLALAAAF-GT
A0A1Y0RCK1      KFLQSKLEEARLTEAQKVSNIRVIENAVAP--SS----PSEPKQKV---ILALASVF-GS
A0A1Z4PWZ0      KFLQSKLEEARLTEAQKVSNIRVIENAVPA--SS----PSDPKPNV---ILALASVF-GS
A0A0C2QLT0      KFLQSKLEEARLTEAQKVSNIRVIENAVAP--SS----PSEPKPKV---ILALASVF-GT
A0A1Z4J2K1      KFLQSKLEEARLTEAQKVSNIRVIENAVAP--SS----PSEPKPKV---ILALASVF-GS
A0A3S0ZSX0      KLLQSKLEEARIAEAQLVGNIQIIEAAQIP--LK----PTSPHKKA---VLAIAIVF-GS
A0A2N6K4T3      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TK----PSLPNKRS---VLAIATLF-GT
A0A370CKT2      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TQ----PSLPNKRT---VLAIAIVF-GT
A0A0S3TL97      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TK----PSLPNKRT---VLAIAIVF-GT
A0A2N6M8A0      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KK----PSLPNKRS---VLVIAIVF-GT
A0A2N6M9E1      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TQ----PSLPNKRT---VLAIAIVF-GT
A0A2N6KJI4      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TK----PSLPNKRT---VLAIAIVF-GT
A0A2N6MZ77      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TK----PSLPNKRT---VLAIAIVF-GT
A0A2N6KT20      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TQ----PSLPNKRT---VLAIAIVF-GT
G6FSN3          KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TQ----PSLPNKRT---VLAIAIVF-GT
A0A4D9CI02      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KK----PSLPNKKA---VLAIAIVF-GT
A0A328I8B9      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KK----PSLPNKKA---VLAIAIVF-GT
A0A4Q9J4Z7      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KK----PSLPNKKA---VLAIAIVF-GT
A0A0M0SU69      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KE----PSLPNKKA---VLAIATVF-GI
A0A1Z4TIZ8      KLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KE----PSLPNKKA---ILAIATVF-GT
A0A0S3TYD7      ESLLSKLQEIQVAEQQQLGNARITSKALIP--EK----PTLLTSALGRSLLLAGSGGAGL
U5QL42          NGLLTKLEELRITEAQETSPWRVLEPPDLP--DT----PVSPKIDQ---NLLYGFIA-SV
K9QF04          NRFLVAKENLQIETARKVPPWQVISRIEAP--NK----PISPNPVR---DLLLGGFA-GL
A0A3C0N2P0      GRFLTVQETLQVEKARTSTSWKKISGPQKP--QA----PISPNVPR---GILLGIVT-GL
K9TLQ0          NRFLAVRENLQIESAQKAMPWQLISQPEVG--TV----PISPNLSR---SLLLGGIA-GL
A0A076HBF2      AGLVSAREKFQLEIAQRSVPWRVIAEPTIN--PK----PIKPSVPR---NLALGTVL-GL
A0A354B169      AGLVSARENFQLEMAQRSVPWRVIAPPQIN--PR----PIEPSISR---NLALGAIL-GL
G4FMX5          AGLVSARENFQLEIAQRSVPWRVIDPPEIN--PN----PIKPSIPR---NLALGTLL-GL
Q0IDT5          SGLVSARETFRLESAQSSVPWRVIDPPEID--PN----PIKPSIPR---NLALGAML-GL
A0A2D6FCW3      TGLVTARENFQLEIAQRSVPWRVIDPPEIN--PN----PIKPSIPR---NLALGAVL-GL
A3ZA21          AGLVSARENFQLEIAQRSVPWRVIDPPKIN--PD----PIQPSVPR---NLALGAVL-GL
A0A140K3H3      DYLMQRRQELYIEQAQENAPWQILEAPPLP--SI----PISPNLER---GILLALVA-GS
K9XUB8          NYLMQRRQELDINKAQENAPWQILEAPRLP--NV----PISPNLQR---GIFLALMA-GG
Q7NEU3          NRLLERLQELRIQAAQELSPWRVIEPAAIP--EK----PIWPKPLL---TLGGGALL-GL
A0A352XE00      NRFLAVRETLQIESAQKTLPWQLIAPPQTP--IK----PISPNVPR---GLVLATVA-GL
B4VS56          NRFLAVRETLQIEAAQKTLPWQLIAEPQQP--QA----PISPNIPH---GIALGAVA-GL
A0A352AAQ3      SRFLAVREKLQIEESQKTPPWQKLSDPQKP--QT----PISPNVPR---GIVLGTVA-GL
A0A350Y472      NRFLAVQEKLQIDESQKTPPWQQLSQPQKP--QQ----PISPNIPR---GIALGAIA-GL
A0A355DVB4      NRFLAVQEKLQIDESQKTPPWQQLSQPQKP--QQ----PISPNIPR---GIALGAIA-GL
A0A2P8VVX1      QELLIQREQISAELSRGGFSWEVVEPPLPG--QR----IG-PDPVR---PLALGIVA-GL
A0A2P8WHY0      QDLLLQREQISAELARGGFDWQIVEPPDVG--DQ----IG-PDPLR---PIALGVVA-GL
A0A2T1CMT9      QRLLEAKQKLEIELSRGGNNWQVIEPPQAG--LQ----IA-PNLAK---DLLLSLVV-AS
A0A563VQJ3      TALLESLQQARLAENQQTGNVDIIEEAIAP--ET----GS-SGRMA---LILLGFLS-GL
A0A1D8TX52      QQLLQARQELSIELARGGFNWQVVEAPLPG--FK----TG-PNMTQ---DLLLGAVV-GL
A0A1U7N5X9      QQLLQARQELSIELARGGFNWQVVEAPLPG--LK----TG-PNMTQ---DLLLGAVV-GL
A0A1D9G4T2      QQLLQARQELSIELARGGFNWQVVEAPLPG--FK----TG-PNMTQ---DLLLGAVV-GL
F4XP71          QQLLQARQELSIELARGGFNWQVVEAPLPG--SK----TG-PNMTQ---DLLLGAVV-GL
A0A2P8QVH5      EQLLQTQQNLGIKIAQGGFNWQIIRDPEPG--VY----MG-TGRIM---LLVSGAVF-GL
A0A2T1FT70      EQLLQTQQNLGIKIAQGGFNWQIIRDPEPG--VY----MG-TGRIM---LLVSGAVF-GL
A0A433W4W4      EQLLQTQQNLGIKIAQGGFNWQIIRDPEPG--VY----MG-TGRIM---LLVSGAVF-GL
K9U5W1          EQLLQTQQNLGIKIAQGGFNWQIIRDPEPG--VY----MG-TGRIM---LLVSGAVF-GL
A0A2W6ZAV2      STYIKTREDFRLEVAQRTRPWRIISPPEFE--DT----PDKPNLRN---SLMLSILI-GG
A0A2G7GMH8      QQLMTARQELGLQLARGGFDWQVVEQPGIG--EQ----IS-PSIKR---NLLLGIVV-GL
K9W742          DQLEKARQELSLEIARGGFDWQVVEQPLLG--EK----TG-PKKAQ---IILLGAVA-GV
A0A2T1DWE8      QQLLKARQDIALEIARGGFDWQVVEEPKLG--KQ----IG-PNVKQ---NILLGAVA-GL
A0A1U7I8L3      EQLLKARQELSLEIARGGFDWQMVEEPQLG--LQ----IG-PSMKR---NLLLGAVV-GL
A0A2T1DJL8      QQLLKARQDLGLEIARGGFDWQVVEQPKVG--QQ----IG-PNWLR---NLLLGAVG-GL
A0A1Z4J9W0      DELQKARQDLSLEIARGGFDWQMVEQPKLG--RQ----VG-PSWMR---NLLIGAAG-GL
A0A0N7Z5K9      DQLEKARQGLGLEIARGGFDWQIVEQAKVG--RQ----VG-PNWLR---NLLIGGAA-GL
A0A0S3TXC5      DQLEKARQELGLEIARGGFDWQVVEQSKVG--RQ----VG-PNWMR---NLMVGAAG-GL
K9SA61          QELLKARQELGLEIARGGFDWQVVEEPRTG--NQ----IA-PNLQR---NLLLGAVA-GL
A0A3D1PBA3      QQLLQAQQELSLEIARGGFDWQALEEPKQG--QQ----IG-PNLKL---NLLLGLVA-GL
K9XPB0          QRLLAAKQELEIALSRGAYNWQVIESPQLG--VQ----IA-PNTTK---DILLSLVV-AS
A0A350Y7Z1      QKLLEARQELGIEIARGGFKWQVVEPPKPG--KQ----MG-PDTRR---DLMLSVVV-GL
A0A352X2A7      QKLMQARQDLGIEIARGGFKWQVVEAPLPG--EQ----IG-PNTKQ---DIMLAVVV-GL
A0A0D8ZYV0      QQLLRAQQELSLEIARGGFEWQALEQPVLG--LQ----VG-PNIKQ---NLLLGLVA-GL
A0A4R4IUM6      QQLLRAQQELSLEIARGGFDWQALEEPRLG--LK----VG-PNLKL---NLLLGLVA-GL
A0A2T1FP73      QQLLRAQQELSLEIARGGFDWQALEEPRLG--LK----VG-PNLKL---NLLLGLVA-GL
A0A433VMS2      QQLLRAQQELSLEIARGGFDWQALEEPRLG--LK----VG-PNLKL---NLLLGLVA-GL
K9TYA7          QQLLRAQQELSLEIARGGFDWQALEEPRLG--LK----VG-PNLKL---NLLLGLVA-GL
A0A2P8QUE1      QQLLRAQQELSLEIARGGFDWQALEEPRLG--LK----VG-PNLKL---NLLLGLVA-GL
A0A2T1DNG3      KQLLKAQQDLGLEIARGGFAWQVVEQAQIG---A----KTGPNLQK---NLMLGLVV-GI
A0A2P8W9H0      NQFLTKREALRIDAAQRQTPWEVLTPPSQP---R----ASAASAKR---NLLLGTLL-GL
A0A1Z4LN32      ENLETRLQEIKVAESQTVGNASIVESAKVS--PS----PQVQKQKF---IVTFGSIFVGL
A0A2I8A9F5      ENLLTKYQEIKIVESQTIGNARILEYAEVD--SS----PKASKKKG---LTLMVSVFGGL
A0A218Q6R8      ENLLTRFQDIKIVESQTIGNARVLQYAEIG--SN----SSANKKKI---IILLGGGFVGL
A0A218QGE0      ENLLTRQLEIEVAKNQTVGNAKVVEYAKVA--FS----PSVKKKKL---VITLGSGFVGL
B8HNB0          GRFMERLQELRIAEAQRTTSWRVLEPAYLP--TA----PISPNMSR---AILLGLFA-GV
A0A563VS48      ETLLNKLQEIQIAEEQDIGKARVVSEAVVP--EF----PIGPQKKM---MMITGGAI-GT
A0A318BJ18      DGLLQRYKEVGVAGGVGVNNISVVDTADAP--RH----PSSPKLLI---NLLLSLLA-GL
A0A3B8Y8H9      TSYLVFQQELELERAKTIYPWRLVSEIRTP--EE----PVSGPLKL---SV-LGTFM-GI
A0A2W1JVB9      ANLVRKLQEIQVLEQQNLGNARILSPALIP--EE----PIAPRKLL---YIFSGFVL-GS
A0A1Z3HMQ0      ETLLVRLQEAQLAENQTVGSAQILEPAAPP--RF----PVGTSTKK---YIAAGGAV-GL
A0A1E5QP61      QILLRNLQEVRIAENQNVGNARVISYATLP--VN----PVAPNKKL---LVAAGVVG-GS
A0A3M2GIL5      EILLKNLQEVQIVENQNVGNARVIASASPP--EF----PVGSGKKL---YLAAGIVA-GG
A0A433NM31      ATLLKKLEEVRIAENQNVGNAQIVDVGRVA--EE----PVAPKKLL---NFALGGVA-GI
A0A3M1PML8      EALLLRLQEIQVAENQNIGNVRVVSPAIVP--DD----PLPSQKKL---FLIAGSLA-GM
A0A352X442      SQLLQKLDETRLIENQNVGNARIVEAAAVP--EK----PTSSKKKL---IAAGGVVV-GG
A0A0T7BPZ0      ETLLTRLQEIHVAENQNMGNARIISTALVP--DK----PGNSRKLL---ILGGAGFF-GL
A0A0M0SHU3      ETLLTRLQEINVAENQNIGNARIISPALVP--DE----PSGARKAL---VVLGGGVL-GA
A0A1D2PBN3      ETLLTRLQEIQVAENQNVGNARIISPALIP--DK----PAGSRKIL---MITGGGVL-GI
A0A0C2LVR7      ETLLTRLQEIQVAENQNVGNARIISPALIP--DK----PAGSQKIL---VITGGGVL-GI
A0A1Z4PQB9      ETLLTRLQEIQVAENQNVGNARIISPALIP--DK----PAGSRKIL---MITGGGVL-GI
A0A1Z4SFN6      EALLTRLQEVQVAENQNIGNARIISPALVP--DE----PTGPRKAL---IIAGGGVL-GI
K9PGI8          EALLTKLQEVQVAENQNIGNARIISPALIP--DA----PAASQKNL---IVLGGGIF-GA
A0A563VLD6      DYLLKRRQELQISLAQETAPWKVLDKPYLP--HK----PISPNIQR---GLALALAG-GG
A0A318BG22      DALLQRFKEIGVAGGSGANNVSVIDTARAP--GA----PASPILWL---NLLLAIGF-GV
A0A2T1E9V8      ETLLKSLQEIKVKENRTVGNVQIVEYAEIP--VV----ATNASNKS---SMIAASLA-GI
A0A3M2GQQ6      NRFLEKLQELQIAEAQETAPWRVLEPPYEP--QL----PISPNVRR---NLLLGLIA-GG
K9SGJ5          TSLSEKLEELRIAEAQEISSWRVLDAALLP--LQ----PIEPNVLR---NLVFGGFA-GI
L8MYT6          NKLTEKLEELRISEAQEISSWKILEPPLLP--VR----PSSPDIER---SLFISAIA-GL
A0A352JGJ6      QKLTEKLEELRISEAQEISSWRILEPPLIP--TR----PSSPDIEK---SLIAGTFI-GL
A0A1J5GLS2      NKLTEKLEELRISEAQEISSWRVLEPPLIP--TR----PSSPDIER---NLMTGAFV-GA
A0A2W4W6M5      NKLTEKLEELRISEAQEISSWKVLEPPLIP--TR----PSSPDIEK---GLIAGAFF-GL
A0A2W7AN33      NKLSEKLEELKVSEAQEISPWKILEPPLIP--TR----PSSPDILM---NLFVGGIS-GL
A0A256BLV2      NKLSEKLEELRISEAQEISSWKILEPPLTP--IK----PSSPDIER---SLITGAIS-GI
A0A2W6ZXF3      NKLTEKLEELRISEAQEISSWRILEPPLIP--TR----PSSPDIER---SLITGAFV-GA
A0A2Z5WX66      NKLTEKLEELRISEAQEISSWRVLEPPLIP--IR----PSSPDIEK---SLIIGALG-GL
K9W1T3          EILSPKLQEIRVQENQTVGNARIVTPASIP--ER----AIAPKKAQ---NLAVGGLL-GI
A0A1Q4RTR1      EQLLRRFQEVQVIENKTVGNARVVSQALVT--DN----PVSPKIAL---NLALGGFL-GI
A0A1Z4SQV2      EQLLRRYQEVQVIENKTVGNARIVSEAQVT--NR----PVSPKLYL---NLALGGFL-GI
A0A2H2XGN1      EQLLRRYQEVQVIENKTVGNARIVSEAQVT--NR----PVSPKLYL---NLALGGFL-GI
A0A433UXH8      EQLLRRLQEVQVIENKTIGNARIVSEAQVT--NR----PVSPKLYL---NLALGGFL-GI
A0A1Z4RMB9      QTLLDSLQKAQIAENQQSGNTDIVEYATVP---D----KGSAGRVM---LMGLGVIL-GA
K1XF69          RTLLQNLEEAQVAANKITNNARIIETANVP---D----EGKTAKVP---LLALGVMG-GL
B5W297          RTLLQNLEEAQVAANKITNNARIIETANVP---D----EGKTAKVP---LLALGVMG-GL
H1W7M8          RTLLQNLEEAQVAANKITNNARIIETANVP---D----EGKTAKVP---LLALGVMG-GL
A0A5Q4H6A5      RTLLQNLEEAQVAANKITNNARIIETANVP---D----EGRTAKIQ---LLALGVMG-GL
D5A466          RTLLQNLEEAQVAANKITNNARIIETANVP---D----EGRTAKIQ---LLALGVMG-GL
B4WP72          EALLTKLQEVQVAENQNVGNARVVEAAIAP--ES----PVDSRREL---ILIAGILA-GS
A0A318B4H2      DGLLQRYKEIGVA-GVGSNNVAIVDAAEVP--GG----PSEPNLNK---TLLVSLLI-GL
B4WQE3          NEFLTKRETLRIEAAQQQTPWEILTPPSAP---Q----AFSQTGKS---SLLVGPIL-GL
A0A2P8W4F7      NQLLASRQELRLQMARQASPWEIISPLSES--SI----TQTTNLPR---KLLLSTVI-GL
A0A5Q4E0Z4      DQLLTSRQDMRLQMARQTAPWELISPLDES--SI----TEMTNLPR---NLLLSTVV-GL
A0A2K3BR24      QALLKRLQEVRVAENQNLGNARIIESASIP--TS----PISPRIKL---NLALGGIL-GA
K9YXY1          QALLKRLQEVRVAENQNLGNARIIESASMP--TS----PISPRIKL---NLALGGIL-GA
U5QJM6          NRLLQRLQELEIKAAQELSPWRVIEPAVLPDKEK----PVWPKPLV---TLGVGSIL-SV
K9SX01          EGLLVKQQDIQLTEEQNIGNARILSPAVPS--GV----PISPKISN---NLTTGAVL-GI
A0A4P7ZT55      SSYLKARESFRLEVAQKTLPWQVISPPEVD--ET----PVKPNLSR---NLMLGLLL-GA
A0A1E5QIR9      QTLLTRLQEVRIAEEQNIGNVRVIQAAVFP--ER----PIAPQKKI---NFGLGGVV-GI
A0A1Z4IBC7      ETLLKKRQEIDIAQNQKIPNARVISYALVP--DF----PEGPRKIL---FVIGGGAV-GI
A0A1W5CPC7      ETLLKKRQEIDIAQNQKIPNARVISYALIP--DF----PEGPRKIL---FIIGGGVA-GI
A0A5Q0GKD1      ETLLKKRQEIDIAQNQKIPNARVISYALIP--DF----PEGPRKIL---FIIGGGVA-GI
Q3MDC6          ETLLKKRQEIDIAQNQKIPNARVISYALIP--DF----PEGPRKIL---FIIGGGVA-GI
A0A1Z4KM73      ETLLKKRQEIDIAQNQKIPNARVISYALIP--DF----PEGPRKIL---FIIGGGVA-GI
Q8YNX7          ETLLKKRQEIDIAQNQKIPNARVISYALIP--DF----PEGPRKIL---FIIGGGVA-GI
A0A367R4K6      ETLLKKRQEIDIAQNQKIPNARVISYALIP--DK----PEGPRKLL---FIVGGGAI-GF
A0A1E2WSV8      ETLLKKRQEIDVAQNQKIPNARVISYALIP--DK----AEGPRKIL---FIVGGGGI-GL
A0A2R5FRT9      ETLLKKRQEIDIAQNQKIPNARVISYALIP--DK----AEGPRKIL---FIVGGGGI-GL
A0A2K8T1B6      ETLLKKRQEIDIAQNQKIPNARVISYALIP--DK----AEGPRKIL---FIVGGGGV-GL
A0A235I9I0      ETLLKKRQEIDIAQNQKIPNARVISYALIP--DK----AEGPRKML---FIIGGAGV-GF
A0A2D0HQT8      ETLLKKRQEIDIAQNQKIPNARVISYALTP--DK----AEGPRKML---FIIGGAGV-GF
A0A2L2NU95      ETLLKKRQEIDIAQNQKIPNARVISYALIP--DK----AEGPRKML---FIVGGAGV-GF
A0A367S084      ETLLKKRQEIDIAQNQKIPNARVISYALTP--DK----AEGPRKML---FIIGGAGI-GF
A0A0V7ZFJ4      TELLKKLQEVQVVENRSVGNATIISEALVP--EH----PISPNITR---NLLLGGIG-GI
A0A367RIS1      EQMLKRLQEVQVLENQNVGNARIVSEALLP--KK----PISPRILL---NLALGGFL-GF
A0A235IXQ2      EQMLKRLQEVQVLENQNVGNATIVSNALVP--KK----RISPRISL---NLALGGFL-GF
A0A1W5CNX3      EQMLKRLQDVEVVENQNVGNARIVSEALLP--KT----PVSPRIVL---NLALGGFL-GF
A0A5Q0GJJ5      EQMLKRLQDVEVVENQNVGNARIVSEALLP--KT----PVSPRIVL---NLALGGFL-GF
Q3MEB7          EQMLKRLQDVEVVENQNVGNARIVSEALLP--KT----PVSPRIVL---NLALGGFL-GF
A0A1Z4KHN9      EQMLKRLQDVEVVENQNVGNARIVSEALLP--KT----PVSPRILL---NLALGGFL-GF
Q8YT70          EQMLKRLQDVEVVENQNVGNARIVSEALLP--KT----PVSPRILL---NLALGGFL-GF
A0A218Q4C1      EQLLGRLQEVQLVENQNVGNARIISEALLP--DK----SISPRIKL---NLALGGFL-GI
A0A166IWU6      EQMLRRLQEVQVAENQNVGNARIVSQALLP--EK----SVSPRINL---NLALGGFL-GI
A0A2S0Q8C0      EQMLRRLQEVQVAENQNVGNARIVSQALLP--EK----SVSPRINL---NLALGGFL-GI
W6FSX4          EQMLRRLQEVQVAENQNVGNARIVSQALLP--EK----SVSPRINL---NLALGGFL-GI
A0A0V7ZNJ9      QNLLKKLQEVQVIENQNIGNARIISEALVP--DK----KISPRIAL---NLLLGGFL-GI
A0A0R0M9H9      QQLLKQLQEVQVLENQNVGNARVISSALVP--EI----PISPRTAL---NIGIGALV-GL
A0A1S1ZVW2      QQLLKQLQEVQVLENQNVGNARVISSALIP--EI----PISPRTAL---NIGIGGIV-GL
A0A1B7WX82      QEFLKQFQLVAVLENQNVGNSRIISQALVP--ER----PVSPKKPL---NLAMGGFL-GI
A0A1B7WTD1      QELLRQFQLVQVMENQNVGNARIISEALVP--EI----AVSPKKPL---NLALGGFL-AL
A0A480ABC0      QELLRQFQLVQVMENQNVGNARVISEALVP--EI----AVSPKKPL---NLALGGFL-GL
A0A1Z4LRU5      QQLLKQLQEVQVVEKQNVGNAKVIASALVP--NK----PISPKIAL---NLALGGFL-GI
A0A1Z4JVB4      EQVSKQLQESEIIENQKVGNARVLSEALVP--DK----PISPIIAI---NLALGGAL-GI
K9PIA4          EQFLRQLQEIQVLENQNIGNARVISQALVP--NR----PVSPVIHL---NLALGGFL-GI
A0A1Z4M597      EQLSKQLQEVEVVENQNVGNARVISEALVA--DK----SVSPIIPL---NLALGGIL-GI
A0A1Z4MWT1      EQLSKQLQEVEVVENQNVGNARVISEALVP--DK----SVSPIIPL---NLALGGIL-GI
A0A1Z4TX53      EQLSKQLQEVEVVENQNVGNARVISEALVP--DK----SVSPIIPL---NLALGGIL-GI
A0A1Z4HVE1      EQLLKQLQEVEVIENQNIGNARVISQALVP--DK----AISPIIPL---NLALGGFM-GI
A0A252ECZ1      EQLSKQLQEVEVIENQNIGNARVISEALVP--ER----PVSPVIPL---NLALGGFL-GI
A0A1Z4G5Y1      EQLMKQLQEVEVIENQNIGNSRVISDALVP--EK----PVSPIVPL---NLGLGGVL-AI
A0A252DNA2      EQLLKQLQEVEVLENQNIGNSRVISEALVP--DK----PVSPIVPL---NLGLGGVL-GI
A0A252E1Q4      EQLLKQLQEVEVLENQNIGNSRVISEALVP--DK----PVSPIVPL---NLGLGGVL-GI
A0A5P8VSD1      GQMMKRLQETQILENQNVGNARILSEALLP--KK----PVSPIILL---NLALGGFL-GF
A0A2A2TNQ5      QQVQKQLQEVEVVEQQKVGNARIVSEALVP--EK----PVAPKIPL---NLALGGFL-GV
A0A3S1C4K5      QQVLKQLQEVEVVEQQKVGNARVVSAAEVP--EI----PVSPKIPL---NLALGGVL-GI
A0A1X4G3D5      KQLQKQLQELEILQGETTGTARVLSSALVP--KR----PVSPRIPL---NIGIGAIL-GV
D4TNI2          KQLQKQLQELEILQGETTGTARVLSSALVP--KR----PVSPRIPL---NIGIGAIL-GV
A0A1Z4H6Z8      EQLVKQLQEVEMIENQNVGNARVISDALVP--DK----AVSPIIPL---NVALGGFL-GI
A0A1Z4NPM1      QQVLKQLQEVEVAEQQKVGNARIVSPALVP--DK----PVSPKIML---NLALGGFL-GV
A0A3F3KPR9      QQLLKQLQEVQVLENQNVGNARVISSALVP--EI----PISPRTAL---NIGIGALV-GV
D4TGN7          QQLLKQLQEVQVLENQNVGNARVISSALVP--EI----PISPRTAL---NIGIGALV-GV
A0A1Z4UZW9      QELLKQFQFIEVLENQNVGNSRIISEALVP--ER----PVSPKIPL---NLALGGFL-GI
A0A0K2M5H0      QEFLKQFQLVQVLENQNVGNSRIISGALVP--ER----PISPKIPL---NLALGGFL-GV
A0A1B7VSH4      QEFLKQYQLVQVLENQNVGNSRVISEALVP--EL----PVSPKIPL---NLALGGFL-GV
A0A1B7W126      QEFLKQYQLVQVLENQNVGNSRVISEALVP--EL----PVFPKIPL---NLALGGFL-GV
A0A3D4C6Q6      QEFLKQYQLVQVLENQNVGNSRVISEALVP--EL----PVFPKIPL---NLALGGFL-GV
A0A1B7UVJ4      QEFLKQFQLVAVLENQNVGNSRIISQALVP--ER----PVSPKKPL---NLAMGGFL-GI
A0A1B7UTR1      QEFLKQFQLVQVLENQNVGNSRIISEALVP--ER----PVSPKIPL---NLALGGFL-GI
A0A5C0DRW9      QEFLKQFQLVQVLENQNVGNSRIISEALVP--ER----PVSPKIPL---NLALGGFL-GI
K7W0A4          QEFLKQSQLVQVLENQNVGNSRIISEALVP--ER----PVSPKIPL---NLALGGFL-GI
A0A1U7HGH0      EALLRSLQEIKVIENRTVGNVQIIEYAQVP--SG----AINASNTS---ALAAGSLA-GL
K9XJD3          EALLRSLQEIKVIENRTVGNVRIIEYAQVP--SG----AINASNTS---ALAAGSLA-GL
A0A2T1CIL7      QTLLGQLQDTQVAENQNVGNVRIIADAIVP--EK----PTSSTQKK---LITLIGSAMGV
A0A1Z4RPC6      NTLLDNKQEIDILVNQQTGNAEVIELGKVP---D----KGSTGRVF---LIALGVLM-GL
A0A2T1CMZ0      KTLLENKSDLDVLVNQQTGNAQIIESGIVP---E----EGSTGRLP---LIVLGVLT-GL
L8M4F7          KNLLDSLEQVELELLQETSNVEIVEPALVP---I----KGTSSKMK---LLALGVMG-GL
A0A140K2P2      ETLLTSLQEVQLAENQQNGNAQIIELAKLP---E----KGSSGRMA---FMLVGILL-GL
K9XWX4          ETLLTSLQEVQLAENQQNGNAQIIELAKLP---E----KGSSGRIA---FMLVGILL-GL
A0A140KB14      QNLLDSQQELQLLQNQKSGNAQIIELAQLP---E----EGSSGRLA---LMVLGVIL-GL
K9XX88          QNLLDSQQELKLLQNQTTGNAQIIELAQLP---E----KGSSGRLA---LMVLGLIL-GL
A0A563VSV6      ENLLSTQQELQILRNKQTGNAEIIEQAIAP---E----NGSTGRMA---LMLLGILM-GL
L8LZE9          ENLLNTQVELDILQNKQTANARIIEPAIAP---E----KGSSGQLA---LMALGILS-GL
A0A433V7A0      QLLLQRLQEVRVAENQNIGNARIIESASIP-RHA----SDFTIKII---ILGLGGLV-GT
A0A1Z4NDS1      ENLLNREQEIRIAENQNIGNARIVSYALVP--DT----PAGPKKIL---IIAAGAIA-GF
K9F4D9          ETLLQNLQQAQVLENQNIGNARIVSPALIP--NE----PLGPSLKL---FLMTGGFA-GL
U9VXM0          ETLLQNLQQAQVLENQNVGNARIVSPALSP--TE----PIGPSLKL---FLLAGGFV-GF
A0A2T1FTR8      KTLLSKLQEIEIAENQTLGNSRILTHAELP--QE----ALSPKKGQ---NIAIGGFL-GL
K9UA41          KTLLSKLQEIEIAENQTLGNSRILTHAELP--QE----ALSPKKGQ---NIAIGGFL-GL
A0A0C2LBE2      ETLLTRLQEVQVAENQNIGNARVISPALVP--DK----STGSGKIL---IIGAGGIL-GV
A0A433NN38      ENLLTRMQEVDVAENQNVGNATIISPALIP--DK----PSGPRKTL---LIAAGGIL-GI
A0A2N6K0T2      ETLLTRLQEINVAENQNVGNARIISPALVP--DE----PSGVRKAL---IAAGGGVL-GI
A0A2N6ML72      ETLLTRIQEINVAENQNVSNARIISPALVP--DE----PSGTRKAL---IAAGGGVL-GI
G6FQZ6          ETLLTRIQEINVAENQNVSNARIISPALVP--DE----PSGTRKAL---IAAGGGVL-GI
A0A2N6MQX9      ETLLTRIQEINVAENQNVSNARIISPALVP--DE----PSGTRKAL---IAAGGGVL-GI
A0A2N6KXT6      ETLLTRIQEINVAENQNVSNARIISPALVP--DE----PSGTRKAL---IAAGGGVL-GI
A0A2N6KGB9      ETLLTRIQEINVAENQNVSNARIISPALVP--DE----PSGTRKAL---IAAGGGVL-GI
A0A2N6L3Y5      ETLLTRIQEINVAENQNVSNARIISPALVP--DE----PSGTRKAL---IAAGGGVL-GI
A0A0S3TIS7      ETLLTRIQEINVAENQNVSNARIISPALVP--DE----PSGTRKAL---IAAGGGVL-GI
A0A1U7GW28      ETLLTRIQEINVAENQNVSNARIISPALVP--DE----PSGTRKAL---IAAGGGVL-GI
A0A2N6LW63      ETLLTRIQEINVAENQNVSNARIISPALVP--DE----PSGTRKAL---IAAGGGVL-GI
A0A328IH74      ETLLTRLQEINVAENQSIGNARIISPALVP--DE----PSGMRKAL---IVFGGGVL-GI
A0A4D9CIB0      ETLLTRLQEINVAENQSIGNARIISPALVP--DE----PSGMRKAL---IVFGGGIL-GI
A0A1Z4TQ63      ETLLTRLQEINVAENQNIGNARIISPALVP--DE----PSGTRKAL---IVLGGGVL-GI
A0A4Q9J8G2      ETLLTRLQEINVAENQNIGNARIISPALVP--DE----PSGMRKAL---IVFGGGIL-GI
A0A1Z4SMD6      ESLVNRSQEIQVAERQTVGNARVIQHARVP--NK----PTLSKSTL---ALAGGGVFGGL
A0A2H2Y096      ESLVNRSQEIQVAERQTVGNARVIQHARVP--NK----PTLSKSTL---ALAGGGVFGGL
K9S8M8          DILSRNLQQVQIIENQNVGNARIVSSASFP--SK----PVGPNKKV---VLMGGMVV-GG
A0A1Z4NFV0      EHLLSRLQEIRVAENQTVGNARIIQAAAPP--PL----PAKSKMSL---LIGVGGVFAGL
B0CAX4          EELLKALQQITISENQNIGNVRVIAAALEP--KE----PVSPRKAF---NLAVGFFL-GG
U5DPF5          EALLQRLQEVRVTENQNLGNARVVENALVP--IN----PIWPRMQL---ILMAGGIV-GA
A0A350Y0P6      DILLKNYQQIRIAENQNVGNARVITYASIP--EA----PVSPKKKL---ILVGGIVA-GS
A0A352X940      EILLRNYQDVRIAENQNVGNADILARALVP--ED----PVSPKKKL---ILGGGIIA-GS
B8HTN4          EGLLKTLQSLQISEQQNAGNVRLIQAATLS--DE----PVSPKLLL---NLILGTIL-GS
A0A2A2TPF8      KQLLTRLQEVRVAENQNVGSARIVQDAAVS--NQ----PVRSKLTM---YLAAGGVFVGL
A0A1Z4R0P8      KNLLTRLQEVRVAENQNVGSARIVQEAVVP--NQ----PVSSKLTL---YLAAGGIFVGL
A0A0T7BUI3      ENLNARLQEIQVAEKQTIGNAKIIQPAQIP--ET----PMLSKKSL---MLALGSLFAGS
A0A1Z4LP32      ENLITRQQEIELAEKQTIGNSRIIQSARIP--NK----TVLSKMTI---MLAGGGVFVGL
K9REP9          ENLITRLQEIELAEKQTIGNSSIIQKARVP--KK----PSLSKMTL---LLAGGGVFVGL
A0A1Z4SIJ3      QNLQDRLQEIEIAEKQTIGNARIIQPARLP--NK----PVLSRLTL---LLAAGSAFAGL
A0A2H2XPG4      QNLQDRLQEIEIAEKQTIGNARIIQPARLP--NK----PVLSRLTL---LLAAGSAFAGL
K9V3C7          EELLTRQQAIRLAENQAMGNARVIQNAIAP--NS----PISSKLTL---LLAVGGVFVGV
A0A1Z4T6Y7      ETLLGRLQEIRVAENQTVGNARVIQNAVVS--PN----PARLRMMF---LLGAGGIFIGA
A0A2H2Y561      ETLLGRLQEIRVAENQTVGNARVIQNAVVS--PN----PARLRMMF---LLGAGGIFIGA
A0A1Q4S362      ETLLGRLQEIRVAENQTIGSARIVQNAVVS--PN----PARMRMML---LLGAGGIFIGA
A0A3S1CIN8      ETLLGRLQEIRVAENQTIGSARIVQNAVVS--PN----PARMRMML---LLGAGGIFIGT
A0A2A2TC28      QNLVARLQEIEIVEKQTIGNARVVQPALVP--KI----AAMSKMTL---LLLGGGVFVGL
A0A0C1NCB0      ENLTLRLQEIQVAEKQTVGNARIIQPAQLP--QK----PALSKLTL---LLPVGGILGGL
A0A2N6K7Q9      ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLAGGSIFAGV
A0A2N6MXH6      ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLAGGSIFAGV
A0A2N6M5A8      ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLAGGSIFAGV
A0A2N6LL61      ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLAGGSIFAGV
A0A0S3TP66      ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLAGGSIFAGV
G6FP91          ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLAGGSIFAGV
A0A1U7GYR5      ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLAGGSIFAGV
A0A2N6KY52      ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLAGGSIFAGV
A0A2N6KMP5      ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLAGGSIFAGV
A0A2N6MA45      ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLAGGSIFAGV
A0A4Q9J9V9      ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLASGSIFAGV
A0A328IGA1      ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLASGSIFAGV
A0A4D9CE41      ENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KK----PVISKTKI---LLASGSIFAGV
A0A0M0SFT2      ENLVSRLQEIQVAEKQTIGNARIVQPAQTP--KK----PVISKTKI---LLASGSIFAGV
A0A1Z4TLC8      ENLVSRLQEIQVAEKQTIGNARIVQPAQIP--KK----SVISKTKI---LLATGSIFAGV
A0A0C2LFH0      ENLVTRLQDIEVAEKQTVGNAKEIQLAQVP--KR----PSVSKITF---LLAGGSVFVGL
A0A1Z4IYV4      ENLVSTLQEIEVAEKQTVGNAKEIQAAKVP--KK----PVLSKVVL---LLAGGGVFVGL
A0A1Z4Q0T6      ENLVTRLQEIEVAEKQTVGNAKEIQPAKVP--KK----PVLSKLVL---LLVGGGVFVGL
A0A0C2PT44      ENLVTRLQEIEVAEKQTVGNAREIQPAKVP--KK----PVLSKVVL---LLAGGGVFVGL
A0A1D2P6J4      ENLVSRLQEIEVAEKQTVGNAKEIQPAQVP--KK----PVISKVVL---LLAGGGVFVGL
A0A4R4IQ40      EILLQKLQEVKVAENQNMGNARIIESALAP--EK----ALLLKPVM---ILAAGILL-SV
A0A433W533      EILLQKLQEVRVAENQNMGNARIIESALAP--EK----ALSLKPMI---ILAAGILL-SV
A0A2P8QWJ3      EILLQKLQEVRVAENQNMGNARIIESALAP--EK----ALLFKPMI---ILAAGILL-SV
A0A2T1FKP8      EILLQKLQEVRVAENQNMGNARIIESALAP--EK----ALLFKPMI---ILAAGILL-SV
K9U6L7          EILLQKLQEVRVAENQNMGNARIIESALAP--EK----ALLFKPMI---ILAAGILL-SV
A0A3M9ZEU1      ETLLTRLQEVQVAENQNVGNARVISSAIVP--EE----PSGLSKKV---YLLAGGIV-GA
A0A1Z4JK72      ENLTSRLQEIQVARNQQVGNARVLQNALVP--TQ----PTGRMRLI---LLAAGTMI-GL
A0A0N7Z489      QNLNARKQEIEVAKNQQVGNARVLQSAMVP--TR----PAGRMRLI---LLAAGAMV-GL
A0A0S3TXS2      QNLNARKQEIEVAKNQQVGNARVLQSAMVP--TR----PAGRMRLI---LLAAGAMV-GL
A0A1Z4RN12      KTLLAKLQEAEIIEQRNTGKVRVTAPAAIA--ED----PVNPDKKV---IVAAGAMM-GA
A0A2T1CMF9      QTLLSKANEISIRQDYKVDKVRVISVAALA--ED----PVNPDAKV---IVAAGAMM-GL
Q7NDC5          RLLQKKFYEYRILEAQNIGNATLIEPAEVP--EI----PAWPKPLL---NLAAGGVL-AL
U5QGK3          KLLQTKFHEYRILEAQNIGNAELIEPAVAP--EL----PAWPSPLL---NLGAGALL-GA
A0A2W4UY24      ETLLASRQQAQVLEKQDVGNARTISLADLP--EE----SISPALKL---YLLAGGVV-GA
A0A2T1GMT4      QSLLKKLQELQVARNKSTSNARIISSAAVP--EK----PDPGPKLI---IGILGGLV-GA
K9UI51          QSLLKKVQELQVARNKSTSNARIISSAAIP--EK----PEPGPKLI---LGILGGLV-GA
K9QM62          QNLLRKTQELQVAEHKNTANARIISQALVP--EE----PVLKKKII---VVVLSVMF-GA
A0A1Z4FWI3      QTLLKKIQELQVAENDNTPNARIIARGLVP--TK----PGLGLKPI---VWLLGILL-GA
A0A1Z4JYE7      QTLLKKVQELQVAENANTANARIIARGSVP--EE----PLAAKKML---VLVIGAMF-GL
A0A2T1FXY4      QTLLKKVQELQVAENKTTAHARIIAQALVP--NK----PVLEQKLI---VLVLGTMF-GA
A0A4V2X3N2      QTLLKKIQELQVAENKTTAHARIIAQALVP--EK----PVLEQKLI---ILALGIMF-GA
K9TYI2          QTLLKKVQELQVAENKTTAHARIIAQALVP--EK----PVLEQKLI---ILALGIMI-GA
A0A1Z4QL41      GTLLKKIQALQVAENQNTASARIITEAIIP--KK----SSGGKKLI---VLLLGGTL-GV
A0A252D4T4      QTLLKKVQELQVAENNNTPNARIIAKGLVP--NK----AALGLKPF---VLVLGILL-GA
A0A252DJH5      QTLLKKVQELQVAENNNTPNARIIAKGLVP--NK----AALGLKPF---VLVLGILL-GA
A0A252EB80      QTLLKKVQELQVAENNNTPNARIIAKGLVP--TK----PALGLKPF---VLVLGILL-GA
A0A1Z4HPW5      QTLLKKVQELQLAENNNTPNARIIAKGSAP--KK----PTLGLKPF---ILVLGVLL-GA
A0A1Z4MSN1      QTLLKKVQELQLAENNNTPNARIIAKGSVP--NK----PTLGLKPF---ILVLGVLL-GA
A0A1Z4U1C2      QTLLKKVQELQLAENNNTPNARIIAKGSVP--NK----PTLGLKPF---ILVLGVLL-GA
A0A0D6KV51      QTLLKKVQELQLAENNNTPNARIIAKGSVP--IK----PTLGLKPF---ILVLGVLL-GA
A0A1Z4MKF8      QTLLKKVQELQLAENNNTPNARIIAKGSVP--IK----PTLGLKPF---ILVLGVLL-GA
A0A2C6WC43      QTLLKKVQELQLVENTNTASSRIIAQALVP--TD----PVAGKKFL---VLLLGIML-GL
A0A1Z4L5A1      QTLLKKVQELQLVENTNTASSRIIAQALVP--AD----PVAGKKLI---VLLLGVMF-GL
A0A367QD86      QTLLKKVQELQLVENTNTASSRIIAQALMP--TD----PVAGKKFL---VLLLGVMF-GL
A0A235IZ96      QTLLKKVQELQLVENTNTASSRIIAQALVP--KD----PIVVKKII---VLVLGVMF-GL
A0A2L2NGP0      QTLLKKVQELQLVENTNTASSRIIAQALVP--KD----PIVVKKII---VLVLGVMF-GL
A0A2K8SM78      QTLLKKVQELQLVENTNTASSRIIAQALVP--KD----PVVGKKII---ILLLGVMF-GL
A0A2R5FPC0      QTLLKKVQELQLVENTNTPSSRIIAPAVVP--NK----PVIGKKII---ILLLGVMF-GL
A0A5P8W5T6      QTLLKKVQELQLVENTNTASSRIIVPALVP--NK----PVTGKKII---VLLLGVMF-GL
A0A140KBA0      QTLLGKLQETQVAEKQNIGTVRVLANAIPP--DE----PTGPSKKL---IVAAGGLL-GG
K9XSG1          QTLLGKLQETQVAEKQNIGTVRVLANAIPP--DE----PSGPSKKL---IVAAGGLL-GG
A0A0F5YE28      ETLLKNLEEVQVAENKSTNNARVIEEAIVP---E----EGSTAKTK---LIALGIML-GL
U7QEH7          ETLLKNLEEVQVAENKSTNNTRIIEEAMVP---E----EGSTAKIQ---LLALGIML-GL
A0A3S1ATK5      ETILKKAQELQVAQNKNTANARIITQAKIP--EK----PASGKKPI---VVAIGVLL-GA
A0A2Z6CPH0      QNLLKKVQELQLAENRNTANARIIAQALVP--EK----PTSGKKLI---ILVMGVMF-GA
A0A1Z4GT50      QTLLKKVQELQVAANKNTANARIIAQASVP--EE----AVLGKKPI---VLSLGVLL-GL
A0A1Z4GIX0      QTVLKKVQELQVAENKTTPNARVVAQATVP--EK----PESGKKLI---FIALGLTF-GA
A0A2H6LC24      QTVLKKVQELQVAENKTTPNARVVAQATVP--EK----PESGKKLI---FIALGLTF-GA
B2J6N5          QTLLKKVQELQLVENTNTASSRIIAQAIVP--DK----PVESKKII---VLVLGVMF-GL
A0A367RMI4      QTLLKKVQELQLVENTNAPSSRIIAQALVP--KD----PTLTKTII---VLVLGVMF-GL
A0A235HUM0      QTLLKKVQELQLVENTNTPSSRIIAQALVP--KD----PTLGKKII---VLVLGVMF-GL
A0A2L2NW47      QTLLKKVQELQLVENTNTPSSRIIAQALVP--ED----PTLTKTII---VLVLGVMF-GL
A0A1E2WUR1      QTLLKKVQELQLVENTNTASSRIIAQALVP--KD----PVAGKKII---VLVLGVMF-GL
A0A235IKU3      QTLLKKVQELQLVENTNTASSRIIAQALVP--KD----PILVKKII---VLVLGVMF-GL
F4XKF3          ETLLKNLNELKVAENQDTANARIIEPAIVP--KK----PLGDKKIK---VLALGVML-GV
A0A1D9FX10      ETLLKNLNELKVAENQDTANARIIEPAIVP--KK----PLGDKKIK---VLALGVML-GV
A0A1D8TNX9      ETLLKNLNELKVAENQDTANARIIEPAIVP--KK----PLGDKKLK---VLALGVML-GV
A0A1U7MYU6      ETLLKNLNELKVAENQDTANARIIEPAIVP--KK----PLGDKKIK---VLALGVML-GV
A0A3C0NJ41      QALLKKQEELKLAENQSIGNARIIEPALVP--ET----RSPINAII---TLLFGGTA-GT
A0A352AG88      EILLKKLQEVRVAENQNIGNARIIEPAEVPLLPS----SQMVQTVL---PVVGGGAL-GI
A0A350Y374      QTLLQKLQELRLAENQNIGNARIVEPAQIP--DS----RSSGKSVL---ILLLGAMA-GT
A0A355DPX0      QTLLQKLQELRLAENQNIGNARIVEPAQIP--DS----RSSGKSVL---ILLLGAMA-GT
A0A0D8ZUV2      QSLLQKLQELKVAENQNTGNASIVEPALVP--DK----ASIKLRVM---ILGLGVIV-SA
A0A433VDI0      ETLLKKIQEVRVAANQRIGNAQIIEPAPIP--KK----PSLLKPAI---ILALGNML-GI
A0A3D1PG43      EILLRKQQEVKVEENRNIGNASIIETALVP--EQ----PTGGKKLI---ILGLGSVL-AT
A0A2P8QQ72      ELMLKKLQELRVEQNRNIGNASIIETALVP--ET----PLLGKRVM---TLGLGGIA-AI
K9TZQ7          ELMLKKLQELRVEQNRNIGNASIIETALVP--ET----PLLGKRVM---TLGLGGIA-AI
A0A2G7GPR0      ETLLRRLQEVRVAENQNMGNARIIEFATVP--EN----SSVRKRAM---ILALGNVL-AL
K9XH68          ETLLRRLQEVRVAENQNMGNARIIEFATVP--EN----ASVRKKAM---ILALGNIL-AL
A0A1U7HW70      ETLLRRLQEVRVAENQNMGNARIIEFATVP--EN----ASVRKKAM---ILALGNIL-AL
A0A2S6VEJ8      ETLLRRLQEVRVAENQNMGNARIIEFATVP--EN----ASVRKKAM---ILALGNVL-AL
                                                                          . 

