BYKdb

Dataset for cluster tadcd of phylum cyanobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

460 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K9SLA9          --------------------------------------------------------MNKL
A0A168TT23      -------------------MSNYGIHDGRHLKPIEDQNTALAQYDPYQSKANEDDDAIDL
A0A0M1JWX9      --------------------MQTAPNSQPSSFDQNGKQPQIVPLSYLAEVPDADEEELDL
A0A2T1M1V6      -----------------------------------------------------------M
A0A2G7GCS2      -----------------------------------------------------------M
K9XBH8          -----------------------------------------------------------M
A0A1Z4LJ30      -----------------------------------------------------------M
K9RI76          -----------------------------------------------------------M
A0A352AE27      ----------------------------------------------------------ML
A0A3B8JH60      -----------------------------------------------------------M
A0A3C0N766      -----------------------------------------------------------M
K9W9J7          -----------------------------------------------------------M
A0A139WSU3      -----------------------------------------------------------M
A0A433VN22      ------------------------------------------------------------
Q7NF11          ------------------------------------------------------------
A0A1Z4JCS8      -----------------------------------------------------------M
A0A6P0PI80      -----------------------------------------------------------M
A0A6P0WGT6      -----------------------------------------------------------M
F4XTX2          -----------------------------------------------------------M
Q7NJN6          -----------------------------------------------------------M
U5QCC3          ------------------------------------------------------------
A0A3M1SVZ4      -------------------------------------------------------MESGG
A0A654SFI6      -------------------------------------MQPSIADRGNYPDTPADYREDGL
K9SSQ0          ---------------------------------------------------MKVYSSKVF
A0A2W1JIN9      -------------------------------------------------------MDQSL
A0A318AJV1      ----------------------------------MLKQTSDHRVSHLAPPQDQARLGDAV
A0A6P0IC70      -------------------------------------------------------METSL
A0A6B3MUB5      -------------------------------------------------------METSL
A0A6M0B7N4      -------------------------------------------------------METSL
A0A6P0J9W3      -------------------------------------------------------METSL
A0A6P0ZWE1      -------------------------------------------------------METSL
A0A1U7N2U4      -------------------------------------------------------METSL
A0A1D9G1F2      -------------------------------------------------------MDTSL
A0A6P0PNZ7      -------------------------------------------------------MDTSL
F4XV38          -------------------------------------------------------MDTSL
A0A6P0W137      -------------------------------------------------------MDTSL
A0A6L9Y9E2      -------------------------------------------------------MDTSL
A0A6P0SGR0      -------------------------------------------------------MDTSL
A0A6M0BK48      -------------------------------------------------------MDTSL
A0A6L9YZL1      -------------------------------------------------------MDTSL
A0A6P0KYM4      -------------------------------------------------------MDTSL
A0A6P0LSD6      -------------------------------------------------------MDTSL
A0A6P0X384      -------------------------------------------------------MEKSF
A0A2P8QIL5      -------------------------------------------------------MEQKY
A0A2T1FLY5      -------------------------------------------------------MEQKY
A0A433W447      -------------------------------------------------------MEQKY
K9U1K8          -------------------------------------------------------MEQKY
K9UYB2          -------------------------------------------------------MEKSI
A0A218QN17      -------------------------------------------------------MEKGI
K9RKN2          -------------------------------------------------------MEKGI
A0A2I8ADV2      -------------------------------------------------------MGRGI
A0A1W5CKM3      -------------------------------------------------------MGKGI
A0A5Q0GMF5      -------------------------------------------------------MGKGI
Q3MEW0          -------------------------------------------------------MGKGI
A0A1Z4KIC7      -------------------------------------------------------MGKGI
Q8YSM5          -------------------------------------------------------MGKGI
A0A1Q4S1H4      -------------------------------------------------------MEKGV
A0A433VBU6      -------------------------------------------------------MEKGV
A0A1Q4RZJ6      -------------------------------------------------------MEKGF
A0A1Z4SNV3      -------------------------------------------------------MEKGF
A0A2H2XJQ1      -------------------------------------------------------MEKGF
A0A3S5K358      -------------------------------------------------------MEKGF
A0A0T7BPJ4      -------------------------------------------------------MAKGI
A0A0C1QS61      -------------------------------------------------------MEKSV
A0A139X3R8      -------------------------------------------------------MEKSV
A0A1Z4I7C5      -------------------------------------------------------MGKGI
A0A0C2MDK7      -------------------------------------------------------MEKGI
A0A1Y0RCK1      -------------------------------------------------------MEKRI
A0A1Z4PWZ0      -------------------------------------------------------MEKGI
A0A0C2QLT0      -------------------------------------------------------MEKGI
A0A1Z4J2K1      -------------------------------------------------------MEKGI
A0A3S0ZSX0      -------------------------------------------------------MEKGF
A0A2N6K4T3      -------------------------------------------------------MEKGL
A0A370CKT2      -------------------------------------------------------MEKGL
A0A0S3TL97      -------------------------------------------------------MEKGL
A0A2N6M8A0      -------------------------------------------------------MEKGL
A0A2N6M9E1      -------------------------------------------------------MEKGL
A0A2N6KJI4      -------------------------------------------------------MEKGL
A0A2N6MZ77      -------------------------------------------------------MEKGL
A0A2N6KT20      -------------------------------------------------------MEKGL
G6FSN3          -------------------------------------------------------MEKGL
A0A4D9CI02      -------------------------------------------------------MEKGL
A0A328I8B9      ------------------------------------------------------------
A0A4Q9J4Z7      -------------------------------------------------------MEKGL
A0A0M0SU69      -------------------------------------------------------MEKGL
A0A1Z4TIZ8      -------------------------------------------------------MEKGL
A0A0S3TYD7      ----------------------------------------MKQPQNPSQTPASDAIELDL
A0A2T1DNG3      ------------------------------------------MTAAQPKLNLSAATDPGY
A0A3S0Y9N9      --------------------------------------------------------MEEY
A0A433UNK7      --------------------------------------------------------MEEY
A0A6P0ZKB8      --------------------------------------------------------MEEY
U5QL42          -------------------------------------------MVNPQASLGPPSDNFNL
A0A076HBF2      ----------------MSNLVAAPGQSPDFDARNVQTVRVHEVGT---NEPIGTEDEIDL
A0A354B169      ------------------------------------------------MGAMGVAEEIDL
G4FMX5          ----------------MSNLSAQP--NPQAVDGLLQ---------------VDGSDEIDL
Q0IDT5          ----------------MSNLIARPGQSPDLVPQTIQDVQVRDLGLNLSNLKAEASDEIDL
A0A2D6FCW3      ----------------MSNLIVNPXQTPDFNRHQAQTVNVQDLGRXVVQA-ADNNDEIDX
A3ZA21          ----------------MSNLIPRAGHSPNLAVQGIQTVQVRDLGTSVAAGPAAADDEIDL
A0A140K3H3      ------------------------------------MNNQLVNPNSLYLPTPETESAFSL
K9XUB8          ------------------------------------MNNQLVNSNTLYLPTPETESTFSL
A0A6H2NHD5      ----------MVFPKTSSPSPAQPSANGNGH------HHNGYLPAPPAPVVVEADDDFDL
A0A2P8W4F7      ------------MPFPPSSTPRETNGHSNGHGNGHGSGRPEFVPMMAPPSLVEKGDDVDL
A0A5Q4E0Z4      ------------MPFSSTPTSEETNGNGNGH------AKHSFVPVSAPSAIVDDSDDFDL
A0A2P8VVX1      -------------------------------------------MVSTSTLPTSTDQEFGY
A0A2P8WHY0      -------------------------------------------MTHAAYQPIPDEPEFGY
A0A2T1CMT9      --------------------------------------------MDQNNWETETQGDLGY
A0A563VQJ3      ----------------------------MTNNGFNYYPPKELESNYYNLPKSRENLDLDL
A0A1D8TX52      --------------------------------------------MKELDLNAAAETDAGY
A0A1D9G4T2      --------------------------------------------MKELDLNAAGETDAGY
A0A6P0PR27      --------------------------------------------MKELDLNAAGETDAGY
A0A6P0WER7      --------------------------------------------MKELDLNAAGETDAGY
F4XP71          --------------------------------------------MKELDLNAAGETDAGY
A0A6L9YR57      --------------------------------------------MKELDLNAAAETDAGY
A0A6P0KZ31      --------------------------------------------MKELDLNAAGETDAGY
A0A6P0LPB8      --------------------------------------------MKELDLNAAGETDAGY
A0A6P0SEV1      --------------------------------------------MKELDLNGAAETDAGY
A0A6B3N2I8      --------------------------------------------MKELDLNGAAETDAGY
A0A6M0B891      --------------------------------------------MKELDLNGAAETDAGY
A0A6P0IJQ1      --------------------------------------------MKELDLNGAAETDAGY
A0A6P0J8J8      --------------------------------------------MKELDLNGAAETDAGY
A0A6P0ZSH6      --------------------------------------------MKELDLNGAAETDAGY
A0A1U7N5X9      --------------------------------------------MKELDLNAAAETDAGY
A0A6L9Z1V0      --------------------------------------------MKELDLNGAAETDAGY
A0A6P0LC12      --------------------------------------------MKELDLNAAAETDAGY
A0A6P0MVJ3      --------------------------------------------MKELDLNAAAETDAGY
A0A2W6ZAV2      ------------MPDPLPSPDELLPPGTLVTLGASSGQVVLIPQEAETQPAPGGSEELKL
K9W742          --------------------------------------------MTQSNLNTVPDTDPGY
A0A3D1PBA3      ----------------------------------------MARVNEHNLPI-NTETDGGY
K9XPB0          ----------------------------------------MKQIEWE-----ENSSDLGY
A0A350Y7Z1      -------------------------------------------MIQSNLP--GDETNLGY
A0A352X2A7      -------------------------------------------MTQSNLP--ETESDFGY
A0A0D8ZYV0      ----------------------------------------MVRGIENN-PNVANETEPGY
A0A2T1FP73      ----------------------------------------MVRVNESNMPMTVEESDGGY
A0A433VMS2      ----------------------------------------MVRVNESNMPMTVEESDGGY
K9TYA7          ----------------------------------------MVRVNESNMPMTVEESDGGY
A0A2P8QUE1      ----------------------------------------MVRVNESNMPMTVEESDGGY
K9SA61          ---------------------------MALVPHTPGNFAPHRSPVTDPRWTDSGDSDGGY
A0A2G7GMH8      --------------------------------------------MNKDNFAMATEQEAGY
A0A6N8FU92      --------------------------------------------MNKENLAMNGEQETGY
A0A2T1DWE8      -----------------------------------------MVVVTVGNLANTVETDPGY
A0A1U7I8L3      --------------------------------------MVNVNTNNLNPAA---ETEAGY
A0A2T1DJL8      MPSVASQKASFSSRSIASFRRFVWHRSDELSFAKGVPIVAESHLNLIAAA----DPDPGY
A0A1Z4J9W0      --------------------------------------MAQSNITLFNASPHAQEPDPGY
A0A0N7Z5K9      --------------------------------------MAQGNITLFNPSPPAQEPDPGY
A0A0S3TXC5      ------------------------------------MIVAQGNITLFNPSSPMQEPDPGY
B8HNB0          ----------------------------------MVQFNAERWLQNQQLLNELYFSASDK
A0A563VS48      --------------------------------------------MNTIEQNVHIDEYLDF
A0A318BJ18      ---------------------------MSFISSNLGSPGAIGSAQSAIASPTIADGPSVL
A0A3B8Y8H9      ----------------------MTDLPNNSLAVNSPQPQVNQTIQSQLREQNEEDISLSV
A0A2W1JVB9      ----------------------------------------------MPAEYQLEEEVIDL
A0A6H1U102      ----------------------------------------MPDRFAGLDRMTLPDDNNDL
A0A7C3ZEJ3      ----------------------------------------------------MPERGTDL
A0A563VLD6      --------------------------------------MNNPINNPEFVQLPSQETGFSL
A0A2P8W9H0      -----------------------------------MASELQLSSKGALHPEGDQEGGLRL
A0A6I5P386      ------------------------------------MIAKRLPTVGIPLDERDREGGLRI
A0A318BG22      --------------------MIRSLTNDTRPGPIDDLQSRRGAMRPAAEVEQWDGGSISL
A0A2T1E9V8      ---------------------------------------------------MEAPENIQF
A0A1Z4LN32      ------------------------------------------------MENQNLSEEIDV
A0A2I8A9F5      ------------------------------------------------METQNSAEDIDI
A0A218Q6R8      ------------------------------------------------METKNYPDEIDI
A0A218QGE0      ------------------------------------------------MDTKNYPEEIDV
A0A3M2GQQ6      -----------------------------------------MQNAIAINPIQDYKNDTDF
A0A6H1U2X0      -----------------------------------------MQNAIAINPIQDYKNDTDF
K9TLQ0          ------------------MDIDGNSPPFFQQLNGPFPSGQTPLPSTILPPLNDDADALNL
K9QF04          ----------------------------------MTQNVENLTLFKPQALPKPQSDPWEL
K9W1T3          --------------------------------------------------------MDEF
K9SGJ5          -------------------------------------------MPEYSLNPGQPEESIDL
A0A6N2JS94      ----------------------------------------MTEYPKATYVGKYVDDSFKL
A0A6C2DSN4      ----------------------------------------MTAYPKATYVGKYVDDSFKL
L8MYT6          ----------------------------------------MTAYPKATYVGKYVDDSFKL
A0A352JGJ6      ----------------------------------------MTEYPKATYAGKYVDDSFKL
A0A1J5GLS2      ----------------------------------------MTEYPKANYVGKYVDDSFKL
A0A2W4W6M5      ----------------------------------------MSEYPKAISTGKYVDDSFKL
A0A2W7AN33      ----------------------------------------MPAYPKATYVGKYVDNSFKF
A0A256BLV2      ----------------------------------------MTEYPKATYVGKYVDDSFKL
A0A2W6ZXF3      ----------------------------------------MTEYPKANYVGRYVDDSFKL
A0A2Z5WX66      ----------------------------------------MTEYPKANYAGKYIDDSFKL
K1XF69          ------------------------------------------MVMDFSNIEHRESIDLDL
B5W297          --------------------------------------------MDFSNIEHRESIDLDL
A0A6H2AL05      ------------------------------------------MVMDFSNIEHRESIDLDL
H1W7M8          ------------------------------------------MVMDFSNIEHRESIDLDL
A0A5Q4H6A5      ------------------------------------------MVMDFSNIEHRESIDLDL
D5A466          --------------------------------------------MDFSNIEHRESIDLDL
U5QJM6          ------------------------------------------------------------
A0A1Z4RPC6      --------------------------------------MTNLQTTNSLSSNHREELDINI
A0A2T1CMZ0      --------------------------------------MTNLQRNNVYNPNRRAEFDINI
L8M4F7          ---------------------------MFKIPNNNSAYSSQTEGEANASINSRDSIDLDI
A0A140K2P2      -----------------------------MTNNYPANNSNNYNYPSETLSASREAIDVNI
K9XWX4          -----------------------------MTNNYPANNSNNYNYPSEVSSASREAIDVNI
A0A140KB14      ----------------------MSNFTGMSNGQTPENLSLNNSY-----TASRESIDVNL
K9XX88          ----------------------MSNFTGMSNGQTPENLSLNNSY-----TASRENIDVNL
A0A563VSV6      ---------------------------MVNSLTNNGGSQPDNSYPNYGLEESRESTDIEI
L8LZE9          -------------------------MYPVNNSSSNG------SYTQGNYPESKEKFEVEI
A0A433NM31      ------------------------------------------------MQSNKQEEYIDL
A0A1Z4NDS1      ---------------------------------------------MDSVTSTTNVEEIDL
U9VXM0          ---------------------------------------------MASQENSVKEVEIDL
A0A6M0RI13      ---------------------------------------------MASQDNSVKEIEIDL
A0A6M0S1N5      ---------------------------------------------MASQDNSVKEIEIDL
K9F4D9          ---------------------------------------------MASQDNSVKEIEIDL
A0A6I5QPI5      --------------------------------------MVAQQANGETRTYTEYIEELDF
A0A1Z3HMQ0      ---------------------------------------------MDGKTYQDYVEEIDL
A0A433W533      -------------------------------------------MQERLIETSENL-DLDF
A0A2P8QWJ3      -------------------------------------------MQERLIETSENL-DLDF
A0A2T1FKP8      -------------------------------------------MQEQLIETSENL-DLDF
K9U6L7          -------------------------------------------MQEQLIETSENL-DLDF
A0A1E5QP61      ------------------------------------------------MDSTDYTEGIDF
U5DPF5          -------------------------------------------MEAIDRNLRQDDDFLDL
A0A6P0X488      ------------------------------------------------MESQQHIEDIDF
A0A6P0UVD5      ------------------------------------------------MESQQHIQDIDF
A0A6P0VDM0      ------------------------------------------------MESQQHIQDIDF
A0A6M0G142      ------------------------------------------------MESQQHVEDIDF
A0A6P0MR53      ------------------------------------------------MESQQHVEDIDF
A0A3M2GIL5      ------------------------------------------------MENQIYTEDIDF
A0A6H1TSJ9      ------------------------------------------------MENQIYTEDIDF
A0A3M1PML8      ----------------------------------------------MSLVSQDYSEEIDF
A0A6M8BE85      ----------------------------------------------MSLASQDYYEEIDF
A0A0T7BPZ0      ------------------------------------------------MSNPEHIEEIDL
A0A352X442      ------------------------------------------------MESTEYIEEIDF
A0A6B3NF44      ------------------------------------------------MEALEYSEEIDF
A0A6M0EPL4      ------------------------------------------------MEALEYSEEIDF
A0A6P0K6L6      ------------------------------------------------MEALEYSEEIDF
A0A6P0MRR9      ------------------------------------------------MESVGFSEELDF
A0A6P0UX57      ------------------------------------------------MESVGFSEELDF
A0A6P0X1X4      ------------------------------------------------MESVGFSEELDF
A0A0M0SHU3      ----------------------------------------------MKESEFKEVEEIDF
A0A1D2PBN3      ------------------------------------------------MESKPNFEEIDF
A0A0C2LVR7      ------------------------------------------------MESKPNFEEIDF
A0A1Z4PQB9      ------------------------------------------------MESKPNFEEIDF
A0A1Z4SFN6      ------------------------------------------------MESKQNLEEVDF
K9PGI8          ------------------------------------------------MESIPKFEEIDF
Q7NEU3          ----------------MTKQPFADPVDK--------------------PAQVVEESSFDW
A0A3C0N2P0      ----------------MGPDGDYQPLLPNGNGKQLSQLSTLNAA----EFSVLNEDKFDL
A0A6P0JR04      ----------------MVSNLNSQPPFSGGSGHSPLAKSGVSESLPPPNLAKSEEDTLNL
A0A6B3M6M6      ----------------MGSDANFQPLLPNSNTQVLLPT-SALSG----GISGIDEDQLDL
A0A6P0KD09      ----------------MGSDANFQPLLPNSNTQVLLPT-SVLSG----GISAIDEDKLDL
A0A6B3NIJ0      ----------------MGSDANFQPLLPNSNTQVLLPT-SVLSG----GISAIDEDKLDL
A0A6M0F053      ----------------MGSDANFQPLLPNSNTQVLLPT-SVLSG----GISAIDEDKLDL
A0A6P2ATU9      ------------MVSNLNPQPHLPPRPPGPIPPSSQNTGDPFVT----LQGNSDEDSFNF
A0A352XE00      ----------------MNLNGDGKVLSINGNAQQSLEVPGINSK----NVADIPNHQVDM
A0A6P0QC14      ----------------MGPDGDYQPMPPYGNGNQAPHLYSPYTT----GLSEFDEDKFDL
B4VS56          ----------------MGSNGEYQPLPPNRNGHLPSELSSLSLY----ELVETEDDKLDL
A0A352AAQ3      ----------------MALTGDYQPLLPTSNGKQLSELMPIYTN----GFSEIQEDKLDL
A0A350Y472      ----------------MGPKVDYQPLLVNANDKPSSVSPPIYPS----GFSLVEEEKLDL
A0A355DVB4      ----------------MGPKVDYQPLLVNANDKPSSVSPPIYPS----GFSLVEEEKLDL
A0A1Z4RMB9      ------------------------MLSNNSNEQNTNSAYPSIA-----PKRDSLD--VNF
A0A318B4H2      --------------MNTNLTYEEAPFDPSAASVVTPVAVDKPA-----GQRLDERAVSAL
B4WQE3          -------------------------------MSSANPPVLRDI-----IQEPDQEGGLRL
A0A2K3BR24      ------------------------------------------M-----PTTTDQEDYIDL
K9YXY1          ----------------------------MDHQEQLPASSVNPI-----PTTTDQEDYIDL
A0A0V7ZFJ4      ------------------------------------MTHNSFD-----FNQEDDD-FIDL
A0A0V7ZNJ9      -------------------------------------MTSSPQ-----VEREDTD-YIDL
A0A367RIS1      -----------------------------------------MP-----SHQDDQD-LINF
A0A235IXQ2      -----------------------------------------ML-----SDQNNQD-LINF
A0A1W5CNX3      -----------------------------------------MP-----SHQDDQD-LINF
A0A5Q0GJJ5      -----------------------------------------MP-----SHQDDQD-LINF
Q3MEB7          -----------------------------------------MP-----SHQDDQD-LINF
A0A1Z4KHN9      -----------------------------------------MP-----SQQDDQD-LINF
Q8YT70          -----------------------------------------MP-----SQQDDQD-LINF
A0A166IWU6      -----------------------------------------MP-----SYQEDQD-EIDL
A0A2S0Q8C0      -----------------------------------------MP-----SYQEDQD-EIDL
W6FSX4          -----------------------------------------MP-----SYQEDQD-EIDL
A0A218Q4C1      -----------------------------------------MP-----SYQEDQD-EINL
A0A6P1ZT04      -----------------------------------------MP-----SYQEEQD-EINL
A0A0R0M9H9      -----------------------------------------MA-----INQEETD-VIDL
A0A1S1ZVW2      -----------------------------------------MP-----INQETTD-VIDL
A0A1B7WX82      -----------------------------------------MS-----INQEDQDSSIDI
A0A1B7WTD1      -----------------------------------------MS-----INQEDQD-SIDI
A0A480ABC0      -----------------------------------------MS-----INQEDQD-SIDI
A0A1Z4LRU5      -------------------------------------MTNEMQ-----VNQEEQD-YIDL
A0A1Z4JVB4      -----------------------------------------MP-----TKQEDRD-SIDF
K9PIA4          -----------------------------------------MP-----TKQEDRD-TIDL
A0A1Z4HVE1      -----------------------------------------MP-----TKQEERE-VIDV
A0A252ECZ1      -----------------------------------------MP-----TKRDDRD-LIDF
A0A1Z4G5Y1      -----------------------------------------MP-----TKRDDRD-LIDF
A0A252DNA2      -----------------------------------------MP-----TKRDDRD-LIDF
A0A252E1Q4      -----------------------------------------MP-----TKRDDRD-LIDF
A0A6G9SK36      -----------------------------------------MP-----TKQEERD-VIDV
A0A1Z4M597      -----------------------------------------MP-----TKQEERE-VIDV
A0A1Z4MWT1      -----------------------------------------MP-----TKQEERE-VIDV
A0A1Z4TX53      -----------------------------------------MP-----TKQEERE-VIDV
A0A5P8VSD1      -----------------------------------------MP-----SHQDEQDL-INF
A0A2A2TNQ5      -----------------------------------------MP-----SHEEDTDY-INL
A0A3S1C4K5      -----------------------------------------MP-----SNQEDQNE-VDF
A0A1X4G3D5      --------------------------------------MPINQ-----VNQEESDV-IDL
D4TNI2          --------------------------------------MPINQ-----VNQEESDV-IDL
A0A1Z4H6Z8      ------------MNVIGAIILFVGTEGSDSPNYIWYFGTLFMP-----TKQDDRDL-IDF
A0A1Z4NPM1      -----------------------------------------MA-----SEYEEQDY-IDI
A0A3F3KPR9      ------------------------MLIFCVMVEPVIATGVYMP-----INKKETDV-IDL
D4TGN7          ------------------------MLIFCVMVEPVIATGVYMP-----INKKETDV-IDL
A0A1Z4UZW9      -----------------------------------------MS-----INQEDQDSSIDI
A0A0K2M5H0      -----------------------------------------MS-----INQEDQDSPIDI
A0A1B7VSH4      -----------------------------------------MS-----INQETQDSSVDI
A0A1B7W126      -----------------------------------------MS-----INQETQDSSVDI
A0A3D4C6Q6      -----------------------------------------MS-----INQETQDSSVDI
A0A1B7UVJ4      -----------------------------------------MS-----INQEDQDSSIDI
A0A1B7UTR1      -----------------------------------------MS-----INQEDQDSSLDI
K7W0A4          -----------------------------------------MS-----INQEDQDSSFDI
A0A5C0DRW9      -----------------------------------------MS-----INQEDQDSSFDI
A0A6H2C088      -----------------------------------------MS-----INQEDQDSSLDI
A0A1Q4RTR1      ------------------------------------------M-----SALNTENDSINF
A0A1Z4SQV2      ------------------------------------------------MQVNAENDSINF
A0A2H2XGN1      ------------------------------------------------MQVNAENDSINF
A0A433UXH8      ------------------------------------------------MAVNTENDSINF
A0A1U7HGH0      ------------------------------------------M-----EVTE-----LDL
K9XJD3          ------------------------------------------M-----EVTE-----LDL
K9SX01          ------------------------------------------------MNQSPAEDKNPL
A0A4P7ZT55      -------------------------------------------------MPAVPDGEINL
A0A1E5QIR9      ------------------------------------------------MTHLEDSDAIDL
A0A1Z4IBC7      ----------------------------------------MTM-----ESLRSIEE-VDI
A0A1W5CPC7      ----------------------------------------MTM-----DSLQGFEE-VDI
A0A5Q0GKD1      ----------------------------------------MTM-----DSLQGFEE-VDI