K9SLA9          AFAGLVTFILAAIDKSIKTSEQASDISG-YSLLGIVPDFGYVAKHDQMMRK---------
A0A168TT23      VVGVGLALLLEFLDSTVHRTEDVEKLVG-RPVLGLIPIVKLSEQRKKSGT----------
A0A0M1JWX9      MLGFGAALLVEQLDFVFHNPEDLKQATD-KPLLGLIPISDRAKQLASSSW----------
A0A2T1M1V6      LFGSLSVLLLLESRNPLFNSKDLQQAG--LPLVLRFPRLRSLSLEKGLDE----------
A0A2G7GCS2      LFGSISLIFFLEKRNPMLRPKDLEQVE--FPVLGRISRLKRTDMERNLSG----------
K9XBH8          LFGSVSLILFLESRNPMLSPRDLRQVE--FPVLGRISRLKRPDMERALSA----------
A0A1Z4LJ30      GFGSAAIILFSENRDPLLSPKDIVQTN--IPVLANIPYIKNIHGKLEQKL----------
K9RI76          GFGSAAIILFMENRNPLLSPKDIQQAN--IPVLASIPYVRHINAKADRKL----------
A0A352AE27      VVGSIALLLLLEARNPLLSPKDLQTLK--FAIVVRIPRLKQSVVGLGLTT----------
A0A3B8JH60      IVGSVALVLFLESRNPLLSPKDLQAIK--FPIVVRIPRFKQSDRALKLGT----------
A0A3C0N766      IVGSVALVLFLESRNPLLSPKDLQAIK--FPIVVRIPRFKQSDRALKLGT----------
K9W9J7          IIGSIALVLLLESRNPLLSPKDLQATK--FPIVVRIPRLRHSNLSWQVGT----------
A0A139WSU3      IIGSIALVLFLESRNPLLNLKDLQGQK--FAIVQSIPRIKHSDPKIEMTS----------
A0A433VN22      VIGSIALVLFLESRNPLLSAKDLQEQK--FAIVERIPRIKHSGVISELAI----------
Q7NF11          VFGSLGLILRKEAINPLLGPKDLQSVE--LPVLARLPRTKGL---LPSGD----------
A0A1Z4JCS8      VIGSIALILLLEARNPLLTPKDLQALK--FSLVARIPKLKRLAIEPNSSF----------
F4XTX2          AVGSIALVLLLERRNPLLSPKDLQAIK--FPMVVNIPHLRHAGMGLELGT----------
Q7NJN6          LSGSIALALWLERRNPMLGVRELDSTG--LPVLGRIPKLKDA----ALSA----------
U5QCC3          IAGSVALALLLERRNPLLAKRDIEVTG--LPVLARLPKFKDN----EL-I----------
A0A3S0Y9N9      LLGVATAFILEKMDKTIKTPESARELLG-YNLLGYIPPFT--------------------
A0A433UNK7      VLGVATAFVLERLDKTIKTSKSAKDILG-YNLLGYIPPFP--------------------
A0A3M1SVZ4      LAGVATALLLEVQDRSIKSVGEAKAQLQ-FALLGVIPQVR--------------------
A0A654SFI6      IGAGALIYGRVVLSQTIKDPQDVTRELG-LSLLGTIPKSD--------------------
K9SSQ0          LVAAIIITVLENSDDRLQQVSQLQTLSD-LPLLGAVPYLA--------------------
A0A2W1JIN9      VLSIGTVILLEALNRKLYSADEIEELVE-LPVLSTLPRLS--------------------
A0A318AJV1      GCGLATVIVMEMLQGGLRTIGEVEARLG-LPVLASVPA----------------------
A0A1U7N2U4      ALAVGMVLLLEVMDNTLHDGSEAEALLK-LPRLGVLPTIP--------------------
A0A1D9G1F2      ALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLPKIP--------------------
F4XV38          ALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLPKIP--------------------
A0A2P8QIL5      TLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVLPVIS--------------------
A0A2T1FLY5      TLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVLPVIS--------------------
A0A433W447      TLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVLPVIS--------------------
K9U1K8          TLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVLPVIS--------------------
A0A4V6P809      TLALGTVLLQEGLDGTLRNATEAGSLVE-VPIIGVLPVIS--------------------
K9UYB2          VSAIALIILLEMLDNKLHDQDETEELLQ-LPLLGVLPRLP--------------------
A0A218QN17      VLGTGVMLLLEVLDNTLKDASEAEELVS-LPLLGVLPRLP--------------------
K9RKN2          ILATGVILLLELMDNTLRDARDAEQLLN-LPLLGVLPRLP--------------------
A0A2I8ADV2      ILATGVVLLLELMDNRLYEVAEAEELLK-LPLLGILPRLP--------------------
A0A1W5CKM3      ILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLPRLP--------------------
A0A5Q0GMF5      ILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLPRLP--------------------
Q3MEW0          ILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLPRLP--------------------
A0A1Z4KIC7      ILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLPRLP--------------------
Q8YSM5          ILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLPRLP--------------------
A0A1Q4S1H4      LLSTGMVLLLEMMDNRLHDVAEAE-LLN-IPLLGILPRLS--------------------
A0A433VBU6      LLSTGMVLLLEMMDNRLHDVAEAE-LLE-LPLLGVLPRLS--------------------
A0A1Q4RZJ6      LLATGVVILLEIMDNTLHDASEAEELLK-LPLLGVLPRLP--------------------
A0A1Z4SNV3      LLATGVVILLELMDNTLRDASEAEELLK-LPLLGVLPRLP--------------------
A0A2H2XJQ1      LLATGVVILLELMDNTLRDASEAEELLK-LPLLGVLPRLP--------------------
A0A3S5K358      LLATGVVILLEVMDNTLHDASEAEELLK-LPLLGVLPRLP--------------------
A0A0T7BPJ4      VLATGIILLLEAMDNTLRSGWEAQDLLK-LQLLGVLPRLP--------------------
A0A0C1QS61      LLATSIVLLLEMMDNTLRDASEAEELLK-LSLLGVLPRLP--------------------
A0A139X3R8      LLATSIVLLLEMMDNTLHDASEAEDLLK-LSLLGVLPRLP--------------------
A0A1Z4I7C5      VLAVGLVLLLELMDNTLRDASEAEELLQ-LPLLGVVPRLP--------------------
A0A0C2MDK7      MLAVGVVLLLEVMDNTLRDATEAEELLQ-LPLLGILPRLP--------------------
A0A1Y0RCK1      VLAVGVVLLLELMDNTLRDATEAEELLQ-LPLLGVLPRLP--------------------
A0A1Z4PWZ0      MLAVGVVLLLEIMDNTLRDASEAEELLQ-LPLLGVLPRLS--------------------
A0A0C2QLT0      MLAVGIVLLLEVMDNTLRDASEAEELLQ-LPLLGVLPRLP--------------------
A0A1Z4J2K1      MLAVGVVLLLEMMDNTLRDASEAEELLQ-LPLLGVLPRLP--------------------
A0A3S0ZSX0      ALATGIVLLLELMDNTLKDASEAEELLD-LPLLGVLPRLP--------------------
A0A2N6K4T3      ALATGIVLLLELMDHTLKDASEAEELLR-LPLLGVLPCLP--------------------
A0A370CKT2      ALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLP--------------------
A0A0S3TL97      ALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLP--------------------
A0A2N6M8A0      ALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLP--------------------
A0A2N6M9E1      ALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLP--------------------
A0A2N6KJI4      ALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLP--------------------
A0A2N6MZ77      ALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLP--------------------
A0A2N6KT20      ALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLP--------------------
G6FSN3          ALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLP--------------------
A0A4D9CI02      ALATGIVLLLELMDHTLKDASEAEDLLK-LPLLAVLPSLP--------------------
A0A328I8B9      ALATGIILLLELMDHTLKDASEAEDLLK-LPLLGVLPSLP--------------------
A0A4Q9J4Z7      ALATGIILLLELMDHTLKDASEAEDLLK-LPLLGVLPSLP--------------------
A0A0M0SU69      ALATGIVLLLEFMDHTLKDASEAEELLK-LPLLGVLPRLP--------------------
A0A1Z4TIZ8      ALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLP--------------------
A0A0S3TYD7      LLAFAATVLAYLLDRRIRTVQDLKDVFD-YPVLGMIPSFTDSGLSQVMESLTKNLQKL--
U5QL42          FLGLGAAFVPDLIDERIKGVEEAKELTG-LPLLGAIPKTEN-------------------
K9QF04          LAGIGTAIAVEKFDNKYHSPEEIQDNTG-LTLLGTIP-----------------------
A0A3C0N2P0      MAGAGVAFLAEKLDKVFHSPDELKDSTG-LPILGTIPFTKKL---KEDIG----------
K9TLQ0          MAGIGAALLAEKLDTKFHSVEDIKDYMG-FPILGTIP-----------------------
A0A076HBF2      VAGAAAGLLRDRMDHVFHHAGEVKDDLG-LPLLGHIPHVEFFKGVREDKRFLL-------
A0A354B169      VAGAFAGLLRDRLDHVFHTAAEAKADLR-LPLLGHIPHVNFFQGVREGKRFQL-------
G4FMX5          VAGAGAGLLRDRKDHVFHSPGEVKAEIGDLPLLGHIPYVDFFKGVREDKRFPL-------
Q0IDT5          VAGVAAGLIRDRFDHVFHLPAEVKDDLN-LPLLGHIPHVAFFKGVREDKRFLL-------
A0A2D6FCW3      VAGAAAGLLRDRMDHVFHHAGEVKMDLG-LPLLGHIPHVDLFKGVREDKRFLL-------
A3ZA21          VAGAGAGLLRDRLDHVFHHPGEVKDDLG-LPLLGHIPHVSFFQGVREDKRFLL-------
A0A140K3H3      LMGVATAFLLQKLDQRVKQVEEVKQMVR-LPLLGTIP--------------KV-------
K9XUB8          FMGVATAFLLQKLDQRVKQVEQVKQIAR-LPLLGTIP--------------KV-------
Q7NEU3          VFGLGIASLLESVDDRVKSISQAKELLN-LPLLGAIPFTEEE---DLQAS----------
A0A352XE00      IAGAGAGSLAEKLDKAFHSLDELKDSTG-LPILGTIPFDKVVKNSKKQIKTNS-------
B4VS56          LAGAGAGFLAEKLDKVFHSAEEVKEKTG-LAVLGTIPFHKPLKKPSKSAKTAG-------
A0A352AAQ3      LAGAGAGMLAEKLDKAFHSPDELKDSTG-LAVLGTIPFGKELKKGIARPVPAA-------
A0A350Y472      LAGAGAGMLAEKLDKAFHSTDELKDTTG-LPLLGTIPFSKELKKNITRSATPS-------
A0A355DVB4      LAGAGAGMLAEKLDKAFHSTDELKDSTG-LPLLGTIPFSKELKKTITRPATPP-------
A0A2P8VVX1      FVGGALAFGVESIDQRVRTSDELKKQVP-LPLLGMLP----RRPSSLPPL----------
A0A2P8WHY0      FVGGGLAFARDSMDKVVRTSDDLKRQVP-LPLLGILPVQPIRKGFSLPGR----------
A0A2T1CMT9      FVGGFAAFVKDFTDETINTSKEIERRTS-LPILGTAP--------GLSIS-SS-------
A0A563VQJ3      FLSNLTAIALEWQDRTVKSIPELKKKLP-YKVLGVIP--------QMDDV----------
A0A1D8TX52      FLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMIP--------ELPEG-KI-------
A0A1U7N5X9      FLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------ELPEG-KI-------
A0A1D9G4T2      FLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMIP--------ELPEG-KI-------
F4XP71          FLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------QLPEG-KI-------
A0A2P8QVH5      VLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGITP--------KLPNF-EL-------
A0A2T1FT70      VLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGITP--------KLPNF-EL-------
A0A433W4W4      VLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGITP--------KLPNF-EL-------
K9U5W1          VLGIGAAFLLEALDDTIHSCDELQKLSS-LPVLGITP--------KLPNF-EL-------
A0A2W6ZAV2      VAGVGAALLRDRLDHVFHQPQDVEDGLG-LPLLGRLP--------FLPVQDGL-------
A0A2G7GMH8      TLGCFAAFIREAVDDAVHSSDELKKQVA-LPLLGLIP--------ELPP-----------
K9W742          MLGGIAAFIRETMDDAVRSSDELKQQVA-LPVLGMTP--------VLPKAKKSEPRMLLP
A0A2T1DWE8      MLGSVAAFIRDTMDDAVHNADDL-KQVA-VPLLGMVP--------ALQYE-GG-------
A0A1U7I8L3      MLGSIVAFIRDMIDDAVHTSDDLKKQVD-LPLLGIIP--------QLNPQ-TR-------
A0A2T1DJL8      MLGGVAAFLREAADDAVRTSEDFKQQVP-LPLLGMVP--------EVPLG-EI-------
A0A1Z4J9W0      MLGCVAAFLRESADKSIRTSEDLTKEAS-IPLIGMVP--------ELPMS-EL-------
A0A0N7Z5K9      MLGSVAAFLRESADKSIRTSEDLTKQAS-IPLIGMVP--------ELPMS-EL-------
A0A0S3TXC5      LLGCVAAFLRESADKSIRTSEDLTKQAS-IPLIGMVP--------ELPLS-EL-------
K9SA61          MLGAVAAFVREGVDDAVHTSDDLQKQVP-LPLLGMIP--------ELPRSVSV-------
A0A3D1PBA3      MLGGVAAFLREAVDDSVHTSEELEKQVE-LPLLGMTP--------ELPKN-KL-------
K9XPB0          FLGGTTAFIKESLDEQLYNSRQIQEKIA-LPLLGSTP--------GLPLA-KH-------
A0A350Y7Z1      FLGGLAAFGREALDDAVHSSEELKRQVA-LPLLGIIP--------ELPRT-GG-------
A0A352X2A7      FLGGIAAFGREFIDDGVHTSDQLKRNLT-LPFLGIIP--------ELPKT-RS-------
A0A0D8ZYV0      MLGGVAAFLREATDDAVHTSDELEKQVS-IPLLGMTP--------EMPQT-KA-------
A0A4R4IUM6      MLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMTP--------EMPRG-RV-------
A0A2T1FP73      MLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMTP--------ELPRG-RV-------
A0A433VMS2      MLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMTP--------ELPRG-RV-------
K9TYA7          MLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMTP--------ELPRG-RV-------
A0A2P8QUE1      MLGSLAAFLRDAVDDSVYSSEDLEKQFE-LPLLGMTP--------ELPRG-RV-------
A0A2T1DNG3      LLGGVAAVSREVLDDSVHSSDELKQQTA-VPLLGTIPELSLGAMSGKPSL----------
A0A2P8W9H0      LLGAGAAIVVDRFSGKIYTIDELKAAVR-LPVLGNIPISSLLNSGGSVLF----------
A0A1Z4LN32      VLSIGSAYFVDLIDRRLKTAKEAEKLFG-YTLLGLIPKFDTNNAKSNHNI----------
A0A2I8A9F5      LVGIAVAFLLDVIDRRLKTAKEAEELFG-YTLLGLIPKFSNNFNTT--QL----------
A0A218Q6R8      LLGVAAAFFIDLIDRRVKTAKEAEELFG-YTLLGLIPVFETKNISN--TL----------
A0A218QGE0      LLGVASAFFVDLIDRRLKTTKEAEALFG-YTLLGLIPKYE-KNTST--FL----------
B8HNB0          LAGIGLALLIERLDSRIHSVEEVKRASG-LPLLGTVPRSRSSEPHKDTDS----------
A0A563VS48      LLGIAVAFLIDIRDNTIKNTREAEQMLP-YPLRGVIPDCK--------------------
A0A318BJ18      GIGALAAFVLEQMDEAIADPIEVTRRLG-LPLLGSVPKTAEGT-----------------
A0A3B8Y8H9      VLGMGAGLLAEKLDDTFHNAEELKQETR-LPLLATIPQLP--------------------
A0A2W1JVB9      LLAFGVALLLDSRDKSVKTLEDIKALFSDYTMLGVIPAIEGVQTKIKEKG----------
A0A1Z3HMQ0      LLGVAMAFFLDLIDKSIKTVKDGEALLG-YTLLGLIPKFG-----LLGND----------
A0A1E5QP61      MLYVLTAFLLELMDPSIKTAKELRMLFR-YTLLGMIPATK-----K--RF----------
A0A3M2GIL5      MLYVVTAFLLELIDPSIKTAKEVREVFR-YTVLGMIPKYR-----K--KG----------
A0A433NM31      ILAVFIALARDAVDTSIKTLREAKEVLG-YTVLGVIPNFD-----KIDKL----------
A0A3M1PML8      LLGVATAFGLDLFDRSIKTVKEAKEALG-YTLLGVVPAFS-----RNAKS----------
A0A352X442      LLGIAVAFLVDLIDHSVKNVKEAKELFG-YTLLGVVPAFG-----KLGNR----------
A0A0T7BPZ0      LVGIIAALALDLLDQSVKNVKQAKEIFG-YTLLGVIPQMN-----RSSKS----------
A0A0M0SHU3      LLGIIAALAADLIDRSIKTVKEAREVFQ-YTLLGVIPSVS-----RTGKS----------
A0A1D2PBN3      LLGVIAAFTLDLIDRSVKTVKEARELFK-YTLLGVIPSIN-----SNSKK----------
A0A0C2LVR7      LLGVIAAFSLDLIDRSVKTVKEARELFK-YTMLGVIPSIN-----SNSKK----------
A0A1Z4PQB9      LLGVIAAFTLDLIDRSVKTVKEARELFK-YTLLGVIPSIS-----SNSTK----------
A0A1Z4SFN6      LLGIMAAFTLDLIDRSLKTVKEARELFQ-YTLLGVIPLVG-----GNGKK----------
K9PGI8          MLGLIAALTLDMIDRSVKTVKEARELLQ-YTLLGVIPLVG-----RNTKN----------
A0A563VLD6      FIGILTAWLLHQLDTRVKLIDEVKQITQ-LPLLGAVPKVLEPRIVLSNEA----------
A0A318BG22      LAGVGIAFIIEFVDDSIKMPDDVEQKLH-LPLLGITPTVEGAEI----------------
A0A2T1E9V8      LVAGAVVYFLELTDKKIKTVKEARELFD-YRLLGTIPIFNKI------------------
A0A3M2GQQ6      LLGVAAAILVERSDQRVKHVDEAKELTG-LPSLGMIPKVSCPLVSQRKGE----------
K9SGJ5          LFGVAIAMYLERSDERIREVEEVRELTH-VPLLGSIPRTDMLELS---------------
L8MYT6          GLGVLIALLLDRLDQRIREVEEVREIID-VPLLASIPMTEVASLA---------------
A0A352JGJ6      TLGILCALLFNRLDQRIREVEEVKEIID-IPLLASVPLTEVASLS---------------
A0A1J5GLS2      VLGILSALALDRLDQRIREVEEVKEIID-VPLLASIPITEVTSLS---------------
A0A2W4W6M5      VLGISSALILNRLDQRIREVEEVREIID-IPLLASIPMTEVASLS---------------
A0A2W7AN33      ALGVLLALLLNRLDQRIRDVGEVREIID-VPLLASIPFTDPVALI---------------
A0A256BLV2      ALGILFALLLNRLDQRIREVEEVRELID-IPLLASIPMTEVSSLS---------------
A0A2W6ZXF3      VLGILSALALDRLDQRIREVEEVKEIID-IPLLASIPMTEVASLS---------------
A0A2Z5WX66      VLGVLFALLLNRLDQRIREVEEVKEIID-IPLLASIPMTEVASLG---------------
K9W1T3          LLGIAVALALETTDKSIKDPEDAKRILG-YPLLGTIPIIEHMDSSTTIRF----------
A0A1Q4RTR1      ILAVGAALTLEALDGTVKTIEEAQELLG-YALLGTIPRLSVSRHYRN-------------
A0A1Z4SQV2      ILAVGAALMSEALDGSVRTLSEAQELLG-YSLLGTIPRLSITRPHRN-------------
A0A2H2XGN1      ILAVGAALMSEALDGSVRTLSEAQELLG-YSLLGTIPRLSITRPHRN-------------
A0A433UXH8      ILAVGAALTLEALDGTVKTIEEAQELLG-YALLGTIPRLSVSRHYRN-------------
A0A1Z4RMB9      FLANLSIILLEMQDRSLQSLAEIKKKFA-YNVIGMTPLEPP-------------------
K1XF69          VASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGIIPSFAAPPFYRY-------------
B5W297          VASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGIIPSFAAPPFYRY-------------
H1W7M8          VASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGIIPSFAAPPFYRY-------------
A0A5Q4H6A5      VASTTLLLLMEMGDKSLRTVAETRDLLG-YTLLGIIPSFAAPPFYRY-------------
D5A466          VASTTLLLLMEMGDKSLRTVAETRDLLG-YTLLGIIPSFADPPFYRY-------------
B4WP72          LVGISAAFAQDLLDRSIKTLNDCREQFG-YALLGAIPLFNETSNLHRSKS----------
A0A318B4H2      VLAVGLVVLAEEIDQSLRDPADVQRELG-LPLLGTIPKVEDK------------------
B4WQE3          LLGSGIALLVDRVKGKICTVRELKDLTN-VPLLATIPYNHLLEGSKASIL----------
A0A2P8W4F7      MLGGVAALLRDRMDQAFHSTDELIKTTQ-LPNLTTIPNAPALQKQPLLIE----------
A0A5Q4E0Z4      LLGGGAALLRDRADTAFHSADELVKATQ-LPNLALVPNAPALQKQPLLMV----------
A0A2K3BR24      MLGIATALALDARDRTVKTVQEVKDRLG-YTVLGSIPLVKTKM-----------------
K9YXY1          MLGVATALALDARDRTVKTVQEVKDRLS-YTVLGSIPLVKTKM-----------------
U5QJM6          VFGLLVAVLLETFDDRVKTVERAKELMQ-LPLLGAIPYNDELNTTAKSEK----------
K9SX01          VAAISVALLLNSRDNLLRSGEDIKRLFG-YPLLGILPNFATRKLENLPAF----------
A0A4P7ZT55      MAGAGAALLRDRLDHVFHSPRDVEQGID-QPLLGSIPFLPLERFQSVNGL----------
A0A1E5QIR9      FLAVVTALVLDAKDTRIKTVREAREYLG-YTLLGIIPNFE-----KIDKG----------
A0A1Z4IBC7      FLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNSKD----------
A0A1W5CPC7      FLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNTKD----------
A0A5Q0GKD1      FLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNTKD----------
Q3MDC6          FLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNTKD----------
A0A1Z4KM73      FLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNGKD----------
Q8YNX7          FLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNGKD----------
A0A367R4K6      FLGIIAAFSLDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNGKE----------
A0A1E2WSV8      FLGIIIAFGLDLIDRSVKTVKEAKEVLR-YSVLGVIPTQG-----RNGKE----------
A0A2R5FRT9      FLGIIVAFGLDLVDRSVKSVKEAKEVMK-YSVLGVIPTQS-----KNGKD----------
A0A2K8T1B6      FLGIIVAFGLDLIDRSLKTVKEAKEVLR-YSVLGVIPTQS-----RNGRD----------
A0A235I9I0      FLGIIVAFTLDLIDRSVKTVKEAKEVLR-YSVLGVIPTQG-----RNGKD----------
A0A2D0HQT8      FLGIIVAFTLDLIDRSVKTVKEAKEVLR-YSVLGVIPTQG-----RNGKD----------
A0A2L2NU95      FLGIIVAFTLDLIDRSVKTVKEAKDVLR-YSVLGVIPTQA-----RNGKD----------
A0A367S084      FLGIIVAFTLDLIDRSVKTVKEAKEVLR-YSVLGVIPAQG-----RNGKD----------
A0A0V7ZFJ4      LLGVGTALLLERTDKSLKTVDKIKQLLD-YPLLGTIPKTPKTTKGST-------------
A0A367RIS1      FLAIAAALLLEAGDTSVKTTEEAQELLD-YPLLGTIPVFEQKDKLAR-------------
A0A235IXQ2      FFAIGVALLLEAGDKSVKTAEEAQHFLD-YPLLGKIPVFDQKARLAR-------------
A0A1W5CNX3      FLAIGAALLLEAGDKSVRTQEEAQQLLD-YPLLGTIPAFDQKARLAR-------------
A0A5Q0GJJ5      FLAIGAALLLEAGDKSVRTQEEAQQLLD-YPLLGTIPAFDQKARLAR-------------
Q3MEB7          FLAIGAALLLEAGDKSVRTQEEAQQLLD-YPLLGTIPAFDQKARLAR-------------
A0A1Z4KHN9      FLAIGAALLLEAGDKSVRTLEEAQQLLD-YPLLGTIPVFDQKVRLAR-------------
Q8YT70          FLAIGAALLLEAGDKSVRTLEEAQQLLD-YPLLGTIPVFDQKVRLAR-------------
A0A218Q4C1      LLAFGSALLLDAVDKSVQTAEEAEKLFD-YPLLGKVP------KLLR-------------
A0A166IWU6      LLAVGSALFLDALDKSVQTAAEAEQLLD-YPLLGKIP------KMIR-------------
A0A2S0Q8C0      LLAVGSALLLDALDKSVQTAAEAEQLLD-YPLLGKIP------KMIR-------------
W6FSX4          LLAVGSALLLDALDKSVQTAAEAEQLLD-YPLLGKIP------KMIR-------------
A0A0V7ZNJ9      LLGAGTALILETMDKSLKTVDQAKRLLN-YPVLGTIPQFEGKG-----------------
A0A0R0M9H9      VLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIPQYENTKRRKNQEQ----------
A0A1S1ZVW2      VLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIPQYENTKRRKNQEQ----------
A0A1B7WX82      LLGAGTALLLESMNQALKNVEEANRLLG-FPLLGMIPLYGGKNPKN--Q-----------
A0A1B7WTD1      LLGAGTALLLESMNQTLKNIEEANRLLG-FPLLGTIPLYGEKKTKN--P-----------
A0A480ABC0      LLGAGTALLLESMNQTLKNIEEANRFLG-FPLLGTIPQYGEKKRKN--TV----------
A0A1Z4LRU5      LLGVGTALILEAMDKSLKTLDEAKKLLG-YPLLGTIPRVDE----K--------------
A0A1Z4JVB4      LLGIGVAILLEAMDSSLKTVEQAQDLLD-YPLLGIIPKVETAKGNH--------------
K9PIA4          LLGLGTALVLESMDNSLKNVEEVKRLLG-YPVLGTIPLAEKVKGSD--------------
A0A1Z4M597      ILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAIPQAEKAKGSE--------------
A0A1Z4MWT1      ILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAIPLAEKAKGSE--------------
A0A1Z4TX53      ILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAIPLAEKAKGSE--------------
A0A1Z4HVE1      MLGLGTALILEAMDNSLKTIEEVKRLLG-YPLLGTIPLAEKVKDSD--------------
A0A252ECZ1      LLGVGTGLLLEAMDTSLKTIEEVKHLLD-YPLLGIIPLAEKAKGSD--------------
A0A1Z4G5Y1      ALGVGAALMLEAADNSLKTIEEVKRLLD-YPLLGTIPLAEKPKGVD--------------
A0A252DNA2      LLGVGVALMLEATDNSLKTIEEVKRLLD-YPLLGTIPLAEKPKGSD--------------
A0A252E1Q4      LLGVGVALMLEATDNSLKTIEEVKRLLD-YPLLGTIPLAEKPKGSD--------------
A0A5P8VSD1      FLGIGAALLLEAEDKSVKTAEEAQQLLD-YPLLGTIPLFDQKTRLAR-------------
A0A2A2TNQ5      LLGAGTALLLEALDKSLKNVDEAKRLLG-YPLLGTVPNLAEK------------------
A0A3S1C4K5      ILGVGAALVLEAMDKSLKSVEEAKRLLG-YPLLGTIPQLGGS------------------
A0A1X4G3D5      ILGVGTALVLESLDKSVKNIEEINRLLD-LPLLGSIPNFETKKRKNKGE-----------
D4TNI2          ILGVGTALVLESLDKSVKNIEEINRLLD-LPLLGSIPNFETKKRKNKGE-----------
A0A1Z4H6Z8      LLGVGAALMLEATDNSLKTIEEVKRLLG-YPLLGTIPLAEKPKGSN--------------
A0A1Z4NPM1      LLGAGSALLLEALDKTLRDIDEAKRLLG-LPVLGTIPQLMDKKGK---------------
A0A3F3KPR9      VLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIPQYENTKRQKNAGG----------
D4TGN7          VLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIPQYENTKRQKNAGG----------
A0A1Z4UZW9      ILGAGTALVLESMNQSLKNIEEANRLLG-FPLLGTIPLYIGKNPKNP-------------
A0A0K2M5H0      ILGAGTALVLESMNQSLKNIEEANRLLG-FPLLGTIPQYGEKNPKNR-------------
A0A1B7VSH4      LLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTIPQHGEKNPKNP-------------
A0A1B7W126      LLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTIPQHGEKNPKNR-------------
A0A3D4C6Q6      LLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTIPQHGEKNPKNR-------------
A0A1B7UVJ4      LLGAGTALLLESMNQALKNVEEANRLLG-FPLLGMIPLYGGKNPKNQ-------------
A0A1B7UTR1      LLGVGTALLLESMNQSLKNVEEANRLLG-FPLLGMIPLYGGKNPKNQ-------------
A0A5C0DRW9      LLGAGTALLLESMNQSLKNVEEANRLLG-FPLLGTIPQYGEKNPKHR-------------
K7W0A4          LLGAGTALLLESMNQSLKNVEEANRLLG-FPLLGAIPQYGEKNPKHR-------------
A0A1U7HGH0      MIAGGIVYLLELTDKKIKTAKEAREIFE-YKLLGTIPLFHNESQTEREQW----------
K9XJD3          MIAGAIVYLLELTDKRIKTAKEAREIFE-YKLLGTIPLFHNDSQTEREEW----------
A0A2T1CIL7      LLATAFAFLLDFKDRSIKNSKEAEEIFG-YPLQGVIPDSGYSAETTVSRG----------
A0A1Z4RPC6      FLSNLTVILLEMQDRTLKTIPEVKRKFG-YQVLGIVPFDSFQ------------------
A0A2T1CMZ0      FLANLTAILLEMQDHSLKTISEIKQKFA-FQVLGIVPLDTLQ------------------
L8M4F7          FFSNAAVLLLETRDRSLKTIGEIRKKLP-HTILGIIPIDDDA------------------
A0A140K2P2      LLSNLSVLLVEMQDRSLKTVAEIKNKFG-YKVLGLVPKHAAE------------------
K9XWX4          LLSNLSVILVEMQDRSLKTVAEIKNKFG-YNVLGLVPKHEAE------------------
A0A140KB14      LLSNLSVLLLEMQDRSLKTMSEIKQRFP-YKVLGLIPQYSDD------------------
K9XX88          LLSNLSVLLLEMQDRSLKTIPEIKQRFP-YKVLGLIPQYTDD------------------
A0A563VSV6      LLSNLTAIYLDMQDRTIKTIADIKKKLP-YKVLGIVPINELS------------------
L8LZE9          LLSNLTAIILDKQDRSLKNISEVKKKLP-YKVLGIIPENKFA------------------
A0A433V7A0      LLATATIFVLELTDKSIKNIEEARKIFD-YTLLGVIPYYG-----SFEKH----------
A0A1Z4NDS1      LCGVITAFALDLIDSSLKTVQEARELFR-YTLLGVIPQIPRNSKRKSEQP----------
K9F4D9          LLGLITAFMADLLDQSVKTVQEGQELYE-YPLLGIIPAWKRGN-----------------
U9VXM0          LLGLIAAFFADIIDQSITTVQEGQELYE-YPLLGIIPAWKRNN-----------------
A0A2T1FTR8      FLGAATAFLLDGADKRIKTSEEAKSLLPGYPILGQIPVFE-----KSRQL----------
K9UA41          FLGAATAFLLDGADKRIKTSEEAKNLLPGYPILGQIPVFE-----KSRQL----------
A0A0C2LBE2      LFGAVAAFALDTIDPSLKTVKQAKELFK-YTLLGVIPLTG-----RNQKK----------
A0A433NN38      LLGVVAAFSLELVDQSVKTLKEAKELFQ-YTLLGVIPNLS-----RYGKT----------
A0A2N6K0T2      LLGIIAALAADLIDRSIKTVREARELFQ-YTLLGVIPSVS-----KTSKN----------
A0A2N6ML72      MLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNNKN----------
G6FQZ6          MLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNNKN----------
A0A2N6MQX9      MLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNNKN----------
A0A2N6KXT6      MLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNNKN----------
A0A2N6KGB9      MLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNNKN----------
A0A2N6L3Y5      MLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNNKN----------
A0A0S3TIS7      MLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNTKN----------
A0A1U7GW28      MLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNTKN----------
A0A2N6LW63      MLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNTKN----------
A0A328IH74      LLGIITALASDLIDRSIKTVKEARELFQ-YTLLGVIPSVS-----RSGKN----------
A0A4D9CIB0      LLGIITALASDLIDRSIKTVKEARELFQ-YTLLGVIPSVS-----RSGKS----------
A0A1Z4TQ63      LLGIIAALTSDLIDRSIKTVREARELFQ-YTLLGVIPSVS-----RSGKS----------
A0A4Q9J8G2      LLGIIAALISDLIDRSIKTVKEARELFQ-YTLLGVIPSVS-----RSGKN----------
A0A1Z4SMD6      LFGVAVAFFIDLIDNSLKTVKEAEVLFD-LTLLGLIPKFEPSPSTVPSIK----------
A0A2H2Y096      LFGVAVAFFIDLIDNSLKTVKEAEVLFD-LTLLGLIPKFEPSPSTVPSIK----------
K9S8M8          MLYLIVAFVFELIDPTVKTAKEIRNLYQ-YTLLGMIPRSKKKRWWFGSGS----------
A0A1Z4NFV0      SLGIAAAFLIDLVDRSIKSVKEAESVFG-YTLLGLIPRFDSSV--SSNRS----------
B0CAX4          LLGLGTALLLEALDTSVKTVQEATGLFD-YTVLGNIPLLKDAEKMTRKGL----------
U5DPF5          LIGTATAITLDVRDQSLKTVQEAKNRLG-YVMLGSIPLFG-----RFNRP----------
A0A350Y0P6      LLYIVTAFVLDLMDPSIKTAKEIRQLFK-YTWLGMIPESRKKGFFWRQKL----------
A0A352X940      LLYIIVAFVLDLMDPSIKTAKEVRQLFR-YTWLGMIPNLRKKGLLSRRKS----------
B8HTN4          LGAIVVIFILESKDKTLKSLEEIQQYFD-YVTLAMIPFDKAAA--TANKA----------
A0A2A2TPF8      MFGIAAAFLIDIIDRSIKTIKEAETIFG-YTLLGLIPKFETN------------------
A0A1Z4R0P8      MLGIAAAFLIDIIDRSIKTTKEAQNIFG-YTLLGLIPKFSTN------------------
A0A0T7BUI3      LLGIAGAFFVDLIDRSLKTVKEAENFFG-WTLLGLIPRFEAN------------------
A0A1Z4LP32      LLGIAAAFTVDLIDRSLKTIKEIEEFFG-YTLIGLIPKFEPN------------------
K9REP9          LFGIAAAFTVDLIDRSLKTVKEIEGFFN-YTLVGLIPKFEPD------------------
A0A1Z4SIJ3      LFGVSIAFFVDLIDNSLKTIKETEAFFE-YPLLGLIPKFESN------NQ----------
A0A2H2XPG4      LFGVSIAFFVDLIDNSLKTIKETEAFFE-YPLLGLIPKFESN------NQ----------
K9V3C7          FLGIAAAFLVDSIDKSIKTIKEAQTLFG-YTPLGLIPKFDAN------------------
A0A1Z4T6Y7      LLGVAAAFLVDVIDKSIKTVKEAQDVFG-YTMLGLIPKFE-N------------------
A0A2H2Y561      LLGVAAAFLVDVIDKSIKTVKEAQDVFG-YTMLGLIPKFE-N------------------
A0A1Q4S362      LLGVAAAFVVDVIDKSIKTVKEAQDVFG-YTLLGLIPKFDTN------------------
A0A3S1CIN8      LLGVAAAFLVDVIDKSIKTVKEAQDVFG-YTLLGLIPKFDTN------------------
A0A2A2TC28      LVGIASAFFIDLIDRSLKTVKESEKFFG-YTMLGFIPKFEPN------NT----------
A0A0C1NCB0      LLGVAAAFFVDLVDRSLKTAKEAEEFFK-YTVLGLIPTFESSTKSSSESS----------
A0A2N6K7Q9      LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKPN------NS----------
A0A2N6MXH6      LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------NS----------
A0A2N6M5A8      LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------NS----------
A0A2N6LL61      LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------NS----------
A0A0S3TP66      LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------NS----------
G6FP91          LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------NS----------
A0A1U7GYR5      LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------NS----------
A0A2N6KY52      LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------NS----------
A0A2N6KMP5      LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------NS----------
A0A2N6MA45      LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------NS----------
A0A4Q9J9V9      LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKPN------NF----------
A0A328IGA1      LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKPN------NF----------
A0A4D9CE41      LLSIAAAFFVDLIDRSLKTVKETETFFG-YILLGLIPKYKPN------NF----------
A0A0M0SFT2      LISIAAAFFVDLIDRSLKTIKETETFFG-YTLLGLIPKYKPN------NF----------
A0A1Z4TLC8      LLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKPN------NF----------
A0A0C2LFH0      LLGTAAAFFVDLIDRTLKTVKEAETFFG-YTLLGLIPKFESK------KT----------
A0A1Z4IYV4      LLGIAAAFFVDLVDRSLKTVKEAETFFG-YTLLGLIPKFESN------TT----------
A0A1Z4Q0T6      LLGVAAAFFVDLVDRSLKTVKEAETFFG-YTMLGLIPKFESN------ST----------
A0A0C2PT44      LLGVAAAFFVDLVDRSLKTVKEAETFFG-YTMLGLIPKFESN------ST----------
A0A1D2P6J4      LVGVAAAFFVDLIDRSLKTVKEAETFFG-YTLLGLIPKFESN------ST----------
A0A4R4IQ40      MLSSGTVAVLEVKDISVKTLKEARELFG-YTFLGAIPSLT-KK--AAVDG----------
A0A433W533      VLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAIPSLT-KK--AAADG----------
A0A2P8QWJ3      VLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAIPSLT-KK--AAADG----------
A0A2T1FKP8      VLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAIPSLT-KK--AAADG----------
K9U6L7          VLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAIPSLT-KK--AAADG----------
A0A3M9ZEU1      LLAITTAFLLDLCDRSIKTVQEAKALFG-YTLLGLIPDYT-----KLGAS----------
A0A1Z4JK72      LLGVAAAFFRDMMDKSLKTVKEAEAQYG-YTMLGLVPKFE-----TSDTP----------
A0A0N7Z489      LLGIAAAFLVDTIDKSLKTVKDAEAQYG-YTLLGLVPRFE-----TSDTP----------
A0A0S3TXS2      LLGIAAAFLVDSIDKSLKTVKDAEAQYG-YTLLGLVPRFE-----TSDTP----------
A0A1Z4RN12      LFGMALAFLLDLKDNTIKNTQEVENLFA-YPLHGVVPNLNLTG--ERKQL----------
A0A2T1CMF9      LFGTALAFLLDLKDNTIKNTQEVENMFA-YPLHGVVPDLSLGG--NNQQF----------
Q7NDC5          ILAALAAYTREFFDDSLRSVEEARGLLG-TSLLGSVPRWN-AQ-----------------
U5QGK3          ILAMLVAYGREFFDDSLQTVEEATSLLG-TPLLGTIPRWT-GA-----------------
A0A2W4UY24      LLGIAIAFLADLLETSVKTVTEGQKLYD-YPLLGVIPDWR-KR--TARNR----------
A0A2T1GMT4      LFGTSAIAYLELRDGSLKTVKEIDKVFG-YTLLGMIPATQRKK--NRARA----------
K9UI51          LLGTSAIAYLELRDSSLKTVKEIDKIFG-YTLLGMIPATQKKK--IRSRA----------
K9QM62          FLSTTTVLLLEMRDRSLKTLQEIRQVFE-YTLLGIIPTSP-VS--HKTMS----------
A0A1Z4FWI3      FLSTTAVVFLETRDRSLKTLNEIREIFGRYTLLGIVPSST-KK--LRSRN----------
A0A1Z4JYE7      FLATSTILLLEIKDKSLKTLDKVKEAFNGYTLLGIIPLLP-QK--TISRK----------
A0A2T1FXY4      LLSTSTVLFLELRDRSLKTLEEIRQRFS-YTLLGVIPLVG-NK--VRSND----------
A0A4V2X3N2      LLSTSTVLFLELRDRSLKTLEEIRQRFR-YTLLGVIPLAT-NK--VRSNN----------
K9TYI2          LLSTSTVLFLELRDRSLKTLEEIRQRFR-YTLLGVIPLVA-NK--VRSND----------
A0A1Z4QL41      FLASSTIFILEMRDSSLKTVNEVREIFG-YTLLGMMPLLA-KK--VPFRH----------
A0A252D4T4      FLATTAVIFLETRDRSLKTLKQIREIFG-YTLLGIVPSST-KK--LRSRN----------
A0A252DJH5      FLATTAVIFLETRDRSLKTLKQIREIFG-YTLLGIVPSST-KK--LRSRN----------
A0A252EB80      FLATTAVVFLETRDRSLKTLKQIREIFG-YTLLGIVPSST-KK--LRSRN----------
A0A1Z4HPW5      FLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVPSST-KK--IRSRY----------
A0A1Z4MSN1      FLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVPSST-KK--IRSRY----------
A0A1Z4U1C2      FLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVPSST-KK--IRSRY----------
A0A0D6KV51      FLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVPSST-KK--IRSRY----------
A0A1Z4MKF8      FLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVPSST-KK--IRSRY----------
A0A2C6WC43      FLATTTVLFLGMRDRSLKTLREVRDIFR-YTLLGIVPLSV-KK--VRSRF----------
A0A1Z4L5A1      FLATTTVLFLGMRDRSLKTLKEVRDVFG-YTLLGIVPLSV-KK--VRSRF----------
A0A367QD86      FLATTTVLLLGMRDRSLKTLKEVRDVFR-YTLLGIIPLSV-KK--VRSRF----------
A0A235IZ96      FFATTTVLFLAMRDKSLKTLREVRDVFG-YTLLGIVPLSV-KK--VRSRY----------
A0A2L2NGP0      FFATTTVLFLAMRDKSLKTLREVRDVFG-YTLLGIVPLSV-KK--VRSRY----------
A0A2K8SM78      FLATTTILFLSMRDRSLKTLKEVRDVFR-YTLLGIIPLSV-KK--VRSRY----------
A0A2R5FPC0      FLATTTVLFLSMRDRSLKTLKEVRDVFR-YTLLGIIPLSV-KK--VR-RD----------
A0A5P8W5T6      FLATTAVLFLSMRDRSLKTLKEVRDIFR-YTLLGIVPLSV-KK--VRSRH----------
A0A140KBA0      LLGIAVAFLLDLKDNSLKNSQEIEEIFG-YPLQGVIPDLA-KEGSPNLLV----------
K9XSG1          LLGIAVAFLLDLKDNSLKNSKEIEEIFG-YPLQGVIPDLE-KEGSPHLLV----------
A0A0F5YE28      VGATTSVLILAMGDQNIRTVEEAKKTFG-YTLLGIIPMFK-NK--RFSDY----------
U7QEH7          VAATTSVLLLEMGDKYIRSVEETKKIFG-YTLLGIIPMFK-NK--RLSSY----------
A0A3S1ATK5      FFGTTTILLLEMRDRSLKTLQEVRDIFG-YTLLGILPSLS-KK--SLFWH----------
A0A2Z6CPH0      FLSTTTVLFLEMRDKSLKTLKEIREVFE-YPLLGVIPLSA-HK--THSRK----------
A0A1Z4GT50      FLSTSAVAALETRDRSLKTLKEVKEIFG-YTLLGMLPLST-KK--GRSRN----------
A0A1Z4GIX0      FLSTSAVLFLEMRDKSLKTLKEIREVFG-YTLLGGIPLST-NK--MRSRE----------
A0A2H6LC24      FLSTSAVLFLEMRDKSLKTLKEIREVFG-YTLLGGIPLST-NK--MRSRE----------
B2J6N5          FLATTTVLVLGMRDRSLKTLQEIRDIFR-YTLLGIVPLSV-KK--IHSRY----------
A0A367RMI4      FFATTTVLFLAMRDRSLKTLKEIRDVFR-YTLLGIVPLSV-KK--LRSRY----------
A0A235HUM0      FFATTTILFLAMRDRSLKTLKEIRDVFG-YTLLGIVPLSV-KK--LRSRD----------
A0A2L2NW47      FFATTTVLFLAMRDRSLKTLKEIRDVFG-YTLLGIVPLSV-KK--LRSRY----------
A0A1E2WUR1      FFATTTILLLAMRDRSLKTLKEVRDIFG-YTLLGIVPLSV-KK--LRSRY----------
A0A235IKU3      FFATTTVLFLAMRDKSLKTLREVRDVFG-YTLLGIVPLSV-KK--VRSRY----------
F4XKF3          TLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIPVFK-HK--KLSRR----------
A0A1D9FX10      TLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIPVFK-HK--KLSRR----------
A0A1D8TNX9      TLATTAILLLEMRDRSIKTLKEVKQLLR-YPVLGVIPVFK-HK--KLSRR----------
A0A1U7MYU6      TLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIPVFK-HK--KLSRR----------
A0A3C0NJ41      LLGMATIILLEVRDVSLKTLKEVREQFG-YTLLATIPLLG-KK--PRRRT----------
A0A352AG88      LLAIVTIITLEVRDTSIKTLREVRELFG-YTLLGVIPSLT-KK--GISRS----------
A0A350Y374      LLAMATIIILEVRDNSIKTLKEVKDLFG-YTLLATIPTFG-KK--TVSRF----------
A0A355DPX0      LLAMATIIILEVRDNSIKTLKEIKDLFG-YTLLATIPTFG-KK--TVPRL----------
A0A0D8ZUV2      LLAGATIIILEVRDTSVKTLKEAQELFG-YTFLGTIPMLG-KK--ANSRG----------
A0A433VDI0      LLAAATIVILEVKDTSIKTLEEALELFG-YTLLGVIPALN-KK--AIPRG----------
A0A3D1PG43      LLATGTILILEISDRTIKTLREVRDAFG-YTVIACIPHV--GKKVGFRNQ----------
A0A2P8QQ72      LLAIATITLLELSDASIKTLREVKQLFG-YTLIGSIPQL--GKFIKLKPG----------
K9TZQ7          LLAIATITLLELSDASIKTLREIKQLFG-YTLIGSIPQL--GKFIKLKPE----------
A0A2G7GPR0      ILAILTICILELSDRSVKTLREARERLD-YTLLGTIPYF--GK--RYANR----------
K9XH68          ILAILTICILELSDRSVKTLREARERLD-YTLLGTIPYF--GK--RYANR----------
A0A1U7HW70      ILAILTICILELSDRSVKTLREARERLD-YTLLGTIPYF--GK--RYANR----------
A0A2S6VEJ8      ILAILTICILELSDRSVKTLREARERLD-YTLLGTIPYFG-GK--RFANR----------
                                                    .                       

K9SLA9          -----------------------------------------------------------S
A0A168TT23      ------------------------------------------------------------
A0A0M1JWX9      ------------------------------------------------------------
A0A2T1M1V6      ------------------------------------------------------------
A0A2G7GCS2      ------------------------------------------------------------
K9XBH8          ------------------------------------------------------------
A0A1Z4LJ30      ------------------------------------------------------------
K9RI76          ------------------------------------------------------------
A0A352AE27      ------------------------------------------------------------
A0A3B8JH60      ------------------------------------------------------------
A0A3C0N766      ------------------------------------------------------------
K9W9J7          ------------------------------------------------------------
A0A139WSU3      ------------------------------------------------------------
A0A433VN22      ------------------------------------------------------------
Q7NF11          ------------------------------------------------------------
A0A1Z4JCS8      ------------------------------------------------------------
F4XTX2          ------------------------------------------------------------
Q7NJN6          ------------------------------------------------------------
U5QCC3          ------------------------------------------------------------
A0A3S0Y9N9      ------------------------------------------------------------
A0A433UNK7      ------------------------------------------------------------
A0A3M1SVZ4      ------------------------------------------------------------
A0A654SFI6      ------------------------------------------------------------
K9SSQ0          ------------------------------------------------------------
A0A2W1JIN9      ------------------------------------------------------------
A0A318AJV1      ------------------------------------------------------------
A0A1U7N2U4      ------------------------------------------------------------
A0A1D9G1F2      ------------------------------------------------------------
F4XV38          ------------------------------------------------------------
A0A2P8QIL5      ------------------------------------------------------------
A0A2T1FLY5      ------------------------------------------------------------
A0A433W447      ------------------------------------------------------------
K9U1K8          ------------------------------------------------------------
A0A4V6P809      ------------------------------------------------------------
K9UYB2          ------------------------------------------------------------
A0A218QN17      ------------------------------------------------------------
K9RKN2          ------------------------------------------------------------
A0A2I8ADV2      ------------------------------------------------------------
A0A1W5CKM3      ------------------------------------------------------------
A0A5Q0GMF5      ------------------------------------------------------------
Q3MEW0          ------------------------------------------------------------
A0A1Z4KIC7      ------------------------------------------------------------
Q8YSM5          ------------------------------------------------------------
A0A1Q4S1H4      ------------------------------------------------------------
A0A433VBU6      ------------------------------------------------------------
A0A1Q4RZJ6      ------------------------------------------------------------
A0A1Z4SNV3      ------------------------------------------------------------
A0A2H2XJQ1      ------------------------------------------------------------
A0A3S5K358      ------------------------------------------------------------
A0A0T7BPJ4      ------------------------------------------------------------
A0A0C1QS61      ------------------------------------------------------------
A0A139X3R8      ------------------------------------------------------------
A0A1Z4I7C5      ------------------------------------------------------------
A0A0C2MDK7      ------------------------------------------------------------
A0A1Y0RCK1      ------------------------------------------------------------
A0A1Z4PWZ0      ------------------------------------------------------------
A0A0C2QLT0      ------------------------------------------------------------
A0A1Z4J2K1      ------------------------------------------------------------
A0A3S0ZSX0      ------------------------------------------------------------
A0A2N6K4T3      ------------------------------------------------------------
A0A370CKT2      ------------------------------------------------------------
A0A0S3TL97      ------------------------------------------------------------
A0A2N6M8A0      ------------------------------------------------------------
A0A2N6M9E1      ------------------------------------------------------------
A0A2N6KJI4      ------------------------------------------------------------
A0A2N6MZ77      ------------------------------------------------------------
A0A2N6KT20      ------------------------------------------------------------
G6FSN3          ------------------------------------------------------------
A0A4D9CI02      ------------------------------------------------------------
A0A328I8B9      ------------------------------------------------------------
A0A4Q9J4Z7      ------------------------------------------------------------
A0A0M0SU69      ------------------------------------------------------------
A0A1Z4TIZ8      ------------------------------------------------------------
A0A0S3TYD7      -----------------------------------------------------------G
U5QL42          -----------LTETLVAP-----------------------------------------
K9QF04          -----------FQKELKAA-----------------------------------------
A0A3C0N2P0      -----------SLSDGSMI-----------------------------------------
K9TLQ0          -----------FEKDLKES-----------------------------------------
A0A076HBF2      -----------QELD--RS-----------------------------------------
A0A354B169      -----------QELD---Q-----------------------------------------
G4FMX5          -----------KELD--SE-----------------------------------------
Q0IDT5          -----------NELDQSSN-----------------------------------------
A0A2D6FCW3      -----------QELD--IN-----------------------------------------
A3ZA21          -----------QELD---Q-----------------------------------------
A0A140K3H3      -----------EKPLIQVN-----------------------------------------
K9XUB8          -----------EEPVIQIN-----------------------------------------
Q7NEU3          -----------SQPQFSKE-----------------------------------------
A0A352XE00      -----------KVYQNSQV-----------------------------------------
B4VS56          -----------K------L-----------------------------------------
A0A352AAQ3      -----------T------P-----------------------------------------
A0A350Y472      -----------K------S-----------------------------------------
A0A355DVB4      -----------K------S-----------------------------------------
A0A2P8VVX1      -----------RRSEPDAR-----------------------------------------
A0A2P8WHY0      -----------QDGGPPI------------------------------------------
A0A2T1CMT9      -----------NNLLTRLP-----------------------------------------
A0A563VQJ3      -----------KEQGVLVK-----------------------------------------
A0A1D8TX52      -----------SKPVLNLS-----------------------------------------
A0A1U7N5X9      -----------SKPVLNLS-----------------------------------------
A0A1D9G4T2      -----------SKPVLNLS-----------------------------------------
F4XP71          -----------SKPVLNLG-----------------------------------------
A0A2P8QVH5      -----------KKPSIALP-----------------------------------------
A0A2T1FT70      -----------KKPSIALP-----------------------------------------
A0A433W4W4      -----------KKPSIALP-----------------------------------------
K9U5W1          -----------KKPSIALP-----------------------------------------
A0A2W6ZAV2      -----------SITEVVEG-----------------------------------------
A0A2G7GMH8      -----------AKPNGLIK-----------------------------------------
K9W742          FGKSQALEPVGNQPIIKLP-----------------------------------------
A0A2T1DWE8      -----------LAALVPF------------------------------------------
A0A1U7I8L3      -----------TEPIIHLP-----------------------------------------
A0A2T1DJL8      -----------NPRSIAMP-----------------------------------------
A0A1Z4J9W0      -----------MPTTPNFA-----------------------------------------
A0A0N7Z5K9      -----------MPTT-NFA-----------------------------------------
A0A0S3TXC5      -----------MPTT-NFA-----------------------------------------
K9SA61          -----------AEPTIKLP-----------------------------------------
A0A3D1PBA3      -----------AKPQISLP-----------------------------------------
K9XPB0          -----------DQFVVKLP-----------------------------------------
A0A350Y7Z1      -----------SGLLVHLP-----------------------------------------
A0A352X2A7      -----------SSIFVNLP-----------------------------------------
A0A0D8ZYV0      -----------SEPVVSLP-----------------------------------------
A0A4R4IUM6      -----------AQPEVSLP-----------------------------------------
A0A2T1FP73      -----------AQPEVSLP-----------------------------------------
A0A433VMS2      -----------AQPEVSLP-----------------------------------------
K9TYA7          -----------AQPEVSLP-----------------------------------------
A0A2P8QUE1      -----------AQPEVSLP-----------------------------------------
A0A2T1DNG3      -----------RLSGQTQA-----------------------------------------
A0A2P8W9H0      -----------AVREINSI----------------------------------------G
A0A1Z4LN32      -----------PVGKDKIA----------------------------------------G
A0A2I8A9F5      -----------EDSA--LA----------------------------------------E
A0A218Q6R8      -----------DTEEPIVE----------------------------------------Q
A0A218QGE0      -----------DRS---LE----------------------------------------K
B8HNB0          ------------------------------------------------------------
A0A563VS48      -----------------------------------------------------------G
A0A318BJ18      ------------------------------------------------------------
A0A3B8Y8H9      -----------------------------------------------------------R
A0A2W1JVB9      -----------ASVAADVK----------------------------------------R
A0A1Z3HMQ0      -----------GPDLELPA----------------------------------------G
A0A1E5QP61      -----------GFLGFSSR----------------------------------------R
A0A3M2GIL5      -----------FFFQNKID----------------------------------------Q
A0A433NM31      -----------NSRNENPE----------------------------------------Q
A0A3M1PML8      -----------NVPLGALD----------------------------------------Y
A0A352X442      -----------GFSFKKSE----------------------------------------A
A0A0T7BPZ0      -----------SSGTTEID----------------------------------------R
A0A0M0SHU3      -----------GYSVEGLD----------------------------------------R
A0A1D2PBN3      -----------SSFLPGVD----------------------------------------Q
A0A0C2LVR7      -----------SSFLPGVD----------------------------------------Q
A0A1Z4PQB9      -----------SSFLRGVD----------------------------------------Q
A0A1Z4SFN6      -----------SYYLPGAD----------------------------------------Q
K9PGI8          -----------SSLLPGGE----------------------------------------Q
A0A563VLD6      -----------EINISKGY-----------------------------------------
A0A318BG22      ------------------------------------------------------------
A0A2T1E9V8      -----------------------------------------------------------A
A0A3M2GQQ6      -----------GRSLP-------------------------------------------S
K9SGJ5          -----------------------------------------------------------P
L8MYT6          -----------------------------------------------------------P
A0A352JGJ6      -----------------------------------------------------------A
A0A1J5GLS2      -----------------------------------------------------------A
A0A2W4W6M5      -----------------------------------------------------------A
A0A2W7AN33      -----------------------------------------------------------S
A0A256BLV2      -----------------------------------------------------------A
A0A2W6ZXF3      -----------------------------------------------------------A
A0A2Z5WX66      -----------------------------------------------------------A
K9W1T3          -----------GNQQ--------------------------------------------R
A0A1Q4RTR1      -----------------------------------------------------------R
A0A1Z4SQV2      -----------------------------------------------------------R
A0A2H2XGN1      -----------------------------------------------------------R
A0A433UXH8      -----------------------------------------------------------R
A0A1Z4RMB9      -----------------------------------------------------------S
K1XF69          --------------LTGGD----------------------------------------R
B5W297          --------------LTGGD----------------------------------------R
H1W7M8          --------------LTGGD----------------------------------------R
A0A5Q4H6A5      --------------FTGGD----------------------------------------R
D5A466          --------------FTGGD----------------------------------------R
B4WP72          -----------HSKQLASSV---------------------------------------F
A0A318B4H2      -----------------------------------------------------------D
B4WQE3          -----------PRYEATRQPI--------------------------------------Y
A0A2P8W4F7      -----------PNLAVTMA----------------------------------------D
A0A5Q4E0Z4      -----------PSLIATTA----------------------------------------D
A0A2K3BR24      ------------------D----------------------------------------N
K9YXY1          ------------------D----------------------------------------D
U5QJM6          -----------QSKEIAKISK--------------------------------------K
K9SX01          -----------VLRNPESVLSKLYLKIRKSKAYRSFASSLESFKISILNAVSEPEN---T
A0A4P7ZT55      -----------WEQLDDQQ-----------------------------------------
A0A1E5QIR9      -----------LSYGKDGE----------------------------------------R
A0A1Z4IBC7      -----------ESPIPGLD----------------------------------------R
A0A1W5CPC7      -----------DIPIPGLD----------------------------------------R
A0A5Q0GKD1      -----------DIPIPGLD----------------------------------------R
Q3MDC6          -----------DIPIPGLD----------------------------------------R
A0A1Z4KM73      -----------DTPIPGLD----------------------------------------R
Q8YNX7          -----------DTPIPGLD----------------------------------------R
A0A367R4K6      -----------HSSIAGLD----------------------------------------R
A0A1E2WSV8      -----------SSSIAGLD----------------------------------------R
A0A2R5FRT9      -----------NPSIAGLD----------------------------------------R
A0A2K8T1B6      -----------HSSIAGLD----------------------------------------R
A0A235I9I0      -----------HSSIPGLD----------------------------------------R
A0A2D0HQT8      -----------HSSIPGLD----------------------------------------R
A0A2L2NU95      -----------HSSIAGLD----------------------------------------R
A0A367S084      -----------HSSIPGLD----------------------------------------R
A0A0V7ZFJ4      ------------------D----------------------------------------N
A0A367RIS1      ------------------G----------------------------------------E
A0A235IXQ2      ------------------G----------------------------------------E
A0A1W5CNX3      ------------------G----------------------------------------E
A0A5Q0GJJ5      ------------------G----------------------------------------E
Q3MEB7          ------------------G----------------------------------------E
A0A1Z4KHN9      ------------------G----------------------------------------E
Q8YT70          ------------------G----------------------------------------E
A0A218Q4C1      ------------------D----------------------------------------E
A0A166IWU6      ------------------D----------------------------------------D
A0A2S0Q8C0      ------------------D----------------------------------------D
W6FSX4          ------------------D----------------------------------------D
A0A0V7ZNJ9      ------------------F----------------------------------------D
A0A0R0M9H9      ------------------E----------------------------------------E
A0A1S1ZVW2      ------------------E----------------------------------------E