Q3MDC6          ----------------------------------------MTM-----DSLQGFEE-VDI
A0A1Z4KM73      ----------------------------------------MTM-----DSLQGFEE-VDI
Q8YNX7          ----------------------------------------MTM-----DSLQGFEE-VDI
A0A367R4K6      ----------------------------------------MTM-----ESLPNVEE-VNI
A0A1E2WSV8      ----------------------------------------MTM-----ESLPNFEE-VNI
A0A2R5FRT9      ----------------------------------------MTM-----ESLPHVEE-VNI
A0A2K8T1B6      ----------------------------------------MTM-----ESLPQFEE-VNI
A0A235I9I0      ----------------------------------------MTM-----ESLPNFEE-VNI
A0A2D0HQT8      ----------------------------------------MTM-----ESLPNFEE-VNI
A0A2L2NU95      ----------------------------------------MTM-----ESLPSFEE-VNI
A0A367S084      ----------------------------------------MTM-----ESLPNFEE-VNI
A0A6P1A9A0      ---------------MISNRNSQSISPNWNGKQLPPQLPPTIS-----GLAKEEEESFNP
A0A1Z4SMD6      ------------------------------------------------MNQGFI-EEIDV
A0A2H2Y096      ------------------------------------------------MNQGFI-EEIDV
K9S8M8          ------------------------------------------M-----EFQHYP-EEIDF
A0A1Z4NFV0      ------------------------------------------M-----ENPSYL-EEIDV
A0A3M9ZEU1      ------------------------------------------M-----HPKDHL-EEVDL
A0A1Z4JK72      -------------------------------------MTSMKM-----ETKQYS-EDFDL
A0A0N7Z489      -------------------------------------MTSMNI-----ETKRYS-EDFDL
A0A0S3TXS2      -------------------------------------MTSMNI-----ETKRYS-EDFDL
A0A2A2TPF8      ------------------------------------------M-----EKQSNS-DDLDL
A0A1Z4R0P8      ------------------------------------------M-----EKQSYP-DELDL
A0A0T7BUI3      ------------------------------------------M-----EKQKAL-EELDI
A0A1Z4LP32      ------------------------------------------M-----QNKKNN-QEVDI
K9REP9          ------------------------------------------M-----KNKNNA-QEIDI
A0A1Z4SIJ3      ------------------------------------------M-----ENEGYPLQEAEI
A0A2H2XPG4      ------------------------------------------M-----ENEGYPLQEAEI
K9V3C7          ---------------------------------MLINQEKPDM-----KPQHYT-EEIDL
A0A1Z4T6Y7      -----------------------------------------ME-----QQNNRS-EDIDI
A0A2H2Y561      -----------------------------------------ME-----QQNNRS-EDIDI
A0A1Q4S362      -----------------------------------------ME-----QQHNRS-EDIDI
A0A3S1CIN8      -----------------------------------------ME-----QQHNRS-EDIDI
A0A2A2TC28      ------------------------------------------M-----ETKGYL-EEIDI
A0A0C1NCB0      -----------------------------------------ME-----ETKGHQ-EEIDI
A0A2N6K7Q9      ------------------------------------------M-----ETNSYT-QEAEI
A0A2N6MXH6      ------------------------------------------M-----ETNSYT-QATEI
A0A2N6M5A8      ------------------------------------------M-----ENNSYT-QATEI
A0A2N6LL61      ------------------------------------------M-----ETNSYT-QATEI
A0A0S3TP66      ------------------------------------------M-----ETNSYT-QATEI
G6FP91          ------------------------------------------M-----ENNSYT-QATEI
A0A1U7GYR5      ------------------------------------------M-----ETNSYT-QATEI
A0A2N6KY52      ------------------------------------------M-----ETNSYT-QATEI
A0A2N6KMP5      ------------------------------------------M-----ETNSYT-QATEI
A0A2N6MA45      ------------------------------------------M-----ETNSYT-QATEI
A0A4Q9J9V9      ------------------------------------------M-----ETNSYT-QETEI
A0A328IGA1      ------------------------------------------M-----ETNSYT-QETEI
A0A4D9CE41      ------------------------------------------M-----ETNSYT-QETEI
A0A0M0SFT2      ------------------------------------------M-----ETNNYT-QETEI
A0A1Z4TLC8      ------------------------------------------M-----ETNSYT-QETEI
A0A0C2LFH0      ------------------------------------------M-----ETRGYQ-EEVEI
A0A1Z4IYV4      ------------------------------------------M-----ETKGYQ-EEVDI
A0A1Z4Q0T6      ------------------------------------------M-----ETKGYQ-EEIDI
A0A0C2PT44      ------------------------------------------M-----ETKGYQ-EEIDI
A0A1D2P6J4      ------------------------------------------M-----ETKGYQ-EEVDI
B4WP72          ------------------------------------------M-----RDKEYTEE-IDL
A0A2T1CIL7      ---------------------------------------MIPT-----IVPSTHEEQIDF
A0A433V7A0      ---------------------------------MKYPKHTTTI-----DSREPEE--IDF
A0A2T1FTR8      --------------------------------------------------------MDEI
K9UA41          --------------------------------------------------------MDEI
A0A0C2LBE2      ---------------------------------------MSAM-----EPVPNSEE-IDF
A0A433NN38      ---------------------------------------MDSI-----KHTHSLEE-IDF
A0A2N6K0T2      -----------------------------------------MK-----ESEFHVEE-IDF
A0A2N6ML72      -----------------------------------------MK-----ESEFHVEE-IDF
G6FQZ6          -----------------------------------------MK-----ESEFHVEE-IDF
A0A2N6MQX9      -----------------------------------------MK-----ESEFHVEE-IDF
A0A2N6KXT6      -----------------------------------------MK-----ESEFHVEE-IDF
A0A2N6KGB9      -----------------------------------------MK-----ESEFHVEE-IDF
A0A2N6L3Y5      -----------------------------------------MK-----ESEFHVEE-IDF
A0A0S3TIS7      -----------------------------------------MK-----ESEFHVEE-IDF
A0A1U7GW28      -----------------------------------------MK-----ESEFHVEE-IDF
A0A2N6LW63      -----------------------------------------MK-----ESEFHVEE-IDF
A0A328IH74      -----------------------------------------MK-----ESEFKVEE-IDF
A0A4D9CIB0      -----------------------------------------MK-----ESEFKVEE-IDF
A0A1Z4TQ63      -----------------------------------------MK-----ESEYQLEE-IDV
A0A4Q9J8G2      -----------------------------------------MK-----ESEYQLEE-IDV
A0A350Y0P6      ------------------------------------------M-----ESKQYVED-IDF
A0A352X940      ------------------------------------------M-----ESKQYVED-IDF
B8HTN4          ------------------------------------------M-----QALEDDR--IDL
A0A6P1AFJ5      -----------------MVASGNPAPLIPNFSNYQPLPQYQPL-----TWQGNTEESFDL
B0CAX4          -----------------------------------------MP-----MSNEYSHESIDV
A0A1Z4RN12      ------------------------------------------M-----DSNLHLEEYIDF
A0A2T1CMF9      ------------------------------------------M-----DSNLPIGEHIDF
Q7NDC5          ---------------------------------------------------------MGL
U5QGK3          ---------------------------------------------------------MGL
A0A2W4UY24      ------------------------------------------------MPQKELE--IDF
A0A0D8ZUV2      --------------------------------------------------MEFID--ADI
A0A433VDI0      -----------------------------------MEPTKPIV-----EYSESIN--IDF
A0A3D1PG43      ------------------------------------------M-----ESREAID--INL
A0A2P8QQ72      --------------------------------------MESRV-----ESREAVD--INL
K9TZQ7          --------------------------------------MESRV-----ESREAVD--INL
A0A6N8G584      ------------------------------------------M-----ESNETID--IDL
A0A2G7GPR0      ------------------------------------------M-----ESNETID--IDL
K9XH68          ------------------------------------------M-----ESNETID--IDP
A0A1U7HW70      ------------------------------------------M-----QSNDTID--IDL
A0A2S6VEJ8      ------------------------------------------M-----ESNETID--IDL
A0A140KBA0      ------------------------------------------M-----ESNLYIDEYLDF
K9XSG1          ------------------------------------------M-----ESNLYTDEYLNF
A0A2T1GMT4      ------------------------------------------M-----ESQESID--LNL
K9UI51          ------------------------------------------M-----ESQESID--LNL
K9QM62          -------------------------------MKAKTLEVDSTI-----KSREAID--LDF
A0A1Z4FWI3      ------------------------------------------M-----ESRESID--LDF
A0A1Z4JYE7      ------------------------------------------M-----ESRESID--LDL
A0A2T1FXY4      ------------------------------------------M-----ESRESID--LDL
K9TYI2          ------------------------------------------M-----ESRESID--LNL
A0A1Z4QL41      ------------------------------------------M-----ESREAVD--LDF
A0A252D4T4      ------------------------------------------M-----ESRESID--FDL
A0A252DJH5      ------------------------------------------M-----ESRESID--FDL
A0A252EB80      ------------------------------------------M-----ESRESID--FDL
A0A6G9SKZ9      ------------------------------------------M-----ESRESID--FDF
A0A1Z4HPW5      ------------------------------------------M-----ESRESID--FDF
A0A1Z4MSN1      ------------------------------------------M-----ESRESID--FDL
A0A1Z4U1C2      ------------------------------------------M-----ESRESID--FDL
A0A0D6KV51      ------------------------------------------------------------
A0A1Z4MKF8      ------------------------------------------M-----ESRESID--FDL
A0A2C6WC43      ------------------------------------------M-----ESRETLD--LDL
A0A1Z4L5A1      ------------------------------------------M-----ESRETID--LDL
A0A367QD86      ------------------------------------------M-----ESRETID--LDL
A0A235IZ96      ------------------------------------------M-----ESRESID--LDL
A0A2L2NGP0      ------------------------------------------M-----ESRESID--LDL
A0A2K8SM78      ------------------------------------------------------------
A0A2R5FPC0      ------------------------------------------M-----ESRESID--LDL
A0A5P8W5T6      ------------------------------------------M-----ESRESID--LDL
A0A0F5YE28      ------------------------------------------M-----EDRESID--LDI
U7QEH7          ------------------------------------------M-----EDRESID--LDI
A0A3S1ATK5      -------------------------------------MSKTPM-----ESREDID--LDL
A0A2Z6CPH0      -------------------------------------MAKNIM-----ESRESLD--LDF
A0A1Z4GT50      ------------------------------------------M-----ESRESID--LDL
A0A1Z4GIX0      -------------------------------------MSKNSM-----ESRETID--LDI
A0A2H6LC24      -------------------------------------MSKNSM-----ESRETID--LDI
B2J6N5          -------------------------------------MSAKST-----ESRESID--LDL
A0A367RMI4      -------------------------------------MSEKSM-----ESRESID--LDL
A0A235HUM0      -------------------------------------MSEKSM-----ESRESID--LDL
A0A2L2NW47      -------------------------------------MSEKSM-----ESRESID--LDL
A0A1E2WUR1      -------------------------------------MSEKSM-----ESRESID--LDL
A0A235IKU3      -------------------------------------MSEKSM-----ESRESID--LDL
A0A1U7MYU6      ------------------------------------------M-----ESRSSID--LDI
A0A1D8TNX9      ------------------------------------------M-----ESRSSID--LDI
A0A6P0L6C2      ------------------------------------------M-----ESRSSID--LDL
A0A6P0MVH0      ------------------------------------------M-----ESRSSID--LDI
A0A6P0KJV0      ------------------------------------------M-----ESRSSID--LDL
A0A6L9ZJG4      ------------------------------------------M-----ESRSSID--IDI
F4XKF3          --------------MAGLVANSHQYQKLFYCAIYLGGAPEELM-----ESRSSID--LDL
A0A1D9FX10      ------------------------------------------M-----ESRSSID--LDL
A0A6P0Q0T0      ------------------------------------------M-----ESRSSID--LDL
A0A6P0W5I0      ------------------------------------------M-----ESRSSID--LDL
A0A3C0NJ41      ------------------------------------------M-----ESRESLD--LDF
A0A352AG88      ------------------------------------------M-----DSAESLD--LDL
A0A350Y374      ------------------------------------------M-----QSTDSPD--LDF
A0A355DPX0      ------------------------------------------M-----QSTDSPD--LDF
                                                                            

K9SLA9          NRGWV------ALRQH---KFPALVAFGIIFGGAALVTV--RI----Q---PIYEAKGQV
A0A168TT23      LEIWR------TILKRKWVVVSILAVFIATAALSSWLTI------------PVYRATAVV
A0A0M1JWX9      GQLFA------VIRRR---AFVILGVAIAVTGAVWVWTD--NQ----T---PQYEGKFQL
A0A2T1M1V6      NHALS------VVRRH---WPPLLALNLLLIAATVYVIT--NIEKFVS---PTWKANAQL
A0A2G7GCS2      NHIVN------IIRRH---WMPLLLLNGVILAGTLYAVI--YTKTNVA---PVWKASAKL
K9XBH8          NHIVN------IIRRH---WMPLLLLNGVVLAATLYAVI--YSKTSVP---PVWKANAEL
A0A1Z4LJ30      NRIAK------IAIRH---WKLLLAWNILILGITAINIK--VA----P---RVWSSQAQL
K9RI76          SRIAT------IAIRH---WKLLLAWNILLIGITAINIK--LT----P---RVWEGKAQL
A0A352AE27      ARIAT------ITARH---WKFLLALNVLVLAAAASNYV--TS----P---KVWTAKAQL
A0A3B8JH60      GKIAA------IASRH---WKSLLVLNLLVLAATAGKLA--TS----P---KVWTANAQL
A0A3C0N766      GKIAA------IASRH---WKSLLVLNLLVLAATAGKLA--TS----P---KVWTANAQL
K9W9J7          GKVAA------IATRH---WKSLFILNLLVIAATAGKLA--TS----P---KVWTATAQL
A0A139WSU3      NKLVT------ISTKH---WKSLIAFNVLVVLATAVAVS--NA----K---PVWIAKTQL
A0A433VN22      ---MT------IAARH---WKSLLVLNALVVSATIAAYS--TS----K---PVWTTTAQL
Q7NF11          MHVIQ------VLKRH---WRPLLVLNGLVLAATIGVAC--YY----P---RTWTATTRI
A0A1Z4JCS8      KKIAL------IASRH---WKALLGLNAVVIFGTLGAML--TT----P---KVWTAQAQL
A0A6P0PI80      KKVVA------ILNRH---WILLLVFNSLVLAASFGAFS--LL----K---PFWIAKAQL
A0A6P0WGT6      KKVVA------ILNRH---WILLLVFNSLVLAASFGAFS--LL----K---PFWIAKAQL
F4XTX2          KKVVA------ILNRH---WILLLVFNSLVLAASFGAFS--LL----K---PFWIAKAQL
Q7NJN6          SSIVA------IGRRH---WRPLLALNTVLLAATVGIAV--FY----P---RTWTASAQL
U5QCC3          MSTLA------IARRH---LRPLLILNGAILTTAIGIAL--FF----P---KSWTATTQL
A0A3M1SVZ4      ESTIQLDRAFPIVKRR---WLPASVVFAAIFTVFYIAAQ--KD----R---PVYIAEGEI
A0A654SFI6      HIDLARYWIEARALRF---WIAAIIALALIAGLVVTLL----S----T---PLYRAGAR-
K9SSQ0          SPLLSTFLVRRLVRKH---LVTVISTTALTLGGAAIYTF--NQ----P---FLYESKGSL
A0A2W1JIN9      SRLPL------VFSRH---RWSALAAFSAVMCGLCLYVV--FA----P---RLYTSKVRL
A0A318AJV1      AAAKR------MLRRR---WATMLGVSSVVFVVALSVVA--CL----P---PRYVAVARI
A0A6P0IC70      SSLVS------VLKRR---FWPALATFASVIGASIAYLV--YT----S---PVYEVKARL
A0A6B3MUB5      SSLVS------VLKRR---FWPALATFASVIGASIAYLV--YT----S---PVYEVKARL
A0A6M0B7N4      SSLVS------VLKRR---FWPALATFASVIGASIAYLV--YT----S---PVYEVKARL
A0A6P0J9W3      SSLVS------VLKRR---FWPALATFASVIGASIAYLV--YT----S---PVYEVKARL
A0A6P0ZWE1      SSLVS------VLKRR---FWPALATFASVIGASIAYLV--YT----S---PVYEVKARL
A0A1U7N2U4      SSLPL------ALRRR---LLAALATFTSVIGGGMAYLV--VT----P---PVYQVKARL
A0A1D9G1F2      SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6P0PNZ7      SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
F4XV38          SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6P0W137      SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6L9Y9E2      SSLPL------ALRRR---LLPALATFTSVIGGAIAYLV--VT----P---PVYQMKARL
A0A6P0SGR0      SSLPL------ALKRR---LLPALATFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6M0BK48      SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6L9YZL1      SSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6P0KYM4      SSLPL------ALKRR---LLPALVTLTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6P0LSD6      SSLPL------ALKRR---LLPALVTLTSVIGGAIAYLV--VT----P---PVYQVKARL
A0A6P0X384      SSLPS------VLKRR---FLPALATFVSVIGASIVYVV--SS----S---PVYQVTGRL
A0A2P8QIL5      ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
A0A2T1FLY5      ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
A0A433W447      ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
K9U1K8          ALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEARL
K9UYB2          SSVFT------ILKRR---SFPALLMFAAVLGGAYAYIS--TA----P---KMYESAIRL
A0A218QN17      SSLLA------ILKRR---ALPALVTFTAVIGGAVAYLT--VT----P---RLYEASARL
K9RKN2          SSLLT------IVMRR---SLPALATFVAVMGGAFAYLS--IT----P---RVYETSARL
A0A2I8ADV2      STLFA------VLRRR---GLPAVSTLAAVIGASVAYLA--IT----P---RFYATSAKM
A0A1W5CKM3      STLLG------VLGRR---GFPAVTVFASVIGASFAYLA--VT----P---RLYETSARL
A0A5Q0GMF5      STLLG------VLGRR---GFPAVTVFASVIGASFAYLA--VT----P---RLYETSARL
Q3MEW0          STLLG------VLGRR---GFPAVTVFASVIGASFAYLA--VT----P---RLYETSARL
A0A1Z4KIC7      STLLG------VLGRR---GFPAVTVFAAVIGASFAYLA--VT----P---RLYETSARL
Q8YSM5          STLLG------VLGRR---GFPAVTVFAAVIGASFAYLA--VT----P---RLYETSARL
A0A1Q4S1H4      SSLWT------VAKRR---SLPAFLTLSAVIAGAVTYLA--VA----P---RMYETSSRL
A0A433VBU6      SSLWA------VVRRR---SLPAFLTLSAVMAGAVTYLA--VA----P---RMYETSSRL
A0A1Q4RZJ6      WSVLS------VLKRR---GLPALITFTAVIGGAVAYLK--VT----P---RLYESSSRL
A0A1Z4SNV3      WSVLA------VIKRR---GLPALITFTAVISGAVAYLK--VT----P---RLYETSARL
A0A2H2XJQ1      WSVLA------VIKRR---GLPALITFTAVISGAVAYLK--VT----P---RLYETSARL
A0A3S5K358      WSVLS------VLKRR---GLPALITFTAVIGGAVAYLK--VT----P---RLYESSSRL
A0A0T7BPJ4      SSLVA------VLKRR---GLPAAAAFVAVMGAAGAYLL--LS----P---KLYEASARM
A0A0C1QS61      SSVLG------VLKRR---SLPAVAAFVATIGGAIAYLA--VT----P---SQYEASARL
A0A139X3R8      SSVLS------VLKRR---SLPAVAAFVAAIGGAIAYLA--VT----P---SQYEASARL
A0A1Z4I7C5      STLLA------VLGRR---GFPAITVFAAVIGTSFAYLQ--VT----P---RLYESSARL
A0A0C2MDK7      SSVLA------VLRRR---SLPAVAAFVAVMGGAIAYLA--VT----P---SKYEAYARL
A0A1Y0RCK1      SNVLA------VLKRR---SAPAIAAFAAVIGGAIAYLA--VT----P---SKYEAYARL
A0A1Z4PWZ0      SSVIG------VLRRR---SLPAIAAFVAVIGGAMAYLT--VT----P---SKYAASARV
A0A0C2QLT0      SSVIG------VLRRR---SLPAIAAFVAVIGGAIAYLA--VT----P---SKYEAYARL
A0A1Z4J2K1      SSVIA------VLRRR---SLPAIAAFVAVIGGAIAYLA--VT----P---SKYEASARL
A0A3S0ZSX0      SSLLL------IFKRR---AFPALATFAAVIGGAIAYLQ--VT----P---HRYQTSARL
A0A2N6K4T3      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--MT----P---RQYQTSTRL
A0A370CKT2      SSLPS------ILKRR---ALPALVTFAAVISGAIAYLQ--IT----P---RQYQTSTRL
A0A0S3TL97      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---HQYQTSTRL
A0A2N6M8A0      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---HQYQTSTRL
A0A2N6M9E1      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---RQYQTSTRL
A0A2N6KJI4      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---RQYQTSTRL
A0A2N6MZ77      SSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---RQYQTSTRL
A0A2N6KT20      SSLPS------ILKRR---ALPALVTFAAVISGAIAYLQ--IT----P---RQYQTSTRL
G6FSN3          SSLPS------ILKRR---ALPALVTFAAVISGAIAYLQ--IT----P---RQYQTSTRL
A0A4D9CI02      SSLPF------ILKRR---ALPALVTFAAVIGGAIAYLL--IT----P---RLYEISTRL
A0A328I8B9      --------------------LPALVTFAAVIGGAIAYLI--IT----P---RLYEISTRL
A0A4Q9J4Z7      SSLPF------ILKRR---ALPALVTFAAVIGGAIAYLI--IT----P---RLYEISTRL
A0A0M0SU69      SSLPF------ILKRR---ALPALATFIAVIGGAIIYLQ--IT----P---RLYETSTRL
A0A1Z4TIZ8      SSLLF------ILKRR---TLPALATFAAVIGGAIAYLQ--IT----P---RLYETSTRL
A0A0S3TYD7      RKTFM------MLTRY---WLPATLAFSLVTVPAAVFLM--TR----K---SSYQATGAV
A0A2T1DNG3      GQLFA------ILKRH---YLWVLAAGTVSVAIAFAYTL--KQ----E---STYISGMQF
A0A3S0Y9N9      LQYWL------IFKRR---WLPVSIVFFTVVALSIVKTL--LE----T---PIYQATAQL
A0A433UNK7      LRYWS------ILKRR---WLPTSIVFLSLLALSIVKTV--LE----T---PIYQAGGQL
A0A6P0ZKB8      LRYLS------IIKRR---WLPTSIVFLTLVGLSIVKTY--LE----T---PIYQAGGQL
U5QL42          LSIWR------TLRKR---KLLSLSVAVAVFGGVAAFTY--TR----P---YIYESETLI
A0A076HBF2      RELWR------ALQRR---KKLVGVTAGSIIVLAALFTT--YQ----RLFRPVYEGSFSL
A0A354B169      RELWL------ALRRR---RKLVTVTASTVLALTVMVTA--YQ----RIFTPVYLGSFSL
G4FMX5          RDLWR------ALKRR---KKLVGVTAAGVISLTCVSTA--YQ----RIFRPVYQGSFAL
Q0IDT5          RELWR------ALKRR---KKIVGFTAAAVLVLSGVVTT--YQ----RLFMPVYEGSFAL
A0A2D6FCW3      RELWR------ALRRR---KNLVGVTAAGVLALSGLNTA--YQ----RIFRPVYQGSFAL
A3ZA21          RELWR------ALKRR---KKLVGVTAAAVVALAGMVTA--YQ----RIFRPVYQGSFAL
A0A140K3H3      TELKQ------TLSRQ---WKPALLVASTVCAGIFLSTV--LQ----N---PKYQSQTLI
K9XUB8          TELKQ------TLSRQ---WKPALLVASTVCIGMFLSTV--LQ----T---PKYRSQTLL
A0A6H2NHD5      GHLVG------VLKRR---AITFLGVTLLSLGGLTLWHL--TR----P---AVYSGGFDL
A0A2P8W4F7      KRLLG------VFKRR---AGVFLGVAALSFGGLTLWHL--SQ----P---PAYSGSVNL
A0A5Q4E0Z4      GHLIG------VLKRR---VGVFVGVAALSFGGLTLWHL--SR----P---PVYSGTANL
A0A2P8VVX1      GQLFQ------ILLRR---WPWIIASLGVATAGAVFVSL--RQ----E---PIYRSNMQL
A0A2P8WHY0      GQLLG------ILLRR---WPWIAGTLVLSVAGAVLVFL--RE----D---PTYRSSMQL
A0A2T1CMT9      GELFS------KLWHR---RLWFIGAFTGVLAIAVPLAL--LK----P---AVYQSYMQI
A0A563VQJ3      GQYLL------KLKRR---WKPAILVFLATLGGSVFLSL--FL----Q---NSYQAAGKL
A0A1D8TX52      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTI--KK----E---PNYISSLQL
A0A1D9G4T2      GQLLA------VLWRR---RLWIISVLLTSLPIAFYITL--KK----E---PNYISSLQL
A0A6P0PR27      GQLLA------VLWRR---RLWIISVLLTSLPIAFYITL--KK----E---PNYISSLQL
A0A6P0WER7      GQLLA------VLWRR---RLWIISVLLTSLPIAFYITL--KK----E---PNYISSLQL
F4XP71          GQLLA------VLWRR---RLWIISVLLTSLPIAFYITL--KK----E---PNYISSLQL
A0A6L9YR57      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTI--KK----E---PTYISSLQL
A0A6P0KZ31      GQLLA------VLWRR---RLWILSVLLTSLPIAFYITL--NK----E---PTYISSLQL
A0A6P0LPB8      GQLLA------VLWRR---RLWILSVLLTSLPIAFYITL--NK----E---PTYISSLQL
A0A6P0SEV1      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A6B3N2I8      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A6M0B891      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A6P0IJQ1      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A6P0J8J8      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A6P0ZSH6      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A1U7N5X9      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PNYISSLQL
A0A6L9Z1V0      GQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSLQL
A0A6P0LC12      GQLLA------VLWRR---RLWILSILLTSLPIAFYVTI--KK----E---PTYISSLQL
A0A6P0MVJ3      GQLLA------VLWRR---RLWILSVLLTSLPIAFYITI--KK----E---PTYISSLQL
A0A2W6ZAV2      GNLLP------ILRRR---QRLLVAVFAATVAIGAAATL--FQ----RVVSPVYQGDFRL
K9W742          GQLFA------ILIRR---RLWLLGILCLALGIATFKAF--TT----K---STYVSSLQL
A0A3D1PBA3      GQLFS------VLMRR---RFWLLGVLGSVLTIATVFTL--IS----K---PTYQSTMQL
K9XPB0          GQLLG------ILWRR---RFWIGGVFLGVLAVAIPLAL--MK----Q---PLYMSQMQL
A0A350Y7Z1      GQLFS------ILLRR---RFWMLGVFCGVLAIAIPIAL--NK----E---PTYQSSMQL
A0A352X2A7      GQLFA------ILLRR---KFWLLGVFCSVLAIAIPIAL--KK----E---PTYQSSIQL
A0A0D8ZYV0      GQLFA------VLSRR---RYWLLGVLGGVLTIATALTL--TA----E---PTFQSTMQI
A0A2T1FP73      GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
A0A433VMS2      GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
K9TYA7          GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
A0A2P8QUE1      GQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEMQL
K9SA61          GQIFA------VLARR---RLWLLGVFGSVVAAAAGLTF--LT----T---PVYQSSLQL
A0A2G7GMH8      GQLLS------VLMRR---RFLLLSVFFGILSMATVLTI--IT----K---PTYKSSMQL
A0A6N8FU92      GQLLL------VLMRR---RFLLLSVFLSVLSAATILTL--MT----K---PTYKSSMQL
A0A2T1DWE8      GQLVA------ALFRR---KLWLLGIFLTVLSAVTIYTL--LK----K---PIYQSSMQL
A0A1U7I8L3      GQLLA------ILLRR---RYWLLGIFSVVLAITAIVTI--TT----K---PTYKSSMQL
A0A2T1DJL8      GQLLS------VLMRR---RLWLIGGLGLSLIGAALFTL--FS----K---PTFRSSMQL
A0A1Z4J9W0      GQLFG------VLLRR---KLWFLGALAGTLALAAGVTA--VL----P---PTYRSTMQL
A0A0N7Z5K9      GQLFG------VLMRR---KIWFLGAVAGTIALAAAVTA--FM----P---PTYRSTMQM
A0A0S3TXC5      GQLFG------VLMRR---KIWFLGALAGTIALAAGVTA--FM----P---PTYRSTMQM
B8HNB0          VELLR------TLKKR---WIPALATAVTVFAGCYIYSA--LQ----T---PLYRSEALI
A0A563VS48      QKYWL------VLKRR---WLPATLTLCGVLGISLGYAL--SQ----E---QIYEAEAKV
A0A318BJ18      RHYLR------IAMRW---RWVILGVTIACVLLGLVVTL--LM----T---PTYTATATV
A0A3B8Y8H9      SQIVP------WLRRR---FWLIGSISLAVSLSAVSYAF--TR----A---PVYEESFQI
A0A2W1JVB9      GKYWL------ILKRR---WLPATIIFLLMFSTATLAAF--LK----A---PIYQSQGTL
A0A6H1U102      SEVLR------ILRKR---AGSAAAIATAVFAGVGLSTA--TK----T---PEYQSETLI
A0A7C3ZEJ3      SDVGR------TLRKR---WPSAAAVATAVFAGVSFSTV--TQ----T---PDYQSETLI
A0A563VLD6      SELKQ------IIFRR---WKPALIVGTTVFAGIFIPTM--LQ----T---PKYQSETFI
A0A2P8W9H0      DRFVA------ALRRH---LLLIAGITTLTASAAVLKAI--TD----A---PTYQSSFDI
A0A6I5P386      DYLLS------SLKRH---FLLITGVTVLTTALAVTKAV--TD----E---PVYQAEFEL
A0A318BG22      QRYVA------TLTKH---RLLILGTTIAAALLALIVTM--LT----E---PRYVARTTF
A0A2T1E9V8      YNYWC------IFKRH---WLPALAIFSTITGGSYLYTS--AK----T---PIYSAQGQI
A0A1Z4LN32      QKYLL------VLKRR---WLIASVVFAGFASFGVLHWV--SQ----K---PAYQATGKL
A0A2I8A9F5      QKYLL------VLKRR---WLVIAGVFVLFATLGGTLAL--KQ----P---KSYEATGKL
A0A218Q6R8      QKYWL------VLKRR---WLIIAAVSTACAALGGVNFF--IQ----P---TTYQASGKL
A0A218QGE0      QKYLL------VLKRR---WLIASGVFAVFATLGGINFV--IQ----P---PVYEASGKL
A0A3M2GQQ6      VELGR------TLVKR---WSIIAIVMTSVFATVAVSTL--RT----T---PQYRSETLI
A0A6H1U2X0      VELGR------TLVKR---WSIIAIVMTSVFATVAVSTL--RT----T---PQYRSETLI
K9TLQ0          RHLLS------VARRR---IFVFAGVSIAVACGVLVKVL--TQ----T---PIYEGNFRL
K9QF04          HQLGA------IARRR---LVVFIAVSGVIIAGVICKQW--LQ----K---PIYKQQFQL