A0A1B7WX82      ------------------E----------------------------------------E
A0A1B7WTD1      ------------------V----------------------------------------E
A0A480ABC0      ------------------V----------------------------------------E
A0A1Z4LRU5      ------------------D----------------------------------------K
A0A1Z4JVB4      ------------------D----------------------------------------E
K9PIA4          ------------------G----------------------------------------E
A0A1Z4M597      ------------------G----------------------------------------V
A0A1Z4MWT1      ------------------A----------------------------------------A
A0A1Z4TX53      ------------------A----------------------------------------A
A0A1Z4HVE1      ------------------G----------------------------------------E
A0A252ECZ1      ------------------G----------------------------------------E
A0A1Z4G5Y1      ------------------G----------------------------------------E
A0A252DNA2      ------------------G----------------------------------------E
A0A252E1Q4      ------------------G----------------------------------------E
A0A5P8VSD1      ------------------G----------------------------------------E
A0A2A2TNQ5      ------------------G----------------------------------------K
A0A3S1C4K5      ------------------K----------------------------------------G
A0A1X4G3D5      ------------------W----------------------------------------E
D4TNI2          ------------------W----------------------------------------E
A0A1Z4H6Z8      ------------------S----------------------------------------E
A0A1Z4NPM1      ------------------K----------------------------------------A
A0A3F3KPR9      ------------------E----------------------------------------E
D4TGN7          ------------------E----------------------------------------E
A0A1Z4UZW9      ------------------Q----------------------------------------E
A0A0K2M5H0      ------------------Q----------------------------------------E
A0A1B7VSH4      ------------------Q----------------------------------------E
A0A1B7W126      ------------------Q----------------------------------------E
A0A3D4C6Q6      ------------------Q----------------------------------------E
A0A1B7UVJ4      ------------------E----------------------------------------E
A0A1B7UTR1      ------------------E----------------------------------------E
A0A5C0DRW9      ------------------Q----------------------------------------E
K7W0A4          ------------------Q----------------------------------------E
A0A1U7HGH0      ------------------------------------------------------------
K9XJD3          ------------------------------------------------------------
A0A2T1CIL7      -----------MQELSFATSRDN------------------------------------N
A0A1Z4RPC6      -----------------------------------------------------------D
A0A2T1CMZ0      -----------------------------------------------------------N
L8M4F7          -----------------------------------------------------------R
A0A140K2P2      -----------------------------------------------------------E
K9XWX4          -----------------------------------------------------------D
A0A140KB14      -----------------------------------------------------------E
K9XX88          -----------------------------------------------------------E
A0A563VSV6      -----------------------------------------------------------D
L8LZE9          -----------------------------------------------------------K
A0A433V7A0      -----------SSRHKEIE----------------------------------------Q
A0A1Z4NDS1      ------------------E----------------------------------------R
K9F4D9          --------------AKG------------------------------------------S
U9VXM0          --------------AKG------------------------------------------T
A0A2T1FTR8      -----------PKLSKGAA----------------------------------------R
K9UA41          -----------PKLSKGAA----------------------------------------R
A0A0C2LBE2      -----------SLRVPEVD----------------------------------------Q
A0A433NN38      -------------LTGRLD----------------------------------------R
A0A2N6K0T2      -----------NYSVQGLD----------------------------------------R
A0A2N6ML72      -----------SYSVQGLD----------------------------------------R
G6FQZ6          -----------SYSVQGLD----------------------------------------R
A0A2N6MQX9      -----------SYSVQGLD----------------------------------------R
A0A2N6KXT6      -----------SYSVQGLD----------------------------------------R
A0A2N6KGB9      -----------SYSVQGLD----------------------------------------R
A0A2N6L3Y5      -----------SYSVQGLD----------------------------------------R
A0A0S3TIS7      -----------SYSVQGLD----------------------------------------R
A0A1U7GW28      -----------SYSVQGLD----------------------------------------R
A0A2N6LW63      -----------SYSVQGLD----------------------------------------R
A0A328IH74      -----------SYSVEGLD----------------------------------------R
A0A4D9CIB0      -----------SYSVEGLD----------------------------------------R
A0A1Z4TQ63      -----------SYSVEGLD----------------------------------------R
A0A4Q9J8G2      -----------SYSVEGLD----------------------------------------R
A0A1Z4SMD6      -----------------------------------------------------------G
A0A2H2Y096      -----------------------------------------------------------G
K9S8M8          ------------------N----------------------------------------T
A0A1Z4NFV0      --------------EELFA----------------------------------------G
B0CAX4          ------------------D----------------------------------------R
U5DPF5          --------------VDG------------------------------------------T
A0A350Y0P6      ------------------N----------------------------------------G
A0A352X940      ------------------D----------------------------------------G
B8HTN4          -----------FKPTQGLE----------------------------------------R
A0A2A2TPF8      --------------NNAIAQTFIE-----------------------------------A
A0A1Z4R0P8      --------------NAAIEQISIE-----------------------------------G
A0A0T7BUI3      --------------HKSVAANITDD----------------------------------G
A0A1Z4LP32      --------------SKSLDSNFIDD----------------------------------N
K9REP9          --------------SKSTDSNPIVD----------------------------------T
A0A1Z4SIJ3      --------------DSSKETRLLGRINGLLAKYQQKNQIVSLPSTNFDSKLLPIRLVGLE
A0A2H2XPG4      --------------DSSKETRLLGRINGLLAKYQQKNQIVSLPSTNFDSKLLPIRLVGLE
K9V3C7          --------------STSLIEEMSGD----------------------------------G
A0A1Z4T6Y7      --------------APTIEQTI--E----------------------------------G
A0A2H2Y561      --------------APTIEQTI--E----------------------------------G
A0A1Q4S362      --------------SASIQQTM--E----------------------------------G
A0A3S1CIN8      --------------SASIEQTM--E----------------------------------G
A0A2A2TC28      --------------HSSLHQ-IMGD----------------------------------N
A0A0C1NCB0      --------------TKSSSDRLMGE----------------------------------A
A0A2N6K7Q9      --------------VSGVQ--EIEA----------------------------------G
A0A2N6MXH6      --------------VSGVQ--EIEA----------------------------------G
A0A2N6M5A8      --------------VSGVQ--EIEA----------------------------------G
A0A2N6LL61      --------------VSGVQ--EIEA----------------------------------G
A0A0S3TP66      --------------VSGVQ--EIEA----------------------------------G
G6FP91          --------------VSGVQ--EIET----------------------------------G
A0A1U7GYR5      --------------VSGVQ--EIEA----------------------------------G
A0A2N6KY52      --------------VSGVQ--EIET----------------------------------G
A0A2N6KMP5      --------------VSGVQ--QIET----------------------------------G
A0A2N6MA45      --------------VSGVQ--QIEA----------------------------------G
A0A4Q9J9V9      --------------VSAVQ--DIED----------------------------------G
A0A328IGA1      --------------VSAVQ--DIED----------------------------------G
A0A4D9CE41      --------------VSAVQ--DIED----------------------------------G
A0A0M0SFT2      --------------VNAVQ--DIED----------------------------------G
A0A1Z4TLC8      --------------VNAVQDVDVED----------------------------------G
A0A0C2LFH0      --------------SAPVN--LMSD----------------------------------K
A0A1Z4IYV4      --------------STPDK--LMSE----------------------------------G
A0A1Z4Q0T6      --------------SAPTK--LMSE----------------------------------G
A0A0C2PT44      --------------SAATK--LMSE----------------------------------G
A0A1D2P6J4      --------------SAPAE--LMSE----------------------------------G
A0A4R4IQ40      --------------KNG-E----------------------------------------T
A0A433W533      --------------KNA-E----------------------------------------A
A0A2P8QWJ3      --------------KSA-E----------------------------------------A
A0A2T1FKP8      --------------KNA-E----------------------------------------A
K9U6L7          --------------KNA-E----------------------------------------A
A0A3M9ZEU1      -----------G--RKSAE----------------------------------------P
A0A1Z4JK72      -----------TIVSPSAD----------------------------------------D
A0A0N7Z489      -----------TILSPGAD----------------------------------------D
A0A0S3TXS2      -----------TILSPGAD----------------------------------------D
A0A1Z4RN12      -----------QLPGNS-T----------------------------------------A
A0A2T1CMF9      -----------QLPGSE-K----------------------------------------A
Q7NDC5          ------------------S----------------------------------------V
U5QGK3          ------------------E----------------------------------------G
A0A2W4UY24      ------------------E----------------------------------------L
A0A2T1GMT4      --------------TTP-E----------------------------------------Q
K9UI51          --------------TTP-E----------------------------------------Q
K9QM62          -----------FYLQDT-E----------------------------------------S
A0A1Z4FWI3      --------------REA-E----------------------------------------L
A0A1Z4JYE7      --------------REG-E----------------------------------------Y
A0A2T1FXY4      --------------WDV-E----------------------------------------S
A0A4V2X3N2      --------------WDV-E----------------------------------------S
K9TYI2          --------------GYV-E----------------------------------------S
A0A1Z4QL41      --------------QKA-Q----------------------------------------T
A0A252D4T4      --------------RET-D----------------------------------------L
A0A252DJH5      --------------RET-D----------------------------------------L
A0A252EB80      --------------RET-D----------------------------------------L
A0A1Z4HPW5      --------------RET-E----------------------------------------I
A0A1Z4MSN1      --------------RET-E----------------------------------------I
A0A1Z4U1C2      --------------RET-E----------------------------------------I
A0A0D6KV51      --------------RET-E----------------------------------------I
A0A1Z4MKF8      --------------RET-E----------------------------------------I
A0A2C6WC43      --------------SSA-E----------------------------------------S
A0A1Z4L5A1      --------------SSA-E----------------------------------------S
A0A367QD86      --------------SSA-E----------------------------------------S
A0A235IZ96      --------------SNL-E----------------------------------------L
A0A2L2NGP0      --------------SNL-E----------------------------------------L
A0A2K8SM78      --------------SNL-E----------------------------------------S
A0A2R5FPC0      --------------SNV-E----------------------------------------P
A0A5P8W5T6      --------------SNL-E----------------------------------------S
A0A140KBA0      --------------GDV-V----------------------------------------D
K9XSG1          --------------GDV-V----------------------------------------D
A0A0F5YE28      --------------FQG-E----------------------------------------R
U7QEH7          --------------FQG-E----------------------------------------K
A0A3S1ATK5      --------------QNA-D----------------------------------------Y
A0A2Z6CPH0      --------------LDTKK----------------------------------------L
A0A1Z4GT50      --------------RDA-E----------------------------------------S
A0A1Z4GIX0      --------------SDG-E----------------------------------------L
A0A2H6LC24      --------------SDG-E----------------------------------------L
B2J6N5          --------------SNT-E----------------------------------------S
A0A367RMI4      --------------SNA-E----------------------------------------S
A0A235HUM0      --------------SNA-E----------------------------------------F
A0A2L2NW47      --------------SNA-E----------------------------------------S
A0A1E2WUR1      --------------SDT-E----------------------------------------S
A0A235IKU3      --------------SNL-E----------------------------------------L
F4XKF3          --------------RDD-L----------------------------------------F
A0A1D9FX10      --------------RDD-L----------------------------------------F
A0A1D8TNX9      --------------RDD-L----------------------------------------F
A0A1U7MYU6      --------------RDD-L----------------------------------------F
A0A3C0NJ41      --------------KHQ-E----------------------------------------R
A0A352AG88      --------------RDL-E----------------------------------------G
A0A350Y374      --------------TAQ-E----------------------------------------R
A0A355DPX0      --------------KAQ-E----------------------------------------R
A0A0D8ZUV2      --------------KDA-E----------------------------------------A
A0A433VDI0      --------------RDK-E----------------------------------------W
A0A3D1PG43      --------------K-Q-E----------------------------------------W
A0A2P8QQ72      --------------RQE-D----------------------------------------C
K9TZQ7          --------------RQQ-D----------------------------------------C
A0A2G7GPR0      --------------RNQ-E----------------------------------------W
K9XH68          --------------RNQ-E----------------------------------------W
A0A1U7HW70      --------------RNQ-E----------------------------------------W
A0A2S6VEJ8      --------------RNQ-E----------------------------------------W
                                                                            

K9SLA9          AKLAKGSVLITRDMPQS-------TLAET-----------FRILHTNLK-----FL----
A0A168TT23      ---TTR--AEDRAVSHYSELHPKSAVSEA-----------FRSLRTSLM-----FS----
A0A0M1JWX9      --------IADSNGRERLQDDRDFGFLEA-----------FRALNTNIR-----FL----
A0A2T1M1V6      ------------------------KSEVE-----------FQRLAAIVS-----SF----
A0A2G7GCS2      ------------------------EVAIE-----------LQRLASAV-------L----
K9XBH8          ------------------------EVPID-----------LQRLASAV-------L----
A0A1Z4LJ30      ------------------------GGEIE-----------FQRLASAVS-----LM----
K9RI76          ------------------------GGEIE-----------FQRLASAVS-----LM----
A0A352AE27      ------------------------ETEVE-----------FQRLASAIS-----LQ----
A0A3B8JH60      ------------------------DTEVE-----------FQRLASAIS-----LQ----
A0A3C0N766      ------------------------DTEVE-----------FQRLASAIS-----LQ----
K9W9J7          ------------------------ETEVE-----------FQRLASAIS-----LQ----
A0A139WSU3      ------------------------VSEVE-----------FQRLASAIS-----LQ----
A0A433VN22      ------------------------ETEVE-----------FQRLASAIS-----LQ----
Q7NF11          ------------------------PPRLE-----------SRQLASTVS-----LM----
A0A1Z4JCS8      ------------------------EGEIE-----------FQRVASAIS-----LQ----
F4XTX2          ------------------------ETDVE-----------FQRLASVIS-----LR----
Q7NJN6          ------------------------AEAEE-----------FRQLASVVS-----LL----
U5QCC3          ------------------------ATAEE-----------FLQLASIVS-----LM----
A0A3S0Y9N9      --------NNSPIPEVVVKNKPDSPVSEA-----------FRILQTNLR-----FF----
A0A433UNK7      --------NGNFIPEVIVKNQPDSSVSEA-----------FRMLQTNLR-----FF----
A0A3M1SVZ4      --------KSNRLLGHRRSIPQIIVRDNPRSLISEA----YRMLQTKLK-----FA----
A0A654SFI6      --------AADVLKDLINSASD---LSEA-----------YQATRANLAF----LT----
K9SSQ0          --------TNAKLLSPSLELISERAFLPH-----SYNHSAFTEAVNSLALNIQNLA----
A0A2W1JIN9      --------KNTLNLGEPASFYENSAILEA-----------YRALFKALE-----FR----
A0A318AJV1      --------------EGGRRWFRSRGRVSPADLIGVAGATVYSEAIRNLRASLIGVR----
A0A1U7N2U4      --------AQALSVEQPKGFLEDMRLMEP-----------YRLLLTTME-----LR----
A0A1D9G1F2      --------AQALSLEQPNRFLEDMRLMEP-----------YRLLLTTME-----LR----
F4XV38          --------AQALSLEQPNRFLEDMRLMEP-----------YRLLLTTME-----LR----
A0A2P8QIL5      --------PEVRGKEYADALMQEPAILES-----------YRSLLRSSE-----FA----
A0A2T1FLY5      --------PEVRGKEYADALMQEPAILES-----------YRSLLRSSE-----FA----
A0A433W447      --------PEVRGKEYADALMQEPAILES-----------YRSLLRSSE-----FA----
K9U1K8          --------PEVRGKEYADALMQEPAILES-----------YRSLLRSSE-----FA----
A0A4V6P809      --------PEVRGKEYADALMQEPAILES-----------YRSLLRSSE-----FA----
K9UYB2          --------AKATILQPANFFFNEISLVEP-----------YRMLFKNLE-----FS----
A0A218QN17      --------AKTLVLEPAERFLDNISLVEP-----------YRMLLKTLE-----FR----
K9RKN2          --------GKTLVLEPSDRFLDQVGLVEP-----------YRMLFKTLE-----FR----
A0A2I8ADV2      --------ATKLTLEPAEKFLDDVGLVEP-----------YRMLLKNLE-----FR----
A0A1W5CKM3      --------ATKLSLEPAEQFLDDLGLVEP-----------YRMLLKNLE-----FR----
A0A5Q0GMF5      --------ATKLSLEPAEQFLDDLGLVEP-----------YRMLLKNLE-----FR----
Q3MEW0          --------ATKLSLEPAEQFLDDLGLVEP-----------YRMLLKNLE-----FR----
A0A1Z4KIC7      --------ATKLSLEPAEQFLDDLGLVEP-----------YRMLLKNLE-----FR----
Q8YSM5          --------ATKLSLEPAEQFLDDLGLVEP-----------YRMLLKNLE-----FR----
A0A1Q4S1H4      --------KSNLALAEADLFLDDMGLVEP-----------YRMLLKTLE-----CR----
A0A433VBU6      --------KSNLALAEADLFLDDMGLVEP-----------YRMLLKTLE-----CR----
A0A1Q4RZJ6      --------AKTLALEPADGFLDNVALVEP-----------YRMLFKSLE-----FR----
A0A1Z4SNV3      --------DRTLVLNPANRFLDNVGLVEP-----------YRMLFKSLE-----FR----
A0A2H2XJQ1      --------DRTLVLNPANRFLDNVGLVEP-----------YRMLFKSLE-----FR----
A0A3S5K358      --------AKTLALEPADGFLDNVALVEP-----------YRMLFKSLE-----FR----
A0A0T7BPJ4      --------GSTLKLQSADTFLDDIGSVEP-----------YRMLLKNIE-----FR----
A0A0C1QS61      --------SKTLVLEPSQRFLDNMSLVEP-----------YRMLFKTLE-----FR----
A0A139X3R8      --------SKTLVLEPSHRFLDNVSLVEP-----------YRMLFKTLE-----FR----
A0A1Z4I7C5      --------ATKLSLEPAEQFLDDLGLVEP-----------YRMLLKNLE-----FR----
A0A0C2MDK7      --------AKTLVLEPANQFLDNMELIEP-----------YRTLFKTLE-----FR----
A0A1Y0RCK1      --------AKTLVLKPANQFLDNISLVEP-----------YRTLFKTLE-----FR----
A0A1Z4PWZ0      --------AKTLVLEPANRFLDNIGLVEP-----------YRTLFKTLE-----FR----
A0A0C2QLT0      --------GKTLVLKPANRFLDNIGLVEP-----------YRTLFKTLE-----FR----
A0A1Z4J2K1      --------AKTLVLEPANRFLDNIGLVEP-----------YRTLFKTLE-----FR----
A0A3S0ZSX0      --------AKTLMLEPSERFLDNSALIEP-----------FRMLFKNLE-----FR----
A0A2N6K4T3      --------SRAIALEPSVRFLDHVGLVEP-----------YRTLFKNLE-----FR----
A0A370CKT2      --------GHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR----
A0A0S3TL97      --------GHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR----
A0A2N6M8A0      --------GHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR----
A0A2N6M9E1      --------GHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR----
A0A2N6KJI4      --------GHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR----
A0A2N6MZ77      --------GHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR----
A0A2N6KT20      --------GHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR----
G6FSN3          --------GHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR----
A0A4D9CI02      --------ADAIALEPSGQFLDHLGLVEP-----------YRTLLKNLE-----FR----
A0A328I8B9      --------AHAIALEPSGQFLDHVGLVEP-----------YRTLLKNLE-----FR----
A0A4Q9J4Z7      --------AHAIALEPSGQFLDHLGLVEP-----------YRTLLKNLE-----FR----
A0A0M0SU69      --------ADAIALEPSGRFLDHVGLVEP-----------YRTLFKNLE-----FR----
A0A1Z4TIZ8      --------THAIALESSGRFLDHVGLIEP-----------YRTLFKNLE-----FR----
A0A0S3TYD7      NLNVVDTELVVRDAPRS-------APAAA-----------YQMLQSNLK-----YV----
U5QL42          ---SRD--GVVIGDRLVTRQYTRSPFKEA-----------LRSLALSLR-----YL----
K9QF04          ---TNQ--LTHYG------NYTLSHYWEA-----------YISLQTNLD-----FL----
A0A3C0N2P0      ---DPE--NLEFQLSAQSYGYNASPLLES-----------FRSLNTNLQ-----FV----
K9TLQ0          ---LTV--SDGENLVQASGGYLFSRFFEA-----------FRSLHADLY-----FM----
A0A076HBF2      ---VTG--EDDPE-AAKQRRYQRFLYQEA-----------FRNLFTSIR-----FL----
A0A354B169      ---LVA--NPASE-AFEKYRSQLFYCQEA-----------FRSLFTSLR-----FL----
G4FMX5          ---TQA--DVGET-ERKAARYQRFFYQEA-----------FRNLFTSLR-----FL----
Q0IDT5          ---NNA--TNAPE-SRKQDRYQRFFYQEA-----------FRNLFTSLR-----FL----
A0A2D6FCW3      ---NPS--EEDQN-TKQKAKYQRFFYQEA-----------FRNLFTSIR-----FL----
A3ZA21          ---SVS--GGDAD-DRREQRYQRFFYQEA-----------FRNLFTSIR-----FL----
A0A140K3H3      ---GET--------NTKAHYYNYSSFTEG-----------LRTLAMNLR-----YT----
K9XUB8          ---GET--------HSRAHYYNYSSFTEG-----------LRALAMNLR-----YT----
Q7NEU3          ---RQK--PDLPK-----SSLEKSMLREA-----------FRSLLTNLR-----FL----
A0A352XE00      ---NRE--VLELAFSGYS-RYRPSPFLEA-----------FRSLHTNLN-----FI----
B4VS56          ---ETP--LLASPISQSTYRYHASPFLEA-----------FRSLQTNLQ-----FI----
A0A352AAQ3      ---EGQ--QLESEFNQRSYRYTASPVLEA-----------FRSLHANLH-----FL----
A0A350Y472      ---HSE--PLELELRRRSSRYNASPLLEA-----------FRSLHANLH-----FL----
A0A355DVB4      ---HSE--PLELELRRRSSRYNASPLLEA-----------FRSLHANLH-----FL----
A0A2P8VVX1      ---GLH--PELAD-SDLMKTVMWPQFRDS-----------LDLIANNLQ-----LL----
A0A2P8WHY0      ----LH--PELAD-SDLMQIVQWPTFREA-----------LDLVANNVQ-----LM----
A0A2T1CMT9      ---FRS--ISSDT-SSIQNVIQWQPFREA-----------IDLIYENLK-----LAYLNS
A0A563VQJ3      ---EEP--DSYVS--------------EL-----------YRMLQANLK-----FM----
A0A1D8TX52      ---LSQ--SERA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----
A0A1U7N5X9      ---LSQ--SEKA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----
A0A1D9G4T2      ---LSQ--SEKT--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----
F4XP71          ---LSQ--SERT--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----
A0A2P8QVH5      ---FFK--QQSLT-SQRIQALNWFPFRES-----------MDLIYQNIQ-----IL----
A0A2T1FT70      ---FFK--QQSLT-SQRIQALNWFPFRES-----------MDLIYQNIQ-----IL----
A0A433W4W4      ---FFK--QQSLT-SQRIQALNWFPFRES-----------MDLIYQNIQ-----IL----
K9U5W1          ---FFK--QQSLT-SQRIQALNWFPFRES-----------MDLIYQNIQ-----IL----
A0A2W6ZAV2      ---MEP--EARFG------------LRES-----------LRNLFSSFR-----LL----
A0A2G7GMH8      ---LNK--QQ----TQVLPMLCLQSFRDA-----------LDLIYKNIR-----LL----
K9W742          ---FGK--PKVLA-PWTVEVLHWSPSWQS-----------LDLIYKNIQ-----LL----
A0A2T1DWE8      -----R--EVGVPAPPIMQVIHWQPFRES-----------LDLIYKNIQ-----LL----
A0A1U7I8L3      ---FRQ--QPILT-SSTIELISWQPFRES-----------LDLIYQNIQ-----LV----
A0A2T1DJL8      ---FQK--AENLA-PSMMQVIHWAPFRES-----------LDLIYKNIQ-----LL----
A0A1Z4J9W0      ---FSR--NAFEENSSMLQVLHWAPFRES-----------LDLIYKNLQ-----LM----
A0A0N7Z5K9      ---FGR--ST--GDTSMLQVLHWAPFRES-----------LDLIYKNLQ-----LM----
A0A0S3TXC5      ---FGR--STNAGDTSMLQVLHWAPFRES-----------LDLIYKNLQ-----LM----
K9SA61          ---LRR--SETFT-TASLEVIHWPPFRES-----------MDLIYQNIQ-----LL----
A0A3D1PBA3      ---FGK--PHLLA-PWTVQVSNWPPTWES-----------LDLIYKNIQ-----LM----
K9XPB0          ---FLS--PK--E-SSVQEIINWQPFRES-----------LDLIYENLQ-----RL----
A0A350Y7Z1      ---FRR--TQVAA-ASTLPMVYWLPFRES-----------LDLIYKHIQ-----LL----
A0A352X2A7      ---FRK--SSVTE-ISTSHLAYSSAFRES-----------LDLIYKNIQ-----LV----
A0A0D8ZYV0      ---FGK--PNVLA-PWTVQVSNWPPSWES-----------LDLIYKNIQ-----LL----
A0A4R4IUM6      ---FGK--PLHLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----LM----
A0A2T1FP73      ---FGK--PLHLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----LM----
A0A433VMS2      ---FGK--PLHLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----LM----
K9TYA7          ---FGK--PLHLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----LM----
A0A2P8QUE1      ---FGK--PLHLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----LM----
A0A2T1DNG3      ---LLP--PITQLTKWR-------PFRES-----------LDLLYQNLQ-----LI----
A0A2P8W9H0      L--TSDFSLPPLSYELRTDQVAM-PFLEA-----------FRILATNIR-----LS----
A0A1Z4LN32      V--SER--VIVATSPRT-------VIHEA-----------YQMLQANLK-----FI----
A0A2I8A9F5      P--ARR--VIVETTPRS-------MIHES-----------FGMLQANLK-----FI----
A0A218Q6R8      F--SPR--IVVETSPRS-------VIHES-----------YQMLQANLK-----FM----
A0A218QGE0      V--SER--IIVATSPRT-------VIHEA-----------YQMLQANLK-----FI----
B8HNB0          ------------------------PFVEA-----------VRSLGLNLR-----YL----
A0A563VS48      ITQGKQQPVLAESSSAITDDGLILPVKEA-----------FQDIQINLQ-----LL----
A0A318BJ18      ---TPREQLLDRKS----------NLVDA-----------YLAINTNLG-----FT----
A0A3B8Y8H9      KLLQNKTDFPGSNPNFS-------LFLEA-----------FLGLQTNLV-----LL----
A0A2W1JVB9      D-------LYVRDTPNS-------PPSEA-----------VRMVQSNLK-----YL----
A0A1Z3HMQ0      EGISPR--VIAFSQTQP-------MVTAA-----------YQMLQANLK-----FI----
A0A1E5QP61      E--IPL--LPTRDQPTT-------YTSEA-----------YRTLQANLK-----FI----
A0A3M2GIL5      I--TPD--LPVRDRPHW-------VVSET-----------YRMLQANLR-----FL----
A0A433NM31      T--LPK--IPVKCTPRS-------MISEI-----------YGMIYANLK-----FL----
A0A3M1PML8      P--APR--VVVRDMPQS-------PIAAS-----------YQMLQANLK-----FL----
A0A352X442      K--DVR--LVARDTPGS-------PIAQA-----------YQMLRANLK-----FL----
A0A0T7BPZ0      Q--IPR--VIGRDVPSF-------PMDEV-----------YQMLQANLK-----FL----
A0A0M0SHU3      P--VPR--VIGRDVPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A1D2PBN3      P--IPR--VIGTDIPQF-------PVGDA-----------YQMLQANLK-----FL----
A0A0C2LVR7      P--IPR--VIGTDIPQF-------PVGDA-----------YQMLQANLM-----FL----
A0A1Z4PQB9      P--IPR--VIGTDIPQF-------PVGDA-----------YQMLQANLK-----FL----
A0A1Z4SFN6      Q--IPR--VIGRDIPHF-------PVGDA-----------YQILQANLK-----FL----
K9PGI8          PFAIPR--LIGRDIPHY-------PIGNA-----------YQMLQANLK-----FL----
A0A563VLD6      ------------NYSYS-------SFTEA-----------FRAIAMNLG-----YM----
A0A318BG22      --------PALLANKRS-------SLSEA-----------YYSIQTALQ-----LA----
A0A2T1E9V8      E--IGSGAVPVIEDPRA-------FISES-----------YRMLQFNLE-----VA----
A0A3M2GQQ6      Y--YTE------------------PFTEA-----------VRSLALNLR-----YL----
K9SGJ5          V--VEKETALAPSMMHS-------AFREA-----------LRSLALNLR-----YL----
L8MYT6          L--LSQ--GILPTSSYY-------AFKEA-----------LSSLALNLR-----YL----
A0A352JGJ6      M--VSQ--GILPTSSYY-------AFKEA-----------LSSLALNLR-----YL----
A0A1J5GLS2      M--VGQ--SILPSSSYY-------AFKEA-----------LSSLALNLR-----YL----
A0A2W4W6M5      M--ISH--GILPTSSYY-------AFKEA-----------LSSLALNLR-----YL----
A0A2W7AN33      M---AK--GQFPNNNYH-------AFKEA-----------LGSLALNLR-----HL----
A0A256BLV2      A--TNQ--GILPSSSYY-------AFKEA-----------LGSLALNLR-----YL----
A0A2W6ZXF3      M--ISQ--GILPSSSYY-------AFKEA-----------LSSLALNLR-----YL----
A0A2Z5WX66      M--LSQ--GILPTSSYY-------AFKEA-----------LSSLALNLR-----YL----
K9W1T3          I--VPS--IVVTNTAGS-------PISEA-----------YRMIHTSLR-----FM----
A0A1Q4RTR1      H--IST--LPIRDNPWS-------PASAA-----------FEKLQSTLE-----YT----
A0A1Z4SQV2      D--IST--LPIRDNPWS-------PASAA-----------FEKLQSTLE-----YT----
A0A2H2XGN1      D--IST--LPIRDNPWS-------PASAA-----------FEKLQSTLE-----YT----
A0A433UXH8      D--IST--LPIRDNPWS-------PASAA-----------FEKLQSTLE-----YT----
A0A1Z4RMB9      Y--QGR--IITREEPDS-------FSSEI-----------YRMIQANLK-----FL----
K1XF69          S--SVQ--VPVVDTPGS-------LISEI-----------YRMIQANLK-----FL----
B5W297          S--SVQ--VPVVDTPGS-------LISEI-----------YRMIQANLK-----FL----
H1W7M8          S--SVQ--VPVVDTPGS-------LISEI-----------YRMIQANLK-----FL----
A0A5Q4H6A5      S--SVQ--VPVVDTPGS-------LISEI-----------YRMIQANLK-----FL----
D5A466          S--SVQ--VPVVDTPGS-------LISEI-----------YRMIQANLK-----FL----
B4WP72          S--NVR--TRSRNVHAS-------VVTEA-----------YQMLWSNLK-----SV----
A0A318B4H2      V--AEE--LQNKKT----------QLYES-----------YLAVRTNLS-----FL----
B4WQE3          F--NEG--VQHLDRTTG-------PFLEA-----------FKLLATNVC-----QG----
A0A2P8W4F7      V--LTQ--SQSPEKLYTSF-----SFAEA-----------FYSLEANLR-----ML----
A0A5Q4E0Z4      L--LAQ--SQSPGNLYSSF-----SFAEA-----------FYSLEANLR-----ML----
A0A2K3BR24      T--SSF--LPLRDLPQS-------SASEA-----------FRMLQANLK-----FS----
K9YXY1          T--SSF--LPLRDLPQS-------SASEA-----------FRMLQANLK-----FS----
U5QJM6          A--KSN--GRVQNPPYTRS-----AYEEA-----------FRSLLTNIR-----FL----
K9SX01          T--ALT--VFVRDNPRA-------PASEA-----------YRMLQTSLR-----FL----
A0A4P7ZT55      ---------------RF-------GLRES-----------LRNLYRSLQ-----LV----
A0A1E5QIR9      V--KAK--LPVKDAPRS-------LISES-----------YRMLYANLK-----FL----
A0A1Z4IBC7      P--VPK--IIGRDIPYF-------PLGDA-----------YQILQVNLK-----FL----
A0A1W5CPC7      A--VPK--IIGRDIPYF-------PLGDA-----------YQILQVNLK-----FL----
A0A5Q0GKD1      A--VPK--IIGRDIPYF-------PLGDA-----------YQILQVNLK-----FL----
Q3MDC6          A--VPK--IIGRDIPYF-------PLGDA-----------YQILQVNLK-----FL----
A0A1Z4KM73      A--VPK--IIGRDIPYF-------PLGDA-----------YQILQVNLK-----FL----
Q8YNX7          A--VPK--IIGRDIPYF-------PLGDA-----------YQILQVNLK-----FL----
A0A367R4K6      P--IPK--IIGRDIPYF-------PLGDA-----------YQILQVNLK-----FL----
A0A1E2WSV8      A--IPK--IIGRDIPYF-------PVGNA-----------YQILQVNLK-----FL----
A0A2R5FRT9      A--IPK--IIGRDIPYF-------PLGNA-----------YQVLQVNLK-----FL----
A0A2K8T1B6      P--IPK--IIGRDIPYF-------PLGNA-----------YQILQVNLK-----FL----
A0A235I9I0      A--IPK--IIGRDIPYF-------PVGNA-----------YQILQVNLK-----FL----
A0A2D0HQT8      P--IPK--IIGRDIPYF-------PVGNA-----------YQILQVNLK-----FL----
A0A2L2NU95      P--IPK--IIGRDIPYF-------PVGNA-----------YQILQVNLK-----FL----
A0A367S084      P--IPK--IIGRDIPYF-------PVGNA-----------YQILQVNLK-----FL----
A0A0V7ZFJ4      Q--EIE--LPVLDNPYS-------SVTSA-----------FEILQTNLA-----FT----
A0A367RIS1      S--ITE--LPVLNNPYS-------SVNAA-----------FEMLQINLG-----FT----
A0A235IXQ2      N--ITE--LPVLNNPYS-------SVNAA-----------FEMLQINLG-----FS----
A0A1W5CNX3      S--ITE--LPVLNNPYS-------SVNAA-----------FEMLQINLG-----FS----
A0A5Q0GJJ5      S--ITE--LPVLNNPYS-------SVNAA-----------FEMLQINLG-----FS----
Q3MEB7          S--ITE--LPVLNNPYS-------SVNAA-----------FEMLQINLG-----FS----
A0A1Z4KHN9      S--ITE--LPVLNNPYS-------SVNAA-----------FEMLQINLG-----FT----
Q8YT70          S--ITE--LPVLNNPYS-------SVNAA-----------FEMLQINLG-----FT----
A0A218Q4C1      H--TTE--LPLLDNPYS-------SVNTA-----------FEMLQINLG-----FT----
A0A166IWU6      N--TSE--LPLLNNPYS-------SVNTA-----------FEMLQINLG-----FT----
A0A2S0Q8C0      N--TSE--LPLLNNPYS-------SVNTA-----------FEMLQINLG-----FT----
W6FSX4          N--TSE--LPLLNNPYS-------SVNTA-----------FEMLQINLG-----FT----
A0A0V7ZNJ9      G--NPE--LPTLNNPYS-------VESSA-----------FEMLQTNLS-----FT----
A0A0R0M9H9      N--QRE--LPVLDNPYS-------PVSTS-----------IEMLQTNLG-----FA----
A0A1S1ZVW2      N--QRE--LPVLDNPYS-------PVSTS-----------IEMLQTNLG-----FA----
A0A1B7WX82      S--RRE--LPLLDNIYS-------PVSTS-----------FEMLQTNLG-----FT----
A0A1B7WTD1      G--LLE--VPLLDQPYS-------PVSTS-----------LEMLHTNLG-----FT----
A0A480ABC0      G--LLE--VPLLDQPYS-------PVSTS-----------LEMLNTNLG-----FT----
A0A1Z4LRU5      D--RQE--LPVLNNPYS-------PASTA-----------FEILQTNLG-----FT----
A0A1Z4JVB4      R--TAA--LPVLHNPYS-------PAAVA-----------FEMFQTNLG-----FS----
K9PIA4          G--GAE--LPVLNNPYS-------PESAA-----------FEMLQTNLG-----FS----
A0A1Z4M597      G--EVE--LPVLNNPYS-------PVSSA-----------FEMLQTNLS-----FS----
A0A1Z4MWT1      S--EQE--LPVLNNPYS-------PVSSA-----------FEMLQTNLS-----FS----
A0A1Z4TX53      S--EQE--LPVLNNPYS-------PVSSA-----------FEMLQTNLS-----FS----
A0A1Z4HVE1      E--GAE--LPVLNNPYS-------AESAA-----------FEMLQANLG-----FS----
A0A252ECZ1      G--STE--LPVLNNPYS-------PESSA-----------FEMLQANLS-----FS----
A0A1Z4G5Y1      G--SAE--LPVLHNPYS-------PESAA-----------FEMLQTNLG-----FS----
A0A252DNA2      G--SAE--LPTLHNPYS-------PESAA-----------FEMLQANLG-----FS----
A0A252E1Q4      G--SAE--LPTLHNPYS-------PESAA-----------FEMLQANLG-----FS----
A0A5P8VSD1      S--ITE--LPVLNNPYS-------SVNAA-----------FEMLQINLG-----FT----
A0A2A2TNQ5      M--ATE--IPARDNPYS-------SGSMA-----------FEMLMTNLA-----FS----
A0A3S1C4K5      N--GDD--LPVLKDPYS-------PATSA-----------FEMLVTNLS-----FT----
A0A1X4G3D5      G--EGD--LPLFDQPYS-------PISRS-----------FQILQTNLG-----FA----
D4TNI2          G--EGD--LPLFDQPYS-------PISRS-----------FQILQTNLG-----FA----
A0A1Z4H6Z8      A--GSE--LPVLNNPYS-------PESTA-----------FEMLQVNLG-----FS----
A0A1Z4NPM1      G--DEE--LPVLNNPYS-------PASVA-----------FEMLQTNLS-----FT----
A0A3F3KPR9      S--QRE--LPILDNPYS-------PVSTS-----------IEMLQTNLG-----FA----
D4TGN7          S--QRE--LPILDNPYS-------PVSTS-----------IEMLQTNLG-----FA----
A0A1Z4UZW9      G--RQE--LPVLNNPYS-------PVSTS-----------FEMLQTNLG-----FT----
A0A0K2M5H0      G--RQE--LPLLDDPYS-------PVSTS-----------FEMLQTNLG-----FT----
A0A1B7VSH4      G--RQE--LPLLDDPYS-------PVSTS-----------FEMLQTNLG-----FT----
A0A1B7W126      G--RQE--LPLLDDPYS-------PVSTS-----------FEMLQTNLG-----FT----
A0A3D4C6Q6      G--RQE--LPLLDDPYS-------PVSTS-----------FEMLQTNLG-----FT----
A0A1B7UVJ4      S--RGE--LPLLDNIYS-------PVSTS-----------FEMLQTNLG-----FT----
A0A1B7UTR1      S--RGE--LPLLDNIYS-------PVSTS-----------FEMLQTNLG-----FT----
A0A5C0DRW9      G--RQE--LPLLDNPYS-------PVTTS-----------FEMLQTNLG-----FT----
K7W0A4          G--RQE--LPLLDNPYS-------PVSTS-----------FEMLQTNLG-----FT----
A0A1U7HGH0      -----R--VPVLAEPRS-------FITES-----------YRMLLANLK-----FP----
K9XJD3          -----Q--VPVLAEPRS-------FVTES-----------YRMLLANLK-----FP----
A0A2T1CIL7      S--SLS--IPDLNLAAV-------RYNEA-----------YNMLQANLK-----FL----
A0A1Z4RPC6      S--HGS--IIVQREPDS-------FASEI-----------YRMIQTNLK-----FL----
A0A2T1CMZ0      N--RGG--LVVQREPDS-------FASEI-----------YRMIQTNLK-----FL----
L8M4F7          S--KRR--VVVEQSPDS-------YTSEI-----------YRMIRTNLT-----AR----
A0A140K2P2      N--Q-G--IIVQKQPDS-------FASEV-----------YRMIQANLK-----FM----
K9XWX4          N--Q-G--IIVHKQPDS-------FASEV-----------YRMIQANLK-----FM----
A0A140KB14      P--N-G--IVVQREPDS-------FNSEL-----------YRMIQANLK-----IL----
K9XX88          P--N-G--IVVQREPDS-------FNSEI-----------YRMIQANLK-----IL----
A0A563VSV6      R--Q-G--VLVQQEPDS-------YASET-----------YRMIQANLK-----FM----
L8LZE9          R--EDG--IMVQQDPDS-------YTSEI-----------YRMIQANLK-----FM----
A0A433V7A0      T--ALN--VHVRDNSRS-------FIYEL-----------YCMIQANLK-----FL----
A0A1Z4NDS1      N--LPQ--IVGRDTPQF-------PFSDA-----------YQMLQANLK-----FL----
K9F4D9          D--VPS--ILVKNSEYS-------SILDA-----------YQALQANLK-----FS----
U9VXM0          D--VPS--ILVRNTEYS-------SVLDA-----------YQSLQANLK-----FS----
A0A2T1FTR8      A--PGQ--LVLTGMTTG-------IEGES-----------FRMLQTNLQ-----FL----
K9UA41          A--PGQ--LVLTGMTTG-------IEGES-----------FRMLQTNLQ-----FL----
A0A0C2LBE2      S--IPK--VIGRDIPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A433NN38      P--TPR--VIGRDIHLF-------AIRDA-----------YQMLQANLR-----FL----
A0A2N6K0T2      P--IPR--VVGRDIPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A2N6ML72      P--IPR--VVGRDIPHF-------PVGDA-----------YQMLQANLK-----FL----
G6FQZ6          P--IPR--VVGRDIPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A2N6MQX9      P--IPR--VVGRDIPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A2N6KXT6      P--IPR--VVGRDIPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A2N6KGB9      P--IPR--VVGRDIPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A2N6L3Y5      P--IPR--VVGRDIPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A0S3TIS7      P--IPR--VVGRDIPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A1U7GW28      P--IPR--VVGRDIPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A2N6LW63      P--IPR--VVGRDIPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A328IH74      P--VPR--VIGRDVPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A4D9CIB0      P--VPR--VVGRDVPYF-------PVGDA-----------YQMLQANLK-----FL----
A0A1Z4TQ63      P--VPR--VVGRDIPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A4Q9J8G2      P--VPR--VVGRDVPHF-------PVGDA-----------YQMLQANLK-----FL----
A0A1Z4SMD6      I--SPR--IVIGTYPHT-------IVHDA-----------YQMLQANLK-----FI----
A0A2H2Y096      I--SPR--IVIGTYPHT-------IVHDA-----------YQMLQANLK-----FI----
K9S8M8          S--VPK--VVVQEAPHS-------IISEN-----------YRMLQANLR-----FL----
A0A1Z4NFV0      V--SPR--VIVATTPRS-------VIHEA-----------YQMLQANLK-----FI----
B0CAX4          P--TPD--LVVRDSPRS-------SVSES-----------YRMLQANLK-----FL----
U5DPF5          R--PVT--LPVRDYPRS-------SMSEA-----------FRMLQANLK-----FS----
A0A350Y0P6      N--VPQ--LVVRDVPHG-------ITSEA-----------YRMLEANLK-----FL----
A0A352X940      D--IPQ--LPVRDAPHA-------IVSEA-----------YRMLEANLK-----FL----
B8HTN4          A--TPQ--LYLRDQPNS-------HLSEA-----------YRTLQANLK-----FL----
A0A2A2TPF8      A--SPR--IIVATLPRS-------VIHEA-----------YQMLQANLN-----FI----
A0A1Z4R0P8      A--SPR--VIVGTLPRS-------VIHEA-----------YQMLEANLN-----FI----
A0A0T7BUI3      I--SER--VIVNSSPRT-------IIHEA-----------YQMLQANLN-----FI----
A0A1Z4LP32      I--SPR--IIVASSPRT-------MIHEA-----------YQMLQANLK-----FI----
K9REP9          I--SPR--IIVASSPRT-------MIHEA-----------YQMLQANLK-----FI----
A0A1Z4SIJ3      V--SNR--IIVASAPHT-------VIHDA-----------YQMLQANLK-----FI----
A0A2H2XPG4      V--SNR--IIVASAPHT-------VIHDA-----------YQMLQANLK-----FI----
K9V3C7          V--SPR--IIVATSPRT-------VIHEA-----------YQMLRANLK-----FI----
A0A1Z4T6Y7      A--SPR--IVVGTLPRS-------VIHEA-----------YQMLQANLK-----FI----
A0A2H2Y561      A--SPR--IVVGTLPRS-------VIHEA-----------YQMLQANLK-----FI----
A0A1Q4S362      A--SPR--VIVGTLPRS-------VIHEA-----------YQMLQANLK-----FI----
A0A3S1CIN8      A--SPR--VVVGTLPRS-------VIHEA-----------YQMLQANLK-----FI----
A0A2A2TC28      V--SPR--VIVASSPRT-------VIHEA-----------YQMLQANLK-----FI----
A0A0C1NCB0      T--SPR--VIVATSPRT-------VVHEA-----------YQMLQANLK-----FI----
A0A2N6K7Q9      V--YPQ--VIATTSPRT-------VVHEA-----------YQMLQANLK-----FI----
A0A2N6MXH6      V--YPQ--VITTTSPRT-------VVHEA-----------YQMLQANLK-----FI----
A0A2N6M5A8      V--YPQ--VITTTSPRT-------VVHEA-----------YQMLQANLK-----FI----
A0A2N6LL61      V--YPQ--VITTTSPRT-------VVHEA-----------YQMLQANLK-----FI----
A0A0S3TP66      V--YPQ--VITTTSPRT-------VVHEA-----------YQMLQANLK-----FI----
G6FP91          V--YPQ--VITTTSPRT-------VVHEA-----------YQMLQANLK-----FI----
A0A1U7GYR5      V--YPQ--VITTTSPRT-------VVHEA-----------YQMLQANLK-----FI----
A0A2N6KY52      V--YPQ--VITTTSPRT-------VVHEA-----------YQMLQANLK-----FI----
A0A2N6KMP5      V--YPQ--VITTTSPRT-------VVHEA-----------YQMLQANLK-----FI----
A0A2N6MA45      V--YPQ--VITTTSPRT-------VVHEA-----------YQMLQANLK-----FI----
A0A4Q9J9V9      V--YPQ--VITTTSPRT-------LVHEA-----------YQMLQANLK-----FI----
A0A328IGA1      V--YPQ--VITTTSPRT-------LVHEA-----------YQMLQANLK-----FI----
A0A4D9CE41      V--YPQ--VITTTSPRT-------LVHEA-----------YQMLQANLK-----FI----
A0A0M0SFT2      V--YPQ--VITTTSPRT-------LVHEA-----------YQMLQANLK-----FI----
A0A1Z4TLC8      V--YPQ--VITTTSPRT-------LVHEA-----------YQMLQANLK-----FI----
A0A0C2LFH0      A--SAR--IIVATSPRS-------VVHEA-----------YQMLQANLK-----FI----
A0A1Z4IYV4      V--SAR--VIVATSPRS-------VIHEA-----------YQMLQANLK-----FI----
A0A1Z4Q0T6      V--SAR--VIVATSPRS-------VIHEA-----------YQMLQANLK-----FI----
A0A0C2PT44      V--SAR--VIVATSPRS-------VIHEA-----------YQMLQANLK-----FI----
A0A1D2P6J4      V--SGR--VIVATSPRS-------VVHEA-----------YQMLQANLK-----FI----
A0A4R4IQ40      A--AIA--LPVRDTPRA-------PIAEA-----------FRMLQANLK-----FS----
A0A433W533      T--TIA--LPVRDTPRA-------PIAEA-----------FRMLQANLK-----FS----
A0A2P8QWJ3      T--TIA--LPVRDTPRA-------PIAEA-----------FRMLQANLK-----FS----
A0A2T1FKP8      T--TIA--LPVRDTPRA-------PIAEA-----------FRMLQANLK-----FS----
K9U6L7          T--TIA--LPVRDTPRA-------PIAEA-----------FRMLQANLK-----FS----
A0A3M9ZEU1      A--TLR--IFPRDLPRS-------PISEA-----------YHMLQANLK-----FL----
A0A1Z4JK72      I--SPR--VIAMTSPRS-------MIHEA-----------YQMLQANLK-----FM----
A0A0N7Z489      I--SPR--VIAMSTPRS-------MIHEA-----------YQMLQANLK-----FM----
A0A0S3TXS2      I--SPR--VIAMTSPRS-------MIHEA-----------YQMLQANLK-----FM----
A0A1Z4RN12      N--LPE--QVTTDASML-------PLKEA-----------YQNIQVNLK-----LL----
A0A2T1CMF9      N--LPE--QIVSEVSMM-------PLKEA-----------YQNIQVNLN-----LL----
Q7NDC5          R--GPL--MALRD-PLS-------PVSEA-----------YRSIRTHLK-----FL----
U5QGK3          P--G-L--VAQSD-PLS-------PMSEA-----------YRSVRTYLK-----FL----
A0A2W4UY24      D--APR--IIVKQRHRV-------PLVES-----------YQSLQANLK-----FS----
A0A2T1GMT4      T--TLE--IAVRDTPQS-------ITSEM-----------SRTIQSNLR-----FL----
K9UI51          T--TLE--IAVRDTPQS-------ITSEM-----------SRTIQSNLR-----FL----
K9QM62          I--TPS--IAVRDRPYS-------LTSEM-----------YRMLQANLK-----FL----
A0A1Z4FWI3      A--PPE--IAVIDTPQS-------LTSEI-----------YRMIQANLR-----FL----
A0A1Z4JYE7      Q--IPR--IAVRDTPDS-------LTSEI-----------YRMIQANLK-----FL----
A0A2T1FXY4      T--NPE--IAVRDKPHS-------LTSEI-----------YRMIQANLK-----FL----
A0A4V2X3N2      T--NPE--ISVRDKPYS-------LTSEI-----------YRMIQANLK-----FL----
K9TYI2          T--IPE--ISVRDKPHS-------LTSEI-----------YRMIQANLK-----FL----
A0A1Z4QL41      N--TQN--IVVRDQPYS-------LASEM-----------YRMIQANLR-----LV----
A0A252D4T4      I--NPE--IAVIDTPHS-------LTSEI-----------YRMIQANLR-----FL----
A0A252DJH5      I--NPE--IAVIDTPHS-------LTSEI-----------YRMIQANLR-----FL----
A0A252EB80      I--NPE--IAVIDTPHS-------LTSEI-----------YRMIQANLR-----FL----
A0A1Z4HPW5      A--TQE--IAVIDSPSS-------LTSEI-----------YRMIQANLR-----FL----
A0A1Z4MSN1      A--TQE--IAVIDSPTS-------LTSEI-----------YRMIQANLR-----FL----
A0A1Z4U1C2      A--TQE--IAVIDSPTS-------LTSEI-----------YRMIQANLR-----FL----
A0A0D6KV51      A--TQE--IAVIDSPSS-------LTSEI-----------YRMIQANLR-----FL----
A0A1Z4MKF8      A--TQE--IAVIDSPSS-------LTSEI-----------YRMIQANLR-----FL----
A0A2C6WC43      I--TQK--VAVRDMPYS-------LTSEM-----------YRMIQANLK-----FL----
A0A1Z4L5A1      I--TQK--VAVRDMPHS-------LTSEM-----------YRMIQANLK-----FL----
A0A367QD86      I--TQK--VAVRDMPHS-------LTSEM-----------YRMIQANLK-----FL----
A0A235IZ96      P--TQT--VAVRDTPYS-------LTSEM-----------YRMIQANLK-----FL----
A0A2L2NGP0      P--TQT--VAVRDTPYS-------LTSEM-----------YRMIQANLK-----FL----
A0A2K8SM78      I--TQK--IAVRDTPYS-------LTSEM-----------YRMIQANLK-----FL----
A0A2R5FPC0      -----K--IAVRDTPYS-------LTSEM-----------YRMIQANLK-----FL----
A0A5P8W5T6      I--TQK--IAVRDTPYS-------LTSEM-----------YRMIQANLK-----FL----
A0A140KBA0      T--LPQ--LPAGQNDSSHHRHALLPIREA-----------YQILQANLK-----LL----
K9XSG1          T--LPQ--LPASQNAHSNNRHVFLPIREA-----------YQILQANLK-----LL----
A0A0F5YE28      A--SQQ--IPVVEASDS-------FISEI-----------YRMLQANLK-----FL----
U7QEH7          A--TPD--IPVIEASDS-------FISEI-----------YRMLQANLK-----FL----
A0A3S1ATK5      I--TPE--IASKDAPQS-------LTSEM-----------YRVIQANLR-----LL----
A0A2Z6CPH0      T--TPE--IAVRDMPHS-------LTSEI-----------YRMIQANLK-----FL----
A0A1Z4GT50      I--TPE--VPVRDTPNS-------LTSEI-----------YRMIQANLR-----FL----
A0A1Z4GIX0      A--SPE--IAVRDMPHS-------LTSEM-----------YRMIQANLK-----FL----
A0A2H6LC24      A--SPE--IAVRDMPHS-------LTSEM-----------YRMIQANLK-----FL----
B2J6N5          I--NQT--IAVRDTPYT-------LTSEM-----------YRMIQANLK-----FL----
A0A367RMI4      I--SQT--IAVRDTPHS-------LTSEM-----------YRMIQANLK-----FL----
A0A235HUM0      T--SQT--VAVRDTPHS-------LTSEM-----------YRMIQANLK-----FL----
A0A2L2NW47      I--SQT--IAVRDTPHS-------LTSEM-----------YRMIQANLK-----FL----
A0A1E2WUR1      T--VQT--IAVRDTPHS-------LTSEM-----------YRMIQANLK-----FL----
A0A235IKU3      P--TQT--VAVRDTPYS-------LTSEM-----------YRMIQANLK-----FL----
F4XKF3          F--GGE--LPVTEQPHS-------MVSEV-----------YRMIQANLK-----FL----
A0A1D9FX10      F--GGE--LPVTEQPHS-------MVSEV-----------YRMIQANLK-----FL----
A0A1D8TNX9      F--GGE--LPVRDQPHS-------MVSEV-----------YRMIQANLK-----FL----
A0A1U7MYU6      F--GGE--LPVTDQPHS-------MVSEV-----------YRMIQANLK-----FL----
A0A3C0NJ41      T--VPE--LPVRDTPRS-------PISEA-----------YRMLQANLK-----FL----
A0A352AG88      T--IPE--LPVRDTPRL-------PISEA-----------YRMLQANLK-----FL----
A0A350Y374      T--IPE--LPVRDNPLA-------AISEV-----------YRMLQANLK-----FL----
A0A355DPX0      T--IPE--LPVRDNPLA-------AISEV-----------YRMLQANLK-----FL----
A0A0D8ZUV2      T--IPE--LPVRDMPRS-------PLSEA-----------YRMLQANLK-----FL----
A0A433VDI0      A--VPE--LPVRDIPNS-------PISEA-----------YRMLQANLK-----FL----
A0A3D1PG43      A--VPE--ISVLENSLS-------PIAEN-----------YRMLQANLK-----FL----
A0A2P8QQ72      P--IPE--LAVRNSPRS-------LTAEA-----------YRMLQANLR-----FL----
K9TZQ7          P--VPE--LAVRNSPRS-------LTAEA-----------YRMLQANLR-----FL----
A0A2G7GPR0      S--IPE--LPVINLPRS-------PISEA-----------YRMLQANLK-----FL----
K9XH68          S--IPE--LPVINLPRS-------PISEA-----------YRMLQANLK-----FL----
A0A1U7HW70      S--IPE--LPVINLPRS-------PISEA-----------YRMLQANLK-----FL----
A0A2S6VEJ8      S--IPE--LPVINLPRS-------PISEA-----------YRMLQANLK-----FL----
                                                                            

K9SLA9          EP-GKAPKVIAITSSIAKEGKSTFTANLAI-AAAQMGAKVLLIDADLRKPTQHQLW-QVP
A0A168TT23      TP-QGMPKTILMTSPGPGDGKTTNAINLAT-VLAQNGARVLLIDADLRKPRLHRDF-SIQ
A0A0M1JWX9      ST-DQPIRAIAVASAVAAEGKSTAAVNLAQ-AAATMGQRVLLVDGDLRRPQVHAKL-GIL
A0A2T1M1V6      ---ELENRRLMITSATRSEGKTTLTLGLAW-ALVQLGFRVLLVDADLRQAEMSRKL-GYP
A0A2G7GCS2      ---MLEHQRLLVTSPTSGEGKTTVTLGLAL-ALVNFGFRVLIVDGDLRQAELSRRL-GQL
K9XBH8          ---MLEHQRILITSPTAGEGKTTMTLGLAL-ALVNCGFRVLMVDGDLRQAELSRRL-GHS
A0A1Z4LJ30      ---QLGSGRLMIASATTSEGKTTATLGLAN-ALINLGFKVLVVDGDFRKSELSQSL-GYQ
K9RI76          ---QLNSGRLMIASANTEEGKTTTTIGLAN-ALLVLGFKVLLVDGDFRRGELSESL-GYQ
A0A352AE27      ---PLKNRRLLVTSATMGEGKTTVTLGLAT-ALVDLGFRVLLVDGDFRKAQLSHRL-GYA
A0A3B8JH60      ---PLQDHRLLVTSAIMGEGKTTVTLGLAT-ALADLGFRVLLVDGDFRKAELSRRL-GYG
A0A3C0N766      ---PLQDHRLLVTSAIMGEGKTTVTLGLAT-ALADLGFRVLLVDGDFRKAELSRRL-GYG
K9W9J7          ---PLKDHRLLITSAIMGEGKTTVTLGLAR-ALADLGFRVLLVDGDFRKAELSRRL-GYG
A0A139WSU3      ---PLNNRRLLVTSATQGEGKTTVAIGLAY-GLVDLGFRVLLVDGDFRSAELSRSL-GYA
A0A433VN22      ---PLENRRLLVTSAIMGEGKTTVAIGLAN-ALVDLGFKVLLVDADFRQAALSRRL-GYT
Q7NF11          ---DLPNRRLMITSSTAGEGKTTLTLGLAN-ALAEMGFRVLLVDADFRQASLSRLL-GHG
A0A1Z4JCS8      ---PLKGIRLLIASAITGEGKTTVALQLAH-ALTELGFRVLLVDGDFRKAQLSHQL-GYL
F4XTX2          ---SGEDRRILITSAMVSEGKTTVTLGLAT-ALVDLGFRVLVVDGDFRQATLSQRL-GHH
Q7NJN6          ---PLPARRLMITSANTGEGKTTVTLGLAK-ALRELGFRVLVVDADFRQAGLGRKL-QVG
U5QCC3          ---PLEGQRLMITSSTFGEGKTTVTLGLAR-ALRSLGFRVLVVDADFRQAGLGRLL-QVN
A0A3S0Y9N9      NS-KQHIKVIVVSSAVPQEGKSTIAANLAF-SISQIGRKVLLVDADFRRPSQDKIW---N
A0A433UNK7      NS-EQSIKVIVVSSSVPKEGKSTIAANLAF-SISQLGRNILLVDADLRNPSQHKIW---E
A0A3M1SVZ4      CA-EQSVKTIVVTSAIAKEGKSTIAANLAA-AISQVGRRVLLVDADLRRPLQHEIW---N
A0A654SFI6      SD-GA-PKLLMLTSSVLAEGKSVSSLALAA-SFARLGKRTLLIDGDLRNSRLMALL-GGE
K9SSQ0          AQ-RT-FKTIAFTSSIPSEGKSTIIYNLSL-TLAELGYKVLLVDADMRKPTIHSLA---G
A0A2W1JIN9      GL-EE-FHTLVVSSAISGEGKSVVTSYLAA-VAAMLSRRTLIIDADLRRPTIHKQF---Q
A0A318AJV1      QA-SG-MRVIGFTSALPGEGKSNTALAFAR-MLAVNGARVLLVDADLRNSKFPGSM---A
A0A1U7N2U4      AQ-KR-LQLIVVSSAVSGEGKSVVVSHLAA-VSARFSRRTLIIDADWRHPMQHNLF---G
A0A1D9G1F2      AQ-KR-LQLIVVSSAVSGEGKSVVASHLGA-VSVRFSRRTLIIDADWRHPMQQDLF---G
F4XV38          AQ-KR-LQLIVVSSAVSGEGKSVVASHLGA-VSVRFSRRTLIIDADWRHPMQHNLF---G
A0A2P8QIL5      AN-ED-IKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQHKLF---K
A0A2T1FLY5      AN-ED-IKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQHKLF---K
A0A433W447      AN-ED-IKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQHKLF---K
K9U1K8          AN-ED-IKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQHKLF---K
A0A4V6P809      AN-ED-IKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQHKLF---K
K9UYB2          TA-EN-LHLFVVSSTISGEGKSIVTSHLGA-ISAMLSRRTLIIDADLRKPVQHKLF---N
A0A218QN17      SN-DK-VQVIVVSSTLSGEGKSIVASHLAA-ISAMLSRRTLIIDADLRRPMQHTLF---N
K9RKN2          SD-DE-LQKIVVSSTISGEGKSVVVSHLAA-VSAMLSRKTLVIDADLRRPVQHTLF---N
A0A2I8ADV2      SH-EK-LQVVVVTSTISGEGKSVVVSHLAA-VAAMLFRRTLIIDADLRRPVQHTLF---N
A0A1W5CKM3      NV-DN-LQVIVVSSPLAGEGKSVIVSHLAA-VSAMLSRRTLIIDADLRKPSQHTLF---N
A0A5Q0GMF5      NV-DN-LQVIVVSSPLAGEGKSVIVSHLAA-VSAMLSRRTLIIDADLRKPSQHTLF---N
Q3MEW0          NV-DN-LQVIVVSSPLAGEGKSVIVSHLAA-VSAMLSRRTLIIDADLRKPSQHTLF---N
A0A1Z4KIC7      NV-DN-LQVIVVSSPLSGEGKSVIVSHLAA-VAAMLSRRTLIIDADLRKPSQHTLF---N
Q8YSM5          NV-DN-LQVIVVSSPLSGEGKSVIVSHLAA-VAAMLSRRTLIIDADLRKPSQHTLF---N
A0A1Q4S1H4      SP-GK-LHLVVVSSALSSEGKSVVVSHLAA-VAAMLSRRTLLIDADLRRPKLHRAF---N
A0A433VBU6      SA-SK-LHSIVVSSALSGEGKSVVVSHLAA-VSAMLSRRTLLIDADLRRPKLHRVF---N
A0A1Q4RZJ6      TS-E--LQLLVVSSTISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQHTIF---N