K9W1T3          TQYWF------IFKRR---WLPASLVFTLVLGVTALVTF--QQ----K---PIYQAQGQI
K9SGJ5          SRFLR------TLRKR---WLVVASISATLFATVAAYTY--IK----E---PVYQSETSL
A0A6N2JS94      AKFFR------VLRKR---WIVIVAVSVTVFAGNTYYTF--TR----T---PQYRSSASL
A0A6C2DSN4      AKFLR------VLRKR---WIVIVAVSVTVFAGNTYYTI--TR----I---PQYRSSASL
L8MYT6          AKFLR------VLRKR---WIVIVAVSVTVFAGNTYYTI--TR----I---PQYRSSASL
A0A352JGJ6      AKFFR------VLRKR---WIVIVAVSASVFVGNAYYTF--TR----T---PQYRSSASL
A0A1J5GLS2      AKFFR------ILRKR---WIVIVAVSASVFAGTTYYTF--TR----V---PQYKAGAAL
A0A2W4W6M5      AKFFR------VLRKR---WIVVAAVSVTVFAGNAYYTF--SR----T---PQYRSNASL
A0A2W7AN33      AKVLR------VFRDR---WTVIATVSVTMLAGSALYTF--TR----T---PQYRSIASL
A0A256BLV2      AKFFR------VLRKR---WIVIVAVSVSVFAGNTYYTF--TR----T---PQYRSSASL
A0A2W6ZXF3      AKFFR------VLRKR---WIVIVAVSASVFAGTTYYTF--TR----T---PQYKAGAAL
A0A2Z5WX66      AKFFR------VLRKR---WMVIVAVSVTVFAGNTYYTF--TR----T---PQYRSNASL
K1XF69          GRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSGKI
B5W297          GRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSGKI
A0A6H2AL05      GRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSGKI
H1W7M8          GRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSGKI
A0A5Q4H6A5      GRYLQ------TLKRR---WFWLLGVFVLTVSGAVYATQ--FL----S---PTYQNSGKI
D5A466          GRYLQ------TLKRR---WFWLLGVFVLTVSGAVYATQ--FL----S---PTYQNSGKI
U5QJM6          -----------------------MMTMAATFTLAVAYTF--LS----Q---PVYKSEMLM
A0A1Z4RPC6      GNYLQ------KLKRR---WIPALAVFIVTVGTTAFLSG--FL----E---KNYKSEGKI
A0A2T1CMZ0      EEYLL------KLKRR---WLPALSVFVVTVGTTLFLTS--FL----E---KTYKSEGKI
L8M4F7          GEYLL------KLKRR---WKIASALFLLTVGAAGLLST--KL----S---TKYEAEGKL
A0A140K2P2      SQYLI------KLRRR---WKLALAVFLLTAGITTALSL--LL----Q---KTYQAQGKL
K9XWX4          SGYLI------KLRRR---WKLALAVFLLTAGVTTALSL--LL----Q---KTYQAQGKL
A0A140KB14      YNYLQ------KLSRR---WKPALAVFLLTVGSMAALST--LL----K---KSYQAEGKL
K9XX88          YNYLQ------KLRRR---WKPALAVFLLTVGSVAALST--LL----K---KSYQAEGKL
A0A563VSV6      ASYFQ------KLKRR---WKPALAVFLLTVVSTFAATS--LL----E---EKYQAEGKI
L8LZE9          LSYLQ------KIQRR---WKPALAVFLLTAGSIGLASV--FL----T---TKYQAGGKI
A0A433NM31      RQYWL------ILKRR---WLPASAVFGFVLLLTALVTF--LQ----K---PVYQAQGKL
A0A1Z4NDS1      QKYVQ------VLQRR---WLPGLAIFGTCVTLATIYAF--SL----Q---PSYKAEGNL
U9VXM0          QKYWR------VLKRR---WLIALTIFGLTTTAAVGVGI--TQ----K---PEYEAEAKL
A0A6M0RI13      QKYWR------VLKRR---WLIALTVFGLTTTAAVGVGI--TQ----K---PEYQAESKL
A0A6M0S1N5      QKYWR------VLKRR---WLIALTVFGLTTTAAVGVGI--TQ----K---PEYQAESKL
K9F4D9          QKYWR------VLKRR---WLIALTVFGLTTTAAVGVGI--TQ----K---PEYQAESKL
A0A6I5QPI5      QKYWL------VLKRR---WIPAFAVFSTTVALSVFAAL--SE----E---SVYKAEGRV
A0A1Z3HMQ0      QRYWL------VLKRR---WLPASLVFAACVVAAALVGL--SQ----K---DTYQASGKL
A0A433W533      SKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATGKL
A0A2P8QWJ3      SKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATGKL
A0A2T1FKP8      SKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATGKL
K9U6L7          SKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATGKL
A0A1E5QP61      QKYWL------VLKRH---WLPASSVFALIVTLATYKAA--TA----D---PVYEAQGKL
U5DPF5          QKYWS------ILKRR---WLPASLVTISTIGLTGIYSA--RQ----T---PIYEARARL
A0A6P0X488      QNYWL------ILKRR---WLPGTLVLLLTVILATTAAL--LK----Q---PTYAAQGKL
A0A6P0UVD5      QSYWL------ILRRR---WLPGTLVLLLTVILATTAAL--LK----Q---PTYAAQGKL
A0A6P0VDM0      QSYWL------ILRRR---WLPGTLVLLLTVILATTAAL--LK----Q---PTYAAQGKL
A0A6M0G142      QKYWL------ILRRR---WLPGTLVLLLTVMLATTAAL--LK----K---PSYTAQGKL
A0A6P0MR53      QKYWL------ILKRR---WLPGTMVFLLTVMLATTAAF--LK----K---PSYTAQGKL
A0A3M2GIL5      QKYWL------VLKRH---WLPSSCVFLLIFALAFAFAY--TR----K---PTYEASGKL
A0A6H1TSJ9      QKYWL------VLKRH---WLPSSCVFLLIFALAFAFAY--TR----K---PTYEASGKL
A0A3M1PML8      QKYWN------VLKRR---WLPATSVFLTLTLLSAAVAI--RQ----K---SSYQAETLL
A0A6M8BE85      QKYWN------VLKRR---WLPATTVFLTLTALSTAIAL--RQ----K---PSYEAETLL
A0A0T7BPZ0      TKYWL------ILQRR---WLPTLGIVGIALTMAFGYVL--SI----K---PTYKAQGSI
A0A352X442      QKYWL------VLKRR---WLPAVGVFGGIVAVAGLAVI--RQ----V---PSYQAQGTI
A0A6B3NF44      QKYWL------VLKRR---WLPATGVVAMTVALSALAVS--RQ----K---DSYKAEGKL
A0A6M0EPL4      QKYWL------VLKRR---WLPATGVVAMTVALSALAVS--RQ----K---DSYKAEGKL
A0A6P0K6L6      QKYWL------VLKRR---WLPATGVVAMTVALSALAVS--RQ----K---DSYKAEGKL
A0A6P0MRR9      KKYWL------VLRRR---WLPGVVVSAIVVTLAVLSTS--KE----E---TVYKAGGQL
A0A6P0UX57      KKYWL------VLRRR---WLPGVAVSAMVVTLAVLSTS--RE----E---TVYKAGGQL
A0A6P0X1X4      KKYWL------VLRRR---WLPGVAVSAMVVTLAVLSTS--RE----E---IVYKAGGQL
A0A0M0SHU3      QKYLL------VLQRR---WMTAVGIFGAVVTLALLYAF--SL----K---PTYTAQASL
A0A1D2PBN3      QKYLL------VLQRR---WVSAVGVFGVVVTVASLYAF--SL----K---PTYNAEGSL
A0A0C2LVR7      QKYLL------VLQRR---WVPAVGVFGAVVTLVSLYAF--SL----K---PTYNAEGSL
A0A1Z4PQB9      QKYLL------VLQRR---WVPAVGVFGVAVTLVSLYAF--SL----K---PTYKAEGSL
A0A1Z4SFN6      QSYLL------VVQRR---WLAAVSVFGVVVALASLQAF--SS----K---PSYEAQGSL
K9PGI8          QKYLL------ILQRR---WIPAAGVFGVVVTLAFLYAV--SL----K---PAYKAEGSL
Q7NEU3          QTYAR------TIWRR---RYAFIGVFVATFSLAAAYTF--LS----N---PVYEGEMLL
A0A3C0N2P0      RRLLA------VARRR---IILVAGVAIAVTSGVAAKVL--RQ----V---PIYEGSFQL
A0A6P0JR04      RQALS------ALRRR---WLLMLLVSVAVTAGVSFRVF--NE----V---PVYRSQFRL
A0A6B3M6M6      SRIIS------LVRRR---VLVIAGVAIAISSGIIAKTL--GK----T---PQYQGKFQL
A0A6P0KD09      SQILS------LVRRR---MVVIAGVAIAISSGIIAKTL--GK----T---PQYQGKFQL
A0A6B3NIJ0      SQILS------LVRRR---MVVIAGVAIAISSGIIAKTL--GK----T---PQYQGKFQL
A0A6M0F053      SQILS------LVRRR---MVVIAGVAIAISSGIIAKTL--GK----T---PQYQGKFQL
A0A6P2ATU9      RLALS------MLRRR---WWILLLVGTAVTSVMGMRVL--QE----D---PLYRSQFRL
A0A352XE00      RQIIA------IARRR---FILTAGVAVAVTSGVATRVL--QQ----V---PKYEGKFQL
A0A6P0QC14      RKILA------VARRR---LIIIAGVAIAVSSGIASKVL--KQ----V---PNYEGKFQL
B4VS56          RQILA------VARRR---ALVVAGMAIAVTSGIVTKVL--QQ----T---PNYEGKFQL
A0A352AAQ3      GQILG------VVRRR---FIVIAGVAIAVTSGIVARVL--KQ----T---PNYEGKFQL
A0A350Y472      RQILA------VAQRR---AIIIAGVAIAVSGGIVSQVL--KQ----E---PNYEGKFQL
A0A355DVB4      RQILA------VAQRR---AIIIAGVAIAVSGGIVSQVL--KQ----E---PNYEGKFQL
A0A1Z4RMB9      NEYLL------KVKRR---WKPALGVFLLTLGVTGALSL--LQ----T---KTYQAEGKI
A0A318B4H2      ERYWR------AMLNR---RLLILAVLLASMTVGVIVYL--MA----T---PQYLATARI
B4WQE3          GRVVD------VLKRH---VFLITGITALATSAVVARAL--TE----T---PLYRADFEL
A0A2K3BR24      QQYWM------ALKRR---SLSAIIVFASTIGIAAAYSF--QQ----E---PIYQAKAKL
K9YXY1          QQYWM------ALKRR---SLSAIIVFASTIGITAAYSF--QQ----E---PIYQAKAKL
A0A0V7ZFJ4      QQYWL------TLKRR---WLPALIVSSSVFGMAAFNTL--KQ----E---PIYSAEGKL
A0A0V7ZNJ9      EQYWL------ILKRR---WVPASVVAGSVVGLAALVTF--MQ----K---PIYEAKAEL
A0A367RIS1      QQYWR------ILKRR---WFLIAIIMGSVFGVTGLVAF--SK----K---PIYESEGKL
A0A235IXQ2      QQYWL------TVKRR---WFLILIIIGSVFGVTGVVTF--SE----K---PIYEAEGKL
A0A1W5CNX3      QQYWL------IAKRR---WLLIATIMGSVFGVTGLLTF--SQ----K---PIYEAEGKL
A0A5Q0GJJ5      QQYWL------IAKRR---WLLIATIMGSVFGVTGLLTF--SQ----K---PIYEAEGKL
Q3MEB7          QQYWL------IAKRR---WLLIATIMGSVFGVTGLLTF--SQ----K---PIYEAEGKL
A0A1Z4KHN9      QQYWL------IVKRR---WLLIAAIIGSVFGVTGLVTF--SQ----K---PIYEADGKL
Q8YT70          QQYWL------IVKRR---WLLIAAIIGSVFGVTGLVTF--SQ----K---PIYEADGKL
A0A166IWU6      RQYWL------AVKRR---WLLIVIIIGSVFGITSFVTF--NQ----K---QIYEAEGKL
A0A2S0Q8C0      RQYWL------AVKRR---WFLIVIIIGSVFGITSFVTF--NQ----K---PIYEAEGKL
W6FSX4          RQYWL------AVKRR---WFLIVIIIGSVFGITSFVTF--NQ----K---PIYEAEGKL
A0A218Q4C1      QQYWL------TVKRR---WLLIATIITSVFGFTAFVTF--SQ----K---PIYQAEGKL
A0A6P1ZT04      QQYWL------TVKRR---WLLIATIIGSVFGITAFITF--SQ----K---PIYQAEGKL
A0A0R0M9H9      QVYWL------ILKRR---WLVILLVMASVLGAAISYTY--SQ----K---PVYQAKGKL
A0A1S1ZVW2      QVYWL------ILKRR---WLVILLVMASVLGAAISYTY--SQ----K---PVYQAKGKL
A0A1B7WX82      QQYWL------IFKRR---WLVSSIVFASVFGITAFVTY--TT----K---PVYESEGKL
A0A1B7WTD1      QQYWL------ILKRR---WFVASVVMASVISATAFMTY--TQ----K---PVYESQGKL
A0A480ABC0      QQYWL------ILKRR---WFVASVVMASVISATAFMTY--TQ----K---PVYESQGKL
A0A1Z4LRU5      GQYWL------ILKRR---WLPALLVTSSIFGLAAFVTF--RQ----K---PVYQAEGKL
A0A1Z4JVB4      QQYWL------ILKRR---WLLTSFVTGSVFGLAALLTF--LQ----K---PAYESPAKL
K9PIA4          QHYWT------VLKRR---WLVTSIVISTVFGLTALVTF--LK----T---PVYESKAKL
A0A1Z4HVE1      QQYWT------VLKRR---WPVTTVVIGSVFGLTCLFTF--LQ----K---PVYESQAKL
A0A252ECZ1      HQYWP------ILKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A1Z4G5Y1      QEYWP------ILKRR---WPVTAVVIGSVFGLTALVTF--VQ----K---PVYESQAKL
A0A252DNA2      QEYWP------ILKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A252E1Q4      QEYWP------ILKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A6G9SK36      QQYWT------IIKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A1Z4M597      QQYWT------VLKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A1Z4MWT1      QQYWT------VLKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A1Z4TX53      QQYWT------VLKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQAKL
A0A5P8VSD1      QQYWL------TLKRR---WLLIITIMGSVFGVTGLVTF--IQ----K---PIYEAESKL
A0A2A2TNQ5      QEYLL------VLKRR---WLAAAIVMGSVFGITAFVTY--SQ----K---PIYEASGKL
A0A3S1C4K5      QQYLR------ILKRR---WLVTAGVMGSVFGLTALVTF--SQ----K---PVYESQGKL
A0A1X4G3D5      QLYWM------ILRRR---WLVVLLVMASVLGGAISYTL--FQ----K---PVYQAKGKL
D4TNI2          QLYWM------ILRRR---WLVVLLVMASVLGGAISYTL--FQ----K---PVYQAKGKL
A0A1Z4H6Z8      QEYWP------ILKRR---WPVTAVVIGSVFGMTALVTF--LQ----K---PVYESQAKL
A0A1Z4NPM1      QQYWL------ILRRR---WLVILLVLGSVFGLAAFYTF--TL----K---PVYEAGGKL
A0A3F3KPR9      QIYWL------ILKRR---WLVILLVIASVLGAAISYTY--SQ----K---PVYQAKGKL
D4TGN7          QIYWL------ILKRR---WLVILLVIASVLGAAISYTY--SQ----K---PVYQAKGKL
A0A1Z4UZW9      QQYWL------IFKGR---WPMASIVFAVVFGVTALVTY--ST----K---PVYESEGKL
A0A0K2M5H0      QQYWL------IFKRR---WPVASVVFAFVFGVTALVTY--ST----K---PVYESEGKL
A0A1B7VSH4      QQYWL------IFKRR---WLVASIVFASVFGATALVTY--LT----K---PVYESEGKL
A0A1B7W126      QQYWL------IFKRR---WLVASIVFASVFGATALVTY--LT----K---PVYESEGKL
A0A3D4C6Q6      QQYWL------IFKRR---WLVASIVFASVFGATALVTY--LT----K---PVYESEGKL
A0A1B7UVJ4      QQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PVYESEGKL
A0A1B7UTR1      QQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PVYESEGKL
K7W0A4          QQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PIYESEGKL
A0A5C0DRW9      QQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PVYESEGKL
A0A6H2C088      QQYWL------TFKRH---WLVTSIVFASVLGVTALFTY--SA----K---PVYESEGKL
A0A1Q4RTR1      RQAWR------ILKRR---WLAVTIVISSAIGVTGAITF--SQ----T---PIYEAEGKL
A0A1Z4SQV2      RQAWR------IMKRR---WLAVTVVLSSVVGITGAVTF--SQ----T---PIYEAEGKL
A0A2H2XGN1      RQAWR------IMKRR---WLAVTVVLSSVVGITGAVTF--SQ----T---PIYEAEGKL
A0A433UXH8      RQAWR------IMKRR---WLAVTIVLSSVVGITGAVTF--SQ----T---PIYEAEGKL
A0A1U7HGH0      HKYWY------ILKRR---WLPAVAAFGTVMGITYLHTL--SR----V---PIYQAQGEL
K9XJD3          HKYWC------ILKRR---WLPAVAAFGTVMGITYLHTL--SR----V---PIYQAQGEL
K9SX01          FELLS------IVRRY---WFLEISIFSLVFGVSAFLTF--QE----K---PIYQATGSL
A0A4P7ZT55      KEIWM------ALRRRRRWFLAGFGVTLAITGVLTLGQR--LF----R---PTYEGSFTL
A0A1E5QIR9      KQYGL------VFKRR---FFPAAIVFCAAIGATAAITF--LQ----K---PTYQAQGEL
A0A1Z4IBC7      HKYIE------VLQRR---WLAVVGVFGLSLALGCLYAF--SL----K---PSYKADGSL
A0A1W5CPC7      HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
A0A5Q0GKD1      HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
Q3MDC6          HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
A0A1Z4KM73      HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
Q8YNX7          HKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEGSV
A0A367R4K6      QKYLE------VLQRR---WLTVIGIFSIAVTLGCLYAF--SL----K---PSYKAEGSL
A0A1E2WSV8      QKYLE------VIQRR---WLPLVGIFSIAVTLGCLYAF--SL----K---PSYKAEGSL
A0A2R5FRT9      QKYLE------VIQRR---WLPLVGIFGITVTLGCLYAF--SL----K---PSYKAEGSL
A0A2K8T1B6      QKYLE------VIQRR---WLPLVGIFGISVTLGCLYAF--SL----K---PSYKAEGSL
A0A235I9I0      QKYLE------VFQRR---WLPLVGIFAISVSLGCLYAF--SL----K---PSYKAEGSL
A0A2D0HQT8      QKYLE------VFQRR---WLPLVGIFAISVSLGCLYAF--SL----K---PSYKAEGSL
A0A2L2NU95      QKYLE------VIQRR---WLPLVGIFAISVTLGCLYAF--SL----K---PSYKAEGSL
A0A367S084      QKYLE------VFQRR---WLPLVGIFAISVSLGCLYAF--SL----K---PSYKAEGSL
A0A6P1A9A0      SKIFG------VLRRR---WWLIGIVTISVSAVVGVRVF--QE----E---PIYQSRFQV
A0A1Z4SMD6      QNYWL------VLKRR---WLIAAGVLLTFVGLSGVAIY--MQ----K---PEYEASGML
A0A2H2Y096      QNYWL------VLKRR---WLIAAGVLLTFVGLSGVAIY--MQ----K---PEYEASGML
K9S8M8          QKYWL------ILKRH---WLPATGAFLLAVCGAAAMAF--TA----E---PIYEAQGKL
A0A1Z4NFV0      HRYWL------VLKRR---WLVVVGILAASTALSGFVLS--TQ----R---PQFEAIGQL
A0A3M9ZEU1      QKYWL------VLKRR---WLPATGVFGTVVALSTLAAV--MQ----K---PTYTATASL
A0A1Z4JK72      QNYWL------ILKRR---WLTAATVLAATVGLVGLATS--MQ----R---PSFEANGRL
A0A0N7Z489      QSYWL------VLKRR---WLVAAGVFAATVGVAGLATS--LQ----R---PNYEANGRA
A0A0S3TXS2      QSYWL------VLKRR---WLVAAGVFAATVGLAGLATS--LQ----R---PNYEATGRV
A0A2A2TPF8      QNYWL------VLKRR---WLIASGIFLTSVALSGFVIS--LQ----R---ANYEAKGKL
A0A1Z4R0P8      QNYWL------VLKRR---WPIALGIFLTSVALSGFAIS--LQ----K---ANYEAEGKI
A0A0T7BUI3      QQYFL------VLQRR---WKILLALIITSVGFSGFAIL--RQ----K---PQYQATGML
A0A1Z4LP32      QQYWL------IIKRR---WLFIVAAMLGSIGLSWFVIL--QQ----K---PQYQANGLL
K9REP9          QQYWL------IVKRR---WLFLVAAMLGSIGLSWLLIL--RQ----K---PEYQATGLL
A0A1Z4SIJ3      QKYWL------VLKRR---WLFVAVTVAASVGVAGIFIV--RQ----H---PEYRANGML
A0A2H2XPG4      QKYWL------VLKRR---WLFVAVTVAASVGVAGIFIV--RQ----H---PEYRANGML
K9V3C7          KNYWL------VLKRR---WLIAAGIFLTSVAMSGFVIS--LQ----K---ATYEASGKL
A0A1Z4T6Y7      RNYWL------ALKRR---WLVASGIFITTVALSGFAIS--LQ----R---PTYQASGKL
A0A2H2Y561      RNYWL------ALKRR---WLVASGIFITTVALSGFAIS--LQ----R---PTYQASGKL
A0A1Q4S362      RSYWL------VLKRR---WLVASGILFTSIALSGFAIS--LQ----R---PTYQASGKL
A0A3S1CIN8      RSYWL------VLKRR---WLIASGILFTSIALSGFAIS--LQ----R---PTYQASGKL
A0A2A2TC28      QQYWL------VLKRR---WLIAATVFCASVGLSGLVVL--RQ----K---PQYEASGML
A0A0C1NCB0      QKYLL------VIQRR---WHIVAGVMLVSMVLSGLGIY--LQ----K---PKYQATGIL
A0A2N6K7Q9      QQYLL------ILKRR---WRLIAAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6MXH6      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6M5A8      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6LL61      QQYLL------ILQRR---WRLITTIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A0S3TP66      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
G6FP91          QQYLL------ILKRR---WRLITTIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A1U7GYR5      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6KY52      QQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADGIL
A0A2N6KMP5      QQYLL------ILKRR---WQLITTIIVASIGLSGSVLF--MQ----K---PEYQADGIL
A0A2N6MA45      QQYLL------ILQRR---WRLITTIIVASIGLSGSALF--MQ----K---PEYQADGIL
A0A4Q9J9V9      QQYIL------VLKRR---WQLIASIIIASIGLSGLALF--MQ----K---PEYQADGIL
A0A328IGA1      QQYIL------VLKRR---WQLIASIILASIGLSGLALF--MQ----K---PEYQADGIL
A0A4D9CE41      QQYIL------VLKRR---WQLIASIILASIGLSGLALF--MQ----K---PEYQADGIL
A0A0M0SFT2      QQYIL------VLKRR---WRLIASIVLAAIGLSGLALF--MQ----K---PEYQADGIL
A0A1Z4TLC8      QQYIL------VLKRR---WRLIASIIIASIGLSGLALF--MQ----K---PEYQADGIL
A0A0C2LFH0      QKYWL------VLKRR---WPIVVGVLLASIGFSSFLIF--LQ----K---PEYQASGML
A0A1Z4IYV4      QKYWL------VLKRR---WPIVAGVVLASVGLSSFAVF--LQ----K---PKYQASGML
A0A1Z4Q0T6      QKYWL------VLKRR---WPIVAGVVLASIGLTTFAVF--LQ----K---PEYQATGML
A0A0C2PT44      QKYWL------VLKRR---WPIVAGSVLTSIGLTTFAVF--LQ----K---PEYQATGML
A0A1D2P6J4      QKYWL------VLKRR---WPIVAGVVLASVGLSSFAVF--LQ----K---PEYQATGML
B4WP72          QKYWC------VLRRR---WRLATFVFSSSICLTVLALA--SQ----E---AEYEATGKL
A0A2T1CIL7      QKYWL------VLKRR---WLPATMIFTGVTGIFVLSAL--SK----P---PTYMAEAQL
A0A433V7A0      QKGWL------TIKRH---WKPALGIFGVVFIITGIGVL--MK----S---PSYTAYGKL
A0A2T1FTR8      AQYWL------VLKRR---WMPAALVFALTTAVATVWTF--KQ----Q---EIFQAKGQV
K9UA41          AQYWL------VLKRR---WMPAALVFALTTAVATVWTF--KQ----Q---EIFQAKGQV
A0A0C2LBE2      QKYWL------ILQRR---WLPAVGVCGVVVSLASLLAF--SS----K---PTFKAEGSL
A0A433NN38      QKYWL------VLQRR---WLPAVGIFGTVLTLASVYAF--SL----K---PYYQAQASL
A0A2N6K0T2      QKYLL------VLQRR---WMTAVGVFGVIVSLALLYAL--ST----K---PTYTAQASL
A0A2N6ML72      QKYLL------VLQRR---WMTAVGVFGVIVTLALLHAL--ST----K---PTYTAQASL
G6FQZ6          QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--SI----K---PTYTAQASL
A0A2N6MQX9      QKYLL------VLQRR---WMTAVGVFGVVFTLALLHAL--ST----K---PTYTAQASL
A0A2N6KXT6      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A2N6KGB9      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A2N6L3Y5      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A0S3TIS7      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A1U7GW28      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A2N6LW63      QKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQASL
A0A328IH74      QKYLL------VLQRR---WLTAVGICGVVLSLALLYAF--SL----K---PTYTAQASL
A0A4D9CIB0      QKYLL------VLQRR---WMTAVGICGVVLSLALLYAF--SL----K---PTYTAQASL
A0A1Z4TQ63      QKYLL------VLQRR---WMTAVGVFGAVVTLALLYAF--SL----K---PTYTAQASL
A0A4Q9J8G2      QKYLL------VLQRR---WMTAVGVFGVVLTLALLYAL--SS----K---PTYTAQASL
A0A350Y0P6      QKYWL------ILRRR---WLPSTVVFGFIFTLATTVAF--VK----K---PSYSAYGKL
A0A352X940      QKYWL------ILKRR---WLPATMVFLLSIGVAVGVAY--TR----Q---PIYEAGGKL
B8HTN4          GKYLT------ILKRR---WLGGAIAFGSILSLVIAYTL--LQ----K---PVYQAQGLL
A0A6P1AFJ5      RQLLT------VARRR---RWLILGTSLLVGSGVAVRNL--DR----E---QVYAGKFRL
B0CAX4          RNYFR------ILRRR---WIPATAVFGSVFVLTALATF--LQ----K---PVYEAEGKL
A0A1Z4RN12      NKYWQ------VLKRR---WLPATATFTGVVLLSLIAAL--SS----Q---KVYEAEAQL
A0A2T1CMF9      SRYWQ------VVRRH---WIPASATFAGVLALSLIAAL--AS----K---NIYQAEARL
Q7NDC5          REYLR------ILNRH---WPYAAGTALAVVTVVTVWTF--AL----P---PVWEAQGRL
U5QGK3          RDYLR------VLNRH---RLYAGGVFVLVVAGVAVWTF--TS----P---SVWEAKGRL
A0A2W4UY24      QKYWL------VLKRH---WLLALAVCGLTTAAAAFLGS--TQ----A---LLYKAEGKL
A0A0D8ZUV2      HKLWL------ILKRR---WLPAAGVFSCVVGLSVVAAM--MP----K---SSYQAEGKL
A0A433VDI0      QKYWS------ILKRR---WLPAVIVFSGVVGLSVVVVL--LQ----K---PVYQAEGKL
A0A3D1PG43      QNLWL------SIKRR---WLPAAGIFGCVLGCSALAAS--LQ----Q---PMYQAQGKI
A0A2P8QQ72      QNLQL------AIKRR---WLAAAGVFGFVLGLSTIVTL--LQ----A---PLYQAEGKL
K9TZQ7          QNLQL------AIKRR---WLAAAGVFGFVLGLSTIVTL--LQ----A---PLYQAEGKL
A0A6N8G584      KRVWL------ILKRR---WLPAAGVFGVVVAVATVLAS--MQ----R---PVYEAQGKL
A0A2G7GPR0      KRVWL------ILKRR---WLPAAGVFGVVVAAAAALAS--MQ----R---PVYEAQGKL
K9XH68          KRVWL------ILKRR---WLPAAGVFGVVVAAATAFAS--MQ----R---PVYEAQGKL
A0A1U7HW70      KRVWL------ILKRR---WLPAAGVFGVVVAAATAFAS--MQ----R---PVYEAQGKL
A0A2S6VEJ8      KRVWL------ILKRR---WLPAAGVFGVVVAAATALAS--MQ----R---PVYEAQGKL
A0A140KBA0      KKYWL------VLKRR---IVPASITCLGVMTLSLVTAL--SL----E---QVYQAEGQV
K9XSG1          QKYWL------VVKRR---IVPASVTCLGVITLSLVTAL--SL----E---QIYEAEGQV
A0A2T1GMT4      SHYLF------AVKRH---WIPAVSIFAATVALSIAATS--LL----K---PSYQAEGRL
K9UI51          SHYLF------AVKRH---WIPAVSIFAATVALSIAAAS--LL----K---PSYQAEGRL
K9QM62          HRYLL------MLKRR---WILTVGIFFATAGFGVFATT--LM----K---PSYEAAGKL
A0A1Z4FWI3      GRYLS------VLKRQ---WIPATTIFASTVAVSVMATT--FM----K---PSYESEGKL
A0A1Z4JYE7      KIYLY------LLRRR---WISVTSIFLGTVSLSILATT--LL----K---PAYESSGKL
A0A2T1FXY4      SQYLL------SLKRR---WLPAVSIFATTVTLSVVAAT--LM----R---PSYEGEGQL
K9TYI2          SQYLL------SLKRR---WLPAVSIFATTVTLSVVAAA--FM----K---PSYEGEGKL
A0A1Z4QL41      GRYLS------SVKRH---WIPATCIFATTVILSALAST--RL----K---PSYESEGKL
A0A252D4T4      GRYLS------IVKRQ---WLPAVTIFASTVALSAVATT--FL----K---PTYEAEGKL
A0A252DJH5      GRYLS------IVKRQ---WLPAVTIFASTVALSAVATT--FL----K---PTYEAEGKL
A0A252EB80      GRYLS------IVKRQ---WIPAVTIFASTVALSAVATT--FL----K---PTYQAEGKL
A0A6G9SKZ9      GRYLS------IVKRQ---WIPAASIFASTVALSVVATT--FL----K---PSYEAEGKL
A0A1Z4HPW5      GRYLS------IVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A1Z4MSN1      SRYLS------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A1Z4U1C2      SRYLS------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A0D6KV51      -----------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A1Z4MKF8      SRYLS------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEGKL
A0A2C6WC43      NRYLL------MLKRW---WVPAATIFIATVMLSAVATR--FI----K---PSYEAEGKL
A0A1Z4L5A1      NRYLL------MLKRW---WIPAATIFLATVMLSAVATR--FM----K---PSYEAEGKL
A0A367QD86      NRYLL------MLKRW---WIPAATIFIATVMLSAVATR--FM----K---PSYEAEGKL
A0A235IZ96      NRYLL------ILKRW---WIPAVGIFVGTVMLSAISTT--FM----K---PSYEAEGKL
A0A2L2NGP0      NRYLL------ILKRW---WIPAVGIFVGTVMLSAISTT--FM----K---PSYEAEGKL
A0A2K8SM78      ------------------------------------------M----K---PSYEAEGKL
A0A2R5FPC0      SRYLL------ILKRW---WLPGTAIFAATVMLSAVATQ--FM----K---PSYEAEGKL
A0A5P8W5T6      GRYLL------ILKRW---WLPATAIFAATVMLSAIATQ--FM----K---PSYEAEGKL
A0A0F5YE28      GKYLQ------TVKRY---WLIVISVFLLCVGLSVYGTK--YL----K---PTYAASGKL
U7QEH7          GKYFK------TVQRY---WLVVIGVFALCVGLSVYGTK--YL----E---PTYAASGKL
A0A3S1ATK5      SRYLL------MIKRQ---WIPAASIFVATIALSALATT--RL----Q---PSYEAEGKL
A0A2Z6CPH0      SHYLM------ILKRR---WLCVTSIVIGTIALSALAAT--LI----K---PSYEAEGKL
A0A1Z4GT50      SRYLL------MLKRQ---WLPANSIFAATVAMSALATT--YM----K---PSYEAQGKL
A0A1Z4GIX0      NRYLL------VLRRR---WILILSILAASVGLSVAATT--LL----K---ASYEAEAKL
A0A2H6LC24      NRYLL------VLRRR---WILILSILAASVGLSVAATT--LL----K---ASYEAEAKL
B2J6N5          SRYLL------ILKRW---WLPATVIFTATVILSAIATQ--FM----K---PSYEAEGKL
A0A367RMI4      NRYLL------ILKRW---WLPAFSVFVATVILSAISTQ--FL----K---PDYEAEGKL
A0A235HUM0      NRYLL------ILKRW---WVPAFSIFVATVILSAISTK--FL----K---PDYEAEGKL
A0A2L2NW47      SRYLL------ILKRW---WLPAFSIFVATVILSAISTQ--FL----K---PDYEAEGKL
A0A1E2WUR1      NRYLL------ILKRW---WLPAVSIFVATVILSAVSTR--FM----K---PDYEAEGKL
A0A235IKU3      NRYLL------ILKRW---WIPAVGIFVGTVMLSAISTT--FM----R---PSYEAEGKL
A0A1U7MYU6      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A1D8TNX9      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A6P0L6C2      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A6P0MVH0      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A6P0KJV0      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A6L9ZJG4      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
F4XKF3          SQYKL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A1D9FX10      SQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A6P0Q0T0      SQYKL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A6P0W5I0      SQYKL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEGKL
A0A3C0NJ41      QKLWL------ALKRR---WLPGVAVFAVVVGLTVPLALSKKQ----K---TDYEAKGKL
A0A352AG88      QKLGL------VIKRR---WLIGAVVFLGMVGLTIPMALLQSQ----Q---TSYEAKGKL
A0A350Y374      YKLWL------VIKRR---WLVGGGVFVLMVGLTIPVALTQMQ----K---GDYEAQGKL
A0A355DPX0      YKLWL------VIKRR---WLVGGGVFVLMVGLTIPVALAQMQ----K---GDYEAQGKL
                                                                     :      

K9SLA9          LIESTIESTTGSVAAPTTTASIPNPNQDNIASSEGLPPLPTDTAISTIP-----------
A0A168TT23      QINHETANILRIEDFEAAPRSWQG------------------------------------
A0A0M1JWX9      LVEPVTGEGANSLSS--------------------------RLG--ALAGGLGMGIPGSS
A0A2T1M1V6      NIPIKG-DKLNA-----------------------------NLG--TLGNLSDGGSDFTR
A0A2G7GCS2      NLPQPT-TRLDT-----------------------------NLG--TLGQLQNSALGFTR
K9XBH8          NLPQST-NSINA-----------------------------SLG--TLGQLQNSGLGFSR
A0A1Z4LJ30      ILPNVT-NDSDA-----------------------------DLG--KLGSVRDGGVVFSQ
K9RI76          ILPNVT-NQSDA-----------------------------DLG--KLGNVRDEGIVFSQ
A0A352AE27      ILPDTT-SSLDA-----------------------------NLG--TLGSLTNDEPVFSN
A0A3B8JH60      ILPNTT-GDLDA-----------------------------NLG--TLGSLRNGGSGFST
A0A3C0N766      ILPNTT-GDLDA-----------------------------NLG--TLGSLRNGGSGFST
K9W9J7          ILPQKS-GNLDA-----------------------------NLG--TLGSLRNGDPGFSS
A0A139WSU3      ILPKTT-SNLDA-----------------------------NLG--TLGSLRNGDSAFSS
A0A433VN22      ILPKTT-SNLDA-----------------------------SLG--TLGTFKNGNLDFSP
Q7NF11          ILPSTN-KNAEI-----------------------------SLG--ALGEVRETGTSFSS
A0A1Z4JCS8      ILPSSNGGNLDA-----------------------------NLG--TLGSYRNSDPSFSP
A0A6P0PI80      ILPET--GKLQA-----------------------------SLG--TLGSLTKGDSELSA
A0A6P0WGT6      ILPET--GKLQA-----------------------------SLG--TLGSLTKGDSELSA