A0A1Z4SNV3      TS-E--LQLLVVSSTISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQHTIF---N
A0A2H2XJQ1      TS-E--LQLLVVSSTISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQHTIF---N
A0A3S5K358      TS-E--LQLLVVSSTISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQHTIF---N
A0A0T7BPJ4      NL-ED-LNSIVISSTISGEGKSVVASHLGA-VSAMLSRKTLIIDADLRRPEQHRIF---H
A0A0C1QS61      S--DR-MRVIVVSSSIAGEGKSIVASHLAA-IAGMLSWRTLIIDADLRRPEQHTLF---N
A0A139X3R8      S--DQ-MRLIVVSSSIAGEGKSIVASHLAA-VAAMLSWRTLVIDADLRRPEQHTLF---N
A0A1Z4I7C5      SI-DN-LQVIVVSSPLSGEGKSVIVSHLAA-VCAMLSRRTLIIDADLRKPSQHTLF---N
A0A0C2MDK7      RS-EQ-LRAIVVSSTISGEGKSVVASHLAA-VVGMLSWRTLIIDADLRRPSQHTLF---N
A0A1Y0RCK1      SR-EQ-LRLIVVSSTISGEGKSVVASHLAA-VAAMLSWRTLVIDADLRKPVQHTLF---H
A0A1Z4PWZ0      SS-EQ-LRLIVVSSPISGEGKSVVASHLAA-VAAMLSWRTLIIDADLRRPVQHTLF---N
A0A0C2QLT0      SP-EQ-VRLIVVSSPISGEGKSVVASHLAA-VAAMLSWRTLIIDADLRRPVQHTLF---N
A0A1Z4J2K1      SP-EQ-VRLIVVSSPISGEGKSVVASHLAA-VAAMLSWRTLIIDADLRRPVQHTLF---N
A0A3S0ZSX0      SS-EP-LRQIVVSSTISGEGKSVVASHLAA-VCAMLSRRTLLIDADLRRPAQHTLF---N
A0A2N6K4T3      SR-ES-LRSIVVSSTITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPILHTLF---N
A0A370CKT2      SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHTLF---N
A0A0S3TL97      SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHTLF---N
A0A2N6M8A0      SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHTLF---N
A0A2N6M9E1      SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHTLF---N
A0A2N6KJI4      SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHTLF---N
A0A2N6MZ77      SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHTLF---N
A0A2N6KT20      SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHTLF---N
G6FSN3          SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHTLF---N
A0A4D9CI02      NP-ES-LRSIVVSSTITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPMLHTLF---N
A0A328I8B9      NP-ES-LGSIVVSSTITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPMLHTLF---N
A0A4Q9J4Z7      NP-ES-LRSIVVSSTITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPMLHTLF---N
A0A0M0SU69      ST-EP-LRSIVVSSTVTGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPVLHTLF---N
A0A1Z4TIZ8      SN-EP-LRSIVVSSSITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPVLHTLF---N
A0A0S3TYD7      SS-DREARAIVVSSCIPSEGKSTVSANLAS-AFAQIGKRVLLIDADLRRPRQHHVW-SLG
U5QL42          G-SNNSVKTLLFTSSIPAEGKSIISYNLGL-VLSEFGKRVLVVDADMRKPNLHRFL-ELP
K9QF04          D-PDKPLKSLVISSALPGEGKSTIAVYLAQ-VAASMGKRVLLIDADLRRPTIHTRVHSLT
A0A3C0N2P0      S-PDEAVRSVVISSATPGDGKSTITTFLAQ-AAAAMGQRVLLVDADLRRPRIHETT-DLP
K9TLQ0          S-PDRPLKSIVISSTLPAEGKTTISMKLAE-AASAMGNRVLLVDADLRRPQIDQRM-DLP
A0A076HBF2      N-SDQPLRSIALTSSLPAEGKSLVNVLLAK-TLSEMGQRILLIDADLRKPQMHVRL-GLN
A0A354B169      N-SEKPLRLIAISSSLPREGKSLIIVLLAK-TLAEMGKKILVIDADMRRPQLHQRL-GLN
G4FMX5          N-SDRPLRSIALTSSLPAEGKSLVNTLLAK-TLAEMGQRVLLIDADLRKPQLHTRL-GLN
Q0IDT5          N-TERPLKAVALTSSLPAEGKSLVNVLLAK-TLAEMGQRVLLVDADLRKPQLHIRL-GIN
A0A2D6FCW3      N-SDQPLRSIAITSSLPAEGKSLVNVLLAK-TLSEMGQKVLLIDADLRKPQLHTRL-GLN
A3ZA21          N-SDRPLRAIALTSSLPAEGKSLVNVLLAK-TLSEMGQRVLLIDADLRKPQMHTRL-GLN
A0A140K3H3      LTEKGKINSLALTSATSAEGKTTVTYNLGI-VLAELGLNVLIIDADMRKPKIHKLA-KLP
K9XUB8          ITETGKINSLALTSSTSAEGKTTVTYNLGL-VLAELGLRVLIVDADMRKPKIHKLA-KLA
Q7NEU3          S-SDRKLKVFVVSSSMPGEGKSTVATNLAK-VVGGLNRKALLVDADLRRPTVSNKL-ELS
A0A352XE00      S-PDRPIRSLVMSSAVPADGKSTTSMFLAQ-AAAAMGEKVLLVDADLRRPQIHVRM-NLL
B4VS56          S-PDQPIRSVVISSAVPADGKSTIATFMAQ-AAAAMGQRVLLVDADLRRPQLHVRT-DLP
A0A352AAQ3      S-PDRPIRSLVMSSAVPADGKSTTSAFLAQ-AAAAMGERVLLVDADLRRPQVHVKT-DLP
A0A350Y472      S-PDKSIRSLVVSSAVPADGKSTVAAFLSQ-AAAAMGERVLLVDADLRRPQVHVKT-DLP
A0A355DVB4      S-PDKTIRSLVVSSAVPADGKSTVAAFLAQ-AAAAMGERVLLVDADLRRPQVHVKT-DLP
A0A2P8VVX1      Q-NSHPSKAIAITSALPGEGKTTLTLGLAF-SLARMGQRVLVIDADLRRSGIQAGL-GLV
A0A2P8WHY0      L-KGKGNQAIAVTSSLPSEGKTTVALGLAF-SLARMRQRVLVIDADLRRSGIATEL-GLS
A0A2T1CMT9      SLVGSALKSIAITSAVAGEGKSTLTLGLAL-SIARDRQKVLVIDADLRSPSLHKSF-ALT
A0A563VQJ3      N-SQRAPKVILVTSSVPGEGKSTITANLAA-AIAQLGRYVLLIDGDLRKPTQNTLW-KAP
A0A1D8TX52      N-PGSEWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLHQQL-GLS
A0A1U7N5X9      N-SGSEWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLHQQL-GLS
A0A1D9G4T2      N-SGSEWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLHQQL-GLS
F4XP71          N-SGSELKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLHQQL-GLS
A0A2P8QVH5      G-SPLSFKSLLLTSALTGEGKSTLAAGMAL-SVARLQRRVLLIDADLRRSNIHKLL-NLS
A0A2T1FT70      G-SPLSFKSLLLTSALTGEGKSTLAAGMAL-SVARLQRRVLLIDADLRRSNIHKLL-NLS
A0A433W4W4      G-SPLSFKSLLLTSALTGEGKSTLAAGMAL-SVARLQRRVLLIDADLRRSNIHKLL-NLS
K9U5W1          G-SPLSFKSLLLTSALTGEGKSTLAAGMAL-SVARLQRRVLLIDADLRRSNIHKLL-NLS
A0A2W6ZAV2      R-ADKVVRLFSVTSTVELEGKSTASALFAQ-TMADLGQRVLLVDADLRRPSLHRLM-SVA
A0A2G7GMH8      T--AFPVKSLAVTSALAGEGKTTLALGLAI-AAARLHQKVLLIDTDLRRPSLHKQL-ELS
K9W742          S-SVSTLRSLMVTSAVAGEGKSTLALGLAI-SAARLHQRVLLIDADLRNPTLHEKL-NLP
A0A2T1DWE8      P-SAAGLRSLVVTSALAGEGKSTIALGLAI-SAARLHQRVLLVDADLRRPSLHQQL-DLP
A0A1U7I8L3      N-STGSLKSLVITSALAGEGKSAIALGLAI-SAARLHQRVLLIDADLRRPSLHKEL-NLP
A0A2T1DJL8      T-AANPLRSLVVTSALAGEGKSTIALGLAI-SAARLHQRVLIIDADLRRPGLHKQL-ELP
A0A1Z4J9W0      T-DGDPLKSLVVTSALAGEGKSTVALGLAI-SAARLHQRVLLIDADLRRPGLHKQL-QLP
A0A0N7Z5K9      T-DGDPMRSLVVTSALAGEGKSTVALGLAI-SAARLHQRVLLIDADLRRPGLHEQL-QLP
A0A0S3TXC5      T-DGSPMRSLVVTSALAGEGKSTVALGLAI-SAARLHQRVLLIDADLRRPGLHHQL-QLP
K9SA61          N-AASPLKSIVVTSALAGEGKSTLAMGLAM-SAARLHQRVLLIDADLRRPSLHKQL-NLP
A0A3D1PBA3      N-ELASFKSLMVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDADLRRPNLHEML-SLP
K9XPB0          G-SGFAFKSLLLTSAVAGEGKSTLVLGLAF-SIARHQKRVLVIDADLRCPSLHEKL-GVE
A0A350Y7Z1      N-SSATLRSIVVTSALPSEGKSTLVVGLAF-SAARLHQRVLLIDADLRRPSLHKQL-NLA
A0A352X2A7      N-AGRLLKSLAVTSALSGEGKSTLVMGLAL-TAARLQQRVLLIDTDLRFPTLHRQL-NLP
A0A0D8ZYV0      NTAVASLQSIMVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDADLRRPNLHQML-NLP
A0A4R4IUM6      N-EMAAFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLHQIL-NLP
A0A2T1FP73      N-EMAAFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLHQIL-NLP
A0A433VMS2      N-EMAAFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLHQIL-NLP
K9TYA7          N-EMAAFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLHQIL-NLP
A0A2P8QUE1      N-EMAAFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLHQIL-NLP
A0A2T1DNG3      NA-TAELHSIVVTSTLAGEGKSTLSVGLAI-SAARLHQRVLLIDADLRRPNLHKLL-NLP
A0A2P8W9H0      NP-EQPLKSITVSSAVPNSGKTTVSFHLAY-TMALLGYRTLVVDNDFRRPSLHTLC-HLP
A0A1Z4LN32      SL-DRKIRSIAVTSSVAGEGKTEVAANLAA-VMAQVGRRVLLVDADMRQPSQHHLW-GLI
A0A2I8A9F5      SL-DKKIRTIAVTSSIAGEGKSEIAANLAA-VIAQTGRRVLLIDADMRRPSQHHLW-NLI
A0A218Q6R8      SL-DKKVRTIVVTSSVPGEGKSEVSANLAA-VMAQVGRKVLLVDADMRQPSQHHLW-GLL
A0A218QGE0      SL-DRKVSAIVVTSSISGEGKTEVAANLAA-VMSLAGRRVLLVDADMRQPSQHHLW-GLI
B8HNB0          SP-DTELRTIAFTSTIPSEGKSTIVYNLGR-MLAELGQKVLIVDADTRNPTIHQII-EQP
A0A563VS48      DP-KERIKTIAITSAVAQEGKSSVSANYAI-AQAQCGKRILLIDGDLRRSSQHDLW-QIP
A0A318BJ18      TE-HGVPRSFLVTSTRPAEGKSTTALALAT-MLARAGKRTILVDGDMRSPSVHQLG-GVD
A0A3B8Y8H9      NP-KQTIKSLTISSAIPEEGKSTVAAHLAQ-AAAKMGQKVLLVDGDLRLPQLHHQP-GLT
A0A2W1JVB9      NS-DKPLKVIVMTSGIPSEGKSTASANLAM-AMAELGQKVLLVDADLRRPVQHRTW-ELL
A0A1Z3HMQ0      SS-DTPRRALTLTSSVPQEGKSEVAANLAA-TIAQTGKQVLLVDADMRSPWQHHLW-NVV
A0A1E5QP61      SP-DREIRIIVVTSAVSQEGKSTVAANLAV-ATAQLGRRVLLIDGDMRHSTQHQIW-NLT
A0A3M2GIL5      SP-DKELKTIVVTSSMAKEGKSAVAANLAL-AIAQLGRRVLLIDADLRHPIQHHIW-DLT
A0A433NM31      GS-DQELRVITITSAVPKEGKSTVSANLAL-AIAQLGFKVLLVDADMRSPSQHQFW-ELG
A0A3M1PML8      SS-DKAVRSFVITSSVAQEGKSEIAANLAA-TMAQLGRKVLLVDADLRRPAQHHTW-NLV
A0A352X442      SS-DKQIKAIVVTSSVPQEGKSEVSANLAA-AIAQVGRRVLLVDADMRHPSQHHLW-NLT
A0A0T7BPZ0      -S-DRRIKAIAVTSSIPKEGKSEVSANLAV-AMAQVGRKVLLIDADMRHPIQHHIW-GIT
A0A0M0SHU3      -S-DKQLKAITVTSSIPKEGKSEVSANLAV-AMAEVERRVLLVDADMRHPIQHHIW-QLS
A0A1D2PBN3      SS-DKQLKAIVVTSSVAKEGKSEVAVNLAV-AMAQVGRRVLLVDADMRHPVQHHVW-GMT
A0A0C2LVR7      SS-DNQLKAIVVTSSVAKEGKSEVAVNLAV-AMAQVGRRVLLVDADMRHPVQHHVW-GMT
A0A1Z4PQB9      SS-DNELKAIVVTSSVPKEGKSEVAANLAV-AMAQVGRRVLLVDADMRHPVQHHVW-GMT
A0A1Z4SFN6      SS-DKKLKAIVVSSCVSKEGKSEVAANLAV-AMAQLGHRVLLVDADMRRPVQHHIW-GMT
K9PGI8          GS-DEELKAIAVTSSVAKEGKSEVAANLAV-AIAQLGRRVLLVDADMRHPVQHHIW-GMT
A0A563VLD6      MAQSGKIKSLVLTSSTSSEGKSTTAYNLGL-ALTDLGSRVLIVDADMRKPKMHKLT-KQS
A0A318BG22      TP-GGLPRTLLVTSAAMAEGKSTTSAALAQ-GVADRGKRVLLVDADLRKPTLHHRF-AQT
A0A2T1E9V8      SS--KALKVIAITSSVPNEGKSTTCANLAA-VMAQLEHKVLIIDADFRHPSQHLIW-QIS
A0A3M2GQQ6      GA-EDEAKTLALTSATSGEGKSTLTYNLGR-VLSELGQRVLIVDADMRKPTVHEFI-KQP
K9SGJ5          GG-DLSIKSIAFTSAVPSEGKSTLVFNLAS-ILAELGHKVLVVDADMRKPNVHHLA-KLR
L8MYT6          GT-DNMMKVIAFTSSVPSEGKSTLTYNLAM-ILSSLGYRILLVDADLRKPTVHKLA-RLS
A0A352JGJ6      GT-DNTMKVIAFTSSVPSEGKSTLTYNLAT-ILAALGYKVLLVDADMRKPTVHKLS-KLS
A0A1J5GLS2      GT-DNMMKVIAFTSSVPSEGKSTLTYNLST-ILAVLGYRVLLVDADMRKPTIHKLS-KLP
A0A2W4W6M5      GT-DNMMKVIAFTSSVPSEGKSTLTYNLAT-ILAALGYKVLLVDADMRKPTVHKLT-KLS
A0A2W7AN33      GM-DNLMKVIAFTSSVPSEGKSTLTYNLAV-ILSSLGYRVLLVDADMRKPTIHKLA-GLS
A0A256BLV2      GT-DNMMKVIAFTSSVPSEGKSTLTYNLAT-ILSALGYRVLLVDADMRKPSIHKLA-GLS
A0A2W6ZXF3      GT-DNMMKVIAFTSSVPSEGKSTLTYNLST-ILAALGYRVLLVDADMRKPTVHKLS-KLP
A0A2Z5WX66      GT-DNTMKVIAFTSSVPSEGKSTLTYNLST-ILAALGYKVLLVDADMRKPTVHKLT-NLS
K9W1T3          SL-DNQLKVMVISSSVPKEGKSTTAANLAV-AISQLGQRVLLIDADMRKPSQHKIW-QLP
A0A1Q4RTR1      LP-DQVLKSIVITSAIPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSSQHEVW-KVE
A0A1Z4SQV2      LP-DQVLKSIVITSAVPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSRQHEIW-KVE
A0A2H2XGN1      LP-DQVLKSIVITSAVPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSRQHEIW-KVE
A0A433UXH8      LP-DQVLKTIVITSAIPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSNQHQIW-KVE
A0A1Z4RMB9      TS-DKPPKVMLITSSVPEEGKSTVVANLAA-AIAQLGRSVLLIDADLRRSSQHTLW-GVD
K1XF69          GS-DRKVRVIVVSSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQHHIW-GLT
B5W297          GS-DRKVRVIVVSSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQHHIW-GLT
H1W7M8          GS-DRKVRVIVVSSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQHHIW-GLT
A0A5Q4H6A5      GS-DRKVRVIVVTSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQHHIW-GLT
D5A466          GS-DRKVRVIVVTSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQHHIW-GLT
B4WP72          TS-RQELKTIVITSAAAGEGKSEVSVNLAT-TIAQSGQRVLLIDADMRHPSLHKTW-NIS
A0A318B4H2      TD-HGAPGVLMLTSSRPNEGKSLSAYALSR-LFAETGASVVLIDADMRNTRLDDLV-ALD
B4WQE3          GS-QDIAKSFSVSSAVPNEGKSTISFYLAH-ASASLGKRTLLVDADLRHPTLHRLC-NLP
A0A2P8W4F7      SS-DVPVQVVALTSSVPGEGKSTICAHLAI-AAANMGRRVLLIDGDLRKPSQHLIF-GQP
A0A5Q4E0Z4      SS-DTPVQVVALTSSVPGEGKSTMCAHLAI-AAANMGRRVLLIDGDLRKPSQHLIF-GRR
A0A2K3BR24      SV-DQKMKVIVLTSSIPNEGKSTVSANLGM-ALAELGHRVLIIDADLRRPSQHQVW-EEP
K9YXY1          SV-DQKMKVIVLTSSIPSEGKSTISANLGM-ALAELGNKVLIIDGDLRRPSQHQVW-EEP
U5QJM6          NS-DKKVNTFVISSSAPGEGKSTVSTNLAR-IAAELNRKVLIIDADLRRPTVAKRL-ELT
K9SX01          NS-DRQIKAIVITSSVPGEGKSTVSANLAV-AIAQLGKRVLLVDVDMRRPSQHKIW-GLG
A0A4P7ZT55      RA-GGNLRMLAVTSTASGEGKTTSVALLGQ-ALADLGLKVLLVDGDLRQMQLHQRF-AAD
A0A1E5QIR9      GS-DRQVRVIAVTSAIPKEGKSTVSANLAL-AIAQLGFRVLLVDADMRHPSQQAFW-DTP
A0A1Z4IBC7      CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW-ELS
A0A1W5CPC7      CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW-DLS
A0A5Q0GKD1      CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW-DLS
Q3MDC6          CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW-DLS
A0A1Z4KM73      CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW-DLS
Q8YNX7          CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW-DLS
A0A367R4K6      CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDTDMRHPIQHHIW-ELK
A0A1E2WSV8      CS-DKPLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW-GLP
A0A2R5FRT9      CS-DKPLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRNPMQHHIW-GLT
A0A2K8T1B6      CS-DKPLRSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRNPIQHHIW-GLK
A0A235I9I0      CS-DKPLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW-GLT
A0A2D0HQT8      CS-DKPLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW-GLT
A0A2L2NU95      CS-DKPLKSIVITSSVAREGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW-GLT
A0A367S084      CS-DKPLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQHHIW-GLT
A0A0V7ZFJ4      VS-DKTLKVIVVSSSNPNEGKSFVSANLAV-TLSQLGRKVLLVDADMRRPRQHRIW-RRP
A0A367RIS1      FS-DKELKVIVVSSSVMNEGKSFVAANLAV-ATAQMGKRVLLIDADMRRPRQHEIW-QKP
A0A235IXQ2      FS-DKELKVIVVSSSVINEGKSFIAANLAV-ATAQMGRRVLLIDADMRHPHQHKMW-QQP
A0A1W5CNX3      FS-DKKLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQHEMW-QQP
A0A5Q0GJJ5      FS-DKKLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQHEMW-QQP
Q3MEB7          FS-DKKLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQHEMW-QQP
A0A1Z4KHN9      FS-DKKLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQHEMW-QQP
Q8YT70          FS-DKKLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQHEMW-QQP
A0A218Q4C1      IS-DKKLKVIVVSSCLPGEGKSFITANLAV-ATAQMGQRVLLIDADMRRPSQQEVW-QVR
A0A166IWU6      IS-DKELKVIVVSSCLPGEGKSFVAANLAV-ATAQMGRRVLLIDADMRRPRQQELW-QVR
A0A2S0Q8C0      IS-DKELKVIVVSSCLPGEGKSFVAANLAV-ATAQMGRRVLLIDADMRRPRQQEVW-QVR
W6FSX4          IS-DKELKVIVVSSCLPGEGKSFVAANLSV-ATAQMGRRVLLIDADMRRPRQREVW-QVR
A0A0V7ZNJ9      SS-DKTLKVLMVTSSVPGEGKSLVSANLAV-TISQFGQRVLLIDGDMRRPRQHKLW-KIH
A0A0R0M9H9      -T-DKELRVILLTSSSPSEGKSFVSANLAL-AASHLGKRVLIVDADLRRPRQHKVW-GLP
A0A1S1ZVW2      -T-DKELQVILVTSSSPAEGKSFVSANLAL-AASHLGKRVLIVDADLRRPRQHKVW-GLP
A0A1B7WX82      LS-DKELRVILVTSSTAGEGKSFVAANLAL-AAAHVGRRVLLVDADMRRPRQQRIW-ETP
A0A1B7WTD1      IS-DKELQVILVTSSTSGEGKSFVAGNLAV-AASHVGKRVLLIDCDMRRPRQHRIW-EIP
A0A480ABC0      IS-DKELQVILVTSTTSGEGKSFVAANLAV-AASHVGKRVLLIDCDMRRPRQHRIW-EIP
A0A1Z4LRU5      MS-DKALKVIVVSSSIPGEGKSFVSSNLAV-AMAQLGRRVLLIDADMRRPTQQNIW-DLP
A0A1Z4JVB4      IC-EQKLKVIVVSSAVPGEGKSFIAANLAT-ATAQLGKKVLLLDADMRRSRQHKIW-QQS
K9PIA4          IS-DKKLKVIVVSSSIPGEGKSFVTANLAV-AIAQLGRRVLLIDADMRRPRQHKIW-EQS
A0A1Z4M597      IS-DKMLKVIAISSSIPGEGKSFVAANLAV-AVAQLGRRVLLVDADMRRPRQHKIW-EQN
A0A1Z4MWT1      IS-DKMLKVIAISSSIPGEGKSFVAANLAV-AVAQLGRRVLLVDADMRRPRQHKIW-EQN
A0A1Z4TX53      IS-DKMLKVIAISSSIPGEGKSFVAANLAV-AVAQLGRRVLLVDADMRRPRQHKIW-EQN
A0A1Z4HVE1      IS-DKTLKVIALSSSIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQHKIW-EQS
A0A252ECZ1      IS-DKKLKVIVVSSSVPGEGKSFVAANLAV-AAAQIGHRVLLVDADMRRPRQHKIW-EQS
A0A1Z4G5Y1      IS-DKTLKVIVLSSSIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQHKVW-EQS
A0A252DNA2      IS-DKTLKVIVLSSSIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQHKVW-EQS
A0A252E1Q4      IS-DKTLKVIVLSSSIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQHKVW-EQS
A0A5P8VSD1      FY-DKELKVVVVSSSVMNEGKSFIAANLAI-ATAQMGKRVLLIDADMRRPRQHEMW-QQP
A0A2A2TNQ5      VS-DQELRVIVVTSSVPGEGKSLVAANLAV-AKAQMGKRVLLIDADMRRPRQHEIW-ELQ
A0A3S1C4K5      LS-DQALRVIAVTSSVPGEGKSFVAANLAV-AKVQMGYRVLLIDADMRRPRQHKVW-EKA
A0A1X4G3D5      -R-DRELQVMLVTSSSQGEGKSFVSANLAA-ALSYLGKRVLIVDGDLRRPCQHRVW-KLP
D4TNI2          -R-DRELQVMLVTSSSQGEGKSFVSANLAA-ALSYLGKRVLIVDGDLRRPCQHRVW-KLP
A0A1Z4H6Z8      IS-DKTLKVIVVSSSIPSEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQHKIW-EQS
A0A1Z4NPM1      VS-DNELRVILVTSSVPGEGKSFVSANLAV-AMSQLGKRVLLIDADMRRPRQHKVW-QLA
A0A3F3KPR9      -T-DKELRVILLTSSSPGEGKSFISANLAL-AASHLGKRVLIVDGDLRRPRQHKVW-GLP
D4TGN7          -T-DKELRVILLTSSSPGEGKSFISANLAL-AASHLGKRVLIVDGDLRRPRQHKVW-GLP
A0A1Z4UZW9      LS-DKELRVILLTSSIPGEGKSFVAANLALAAAAQPGRRVLLVDADMRRPRQQSIW-EIH
A0A0K2M5H0      CS-DKELRVILVTSATPGEGKSFVAANLAL-AAAYVGRRVLLVDADMRLPRQHRVW-EIH
A0A1B7VSH4      VS-DKKLRVILVTSATPGEGKSFVAANLAL-AGAYVGKRVLLVDADMRRPRQHRVW-EIH
A0A1B7W126      VS-DKELRVILVTSATPGEGKSFVAANLAL-AGAYVGKRVLLVDADMRRPRQHRVW-EIH
A0A3D4C6Q6      VS-DKELRVILVTSATPGEGKSFVAANLAL-AGAYVGKRVLLVDADMRRPRQHRVW-EIH
A0A1B7UVJ4      LS-DKQLRVILVTSSTSGEGKSFMAANLSL-AAAHVGRRVLLVDADMRRPRQHRIW-ETP
A0A1B7UTR1      LS-DKQLRVILVTSSTSGEGKSFMAANLSL-AAAHVGRRVLLVDADMRRPRQHRIW-ETP
A0A5C0DRW9      LS-DKKLRVVLLTSSTPEEGKSFVAANLAL-AAAHVGRRVLLVDADMRRPRQHRVW-EIP
K7W0A4          LS-DKELRVILLTSSTPGEGKSFVAANLAL-AAAHVGRRVLLVDADMRRPRQHRVW-EIP
A0A1U7HGH0      PSLDRSSRVILVTSSIPKEGKSTTCANLAA-VMALLNYKVLIIDADLRHPSQHQIW-EIA
K9XJD3          PSLERSSRVILVTSSAPKEGKSTTCANLAA-VMALLNYKVLIIDADLRHPSQHQIW-EIA
A0A2T1CIL7      TT-NWDRKAIAVTSSVPQEGKSEVASNLAK-SMADLGRRVLLIDADLRRPTQHHIL-GLS
A0A1Z4RPC6      AV-KRQPKVIVITSSVPGEGKSTIAANLAA-AMAQLGRKVLLIDGDLRKASQQDLW-QVS
A0A2T1CMZ0      AV-KQQPKVILMTSSVPGEGKSLVAANLAA-AMAQLGRKVLLIDGDLRKASQHDLW-QIS
L8M4F7          SS-QVLPKVILVTSSVPGEGKSTVTANLAA-AISQLGSRVLLVDGDLRRPSQHLLW-NRN
A0A140K2P2      SL-ENSTQVILVTSSVPEEGKSTVSANLAA-AIAQLGKRVLLIDGDLRKPSQHRLW-NLE
K9XWX4          SL-EHPPQVILVTSSVPEEGKSTVSANLAT-AIAQLGKRVLLIDGDLRKPSQHHLW-NLD
A0A140KB14      NQ-DNPPQVILITSSVPGEGKSTVAANLAA-AIAQLGRRVLLIDGDLRRATQHHLW-SMS
K9XX88          NQ-DNPPQVVLVTSSVPGEGKSTIAANLAT-AIAQLGRRVLLIDGDLRRANQHHLW-NMS
A0A563VSV6      TT-QRPPKVILITSSAPGEGKSTVTANLAA-AIAQLGRRVLLIDGDLRKSSQHQLW-GVS
L8LZE9          TS-QRPPKVILVTSSIPGEGKSTVTANLAA-AISQLGRKVLLIDGDLRKASQHQLW-GVS
A0A433V7A0      CS-DKALKVIVITSTVPSEGKSTVAANLAA-AIAQLGKQVLLVDADMRHPSQHTAW-NLI
A0A1Z4NDS1      AS-DNELKTIVVSSSVSGEGKSEVSANLAV-TVAQLGRRVLLIDADMRCPIQHHIW-GLN
K9F4D9          CV-DTHVKTVTVTSAVGGEGKSEVAANLAL-TLAHLGHTVLLVDADLRKPTQHHIW-DLP
U9VXM0          CV-ESQVKTITITSAVGGEGKSEVAANLAL-TLAHLGHMVLVVDADMRKPTQHLIW-DLP
A0A2T1FTR8      NA-DDSLKVVVVSSSQSGEGKSTVAANLAL-AVAELGKRVLLVDADMRKPAQHLIW-RQG
K9UA41          NA-DDSLKVVVVSSSQSGEGKSTVAANLAL-AVAELGKRVLLVDADMRKPAQHLIW-RQG
A0A0C2LBE2      SS-DREPRVIVVTSSVSGEGKSEVAANLAM-AMTQVGHRVLLVDADMRHPVQHHVW-NLT
A0A433NN38      -S-DKQLKAIAVTSSVAKEGKSEVSANLAV-VMAQVGRRVLLVDADMRRPCQHHIW-GLT
A0A2N6K0T2      -S-DKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHHIW-QLR
A0A2N6ML72      -S-YKQLKAITVTSSIPREGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHHIW-QLS
G6FQZ6          -S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHHIW-QLS
A0A2N6MQX9      -S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHHIW-QLS
A0A2N6KXT6      -S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHHIW-QLS
A0A2N6KGB9      -S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHHIW-QLS
A0A2N6L3Y5      -S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHHIW-QLS
A0A0S3TIS7      -S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHHIW-QLS
A0A1U7GW28      -S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHHIW-QLS
A0A2N6LW63      -S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHHIW-QLS
A0A328IH74      -S-DKQLKAITVTSSIPKEGKSEVCANLAV-AMAEVERRVLLVDADMRHPIQHHIW-QLS
A0A4D9CIB0      -S-DKQLKAITVTSSIPKEGKSEVCANLAV-AMAEVERRVLLVDADMRHPIQHHIW-QLS
A0A1Z4TQ63      -S-DKQLKAITVTSSIPKEGKSEVSANLAV-AMAEVERRVLLVDADMRHPIQHHIW-QLS
A0A4Q9J8G2      -S-DKQLKAITVTSSIPKEGKSEVSANLAV-AMVEVERRVLLVDADMRHPIQHHIW-QLS
A0A1Z4SMD6      S--DKKVRTIAVASSVALEGKSEVSANLAA-ALANAGRRVLIVDTDMRQPRQHHLW-GLI
A0A2H2Y096      S--DKKVRTIAVASSVALEGKSEVSANLAA-ALANAGRRVLIVDTDMRQPRQHHLW-GLI
K9S8M8          SP-DRELKVIVVTSPVPQEGKSTVSANLAA-AMAQLGRRVLLVDADMRHPMQHHVW-HLT
A0A1Z4NFV0      SH--KKVRTIVITSSVAGEGKSEVAANLAT-SIAQSGRRVLLVDADMRNPSQHHLW-GRI
B0CAX4          SS-DHHVQVFVVTSSIPKEGKSTVVANLAL-ALGELGHRVLVIDADMRRPSQHQVW-ELP
U5DPF5          TT-DRKLKVVAVTSSIPREGKSTVSANLGV-ALAELGNRVLVIDADMRRPSQHQVW-ELA
A0A350Y0P6      SP-DHVLKRIVVTSSVAQEGKSTVSANLAI-AMAQVGRRVLLVDADMRHPMQHHIW-DLA
A0A352X940      SP-DKMLKVIVVTSSVSREGKSTVSANLAA-AMAQLGRKVLLIDADMRHPIQHHIW-DLA
B8HTN4          SSPDHPIRTIVITSTRPQEGKSTVSANLAL-AIAELGHKVLLIDADLRLPLQHQIW-ELP
A0A2A2TPF8      SH-KK-VRTIVVTSSVAGEGKSEVSANLAA-VMAQAGKRVLIIDADMRNPSQHHLW-GVM
A0A1Z4R0P8      SH-KR-VRTLVVTSSVAGEGKSEVSANLAA-VIAQTGKRVLLIDADMRNPSQHHLW-GVM
A0A0T7BUI3      SH-KK-VRAIAITSCVPGEGKSEVSANLAA-ILAQAGRRVLLIDADMRKPSQHHLW-GLI
A0A1Z4LP32      SH-KE-VRTIVVTSSVVGEGKSEVSANLAA-ILAQSGKRVLLVDADMRQPNQHHLW-GLI
K9REP9          SH-KE-VRTIAVTSSVVGEGKSEVTANLGA-ILAQGGQRVLIVDADMRQPMQHHLW-GLI
A0A1Z4SIJ3      SH-KK-VCTLAITSSVAGEGKSEVAANLAA-ALAQSGRQVLLVDADMRQPAQHRLW-GLI
A0A2H2XPG4      SH-KK-VCTLAITSSVAGEGKSEVAANLAA-ALAQSGRQVLLVDADMRQPAQHRLW-GLI
K9V3C7          SH-KQ-VRTIVVTSSVAGEGKSEVSANLAA-AIAQTGKRVLLVDADMRQPSQHHLW-GLM
A0A1Z4T6Y7      SH-KK-VRTIVITSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDGDMRNPAQHHLW-GVM
A0A2H2Y561      SH-KK-VRTIVITSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDGDMRNPAQHHLW-GVM
A0A1Q4S362      SH-KT-VRTIVVTSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDSDMRNPSQHHLW-GVM
A0A3S1CIN8      SH-KT-VRTIVVTSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDSDMRNPSQHHLW-GVM
A0A2A2TC28      SH-KK-VCTIVVTSSVAGEGKSEVTANLAA-IIAQSGRRVLLVDADMRQPSQHHLW-GLI
A0A0C1NCB0      SH-KR-LRTIVVTSSVPGEGKSEVSANLAA-VLAQSERKVLLIDADMRLPSQHHIW-GLI
A0A2N6K7Q9      SH-RK-VRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-GLI
A0A2N6MXH6      SH-RK-VRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-GLI
A0A2N6M5A8      SH-RK-VRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-GLI
A0A2N6LL61      SH-RK-VRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-GLI
A0A0S3TP66      SH-RK-VRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-GLI
G6FP91          SH-RK-VRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-GLI
A0A1U7GYR5      SH-RK-VRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-GFI
A0A2N6KY52      SH-RK-VRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-GLI
A0A2N6KMP5      SH-RK-VRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-GLI
A0A2N6MA45      SH-RK-VRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-GLI
A0A4Q9J9V9      SH-RK-VRKIVVTSSVSAEGKSEVSANLAA-IIAQSGKRVLLVDADMRKPTQHHLW-SLI
A0A328IGA1      SH-RK-VRKIVVTSSVSAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-SLI
A0A4D9CE41      SH-RK-VRKIVVTSSVSAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-SLI
A0A0M0SFT2      SH-RK-VRKIVVTSSVSAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-SLI
A0A1Z4TLC8      SH-RK-VRKIVVTSSVSAEGKSDVSANLAA-VIAQSGKRVLLVDADMRKPTQHHLW-SLI
A0A0C2LFH0      SH-RK-VRTIVVTSSVPGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPSQHHLW-GLV
A0A1Z4IYV4      SH-KK-VRTIVVTSSVPGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQHHLW-GVI
A0A1Z4Q0T6      SH-KK-VRTIVVTSSVAGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQHHLW-GVI
A0A0C2PT44      SH-KK-VRTIVVTSSVAGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQHHFW-GVI
A0A1D2P6J4      SH-KR-VRTIVVTSSVAEEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQHHLW-GVI
A0A4R4IQ40      SS-DK-LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQHHIW-EKA
A0A433W533      SS-DK-LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQHHIW-EKA
A0A2P8QWJ3      SS-DK-LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQHHIW-EKA
A0A2T1FKP8      SS-DK-LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQHHIW-EKA
K9U6L7          SS-DK-LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQHHIW-EKA
A0A3M9ZEU1      SS-DQEIRVVVVTSAVAKEGKSTIAANLAA-AAAQVGRRVLLIDADLRYPQQHHIW-DLL
A0A1Z4JK72      SL-DKKVKTIVISSAVPREGKSEVAANLAA-TMAQSGRKVLLVDADMRNPSQHHLW-GIV
A0A0N7Z489      SL-DKPVKTIVISSAVPREGKSEVAANLAA-TMAQSGRRVLLVDADMRNPSQHHLW-GLV
A0A0S3TXS2      SL-DKKVKTIVISSAVPREGKSEVAANLAA-TMAQSGRKVLLVDADMRNPSQHHLW-GLV
A0A1Z4RN12      GA-NVETKTIAVTSSVPQEGKSSVSANLAV-ARAQCGQKVLLVDADMRRPTQHRIW-EIT
A0A2T1CMF9      DA-DAKKKVIAITSSVPQEGKSSVSANLAV-ARSQCSQRILLIDADMRRPTQHHIW-EIS
Q7NDC5          SS-ERGLRAFVLTSASPQEGKSTTAANLAA-VSAQAGARVLLVDGDLRKPRQHALW-DLD
U5QGK3          SA-ESPLTAVVFTSASPQEGKSTTVANLAI-VSAQSGARVLLIDADLRKPRQHKLW-EVS
A0A2W4UY24      YF-DGSLKAITVTSAVGGEGKSEISANLAL-TLAQLGHSVLLIDADMRSPIQHHIW-DIS
A0A2T1GMT4      GA-DKPLKTIAITSSVANEGKSKVAANLAA-AIAGMGQKVLLIDADMRVPYQHRFW-KLP
K9UI51          SA-DKPLKIIAITSSVANEGKSKVAANLAA-AIAGMGQKVLLIDADMRVPYQHRFW-KLP
K9QM62          SS-DKELKTIVVTSSVPKEGKSSVSANLAL-AISQMGRKVLLIDADMRVPSQHKIW-ELS
A0A1Z4FWI3      SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVPSQHHLW-QIT
A0A1Z4JYE7      SS-DKLLKTIVVTSAVAKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVSSQHYIW-GIT
A0A2T1FXY4      SP-DRVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRDSSQHHLW-QLT
A0A4V2X3N2      SP-DRALKTIVVTSAVPQEGKSTVSANLAA-AIAQLGRKVLLVDADMRDSSQHHLW-QLT
K9TYI2          SP-DRALRTIVITSAVPKEGKSTVSANLAA-AIAQLGRKVLLVDADMRDSSQHHLW-QLT