F4XTX2          ILPET--GKLQA-----------------------------SLG--TLGSLTKGDSELSA
Q7NJN6          ILPNAS-SNLSA-----------------------------NLG--PLGNIQQQGLPFSN
U5QCC3          ILPDTS-SNLSA-----------------------------SLG--PLGNLQQQGLTFST
A0A3M1SVZ4      LIEKVSSTPSVT----------------------------------GVGSEVGLLDPLTK
A0A654SFI6      -------I-EIS----------------------------------QISANVTSLDPLEN
K9SSQ0          LIEN------------------------------------------------------AP
A0A2W1JIN9      ILDGTPST-SVS----------------------------------DFGSTIAQQP----
A0A318AJV1      RIDPSL-------------------------------------------NPMSQDQGQGV
A0A6P0IC70      MLDNKQ-V-SVS----------------------------------PLGRDLSQLPNRGP
A0A6B3MUB5      MLDNKQ-V-SVS----------------------------------PLGRDLSQLPNRGP
A0A6M0B7N4      MLDNKQ-V-SVS----------------------------------PLGRDLSQLPNRGP
A0A6P0J9W3      MLDNKQ-V-SVS----------------------------------PLGRDLSQLPNRGP
A0A6P0ZWE1      MLDNKQ-V-SVS----------------------------------PLGRDLSQLPNRGP
A0A1U7N2U4      MLENKK-V-SVS----------------------------------ELGRNLSQVPANTP
A0A1D9G1F2      MLDNKK-V-SVS----------------------------------ELGDNLSQVPANTP
A0A6P0PNZ7      MLDNKK-V-SVS----------------------------------ELGDNLSQVPANTP
F4XV38          MLDNKK-V-SVS----------------------------------ELGDNLSQVPANTP
A0A6P0W137      MLDNKK-V-SVS----------------------------------ELGDNLSQVPANTP
A0A6L9Y9E2      MLDNKK-V-SVS----------------------------------ELGRNLSQVPANTP
A0A6P0SGR0      MLDNKK-V-SVS----------------------------------ELGDNLSQVPANTP
A0A6M0BK48      MLDNKK-V-SVS----------------------------------ELGDNLSQVPANTP
A0A6L9YZL1      MLDNKK-V-SVS----------------------------------ELGDNLSQVPANTP
A0A6P0KYM4      MLDNKK-V-SVS----------------------------------ELGDNLSQVPANIP
A0A6P0LSD6      MLDNKK-V-SVS----------------------------------ELGDNLSQVPANIP
A0A6P0X384      MLDEKK-V-SVS----------------------------------ELGREISQLEGEIP
A0A2P8QIL5      MLDGKQLS-LAG----------------------------------ETGRDLTQESARLD
A0A2T1FLY5      MLDGKQLS-LAG----------------------------------ETGRDLTQESARLD
A0A433W447      MLDGKQLS-LAG----------------------------------ETGRDLTQESARLD
K9U1K8          MLDGKQLS-LAG----------------------------------ETGRDLTQESARLD
K9UYB2          MVDEKRGT-SVS----------------------------------ELGRNLTQV--SNS
A0A218QN17      MQDDRR-V-SVS----------------------------------ELGRDLTQVSSGAP
K9RKN2          MLDEKQ-I-SVS----------------------------------ELGRDLTQVANSTP
A0A2I8ADV2      MVDAKG-V-SVS----------------------------------ELGRDLTQP-SVVG
A0A1W5CKM3      MLDDKK-A-SVS----------------------------------ELGRDLTQI-NSTA
A0A5Q0GMF5      MLDDKK-A-SVS----------------------------------ELGRDLTQI-NSTA
Q3MEW0          MLDDKK-A-SVS----------------------------------ELGRDLTQI-NSTA
A0A1Z4KIC7      MLDDKK-A-SVS----------------------------------ELGRDLTQI-TPTG
Q8YSM5          MLDDKK-A-SVS----------------------------------ELGRDLTQI-TPTG
A0A1Q4S1H4      MVDDKG-V-SVS----------------------------------DFGRSITQLNAGTP
A0A433VBU6      MLDSKS-V-SVS----------------------------------ALGRDITQLDAGTP
A0A1Q4RZJ6      IFDDRR-T-SVS----------------------------------ELGRDLSQTSITSA
A0A1Z4SNV3      IFDDKR-V-SVS----------------------------------ELGRDLSQTSVSGS
A0A2H2XJQ1      IFDDKR-V-SVS----------------------------------ELGRDLSQTSVSGS
A0A3S5K358      IFDDRR-T-SVS----------------------------------ELGRDLSQTSVTSP
A0A0T7BPJ4      MLDDKR-V-SVS----------------------------------DLGRDLTQVTSTTP
A0A0C1QS61      MLDSKQ-T-SVS----------------------------------ELGRNLSQVSSNTP
A0A139X3R8      MLDNKQ-T-SIS----------------------------------ELGRDLSQVSSNTP
A0A1Z4I7C5      MLEDKK-A-SVS----------------------------------ELGRDLTQINSSSV
A0A0C2MDK7      MLDDKR-V-SVS----------------------------------ELGRDLTQVSANAP
A0A1Y0RCK1      MLDDKR-V-SVS----------------------------------ELGRDLTQVSSNSP
A0A1Z4PWZ0      MLDDKR-V-SVS----------------------------------ELGRDLTQVSSNAP
A0A0C2QLT0      MQDDKR-V-SVS----------------------------------ELGRDLTQVSSNAP
A0A1Z4J2K1      MQDDKR-V-SVS----------------------------------ELGRDLTQVSSSGP
A0A3S0ZSX0      MLDDKR-V-SVS----------------------------------ELGRDLTQMPTNIP
A0A2N6K4T3      MLDQKR-V-SVS----------------------------------ELGRDLTQLSSDTP
A0A370CKT2      MLDQKR-V-SVS----------------------------------ELGRDLTQLNSGTP
A0A0S3TL97      MLDQKR-V-SVS----------------------------------ELGRDLTQLNSGTP
A0A2N6M8A0      MLDQKR-V-SVS----------------------------------ELGRDLTQLNSGTP
A0A2N6M9E1      MLDQKR-V-SVS----------------------------------ELGRDLTQLNSGTP
A0A2N6KJI4      MLDQRR-V-SVS----------------------------------ELGRDLTQLNSGTP
A0A2N6MZ77      MLDQKR-V-SVS----------------------------------ELGRDLTQLNSGTP
A0A2N6KT20      MLDQKR-V-SVS----------------------------------ELGRDLTQLNSGTP
G6FSN3          MLDQKR-V-SVS----------------------------------ELGRDLTQLNSGTP
A0A4D9CI02      ILDQKR-V-SVS----------------------------------ELGRDLTQLSPGTS
A0A328I8B9      ILDQKR-V-SVS----------------------------------ELGRDLTQLSPGTS
A0A4Q9J4Z7      ILDQKR-V-SVS----------------------------------ELGRDLTQLSPGTS
A0A0M0SU69      ILDQKR-V-SVS----------------------------------ELGRDLTQLSSATP
A0A1Z4TIZ8      ILDQKR-V-SVS----------------------------------ELGRDLTQLSPGTP
A0A0S3TYD7      LV---KKQASTTSVL------------------------GLQVDVGEIE---------SL
A0A2T1DNG3      LVEPNYQGKNS-----------------------------------GAD-----PFTDAT
A0A3S0Y9N9      VLKKNATSSLTGVGS--------------------------QLG--QLE---------NS
A0A433UNK7      VLKKNSTSSLTGVGN--------------------------QLG--QLE---------SS
A0A6P0ZKB8      VLKKNSTSSLTGVGS--------------------------QLG--QLE---------SS
U5QL42          LVD-------------NRQQIPVVQTT-------------------ESA-----LP----
A0A076HBF2      LITDPISNEGGG-RSGMANVEGTMFEQ-------------------LAR-----NT----
A0A354B169      LITDPISSENSNGNSNATALSGTMFEQ-------------------LAR-----NT----
G4FMX5          LITDPISNDSGNNSASAGGLNGSMFEE-------------------LAR-----NT----
Q0IDT5          LITDPISNEGGNNSAASSAASGTVFEQ-------------------LAR-----NT----
A0A2D6FCW3      LITDPLNNESGN-RAAAAALDGGMFEE-------------------LAR-----NT----
A3ZA21          LITDPISNEGGNGRNAAFAASGTMFEQ-------------------LAR-----NT----
A0A140K3H3      LLENQKTQQSA-----SVSPEQQSLAT---------------------G-----YY----
K9XUB8          LLENNKTQQSA-----LVSPGQQSLNT---------------------G-----YS----
A0A6H2NHD5      LVEPVTSANSLE----GDLLNLSQGTR---------------------S-----G-----
A0A2P8W4F7      LVEPVTNAPPVG----LEEVVGAQGNR---------------------G-----A-----
A0A5Q4E0Z4      LVEPVTAVNPLG----LEAMVGVAGAR---------------------N-----TS----
A0A2P8VVX1      LVEPNYQQE-------LNSSDLSSFAD---------------------Q-----DP----
A0A2P8WHY0      IVEPNYEDD-------VTARELDGLAN---------------------A-----SD----
A0A2T1CMT9      LAESNYQAKDLQD---NQRDSEEQFAD---------------------A-----NV----
A0A563VQJ3      LFRQNTAASLT-----GIGEDISSLDS---------------------I-----GV----
A0A1D8TX52      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A1D9G4T2      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6P0PR27      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6P0WER7      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
F4XP71          LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6L9YR57      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6P0KZ31      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6P0LPB8      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6P0SEV1      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6B3N2I8      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6M0B891      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6P0IJQ1      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6P0J8J8      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6P0ZSH6      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A1U7N5X9      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6L9Z1V0      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6P0LC12      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A6P0MVJ3      LVEPNYID--------KTRGIESQFTE---------------------S-----TV----
A0A2W6ZAV2      LVSDPIDASSTEG---AADSSLRALAL---------------------Q-----PQ----
K9W742          LVEPNYQSKRQD----GQEGAEKQIVD---------------------P-----NI----
A0A3D1PBA3      LIEPNYQGKRDT----DAQRPSQQYAE---------------------S-----GV----
K9XPB0          LIESNYQTKDSTRGNDNNQYLEEEFAD---------------------S-----SI----
A0A350Y7Z1      LIEPYVQQKQE-----GKPQTEEQFTD---------------------S-----NV----
A0A352X2A7      LIEPLVQEKQQ-----RRSE-ENQFTE---------------------S-----NI----
A0A0D8ZYV0      LIEANYQGRKD-----IQPGADSEFTD---------------------A-----NV----
A0A2T1FP73      LIEPNYQGKKDG----TTPRQGEQYAD---------------------S-----GV----
A0A433VMS2      LIEPNYQGKKDG----TTPRQGEQYAD---------------------S-----GV----
K9TYA7          LIEPNYQGKKDG----TTPRQGEQYAD---------------------S-----GV----
A0A2P8QUE1      LIEPNYQGKKDG----TTPRQGEQYAD---------------------S-----GV----
K9SA61          LVESNYQGRDQNG---D-RASEGQFTD---------------------S-----NV----
A0A2G7GMH8      LVEPNYQGKTDQG---QGKTTESEFAD---------------------S-----NV----
A0A6N8FU92      LVEPNYQGKSEQG---QRKTTESDFTD---------------------S-----NV----
A0A2T1DWE8      LVEPNYQSKKDSG---A--GSENQFAD---------------------S-----NV----
A0A1U7I8L3      LVEPNYQGKQEGS---K--NAENDFAD---------------------S-----NV----
A0A2T1DJL8      LSESNYRSRKTDN---P--ATPS-FAD---------------------S-----NV----
A0A1Z4J9W0      MVESNYRERRSPN---D--TRPS-FAD---------------------P-----NV----
A0A0N7Z5K9      LVESNYRERRAPG---D--NSPS-FAD---------------------P-----NV----
A0A0S3TXC5      LIESNYRERRTPG---D--NSVS-FAD---------------------P-----NV----
B8HNB0          LTGKEQSTPLGE----------------------------------EIN-----STSSYS
A0A563VS48      LIKSNKTDTLSG--F------------------------ENETG--NIE-----VI--SE
A0A318BJ18      -----EIAREASQVTNFQGVERQS----------------------SLV-----------
A0A3B8Y8H9      LV---DTPGDSNRGLPGGINSSLG----------------------NFL-----GV--ST
A0A2W1JVB9      RI---KESQSGLTEL-------------------------------DLG-----GISPLS
A0A6H1U102      LLDNEASTPLVP-----------------------------GAP--EIA-----------
A0A7C3ZEJ3      LLDKKTGVSIEP-----------------------------TVPLQDGY-----------
A0A563VLD6      LLENPQTKESAR--IVPGNMTRGS----------------------AFS-----------
A0A2P8W9H0      LTPSSTLETQIISTLNPNALSNQT----------------------EFG-----------
A0A6I5P386      LTPSVTPESKVVSNLTSEGLGDAI----------------------NSA-----------
A0A318BG22      EV---QREAPRV--LDVNSAESDS----------------------RPS-----------
A0A2T1E9V8      LF---KQDKTSS--L-------IGLDS-------------------DAQ-----AM--DS
A0A1Z4LN32      LF---RTDRTSS--L-------TGAGE--------------EIG--HLE-----SI--KR
A0A2I8A9F5      LF---QMNRTSS--L-------TGIGG--------------KIG--DLE-----SI----
A0A218Q6R8      LF---QLNRTSS--L-------TGVGG--------------RIG--DLE-----SI----
A0A218QGE0      LF---QSNQTSS--L-------TGVGE--------------KIG--HLE-----SI--KP
A0A3M2GQQ6      LVDDRSSVPVVP----------------------------------GLE-----SP--YP
A0A6H1U2X0      LVDDRSSVPVVP----------------------------------GLE-----SP--YP
K9TLQ0          LVEPIKGQDNLE----------------------------------QLNQALTRNS--GK
K9QF04          MLDSATSDSDSNPLADSPRRSAVV------------------------------PL----
K9W1T3          LI---KKNNSTSLLL-------------------------------NLD-----KIDGSA
K9SGJ5          LI---DDATISVSNL-------------------------------PVND----GLDKYS
A0A6N2JS94      LV----NSTIAVSDI-------------------------------QLP-----GLPS-S
A0A6C2DSN4      LI---NNSTIPVSDI-------------------------------QVPNAPSSGLPA-S
L8MYT6          LI---NNSTIPVSDI-------------------------------QVPNAPSSGLPA-S
A0A352JGJ6      LI---NNSTIAISDI-------------------------------QVP-----GLPG-S
A0A1J5GLS2      LI---NNSTIAVSDI-------------------------------QIP-----GLPG-T
A0A2W4W6M5      LI---NNSTIAVSDI-------------------------------QVP-----GLPS-A
A0A2W7AN33      LI----NSTISAPNI-------------------------------QPT-----GAST-S
A0A256BLV2      LV----NSTIAVSDI-------------------------------QLP-----GLST-S
A0A2W6ZXF3      LI---NNSTIAVSDI-------------------------------QVP-----GLPG-A
A0A2Z5WX66      LI---NNSTIAVSDI-------------------------------QVP-----GLPG-T
K1XF69          LF---KVDRTS-SLAGIG--EGLG----------------------ELK-----AL---L
B5W297          LF---KVDRTS-SLAGIG--EGLG----------------------ELK-----AL---L
A0A6H2AL05      LF---KVDRTS-SLAGIG--EGLG----------------------ELK-----AL---L
H1W7M8          LF---KVDRTS-SLAGIG--EGLG----------------------ELK-----AL---L
A0A5Q4H6A5      LF---KVDRTS-SLAGIG--EGLG----------------------ELK-----AL---L
D5A466          LF---KVDRTS-SLAGIG--EGLG----------------------ELK-----AL---L
U5QJM6          LL---EDKSSQTQVL-----EDAA----------------------QQI-----QLGGGA
A0A1Z4RPC6      LF---KKNSVD-SFLDLQ--SKPE----------------------QLN-----SI---L
A0A2T1CMZ0      LF---KKNTPN-ELLNLS--ENTN----------------------EFN-----SL---L
L8M4F7          LF---KSSSLA-SLTGVA--KNSS----------------------ALE-----TLNYSL
A0A140K2P2      LF---KQNSTA-SLTGVG--KNVG----------------------ELK-----PL---L
K9XWX4          LF---KQNSTA-SLTGVG--ENVG----------------------ELK-----PL---L
A0A140KB14      LF---KQNNTA-SLTKVG--QGVG----------------------ELK-----PL---L
K9XX88          LF---KQNNTA-SLTKVG--QGIG----------------------ELK-----PL---L
A0A563VSV6      LF---KQKN---NLLPVG--EGVG----------------------ELT-----TF---L
L8LZE9          LF---EPQD---NLTDLG--NPSN----------------------DLQ-----SL---T
A0A433NM31      LL---KRTGSTSTVTGLG--KELG----------------------QLD-----SLVDSP
A0A1Z4NDS1      LI---KTNNTP-SLTGLG--EAIG----------------------KLE-----SL--TR
U9VXM0          LF---ELSNQTSSLVGFE--GGTR----------------------ELR-----AL--TN
A0A6M0RI13      LF---ELSNQASALVGLE--GGNR----------------------ELR-----AL--TN
A0A6M0S1N5      LF---ELSNQASALVGLE--GGNR----------------------ELR-----AL--TN
K9F4D9          LF---ELSNQASALVGLE--GGNR----------------------ELR-----AL--TN
A0A6I5QPI5      LF---RSDRTT-SLTGLG--DDRG----------------------RVE-----IL----
A0A1Z3HMQ0      LF---QVDRST-SLTGVG--DEIG----------------------DLE-----AV--NP
A0A433W533      IV---KKNDQTAALTGLG--QGIG----------------------DLE-----GL--NL
A0A2P8QWJ3      IV---KKNDQTAALTGLG--QGIG----------------------DLE-----GL--NL
A0A2T1FKP8      IV---KKNDQTAALTGLG--QGIG----------------------DLE-----GL--NL
K9U6L7          IV---KKNDQTAALTGLG--QGIG----------------------DLE-----GL--NL
A0A1E5QP61      LF---KKQNTTSALVTDAG-AKIG----------------------QLD-----TL--TQ
U5DPF5          LL---QTADGAIPFAGFSGGSST-------------------------------------
A0A6P0X488      LL---KKRILSSLGTEAG--EQIG----------------------ELE-----AL--NN
A0A6P0UVD5      LL---KKRILSSLGTEAG--EQIG----------------------ELE-----AL--NN
A0A6P0VDM0      LL---KKRILSSLGTEAG--EQIG----------------------ELE-----AL--NN
A0A6M0G142      LL---KKRIVSSIGTEAG--EQIG----------------------ELE-----AL--NN
A0A6P0MR53      LL---KKRILSSLGTEAG--EQIG----------------------ELE-----AL--NN
A0A3M2GIL5      LI---KKRNTTSALVTEAG-AKLG----------------------ELD-----SV--YQ
A0A6H1TSJ9      LI---KKRNTTSALVTEAG-AKLG----------------------ELD-----SV--YQ
A0A3M1PML8      QV---RSSGAA-KLTGVG--EGLG----------------------ELE-----KL--TL
A0A6M8BE85      QV---RSSAAS-RLTGVG--EGLG----------------------ELE-----RL--TL
A0A0T7BPZ0      LI---RTNRTS-SLTGLG--GDIG----------------------RLE-----SL--TQ
A0A352X442      LI---QKDRSA-SLTGLD--EALS----------------------QFD-----KL--AQ
A0A6B3NF44      LF---KEDNSS-SLTGLE--NEIG----------------------ELK-----GL--TN
A0A6M0EPL4      LF---KEDNSS-SLTGLE--NEIG----------------------ELK-----GL--TN
A0A6P0K6L6      LF---KEDNSS-SLTGLE--NEIG----------------------ELK-----GL--TN
A0A6P0MRR9      LL---KEDRSAGALTGLEGLDEAG----------------------RLK-----GL--TS
A0A6P0UX57      LL---KEDRSAGALTGLEGLDETG----------------------RLK-----GL--TT
A0A6P0X1X4      LL---KEDRSAGALTGLEGLDETG----------------------RLK-----GL--TT
A0A0M0SHU3      LI---KTNRTS-SLTGLG--EDIG----------------------RIE-----SL--VR
A0A1D2PBN3      LI---KTNRTS-SLTGLG--EALG----------------------RLE-----SL--GV
A0A0C2LVR7      LI---KTNRTS-SLTGLG--EALG----------------------RLE-----SL--GV
A0A1Z4PQB9      LI---KTNRTS-SLTGLG--EALG----------------------RLE-----SL--GV
A0A1Z4SFN6      LV---KTNRST-SLTGLG--ESIG----------------------RIE-----SL--TN
K9PGI8          LI---KTNRSA-SLTGLG--EGIG----------------------QVD-----SL--VN
Q7NEU3          LLE---DRNSQPKVL------------------------ADEAS--PMS-----YF--AS
A0A3C0N2P0      LVGPVSSSEDKLGKL------------------------AQSLN--EGG-----GS--SS
A0A6P0JR04      LVEPI-AGEASFDQF------------------------SQRLI--GQL-----GF--EL
A0A6B3M6M6      LVEPV-TGEQKLDQL------------------------NQSLK--TTA-----GI--QT
A0A6P0KD09      LVEPV-TGEQKLDQL------------------------NQSLK--TTA-----GI--KA
A0A6B3NIJ0      LVEPV-TGEQKLDQL------------------------NQSLK--TTA-----GI--KA
A0A6M0F053      LVEPV-TGEQKLDQL------------------------NQSLK--TTA-----GI--KA
A0A6P2ATU9      LVEPI-ASEQQFDQF------------------------SQRLI--GQL-----GL--DF
A0A352XE00      LIGPV-SGGDRLDEL------------------------SQSLA--QNT-----GS--QG
A0A6P0QC14      LVGPV-SGEDQVDKL------------------------TQSLG--QNV-----GI--EV
B4VS56          LVGSV-SGEDQLEQI------------------------SESLN--QSA-----GV--QT
A0A352AAQ3      LVGSV-SGEDRVEQL------------------------TEALS--KTA-----NI--QV
A0A350Y472      LVGSP-SGEDQAEQL------------------------TEALS--KTG-----TV--QV
A0A355DVB4      LVGSP-SGEDQAEQL------------------------TEALS--KTG-----TV--QV
A0A1Z4RMB9      LF---KQTSAAS--Y-------TG-IG------------E-EAG--TLK-----PI--LN
A0A318B4H2      EI---QRSQAKV--V--------------------------NVGGLEME-----DR--SR
B4WQE3          LTPLVTLETQIISTISPDALSNQS---------------E-SVG----------------
A0A2K3BR24      LF---QGESQAL-----------------------------ALP--TLE-----QQ--GN
K9YXY1          LF---QGESQAL-----------------------------ALP--TLE-----QQ--GN
A0A0V7ZFJ4      RFN---SDRVSA--L-------TA-LN------------S-QMG--EVA-----AI--TG
A0A0V7ZNJ9      LFN--KQSNVSS--L-------TG-LS------------G-AVG--ELS-----GI--TN
A0A367RIS1      LFN--KESGLSS--L-------TG-VN------------E-QLG--QLS-----GV--TN
A0A235IXQ2      LFN--KQSGVSS--L-------TG-VN------------E-QLG--QLS-----GV--TN
A0A1W5CNX3      LFN--KQSGVSS--L-------TG-VS------------E-QLG--QLS-----GV--TN
A0A5Q0GJJ5      LFN--KQSGVSS--L-------TG-VS------------E-QLG--QLS-----GV--TN
Q3MEB7          LFN--KQSGVSS--L-------TG-VS------------E-QLG--QLS-----GV--TN
A0A1Z4KHN9      LFN--KQSGVSS--L-------TG-VS------------E-QLG--QLS-----GV--TN
Q8YT70          LFN--KQSGVSS--L-------TG-VS------------E-QLG--QLS-----GV--TN
A0A166IWU6      IFD--KQNSVSS--L-------TG-VS------------E-GVG--ELS-----GL--TS
A0A2S0Q8C0      IFD--KQNSVSS--L-------TG-VS------------E-GVG--ELS-----GL--TN
W6FSX4          IFD--KQNSVSS--L-------TG-VS------------E-GVG--ELS-----GL--TS
A0A218Q4C1      IFD--KQSSVSS--L-------TG-VS------------E-RVG--ELS-----RL--TN
A0A6P1ZT04      IFD--KQSSVSS--L-------TG-VS------------E-RVG--ELS-----GL--TN
A0A0R0M9H9      LFE--KKDGVSS--L-------TS-LA------------T-SVG--ELG-----GI--GN
A0A1S1ZVW2      LFE--KKDGVSS--L-------TS-LA------------T-SVG--ELG-----GV--GN
A0A1B7WX82      VFT--KKGVASS--L-------TTNIS------------Q-QMG--ELG-----GL--TN
A0A1B7WTD1      VFT--KKDAASS--L-------SS-LS------------D-KMG--ELG-----GL--TN
A0A480ABC0      VFT--KKDAASS--L-------SS-LS------------D-KMG--ELG-----GL--TN
A0A1Z4LRU5      RFD--KNNNVSS--L-------SG-LG------------G-QIG--ELS-----GI--TN
A0A1Z4JVB4      IFN--KQNGISS--F-------SD-IA------------A-KAG--ELR-----GL--TS
K9PIA4          LFN--KQNGVSS--L-------TG-FS------------S-KMG--ELG-----GL--TN
A0A1Z4HVE1      LFN--KQNGVSS--L-------TG-LS------------S-QVG--ELS-----GL--TN
A0A252ECZ1      LFN--KQSGVSS--L-------SG-LS------------S-QVG--ELS-----GL--TN
A0A1Z4G5Y1      LFN--KQSGVSS--L-------TG-LS------------S-QVG--ELS-----GL--TN
A0A252DNA2      LFN--KQSGVSS--L-------TG-LS------------S-QVG--ELS-----GL--TN
A0A252E1Q4      LFN--KQSGVSS--L-------TG-LS------------S-QVG--ELS-----GL--TN
A0A6G9SK36      LFD--KQNGVSS--L-------TG-IS------------A-QVG--ELS-----GL--TN
A0A1Z4M597      LFN--KQNGVSS--L-------TG-LS------------S-QVG--ELS-----GL--TN
A0A1Z4MWT1      LFN--KQNGVSS--L-------TG-LS------------S-QVG--ELS-----GL--TN
A0A1Z4TX53      LFN--KQNGVSS--L-------TG-LS------------S-QVG--ELS-----GL--TN
A0A5P8VSD1      LF---NNQSPSS--L-------TA-VS------------Q-QLG--QLT-----GL--TT
A0A2A2TNQ5      LL---KQNEASN--L-------TG-LN------------Q-KLG--ELS-----GL--TN
A0A3S1C4K5      LI---KNNGASS--L-------TG-LS------------E-KVG--ALS-----AL--TN
A0A1X4G3D5      LFEGDRVSSLTR--L-------GG-LA------------E-LAQ--LTG-----AT--GS
D4TNI2          LFEGDRVSSLTR--L-------GG-LA------------E-LAQ--LTG-----AT--SS
A0A1Z4H6Z8      LFN--KQSGASS--L-------SG-LS------------S-QVG--ELS-----GL--TN
A0A1Z4NPM1      ML---KQNSSSS--L-------IG-LS------------D-KLG--ELS-----GL--TN
A0A3F3KPR9      LFE--KKDGVSS--L-------TS-LA------------T-SVG--ELG-----GL--GN
D4TGN7          LFE--KKDGVSS--L-------TS-LA------------T-SVG--ELG-----GL--GN
A0A1Z4UZW9      VFT--KKSGASS--L-------TS-LS------------Q-QMG--ELG-----AL--TN
A0A0K2M5H0      VFT--KKSGASS--L-------SS-LS------------Q-QMG--ELG-----AL--TN
A0A1B7VSH4      VFT--KKSGASS--L-------SG-LS------------Q-QMG--ELG-----AL--TN
A0A1B7W126      VFT--KKSGASS--L-------SG-LS------------Q-QMG--ELG-----AL--TN
A0A3D4C6Q6      VFT--KKSGASS--L-------SG-LS------------Q-QMG--ELG-----AL--TN
A0A1B7UVJ4      VFT--KRSGASS--L-------AD-IS------------Q-SMG--ELG-----GL--TN
A0A1B7UTR1      VFT--KRSGASS--L-------AD-IS------------Q-SMG--ELG-----GL--TN
K7W0A4          VFT--KKSGASS--L-------AG-LS------------Q-SLG--ELG-----GL--TN
A0A5C0DRW9      VFT--KKSGASS--L-------AG-LS------------Q-SLG--ELG-----GL--TN
A0A6H2C088      VFT--KKSGASS--L-------AG-LS------------Q-SLG--ELG-----GL--TN
A0A1Q4RTR1      TF---NKAN-----LYSSLTGITG-GQ--------------ELE--MLG-----RG--AN
A0A1Z4SQV2      LF---NRAN-----LYSSLTGITE-SQ--------------NID--V-------PG--IN
A0A2H2XGN1      LF---NRAN-----LYSSLTGITE-SQ--------------NID--V-------PG--IN
A0A433UXH8      LF---NKAN-----LYSSLTGITE-GQ--------------NID--V-------PG--IN
A0A1U7HGH0      LF---RQDRSSS--L-------IG-LQ--------------SAT--QAN-----PT--TQ
K9XJD3          LF---RQDRSSS--L-------IG-LQ--------------SAT--QAN-----PT--TQ
K9SX01          LF---KSQRQSN----------TL-TG------------VNSVA--QIS-----DT--VA
A0A4P7ZT55      LV---SDPLSEDRQL-------GG-PS------------N-QLS--DLA-----LV--NP
A0A1E5QIR9      LF---KKNNVTT--------NVTV-VG------------K-EVP--EIH-----SP----
A0A1Z4IBC7      MI---MTNRTFS--L-------TG-LP------------Q-DIG--KLE-----PL--NV
A0A1W5CPC7      MI---KTNRTSS--L-------TG-LP------------Q-DIG--RLE-----PL--NV
A0A5Q0GKD1      MI---KTNRTSS--L-------TG-LP------------Q-DIG--RLE-----PL--NV
Q3MDC6          MI---KTNRTSS--L-------TG-LP------------Q-DIG--RLE-----PL--NV
A0A1Z4KM73      MI---KTNRTSS--L-------TG-LP------------Q-DIG--RLE-----PL--NV
Q8YNX7          MI---KTNRTSS--L-------TG-LP------------Q-DIG--RLE-----PL--NV
A0A367R4K6      MI---KTNRTSS--L-------TG-LP------------E-DIG--RLE-----AL--NV
A0A1E2WSV8      MI---KTNRSSS--L-------TG-LP------------Q-DIG--RLE-----AL--NV
A0A2R5FRT9      MI---KTNRSSS--L-------TG-LS------------E-DIG--RLE-----AL--NV
A0A2K8T1B6      MI---KTNRSSS--L-------TG-LS------------Q-DIG--RLE-----AL--NV
A0A235I9I0      MI---KTNRSSS--L-------TG-LP------------D-DIG--RLE-----AL--NV
A0A2D0HQT8      MI---KTNRSSS--L-------TG-LP------------D-DIG--RLE-----AL--NV
A0A2L2NU95      MI---KTNRSSS--L-------TG-LP------------D-DIG--RLE-----AL--NV
A0A367S084      MI---KTNRSSS--L-------TG-LP------------D-DIG--RLE-----AL--NV
A0A6P1A9A0      LV---GQLTNEQ--I------------------------N-PLA--EQA-----GV--ST
A0A1Z4SMD6      LF---QSNRTSS--L-------TK-VG------------E-KIG--DLE-----SV--MR
A0A2H2Y096      LF---QSNRTSS--L-------TK-VG------------E-KIG--DLE-----SV--MR
K9S8M8          LL---KKKNTTSALV-------TD-AS------------A-KVG--ELD-----TL--SD
A0A1Z4NFV0      LF---QSNRTSA--Y-------TK-IG------------E-NTG--SLE-----SL--RH
A0A3M9ZEU1      LV---KADRSSS--L-------VG-LT------------KVETG--ELQ-----AL--TT
A0A1Z4JK72      LV---QSNRTTS--L-------TG-VG------------E-KVG--TLE-----SL--KR
A0A0N7Z489      LV---QSNRTTS--L-------TG-VG------------E-RVG--TLE-----AL--RR
A0A0S3TXS2      LV---QSNRTTS--L-------TG-VG------------E-RVG--TLE-----AL--RR
A0A2A2TPF8      LF---QANRTNS--L-------TG-VD------------G-KFR--DLE-----SI--RR
A0A1Z4R0P8      LF---QANRTNS--L-------TG-VD------------G-KFR--DLE-----SI--RR
A0A0T7BUI3      LF---KSDRISS--L-------TK-AG------------E-KIG--DLE-----SL--IR