A0A1Z4QL41      SS-DQVLKSIVVTSAVSKEGKSTVSANLAA-VMAQLGRKVLLIDADLRLPSQHDLW-QLN
A0A252D4T4      SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVPSQHHLW-QIT
A0A252DJH5      SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVPSQHHLW-QIT
A0A252EB80      SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVPSQHHLW-QIT
A0A1Z4HPW5      SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPTQHHLW-QIT
A0A1Z4MSN1      SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPTQHHLW-QIT
A0A1Z4U1C2      SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPTQHHLW-QIT
A0A0D6KV51      SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPTQHHLW-QIT
A0A1Z4MKF8      SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPTQHHLW-QIT
A0A2C6WC43      SS-DKVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW-ELT
A0A1Z4L5A1      SS-DKVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW-QLT
A0A367QD86      SS-DKVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW-QLT
A0A235IZ96      SS-DKALKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRQVLLIDADMRVPSQHHFW-QLS
A0A2L2NGP0      SS-DKALKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRQVLLIDADMRVPSQHHFW-QLS
A0A2K8SM78      SS-DKVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW-QLT
A0A2R5FPC0      SS-DKVLRTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRIPSQHHLW-QLT
A0A5P8W5T6      SS-DKVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW-QLT
A0A140KBA0      SL-SQARKVIAVTSCVPQEGKSHVSANLAI-AQNQVGKRILLIDADMRRPSQHKIW-SIP
K9XSG1          SL-SQERKVIAVTSCVPQEGKSHVSANLAI-AQNQVGKRILLIDADMRRPTQHKIW-SIP
A0A0F5YE28      SS-DKRIKTIVVTSSVPKEGKSTVSANLAA-TLAQLGYRVMLIDADMRQPSQHHLW-GLT
U7QEH7          SS-DKRIKTIVVTSSVPKEGKSTVSANLAA-TLAQLGYRVMLIDADMRQPSQHHLW-GLT
A0A3S1ATK5      SS-DKVIKSIVVTSSISKEGKSTVAANLAT-VISQLGRKVLLIDADLRVPTQHHFW-QIS
A0A2Z6CPH0      SS-DKVLKTIVVTSSVPKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVPSQHHLW-QLT
A0A1Z4GT50      SS-DKVVKTIVITSAVPKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVPSQHHIW-QLT
A0A1Z4GIX0      SS-DKVLKTVVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW-QLT
A0A2H6LC24      SS-DKVLKTVVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW-QLT
B2J6N5          SS-DKVLKTIVVTSAVPKEGKSTVSANLAT-AIAQLGRQVLLIDADMRVPSQHHLW-EVS
A0A367RMI4      SS-DNVLKTIVITSAVPKEGKSTVSANLAA-AIAQLGRQVLLIDADMRVPSQHHLW-ELT
A0A235HUM0      SS-DNLLKTIVITSAIPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW-QLT
A0A2L2NW47      SS-DHLLKTIVITSAVPKEGKSTVSANLAA-AIAQLGRQVLLIDADMRVPSQHHLW-QLT
A0A1E2WUR1      SS-DKVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHHLW-QLT
A0A235IKU3      SS-EKALKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRQVLLIDADMRVPSQHHFW-QLS
F4XKF3          RS-DHPLKVIVVTSSVSKEGKSTVSANLAA-AMAQLGRRVLLIDSDMRHPCQHYIW-QVM
A0A1D9FX10      RS-DHPLKVIVVTSSVSKEGKSTVSANLAA-AMAQLGRRVLLIDSDMRHPCQHYIW-QVM
A0A1D8TNX9      KS-DHPPKVIVVTSSVSKEGKSTVSANLAA-AMAQLGRRVLLIDADMRHPCQHYIW-QVM
A0A1U7MYU6      RS-DHPLKVIVVTSSVSKEGKSTVSANLAA-AMAQLGRRVLLIDSDMRHPCQHYIW-QVM
A0A3C0NJ41      SS-DKPLKVIVVTSSVPKEGKSTVSANLAA-AMAQLGRRVLLVDADLRHPFQHHMW-ELT
A0A352AG88      SS-DKTPRVIVVTSSVPKEGKSTVSANLAA-AIAQLGRRVLLIDADLRHPLQHHIW-DLT
A0A350Y374      SS-DKPPKVILVTSSVPQEGKSTVSANLAL-AIAQLGRRVLLVDADLRYPVQHHIW-QLT
A0A355DPX0      SS-DKPPQVILVTSSVPQEGKSTVSANLAL-AIAQLGRRVLLVDADLRYPVQHHIW-QLT
A0A0D8ZUV2      SS-DKPLRVIVVTSSVPREGKSTVSANLAT-AMAQLGYRVLLVDADMRRPVQHHIW-KLN
A0A433VDI0      GS-DKALKVIVVTSAVSKEGKSTVSANLAA-AIAQLERQVLLVDADMRRPVQHHVW-ELT
A0A3D1PG43      SS-ERALKAVVVSSSVPKEGKSTVSANLAA-AIAQLGRRVLLVDADMRCPVQHHIW-NIN
A0A2P8QQ72      NL-DRPLKAVVVTSSVPKEGKSTVCANLAV-AIAQLGRRVLLIDADLRSPIQHHIW-QQT
K9TZQ7          NL-DRPLKAVVVTSSVPKEGKSTVCANLAV-AIAQLGRRVLLIDADLRSPIQHHIW-QQT
A0A2G7GPR0      SS-DKPLKVIVVTSAVPKEGKSTVSANLAA-AMAQLGRKVLLIDADMRHPLQHHIW-ELT
K9XH68          SS-DKPLKVIVVTSAVPKEGKSTVSANLAA-AMAQLGRKVLLVDADMRHPLQHHIW-ELT
A0A1U7HW70      SS-DKPLKVIVVTSAVPKEGKSTVSANLAA-AMAQLGRKVLLVDADMRHPLQHHIW-ELT
A0A2S6VEJ8      SS-DKPLKVIVVTSAVPKEGKSTVSANLAA-AMAQLGRKVLLVDADMRHPLQHHIW-ELT
                         . .:*    .**:      .           :::* * *            

K9SLA9          --NSQGLSN-------VLA-GS---A-NFY--TTTQQVE-PR--------LELLTAGTLP
A0A168TT23      --QAPGVTN-------RIADVG---SQEVATSSIIPTTT-EG--------LFVMPSGNQA
A0A0M1JWX9      --NRQGLSN-------VLA------T-DLQAKDAIQRSPIEEN-------LFILTAGTLP
A0A2T1M1V6      --QFRRGTG-----------YP-----E------ILLPIHPG--------FDLMLAPLIQ
A0A2G7GCS2      --QKQPK-N-----------GQ-----Q------TPVSVCLG--------LDLLPAPNLS
K9XBH8          --KTETTMN-----------AK-----Q------SPVSVSLG--------LDLIPAPAVR
A0A1Z4LJ30      --SQTILDS-----------RF------------IHKKIRPN--------LDLLSVNIAE
K9RI76          --PQAKSRF-------------------------VHNQVRFN--------LDLLSVNIAE
A0A352AE27      --RELLPPE-------------------------KPVQLRPS--------LDLVPTLPKQ
A0A3B8JH60      --RELKGTE-----------AP-----LFADVAQQPVQIQPS--------LDLVPISPKK
A0A3C0N766      --RELKGTE-----------AP-----LFADVAQQPVQIQPS--------LDLVPISPKK
K9W9J7          --REVELAD-----------AP-----RFANEVQQPVSLEGG--------LDLLPTSPKK
A0A139WSU3      --EDSTIEQ-------------------------LQRSIQPN--------LDLLPTLPKR
A0A433VN22      --QTST-ED-------------------------LSISIQPN--------LDLLPTLPRQ
Q7NF11          --PQVEGTQ-----------A-------------EPVSVIAD--------LDLVPALAIE
A0A1Z4JCS8      --SD-RSVG-----------D-------------QVISLQPN--------LDFVPTMPQT
F4XTX2          --HD-PLKP-----------G-------------QPVKIQPS--------LDLLPTSHKK
Q7NJN6          --PG----------------S-------------EPVALAPS--------LSFLPAGRPD
U5QCC3          --QG----------------N-------------EPVALAPS--------LNFLPAGQPD
A0A3S0Y9N9      IMNHAGLTN-------VIK-SQ---L-DLD--NAMTKV-TSN--------LQVITAGEQT
A0A433UNK7      IPNEVGLSN-------VLK-RQ---V-DLD--QAVTEI-VPN--------LEVLTAGELN
A0A3M1SVZ4      LGNEMGLGN-------TIS-GQ---V-DFH--LALQPT-MPN--------LDVLTAGTLA
A0A654SFI6      GADTAGLAA-------LLT-TN---DASLE--SQVFSSDLFA--------IDVLPAGRTP
K9SSQ0          VSNKLGLSQ-------AIA-TK---L-PWQ--QIIHTGDHSQFSAGY---LHIITAGATP
A0A2W1JIN9      LPNKSGLSD-------ILS-GD---V-SLE--SAAQSTSIDN--------LSVVTAGSSC
A0A318AJV1      IGPGKGLIE-------ALR-GR---A-PLV--ATVIPDRIGG--------LDILPVAQTL
A0A1U7N2U4      LPPQPKVKD-------LMD-SN---Q-TCL--EAVQPTAIAN--------LSILTCSDQP
A0A1D9G1F2      LSPQPKVTD-------VID-SN---Q-TWL--SAVQPTAIPN--------LSILTCSDLP
F4XV38          LPPKPKVTD-------VID-SN---Q-TWR--SAVQPTAIAN--------LSILTCSDQP
A0A2P8QIL5      LAAKPGLAE-------VAQ-GK---L-ALA--EAVQTTGIDK--------LKVLCSGRPR
A0A2T1FLY5      LAAKPGLAE-------VAQ-GK---L-ALA--EAVQTTGIDK--------LKVLCSGRPR
A0A433W447      LAAKPGLAE-------VAQ-GK---L-ALA--EAVQTTGIDK--------LKVLCSGRPR
K9U1K8          LAAKPGLAE-------VAQ-GK---L-ALA--EAVQTTGIDK--------LKVLCSGRPR
A0A4V6P809      LAAKPGLAE-------VAQ-GK---L-ALA--EAVQTTGIDK--------LKVLCSGRPR
K9UYB2          LNPQPGIAE-------VFD-GT---K-TLT--QAIQPTEIEN--------LWVLTCGDFY
A0A218QN17      LAPTPGITD-------VIE-KR---R-SLN--QAVQPTDVEN--------LDVLTGGEFH
K9RKN2          LPPKPGITE-------IIE-GR---R-NFA--NAIQKTDVDN--------LDVLTCGELH
A0A2I8ADV2      LPPKPGISD-------VIN-GN---R-TLL--NAVQPTDIEN--------LSVLTCGELH
A0A1W5CKM3      LPPRPGITD-------VID-GT---R-PLL--SAVQSTTIEN--------LSVLTCGELR
A0A5Q0GMF5      LPPRPGITD-------VID-GT---R-PLL--SAVQSTTIEN--------LSVLTCGELR
Q3MEW0          LPPRPGITD-------VID-GT---R-PLL--SAVQSTTIEN--------LSVLTCGELR
A0A1Z4KIC7      LPPRPGITD-------VID-GT---R-PLL--SAVQSTTIEN--------LSVLTCGELR
Q8YSM5          LPPRPGITD-------VID-GT---R-PLL--SAVQSTTIEN--------LSVLTCGELR
A0A1Q4S1H4      LQAAPGLSD-------AIS-QR---SGRLA--DFVQPTGIEN--------LSVLTCGSMS
A0A433VBU6      LQNAPGLSD-------AIT-ER---R-RLA--DFVQPTAIEN--------LFVLTCGSMS
A0A1Q4RZJ6      LPGKPGITD-------IVE-GN---I-SLK--EAVQPTEIEN--------LSVLTCGGIY
A0A1Z4SNV3      LPAKPGITD-------IVE-GS---I-SLK--EAVQPTEIEN--------LSVLTCGELH
A0A2H2XJQ1      LPAKPGITD-------IVE-GS---I-SLK--EAVQPTEIEN--------LSVLTCGELH
A0A3S5K358      LPGKPGISD-------IVE-GN---I-SLK--EAVQPTEIEN--------LSVLTCGGIY
A0A0T7BPJ4      LEHKPGVAD-------VIA-GN---L-SLM--EAVQPSGTEN--------LSVLTCGEMH
A0A0C1QS61      LAGKPGVSD-------VLE-GD---I-SLA--DAVQSTDIEN--------LDVLTCGELH
A0A139X3R8      LSGKPGVTD-------VLE-GD---I-SLA--DAVQSTDIEN--------LDVLTCGELH
A0A1Z4I7C5      LPPKPGITD-------VID-GK---R-PLL--NAVQSTAVDN--------LSVLTCGELR
A0A0C2MDK7      LAPGPGITD-------VLE-GN---I-SLL--DAVQPTDIEN--------LDVLTCGELH
A0A1Y0RCK1      LAPKLGITD-------VLE-GN---I-SLL--DAVQPTDIEN--------LDVLTCGQLH
A0A1Z4PWZ0      LTPKPGITD-------VLE-GN---V-SLL--DAVQPTDIEN--------LDVLTCGELY
A0A0C2QLT0      LTGKPGITD-------VLE-GN---V-SLL--DAVQPTDIEN--------LDVLTCGELY
A0A1Z4J2K1      LTPKPGITN-------VLE-GN---V-SLL--DAVQPTDIEN--------LDVLTCGELY
A0A3S0ZSX0      LAPQPGITD-------LIY-GE---R-SLQ--QTVQPTRIEN--------LFVLTCGELY
A0A2N6K4T3      LAPQPGITD-------VID-SE---R-SLE--ETVQQTNIAN--------LCVLTCGELC
A0A370CKT2      LAPRPGITD-------VID-SE---R-SLE--ETVQRTNIPN--------LSVLTCGELH
A0A0S3TL97      LAPRPGITD-------VID-SE---R-SLE--ETVQRTNIPN--------LSVLTCGELH
A0A2N6M8A0      LAPRPGITD-------VID-SE---R-SLE--ETVQRTNIPN--------LSVLTCGELH
A0A2N6M9E1      LAPRPGITD-------VID-SE---R-SLE--ETVQRTNIPN--------LSVLTCGELY
A0A2N6KJI4      LAPRPGITD-------VID-SE---R-SLE--ETVQRTNIPN--------LSVLTCGELH
A0A2N6MZ77      LAPRPGITD-------VID-SE---R-SLE--ETVQRTNIPN--------LSVLTCGELH
A0A2N6KT20      LAPRPGITD-------VID-SE---R-SLE--ETVQRTNIPN--------LSVLTCGELY
G6FSN3          LAPRPGITD-------VID-SE---R-SLE--ETVQRTNIPN--------LSVLTCGELH
A0A4D9CI02      LAPQPGITD-------VID-SQ---R-SLE--ETVQRTHIAN--------LSVLTCGDLY
A0A328I8B9      LAPQPGITD-------VID-SQ---R-SLE--ETVQRTHIAN--------LSVLTCGDLY
A0A4Q9J4Z7      LAPQPGITD-------VID-SQ---R-SLE--ETVQRTHIAN--------LSVLTCGDLY
A0A0M0SU69      LVPQPGITD-------VID-SE---R-SLE--ETVQRTHIAN--------LCVLTCGDLY
A0A1Z4TIZ8      LAPQPGITD-------VID-SQ---R-SLE--ETVQRTHIAN--------LSVLTCGDLY
A0A0S3TYD7      -TNDVGFSD-------VLV-GV---S-TLE--DALCPVM-EN--------LWLLPAGKIP
U5QL42          --NSRGLST-------AIA-TE---T-PWQ--QLVQ--------SGGNPNLTLLTSGPIP
K9QF04          --NVWGLSN-------LIS-GS---F-PIE--NIIQISP-EN--EN----LHILTAGKTP
A0A3C0N2P0      --NVWGLSN-------VIS-SE---I-NFE--DVIQRSP-IE--DN----LFVLTAGQIP
K9TLQ0          --NVWGLSN-------LIS-TD-----SLN--AQDSIQQ-SALNQN----LYVLTAGQMP
A0A076HBF2      --NLSGLSN-------VLT-ED---D-QTW--RDAVQTV-PGYQN-----WSVLTAGRRP
A0A354B169      --NLVGLSN-------LLA-DD---C-LHW--RNCVQSL-PGYEH-----WDVITAGLPP
G4FMX5          --NLRGLSN-------VLT-DD---S-SHW--RQALQPI-NGYEG-----WSVMTAGRRP
Q0IDT5          --NLQGLSN-------LIT-ED---A-LHW--RDLCKQV-PGYEN-----WSVMTAGLRP
A0A2D6FCW3      --NLRGLTN-------VLT-DD---S-NSW--RSLLQPV-EGYEN-----WSVITAGRRP
A3ZA21          --NLSGLSN-------LLA-DD---G-FHW--RDVVQTV-PGYDQ-----WSLITAGRRP
A0A140K3H3      --NDEGLSE-------AIT-TE---R-PWT--DFVQIGV-VE-------NLHLITSGSTS
K9XUB8          --NDEGLSE-------AIA-NE---R-PWT--DYVRLGV-LE-------NLHLITAGSTS
Q7NEU3          --NGPGLST-------VLA-GE---M-HWS--NCVNQID-EN--------VHVLTSGPLP
A0A352XE00      --NMWGLSN-------AIS-SD---I-NVD--NLIQESP-VD--EN----LFVLTAGQLP
B4VS56          --NVWGLSH-------VIS-SD---I-NVK--DVIQPSP-LE--EN----LFVLTAGQIP
A0A352AAQ3      --NVWGLSN-------VIS-SE---I-SVD--DVIQQSP-WE--EN----LFVLTAGQIP
A0A350Y472      --NVWGLSN-------VIS-SE---I-NVS--DVIQQSP-LE--DN----LFVLTAGQIP
A0A355DVB4      --NVWGLSN-------VIS-SE---I-NVS--DVIQQSP-LE--DN----LFVLTAGQIP
A0A2P8VVX1      --AEQGLSG-------LLT-GE---P-AQN--RPHRLDF-GS--VF----VDVLPAGPIP
A0A2P8WHY0      --TEGNLAN-------LLK-GV---T-RPS--RPHRLDF-GP--GH----IDVLPAGDPL
A0A2T1CMT9      --NLSGLTN-------FLG-GE---I-SLP--LIHQVSL-SG--AR----IDLITSGTMT
A0A563VQJ3      --KTVGLQD-------LIR-DR---K-PLA--NAVHRPM-PK--------LDILFSTSRV
A0A1D8TX52      --NYEGLSTLLEDDTALLE-DD---T-ATP--NPVSISP-LG--ST----IDVLTAGPTP
A0A1U7N5X9      --NQEGLST-------LLE-DD---I-ATP--SPVSISP-LG--ST----IDVLTAGPTP
A0A1D9G4T2      --NQEGLST-------LLE-DD---T-ATP--SPVSISP-LG--ST----IDVLTAGPTP
F4XP71          --HQEGLST-------LLE-DD---T-ATP--SPVSISP-LG--ST----IDVLTAGPTP
A0A2P8QVH5      --NDRGLST-------LLT-EE---A-DVR--ERDCIQS-VQ--PS----LDVLTAGPTP
A0A2T1FT70      --NDRGLST-------LLT-EE---A-DVR--ERDCIQS-VQ--PS----LDVLTAGPTP
A0A433W4W4      --NDRGLST-------LLT-EE---A-DVR--ERDCIQS-VQ--PS----LDVLTAGPTP
K9U5W1          --NDRGLST-------LLT-EE---A-DVR--ERDCIQS-VQ--PS----LDVLTAGPTP
A0A2W6ZAV2      --NGEGLSN-------LLT--E---P-TLQ--PERLIQP-IS--ER----LDLITAGPAP
A0A2G7GMH8      --NEQGLST-------LLT-SD---R-ALP--CRRRIQL-FG--AQ----IDVLTSGPTP
K9W742          --NDYGLST-------LLS-SD---A-PLP--IQTSLHA-SS--AY----IDVITSGPIS
A0A2T1DWE8      --NNYGLST-------LLT-RH---T-PLR--HHGDFQP-SH--RYTDIPLSILTSGPTP
A0A1U7I8L3      --NDRGLST-------LLT-ND---V-SLR--DETNVQI-SR--QHNN--ISILTAGPTP
A0A2T1DJL8      --NEQGLST-------LLS-GD---R-ML---SQNAIQL-AG--TYSDLSISVLTAGPAP
A0A1Z4J9W0      --NDHGLST-------LLT-SD---R-AI---TQGAIQP-AS--TYSDLPISVLTAGSSP
A0A0N7Z5K9      --NEHGLST-------LLT-SD---R-AL---TQAAIQP-AS--TYSDLPISVLTAGPTP
A0A0S3TXC5      --NDHGLST-------LLT-SD---R-AL---TQSAIQP-AS--TYSDLPISVLTAGPTP
K9SA61          --NDRGLSS-------LLS-GD---A--LF--QHGDIQP-SGHDSD----ISVLTAGPTP
A0A3D1PBA3      --NEQGLST-------LLS-SD---A-TLP--GQGVIQS-SG--AF----IDILTAGPLP
K9XPB0          --NNSGLSD-------LLQ-GT---T-ASL--NIQQVTL-AG--EN----IDLVTCGSRI
A0A350Y7Z1      --NEQGLAT-------LLV-ED---S-SIP--SPQRLSL-SG--SE----IDVLTAGPIP
A0A352X2A7      --NEEGLST-------LLA-DD---N-SIP--NPQHVSL-LG--SN----IDVLTAGPIP
A0A0D8ZYV0      --NEEGLST-------LLA-SD---A-NVP--SNAGIQS-SG--SY----IDILTAGPMP
A0A4R4IUM6      --NDYGLST-------LLS-SD---A-TLP--MHNAIQS-SG--SY----IDILTAGPQP
A0A2T1FP73      --NDYGLST-------LLS-SD---A-TLP--IHNAIQS-SG--SY----IDILTAGPQP
A0A433VMS2      --NDYGLST-------LLS-SD---A-TLP--IHNAIQS-SG--SY----IDILTAGPQP
K9TYA7          --NDYGLST-------LLS-SD---A-TLP--IHNAIQS-SG--SY----IDILTAGPQP
A0A2P8QUE1      --NDYGLST-------LLS-SD---A-TLP--IHNAIQS-SG--SY----IDILTAGPQP
A0A2T1DNG3      --NEQGLST-------LLVSQSPIPQ-QIE--TQDANLR-GN--------ISVLTAGPTP
A0A2P8W9H0      --NEKGLSN-------YVI-GE---Y-DFEDIVVNLPLD-EK--------LFIVTAGPIP
A0A1Z4LN32      --NSIGLSN-------VMV-GE---H-DLE--DAVQKVT-EN--------LSVLTSGVMP
A0A2I8A9F5      --NSAGLSN-------VVV-EQ---N-DFS--ATVQAVT-PS--------LSVLTSGVTP
A0A218Q6R8      --NSIGLSN-------VMV-GQ---E-ELS--DTIKQIT-PN--------LSVLTTGVIP
A0A218QGE0      --NSVGLSN-------VMV-GE---N-DFS--KSVQRIT-SN--------LSVLTAGVMP
B8HNB0          --NLRGLTT-------AIA-SD---K-SWQ--EMLIPGGVTN--------LDILTAGFRP
A0A563VS48      --NQIGLTN-------VLN-QE---A-EWY--EGVQNVR-PN--------LDVLTAGTTP
A0A318BJ18      --HDHGLSN-------FLS-GE---D-DID--SLVFSMSDLG--------FSAMTAGPIP
A0A3B8Y8H9      SSNQYSLED-------ILN-QD---L-APDQAITISPLN-PN--------LYVLVGTAKS
A0A2W1JVB9      --NRVGLSD-------VLV-GE---A-TLE--DAIQEGE-TN--------LDVLTAGVLP
A0A1Z3HMQ0      --NQIGLSH-------VLV-GE---G-HLN--QALRPVA-NN--------LTLLSAGVTP
A0A1E5QP61      --NVAGLSD-------VIA-NQ---A-KFN--IAVREVM-EN--------LDVLPSGATP
A0A3M2GIL5      --NIAGLSD-------AIV-SQ---V-ELD--QATLDVS-DN--------LDVLPSGVIP
A0A433NM31      --NNKGLSN-------LIV-EQ---I-DLE--TVVTKVE-QN--------LYVLTSGVLP
A0A3M1PML8      --NAAGLTN-------LLI-DQ---V-SSE--SVIQEVM-PG--------LHVLPSGVVP
A0A352X442      --NAVGLSN-------LLV-GE---A-DFS--TAVQEVM-PG--------LEVLTSGVIP
A0A0T7BPZ0      --NAKGLSN-------IIV-DQ---V-PFN--TLMREVM-PN--------LFVITSGVLP
A0A0M0SHU3      --NKRGLSN-------IIV-DQ---V-PIE--TVLHEVM-PN--------LHVLTSGVMP
A0A1D2PBN3      --NAVGLSN-------VIV-D----V-PID--IAVQEAI-PN--------LYVLSSGVVP
A0A0C2LVR7      --NAVGLSN-------VIV-DE---L-PID--IAVQEAI-PN--------LYVLPSGVVP
A0A1Z4PQB9      --NAVGLSN-------VIV-DE---L-PID--IAVQEVI-PN--------VYVLPSGVVP
A0A1Z4SFN6      --NAVGLSN-------VIV-DQ---S-PMR--VAIQEVM-PY--------LYVLPSGVVP
K9PGI8          --NAVGLSN-------VIV-DQ---V-PLN--KAVQEFI-PN--------LYVLTSGVIP
A0A563VLD6      --NEKGLTE-------AIV-SD---E-HWS--EIVNPNIVDG--------LDVMTAGSNV
A0A318BG22      --NQVGFSN-------LLT-GE---L-PLS--DVRIRLQDQG--------FDIITSGPLP
A0A2T1E9V8      --NEEGLMN-------VIA-EK---V-SFS--DRVIQTVRKN--------LDVITTGESD
A0A3M2GQQ6      --NALGLSS-------AIA-TD---R-NWS--DLIHRSESGR--------LHILTSGPTP
K9SGJ5          --NNYGLST-------VIA-TN---R-SWRQVVQSANVK-GC--------LNVITSGPLP
L8MYT6          --NKFGLST-------ALA-TP---S-PWQELTQVVDEK-GN--------LHILTSGSIP
A0A352JGJ6      --NKFGLST-------ALA-TP---S-PWQDLVQIADEK-DN--------LHILASGSLP
A0A1J5GLS2      --NKVGLST-------ALA-TP---T-PWQDLIQSGDEK-GN--------LDVLTSGSIP
A0A2W4W6M5      --NKVGLST-------ALA-TP---S-PWQDLIQVADDK-GN--------LHVLTSGSIP
A0A2W7AN33      --NKVGLSM-------ALA-TP---S-PWQDLIQVGSDH-NN--------LYILTSGSPP
A0A256BLV2      --NKVGLST-------ALA-TP---S-PWQDLIQAGDEQ-DN--------LHILTSGSLP
A0A2W6ZXF3      --NKVGLST-------ALA-TP---T-PWQDLIQSGDEK-GN--------LDVLTSGSIP
A0A2Z5WX66      --NKSGLST-------ALA-TP---N-PWQDLVQVADET-GN--------LHVLTSGSLP
K9W1T3          --NETGLST-------VLT-GQ---S-DFN--DAVVEVM-EN--------LEVLTAGTPP
A0A1Q4RTR1      --NSQGLNE-------ILE-NK---I-DLQ--TAVKNIS-NN--------VYLLTAGATP
A0A1Z4SQV2      --NSQGLNE-------ILE-GT---I-DLQ--TAERKVS-NN--------VYLLTAGVTP
A0A2H2XGN1      --NSQGLNE-------ILE-GT---I-DLQ--TAERKVS-NN--------VYLLTAGVTP
A0A433UXH8      --NSQGLNE-------ILE-NK---I-DLQ--TASRKVA-NN--------VYLLTAGTTP
A0A1Z4RMB9      --NNLGLKD-------ILTNDQ---S-PLS---VIKRPM-PK--------LSLLTSGIVN
K1XF69          --NAVGLSD-------VLV-EE---A-TLS--EAVKPGI-DQ--------LDILTAGVTP
B5W297          --NAVGLSD-------VLV-EE---A-TLS--EAVKPGI-DQ--------LDILTAGVTP
H1W7M8          --NAVGLSD-------VLV-EE---A-TLS--EAVKPGI-DQ--------LDILTAGVTP
A0A5Q4H6A5      --NAVGLSD-------VLV-EQ---A-TLS--EAVNRGI-DQ--------LDILTAGVTP
D5A466          --NAVGLSD-------VLV-EE---A-TLS--EAVKPGI-DQ--------LDILTAGVTP
B4WP72          --NRVGLSS-------FLV-GQ---S-SAQ--DTIQSVM-PR--------LHVLPSGWIS
A0A318B4H2      --ARPGLSN-------YLS-GA---N-EIG--DVLQEPRGEG--------FAMIPAGPTP
B4WQE3          --NEKGLSD-------YIA-GD---A-LLDESFVNLAVD-EN--------LFFMSSGSIA
A0A2P8W4F7      --NRQGLSD-------LITQAI---D-DPNDLVLQLPGN-PN--------LHLLTAGARP
A0A5Q4E0Z4      --NGRGLSE-------LITQGL---E-AANDLVLTMPDN-PN--------LHLLTAGALP
A0A2K3BR24      --NAVGLSN-------VLV-ED---K-EVN--SVVKELM-QN--------LDVLTAGAPP
K9YXY1          --NAVGLSN-------VLV-ED---K-EIN--SVVRELM-PN--------LDVLTAGAPP
U5QJM6          --NSRGLSS-------VLA-GN---L-SWQ--EAVQKLG-EN--------LFVLTSGPIP
K9SX01          --NASGLSN-------ILV-GE---T-QLE--TVLESVV-PN--------LDILSSGVLP
A0A4P7ZT55      --GARGWSE-------LFTEHP---P-ELE--ALLQWPE-AN--------LALLPVGRRP
A0A1E5QIR9      --KTVGLSN-------IIV-EQ---V-DPH--EAIAEVM-PH--------LFVLTAGSLP
A0A1Z4IBC7      --NEIGLSN-------VLI-GQ---V-TLE--DAVQEVM-PN--------LEVLPCGILP
A0A1W5CPC7      --NAIGLTN-------VLI-GQ---V-TLD--EAVQEVM-PN--------LEVLPCGILP
A0A5Q0GKD1      --NAIGLTN-------VLI-GQ---V-TLD--EAVQEVM-PN--------LEVLPCGILP
Q3MDC6          --NAIGLTN-------VLI-GQ---V-TLD--EAVQEVM-PN--------LEVLPCGILP
A0A1Z4KM73      --NAIGLTN-------VLI-GQ---V-TLD--EAVQEVM-PN--------LEVLPCGILP
Q8YNX7          --NAIGLTN-------VLI-GQ---V-TLD--EAVQEVM-PN--------LEVLPCGILP
A0A367R4K6      --NTVGLSN-------VII-GQ---V-SLD--EAVQEVM-PN--------LEVLTCGTLP
A0A1E2WSV8      --NAMGLSN-------VII-GQ---A-SLD--TVVQEVM-PN--------LEVLTSGVLP
A0A2R5FRT9      --NVTGLSN-------AIA-GQ---V-SLD--VAIQEVM-PN--------LEVLTSGILP
A0A2K8T1B6      --NTIGLSN-------VII-GE---A-SLD--TVAQEVM-PN--------LEVLTSGVLP
A0A235I9I0      --NTSGLSN-------IIG-SQ---A-PLD--TVVQEVM-PN--------LEVLTSGVLP
A0A2D0HQT8      --NTMGLSN-------IIT-NQ---A-SLD--TVVQEVM-PN--------LEVLTSGVLP
A0A2L2NU95      --NTMGLSN-------VIL-NQ---A-SLD--TVVQEVM-PN--------LEVLTSGVLP
A0A367S084      --NTMGLSN-------ILI-NQ---A-SLD--TVVQQVM-PN--------LEVLTSGVLP
A0A0V7ZFJ4      --NLIGLSN-------VLV-GQ---S-KLQ--DTLQKAL-PA--------LDVLLVGKIP
A0A367RIS1      --NLMGLSN-------VLV-GQ---A-TLA--GAAKEVV-SN--------LELLTAGTIP
A0A235IXQ2      --NLMGLSN-------VLV-GQ---T-SLA--EAAKEVV-IN--------LELLTSGTIP
A0A1W5CNX3      --NLMGLSN-------VLV-GQ---A-TLA--EAAKEVV-IN--------LELLTSGTIP
A0A5Q0GJJ5      --NLMGLSN-------VLV-GQ---A-TLA--EAAKEVV-IN--------LELLTSGTIP
Q3MEB7          --NLMGLSN-------VLV-GQ---A-TLA--EAAKEVV-IN--------LELLTSGTIP
A0A1Z4KHN9      --NLMGLSN-------VLV-GQ---A-TLA--EAAKEVV-IN--------LELLTSGTIP
Q8YT70          --NLMGLSN-------VLV-GQ---A-TLA--EAAKEVV-IN--------LELLTSGTIP
A0A218Q4C1      --NLIGLSN-------VLV-GQ---A-TLA--QSCHEAL-VN--------LHLLTAGTIP
A0A166IWU6      --NLMGLSN-------ILA-GQ---T-DLT--QISQEAL-VN--------LDLLTAGTIP
A0A2S0Q8C0      --NLMGLSN-------VLA-GQ---T-NLT--QSSQEAL-VN--------LDLLTAGTIP
W6FSX4          --NLMGLSN-------VLA-GQ---T-NLT--QSSQEAL-VN--------LDLLTAGTIP
A0A0V7ZNJ9      --SFSGLSN-------LLV-GK---A-ELQ--NSIQKPL-AT--------LDLLPAGKIP
A0A0R0M9H9      --NFVGLSN-------VLV-AQ---T-QLE--NCLQDV--SS--------VNVLTAGKVP
A0A1S1ZVW2      --NFVGLSN-------LLV-AQ---T-QLE--NCLQDV--SS--------VNVLTAGKVP
A0A1B7WX82      --NLLGLSN-------ILA-GQ---A-QLK--NTVQEVS-PL--------VDLLPVGKIP
A0A1B7WTD1      --NLLGMSN-------ILA-GQ---N-EVK--PAIHKVF-LN--------VDMLPAGKIP
A0A480ABC0      --NLLGLSN-------ILA-GQ---N-EVK--PAIHTVF-SN--------VDMLPAGKIP
A0A1Z4LRU5      --NMIGLSN-------VLV-GQ---A-ALN--GSTEEAL-VT--------LDVLTSGKIP
A0A1Z4JVB4      --HLMGLSN-------ILV-GQ---A-DLQ--STSKEVL-IN--------LDLLTSGIIP
K9PIA4          --NLIGLSN-------ILV-GQ---A-ELQ--SSTKEAL-MA--------MDLLTAGTIP
A0A1Z4M597      --NLVGLSN-------ILV-GQ---T-ELQ--TTSKEAL-MT--------LDIITAGTIP
A0A1Z4MWT1      --NLVGLSN-------ILV-GQ---T-ELQ--TTTKEAL-MT--------LDIITAGTIP
A0A1Z4TX53      --NLVGLSN-------ILV-GQ---T-ELQ--TTTKEAL-MT--------LDIITAGTIP
A0A1Z4HVE1      --NLIGLSN-------ILV-NQ---A-ELQ--TTTKEAL-MT--------LDLITAGTIP
A0A252ECZ1      --NLIGLSN-------ILV-GQ---A-ELP--TTTKEAL-MT--------LDFVSSGTIP
A0A1Z4G5Y1      --NLIGLSN-------ILV-NQ---A-ELA--TTTKEAL-MT--------LDLVTAGTIP
A0A252DNA2      --NLIGLSN-------ILV-NQ---A-ELP--TTTKEAL-MT--------LDLVTAGTIP
A0A252E1Q4      --NLIGLSN-------ILV-NQ---A-ELP--TTTKEAL-MT--------LDLVTAGTIP
A0A5P8VSD1      --NLMGLSN-------VLV-GQ---A-TLA--EAAKEVM-IN--------LELLTSGTIP
A0A2A2TNQ5      --NFMGLSN-------ALV-GQ---G-EWV--NLTKEVV-YG--------LDVLTAGTIP
A0A3S1C4K5      --NFMGLSE-------VLV-GQ---A-EYV--AIAQEAI-HN--------LDILTAGTIP
A0A1X4G3D5      --NFVGLSE-------ILA-GR---T-QLG--ASIQEVS-S---------ISVLTAGNTP
D4TNI2          --NFVGLSE-------ILA-GR---T-QLG--ASIQEVS-S---------ISVLTAGNTP
A0A1Z4H6Z8      --NLIGLSN-------ILV-NQ---A-ELP--TTTKEAL-MT--------LDLVTAGTIP
A0A1Z4NPM1      --NITGLSN-------LLV-GQ---A-VLS--QVTHEAL-VT--------LDLVTTGTTP
A0A3F3KPR9      --NFVGLSN-------VLV-AQ---T-QLE--NCLQDVS-S---------VHVLTAGKVP
D4TGN7          --NFVGLSN-------VLV-AQ---T-QLE--NCLQDVS-S---------VHVLTAGKVP
A0A1Z4UZW9      --NLLGLSN-------VLA-GQ---V-QLK--NAVQEVS-PQ--------VHILPAGRTP
A0A0K2M5H0      --NLLGLSN-------ILA-GQ---A-QLE--NAVQEVS-PL--------VNMLPAGKIP
A0A1B7VSH4      --NLLGLSN-------ILA-GQ---T-QLK--NAVQEVS-PL--------VKMLPAGKIP
A0A1B7W126      --NLLGLSN-------ILA-GQ---T-QLK--NAVQEVS-PL--------VKMLPAGKIP
A0A3D4C6Q6      --NLLGLSN-------ILA-GQ---T-QLK--NAVQEVS-PL--------VKMLPAGKIP
A0A1B7UVJ4      --NLLGLSN-------ILA-GQ---A-QLK--NTVQEVS-PL--------VDLLPVGKIP
A0A1B7UTR1      --NLLGLSN-------ILA-GQ---A-QLK--NTVQEVS-PL--------VDLLPVGKIP
A0A5C0DRW9      --NLLGLSN-------ILA-GQ---T-QLK--NAVQEVS-PQ--------VNMLPAGKIP
K7W0A4          --NLLGLSN-------ILA-GQ---M-QLK--NAVQEVS-PQ--------VNMLPAGKIP
A0A1U7HGH0      --NHIGLMN-------TIT-KR---V-GVNK-KAIQPVA-KN--------IDVLTTGTSE
K9XJD3          --NHIGLMN-------TIA-KR---I-GVNK-KAIQPVA-KN--------IDVLTTGTSE
A0A2T1CIL7      --NTAGLSN-------VLL-NE---T-EWQ--EAVQRVM-PN--------LDVLTAGVIP
A0A1Z4RPC6      --NLMGVKD-------VIT-HK---T-PLD--QVVSQPM-KQ--------LDLLTAGTIA
A0A2T1CMZ0      --NKVGVKD-------VVA-HK---T-PLA--QVVTQPI-MQ--------LNVLTSGTIA
L8M4F7          --SHQGIKE-------VIQ-GE---A-ELA--DAVTQPM-LN--------LKLLASGEVV
A0A140K2P2      --NFVGLRD-------VIV-AQ---K-PLS--LAVSKPL-EK--------LDLLTAGELQ
K9XWX4          --NFVGLKD-------VIS-AQ---K-PLS--LAVSRPL-EQ--------LDLLTAGEVQ
A0A140KB14      --NHLGFKD-------VLT-HK---T-SLQ--EVVARPL-DR--------LDLLTVGVVP
K9XX88          --NHLGLKD-------VLT-HK---T-SLH--EVVARPI-ER--------LDLLTVGVVP
A0A563VSV6      --NQVGIKD-------LVT-NQ---A-SVR--DVASKPM-AK--------LDLLTSGMIP
L8LZE9          --NQKGVKE-------LLT-EK---I-ALN--QITQQPM-PN--------MDLLTSGEII
A0A433V7A0      --NEVGLSN-------AIV-SR---D-NPR--VAVKEVM-SN--------LDVLCSGVIP
A0A1Z4NDS1      --NTIGLSN-------VIV-NQ---V-NLS--LAVEEVI-PN--------LHLLPAGVVP
K9F4D9          --NVQGLSN-------FAS-GQ---V-PLK--DVIVSQE-PN--------LHILTAGVIP
U9VXM0          --NLQGLSN-------FAT-GQ---V-SLK--DVIISQE-PN--------LHILPAGVIP
A0A2T1FTR8      --NYEGLSN-------VLS-GQ---C-DRK--TATTEIQ-PN--------LFLVTAGVVP
K9UA41          --NYEGLSN-------VLS-GQ---C-DRK--TATTEIQ-PN--------LFLVTAGVVP
A0A0C2LBE2      --NAVGLSH-------VIV-NP---D-TLN--VALQEAM-PN--------LDVIPSGVVP
A0A433NN38      --NAQGLSN-------AIVDDQ---I-PLN--TVVQEVM-PN--------LYVLPSGVIP
A0A2N6K0T2      --NNQGLSN-------IIV-DQ---V-PLE--TTVHEVM-PN--------LHVLTSGVIP
A0A2N6ML72      --NNQGLSN-------IIV-DQ---V-PLE--TIVHEVM-PN--------LHVLTSGVMP
G6FQZ6          --NNQGLSN-------IIV-DQ---V-PLE--TIVHEVM-PN--------LHVLTSGVIP
A0A2N6MQX9      --NNQGLSN-------IIV-DQ---V-PLE--TIVHEVM-PN--------LHVLTSGVMP
A0A2N6KXT6      --NNQGLSN-------IIV-DQ---V-PLE--TIVHEVM-PN--------LHVLTSGVIP
A0A2N6KGB9      --NNQGLSN-------IIV-DQ---V-PLE--TIVHEVM-PN--------LHVLTSGVMP
A0A2N6L3Y5      --NNQGLSN-------IIV-DQ---V-PLE--TIVHEVM-PN--------LHVLTSGVMP
A0A0S3TIS7      --NNQGLSN-------IIV-DQ---V-PLE--TIVHEVM-PN--------LHVLTSGVMP
A0A1U7GW28      --NNQGLSN-------IIV-DQ---V-PLE--TIVHEVM-PN--------LHVLTSGVMP
A0A2N6LW63      --NNQGLSN-------IIV-DQ---V-PLE--TIVHEVM-PN--------LHVLTSGVMP
A0A328IH74      --NKKGLSN-------IIV-DK---V-ALE--TVVHEVM-PN--------LHVLTSGVIP
A0A4D9CIB0      --NKKGLSN-------LIV-DK---V-ALE--TVVHEVM-PN--------LHVLTSGVIP
A0A1Z4TQ63      --NKKGLSN-------IIV-DQ---V-PLE--SVVHEVM-PN--------LHVLTSGVIP
A0A4Q9J8G2      --NKKGLSN-------IIV-DQ---V-PLE--TVVHEVM-PN--------LHVLTSGVIP
A0A1Z4SMD6      --NSTGLSN-------IIV-GQ---E-EFS--SAVQSIT-TN--------LSVLTAGVQP
A0A2H2Y096      --NSTGLSN-------IIV-GQ---E-EFS--SAVQSIT-TN--------LSVLTAGVQP
K9S8M8          --NLAGLSN-------VIM-KQ---T-DLS--EAVNPVM-DN--------LDVLTCGAIP
A0A1Z4NFV0      --NPTGLSN-------ILV-GQ---D-DMS--KAVQTVT-GN--------LSVLTAGVIP
B0CAX4          --NALGLSN-------VLV-EQ---K-DWH--EAIRPED-DQ--------LDILTAGVTP
U5DPF5          --NTTGLSN-------VLV-EQLSVA-EIA--HAEGQDG-NK--------LDVLTAGVIP
A0A350Y0P6      --NTVGLSE-------VIV-HQ---T-QFE--FAVREVM-DN--------LDVLPSGVIP
A0A352X940      --NAMGLSE-------VIV-NH---A-EFK--DAVREVT-DN--------LDVLPSGAIP
B8HTN4          --NATGLTH-------LLA-DN---H-SST--KFIHQES-DN--------LDVLTAGPRA
A0A2A2TPF8      --NLTGLSN-------VIV-GQ---E-QIR--RCIQSVT-RN--------LSVLTAGVIP
A0A1Z4R0P8      --NLTGLSN-------AIV-GQ---N-QIR--RCIQSVT-RN--------LSVLTAGVIP
A0A0T7BUI3      --NSVGLSN-------VIV-GQ---N-DFP--QAVQRIT-SN--------LFVLTAGVQP
A0A1Z4LP32      --NGGGLSN-------VIV-GQ---D-EFS--RCYHQVN-KY--------LSVLSAGVQP
K9REP9          --NSGGLSN-------VIV-GQ---D-ELY--RCHHQVT-EN--------LSVLTAGVQP
A0A1Z4SIJ3      --NSVGLSN-------VIV-GQ---S-DFL--LSKKVVN-EH--------LSILTAGVRP
A0A2H2XPG4      --NSVGLSN-------VIV-GQ---S-DFL--LSKKVVN-EH--------LSILTAGVRP
K9V3C7          --NVKGLSN-------LLV-DR---V-KLN--RVVQKVS-TN--------LSLLTAGVIP
A0A1Z4T6Y7      --NLTGLSN-------VIV-GQ---D-RIR--SCIQSVT-RN--------LSVLTAGVIP
A0A2H2Y561      --NLTGLSN-------VIV-GQ---D-RIR--SCIQSVT-RN--------LSVLTAGVIP
A0A1Q4S362      --NLTGLSN-------VIV-GQ---D-RIR--NCIQTVT-RN--------LSVLTAGVIP
A0A3S1CIN8      --NLTGLSN-------VIV-GQ---D-RIR--NCIQTVT-RN--------LSVLTAGVIP
A0A2A2TC28      --NSSGLSN-------IIV-GQ---D-EFS--LAVKTVT-NH--------LSILTAGVQP
A0A0C1NCB0      --NSVGLSN-------VIV-AQ---D-EFS--QAVQEVT-SH--------LSVLTAGVQP
A0A2N6K7Q9      --NSVGLSH-------LLV-GQ---G-VLS--QAVQKVT-EF--------LAVLTAGVIP
A0A2N6MXH6      --NSVGLSH-------LLV-GQ---G-VFS--QAVQKVT-EF--------LAVLTAGVIP
A0A2N6M5A8      --NSVGLSH-------LLV-DQ---G-VFS--QAVQKVT-EF--------LSVLTAGVIP
A0A2N6LL61      --NSVGLSH-------LLV-GQ---G-VFS--QAVQKVT-EF--------LAVLTAGVIP
A0A0S3TP66      --NSVGLSH-------LLV-GQ---G-VFS--QAVQKVT-EC--------MAVLTAGVIP
G6FP91          --NSVGLSH-------LLV-DQ---G-VFP--QAVQKVT-EF--------LAVLTAGVIP
A0A1U7GYR5      --NSVGLSH-------LLV-DQ---G-VFS--QAVQKVT-EF--------LAVLTAGVIP
A0A2N6KY52      --NSVGLSH-------LLV-DQ---G-VFS--QAVQKVT-EF--------LAVLTAGVIP
A0A2N6KMP5      --NSVGLSH-------LLV-GQ---G-VFS--QAVQKVT-EF--------LAVLTAGVIP
A0A2N6MA45      --NSVGLSH-------LLV-GQ---G-VFS--QAVQKVT-EF--------LAVLTAGVIP
A0A4Q9J9V9      --NSVGLSH-------LLV-GQ---A-VFS--EAVHKVT-EF--------LSVLTAGVIP
A0A328IGA1      --NSVGLSH-------LLV-GQ---A-VFS--EAVHKVT-EF--------LSVLTAGVIP
A0A4D9CE41      --NSVGLSH-------LLV-GQ---A-VFS--EAVHKVT-EF--------LSVLTAGVIP
A0A0M0SFT2      --NSVGLSH-------LLV-GQ---A-VFS--EAVHKVT-EF--------LSVLTAGVIP
A0A1Z4TLC8      --NSVGLSH-------LLV-GQ---G-VFS--QAVHKVT-EY--------LSVLTAGVIP
A0A0C2LFH0      --NSVGLSN-------VIV-GQ---D-QLP--QTVQTVT-KE--------LSILTAGVQP
A0A1Z4IYV4      --NSVGLSN-------MIV-CQ---A-EFP--QGVQTVT-KH--------LSVLTAGVVP
A0A1Z4Q0T6      --NSVGLSN-------MIV-CQ---A-EFP--QGVQTVT-QH--------LSVLTAGVVP
A0A0C2PT44      --NSVGLSN-------LIV-CQ---A-EFP--QGVQTVT-KD--------LSVLTAGVVP
A0A1D2P6J4      --NSVGLSN-------MIV-CQ---A-EFP--QGVKTVT-KH--------LSVLTAGVVP
A0A4R4IQ40      --NTEGLSD-------AIV-GQ---V-DYQ--FAIKEVL-PK--------LHILTAGATP
A0A433W533      --NTEGLSD-------AIV-GQ---V-DYQ--SAIKEVL-PK--------LHILTAGATP
A0A2P8QWJ3      --NTEGLSD-------AIV-GQ---V-DYQ--SAIKEVL-PK--------LHILTAGATP
A0A2T1FKP8      --NTEGLSD-------AIV-GQ---V-DYQ--SAIKEVL-PK--------LHILTAGATP
K9U6L7          --NTEGLSD-------AIV-GQ---V-DYQ--SAIKEVL-PK--------LHILTAGATP
A0A3M9ZEU1      --NTGGLSN-------VIV-GQ---Q-ELS--TAIQPAM-PG--------LDVLPAGVVP
A0A1Z4JK72      --NSVGLSN-------VVV-DQ---S-ELR--QAVKPIT-NN--------LSILTAGVMP
A0A0N7Z489      --NSVGLSN-------VVV-DQ---S-ELR--QAVKPIT-SN--------LSVLTAGVMP
A0A0S3TXS2      --NSVGLSN-------VVV-DQ---S-ELR--QAVKPIT-SN--------LSVLTAGVMP
A0A1Z4RN12      --NEIGLSN-------VLK-HE---V-QWA--DVVHKVM-PN--------LDVLTSGIVP
A0A2T1CMF9      --NQIGLSE-------VLS-GK---V-SWS--ETVQNVM-PN--------LDVLTSGSMP
Q7NDC5          --NRQGLST-------LLV-GE---A-DWQT-AVRPTPQ-PG--------LVVLTAGPPP
U5QGK3          --NQQGLST-------LLT-GE---G-NWRDLLVQPPGL-ER--------LSLLTAGPMP
A0A2W4UY24      --NLKGLSN-------LVA-GQ---L-PLK--QAIVRQE-PN--------LHLLPAGSIP
A0A2T1GMT4      --LKKGLSE-------LIE-RK---S-KFQ--QISWTVM-EN--------LDVLTAGGKP
K9UI51          --LRKGLSE-------LIE-RK---S-KLQ--QISWTVM-EN--------LDVLTAGARP
K9QM62          --HTSGLSD-------VLV-GQ---S-QFN--ETVSQVT-HY--------LDVLTAGVRP
A0A1Z4FWI3      --NSAGLSD-------VLV-GE---A-EFK--TVACNVI-EN--------LDVLTAGVRP
A0A1Z4JYE7      --STAGLSE-------VLV-GH---L-DVR--FAVKKVM-DN--------LDILTAGVRP
A0A2T1FXY4      --NAAGLSE-------VLV-GQ---A-QLS--IATSKVI-NN--------LDVLTAGVTP
A0A4V2X3N2      --NATGLSE-------VLV-GQ---A-QVS--IATSKVM-NN--------LDVLTAGVTP
K9TYI2          --NAAGLSE-------VLV-GQ---A-QLS--VATSKVM-NN--------LDVLTAGVTP
A0A1Z4QL41      --NLAGLSE-------VLV-DE---A-ELN--VALCKVM-DN--------LDVLTAGVRP
A0A252D4T4      --NTAGLSE-------VLV-GE---A-EFK--TAACNVI-DN--------LDVLTAGVRP
A0A252DJH5      --NTAGLSE-------VLV-GE---A-EFK--TAACNVI-DN--------LDVLTAGVRP
A0A252EB80      --NAAGLSE-------VLV-GE---A-EFK--TAACNVI-DN--------LDVLTAGVRP
A0A1Z4HPW5      --NTAGLSE-------VLV-GE---A-DFK--TAASNVI-EN--------LDVLTAGVRP
A0A1Z4MSN1      --NTAGLSE-------VLV-GE---A-EFK--TAASNVI-EN--------LDVLTAGVRP
A0A1Z4U1C2      --NTAGLSE-------VLV-GE---A-EFK--TAASNVI-EN--------LDVLTAGVRP
A0A0D6KV51      --NTAGLSE-------VLV-GE---A-EFK--TAASNVI-EN--------LDVLTAGVRP
A0A1Z4MKF8      --NTAGLSE-------VLV-GE---A-EFK--TAASNVI-EN--------LDVLTAGVRP
A0A2C6WC43      --NAVGLSE-------VLV-GQ---A-EFN--TAVSKVM-DN--------LDVLTAGVRP
A0A1Z4L5A1      --NAVGLSE-------VLV-GQ---A-EFN--IAVSKVM-DN--------LDVLTAGVRP
A0A367QD86      --NVVGLSE-------VLV-GQ---A-EFN--TAVSKVM-DN--------LDVLTAGVRP
A0A235IZ96      --NAVGLSE-------VLV-GQ---V-EFN--MAISKVM-DN--------LDVLTAGVRP
A0A2L2NGP0      --NAVGLSE-------VLV-GQ---V-EFN--MAISKVM-DN--------LDVLTAGVRP
A0A2K8SM78      --NAVGLSE-------VLV-GQ---A-EFD--VTVSKVM-DN--------LDVLTAGVRP
A0A2R5FPC0      --NAVGLSE-------VLI-GQ---A-EFD--VTVSRVM-DN--------LDVLTAGVRP
A0A5P8W5T6      --NAVGLSE-------VLV-GQ---A-EFD--VSVSKVM-DN--------LDVLTAGVRP
A0A140KBA0      --NYLGLSN-------VLK-GE---A-EWQ--EAIKTIK-PG--------LDILTAGDLP
K9XSG1          --NYLGLSN-------VLK-GE---V-EWQ--EAIKTIK-PG--------LDILTAGEPP
A0A0F5YE28      --NAVGLSD-------ILV-GQ---A-ELS--SVIRQGI-ER--------LDIIPSGVTP
U7QEH7          --NAVGLSD-------ILV-GQ---A-ELQ--SGICQGI-ER--------LDIIPSGVTP
A0A3S1ATK5      --NSPGLSE-------VLV-AQ---V-EYS--NSIFRVM-DN--------LDVLPAGVRP
A0A2Z6CPH0      --NVAGLSE-------VLV-GQ---S-EVD--TAVNQVM-DN--------LNVLTAGVRP
A0A1Z4GT50      --NAAGLSE-------VLV-AQ---A-EFK--QAACKVM-DN--------LDVLTAGVRP
A0A1Z4GIX0      --NAAGLSE-------VLV-GQ---A-EFP--TAVSQVM-DN--------LDVLTAGVRP
A0A2H6LC24      --NAAGLSE-------VLV-GQ---A-EFP--SAVYQVM-DN--------LDVLTAGVRP
B2J6N5          --NADGLSE-------VLV-GQ---T-EFD--VALSKVM-DN--------LDVLTAGSRP
A0A367RMI4      --NEVGLSE-------VLV-GQ---A-EFD--IAVSKVM-DN--------LDVLTAGVRP
A0A235HUM0      --NEVGLSE-------VLV-GQ---A-EFE--IAVSQVM-DN--------LDVLTAGVRP
A0A2L2NW47      --NEVGLSE-------VLV-GQ---A-EFE--IAVSKVM-DN--------LDVLTAGVRP
A0A1E2WUR1      --NAVGLSE-------VLV-GQ---A-EFD--IAVSKVM-DS--------LDVLTAGVRP
A0A235IKU3      --NAVGLSE-------VLV-GQ---V-EFN--MAISKVM-DN--------LDVLTAGVRP
F4XKF3          --NVAGLSQ-------VLI-GE---V-PLE--LAICKAM-EN--------LDVLTAGVMP
A0A1D9FX10      --NVAGLSQ-------VLI-GE---V-PLE--LAICKAM-EN--------LDVLTAGVMP
A0A1D8TNX9      --NVAGLSQ-------VLI-GE---V-PLE--LVICQAM-EN--------LDLLTAGVMP
A0A1U7MYU6      --NVAGLSQ-------VLI-GE---V-PLE--LAICQAM-EN--------LDVLTAGVMP
A0A3C0NJ41      --NAGGLSD-------VLV-GQ---A-EFK--AVVTEVM-DN--------LDVLSCGVIP
A0A352AG88      --NTAGLSD-------VLV-GQ---A-DFA--ATVRTGM-DS--------LDVLTAGVIP
A0A350Y374      --NAAGLSD-------VLV-VQ---A-EFE--TAVNKVM-DN--------LDVLTAGVIP
A0A355DPX0      --NAAGLSD-------VLV-VQ---A-EFE--TAVNKVM-DN--------LDVLTAGVIP
A0A0D8ZUV2      --NITGLSD-------VIV-GQ---S-EFK--TSVRTAI-KN--------LDVLTAGVMP
A0A433VDI0      --NAVGLSD-------VIV-GQ---A-EFK--ASVTQVM-PN--------LEVLTSGVIP
A0A3D1PG43      --NVAGLSN-------VIV-SQ---T-EFQ--TTVQQVM-TN--------LDVLTAGVMP
A0A2P8QQ72      --NVEGLSH-------VLV-GG---T-DFQ--AAVEQVM-PN--------LHVLTAGVVP
K9TZQ7          --NVEGLSH-------VLV-GG---T-DFQ--AAVEQVM-PN--------LHVLTAGVVP
A0A2G7GPR0      --NAAGLSD-------VIV-SQ---A-EFE--SVVTEVI-PK--------LDVLSAGVIP
K9XH68          --NAAGLSD-------VIV-SQ---A-EFE--SVVTEVI-PK--------LDVLSAGVIP
A0A1U7HW70      --NAAGLSD-------VIV-SQ---A-EFE--SVVTEVI-PK--------LDVLSAGVIP
A0A2S6VEJ8      --NAAGLSD-------VIV-SQ---A-EFE--SVVTEVI-PK--------LDVLSAGVIP
                                                                     :      

K9SLA9          TN--PAALLDS-RPMNSLLSVAAR--NYDLVLLDTPPVTVAADTTVLGKKTDGVVLLVRP
A0A168TT23      PN--PAELLSS-DRMRKIINMSAR--AFDHVIIDSAPILGLADALVLSRCVDGVILVTSA
A0A0M1JWX9      PD--PIRLLSS-QKMQQLMQQWSR--EFDLVILDTPPLKNVVDGRVLAGYTDGVVLVVSM
A0A2T1M1V6      PN-KIGEFFLR-GEFEQRLNRAQASDNYDFILIDSPPVNLTSETSLMSRLIQNVMFLVRP
A0A2G7GCS2      KT-KIPEYFAR-GRFQQNLDQIQAEGGYDYVLVDSPPIGLASETNLMSSVVRNVLFVVRS
K9XBH8          RE-KIAEFFAR-GSFERNLNQIQSSGGYDFVLVDSPPVGLASETNLMSSVIQNVLFVVRA
A0A1Z4LJ30      DK--ISEFVAR-GEFEQHLNFVQTNDNYDYVLVDSSPVTLTPEAALLAKVIINVLFVVRS
K9RI76          DK--ISEFVAR-GEFEQYLNLIQAQGNYDYVLVDSSPVALTPEAALLARIISKVVFVVRS
A0A352AE27      GK--IVEMVTR-GRFEESLVAAQSANEYDYILVDSAPVSLTSETVLMAAITRNVLFVVRP
A0A3B8JH60      GK--IVELVRG-GRFEQSLEAIQSAGDYDYILIDSAPVTFTSETALMASIVPNVLFVVRP
A0A3C0N766      GK--IVELVRG-GRFEQSLEAIQSAGDYDYILIDSAPVTFTSETALMASIVPNVLFVVRP
K9W9J7          GK--IVELVRR-GRFEQSLAVAESANKYDYVLIDSAPVSLTSETALMANVVPNVLFVVRP
A0A139WSU3      GK--IVETIKR-GRFEQALTACEARGNYDYVIVDSAPVSLTSETALMATLISNVLFVVRP
A0A433VN22      GK--IVEIIRR-GNFEKTLATCEANNKYDYIIVDSAPVSFTSETPLIANIIRNVLFVVRP
Q7NF11          DT--STAFFVQ-GGFERYLDDVQTD-GYDYVLVDSPPISLTSEAALMIPAVRNVLFVVRP
A0A1Z4JCS8      GK--IVDLVKR-GRFERYLAVAESQKDYDYVLVDSAPVSSTSETALMAAIVPYVLFVVRP
F4XTX2          GK--IVELVTQ-GKFEQSLATAEESGDYDYVLIDSAPVSMTSETALMAAVIGNLLFVVRP
Q7NJN6          ERTSVGEYIAR-GHFSRYLSELESAGGYDYVLIDTAPEDLVAETKLIAAAIGNVLFVVRP
U5QCC3          GDASIGEHIVK-GNFTRHLDRLKQENGHDYILIDTAPEQLVAETKLIAAEIRNVLFVVRP
A0A3S0Y9N9      NN--PSALINS-TQMAVFIAQVAQ--KYDFVIIDSPPFTVAADATILGKLANGILLVVRP
A0A433UNK7      HN--PASLLDS-SQMAVFVAQVAQ--KYDFVIIDTSPLTVAADATILGKLVNGILFVVRP
A0A3M1SVZ4      PN--PIALLDS-QRMVSLMEEFAD--RYDFIILDAPPLNVAADASILGKMSDGILWVVRP
A0A654SFI6      PN--PVELLAS-PRIGHILTQARD--QYDQVVIDSAPMLSLADAVELSRFVDGVLYVVES
K9SSQ0          PN--PMILLES-NKFQKLLGEWDQ--TYDYVLIDTPPIVGITDAQSLAPRMDGVVLVTAI
A0A2W1JIN9      VL--PSRFFES-DGMKILLEEARS--SYDLVIVDTPPVTSCVDAMAVSSEGYPLLLIARP
A0A318AJV1      FI--SRDIFSP-STVQNLLENGRA--LYDFVVMDLPPVLGVADARLLAAMADANVFVVRW
A0A1U7N2U4      SG--PATFLQS-QVMKSILAAAGD--HYDLVIVDTPPVSSFADAHTLSRYSDGLVMVTRA
A0A1D9G1F2      SG--PATFLQS-QVIKSILAAAAD--HYDLVIVDTPPVSSFPDAHTLSRYSDGLVMVTRP
F4XV38          SG--SATFLQS-QMIKSILAAAAD--HYDLVIVDTPPVSSFADAHILSRYSDGLVIVTRP
A0A2P8QIL5      SH--PSELFES-RQIQQVIAAAAS--QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARP
A0A2T1FLY5      SH--PSELFES-RQIQQVIAAAAS--QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARP
A0A433W447      SH--PSELFES-RQIQQVIAAAAS--QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARP
K9U1K8          SH--PSELFES-RQIQQVIAAAAS--QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARP
A0A4V6P809      SH--PSELFES-RQIQQVIAAAAT--QYDLIVIDTPPVTSCIDAVSLCGNGEKLLLVARP
K9UYB2          GS--ASQMLES-AAMRHIITEASE--HFDLVIIDTPPLTICADAITLGRITEGLLLVTRP
A0A218QN17      GR--PSQLLES-PAMKSLVAEAAA--TYDMVIIDTAPISACADAATLARQSDGIMLVTRP
K9RKN2          GR--PSQLLES-VEMKLILEEAAK--EYDLVIIDTPPVSACADAATLGKQGDGVVLVTRP
A0A2I8ADV2      GR--PSQLLES-EAMKSLIAEAAH--HYDLVIIDTPPIGVCADASTLSQYSDGVIMTTRP
A0A1W5CKM3      GR--PSQILES-AAMKALVAEAAQ--RYDLVIIDTPPLSACADASTLSQMSDGVILTTRP
A0A5Q0GMF5      GR--PSQILES-AAMKALVAEAAQ--RYDLVIIDTPPLSACADASTLSQMSDGVILTTRP
Q3MEW0          GR--PSQILES-AAMKALVAEAAQ--RYDLVIIDTPPLSACADASTLSQMSDGVILTTRP
A0A1Z4KIC7      GR--PSQILES-AAMKSLVAEAAQ--RYDLVIIDTPPLSACADASTLSQMSDGVILTTRP
Q8YSM5          GR--PSQILES-AAMKSLVAEAAQ--RYDLVIIDTPPLSACADASTLSQMSDGVILTTRP
A0A1Q4S1H4      AR--PSQLLES-NQMKALLTEAAE--NYDLVILDTPPLSACADATTLSQLSDGVMLVTRP
A0A433VBU6      TR--PSQLLES-TYMKALMMEAAE--SYDLVILDTPPLSACADATTLGQLSDGIMLVTRP
A0A1Q4RZJ6      GR--PSQILES-AAMKKLIAEAAA--NYDFVIIDTPPLSACADTATLAKQCEGVLMVTRP
A0A1Z4SNV3      VR--PSQILES-PAMKRLISEAVA--NYDFVIIDTPPLSACADTATLAKQSEGVLMVTRP
A0A2H2XJQ1      VR--PSQILES-PAMKRLISEAVA--NYDFVIIDTPPLSACADTATLAKQSEGVLMVTRP
A0A3S5K358      GR--PSQILES-AAMKKLIAEAAA--NYDFVIIDTPPLSACADTATLAKQCEGVLMVTRP
A0A0T7BPJ4      NR--PSQLLES-PEMKALIAEATA--KFDLVIIDTPPLCACADASTLSRYSDGMVVVTRP
A0A0C1QS61      GR--PSQLLES-IAMKSLVAEASE--NYDLVILDTPPLSACADAATLAKQSDGVMLVTRP
A0A139X3R8      GR--PSQLLES-VAMKSLVAEAAE--NYDLVIIDTPPLSACADAATLAKQSDGVMLVTRP
A0A1Z4I7C5      GR--PSQILES-PAMKSLVAQAAE--YYDIVIIDTPPLSACADAASLSQMSDGVILATRP
A0A0C2MDK7      GR--PSQLLES-IAMKSLMAEAAE--NYDLVIIDTPPLTACADALTLAQEGNGLMLVTRP
A0A1Y0RCK1      GR--PSQLLES-IEMKSLIAEASE--NYDLVIIDTPPLSACADASTLAQQSDGVVLVTRP
A0A1Z4PWZ0      GR--PSQLLES-IAMKSLVAEAAE--NYDLVIIDTAPLCSCADASTLARQSDGVMLVTRP
A0A0C2QLT0      GR--PSQLLES-IAMKSLVAEAAE--NYDLVIIDTPPLSACADASTLAQQSDGVMLVTRP
A0A1Z4J2K1      GR--PSQLLES-IAMKSLVAEAAE--NYDLVIIDTPPLSACADASTLAQQSDGVMLVTRP
A0A3S0ZSX0      GR--PLQLLES-DAMKSLLAEAVQ--QYDCVILDTPPLSACADAHTLSRQSDGVLIVTRP
A0A2N6K4T3      GY--PSRLLES-NAISSLLAEATR--QYDCVIIDTPPLSACADAHTLGRQSNGILLVTRP
A0A370CKT2      GR--PSHLLESXXXMKSLLIEAVR--QYDFVVIDTPPLSACADAHTLGRQSDGILLVTRP
A0A0S3TL97      GR--PSHLLES-EAMKSLLIEAVR--QYEFVVLDTPPLSACADAHTLGRQSDAILLVTRP
A0A2N6M8A0      GR--PSHLLES-EAMKSLLIEAVR--QYEFVVLDTPPLSACADAHTLGRQSDAILLVTRP
A0A2N6M9E1      GR--PSHLLES-EAMKSLLIEAVR--QYEFVVIDTPPLSVCADAHTLGRQSDGSLLVTRP
A0A2N6KJI4      GR--PSHLLES-EAMKSLLIEAVR--QYDFVVIDTPPLSACADAHTLGRQSDGILLVTRP
A0A2N6MZ77      GR--PSHLLES-EAMKSLLIEAVR--QYDFVVIDTPPLSACADAHTLGRQSDGILLVTRP
A0A2N6KT20      GR--PSHLLES-EAMKSLLIEAVR--QYDFVVIDTPPLSACADAHTLGRQSDGSLLVTRP
G6FSN3          GR--PSHLLES-EAMKSLLIEAVR--QYDFVVIDTPPLSACADAHTLGRQSDGILLVTRP
A0A4D9CI02      GR--PSHLLES-EAMRSVIIEATR--LYDFVIIDTPPLGACADGQTLGRQSGGILLVTRP
A0A328I8B9      GR--PSHLLES-EAMRSVIIEATR--LYDFVIIDTPPLSACADGQTLGRQSSGILLVTRP
A0A4Q9J4Z7      GR--PSHLLES-EAMRSVIIEATR--LYDFVIIDTPPLGACADGQTLGRQSGGILLVTRP
A0A0M0SU69      GR--PSHLLES-EVMKSLMTEATQ--RFDCVIIDTSPLSACADAQTLGRQSDGILLVTRP
A0A1Z4TIZ8      GH--LSHLLES-EVMKSLITEAIL--QYDCVIIDTPPLSACADAQTLGRQSDGILLVTRP
A0A0S3TYD7      PN--PIALLDS-ERMSFLMQVFLE--RYDYVIFDTPPLSGIADATILGKRADGLVLVSRL
U5QL42          PN--PVALLNS-EKMTELLAQWRE--NFDYVIVDTPPVVGLPDAQSIVSRVDRVVLIVAI
K9QF04          PN--PAQLLSS-SKMRDLLVQFQK--SYDLVIVDTPPLHGFADAKFLASQTNGLIMVIGL
A0A3C0N2P0      PD--PTRLLSS-KKMKNLVERFQE--AYDLVIFDTPPLMGLADAKLLATHTDGIVMVVGL
K9TLQ0          PD--PARLLSS-QRMKQLIEEFKT--SFDLVIFDTPPLGAISDAKFLAPHTDGLVMVIGM
A0A076HBF2      PD--PTRLLSS-NRMRSLVNELEASGQFDLVLFDTPPVLGLADAALVAEHCDGLMLLVSL
A0A354B169      PD--STRLLSS-NRMRDLMVDLGHCGDYDLVLFDTPPLLGLTDAVLVAENCDGLVLLVSL
G4FMX5          PD--PTRLLSS-KRMHQLVEDLGKSEEFDLILFDTPPVLGLADAALVAEHCDGLMLLVSL
Q0IDT5          PD--PTRLLSS-QRMHDLVQEITQSNDFDLVLFDTPPVLGLADASLVAEHCDGLMLLVSL
A0A2D6FCW3      PD--PARLLSS-NRLHQLVEDLENSGEFDLILFDTAPVLGLADAALVAEHCDGLVLMVSL
A3ZA21          PD--PTRLLSS-QRMHSLVQELANGGEFDLVVFDTPPVLGLADAALVAEHCDGLMLLVSL
A0A140K3H3      PN--PIALLNS-DKMKQLLQQWQE--AYDYVLVDTPPIGVVADAKSLANQVDSVLFVVGI
K9XUB8          PN--PIALLNS-DKMKQLMQQWQE--AYDYVLIDTPPIGVMADAKSLANQVDSVLFVVGM
Q7NEU3          PD--PVALLDS-LRMKELVKQWGE--RYDLVIIDSPPMIGLADATILTKCADGLVFVIGL
A0A352XE00      PD--PTRLLNS-KKMQNLVEYFQS--KFDLVIFDMPPLLGLADARLLAAYTDGILMVVGL
B4VS56          PD--PTRLLCS-QKMQHLVESFEE--MFDLVIFDTPPMLGLADARLLAAHTDGIVMVVGL
A0A352AAQ3      PD--PIRLLCS-KKMQNLVAYLQK--SFDLVIFDTPPLLGLADARVLAAHTDGIVMIVGL
A0A350Y472      PD--PTRLLCS-KKMQNLVERFHG--AFDLVIFDTPPLLGLADARLLAAHTDGIIMVVGL
A0A355DVB4      PD--PTRLLCS-KKMQNLVDRFHG--AFDLVIFDTPPLLGLADARLLAAHTDGIIMVVGL
A0A2P8VVX1      DD--PISLLSS-PRFRQLLARGKE--RYDLILVDTTPLIGMADALKVGAVCDSTVLVTRL
A0A2P8WHY0      ND--PITLLSS-PRFQKLIHRCKS--IYDVVLVDTPPLTGMADALKIGAVCDNVLLVARL
A0A2T1CMT9      ED--PVKILNS-SRLGRFIEQQKE--NYDLILVDTPPAIGMVDAIKIASICDTSLIVSRL
A0A563VQJ3      SN--PLALLDS-PEMGELIARGRK--TYDLVLIDAPPLPVTADVLTLSKMVDGILFVSRL
A0A1D8TX52      ID--PVKLLGS-KRMKNLMAEFQE--TYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRL
A0A1U7N5X9      ID--PVKLLGS-KRMKNLMAEFQQ--TYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRL
A0A1D9G4T2      ID--PVKLLGS-KRMKNLMAEFQQ--TYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRL
F4XP71          ID--PVKLLGS-KRMKNLMAEFQQ--TYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRL
A0A2P8QVH5      TD--IVKLLSS-QRMKHLIESFEQ--SYDLVLVDAPPILGLADASIVASLCSGTVVVERL
A0A2T1FT70      TD--IVKLLSS-QRMKHLIESFEQ--SYDLVLVDAPPILGLADASIVASLCSGTVVVERL
A0A433W4W4      TD--IVKLLSS-QRMKHLIESFEQ--SYDLVLVDAPPILGLADASIVASLCSGTVVVERL
K9U5W1          TD--IVKLLSS-HRMKHLIESFEQ--SYDLVLVDAPPILGLADASIVASLCSGTVVVERL
A0A2W6ZAV2      PD--ATKLLSS-ERCSALVEQIRSLPGYDVVLFDTPPSLALSDALLLSEHLDGTVFLVSL
A0A2G7GMH8      VD--PVQLLSS-SKMKEMMLAFEQ--EYDLVLLDTPPVLGRVDAIQTASFCSGAILVARI
K9W742          PD--PANLLSS-PRMGELMAEFEQ--SYDLVLVDAPPVLGLVDSILTASYCGGVLLVARM
A0A2T1DWE8      TD--PAQLLSA-ERMGDLVQALEQ--AYDLIIIDAPPVLGIVDALLTASFCSSMVLVGRI
A0A1U7I8L3      LD--PAQLLSS-QRMRELMANFEQ--SYDLVLLDAPPVLGIVDAILAASFCSGAVLVGRI
A0A2T1DJL8      SD--PVKLLSS-RRMKELMTVFEQ--SYDLVIVDVPPVLGIVDAMLAASFCDGTLLVGKV
A0A1Z4J9W0      SD--SVKLLSS-KRMRDLMTLFEQ--HYDLVILDAPPVLGIVDALLASSCSDGVLLVGRM
A0A0N7Z5K9      TD--SVKLLSS-KRMRDLMTVFEQ--HYDLVILDCPPVLGIVDALLAASFCDGTLLVGRM
A0A0S3TXC5      TD--SVKLLSS-KRMRDLMTVFEQ--HYDLVILDAPPVLGIVDALLAASFCDGALLVGRM
K9SA61          TD--PAKLLSS-RRMAELMAMFEQ--TYDLVVLDAPPVLGMVDAMLAGSFCQGVMLVGRI
A0A3D1PBA3      SD--PANLLSS-QRMRELIAEFEK--NYDLILLDAPPVLGMVDAMIAASLCTGVVLVSRV
K9XPB0          TD--PVKFLSS-PKFKQSIDQLQA--NYDLILIDTPPVLGMVDAIKISGYCGGTMIVSRL
A0A350Y7Z1      PD--PVKLLSS-QRMRQLMAGFEQ--NYDLILVDTPPILGMVDALQAASFCNGVVIVGRI
A0A352X2A7      LD--PVKLLSS-PRMKKLMASFEQ--TYSLILLDSPPILGMVDAMEVASFASGVIMVGRM
A0A0D8ZYV0      AD--PANLLSS-ERMRELMAKFED--TYDLVLVDAPPVLGMVDAILSASFCSGVVLVSRM
A0A4R4IUM6      ED--PANLLSS-QRMRELMAGFEQ--NYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRV
A0A2T1FP73      ED--PANLLSS-QRMRELMAGFEQ--NYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRV
A0A433VMS2      ED--PANLLSS-QRMRELMAGFEQ--NYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRV
K9TYA7          ED--PANLLSS-QRMRELMAGFEQ--NYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRV
A0A2P8QUE1      ED--PANLLSS-QRMRELMAGFEQ--NYDLILLDAPPLLGMVDAMIAASCCTGVVLVSRV
A0A2T1DNG3      AD--PAKLLSS-QRMKEIIATFEQ--TYDLVIVDAPPALGMVDAVLTASCCSGVLLVGRI
A0A2P8W9H0      PS--PLKILAA-PRMQEFYDKINQ--EFDFIIFDTPPLLGFADTPMIAEKTQGMLLAVHL
A0A1Z4LN32      PN--PLALIDS-ERMTSFIEMLSL--NYDYIVFDTPPLTGNAESAVLSQMVDGALVIVRP
A0A2I8A9F5      PN--PLALIDS-EAMKSLIDNLSK--KYDYIVFDTPPLLGNADAAVLSKLADGVLVVSRI
A0A218Q6R8      PN--PLALIDS-ECMTSLINRLNQ--QYDYIIFDTPPLIGTVDAAVLGKMVDGVLVVVRP
A0A218QGE0      PN--PLALIDS-ERMTSFIDMLSQ--SYDYVIFDTPPLVGTADAAVLGNMVDGVLIVVRP
B8HNB0          PN--PIALLDS-YKMVGLIDEWRQ--HYDYILVDTPPVLGVPDIQSIGCRFDGVVMLVAM
A0A563VS48      DN--PIALLDS-LSMAVLMMKLLE--NYDRIIFDTPPLVGLADAKILSKLVDGLLFVVRP
A0A318BJ18      PN--AAELLTG-QRLNILLDRLLE--RYDHVVIDSPPVMGLADAPLISSRVEGVVYAVES
A0A3B8Y8H9      PN--PSASLSC-EKFATLSRQWQE--KFDLVIFDAPPLLGLVDAKLLTAKTDGLLLVVRL
A0A2W1JVB9      PN--PSALIDS-DHMVNLLQEFGR--RYRYVIIDSPPLSAAADTLTLSRMADGLLLVVRP
A0A1Z3HMQ0      PN--PLALIDS-ERMAALVRTLAK--RYDYVLFDTPPLIGAADAAVLGRATDGVLLVLRP
A0A1E5QP61      PN--PLALIDS-KRMASLLEEFRD--NYEFIIIDTPPFLLVADALALGKMTDGLLLVTRP
A0A3M2GIL5      PN--PLALLDS-KRMAGAIEQFAQ--DYDFILIDTPPLVMAADALTVGKMSDGIVLVVRP
A0A433NM31      PN--PLAILNS-RRMASLVEVFSS--SYDFVLIDTPPLSAAADARIIGAMTDGIVMIVQP
A0A3M1PML8      PN--PVALLDS-KRMASLVEDFLK--EYDFVLFDTPPLAGIADAAVLGKMTDGMVLVVRP
A0A352X442      PN--PVAILDS-KRMANLMETFAK--GYDAVIVDTPPMAGIADAPILGKMADGILLVVRP
A0A0T7BPZ0      PN--PVALLDS-QGMESLVINFAQ--EFDCIIFDTPPLVGIADAAVLGKLADGILLVVRP
A0A0M0SHU3      PN--PVALLDS-ERMASLVANFTK--DYDCVIFDAPPLAGTADAAVLGKLADGVLLVVRP
A0A1D2PBN3      PN--PVALLDS-RRMAALVNTFVK--DYDFVIFDTPPLAGIADAAVLGKLADGILLVVRP
A0A0C2LVR7      PN--PMALLDS-RRMAALVNTFVK--DYDFVIFDTPPLAGTADAAVLGKLADGILLVVRP
A0A1Z4PQB9      PN--PVALLDS-RRMAALVNTFVS--NYDFVIFDTPPLAGIADAAVLGKLADGILLVVRP
A0A1Z4SFN6      PN--SVALLDS-QRMATLVTTFTE--EYDFVIFDTPPLSGMADAAVLSKLADGIMLVVRP
K9PGI8          PN--SIALLGS-KRMDSLVKIFAK--EYDFVIFDTPPLTGIPDAAVLGKMTDGILLVVRP
A0A563VLD6      PN--PIAILNS-PKMAQLLKEWEE--SYDYVLIDTPPIGIMADAQSIIHLVDTVLFVVGI
A0A318BG22      PN--PALLLSS--GLQSQIDALMA--DYDLVILDGPPVMGLADAPLLADVAEATVLVIEA
A0A2T1E9V8      HN--QNILLDS-RKMGAFINQCPK--QYDYVIIDTPPLAISADANILGKFADGVILVTRP
A0A3M2GQQ6      PN--PVALLES-QKMTQMLTQWRQ--AYDYVLIDTPPILGLSDSQSMVTKVDRVVLVCAI
K9SGJ5          PN--PMVLLES-TKMTKLLQLWRQ--TYDYVLIDTPPIVGITDAQCLAGKVDSVVLVAAI
L8MYT6          PN--PMLLLES-VKMTALVQEWRQ--EYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAI
A0A352JGJ6      PN--PMLLLES-TKMSALLQEWRQ--AYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAI
A0A1J5GLS2      PN--PMMLLES-TKMNALIQEWRQ--EYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAI
A0A2W4W6M5      PN--PMLLLES-AKMTALLQEWRQ--EYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAI
A0A2W7AN33      PN--PMLLLES-NKMTTLLEEWKQ--EYDYVLVDTPPIIGITDALCLTSKVDTFILVAAI
A0A256BLV2      PN--PMLLLES-NKMAALLQEWRQ--EYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAI
A0A2W6ZXF3      PN--PMLLLES-TKMSALIQEWRQ--VYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAI
A0A2Z5WX66      PN--PMLLLES-TKMTALLQEWRQ--AYDYVLVDTPPVIGITDAQCLTSKVDTFILVAAI
K9W1T3          PN--PLILIDS-SQMAVLVGQSAQ--TYDFVIIDSPPVSVAADTTILGRMANGLMFVVRP
A0A1Q4RTR1      SN--PFATLAS-PRMNALIATAQQ--EYDFVIIDTPPVIYAADALILGKLVDGTLVVVRP
A0A1Z4SQV2      SN--PFAILGS-PQMNDLMATAQQ--EYDFVIIDTPPVIYAADALVLGKLVDGALVVVRP
A0A2H2XGN1      SN--PFAILGS-PQMNDLMATAQQ--EYDFVIIDTPPVIYAADALVLGKLVDGALVVVRP
A0A433UXH8      SN--PFATLAS-PRMNALIATAQQ--EYDFVIIDTPPVIYAADALVLGKLVDGTLVVVRP
A0A1Z4RMB9      SN--PLALLDS-PMMSDFVGRSRR--DYDLILIDAPPLPVTADVLTLSKLVDGIVFVTRP
K1XF69          PN--PLALLDS-RRMTSLIRNFSE--EYDFVIIDTPPLLLAADALTLANMASGVLMVARP
B5W297          PN--PLALLDS-RRMTSLIRNFSE--EYDFVIIDTPPLLLAADALTLANMASGVLMVARP
H1W7M8          PN--PLALLDS-RRMTSLIRNFSE--EYDFVIIDTPPLLLAADALTLANMASGVLMVARP
A0A5Q4H6A5      PN--PLALLDS-RRMTSLIRNFSE--QYDFVIIDTPPLVLAADALTLASMASGVLMVARP
D5A466          PN--PLALLDS-RRMTSLIRNFSE--EYDFVIIDTPPLVL