A0A1Z4LP32      LF---KSDRISS--L-------TK-AG------------E-KIG--DLE-----SL--MR
K9REP9          LF---KSDRISS--L-------TK-AG------------E-KIG--DLE-----SL--MR
A0A1Z4SIJ3      LF---KSDRISS--L-------TK-AG------------E-KIG--DLE-----SL--MR
A0A2H2XPG4      LF---KSDRISS--L-------TK-AG------------E-KIG--DLE-----SL--MR
K9V3C7          LF---QTNRTSS--L-------TG-VG------------E-KIG--SLE-----SF--RN
A0A1Z4T6Y7      LF---QTNRASF--L-------TG-VG------------E-KIG--DLE-----TV--RR
A0A2H2Y561      LF---QTNRASF--L-------TG-VG------------E-KIG--DLE-----TV--RR
A0A1Q4S362      LF---QANRASL--L-------TG-VG------------E-KVG--DLE-----SV--RR
A0A3S1CIN8      LF---QANRASL--L-------TG-VG------------E-KVG--DLE-----SV--RR
A0A2A2TC28      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----SL--MR
A0A0C1NCB0      LI---QSDRTSS--L-------TK-AG------------E-KIG--HLE-----SL--MR
A0A2N6K7Q9      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A2N6MXH6      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A2N6M5A8      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A2N6LL61      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A0S3TP66      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
G6FP91          LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A1U7GYR5      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A2N6KY52      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A2N6KMP5      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A2N6MA45      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A4Q9J9V9      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A328IGA1      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A4D9CE41      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A0M0SFT2      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A1Z4TLC8      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----AL--MR
A0A0C2LFH0      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----SL--MR
A0A1Z4IYV4      LF---QSDRTSS--L-------TK-VG------------E-KIG--DLE-----SL--MR
A0A1Z4Q0T6      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----SL--MR
A0A0C2PT44      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----SL--MR
A0A1D2P6J4      LF---KSDRTSS--L-------TK-VG------------E-KIG--DLE-----SL--MR
B4WP72          LI---KGGRTSS--L-------TG-LN------------V-DIG--ELE-----AL--DS
A0A2T1CIL7      LI---RIDKSSQ--L-------VG-LE------------E-ERG--QIE-----VI--GK
A0A433V7A0      LF---RVDTTPF--LIGIKTKD-----------------E-NVS--PLV-----PL--TF
A0A2T1FTR8      IL---KKTNKTS--ALLSSATNAA-SG------------G-AIG--ELE-----GL--TG
K9UA41          IL---KKTNKTS--ALLSSATNAA-SG------------G-AIG--ELE-----GL--TG
A0A0C2LBE2      LI---KTNRTSS--L-------TG-LG------------E-AIG--RLD-----TL--TM
A0A433NN38      LI---KTNRTSS--L-------TG-LG------------E-DLG--RLE-----AL--VS
A0A2N6K0T2      LI---KTNRTSS--L-------TG-LG------------E-DLG--RLE-----SL--VQ
A0A2N6ML72      LI---KTSRTSS--L-------TG-LG------------E-DLG--RLE-----SL--VQ
G6FQZ6          LI---KTSRTSS--L-------TG-LG------------E-DLG--RLE-----SL--VQ
A0A2N6MQX9      LI---KTSRTSS--L-------TG-LG------------E-DLG--RLE-----SL--VQ
A0A2N6KXT6      LI---KTSRTSS--L-------TG-LG------------E-DLG--RLE-----SL--VQ
A0A2N6KGB9      LI---KTSRTSS--L-------TG-LG------------E-DLG--RLE-----SL--VQ
A0A2N6L3Y5      LI---KTSRTSS--L-------TG-LG------------E-DLG--RLE-----SL--VQ
A0A0S3TIS7      LI---KTSRTSS--L-------TG-LG------------E-DLG--RLE-----SL--VQ
A0A1U7GW28      LI---KTSRTSS--L-------TG-LG------------E-DLG--RLE-----SL--VQ
A0A2N6LW63      LI---KTSRTSS--L-------TG-LG------------E-DLG--RLE-----SL--VQ
A0A328IH74      LI---KTNRTSS--L-------TG-LG------------E-DIG--RLE-----SL--VR
A0A4D9CIB0      LI---KTNRTSS--L-------TG-LG------------E-DIG--RLE-----SL--VR
A0A1Z4TQ63      LI---KTNRASS--L-------TG-LG------------E-DIG--RLE-----SL--AE
A0A4Q9J8G2      LI---KTNRASS--L-------TG-LG------------E-DLG--RLE-----SL--AE
A0A350Y0P6      LL---QKRSATS--ALVTEAG------------------E-KIG--QLE-----AL--NN
A0A352X940      LL---QKKNKTS--ALVTKAG------------------E-KIG--ELD-----SL--NA
B8HTN4          LL---KDSENPL--ASMGA--------------------T-SVG--NLV-----AL--GG
A0A6P1AFJ5      LV---EPVTTDP--TT-----------------------N-IVA--ENQ-----PL--SA
B0CAX4          LL---KKQGGAT--IADLEI-------------------G-GLG--GLE-----AL--SS
A0A1Z4RN12      LI---KPDRTSK--L-------IG-ID------------T-NPE--EIK-----GL--TQ
A0A2T1CMF9      LI---EPEQTSR--R-------IG-IE------------D-GNP--EVK-----KT--VL
Q7NDC5          LF---KQKDTAI--DNPT-AVGLR---------------G-ALG--QMG-----S---VA
U5QGK3          LF---KQKDTAV--GSENPARSLR---------------G-SLG--QLD-----S---VA
A0A2W4UY24      LF---ESSKPVT--AIVGLD-------------------T-GEG--NLT-----PL--TS
A0A0D8ZUV2      LL---KRVNETS--AATGLGS--------------------QIG--ELD-----TL--AQ
A0A433VDI0      ML---KKVDWAS--AATGVGE--------------------QIG--ELD-----TL--AQ
A0A3D1PG43      LL---KKIDNAS--SVTELSQ------------------T-DNS--ELE-----PL--SQ
A0A2P8QQ72      LL---KKPSETS--SLN--PE------------------K-YEP--RLE-----PL--SA
K9TZQ7          LL---KKPSETS--SLN--PE------------------K-YEP--RLE-----PL--SA
A0A6N8G584      LF---KRADRTT--AISGLKD------------------I-NVG--ELE-----AI--AA
A0A2G7GPR0      LF---KRADRTT--AISGLKD------------------I-NVG--ELE-----AI--AT
K9XH68          LF---RKADRTT--AISGLKD------------------I-NVG--ELE-----AL--AT
A0A1U7HW70      LF---RKADRTT--AISGLKD------------------I-NVG--ELE-----AI--AT
A0A2S6VEJ8      LF---RKADRTA--AISGLKD------------------I-NVG--ELE-----AL--AA
A0A140KBA0      MI---KTNKSAK--L-------TG-LE------------N-DIG--KIE-----VL--TN
K9XSG1          MI---KTNKSAK--L-------TG-LE------------N-DIG--KIE-----VL--TN
A0A2T1GMT4      LF---KNSTFRV--IGPNLIPNSM-EG------------S-ESG--DLK-----SL--VS
K9UI51          LF---KNSTFRV--IGPNLIPSNM-EG------------S-ESG--DLK-----SL--VS
K9QM62          LF---RIPAFNI--VGSNLLPNSS-EG------------E-FRG---LR-----AL--VS
A0A1Z4FWI3      LF---KSPSFNV--VGTNLLPNGS-EG------------Q-ATG--DLK-----SL--VS
A0A1Z4JYE7      WF---RIPSFKT--IGTNLLPNNN-EG------------D-AAG--DLK-----SL--VS
A0A2T1FXY4      LF---KTPSFNV--VGSNLLPSIS-EG------------Q-ETG--DLR-----AL--VS
K9TYI2          LF---KTPSFNV--VGSNLLPSIS-EG------------Q-ETG--DLR-----AL--VS
A0A1Z4QL41      LF---KVPSFQI--LGTNLLPNSS-EG------------G-GIG--DLK-----PL--VS
A0A252D4T4      LF---KTPSFNV--VGTNLLPSDS-EG------------G-TSG--DLK-----PL--VS
A0A252DJH5      LF---KTPSFNV--VGTNLLPSDS-EG------------G-TSG--DLK-----PL--VS
A0A252EB80      LF---KTPSFNV--VGTNLLPSDS-EG------------G-GSG--DLK-----PL--VS
A0A6G9SKZ9      LF---KTPSFSV--VGADLLPSES-E---------------ARG--DLR-----PL--VS
A0A1Z4HPW5      LF---KTPSFNV--VGTELLPTET-Q---------------ARG--DLR-----PL--VS
A0A1Z4MSN1      LF---KTPSFNV--VGSELLPSES-Q---------------ARG--DLR-----PL--VS
A0A1Z4U1C2      LF---KTPSFNV--VGSELLPSES-Q---------------ARG--DLR-----PL--VS
A0A0D6KV51      LF---KTPTFNV--VGSELLPSES-Q---------------ARG--DLR-----PL--VS
A0A1Z4MKF8      LF---KTPTFNV--VGSELLPSES-Q---------------ARG--DLR-----PL--VS
A0A2C6WC43      LF---RIPSFKV--VGSNLLPTTT-EG------------G-STG--DLK-----SL--IA
A0A1Z4L5A1      LF---RIPSFKV--VGSNLLPTTT-EG------------G-STG--DLK-----SL--IA
A0A367QD86      LF---RIPSFKV--VGSNLLPTTT-EG------------G-STG--DLK-----SL--IA
A0A235IZ96      LF---RVPSFKV--AGSNLSPGSS-EG------------G-DSG--DLK-----AL--VA
A0A2L2NGP0      LF---RVPSFKV--AGSNLSPGSS-EG------------G-DSG--DLK-----AL--VA
A0A2K8SM78      LF---RIPSFKV--VGSNLFPTNA-EG------------G-DPG--DLK-----SL--LA
A0A2R5FPC0      LF---RIPSFKV--VGSNLFPTNA-EG------------G-DPG--DLK-----SL--LA
A0A5P8W5T6      LF---RIPSFKV--VGSNLLPTNT-EG------------G-DAG--DLK-----SL--LA
A0A0F5YE28      LF---KVDRTSS--L-------AG-IG------------E-GLG--ELK-----AL--LA
U7QEH7          LF---KVDRTSS--L-------AG-IG------------E-GLG--ELK-----AL--LA
A0A3S1ATK5      LF---KLPSFQV--LGNNLLRSNS-EG------------E---G--DLK-----SL--VS
A0A2Z6CPH0      LF---RMPSFKT--VGTNLLPNNN-EG------------D-QAG--DLK-----SL--VS
A0A1Z4GT50      LF---KTPSFKV--IGSNLLPNNS-EG------------E-EA---DLK-----PL--VS
A0A1Z4GIX0      LF---RMPSFNV--VGTNLLPSNN-EG------------E-ETG--DLR-----SL--VS
A0A2H6LC24      LF---RMPSFNV--VGTNLLPSNN-EG------------E-ETG--DLR-----SL--VS
B2J6N5          LF---RIPSFKV--VGSNLLPTNT-EG------------G-DAG--DLK-----SL--LA
A0A367RMI4      LF---RVPSFKV--AGNNLYPDTS-EG------------G-DAG--DLK-----PL--VA
A0A235HUM0      LF---RVPSFKV--AGNNLSPGTS-EG------------G-DSG--DLK-----PL--VA
A0A2L2NW47      LF---RVPSFKV--GGNNLSPGTA-EG------------G-DSG--DLK-----PL--VA
A0A1E2WUR1      LF---RLPSFKV--AGTNLSPGSS-EG------------G-DSG--DLK-----PL--VA
A0A235IKU3      LF---RVPSFKV--AGSNLSPGSS-EG------------G-DSG--DLK-----AL--VA
A0A1U7MYU6      LF---KIDRTAF--L-------TG-LG------------E-EIE--QLR-----PL--VD
A0A1D8TNX9      LF---KIDRTAF--L-------TG-LG------------E-EID--QLR-----PL--VD
A0A6P0L6C2      LF---KIDRTAF--L-------TG-LG------------E-EID--QLR-----PL--VD
A0A6P0MVH0      LF---KIDRTAF--L-------TG-LG------------E-EID--QLR-----PL--VD
A0A6P0KJV0      LF---KIDRTAF--L-------TG-LG------------E-EIE--QLR-----PL--VD
A0A6L9ZJG4      LF---KIDRTPF--L-------TG-LG------------E-EIE--QLR-----PL--VD
F4XKF3          LF---KIDRTAF--L-------TG-LG------------E-EID--QLR-----PL--VD
A0A1D9FX10      LF---KIDRTAF--L-------TG-LG------------E-EID--QLR-----PL--VD
A0A6P0Q0T0      LF---KIDRTAF--L-------TG-LG------------E-EID--QLR-----PL--VD
A0A6P0W5I0      LF---KIDRTAF--L-------TG-LG------------E-EID--QLR-----PL--VD
A0A3C0NJ41      LF---KVNRTAS--L-------TG-VGQVERLEGGQTAQQ-PVG--GLG-----AL--TQ
A0A352AG88      LF---KVSRTAD--L-------TG-VG------------Q-QVG--ELA-----PL--TT
A0A350Y374      LF---KVNRTTS--L-------TG-LG------------K-EVG--NFA-----PL--TT
A0A355DPX0      LF---KVNRTTS--L-------TG-LG------------K-EVG--NFA-----PL--TT
                                                                            

K9SLA9          -PGDR----LANEAAVIKSNAIAKEVVGVLNQT----------------AT---------
A0A168TT23      -VEQF----YQTQYEILRGRQLAENVVEKLEVWDHPELSGEI-------SQRNLYRELRA
A0A0M1JWX9      GSGVD----YQSQIALLRSPKLMEPIIQQLKPK----------------YP---------
A0A2T1M1V6      -EVNP----LYTQSAILMSDSVLGRVLTVDPEK---------------------------
A0A2G7GCS2      -ELNP----LQIQMTILTSDTVMERALAVDPEK---------------------------
K9XBH8          -ELNP----LQTQLSILTSDTVMQRVLSVDPEK---------------------------
A0A1Z4LJ30      -QINP----LNILSSVAMSDRVIQEVWQNDPEK---------------------------
K9RI76          -QLNP----LNILSSIATSDHVVEEVWQNDPEK---------------------------
A0A352AE27      -QLNP----LKVQAYILTSDALMQRLWASDTEN---------------------------
A0A3B8JH60      -EVNP----LKVQASILTSDELLQKARAIDPEK---------------------------
A0A3C0N766      -EVNP----LKVQASILTSDELLQKARAIDPEK---------------------------
K9W9J7          -EVNP----LKVQASILTSDALLEQVLVSDPQK---------------------------
A0A139WSU3      -EVNP----LNVQASILTSDTLLEKVLASDPER---------------------------
A0A433VN22      -ELNP----LKVQTSILMSDALLEKVLDSDPEK---------------------------
Q7NF11          -EVNA----LKVQSAILTSSEVLSKAWQADPQR---------------------------
A0A1Z4JCS8      -QVNP----LKIQEAILTSDAILEKAWAADPER---------------------------
A0A6P0PI80      -KSHP----LNMQASILKSDALMRRLLESDPEK---------------------------
A0A6P0WGT6      -KSHP----LNMQASILKSDALMRRLLESDPEK---------------------------
F4XTX2          -KSHP----LNMQASILKSDALMRRLLESDPEK---------------------------
Q7NJN6          -ELNP----TSIQSNILLSSDVLRPVWQKDPER---------------------------
U5QCC3          -ELSP----TTIQSNILLSDSVLRRVWLKDPEK---------------------------
A0A3M1SVZ4      E-NSP----LDTEAEIISSVPIVEQTIAAL-------QLKNSE------GK---------
A0A654SFI6      ESRVSELQYLNTQYELLESRFMATRVADAASLETDPAFIEAFD------LD---------
K9SSQ0          TDGNS----LSTQAAILASRPLIETALPKIPA-----NLSTNL------SK---------
A0A2W1JIN9      -GNGA----LANQEEIVSSKRLLERAL----------QSYRQQ------WD---------
A0A318AJV1      IGAET----METEAGLMASRGLAVAVVRKLHLDR---DPEFAS------PS---------
A0A6P0IC70      GGANP----IANQAELVKSQRILQQAIDQVFS-----QYVSNL------VT---------
A0A6B3MUB5      GGANP----IANQAELVKSQRILQQAIDQVFS-----QYVSNL------VT---------
A0A6M0B7N4      GGANP----IANQAELVKSQRILQQAIDQVFS-----QYVSNL------VT---------
A0A6P0J9W3      GGANP----IANQAELVKSQRILQQAIDQVFS-----QYVSNL------VT---------
A0A6P0ZWE1      GGANP----IANQAELVKSQRILQQAIDQVFS-----QYVSNL------VT---------
A0A1U7N2U4      GEASP----IATQAELVGSQRVLQGALYQI-------GILGSS------PE---------
A0A1D9G1F2      GGADP----IATQAELVGSERLLQGALDEI-------ALLGSS------QE---------
A0A6P0PNZ7      GGADP----IATQAELVGSERLLQGALDEI-------ALLGSS------QE---------
F4XV38          GGADP----IATQAELVGSERLLQGALDEI-------ALLGSS------QE---------
A0A6P0W137      GGADP----IATQAELVGSERLLQGALDEI-------ALLGSS------QE---------
A0A6L9Y9E2      GGANP----IATQAELVGSERVLQRALDEI-------ALLGTS------DE---------
A0A6P0SGR0      GGANP----IATQAELVGSERVLEGALYQI-------GILGSS------QE---------
A0A6M0BK48      GGADP----IATQAELVGSERVLQGALDEI-------ALLGSS------PE---------
A0A6L9YZL1      GGADP----IATQAELVGSERVLQGALDEI-------ALLGSS------PE---------
A0A6P0KYM4      GGADP----IATQAELVGSERVLQGALYQI-------ALLSSS------PE---------
A0A6P0LSD6      GGADP----IATQAELVGSERVLQGALYQI-------ALLSSS------PE---------
A0A6P0X384      GQESP----LATQVELIKSQPVLLRTINQLFP----------N------EE---------
A0A2P8QIL5      --SNP----VATQAELALSQKVLRQAIYEAYT-----ANNRNS------NA---------
A0A2T1FLY5      --SNP----VATQAELALSQKVLRQAIYEAYT-----ANNRNS------NA---------
A0A433W447      --SNP----VATQAELALSQKVLRQAIYEAYT-----ANNRNS------NA---------
K9U1K8          --SNP----VATQAELALSQKVLRQAIYEAYT-----ANNRNS------NA---------
K9UYB2          PGNSP----LANQAEVVKSERVLQKALEIASA-----KTSPET------LN---------
A0A218QN17      GGPSP----LANEAELVKSQRVLERAIALASL-----KSYNGS------PP---------
K9RKN2          GGPSP----LADQAELVKSQRVLEKAIKIFSS-----QYKIKN------DQ---------
A0A2I8ADV2      RSSNP----LADQAELVKSQAVLDQAIKTLA---------SKH------PQ---------
A0A1W5CKM3      IGRNP----LADQAELLKSQTVLQLAISKLNP-----PIKDSS------TQ---------
A0A5Q0GMF5      IGRNP----LADQAELLKSQTVLQLAISKLNP-----PIKDSS------TQ---------
Q3MEW0          IGRNP----LADQAELLKSQTVLQLAISKLNP-----PIKDSS------TQ---------
A0A1Z4KIC7      VGRNP----LADQAELLKSQTVLQLAISKLNP-----PIKDSS------TQ---------
Q8YSM5          VGRNP----LADQAELLKSQTVLQLAISKLNP-----PIKDSS------TQ---------
A0A1Q4S1H4      GGASA----LGDQAELIKSQQVLEKALTALKA-----NSQTAS------QA---------
A0A433VBU6      GGASP----LADQAELIKSQQVLEKALTALKA-----NPQTAS------SS---------
A0A1Q4RZJ6      G-NSP----LANQAELIKSERILTQALAIAGN-----SDGGQN------GS---------
A0A1Z4SNV3      G-NSA----LANQAELIKSERILNQALAI--------AETSEA------GR---------
A0A2H2XJQ1      G-NSA----LANQAELIKSERILNQALAI--------AETSEA------GR---------
A0A3S5K358      G-NSP----LANQAELIKSERILTQALAIVGNSDVENSEDGQN------GS---------
A0A0T7BPJ4      GGPSP----LADQAELVKSEKVLEKAIAATYP-----PG----------VK---------
A0A0C1QS61      GGPSP----LADQAELVKSQRVLNRALQIFKS-----SYK---------ST---------
A0A139X3R8      GGPSP----LADQAELAKSQRVLNRALQIFQS-----SHK---------TN---------
A0A1Z4I7C5      G-RNP----LADQAEFLKSQPVLQLAISKLNR-----QQG-NS------TQ---------
A0A0C2MDK7      G-ISP----LADQAELIKSQRVLERAIAIAFP-----QTKGNL------SL---------
A0A1Y0RCK1      G-NSP----LADQAELIKSQRVLERAIAIAFP-----QIKGNL------SQ---------
A0A1Z4PWZ0      G-ISP----LADQAELVKSQRVLERAIAIAFP-----EIKGNL------SL---------
A0A0C2QLT0      G-ISP----LADQAELIKSQRVLERAIAIAFP-----EIKGNL------QR---------
A0A1Z4J2K1      G-ISP----LADQAELIKSQRVLEQAVAIAFP-----EIKGNL------QR---------
A0A3S0ZSX0      GGPSP----LADQAELIKSQRVLRRAIARVIP-----QLNSSS------LS---------
A0A2N6K4T3      GGSNP----LADQAELIKSQRVLQRALTEVTA-----ESGFRS------PE---------
A0A370CKT2      GGSNP----LADQAELIKSQRVLQRALTEVTA-----ESGFRS------PE---------
A0A0S3TL97      GGSNP----LADQAELIKSQRVLQRALTEVTA-----ESGFRS------PE---------
A0A2N6M8A0      GGSNP----LADQAELIKSQRVLQRALTEVTA-----ESGFRS------PE---------
A0A2N6M9E1      GGSNP----LADQAELIKSQRVLQRALTEVTA-----ESGFRS------PE---------
A0A2N6KJI4      GGSNP----LADQAELIKSQRVLQRALTEVTA-----ESGFRS------PE---------
A0A2N6MZ77      GGSNP----LADQAELIKSQRVLQRALTEVTA-----ESGFRS------PE---------
A0A2N6KT20      GGSNP----LADQAELIKSQRVLQRALTEVTA-----ESGFRS------PE---------
G6FSN3          GGSNP----LADQAELIKSQRVLQRALTEVTA-----ESGFRS------PE---------
A0A4D9CI02      GNSNP----LADQAELIKSQRVLQKALAKVAA-----ESGFSS------PE---------
A0A328I8B9      GNSNP----LADQAELIKSQRVLQKALAKVAA-----ESGFSS------LE---------
A0A4Q9J4Z7      GNSNP----LADQAELIKSQRVLQKALAKVAA-----ESGFSS------VE---------
A0A0M0SU69      GGSNP----LADQAELIKSQRILQKALTKVAA-----ESGFSL------PE---------
A0A1Z4TIZ8      GGSNP----LADQAELIKSQRVLQKALAKVSA-----ESGFSP------PG---------
A0A0S3TYD7      DKSGP----LTTQAELIKSLPIVQRTIEDLNLQ----------------DD---------
A0A2T1DNG3      -VEVD----YATQISLMQSSNLLKKAMTLLQTEYPEL------------DP---------
A0A3S0Y9N9      VSGKP----MGTEVAVLRSLPIAERTINALSLN---------------------------
A0A433UNK7      VSGRP----LGTEVAVLRSLPLAEQTINAIRLN---------------------------
A0A6P0ZKB8      VSGRP----LGTEVAVLRSIPLAERTINTLGFN---------------------------
U5QL42          -SAAN----LETEIQILKSRSLIGRAIHRLAPP----------------FN---------
A0A076HBF2      -TSND----IPTLIEVLQSPVLLQPVAD---------------------KF---------
A0A354B169      -TSND----LPTLIEVLRSPMLLNPIAQ---------------------HF---------
G4FMX5          -TSND----LPTLIELLQSPLLLSPIAE---------------------RF---------
Q0IDT5          -TQND----IPTLIEVLESPLLLAPIAK---------------------RF---------
A0A2D6FCW3      -TSND----IPTLIELLQSPLLLSPIAQ---------------------RY---------
A3ZA21          -TQND----IPTLIEVLQSPLLLAPIAK---------------------RF---------
A0A140K3H3      -NLKD----LSTEVLVLRSYPLIAKAVKQVQQK----------------YG---------
K9XUB8          -NLKD----LSTEILVLRSYPLIAKAVEKVQQE----------------YS---------
A0A6H2NHD5      --L-D----YTSQIRVLRSPGVINPILESIQQR----------------YP---------
A0A2P8W4F7      --L-D----YDSQIRVLRGPAVIEPILADIQRR----------------YP---------
A0A5Q4E0Z4      -GL-D----YTSQIRVLRGPDVINPILANIQRQ----------------YP---------
A0A2P8VVX1      -RDAD----YATQLALMRSGQFLQEAVDVLRTD----------------YP---------
A0A2P8WHY0      -QSID----YNTQLTLMRSEQFLREAVASLEAE----------------YP---------
A0A2T1CMT9      -EL-D----YTTQIKVLTSHEILQRVVNQLKLKDQRSEQASSSYGGVISDS---------
A0A563VQJ3      -NETP----LKNEIEKITASPVLQETIDQL------------------------------
A0A1D8TX52      -DI-D----YATQLQLMGSSELIQRAVDLLRDD----------------YP---------
A0A1D9G4T2      -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
A0A6P0PR27      -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
A0A6P0WER7      -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
F4XP71          -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
A0A6L9YR57      -DI-D----YATQLQLMGSSELIQRAVDLLRDD----------------YP---------
A0A6P0KZ31      -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
A0A6P0LPB8      -DI-D----YATQLQLMRSSELIQRAVELLRDD----------------YP---------
A0A6P0SEV1      -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
A0A6B3N2I8      -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
A0A6M0B891      -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
A0A6P0IJQ1      -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
A0A6P0J8J8      -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
A0A6P0ZSH6      -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
A0A1U7N5X9      -DI-D----YATQLQLMRSSELMKRAVELLRDD----------------YP---------
A0A6L9Z1V0      -DI-D----YATQLQLMRSSELIQRAVELLRDD----------------YP---------
A0A6P0LC12      -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
A0A6P0MVJ3      -DI-D----YATQLQLMRSSELIQRAVDLLRDD----------------YP---------
A0A2W6ZAV2      -DRAN----TPVLIEVLTSPLLLEPIAQRL------------------------------
K9W742          -QV-D----SATQLNLMQGSQLLQKALDLLRPD----------------YP---------
A0A3D1PBA3      -KIDD----YATQINVMRSSLLLQRAADILRPE----------------YP---------
K9XPB0          -EI-D----YPTQLKLMRSSYLLKKVVKKLGVE----------------GS---------
A0A350Y7Z1      -EV-D----YATQLNLMRSSQLIQKAVDRLHPK----------------YP---------
A0A352X2A7      -EV-D----YTTQINLMRSSQLIQRAVNLLQDK----------------YP---------
A0A0D8ZYV0      -EI-D----YATQINVMRSTLLLQRAVDLLKPE----------------YP---------
A0A2T1FP73      -TIDD----YATQINVMRSSLLIQRAVDILRSE----------------YP---------
A0A433VMS2      -TIDD----YATQINVMRSSLLIQRAVDILRSE----------------YP---------
K9TYA7          -TIDD----YATQINVMRSSLLIQRAVDILRSE----------------YP---------
A0A2P8QUE1      -TIDD----YATQINVMRSSLLIQRAVDILRSE----------------YP---------
K9SA61          -KL-D----YSTQLQLMKSSQLLQRAVDQLKPT----------------YP---------
A0A2G7GMH8      -EV-D----IATQINLMSSSILLQRAVSLLQPE----------------YP---------
A0A6N8FU92      -EV-D----IATQINLMSSSILLQKAVYLLQPK----------------YP---------
A0A2T1DWE8      -EI-D----YSTQLTQMRSSQLLQKAVVLLQAE----------------YP---------
A0A1U7I8L3      -EI-D----YATQLNLMRSSQLIQKAVDLLRPQ----------------YP---------
A0A2T1DJL8      -EI-D----NATQLNLMRSSQLLQRAVDQLKLN----------------GS---------
A0A1Z4J9W0      -ET-D----AATQVNLMRSGQLLQRAVDQLKPR----------------YS---------
A0A0N7Z5K9      -ES-D----TATQVNLMRSTQLLQRAVDELQPR----------------YS---------
A0A0S3TXC5      -ET-D----TATQVNLMRSTPLLQRAVDELKPR----------------YS---------
B8HNB0          NWSNP----LINEIQVLQSSSLVTKAQQQLKPP----------------HN---------
A0A563VS48      -ESDP----LATEAEILRSRPILEKLIKELDLR----------------DE---------
A0A318BJ18      -DQEF----YETQYGLLRSRALSERVATQLRLV----------------DD---PKFYEM
A0A3B8Y8H9      NSDNY----FLTQIQILYSYKIIAPVLEKLNKV----------------FP---------
A0A2W1JVB9      GDSSP----LDTEIETILSVPVLQEALKQLKLT----------------DD---------
A0A6H1U102      -TRKD----RSTEIQILQSHSLVAKAISRLEDS----------------TS---------
A0A7C3ZEJ3      -TAKD----LSTEIQILQSRSLVSKAVAQLENS----------------FS---------
A0A563VLD6      -SLRD----LSTEILVLRSNSLISQAIAQYPNT----------------FK---------
A0A2P8W9H0      -NSTI----DETRLRILTSPRVIEPILKELQKS----------------QP---------
A0A6I5P386      -DIAV----DETTLKILESPRVMKPILEELQKI----------------YP---------
A0A318BG22      -DSMF----METQLAFIRSRAMAEGIVKRLHLD----------------QN---------
A0A2T1E9V8      QSNSS----LNTESRLILSENILRKILDIVNEN----------------SS---------
A0A1Z4LN32      -EANP----LDTQAIILQSEPIIKDVVKSLELK----------------GN---------
A0A2I8A9F5      -GSNP----LDTQALLVRSKPILEEVVNTLNLK----------------DK---------
A0A218Q6R8      -GANP----LDTQALLVRSTPIIEDVINTLELK----------------DQ---------
A0A218QGE0      -EANP----LDTQAIVMQSEPVMQDAIETLKLK----------------DK---------
A0A3M2GQQ6      GPQKD----LSTEIQILRSHALVAKAIAALGDT----------------DN---------
A0A6H1U2X0      GPQKD----LSTEIQILRSHALVAKAIAALGDT----------------DN---------
K9TLQ0          GEILD----YETQMEVLLSSPIINPIFTNIQQN----------------YP---------
K9QF04          -QFRD----FKTEIEVLASYKVISPLLPTIQSR----------------YP---------
K9W1T3          GAGNQ----INTQAELINSIPVAQETIATLNLS---------------------------
K9SGJ5          -KEPS----LDTEIAILKSRSLIEPAVAQLDNI----------------DP---------
A0A6N2JS94      -STVN----LGTEIAILKSRPLIEIAVSKMHQS----------------PS---------
A0A6C2DSN4      -PVIN----LGTEIGILKSRPLIESAIAKMRQS----------------SD---------
L8MYT6          -PVIN----LGTEIGILKSRPLIESAIAKMRQS----------------SD---------
A0A352JGJ6      -SLIN----LGTEIGILRSRPLIEVAVTKIKQS----------------SA---------
A0A1J5GLS2      -SSIN----LGTEIGILRSRPLIEVAVAKMKQS----------------PT---------
A0A2W4W6M5      -SLIN----LGTEIGILRSRPLIEVAVSKMRQS----------------PS---------
A0A2W7AN33      -SMVD----LGTEIAILKSRPLIETAVCKMQQS----------------PT---------
A0A256BLV2      -SLVN----LGTEVAILKSRPLIEIAVSKMQQS----------------PS---------
A0A2W6ZXF3      -SSIN----LGTEIGILRSRPLIEIAVAKMRQS----------------PT---------
A0A2Z5WX66      -SLIN----LGTEIGILRSRPLIEVAVAKLQQS----------------AS---------
K1XF69          ADQTP----LSTQIELMYSNPLLETVIERLNLT----------------NE---------
B5W297          ADQTP----LSTQIELMYSNPLLETVIERLNLT----------------NE---------
A0A6H2AL05      ADQTP----LSTQIELMYSNPLLETVIERLNLT----------------NE---------
H1W7M8          ADQTP----LSTQIELMYSNPLLETVIERLNLT----------------NE---------
A0A5Q4H6A5      ADQTP----LSTQIELMHSNPLLETVIERLNLT----------------NE---------
D5A466          ADQTP----LSTQIELMHSNPLLETVIERLNLT----------------NE---------
U5QJM6          DFTTQ----INTQLQVLLSRPLVNKAVVRLSKK----------------YP---------
A0A1Z4RPC6      PDQTP----LSTEKLRITSEPVLQQTIDQLKLV----------------DA---------
A0A2T1CMZ0      NTQTP----LSTEKLRMISEPVLQQTIDQLKLE----------------NS---------
L8M4F7          GQQSP----LHNQREQIFTSAVLQQTVENLDLK----------------NE---------
A0A140K2P2      VNQSP----LSTQIEVITSDPVLQQTIDQLKLV----------------DD---------
K9XWX4          VNQSP----LSTQIEVITSTPVIQQTIDKLKLQ----------------DD---------
A0A140KB14      NDQSP----LKTEIERMKAEPILVQTIEKLKLK----------------DE---------
K9XX88          NDQSP----LKTEIERMKTEPILVQTIEKLKLK----------------DE---------
A0A563VSV6      NNQTP----LLTQQEVISSAPVLQQTIEILKLT----------------NE---------
L8LZE9          VGATP----LVSQKEILTSSPILQKTIDQLSLT----------------DA---------
A0A433NM31      ESNYP----VNTQAEIINSVAFAQRTINELDLK----------------NE---------
A0A1Z4NDS1      -DSNP----SDTQVKIITSNQVIQETIQRLGLK----------------DS---------
U9VXM0          -LDNP----LDTQIEVFGSIPLVQQVIEQLKLQ----------------ND---------
A0A6M0RI13      -LDNP----LDTQIEVFRSIPLVQKVIETLKLQ----------------DD---------
A0A6M0S1N5      -LDNP----LDTQIEVFRSIPLVQKVIETLKLQ----------------DD---------
K9F4D9          -LDNP----LDTQIEVFRSIPLVQKVIETLKLQ----------------DD---------
A0A6I5QPI5      -AADP----LDTQAELIRSLPLMQATVDALGLT----------------TS---------
A0A1Z3HMQ0      VNSDP----LSTQAAILSSLPVLQEAVNALDLQ----------------DA---------
A0A433W533      -QSNP----VNTEIEVVRSIPLLQKTIAALNLK----------------DD---------
A0A2P8QWJ3      -QSNP----VNTEIEVVRSIPLLQKTIAALNLK----------------DD---------
A0A2T1FKP8      -QSNP----VNTEIEVVRSIPLLQKTIAALNLK----------------DD---------
K9U6L7          -QSNP----VNTEIEVVRSIPLLQKTIAALNLK----------------DD---------
A0A1E5QP61      -FNNP----LDTEAEVISSMPIVKETVEALNFR----------------DD---------
U5DPF5          -SNTL----LANEAAIIRSLPIGQQVIERLDIR----------------NA---------
A0A6P0X488      FINTP----LDTEAQVITSRPLVEKTIEQLDLK----------------NK---------
A0A6P0UVD5      FINTP----LDTEAQVITSRPLIEKTIEQLDLK----------------NK---------
A0A6P0VDM0      FINTP----LDTEAQVITSRPLIEKTIEQLDLK----------------NK---------
A0A6M0G142      FINTP----LDTEAQVITSRPLIEKTIEQLDLK----------------NQ---------
A0A6P0MR53      FINTP----LDTEAQVITSRPLIEETIKQLELR----------------NQ---------
A0A3M2GIL5      -LNSP----LDTEAEIISSTPIIEQTIAELQLK----------------GP---------
A0A6H1TSJ9      -LNSP----LDTEAEIISSTPIIEQTIAELQLK----------------GP---------
A0A3M1PML8      -QSNP----VDSQAQIIQSAPIVSEVIRSLDLR----------------DE---------
A0A6M8BE85      -QSNP----VDSQAQIIQSAPIVSEVIQSLDLR----------------DE---------
A0A0T7BPZ0      -TNNP----VETQAKIVASVPVIQKTIRSLDLK----------------DN---------
A0A352X442      -KSDP----IATAAAIVKSRPIAEKTVAELNLR----------------DE---------
A0A6B3NF44      -TSDP----LATQAEIIRSRPIAQKTIEILQLK----------------DE---------
A0A6M0EPL4      -TSDP----LATQAEIIRSRPIAQKTIEILQLK----------------DE---------
A0A6P0K6L6      -TSDP----LATQAEIIRSRPIAQKTIEILQLK----------------DE---------
A0A6P0MRR9      -NSEP----LATQAQVVLSRPIAENTVKDLNLQ----------------DE---------
A0A6P0UX57      -NSEP----LATQAQVVLSRPIAEKTVKKLDLR----------------DE---------
A0A6P0X1X4      -KSEP----LATQAQVVLSRPIAEKTVKKLDLR----------------NE---------
A0A0M0SHU3      -ENSP----VDTQAKIVISVPVIQETITSLSLK----------------ND---------
A0A1D2PBN3      -NNNP----SDTQAKIVASVPVIQETITELDLR----------------DN---------
A0A0C2LVR7      -NNNP----SDTQAKIVASVPVIQETITELDLR----------------DK---------
A0A1Z4PQB9      -NNNP----SDTQAKIVVSVPVIQETITELDLR----------------DD---------
A0A1Z4SFN6      -TNNP----LETQAKIVESVPVIQETIRTLNLK----------------DD---------
K9PGI8          -TNSP----SDTQAKIVVSVPVIQETIRVLKLK----------------NE---------
Q7NEU3          -NSAD----INTQIEVLLRRPLIEKALRVLRPK----------------FP---------
A0A3C0N2P0      -NTPD----YDTQIQVLWSPQVLSKIVKEIQTR----------------YP---------
A0A6P0JR04      ----D----YETQVEVLRSPTVMRPIVEKIQEK----------------YP---------
A0A6B3M6M6      -DGLD----YESQIEVLKSPQVMSPIVESIQAR----------------YP---------
A0A6P0KD09      -DGLD----YESQIEVLRSPQVMLPIVESIQAR----------------YP---------
A0A6B3NIJ0      -DGLD----YESQIEVLRSPQVMLPIVESIQAR----------------YP---------
A0A6M0F053      -DGLD----YESQIEVLRSPQVMLPIVESIQAR----------------YP---------
A0A6P2ATU9      ----D----YETQIEVLRSPAVLAPIIEQIQTQ----------------YP---------
A0A352XE00      -NAPD----YETQIQVLWSSQIMIPIVKKIQAQ----------------YP---------
A0A6P0QC14      -EGPD----YETQIQVLWSPQVISPILKNIQAQ----------------YP---------
B4VS56          -NSID----YETQIQVLWSPQVMTPIVEQIQSR----------------YP---------
A0A352AAQ3      -EGPD----YETQIQVLWSPQVMAPIVKKIQAR----------------YP---------
A0A350Y472      -QGPD----YETQIQVLWSPQVMAPIVAQIQSR----------------YP---------
A0A355DVB4      -QGPD----YETQIQVLWSPQVMTPIVKQIQSR----------------YP---------
A0A1Z4RMB9      -DQTP----LTTQIQVLRSEPVVQQVIDQLKLT----------------DN---------
A0A318B4H2      -DLQF----YETQYNLLKARSLAERVARVLGLQ----------------NDDKFFAMYGG
B4WQE3          -VGLL----DDTKLKILTSPRVLVSAVEELEKT----------------YP---------
A0A2K3BR24      --AGP----LTNQSQIMQSAPMLQEVIDRLGLK----------------ND---------
K9YXY1          --AGP----LTNQSQIMQSAPMLQEVVDRLGLK----------------ND---------
A0A0V7ZFJ4      -KGNP----LATEAQIIRSRPIIQKTISKLNLR----------------DS---------
A0A0V7ZNJ9      -LSNP----LETEAKVIRSNPIIQKTIDKFNLR----------------DD---------
A0A367RIS1      -LSNP----LETEAEIIRSNPLTQKTIAELHLK----------------DK---------
A0A235IXQ2      -VSNP----LETEAEIIRSYPLTKKTIAELQLK----------------DK---------
A0A1W5CNX3      -LSNP----LETEAEIIRSNPIIQKTIAESQLK----------------DE---------
A0A5Q0GJJ5      -LSNP----LETEAEIIRSNPIIQKTIAESQLK----------------DE---------
Q3MEB7          -LSNP----LETEAEIIRSNPIIQKTIAESQLK----------------DE---------
A0A1Z4KHN9      -LSNP----LETEAEIIRSNPIIQKTIAESQLK----------------DE---------
Q8YT70          -LSNP----LETEAEIIRSNPIIQKTIAESQLK----------------DE---------
A0A166IWU6      -SSNP----LETQAEIIRSHPLIQKTIVDLQLK----------------DQ---------
A0A2S0Q8C0      -SSNP----LETQAEIIRSHPLIQKTIVDLQLK----------------DQ---------
W6FSX4          -SSNP----LETQAEIIRSHPLIEKTIVDLQLK----------------DQ---------
A0A218Q4C1      -LSNP----LDTQAEIIRSHPLIQQTIDNLQLK----------------NQ---------
A0A6P1ZT04      -LSNP----LETQAEIIRSHPLIQKIIDELQLK----------------DQ---------
A0A0R0M9H9      -NSNP----IDTEAEVIRSHPLITKTINQLGIK----------------NT---------
A0A1S1ZVW2      -NSNP----IDTEAEVIRSHPLITKTINQLGTK----------------NT---------
A0A1B7WX82      -LSNP----VDTESEIIRSYPIIIKTITTLKLT----------------DD---------
A0A1B7WTD1      -LSNP----VDTEAEVIRSNPIISKTINDLKLK----------------GK---------
A0A480ABC0      -LSNP----VDTEAEVIRSNPIVTKTITELKLK----------------GR---------
A0A1Z4LRU5      -LSNP----LDTEAEVIQSHPLIKETITKLNLI----------------NE---------
A0A1Z4JVB4      -FSNP----VDTEAEVIRSYPIIQKTITTLKLK----------------DK---------
K9PIA4          -LSNP----VDTEAEVIRSYPIINKTITTLNLK----------------DE---------
A0A1Z4HVE1      -LSNP----VDTEAEVIRSNPIVLKTITSLNLK----------------DK---------
A0A252ECZ1      -LSNP----VDTEAEVIRSNPIVQKTITSLNLK----------------DK---------
A0A1Z4G5Y1      -LSNP----VDTEAEVIRSNPIVQKTIASLNLK----------------DK---------
A0A252DNA2      -LSNP----VDTEAEVIRSNSIVQKTITSLKLK----------------DK---------
A0A252E1Q4      -LSNP----VDTEAEVIRSNSIVQKTITSLKLK----------------DK---------
A0A6G9SK36      -LSNP----VDTEAEVVRSNPIVQKTIISLNLK----------------DR---------
A0A1Z4M597      -LSNP----VDTEAEVIRSNPIVLKTITSLDLK----------------DK---------
A0A1Z4MWT1      -LSNP----VDTEAEVIRSNPIVLKTITSLNLK----------------DK---------
A0A1Z4TX53      -LSNP----VDTEAEVIRSNPIVLKTITSLNLK----------------DK---------
A0A5P8VSD1      -NSNL----LETEAEIIRSHPLTQKIIDELHIK----------------DN---------
A0A2A2TNQ5      -TSNP----LETEAEIIRSNPLVKKIVNELEMQ----------------DK---------
A0A3S1C4K5      -TSSP----LDTEAEVIRSNPLVKKTISELELK----------------DK---------
A0A1X4G3D5      -GGSG----LENEAEVIRSRPMLEQLVETLELQ----------------DD---------
D4TNI2          -GGSG----LENEAEVIRSRPMLEQLVETLELQ----------------DD---------
A0A1Z4H6Z8      -LSNP----VDTEAEVIRSNPIIQKTITSLNLK----------------DK---------
A0A1Z4NPM1      -TSNP----LDTEAEVIRSTPSVQKTIEKFQLR----------------TP---------
A0A3F3KPR9      -NSNP----IDTEAEVIRSHPLITKTINQLGIK----------------NT---------
D4TGN7          -NSNP----IDTEAEVIRSHPLITKTINQLGIK----------------NT---------
A0A1Z4UZW9      -LSNP----VDTESEIIRSYPIVNKTITTLKLT----------------DD---------
A0A0K2M5H0      -LSNP----VDTESEIIRSYPIVIKTITTLKLT----------------DN---------
A0A1B7VSH4      -LSNP----VDTESEIIRSYPIVIKTITTLNLT----------------DD---------
A0A1B7W126      -LSNP----VDTESEIIRSYPIVIKTITTLNLT----------------DD---------
A0A3D4C6Q6      -LSNP----VDTESEIIRSYPIVIKTITTLNLT----------------DD---------
A0A1B7UVJ4      -LSNP----VDTESEIIRSYPIVIKTITTLNLT----------------ND---------
A0A1B7UTR1      -LSNP----VDTESEIIRSYPIVIKTITTLNLT----------------ND---------
K7W0A4          -LSNP----VDTESEIIRSYPIVIKTITTLNLT----------------ND---------
A0A5C0DRW9      -LSNP----VDTESEIIRSYPIVIKTITTLNLT----------------ND---------
A0A6H2C088      -LSNP----VDTESEIIRSYPIVIKTITTLNLT----------------ND---------
A0A1Q4RTR1      -AGNP----LETQAEIIRSQPVIQKTIDILELK----------------NK---------
A0A1Z4SQV2      -STNP----LETQAEIIRSQPLVQKTIDTLELR----------------NN---------
A0A2H2XGN1      -STNP----LETQAEIIRSQPLVQKTIDTLELR----------------NN---------
A0A433UXH8      -SNNP----LETQAELIRSQPLVQKTIDALELK----------------NS---------
A0A1U7HGH0      -NDTS----LATEAKVIRSIPILQQALEQINEA----------------SQ---------
K9XJD3          -NDTS----LATEAKVIRSVPILQQALEQINEA----------------SQ---------
K9SX01          --GDP----RYTQLQVIRSTPVVAQTIKAL------------------------------
A0A4P7ZT55      -GTVD----LPNLIEVLTSPMLLQPLANAQGL----------------------------
A0A1E5QIR9      -PTNP----LDTEVAIVRSVATSEGVMQALDLR----------------DE---------
A0A1Z4IBC7      -NDNP----LETQVRIIGSNPVLERTINTLNLK----------------EA---------
A0A1W5CPC7      -NDNP----LETQVRIIGSNPVLEQTIKALNLK----------------DK---------
A0A5Q0GKD1      -NDNP----LETQVRIIGSNPVLEQTIKALNLK----------------DK---------
Q3MDC6          -NDNP----LETQVRIIGSNPVLEQTIKALNLK----------------DK---------
A0A1Z4KM73      -NDNP----LETQVRIIGSNPVLQQTIKALNLK----------------DQ---------
Q8YNX7          -NDNP----LETQVRIIGSNPVLQQTIKALNLK----------------DQ---------
A0A367R4K6      -NDNP----LETQVKIVGSNPVLEQTIKELNLT----------------DN---------
A0A1E2WSV8      -NDNP----LETQVRVIGSNPVIEKTINSLKLK----------------DS---------
A0A2R5FRT9      -NDNP----LETQVRVIGSNPVIEKTINSLNLK----------------DS---------
A0A2K8T1B6      -NDNP----LETQVRVIGSNPVIEETINSLNLK----------------DS---------
A0A235I9I0      -NDNP----LETQVRVIGSNPVIEKTINSLNLK----------------DG---------
A0A2D0HQT8      -NDNP----LETQVRVIGSNPVIEKTINSLNLK----------------DS---------
A0A2L2NU95      -NDNP----LETQVRVIGSNPVIEKTINSLNLK----------------DS---------
A0A367S084      -NDNP----LETQVRVIGSNPVIEKTINSLNLK----------------DS---------
A0A6P1A9A0      -KSVD----YETQIQVLSSPKVLSPILEKIKAE----------------YP---------
A0A1Z4SMD6      -EGNP----LETQAVILNSEPIIQKVINTLKLK----------------DK---------
A0A2H2Y096      -EGNP----LETQAVILNSEPIIQKVINTLKLK----------------DK---------
K9S8M8          -KDTP----LDTEAEVIRSTPIAEEVITSMGLR----------------SS---------
A0A1Z4NFV0      -ESNP----LSTQAVVLQSRPILEQVIAKLNLR----------------DR---------
A0A3M9ZEU1      -ANSP----VETQAEIVRSAAIARATIEALDLR----------------DD---------
A0A1Z4JK72      -EGNP----LDTQAVVVTSYPILQRVIDTLQLK----------------NS---------
A0A0N7Z489      -EGNP----LDTQAAVVTSYPILQRVIDTLQLK----------------NA---------
A0A0S3TXS2      -EGNP----LDTQAAVVTSYPILQRVIDTLQLK----------------NS---------
A0A2A2TPF8      -EANP----LSTQAVILQSRPILQAVVEKLNLR----------------DK---------
A0A1Z4R0P8      -EANP----LSTQAVILQSRPILQAVIERLNLR----------------DD---------
A0A0T7BUI3      -ENNP----LNTQAVIVNSQPVIKEVIKTLNLK----------------DN---------
A0A1Z4LP32      -EGNP----LETQAVVIQSEPILQEVIDTLNLK----------------DD---------
K9REP9          -EGNP----LETQAVIVQSEPILQKVIDTLNLK----------------DD---------
A0A1Z4SIJ3      -QGNP----LETQAVIVDSEPVLEEVIRTLDLK----------------DK---------
A0A2H2XPG4      -QGNP----LETQAVIVDSEPVLEEVIRTLDLK----------------DK---------
K9V3C7          -EANP----LSTQAAILESRPIVQEVIQALDLK----------------DN---------
A0A1Z4T6Y7      -EANP----LSTQAEILQSRPILEAVIKKLDLR----------------DK---------
A0A2H2Y561      -EANP----LSTQAEILQSRPILEAVIKKLDLR----------------DK---------
A0A1Q4S362      -EANP----LSTQAEILQSRPILEEVIKKLDLR----------------DK---------
A0A3S1CIN8      -EANP----LSTQAEILQSRPIIEEVIKKLDLR----------------DK---------
A0A2A2TC28      -EGNP----LQTQAVIVNSQPILQEVINNLNLK----------------DK---------
A0A0C1NCB0      -EGNP----SDTQAVVVTSAPILQQVIDKLALK----------------NN---------
A0A2N6K7Q9      -EGNP----LETQAVIVNSHPMLQEVITSLQLK----------------DE---------
A0A2N6MXH6      -EGNP----LETQAVIVNSHPMLQEVITALQLK----------------DD---------
A0A2N6M5A8      -EGNP----LETQAVIVNSHPMLQEVITALQLK----------------DD---------
A0A2N6LL61      -EGNP----LETQAVIVNSHPMLQEVITALQLK----------------DD---------
A0A0S3TP66      -EGNP----LETQAVIVNSHPMLQEVITALQLK----------------DD---------
G6FP91          -EGNP----LETQAVIVNSHPMLQEVITALQLK----------------DD---------
A0A1U7GYR5      -EGNP----LETQAVIVNSHPMLQEVITALQLK----------------DD---------
A0A2N6KY52      -EGNP----LETQAVIVNSHPMLQEVITALQLK----------------DD---------
A0A2N6KMP5      -EGNP----LETQAVIVNSHPMLQEVITALQLK----------------DD---------
A0A2N6MA45      -EGNP----LETQAVIVNSHPMLQEVITALQLK----------------DD---------
A0A4Q9J9V9      -EGNP----LETQAVIVNSHPMLQEVITALDLK----------------DE---------
A0A328IGA1      -EGNP----LETQAVIVNSHPMLQEVITALDLK----------------DE---------
A0A4D9CE41      -EGNP----LETQAVIVNSHPMLQEVITALDLK----------------DE---------
A0A0M0SFT2      -EGNP----LETQAVIVNSHPMLQEVITALDLK----------------DE---------
A0A1Z4TLC8      -EGNP----LETQAVIVNSHPMLQEVITALDLK----------------NE---------
A0A0C2LFH0      -EGNP----LETQAVILKSEPILKEVIDTLGLK----------------DK---------
A0A1Z4IYV4      -EGNP----LETQSVILTSQPILEEVIKTLELK----------------DK---------
A0A1Z4Q0T6      -EGNP----LETQAVILQSQPILEEVINTLRLK----------------DK---------
A0A0C2PT44      -EGNP----LETQAVILKSEPILEEVIKTLELK----------------DK---------
A0A1D2P6J4      -EGNP----LETQAVILKSEPILEEVINTLGLK----------------DK---------
B4WP72          LQKDP----LRTQAEIIQSLPTLEKAIATAEAA----------------VI---------
A0A2T1CIL7      -DSNP----VVTEAEILRSRPILEKAIKQLNLK----------------ND---------
A0A433V7A0      -EGNP----LSTEAEILLSEPLIRETISALNLK----------------DE---------
A0A2T1FTR8      --STP----VNTQAEILKSLTTIKGAL--IELR----------------DG---------
K9UA41          --STP----VNTQAEILKSLTTIKGAL--VELR----------------DG---------
A0A0C2LBE2      -ESNP----SETQAKIVASVPVIQETIAELDLK----------------DD---------
A0A433NN38      -QSSP----VDTQVKIVTSVPVLQETIKALDLR----------------DS---------
A0A2N6K0T2      -DNSP----VDTQAKIVTSVPVIQETITSLSLK----------------ND---------
A0A2N6ML72      -DNSP----VDTQAKIVTSVPVLQETITSLSLK----------------ND---------
G6FQZ6          -NNSP----VDTQAKIVTSVPVLQATITSLSLK----------------ND---------
A0A2N6MQX9      -DNSP----VDTQAKIVTSVPVLQETITSLSLK----------------DD---------
A0A2N6KXT6      -NNSP----VDTQAKIVTSVPVLQETITSLSLK----------------ND---------
A0A2N6KGB9      -DNSP----VDTQAKIVTSVPVLQETITSLSLK----------------ND---------
A0A2N6L3Y5      -DNSP----VDTQAKIVTSVPVLQATITSLSLK----------------ND---------
A0A0S3TIS7      -DNSP----VDTQAKIVTSVPVLQATITSLSLK----------------ND---------
A0A1U7GW28      -DNSP----VDTQAKIVTSVPVLQATITSLSLK----------------ND---------
A0A2N6LW63      -DNSP----VDTQAKIVTSVPVLQATITSLSLK----------------ND---------
A0A328IH74      -ENSP----VDTQAKIVISVPVIQETITSLSLK----------------NN---------
A0A4D9CIB0      -ENSP----VDTQAKIVISVPVIQETITSLSLK----------------NN---------
A0A1Z4TQ63      -NNTP----LDTQAKIVTSVPVIQETITSLSLK----------------ND---------
A0A4Q9J8G2      -KDSP----LDTQAKIVTSVPVIQETITTLSLK----------------DD---------
A0A350Y0P6      FINTP----LDTEAQIITAQPILEKTIAKLNLK----------------TA---------
A0A352X940      FINTP----LDTEAQVITSLPLIQKTIERLNLK----------------TE---------
B8HTN4          -KSSP----IDTEAQIIRSTPIIQELITTLQLK----------------DP---------
A0A6P1AFJ5      -SRLD----YATQIQVLWSNQVLSPISEAIKQK----------------YP---------
B0CAX4          -KSSP----VQTEAEIIRSEPILRQTITALKLV----------------DD---------
A0A1Z4RN12      -DKDP----IETEAKILQSRPIVERLIKELELK----------------ND---------
A0A2T1CMF9      -EKDP----IETEAEILGSRTIVEKVIQELDLK----------------SE---------
Q7NDC5          -YGNP----LDTQAEILQSRPVAAGVIRDLQLG----------------DP---------
U5QGK3          -FGNP----LDTQAEIIQSRPLVEKVIRTLQLK----------------DP---------
A0A2W4UY24      -QSNP----LDTQVEIFLSKPIAEKVINQLKIE----------------DS---------
A0A0D8ZUV2      -QTNP----LKTEAAVLSSIPLAQQTITALNLK----------------DN---------
A0A433VDI0      -QSNP----LKTETEVLRSIPLVQRTIAELNLK----------------DE---------
A0A3D1PG43      -LGNP----SQTEIEIMSSRPLAKETIAALNLK----------------DK---------
A0A2P8QQ72      -ESNP----VSTESEIVSSIPLAQKTIAALTLK----------------DE---------
K9TZQ7          -ESNP----VSTESEIVSSIPLAQKTIAALTLK----------------DE---------
A0A6N8G584      -KANP----LNTEIEIIRSVPFIEKTITALNLR----------------ND---------
A0A2G7GPR0      -KANP----LNTEIEIIRSVPFVEKTISALNLR----------------NS---------
K9XH68          -KANP----LNTEIEIIRSVPFLEKTITALNLR----------------ND---------
A0A1U7HW70      -KANP----LNTEIEIIRSVPFLEKTIASLNLR----------------ND---------
A0A2S6VEJ8      -KANP----LNTEIEIIRSVPFLEKTITALNLR----------------ND---------
A0A140KBA0      -ESDP----LTTEVEVVSSRPIIDRVIKELDLR----------------NK---------
K9XSG1          -ESDP----LTTEVEVVSSRPIIDRVIKELDLR----------------NK---------
A0A2T1GMT4      -TQNP----ITTQMEVIASRPLLQKTADRLKLK----------------ND---------
K9UI51          -NQNP----ITTQMEVIASRPLLQRTADRLKLK----------------ND---------
K9QM62          -TQNP----ISTEVEVITSYPLLQRTIDALKLK----------------NN---------
A0A1Z4FWI3      -NQNP----ISSQIEVISSPTLLQRTIDELQLK----------------ND---------
A0A1Z4JYE7      -TQNP----ISTQVEVISSPPLLEKVINKLELT----------------NE---------
A0A2T1FXY4      -TQNP----ISSQMEVISSPALLQRTIDELQLK----------------ND---------
K9TYI2          -TQNP----VSSQIEVISSPTLLQQAIDELQLK----------------NN---------
A0A1Z4QL41      -TQNP----ISTQIEVISSPPVLQKTIDKLKLK----------------NQ---------
A0A252D4T4      -TQNP----ISTQIEVISSPILLQRTIDELQLK----------------NA---------
A0A252DJH5      -TQNP----ISTQIEVISSPILLQRTIDELQLK----------------NA---------
A0A252EB80      -TQNP----ISTQIEVISSPILLQRTIDELQLK----------------NA---------
A0A6G9SKZ9      -TQNP----ITTQIEVITSPLLLQKTIDELQLK----------------NN---------
A0A1Z4HPW5      -TQNP----ITTQIEVITSPLLLQKTIDELQLK----------------NN---------
A0A1Z4MSN1      -TQNP----ITTQIEVITSPLLLQKTIDELQLK----------------NK---------
A0A1Z4U1C2      -TQNP----ITTQIEVITSPLLLQKTIDELQLK----------------NK---------
A0A0D6KV51      -TQNP----ITTQIEVITSPLLLQKTIDELQLK----------------NK---------
A0A1Z4MKF8      -TQNP----ITTQIEVITSPLLLQKTIDELQLK----------------NK---------
A0A2C6WC43      -SQNP----INTQIEVISSPALLQKTIDKLQLK----------------DQ---------
A0A1Z4L5A1      -SQNP----INTQIEVISSPALLQKTIDKLQLK----------------DK---------
A0A367QD86      -SQNP----INTQIEVISSPPLLQKTIDKLQLK----------------DK---------
A0A235IZ96      -TQNP----VSTQIEVITSPSLLQRAIDKLKLK----------------DK---------
A0A2L2NGP0      -TQNP----VSTQIEVITSPSLLQRAIDKLKLK----------------DK---------
A0A2K8SM78      -TQNP----INTQIEVISSPNLLQRTIDKLQLK----------------DE---------
A0A2R5FPC0      -TQNP----INTQIEVISSPNLLQRTIDKLGLK----------------DE---------
A0A5P8W5T6      -TQNP----INTQIEVISSPTLLQRTIDKLGLK----------------DD---------
A0A0F5YE28      -DQTP----LSTQIEIISSNRLLNQVIEQLNLV----------------DD---------
U7QEH7          -DQTP----LSTQIEIIYSNRLLNQVINQLNLV----------------DS---------
A0A3S1ATK5      -TQNP----ISTEIEVISSRPLLQQTIDKLGLK----------------NK---------
A0A2Z6CPH0      -TQNP----ISTQIEVISSPLLLEQIIDKIQLK----------------DE---------
A0A1Z4GT50      -TQNP----ISTQIEVITSPPLLQRTIDQLHLK----------------NN---------
A0A1Z4GIX0      -TQNP----INTQIEVISSPPLLQRTIDKLQLK----------------ND---------
A0A2H6LC24      -TQNP----INTQIEVISSPPLLQRTIDKLQLK----------------ND---------
B2J6N5          -TQNP----INTQIEVISSPTLLQRTIDKLQLK----------------DQ---------
A0A367RMI4      -TQNP----ISSQIEVISSPALLQRTIDKLQLK----------------DN---------
A0A235HUM0      -TQNP----ISSQIEVISSPALLQRTIDKLQLK----------------DK---------
A0A2L2NW47      -TQNP----ISSQIEVISSPALLQRTIDKLQLK----------------DN---------
A0A1E2WUR1      -TQNP----ISSQIEVITSPKLLQRTIDKLQLK----------------DN---------
A0A235IKU3      -TQNP----VSTQIEVITSPNLLQRAIDKLKLK----------------DK---------
A0A1U7MYU6      -AQNP----LSTEVEVIYSHPLLQQIIDQLNLT----------------DN---------
A0A1D8TNX9      -AQNP----LSTEVEVIYSHPLLQQIIDQLNLT----------------DN---------
A0A6P0L6C2      -AQNP----LSTEVEVIYSHPLLQQIIDQLNLT----------------NN---------
A0A6P0MVH0      -AQNP----LSTEVEVIYSHPLLQQIIDQLNLT----------------DN---------
A0A6P0KJV0      -AQNP----LSTEVEVIYSHPLLQQIIDQLNLT----------------DN---------
A0A6L9ZJG4      -AQNP----LSTEVEVIYSHPLLQQIIDQLNLT----------------DN---------
F4XKF3          -AQNP----LSTEVEVIYSHPLLQQIIDQLNLT----------------DN---------
A0A1D9FX10      -AQNP----LSTEVEVIYSHPLLQQIIDQLNLT----------------DN---------
A0A6P0Q0T0      -AQNP----LSTEVEVIYSHPLLQQIIDQLNLT----------------DN---------
A0A6P0W5I0      -AQNP----LSTEVEVIYSHPLLQQIIDQLNLT----------------DN---------
A0A3C0NJ41      -TGNP----VSTEMEILHSIPLAQKTIAAFNLK----------------DN---------
A0A352AG88      -NSNP----ITTEIEILRSVPLAKETIAALNLK----------------SE---------
A0A350Y374      -DSNP----ISTEIEILSSLPLLDKTLNTLNLK----------------DD---------
A0A355DPX0      -DSNP----ISTEIEILSSVPLLDKTLNTLNLK----------------DD---------
                                                                            

K9SLA9          -------------ENELEAEQ---------SIESF----LAN-LQVTNLP--D-------
A0A168TT23      LPGRLVQLIRSDPPSAQPAAVQSPEAARAAAIRSAGGRLRAR-ISVSPRE--N-------
A0A0M1JWX9      -------------E------V---------EYKTLVTGEKPP-LIIEQKK--EA------
A0A2T1M1V6      -------------SE-FSNLE---------DYKKL--------FTIEPQT--Q-------
A0A2G7GCS2      -------------SL-YPRLS---------DYKLA--------FSATPQE--Q-------
K9XBH8          -------------SS-YLRLS---------DYKSL--------FTVSPQE--Q-------
A0A1Z4LJ30      -------------AD-FSRLN---------NFKKL--------FEVSPEK--E-------
K9RI76          -------------SE-YSRLS---------QFKKL--------FEVTPEK--E-------
A0A352AE27      -------------SQ-FG-LR---------SYKKL--------FEISPQE--Q-------
A0A3B8JH60      -------------NK-APKPS---------QYKKL--------FKVSPQE--Q-------
A0A3C0N766      -------------NK-APKPS---------QYKKL--------FKVSPQE--Q-------
K9W9J7          -------------TK-FSRLA---------KYKRL--------FQVKPQE--Q-------
A0A139WSU3      -------------GK-FNSIS---------RYRQL--------FKVTPQE--Q-------
A0A433VN22      -------------NK-FKNLE---------QYKAL--------FQVSPQE--Q-------
Q7NF11          -------------EK-YPQLG---------SYEKL--------FKAVPQS--Q-------
A0A1Z4JCS8      -------------DA-ANKPR---------NYGQF--------FEVTSLE--Q-------
A0A6P0PI80      -------------TD-FQRLV---------QYKQL--------FAVSPHQ--E-------
A0A6P0WGT6      -------------TD-FQRLV---------QYKQL--------FAVSPHQ--E-------
F4XTX2          -------------TD-FQRLV---------QYKQL--------FAVSPHQ--E-------
Q7NJN6          -------------TEKFTRLD---------TYGKL--------FKGKPGD--Q-------
U5QCC3          -------------QEKFPRLE---------DYTKL--------FKSKIED--Q-------
A0A3M1SVZ4      -------------L------V---------EYSDV----LKN-LKLSKVQ--S-------
A0A654SFI6      -------------E---ETPV---------TRRDVEQVLLDN-IKVTPIS--Q-------
K9SSQ0          -------------Q-----DL---------IT-------QIS-DHLTITP--D-------
A0A2W1JIN9      -------------DP-VDIPL---------SVGEL----KQS-LQTGIVP--G-------
A0A318AJV1      -------------RL-THRPA---------TPDQIVTRVTKS-VGVSRDQ--L-------
A0A6P0IC70      -------------K------I---------TPKEL----KKD-LTVKNIP--A-------
A0A6B3MUB5      -------------K------I---------TPKEL----KKD-LTVKNIP--A-------
A0A6M0B7N4      -------------K------I---------TPKEL----KKD-LTVKNIP--A-------
A0A6P0J9W3      -------------K------I---------TPKEL----KKD-LTVKNIP--A-------
A0A6P0ZWE1      -------------K------I---------TPKEL----KKD-LTVKNIP--A-------
A0A1U7N2U4      -------------G------L---------TINTL----RRD-LKVKIVP--A-------
A0A1D9G1F2      -------------G------L---------TIDTL----RED-LKVKIVP--A-------
A0A6P0PNZ7      -------------G------L---------TIDTL----RED-LKVKIVP--A-------
F4XV38          -------------G------L---------TIDTL----RED-LKVKIVP--A-------
A0A6P0W137      -------------G------L---------TIDTL----RED-LKVKIVP--A-------
A0A6L9Y9E2      -------------G------L---------TIDKL----RED-LKVKIVP--A-------
A0A6P0SGR0      -------------G------L---------TIDTL----RED-LKVKIVP--A-------
A0A6M0BK48      -------------G------L---------TIDKL----RED-LKVKIVP--A-------
A0A6L9YZL1      -------------G------L---------TIYKL----RED-LKVKIVP--A-------
A0A6P0KYM4      -------------G------L---------TIDKL----RQD-LKVKIVP--A-------
A0A6P0LSD6      -------------G------L---------TIDKL----RKD-LKVKIVP--A-------
A0A6P0X384      -------------A-----LI---------STDDL----KEG-LNTKIVP--A-------
A0A2P8QIL5      -------------E-----PP---------TVEEL----RKQ-LKVKTVP--A-------
A0A2T1FLY5      -------------E-----PP---------TVEEL----RKQ-LKVKTVP--A-------
A0A433W447      -------------E-----PP---------TVEEL----RKQ-LKVKTVP--A-------
K9U1K8          -------------E-----PP---------TVEEL----RKQ-LKVKTVP--A-------
K9UYB2          -------------------SI---------TTKQL----RRG-LRVKVVP--A-------
A0A218QN17      -------------S-----QI---------TSGDL----SKG-LGVKIVP--A-------
K9RKN2          -------------NF-GKDGL---------TSEYL----RKN-LSVKIVP--A-------
A0A2I8ADV2      -------------I-----QL---------TPTDI----SSA-LKVSILP--A-------
A0A1W5CKM3      -------------K-----PL---------TASDI----RSN-LKVIIVP--A-------
A0A5Q0GMF5      -------------K-----PL---------TASDI----RSN-LKVIIVP--A-------
Q3MEW0          -------------K-----PL---------TASDI----RSN-LKVIIVP--A-------
A0A1Z4KIC7      -------------K-----PL---------TPSDI----RSN-LKVIIVP--A-------
Q8YSM5          -------------K-----PL---------TPSDI----RSN-LKVIIVP--A-------
A0A1Q4S1H4      -------------E-----KT---------TLKKL----SRD-LKVKIIP--A-------
A0A433VBU6      -------------E-----KL---------SFKQL----SRD-LKVKIIP--A-------
A0A1Q4RZJ6      -------------T-----KL---------TVDEF----SQG-IRVKTIP--A-------
A0A1Z4SNV3      -------------S-----TI---------TTAEL----SRG-IRIKTIP--A-------
A0A2H2XJQ1      -------------S-----TI---------TTAEL----SRG-IRIKTIP--A-------
A0A3S5K358      -------------T-----KL---------TVDEL----SQG-IRVKTIP--A-------
A0A0T7BPJ4      -------------D-----SI---------TPEKL----RKK-LKVKIVP--A-------
A0A0C1QS61      -------------T-----QV---------KIQDL----NKG-LGVKIVP--A-------
A0A139X3R8      -------------T-----QV---------KTPDL----SKG-LGVKIVP--A-------
A0A1Z4I7C5      -------------K-----KL---------SPSDI----KSN-LKVVIVP--A-------
A0A0C2MDK7      -------------S-----PV---------STAEL----SHN-LKVKIVP--A-------
A0A1Y0RCK1      -------------S-----PV---------STAEL----SHN-LKVKIVP--A-------
A0A1Z4PWZ0      -------------S-----PV---------TTGEL----SHN-LKVTIVP--A-------
A0A0C2QLT0      -------------S-----PV---------TTTEL----SRN-LKVKIVP--A-------
A0A1Z4J2K1      -------------S-----PV---------STAEL----SHN-LKVKIVP--A-------
A0A3S0ZSX0      -------------T-----PL---------TPEKV----RQG-LKVKIVP--A-------
A0A2N6K4T3      -------------N-----EL---------TVDQL----TQG-LKVKIVP--A-------
A0A370CKT2      -------------N-----EL---------TVDQL----SQG-LKIKIVP--A-------
A0A0S3TL97      -------------N-----EL---------TVDQL----SQG-LKIKIVP--A-------
A0A2N6M8A0      -------------N-----EL---------TVDQL----SQG-LKIKIVP--A-------
A0A2N6M9E1      -------------N-----EL---------TVDQL----SQG-LKVKIVP--A-------
A0A2N6KJI4      -------------N-----EL---------TVDQL----SQG-LKIKIVP--A-------
A0A2N6MZ77      -------------N-----EL---------TVDQL----SQG-LKIKIVP--A-------
A0A2N6KT20      -------------N-----EL---------TVDQL----SQG-LKIKIVP--A-------
G6FSN3          -------------N-----EL---------TVDQL----SQG-LKIKIVP--A-------
A0A4D9CI02      -------------N-----EL---------TVGQL----SRN-LKVKIVP--A-------
A0A328I8B9      -------------N-----EL---------TVGQL----SRN-LKVKIVP--A-------
A0A4Q9J4Z7      -------------N-----EL---------TVGQL----SRN-LKVKIVP--A-------
A0A0M0SU69      -------------N-----EL---------TVGQL----SQN-LKVKIVP--A-------
A0A1Z4TIZ8      -------------N-----EL---------TVEQL----SQN-LKVKIVP--A-------
A0A0S3TYD7      -------------D---NAPL---------KVEDF----LKR-LKVTPVN--R-------
A0A2T1DNG3      -------------DN-PG------------SVGGF----RGA-LTIVQVG--TKKVD---
A0A3S0Y9N9      -------------L----------------NPLVF----LKE-LQVKNIE--Q-------
A0A433UNK7      -------------I----------------NPLVF----LKD-LEVKNIE--N-------
A0A6P0ZKB8      -------------L----------------NPLVF----LKD-LEVKNIE--N-------
U5QL42          -------------I------L---------NSTTA----ADN-ISISQIG--D-------
A0A076HBF2      -------------E------L---------TTDAL----RSR-VDISTGG--AKRKEA--
A0A354B169      -------------D------L---------TYLNL----SSR-LKISIGG--EKSQEA--
G4FMX5          -------------D------L---------SENGL----ASR-ITITTGG--EKRTEA--
Q0IDT5          -------------D------V---------SENEL----AER-INITTGG--AKRKEA--
A0A2D6FCW3      -------------D------L---------NANAL----AKR-ITITTGG--EKRKEA--
A3ZA21          -------------D------L---------AENAL----ASR-IEISTGG--AKRKEA--
A0A140K3H3      -------------D------L---------TVTDV----MEN-LSITQAA--VNEMP---
K9XUB8          -------------D------L---------TVGNV----IGN-LSIIQAN--VNEIP---
A0A6H2NHD5      -------------D------I---------TYGTL----LNN-LTITRDG--E-------
A0A2P8W4F7      -------------N------I---------TYNAL----LSR-LSIVQEG--E-------
A0A5Q4E0Z4      -------------E------I---------TYTTL----LND-LVISQEG--E-------
A0A2P8VVX1      -------------E------I---------TVDEL----RAG-FTLARLS----EGR---
A0A2P8WHY0      -------------D------L---------DVDQV----VNT-FSLQRVG--GEERD---
A0A2T1CMT9      -------------E------A---------TTAAIIAALRES-IGVYQVL--DESTDSNK
A0A563VQJ3      ---------------------------------ELTDGEGEP-LKPKNFA--QNLTVELV
A0A1D8TX52      -------------D------I---------TIRDI----RGS-LRLAQVL--QGKTE---
A0A1D9G4T2      -------------D------I---------TVGDI----RGS-LRLAQVL--QGKTE---
A0A6P0PR27      -------------D------I---------TVGDI----RGS-LRLAQVL--QGKTE---
A0A6P0WER7      -------------D------I---------TVGDI----RGS-LRLAQVL--QGKTE---
F4XP71          -------------D------I---------TVGDI----RGS-LRLAQVL--QGKTE---
A0A6L9YR57      -------------N------I---------TIRDI----RGS-LRLAQVL--QGKTE---
A0A6P0KZ31      -------------D------I---------TIRDI----RGS-LRLAQVL--QGKTE---
A0A6P0LPB8      -------------D------I---------TVGDI----RGS-LRLAQVL--QGKTE---
A0A6P0SEV1      -------------D------I---------TIRDI----RGS-LRLAQVL--QGKTE---
A0A6B3N2I8      -------------D------I---------TVGDI----RGS-LRLAQVL--QGKTE---
A0A6M0B891      -------------D------I---------TVGDI----RGS-LRLAQVL--QGKTE---
A0A6P0IJQ1      -------------D------I---------TVGDI----RGS-LRLAQVL--QGKTE---
A0A6P0J8J8      -------------D------I---------TVGDI----RGS-LRLAQVL--QGKTE---
A0A6P0ZSH6      -------------D------I---------TVGDI----RGS-LRLAQVL--QGKTE---
A0A1U7N5X9      -------------N------I---------TVGDI----RGS-LRLAQVL--QGKTE---
A0A6L9Z1V0      -------------D------I---------KVGDI----RDS-LRLAQVL--QGKTE---
A0A6P0LC12      -------------D------I---------TIRDI----RGS-LRLAQVL--QGKTE---
A0A6P0MVJ3      -------------D------I---------TIGDI----RGS-LRLAQVL--QGKTE---
A0A2W6ZAV2      -------------N------V---------SPDKI----ASG-LKIVSGG--DA------
K9W742          -------------D------L---------TLKEL----RKS-LSVFQVE--GSQDDS--
A0A3D1PBA3      -------------T------I---------TAKEI----KAN-LKLRQVL--EEK-----
K9XPB0          -------------D------A---------EIAEIVEQLKSS-LSVYQVI--DESEDNKG
A0A350Y7Z1      -------------E------I---------QVTDI----KES-FSLTGVQ--EEDTDIKD
A0A352X2A7      -------------T------I---------KVEEI----REF-LTITRII--EDETE---
A0A0D8ZYV0      -------------D------M---------TVKEL----KQT-LVLTPLV--EENSNTKY
A0A2T1FP73      -------------T------L---------TVAEV----KKN-LVLKQVV--EEKAN---
A0A433VMS2      -------------T------L---------TVAEV----KKN-LVLKQVV--EEKAN---
K9TYA7          -------------T------L---------TVAEV----KKN-LVLKQVV--EEKAN---
A0A2P8QUE1      -------------T------L---------TVAEV----KKN-LVLKQVV--EEKAN---
K9SA61          -------------D------I---------TVGHL----KEA-LIVTQVE--DD-----K
A0A2G7GMH8      -------------D------I---------DIKSL----RKS-LTLSPVQ--GQDGTGKK
A0A6N8FU92      -------------D------I---------DIQEI----KKS-LVLIPVQ--GQEGTGKK
A0A2T1DWE8      -------------K------L---------EAAEL----QKA-LVLTQVE--E----D-K
A0A1U7I8L3      -------------K------I---------KVKDI----KEA-LVVNQLQ--E----D-K
A0A2T1DJL8      -------------N------L---------DVGDL----QKG-LTVSQVI--EQRGND-K
A0A1Z4J9W0      -------------D------I---------DVDRL----RKR-LNIAQVQ--ELRGNE-R
A0A0N7Z5K9      -------------D------I---------DVDRL----RNR-LNIAQVQ--ELRGSE-R
A0A0S3TXC5      -------------D------I---------DVDRL----TRR-LNIVQVQ--ELRGNE-R
B8HNB0          -------------KT---------------SVGSI----AGG-LSITQVG--D-------
A0A563VS48      -------------G---GELI---------RYQSF----RES-FQVRPIT--G-------
A0A318BJ18      YKFNSDDPAFQLVN---GRYTSTGRAERVRIAGEI----LRDNLTIGSTR--L-------
A0A3B8Y8H9      ------------PET-EEEKV---------EYQAF----IENQLSINRPK--D-------
A0A2W1JVB9      -------------E---GEPL---------KIFDF----EEQ-LSIKKAR--A-------
A0A6H1U102      -------------Q------L---------SVSQV----VRH-LSIRQAG--E-------
A0A7C3ZEJ3      -------------N------L---------SVEDV----VRN-LSIRQAG--D-------
A0A563VLD6      -----------------GLSV---------GEVIS----KLS-INTQEVNEIP-------
A0A2P8W9H0      -------------S------V---------SYGQL----ITN-LKIVPNQ--D-------
A0A6I5P386      -------------E------M---------TYRQL----IFS-LGIKKSN--E-------
A0A318BG22      -DAFVDDAATGGGD---GKAPAVRQRRIDAATAVV----MRN-IEAAPLV--G-------
A0A2T1E9V8      -------------Q---KTPL---------SVGDL----QAG-LEVINIE--G-------
A0A1Z4LN32      -------------N---GKPL---------DPNSI------S-IGTGSIV--G-------
A0A2I8A9F5      -------------K---GERL---------KIESV------D-IQVEAIP--G-------
A0A218Q6R8      -------------E---NNLL---------RPESI------N-INIERIM--G-------
A0A218QGE0      -------------K---GNPL---------SPDAI------S-IKTEAVV--G-------
A0A3M2GQQ6      -------------------PI---------GVKQV----ASN-LSIHKAG--E-------
A0A6H1U2X0      -------------------PI---------GVKQV----ASN-LSIHKAG--E-------
K9TLQ0          -------------E------L---------KFEEL----IKN-LSVRRLK--S-------
K9QF04          -------------D------I---------DYRQL----VKQ-LKIKHKE--N-------
K9W1T3          -------------Q----------------KPESF----LKP-LKVTNIR--S-------
K9SGJ5          -------------TM--TQDQ---------MVSYV----LEN-LYIRQEK--G-------
A0A6N2JS94      -------------AA--YKDI---------DALTI----MSG-LDIRPEK--D-------
A0A6C2DSN4      -------------GS--SKPI---------DASSV----ING-LDIRPEK--D-------
L8MYT6          -------------GS--SKPI---------DASSV----ING-LDIRPEK--D-------
A0A352JGJ6      -------------SS-KIKDI---------DAVTI----MSG-LEIRPEK--D-------
A0A1J5GLS2      -------------AS-AYREI---------DAGTI----MGG-LEIRPEK--D-------
A0A2W4W6M5      -------------AN-TYKEI---------DAGTI----MGG-LEIRPEK--D-------
A0A2W7AN33      -------------AI-PYKDI---------DTLAI----MDG-LDIQPEK--N-------
A0A256BLV2      -------------AL-SFKDL---------DPLTI----MNG-LDIRPEK--D-------
A0A2W6ZXF3      -------------AS-SYKEI---------DAGTI----MNG-LEIRPER--D-------
A0A2Z5WX66      -------------SN-ASKDI---------DAVTI----MNG-LEIRPEK--D-------
K1XF69          -------------D---GEPV---------APEDI----RRN-LDMRIIG--G-------
B5W297          -------------D---GEPV---------APEDI----RRN-LDMRIIG--G-------
A0A6H2AL05      -------------D---GEPV---------APEDI----RRN-LDMRIIG--G-------
H1W7M8          -------------D---GEPV---------APEDI----RRN-LDMRIIG--G-------
A0A5Q4H6A5      -------------D---GDPI---------YPEDI----RRN-LDIRIIG--G-------
D5A466          -------------D---GDPI---------YPEDI----RRN-LDIRIIG--G-------
U5QJM6          -------------K---LKDD---------DIDDV----IKR-LEIEQVT--R-------
A0A1Z4RPC6      -------------A---GKPL---------KTEDF----KKK-LTVEIVG--G-------
A0A2T1CMZ0      -------------L---GEPL---------KVKEF----KEK-LAIEIVG--G-------
L8M4F7          -------------N---GEFI---------DPNGL----RPQ-LKVKLLP--G-------
A0A140K2P2      -------------Q---GKPI---------KPKDF----EKK-LSIELVG--G-------
K9XWX4          -------------Q---GKPI---------KPKDF----EKK-LNIELVG--G-------
A0A140KB14      -------------E---GKAL---------KPEVL----NNK-LKIEIIG--G-------
K9XX88          -------------E---GKAL---------KPEAL----NKK-LKIEIVS--G-------
A0A563VSV6      -------------E---GETL---------TAKDL----RRK-LQVGLVG--G-------
L8LZE9          -------------E---GEPL---------TPEKM----TKK-LKADLVG--A-------
A0A433NM31      -------------Q---GEPL---------KIKEF----QQR-LEVKNIK--G-------
A0A1Z4NDS1      -------------E---GNPL---------QIKAF----RSK-LKVDSAK--G-------
U9VXM0          -------------E---GELL---------QPDEL----LRD-LTITGIP--G-------
A0A6M0RI13      -------------E---GELL---------QPEDL----LKS-LTVTGVP--G-------
A0A6M0S1N5      -------------E---GELL---------QPEDL----LKS-LTVTGVP--G-------
K9F4D9          -------------E---GELL---------QPEDL----LKG-LTVTGVP--G-------
A0A6I5QPI5      -------------S---GRPL---------NPRAL----LGK-VSAQPVG--G-------
A0A1Z3HMQ0      -------------K---GNSI---------PPDVL----RRG-LTIAPLE--G-------
A0A433W533      -------------R--TSEPL---------KPADI----IGK-LKLKNIG--G-------
A0A2P8QWJ3      -------------R--TSEPL---------KPADI----IGK-LKLKNIG--G-------
A0A2T1FKP8      -------------R--TSEPL---------KPADI----IGK-LKLKNIG--G-------
K9U6L7          -------------R--TSEPL---------KPADI----IGK-LKLKNIG--G-------
A0A1E5QP61      -------------Q---GKFI---------PPGDF----LSQ-LNVKKIE--G-------
U5DPF5          -------------D---GTPM---------APQNI----VGN-LKVYEVP--N-------
A0A6P0X488      -------------A---GESV---------KPGYI----LGG-LTVEGIK--G-------
A0A6P0UVD5      -------------A---GESV---------KPSYV----LGG-LTVEGIK--G-------
A0A6P0VDM0      -------------A---GESV---------KPSYV----LGG-LTVEGIK--G-------
A0A6M0G142      -------------E---GEAV---------KPGYI----LGG-LTVEGIK--G-------
A0A6P0MR53      -------------A---GESV---------KPGYI----LGG-LTVEGIK--G-------
A0A3M2GIL5      -------------E---GNLI---------PPGGL----LSG-LGVKGIK--G-------
A0A6H1TSJ9      -------------E---GNLI---------PPGGL----LSG-LGVKGIK--G-------
A0A3M1PML8      -------------K---GEPV---------LVKDF----LSK-LKANSIP--A-------
A0A6M8BE85      -------------N---GDPM---------LVKDV----VSK-LTARSIP--A-------
A0A0T7BPZ0      -------------Q---GKPL---------TIEDL----TKN-IKVEVVK--G-------
A0A352X442      -------------T---GNPI---------KPEVV----LQG-LQVKPVA--G-------
A0A6B3NF44      -------------E---GNPL---------DPKTL----WAG-LEVKPVT--G-------
A0A6M0EPL4      -------------E---GNPL---------DPKTL----WAG-LEVKPVT--G-------
A0A6P0K6L6      -------------E---GNPL---------DPKTL----WAG-LEVKPVT--G-------
A0A6P0MRR9      -------------E---GNPL---------DPETL----LKH-LSAEPVA--G-------
A0A6P0UX57      -------------E---GEPM---------AAEQL----LKA-LTAEPVA--G-------
A0A6P0X1X4      -------------E---GEPI---------APEKL----LKG-LTAEPVA--G-------
A0A0M0SHU3      -------------E---GEPL---------TVEEL----LED-LKVESVK--G-------
A0A1D2PBN3      -------------K---GKPL---------TIQEL----SKK-LKIKGDK--G-------
A0A0C2LVR7      -------------R---GKPL---------TIQEL----SKK-LKIKGDK--G-------
A0A1Z4PQB9      -------------K---GKPL---------TIQEL----SKE-LKIKGDK--G-------
A0A1Z4SFN6      -------------E---GQLL---------TIPNF----TAK-LKTKNYK--G-------
K9PGI8          -------------R---GKFI---------QTQDL----SHK-LKVESSK--G-------
Q7NEU3          -------------E---LLDQ---------DAEDI----TKR-LEIIREE--R-------
A0A3C0N2P0      -------------D---I------------DANTL----RSQ-LQISRLG--E-------
A0A6P0JR04      -------------K---M------------DYNGV----IGN-LSISRVE--T-------
A0A6B3M6M6      -------------E---F------------DYNTL----QEQ-LTVSQLR--E-------
A0A6P0KD09      -------------E---F------------DYDSF----QDK-LTVTQLR--E-------
A0A6B3NIJ0      -------------E---F------------DYDSF----QDK-LTVTQLR--E-------
A0A6M0F053      -------------E---F------------DYDSF----QDK-LTVTQLR--E-------
A0A6P2ATU9      -------------E---V------------DYGAL----VGA-FNVSQIV--G-------
A0A352XE00      -------------E---I------------DYNLL----RTK-LTISRLQ--Q-------
A0A6P0QC14      -------------E---I------------DYDTL----RGK-LGISRLA--E-------
B4VS56          -------------E---I------------DYNTL----RSQ-LAINQLQ--E-------
A0A352AAQ3      -------------T---V------------DYDTL----RTK-LIISRLQ--Q-------
A0A350Y472      -------------E---V------------DYSAL----RTK-LTISRLQ--E-------
A0A355DVB4      -------------E---V------------DYSAL----RTK-LTISRLQ--E-------
A0A1Z4RMB9      -------------E---DKPL---------KPEDF----RKK-LVTEVVG--G-------
A0A318B4H2      EEPSAAAPRTRSAQE-QGKRLDQ-------AASIL----LDN-ITVEPIG--A-------
B4WQE3          -------------D------I---------SYDSL----KNN-LTITPND--N-------
A0A2K3BR24      -------------E---GEPL---------TPGGM----RKN-LNVTRLS--D-------
K9YXY1          -------------E---GEPL---------TPGGV----RKN-LNVTRLS--D-------
A0A0V7ZFJ4      -------------K---GKLL---------KPSVL----ISK-LRVNAVG--D-------
A0A0V7ZNJ9      -------------D---NEPI---------SIEDF----LKQ-LKVKSAK--G-------
A0A367RIS1      -------------L---GQPL---------EIDTF----LSN-LKIKSIR--G-------
A0A235IXQ2      -------------L---GQPL---------EIDDF----LHN-LKIKSVR--G-------
A0A1W5CNX3      -------------Q---GQPL---------EIDDF----LRS-LKIKSVR--G-------
A0A5Q0GJJ5      -------------Q---GQPL---------EIDDF----LRS-LKIKSVR--G-------
Q3MEB7          -------------Q---GQPL---------EIDDF----LRS-LKIKSVR--G-------
A0A1Z4KHN9      -------------Q---GQPL---------EIDDF----LRN-LKIKSVR--G-------
Q8YT70          -------------Q---GQPL---------EIDDF----LRN-LKIKSVR--G-------
A0A166IWU6      -------------E---GEPL---------RIDNF----LGS-LKVNAVR--G-------
A0A2S0Q8C0      -------------E---GEPL---------KIDHV----LGS-LKVQAIR--G-------
W6FSX4          -------------E---GEPL---------KIDHV----LGS-LKVQAIR--G-------
A0A218Q4C1      -------------E---GEPL---------GVGSF----LGK-LKVTTIR--G-------
A0A6P1ZT04      -------------E---GEPL---------AIDDF----LKK-LKVQSIR--G-------
A0A0R0M9H9      -------------K---GEPI---------EIDRF----LKQ-LKLQTIR--G-------
A0A1S1ZVW2      -------------K---GEPI---------EIDVF----LKQ-LKLQIIR--G-------
A0A1B7WX82      -------------K---GGQI---------SLENF----LKK-LKLKSIR--G-------
A0A1B7WTD1      -------------K---GAPM---------TTDAF----LKT-LKLKTIR--G-------
A0A480ABC0      -------------K---GAPM---------TTGDF----LKI-LKLKTIR--G-------
A0A1Z4LRU5      -------------E---GETL---------SHEAF----LKL-LQVKSIR--G-------
A0A1Z4JVB4      -------------K---GQPL---------SIEDF----LKN-LKLKTIR--G-------
K9PIA4          -------------T---GEYL---------PIETF----LKI-LQLKTIR--G-------
A0A1Z4HVE1      -------------S---GKPL---------TIEKF----LKL-LKLKTIR--G-------
A0A252ECZ1      -------------S---GKLV---------SIERF----LKV-LKLKTIR--G-------
A0A1Z4G5Y1      -------------S---GKPL---------SIEKF----LKK-LKLKTIR--G-------
A0A252DNA2      -------------S---GKPL---------SIEKF----LKL-LKLKTIR--G-------
A0A252E1Q4      -------------S---GKPL---------SIEKF----LKL-LKLKTIR--G-------
A0A6G9SK36      -------------W---GKPL---------TIEKF----LKI-LKLKTIR--G-------
A0A1Z4M597      -------------S---GKPL---------TIEKF----LKL-LKLKTIR--G-------
A0A1Z4MWT1      -------------S---GKPL---------SIEKF----LKL-LKLKTIR--G-------
A0A1Z4TX53      -------------S---GKPL---------SIEKF----LKL-LKLKTIR--G-------
A0A5P8VSD1      -------------L---GQPL---------ELRDF----LRN-LKIKNIR--G-------
A0A2A2TNQ5      -------------K---GKPL---------EIDDF----LKN-LKVKSVK--G-------
A0A3S1C4K5      -------------K---GKPL---------KVEPF----LKL-LKVKSVK--G-------
A0A1X4G3D5      -------------E---GKPL---------DPDVI----LGN-LKLQTVR--G-------
D4TNI2          -------------E---GKPL---------DPDVI----LGN-LKLQTVR--G-------
A0A1Z4H6Z8      -------------S---GKPL---------TIEKF----LKL-LKLKTIR--G-------
A0A1Z4NPM1      -------------K---GKPL---------SVEDF----LKN-LKVKSVR--G-------
A0A3F3KPR9      -------------K---GEPI---------EIDRF----LKQ-LKLQTIR--S-------
D4TGN7          -------------K---GEPI---------EIDRF----LKQ-LKLQTIR--G-------
A0A1Z4UZW9      -------------Q---GKQL---------SLEVF----LKK-LKLKTIR--G-------
A0A0K2M5H0      -------------Q---GKQL---------SLEVF----LKK-LKLKTVR--G-------
A0A1B7VSH4      -------------Q---GKQL---------SLEVF----LKK-LKLKTVR--G-------
A0A1B7W126      -------------Q---GKQL---------SLEVF----LKK-LKLKTVR--G-------
A0A3D4C6Q6      -------------Q---GKQL---------SLEVF----LKK-LKLKTVR--G-------
A0A1B7UVJ4      -------------Q---GKQI---------SLENF----LTK-LKLKTIR--G-------
A0A1B7UTR1      -------------Q---GKQI---------SLENF----LTK-LKLKTIR--G-------
K7W0A4          -------------Q---GKQI---------SLENF----LKK-LKLKTIR--G-------
A0A5C0DRW9      -------------Q---GKQI---------SLENF----LKK-LKLKTIR--G-------
A0A6H2C088      -------------Q---GKQI---------SLENF----LKK-LKLKTIR--G-------
A0A1Q4RTR1      -------------K---GQPL---------AFEEF----SKN-LKVSGVK--G-------
A0A1Z4SQV2      -------------N---GQPL---------TVEEF----SQK-LKVAGVK--G-------
A0A2H2XGN1      -------------N---GQPL---------TVEEF----SQK-LKVAGVK--G-------
A0A433UXH8      -------------K---GQPL---------TIEEF----SQK-LKVTGVK--G-------
A0A1U7HGH0      -------------N----TTL---------SLESL----RQG-LDIVAVE--G-------
K9XJD3          -------------N----TAL---------SLESL----RQG-LDIVDVE--G-------
K9SX01          -----------------ALPL---------DNDVF----LKP-LSLDVIK--Y-------
A0A4P7ZT55      ------------------------------EPDAL----VGR-VTARSVQRDA-------
A0A1E5QIR9      -------------E---GQPL---------KRKDF----LRR-LSISTLK--D-------
A0A1Z4IBC7      -------------N---GKKL---------SIRIF----AQQ-LKIEGIK--G-------
A0A1W5CPC7      -------------N---GKPL---------SIRIF----AKQ-LKIEGIK--G-------
A0A5Q0GKD1      -------------N---GKPL---------SIRIF----AKQ-LKIEGIK--G-------
Q3MDC6          -------------N---GKPL---------SIRIF----AKQ-LKIEGIK--G-------
A0A1Z4KM73      -------------N---GKPL---------SIRIF----AKQ-LKIEGIK--G-------
Q8YNX7          -------------N---GKPL---------SIRIF----AKQ-LKIEGIK--G-------
A0A367R4K6      -------------H---GKLL---------SIRDL----AQQ-LKVEGIK--G-------
A0A1E2WSV8      -------------Q---GKPL---------SIPDL----AKQ-LKIEGIK--G-------
A0A2R5FRT9      -------------K---GKLL---------SIPDL----AKQ-LKIEGIK--G-------
A0A2K8T1B6      -------------K---GKRL---------SIPDL----AKK-LKIEGIK--G-------
A0A235I9I0      -------------Q---GKLL---------SIPDL----AKQ-LKIEGIK--G-------
A0A2D0HQT8      -------------Q---GKLL---------SIPDL----AKQ-LKIEGIK--G-------
A0A2L2NU95      -------------Q---GKLL---------SIPDL----AKQ-LKIEGIK--G-------
A0A367S084      -------------Q---GKLL---------SIPNL----AKQ-LKIEGIK--G-------
A0A6P1A9A0      -------------N------Y---------DYSSL----SNN-LKINRLG--Q-------
A0A1Z4SMD6      -------------K---GKLL---------NPELV------K-VKVETIT--G-------
A0A2H2Y096      -------------K---GKLL---------NPELV------K-VKVETIT--G-------
K9S8M8          -------------S---GKPM---------KPESF----LRG-LEVKTIR--G-------
A0A1Z4NFV0      -------------N---GKLL---------DPDLL------K-IKVEPVM--G-------
A0A3M9ZEU1      -------------N---GKRL---------QPQDI----SKQ-LKVKNIP--S-------
A0A1Z4JK72      -------------K---GRPM---------DPEEL----SKQ-LKVEAVP--T-------
A0A0N7Z489      -------------Q---GRPL---------EPDEL----SRQ-IKVEPVP--T-------
A0A0S3TXS2      -------------Q---GRPM---------EPEEL----SRQ-VKVEAVP--T-------
A0A2A2TPF8      -------------T---GKLI---------EPESL------I-IKVEPIA--G-------
A0A1Z4R0P8      -------------T---GKLV---------DPKSL------I-IKVEPVA--G-------
A0A0T7BUI3      -------------Q---GKFR---------NPETL------L-IKVEPIV--G-------
A0A1Z4LP32      -------------D---GKPL---------EPESL------P-MEVEALV--G-------
K9REP9          -------------D---GKPL---------EPEAL------D-LEIEPLV--G-------
A0A1Z4SIJ3      -------------K---GHPL---------DPDQL------K-IKIEAIP--G-------
A0A2H2XPG4      -------------K---GHPL---------DPDQL------K-IKIEAIP--G-------
K9V3C7          -------------K---GRSL---------VPEAF------K-IKVEAVP--G-------
A0A1Z4T6Y7      -------------N---GNLV---------KPESL------N-IKVEPII--G-------
A0A2H2Y561      -------------N---GNLV---------KPESL------N-IKVEPII--G-------
A0A1Q4S362      -------------N---GELL---------EPESI------N-IKIEPIP--G-------
A0A3S1CIN8      -------------N---GELL---------KPESI------N-IKIDPIP--G-------
A0A2A2TC28      -------------D---GKPV---------DVELF------K-VLVEPVV--G-------
A0A0C1NCB0      -------------D---GTPL---------QPEDL------E-IKVDPVV--G-------
A0A2N6K7Q9      -------------Q---GKLI---------APELL------K-VNVKPIV--G-------
A0A2N6MXH6      -------------Q---GKLI---------EPELL------K-VNVKPIV--G-------
A0A2N6M5A8      -------------Q---GKLI---------DPELL------K-VNVKPIV--G-------
A0A2N6LL61      -------------Q---GKLI---------DPELL------K-VNVKPIV--G-------
A0A0S3TP66      -------------Q---GKLI---------DPELL------K-VNVKPIV--G-------
G6FP91          -------------Q---GKLI---------DPELL------K-VNVKPIV--G-------
A0A1U7GYR5      -------------Q---GKLI---------DPELL------K-VNVKPIV--G-------
A0A2N6KY52      -------------Q---GKLI---------DPELL------K-VNVKPIV--G-------
A0A2N6KMP5      -------------Q---GKLI---------DPELL------K-VNVKPIV--G-------
A0A2N6MA45      -------------Q---GKLI---------DPELL------K-VNVKPIV--G-------
A0A4Q9J9V9      -------------Q---GKII---------DPELL------K-INVKPIV--G-------
A0A328IGA1      -------------Q---GKII---------DPELL------K-INVKPIV--G-------
A0A4D9CE41      -------------Q---GKII---------DPELL------K-INVKPIV--G-------
A0A0M0SFT2      -------------Q---GKLI---------DPELL------K-INVKPIV--G-------
A0A1Z4TLC8      -------------Q---GKLI---------DPELL------K-INVKPIV--G-------
A0A0C2LFH0      -------------K---GNAL---------DPESL------K-IKVEPIV--G-------
A0A1Z4IYV4      -------------K---GNTL---------DPESL------K-IKVEPIV--G-------
A0A1Z4Q0T6      -------------K---GNTL---------EPESL------K-IKVEPIV--G-------
A0A0C2PT44      -------------K---GETL---------DSESL------K-IKVEPIV--G-------
A0A1D2P6J4      -------------K---GATL---------EPESL------K-IKVEPIV--G-------
B4WP72          -------------E----EAL---------TPTSL----KEG-LEVKAIP--G-------
A0A2T1CIL7      -------------Q---GNFL---------KYQEI----LAN-LEVKPIV--G-------
A0A433V7A0      -------------Q---DNAR---------LETNL----KKQ-FQVKNIA--G-------
A0A2T1FTR8      -------------KY-ANRPERKRLDKFINKNESF----VQQ-LKVSSIK--N-------
K9UA41          -------------KY-ANRPERKRLDKFINKNESF----VQQ-LKVSSIK--N-------
A0A0C2LBE2      -------------K---GKAI---------TIEEL----TNT-LKISSLK--G-------
A0A433NN38      -------------L---GNPL---------RIEDL----AAA-LSVVSVK--G-------
A0A2N6K0T2      -------------D---GEPL---------RVEDV----QKN-LKVEGVK--G-------
A0A2N6ML72      -------------E---GEPL---------KVEDL----QKK-LKVEGVK--G-------
G6FQZ6          -------------E---GEPL---------KVEDL----QKK-LKVEGVK--G-------
A0A2N6MQX9      -------------E---GEPL---------KVEDL----QKK-LKVEGVK--G-------
A0A2N6KXT6      -------------E---GEPL---------KVEDL----QKK-LKVEGVK--G-------
A0A2N6KGB9      -------------E---GEPL---------KVEDL----QKK-LKVEGVK--G-------
A0A2N6L3Y5      -------------E---GEPL---------KVEDL----QKK-LKVEGVK--G-------
A0A0S3TIS7      -------------E---GEPL---------KVEDL----QKK-LKVEGVK--G-------
A0A1U7GW28      -------------E---GEPL---------KVEDL----QKK-LKVEGVK--G-------
A0A2N6LW63      -------------E---GEPL---------KVEDL----QKK-LKVEGVK--G-------
A0A328IH74      -------------E---GEPL---------TVEEL----LEN-LKVEGVK--G-------
A0A4D9CIB0      -------------E---GEPL---------TVEEL----LEN-LKVEGVK--G-------
A0A1Z4TQ63      -------------E---GEPL---------KIEDL----LKN-LKVEGLK--G-------
A0A4Q9J8G2      -------------E---GEPL---------KIKDL----LKN-LKVEGLK--G-------
A0A350Y0P6      -------------E---GTPV---------QPSSI----GAG-LKVEGIK--G-------
A0A352X940      -------------N---GSPI---------KPENL----LGR-LTVKGLK--G-------
B8HTN4          -------------Q---GQLL---------KPEAF----LES-LSVNNIR--G-------
A0A6P1AFJ5      -------------E------I---------NYNSL----AQN-LKISQVN--N-------
B0CAX4          -------------E---DQPL---------ETKDF----IEA-LTVFNVR--D-------
A0A1Z4RN12      -------------D---GEPL---------TYKSV----STA-LSVEPII--G-------
A0A2T1CMF9      -------------K---GEPL---------TYKTV----KKA-LKVEPVI--G-------
Q7NDC5          -------------RR-PGELL---------ATTDF----LRA-LKVEALR--R-------
U5QGK3          -------------QR-RGQLL---------RPEKF----LKA-LKVETLR--R-------
A0A2W4UY24      -------------E---GAPL---------EANAL----LQD-MSVRAIP--G-------
A0A0D8ZUV2      -------------D---GEVL---------LPEGF----LKK-QNIKQLA--A-------
A0A433VDI0      -------------A---GVPL---------EPEDF----IKE-LKVKQLS--A-------
A0A3D1PG43      -------------K---GATV---------QPTEL----LGK-LKLKNVP--A-------
A0A2P8QQ72      -------------E---GKPL---------KPTAL----ISQ-LTLKNIP--A-------
K9TZQ7          -------------E---GKPL---------KPTAL----ISQ-LTLKNIP--A-------
A0A6N8G584      -------------S---GALI---------KPQVL----ANR-INARNVP--L-------
A0A2G7GPR0      -------------G---GSLM---------KPQTL----ATR-INAKNVP--L-------
K9XH68          -------------G---GSLI---------KPQAL----AGK-MSAKNIP--L-------
A0A1U7HW70      -------------S---GSLI---------KPQAL----AGK-MSARNIP--L-------
A0A2S6VEJ8      -------------N---GSLL---------KPQVL----ASR-VNARNIP--L-------
A0A140KBA0      -------------Q---DELY---------RYKDL----INK-LEIKPVT--G-------
K9XSG1          -------------Q---DELY---------RYKDL----INN-LEIKALT--G-------
A0A2T1GMT4      -------------R---GKLI---------AASDL----HSG-LTTKIVG--G-------
K9UI51          -------------R---GKLL---------TASDI----HTG-LTTKIIG--G-------
K9QM62          -------------Q---GKPL---------TVKAL----AKN-LDLKIVG--G-------
A0A1Z4FWI3      -------------K---GEPL---------TVEAL----KQR-LTLKIVG--G-------
A0A1Z4JYE7      -------------K---GEPL---------TVEEL----QEK-LTLKIIG--G-------
A0A2T1FXY4      -------------R---GELQ---------EVEAF----KKA-VKLKIVG--G-------
K9TYI2          -------------R---GEPQ---------EIEAF----KKA-VKLKIVG--G-------
A0A1Z4QL41      -------------K---GEPL---------EVEDL----VKD-LTLKIIG--G-------
A0A252D4T4      -------------I---GEPL---------TVEAL----KKA-INLKIIG--G-------
A0A252DJH5      -------------I---GEPL---------TVEAL----KKA-INLKIIG--G-------
A0A252EB80      -------------I---GEPL---------TVESL----KKA-INLKIIG--G-------
A0A6G9SKZ9      -------------E---GKPL---------TAEAL----KKA-LNLKIIG--G-------
A0A1Z4HPW5      -------------Q---GQLL---------TPEAL----KKA-LNLKIIG--G-------
A0A1Z4MSN1      -------------E---GKPL---------TTEAL----KKA-LSIKIIG--G-------
A0A1Z4U1C2      -------------E---GKPL---------TTEAL----KKA-LSIKIIG--G-------
A0A0D6KV51      -------------E---GKPL---------TPEVL----KKA-LNIKIIG--G-------
A0A1Z4MKF8      -------------E---GKPL---------TPEVL----KKA-LNIKIIG--G-------
A0A2C6WC43      -------------E---GQPL---------TVKAL----QKS-LILKIIG--G-------
A0A1Z4L5A1      -------------E---GQPL---------TVKAL----QKS-LVLKIIG--G-------
A0A367QD86      -------------E---GQPL---------TVKAL----QKS-LVLKIIG--G-------
A0A235IZ96      -------------E---DKPL---------EVQAL----QKS-LTLKIVG--G-------
A0A2L2NGP0      -------------E---DKPL---------EVKAL----QKS-LTLKIVG--G-------
A0A2K8SM78      -------------E---GKPL---------EVEKL----RNS-LTLKIVN--G-------
A0A2R5FPC0      -------------E---GKPI---------EVEKL----RKA-VILKIIN--G-------
A0A5P8W5T6      -------------E---GKPI---------EVEKL----RKA-VIMKIVN--G-------
A0A0F5YE28      -------------E---GKLI---------DPESI----RKS-LEVKIIG--G-------
U7QEH7          -------------E---GKLR---------EAESI----RKS-LEVKIIG--G-------
A0A3S1ATK5      -------------K---GEVL---------EVEDL----QKS-LTLKIVG--G-------
A0A2Z6CPH0      -------------N---GESL---------KVEEL----QKK-LKLKIIG--G-------
A0A1Z4GT50      -------------N---GEVL---------AVEEL----AEA-LELKIVG--G-------
A0A1Z4GIX0      -------------K---GEPL---------KVEEL----QKN-LTLKIVG--G-------
A0A2H6LC24      -------------K---GEPL---------KVEEL----QKN-LTLKIVG--G-------
B2J6N5          -------------E---GKPL---------EVEKL----RKS-LTLKIVS--A-------
A0A367RMI4      -------------D---GEPL---------EVKKL----LKL-LNLKVIG--G-------
A0A235HUM0      -------------E---GEPL---------EVKAL----QKA-LNLKIVG--G-------
A0A2L2NW47      -------------E---GEPL---------EVKEL----LKV-LNLKIVG--G-------
A0A1E2WUR1      -------------E---GIPL---------EVQAL----KKA-LNLKIIG--G-------
A0A235IKU3      -------------E---DKPL---------EVQAL----QKS-LTLKIVG--G-------
A0A1U7MYU6      -------------E---GLPL---------EPEAL----KRR-LTIKIVG--G-------
A0A1D8TNX9      -------------E---GLPL---------EPEAL----KRR-LTIKIVG--G-------
A0A6P0L6C2      -------------E---GLPL---------EPEAL----KRS-LTVKIVG--G-------
A0A6P0MVH0      -------------E---GLPL---------EPEAL----KRS-LTVKIVG--G-------
A0A6P0KJV0      -------------E---GLPL---------EPEAL----KKK-LTVKIVG--G-------
A0A6L9ZJG4      -------------E---GLPL---------EPEAL----KRR-LTIKIVG--G-------
F4XKF3          -------------E---GLPL---------QPEAL----KRK-LTVKIVG--G-------
A0A1D9FX10      -------------E---GLPL---------EPEAL----KKK-LTVKIVG--G-------
A0A6P0Q0T0      -------------E---GLPL---------QPEAL----KRK-LTVKIVG--G-------
A0A6P0W5I0      -------------E---GLPL---------QPEAL----KRK-LTVKIVG--G-------
A0A3C0NJ41      -------------K---GKSL---------TPEDF----QKK-LKAKIVG--G-------
A0A352AG88      -------------D---GTPL---------SPEAL----HEK-LTIENLA--E-------
A0A350Y374      -------------Q---GEPI---------SPESL----QKK-LKIKTIG--A-------
A0A355DPX0      -------------Q---GEPI---------SPESL----QKK-LKIKTIG--A-------
                                                                            

K9SLA9          ---SEILEISYHDPDPKRAASIVNTVSKIYIASDLETKSLEAKSLLQFVERQ-LPTSKSA
A0A168TT23      ---SRLVYVSVNSFDPAFAAQLANAVVEEYVRSTMQRRYDAGQEAREFLEGQ-LADMRIA
A0A0M1JWX9      ---TKIIEVRYQDEDPEKIDFILKKLAENYLRYSFEDRQTNTRKGIQFIEEQ-LPQLRQR
A0A2T1M1V6      ---TTVIDLEVEATSPELAYQRVKTLMNSYQKRLNELRQQDVKSQDQFAENA-LKKAQNN
A0A2G7GCS2      ---STIINLQVKASSPEIAQKRLSNLINVYQLRLNELRHQDTNVRKQFSQTD-LEDAQAQ
K9XBH8          ---TTIIALEVKASSPEIAQQRLNNLINIYQLRLNELRYQDTSVREEFSRGD-IEKARQQ
A0A1Z4LJ30      ---STVISVSVEGSSPELAQQRANGLIKAFRDRLQELRKDEAQQRSQFMQDE-VKQAYQK
K9RI76          ---STVISLEVQGSSPELAKNRAAALIAAFSNRLQELRLDEAKQRSQFMQGE-VKLANTK
A0A352AE27      ---STTISLTVKGSSPELAHQRAIALIEAYQQRLNELRQTDGVARAQFSQKQ-LEQAQQR
A0A3B8JH60      ---STIISLAVNGSTPEVARQRAIALLKVYQARLNELRQADGMSRKQFSQKE-LEQAKER
A0A3C0N766      ---STIISLAVNGSTPEVARQRAIALLKVYQARLNELRQADGMSRKQFSQKE-LEQAKER
K9W9J7          ---STIISLAVSGSTPELAKGRANNLLQVYQQRLNQLRQADSASRKQFSQKE-LNQAKAR
A0A139WSU3      ---STIMLLTVSGSSPKLANQRAIAITEAYQNRLNELRQANSRTRQKFSQIE-LEQAKLK
A0A433VN22      ---STVLSLTVSGSQPDLATLRTQNLIKAYQARLDELREGNSKERQKFNVKE-LEQAKAK
Q7NF11          ---TTILAVEAKGNAPEVAEARADLVVRSYVARLEELRNAYAASRDTLSQKE-LDRARRE
A0A1Z4JCS8      ---TSVMLLSVTGSSPDIAKQRAEAILNAYRQRLSELRQANNNTRDGFSQKQ-LEQAQRR
A0A6P0PI80      ---STTIWLNATGASPELARDRVRALISAYQERLNELRQADGTTRVEFNKKA-LDRAKQK
A0A6P0WGT6      ---STTIWLNATGASPELARDRVRALISAYQERLNELRQADGTTRVEFNKKA-LDRAKQK
F4XTX2          ---STTIWLNATGASPELARDRVRALISAYQERLNELRQADGTTRVEFNKKA-LDRAKQK
Q7NJN6          ---STIVQLEAKGSSPELAQQRAEWVLQSYQTRLNALRLDDARRRDEFSRVE-TAKAQNN
U5QCC3          ---STIVQVQVKGSSPEIAKNRANALLQSYQRRLNELRLDDARRRDQFSHEE-LERAKRT
A0A3M1SVZ4      ---SDILTISYQDENPKKAATFVNSLIEVYLEDDILRKRAELTATREFIEAK-LPDAEYT
A0A654SFI6      ---SSLVDIEFSSPSPEISSKISNLWADEFIRANYEKRFGANIDAREFLNKQ-IEELRER
K9SSQ0          ---AKVLNISYSDRNPKTAATIL----QGLLETYKAYGANKANQATQLIQAQ-IPDAKKQ
A0A2W1JIN9      ---TDIFQLQYTSSDPELASRMLNSIAQTVVQENTETIQAEAKSAREFLEGQ-IPQRRQE
A0A318AJV1      ---SYIISLGFKSRDAAKSSRIANAFADTYLDMRVHGEASSSVQQAAFFRQR-LDELARQ
A0A6P0IC70      ---TNILEISYQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRAL
A0A6B3MUB5      ---TNILEISYQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRAL
A0A6M0B7N4      ---TNILEISYQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRAL
A0A6P0J9W3      ---TNILEISYQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRAL
A0A6P0ZWE1      ---TNILEISYQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRAL
A0A1U7N2U4      ---TNILELSYQSQNPELATTVLNAVANAMVSESAQGIRSEARAVREFLEKE-VPLRRLE
A0A1D9G1F2      ---TNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLE
A0A6P0PNZ7      ---TNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLE
F4XV38          ---TNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLE
A0A6P0W137      ---TNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLE
A0A6L9Y9E2      ---TNILELSYQGQNPELATTVLNAIANAMVSESAEGIRSEAKAVREFLEKE-VPLRRLE
A0A6P0SGR0      ---TNILELSYQGQNPELATTVLNAIANAMVTESAEGIRSEARAVREFLEKE-VPLRRLE
A0A6M0BK48      ---TNILELSYQGQNPELATTVLNAVANAMVTESAEGIRSEAKAVREFLEKE-VPLRRLE
A0A6L9YZL1      ---TNILELSYQGQNPELATTVLNAIANAMVTESAEGIRSEAKAVREFLEKE-VPLRRLE
A0A6P0KYM4      ---TNILELSYQGQNPELATTVLNAVANAMVTESAEGIRSEAKAVREFLEKE-VPLRRLE
A0A6P0LSD6      ---TNILELSYQGQNPELATTVLNAVANAMVTESAEGIRSEAKAVREFLEKE-VPLRRLE
A0A6P0X384      ---TNILELSYESENPELATRLLNTVLQVMVQESSEAIRSEARSLREFLEAE-LPKRRAA
A0A2P8QIL5      ---TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-VPKKRAQ
A0A2T1FLY5      ---TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-VPKKRAQ
A0A433W447      ---TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-VPKKRAQ
K9U1K8          ---TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-VPKKRAQ
K9UYB2          ---TNIIDLSYQSEDSQLAANLVNSVAMAMIRDHVQAISSEATKIREFLETKELPKARQA
A0A218QN17      ---TNILELSYKSKDPELAAQLLNAVSQAMIEENTKTISSEATKVREFLENNEIPNARKR
K9RKN2          ---TNILQISYENQDPLLAARLLNAVSSAMVEYDIKAISSEATKVKDFLENKQLPIARKK
A0A2I8ADV2      ---TNILQLNYFHQDPQFAADVLNAVSQAMVEENIQAISSEATKVRKFLEKE-VPVARNR
A0A1W5CKM3      ---TNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQR
A0A5Q0GMF5      ---TNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQR
Q3MEW0          ---TNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQR
A0A1Z4KIC7      ---TNILDLRYQSPEPNQAAQVLNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQR
Q8YSM5          ---TNILDLRYQSPEPNQAAQVLNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQR
A0A1Q4S1H4      ---TNILELSYKASDPVFAARLLNAVSNAMVEENIKTISSEATKVRQFLEKNEVPNAQQR
A0A433VBU6      ---TNILELRYKAADPVFATRLVNAVTDAMVEENIKTMSSEATKVREFLEKKEVPNAQQR
A0A1Q4RZJ6      ---TNILEISYQSKNPDLAATYANAVAMATIRDNIKSISSEATKVRQFLQQQ-LPQARTQ
A0A1Z4SNV3      ---TSILEISYQSKNPELAATYVNAVAMATIRDNTKSISTEATKVRQFLQQQ-LPQARAQ
A0A2H2XJQ1      ---TSILEISYQSKNPELAATYVNAVAMATIRDNTKSISTEATKVRQFLQQQ-LPQARAQ
A0A3S5K358      ---TNILEISYQSKNPDLAAAYANAVAMATIRDNIKSISSEATKVRQFLQQQ-LPQARTQ
A0A0T7BPJ4      ---TNILEFKYEARDAQLAAKLLNVIAQTMVEENTRTISSQATKVREFLEKKEVPAAQRN
A0A0C1QS61      ---TNILQLSYQSKNPKLAAQLLNSVARAMEEESANTIRQEAANVRKFLEME-VPKAREK
A0A139X3R8      ---TNILQLSYQSKDPILAAQLLNAVSRAMEEESANTIRQEAANVRKFLATE-VPKARQN
A0A1Z4I7C5      ---TNILELRYQSPNPEQTAQVLNAVSQAMVEENIKTINSEATKVREFLSQK-VPQARQR
A0A0C2MDK7      ---TNILELSYQSRDPQLAAKVLNAVSQAMVEDNVKSIGLEATKVKQFLEQKQVPEAEKK
A0A1Y0RCK1      ---TNILELNYQSKNPQLAAQLLNAISQAMVEDNTKSINSEATKVKEFLEEKQVPEADKQ
A0A1Z4PWZ0      ---TNILELSYQSEYPKLAARLLNAVAQAMVEDNIKAISSEATKVKAFLEKKQVPSAEKQ
A0A0C2QLT0      ---TNILELSYQSKDPRLAAKLLNAISQAMVEDNTKAISSEATKVKKFLEEKQVPEADKQ
A0A1Z4J2K1      ---TNILELSYQSKDPQLAAKLLNAISQAMVEDNTKAISSEATKVKKFLEEKQVPEADKQ
A0A3S0ZSX0      ---TNILEVSYEHKDPALASKLVNAVSQAMVEDNTQIIRQEAANVRKFLQQQ-VPEARQR
A0A2N6K4T3      ---TNILEVSYLNKDPILATKVVNAVSKAMVEDNTQVIRQEAANVRKFLETK-VPDARKR
A0A370CKT2      ---TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQ
A0A0S3TL97      ---TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQ
A0A2N6M8A0      ---TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQ
A0A2N6M9E1      ---TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQ
A0A2N6KJI4      ---TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQ
A0A2N6MZ77      ---TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQ
A0A2N6KT20      ---TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQ
G6FSN3          ---TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQ
A0A4D9CI02      ---TNILEVSYLNKDPTLATKVVNAVSQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKR
A0A328I8B9      ---TNILEVSYLNKDPTLATKVVNAISQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKR
A0A4Q9J4Z7      ---TNILEVSYLNKDPTLATKVVNAISQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKR
A0A0M0SU69      ---TNILEVSYLNKDPTLATRVVNAVSQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKR
A0A1Z4TIZ8      ---TNILEVSYLNKNPTLATKVVNAISQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKR
A0A0S3TYD7      ---SDILRVEYRSNDPMEAAEVVNHLMQLYVQDNLTANRAEAKSAREFIQSQ-LPEVERN
A0A2T1DNG3      ---TKIFSITYTSNDPIKTQKVLQAVQKVYQDYNLQQQQDRLTRGLAFVDKQ-LPQVEGK
A0A3S0Y9N9      ---TDILEISYADTNPRMAASIVNTLMKIYIENDIDINRAQTRSARSFIAQQ-LPLSKAA
A0A433UNK7      ---TDILEVYYTSTDPRTAASVVNTLMKVYIENDINANRAQTRSARDFIAQQ-LPLRKAA
A0A6P0ZKB8      ---TDILEVYYTDEEPRTAASVVNTLMKIYIENDIEANRAQTKSARDFIAQQ-LPARKAA
U5QL42          ---AGVLRVAYRDTNPERAKAVLTALGATYVEYSLESKRGQADNAIKFIEAK-LPRAKKV
A0A076HBF2      ---EGVLNVRLTGRNPIEDERLLNALSNTYLQAALQQRQQRLADGLAFLNKQ-APSLQTR
A0A354B169      ---EGVLNVSLTGHDPVQDELVLKAISAAYLHAALEQRQKRLADGLTFLNKN-APTLQQK
G4FMX5          ---EGILRVSLVGRDKDEDQQLLTALSDTYLKVALQERQQRLADGLNFLNKQ-APALEAK
Q0IDT5          ---EGVLKVSLTGRNPKEDGQLLEAISAAYLQTALQQRQKRLTDGIAFLDLQ-APALQAK
A0A2D6FCW3      ---EGILNVSVTGRDPVEDKQLLDDLSSTYLQAALQQRQQRLSDGLNFLNKQ-APALEAK
A3ZA21          ---DGVLNVSLTGRDPEQDEVLLQAISTAYLQAALQQRQQRLADGIDFLNKQ-APALQQK
A0A140K3H3      ---TDVLVVSYTDTNPERAKAVLDALGSTYVEYSLNRQRSQAGNAINFIDEQ-LPKAQAE
K9XUB8          ---TDVLVVSYIDSNPERAKAVLEALGSTYVEYSLNRQRSQAANAINFIDQQ-LPKAQAE
A0A6H2NHD5      ---SKVLRVNYRDQDPEVVAFVLSEVAEGFVDYSVDDRQAELRRGLTFLDEQ-LQEKWQE
A0A2P8W4F7      ---SKVLRVTYNGADPAVVSFVLNQVVEGFVDYSVQDRQGDLRRGLTFLDEQ-LQEKWQE
A0A5Q4E0Z4      ---SKVLRITYKNSDPEVVTTVISEVVKGFVAYSVQDRQGELRRGLEFLDEQ-LQEKWQE
A0A2P8VVX1      -TGTRIFQASYTANDPTQPQRVLAALQDIYLNYNQEQQAQRLSRGLDNVNNR-LANTQQN
A0A2P8WHY0      -KATRVFQATYVDSDPIKTQRLLEALKEAYLEFNEAQQARRLERGLEHTNNR-LDNTQKN
A0A2T1CMT9      DSATKIIQVSYVGSSPVETKKVLTAIQEVYLKYNLEQQEKRLRDALTFINQQ-IPQARKE
A0A563VQJ3      -GGSDVIEVGYNADRPEIAAEIVNTLMTIYVREQIRNNQAEPANAKEFINRQ-LPEIEVK
A0A1D8TX52      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPKARKD
A0A1D9G4T2      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNN
A0A6P0PR27      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNN
A0A6P0WER7      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNN
F4XP71          ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNN
A0A6L9YR57      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPKARKD
A0A6P0KZ31      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQEYNLEQQEMRLNKGLAFINQQ-LPTARKN
A0A6P0LPB8      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQEYNLEQQEMRLNKGLAFINQQ-LPTARKN
A0A6P0SEV1      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNN
A0A6B3N2I8      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNN
A0A6M0B891      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNN
A0A6P0IJQ1      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNN
A0A6P0J8J8      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNN
A0A6P0ZSH6      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNN
A0A1U7N5X9      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPKARKD
A0A6L9Z1V0      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNN
A0A6P0LC12      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINEQ-LPTARKN
A0A6P0MVJ3      ---TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARKN
A0A2W6ZAV2      ---SGVMDVSLLWDDRREGQQILEAISAEYLAFSMRQRQERLAQGLEFLDTQ-APVLQQG
K9W742          --KTKIFAANYTANDPVKTQKVLQAVQRVYLNYNREQQRLRLAKGLAFIDEQ-LPKARLS
A0A3D1PBA3      -VNTKIVEATYTANDPVKAEKVLEAVYKVYQIYNREQQQQRLQKGLKFINEQ-IPVVSKT
K9XPB0          -TETKIIEVAYVSQDYNDSKKILEAIEQVYIEYNVEQQEKRLRDGLAFIAKQ-IPAAQQE
A0A350Y7Z1      -TQTKIVKVVYTSNDPIQTQDVLAAIQTVYQDYNLQQQQVRLTEGLAFINDQ-LPTARDN
A0A352X2A7      ---TKIVKIDYISKDPIQTQEVLKAIQKIYQNYNLEQQKQRLVDGLSFIDNQ-LVTAANN
A0A0D8ZYV0      ---TKIVEANYVSNDPVKTQKVLQTIYQVYQSYNREQQEQRLKKGLKFINEQ-IPGVRNQ
A0A2T1FP73      ---TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-IPAVTKT
A0A433VMS2      ---TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-IPAVTKT
K9TYA7          ---TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-IPAVTKT
A0A2P8QUE1      ---TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-IPAVTKT
K9SA61          -TKTKIFEAIYTGDDPEKTQAVLQAVQKVYQDYNREQQELRLSRGLAFINDQ-LPKVQAE
A0A2G7GMH8      -VRTKIVEVLYTDNDPQRTQNVLNAMQQVYQDYNLEQQKLRLAKGLTFINEQ-LPVIKDR
A0A6N8FU92      -VRTKIVEVLYTDNDPVRTNDVLSAMQQVYQDYNLEQQKIRLAKGLTFINEQ-LPLVQDR
A0A2T1DWE8      -VKTKIFQAVYTSDDPEKTQKVLMAVQQVYKDYNREQQKLRLTRGLAFVDEQ-LPLVEKQ
A0A1U7I8L3      -VNTKIFEVTYIDNDPIKTQTVLETIKRVYQDYNREQQQLRLTKGLSFIDAQ-LPSLRES
A0A2T1DJL8      -INTSIFEMVYTGHDRQQTQAVLQAIQQVYQQYNLEQQKARLTKGLGFINEQ-IPQVEAR
A0A1Z4J9W0      -VTTNLVEVTYIDHDRIKTREVLKALEKVYQDYNLEQQRNRLTKGLSFIDRQ-IPEVQAK
A0A0N7Z5K9      -VNTSIVEMSYIDYDRVKTREVLKSLQRVYQDYNLEQQRNRLAKGLSFIDRQ-IPQVQEK
A0A0S3TXC5      -VNTNIVEMSYIDHDRVKTREVLKALQRVYQDYNLEQQRNRLAKGLSFIDRQ-IPQVQAK
B8HNB0          ---SDVLKVTYTGTDPKTVQAILDALNKTYIDYSLEKRRSQVSSGVRFIEEQ-LPAAQAK
A0A563VS48      ---TDILNIRYEGNDPEVVASVVNQALMLYKDQDRLSNRTEAVAARTFITEQ-LPQVKAN
A0A318BJ18      ---SRLVDITFSSPDPDFSARIANAWAENFIQTNLERKIQATSYGRNLLQRQ-LALQKER
A0A3B8Y8H9      ---TNIIIVSYQDIDPRKVTFILNELAKVYLDYSLNDPRMKKTQGLQFVEDQ-LPKLDQE
A0A2W1JVB9      ---GDVIELAYESEDPEEAALVINTLMKVYLADNLRINRLEASSARQYIDQE-LPKTREK
A0A6H1U102      ---ADVLIVSYTDTDPSRAKAILEALGSTYVDYSLERQLSQATNAIDFIEEQ-LPKAQAE
A0A7C3ZEJ3      ---ADVLIVSYTDRDPERAKAVLEALGNTYVDYSLERQRSEATNAIGFIKEQ-LPEAQKE
A0A563VLD6      ---TDVLTVSFIDSSPQRAKEVLDALGKVYVQYSLDKQRSQAANAIDFIDEQ-LPDSQLD
A0A2P8W9H0      ---GEILTVTYSSEDPEQVTDVLEVVMAGYLRYSLEDRQNDIFRGLDFLDEQ-LPEVRER
A0A6I5P386      ----DVLVVSYKSTDSEKVTYVLDLLLSTYLRYSLEDRQNDINRGISFVDEQ-LPVVRQQ
A0A318BG22      ---SSVIELRYTSNDARLSAAIANAAVDQFIESTTQRQYAASSYARSFVGNR-LTQQRAR
A0A2T1E9V8      ---TDILQVTYKSNNPEIASLVVNQLMNVYVNRNLLGNRAAAISAGNFITSQ-LPKVKAN
A0A1Z4LN32      ---TDILRVSYTSGKPELAIKVVDKVMEAYIKKNIYTNRSEAIAARSFIEKQ-LPSAKRG
A0A2I8A9F5      ---TDGLKVGYVSEDPYLAKAIVNQVMKSYIANNILTNRSEVMAAGDFIAKQ-LPGAKTE
A0A218Q6R8      ---TDGLQVSYVSEEPQLAKEVVNQVMKSYIANNILANRSEAIAAATFIQQQ-LPQAKKE
A0A218QGE0      ---TDVLKVSYTSDNPESAKAIVDQVMKSYIANNILSNRTQAISAGAFIEKE-LPRAKAQ
A0A3M2GQQ6      ---ADVLIVSYTDTDPARAKAILDVLGKTYVDYSLERQVSQASNAIEFIEEQ-LPKAQQE
A0A6H1U2X0      ---ADVLIVSYTDTDPARAKAILDVLGKTYVDYSLERQVSQASNAIGFIEEQ-LPKAQQE
K9TLQ0          ---TKILDIRYQDTDPQKIQIILKELATGYIHYSEMEQQTTLRQGLEFVETQ-LPRLQQR
K9QF04          ---TAIVEVSYQDTDPEKIEFVLDKLAEGYTAYYLEKLQTSSKQALKLVEAL-SPQQRQR
K9W1T3          ---TDILQVSYTDTDPAKAAKIINTVMSIYIKSDVNAQRSEAKAAREFVEKQ-LPIIEVT
K9SGJ5          ---ASVLWLIYRDPDPQRAKDVLDSLASAYSQYSLKDRRSRSSTAIQFIEDK-LPQVKKD
A0A6N2JS94      ---TMVLRLTYTDSNPKRAQGVLNALAQTYVEYSLKDRRTKSSTAIKFIQDK-LPQVKQQ
A0A6C2DSN4      ---ALILRLTYTDSDPKRAREVLGALSQTYVEYSLKDRRTKSSNAIKFIQDK-LPQVKQK
L8MYT6          ---ALILRLTYTDSDPKRAREVLGALSQTYVEYSLKDRRTKSSNAIKFIQDK-LPQVKQK
A0A352JGJ6      ---ALILRLNYIDSDPKRAREVLNALAQTYVEYSLKDRRTKSSTAIKFIQDK-LPQVKQQ
A0A1J5GLS2      ---ALILRLIYTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAIKFIQEK-LPQVKQQ
A0A2W4W6M5      ---ALILRLTYTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAIKFIQDK-LPQVKQQ
A0A2W7AN33      ---AMVLRLIYTDSNPKRAQEVLNALSQTYVEYSLNNRRTNSSTAIKFIQDK-LPQVKQQ
A0A256BLV2      ---TMVLRLTYTDSDPKRAREVLTALTQTYVEYSLKDRRTKSSTAIKFIQDK-LPQVKQQ
A0A2W6ZXF3      ---ALILRLIFTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAIKFIQEK-LPQVKQQ
A0A2Z5WX66      ---ALILRLTYTDSNPKRAREVLTALSETYVEYSLKDRRTKSSTAIKFIQGK-LPQVKQQ
K1XF69          ---TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-LPRVQQE
B5W297          ---TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-LPRVQKE
A0A6H2AL05      ---TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-LPRVQKE
H1W7M8          ---TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-LPRVQKE
A0A5Q4H6A5      ---TDIVLLTYQSKNPQEVADVINTIMEVYIDANVSGIRQEASGAKEFIQEQ-LPRVQQE
D5A466          ---TDIVLLTYQSKNPQEVADVINTIMEVYIEANVSGIRQEASGAKEFIQEQ-LPRVQQE
U5QJM6          ---TQVVSVAFKDTDRQLVQDMLKELAKIYIDYSQDVQKSQVSGAITFINAE-LPRVRMN
A0A1Z4RPC6      ---TDVIQIAYKDPDPVIASKVINTLMDVYIKEQVNSNKKATASADSFVTST-IPKIEDK
A0A2T1CMZ0      ---SDVISIEYKDPDPIIASKVVNTLMGVYIKEHVRSNKSATVSADSFISST-IPKIETK
L8M4F7          ---TDLIQILYKDPNPKFAADIVNSLMNVYVEAQIRGNQSDPAVAKKFINQQ-IPTLKAK
A0A140K2P2      ---SDVIEITYAHPNPKVAADVVNTLMNTYINEQIRTNQSEPASAREFINKQ-LPQIESQ
K9XWX4          ---SDVVEITYAHPNPKVAADVVNTLMNTYINEQIRANQSEPASAREFINKQ-LPQIESQ
A0A140KB14      ---TDVISVRYQDQDPYTAADVINTLMKLYLDEQVKSTQAETANADSFISNQ-LPQIEQK
K9XX88          ---TDVISLRYQDQDPYTAADVINTLMKLYLDEQVKSTQAETANADGFISNQ-LPQIEQK
A0A563VSV6      ---SDVIEIIYKDSDPIQASQVVNTLMDVYIKNQVRSNQAETENADSFVTTQ-IPQVEDK
L8LZE9          ---SDVIEITYEDKDPQIASNVVNTLMNIFLENKIANNQKDTESADFFVESQ-LPQVEKR
A0A433NM31      ---TDTLLISYKSTVPEQAQAVVNKLMDSYLRNNMMATRTEAIAARNFIESQ-LPKSKIS
A0A1Z4NDS1      ---TDIIQVSYQDNDPELAAKVVNKLMEVYVQNNIRENRAEASAAGTFLDDQ-RPNAARI
U9VXM0          ---TDVLKVTYTSDDPELAANVVNTLTDIYIENDIQTNRAAAVAAQEFISAQ-LPESEAA
A0A6M0RI13      ---TDVLKVTYTSEDPEIAATVVNTLADIYIENDIQTNRAAALAAQEFITAQ-LPESEEA
A0A6M0S1N5      ---TDVLKVTYTSEDPEIAATVVNTLADIYIENDIQTNRAAALAAQEFITAQ-LPESEEA
K9F4D9          ---TDVLKVTYTSEEPEIAATVVNTLADIYIENDIQTNRAAALAAQEFITAQ-LPESEEA
A0A6I5QPI5      ---TDVLRISVESEDPEEAAAIVNQVIESYREQNIESNREEAAAARQFIEEQ-LPTTEAE
A0A1Z3HMQ0      ---TDVLRVAYQSPNGELSAAVVNQVMTSYIERNITMNRSEATAARQFVQEQ-LPKAEAE
A0A433W533      ---TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-IPDVEAR
A0A2P8QWJ3      ---TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-IPDVEAR
A0A2T1FKP8      ---TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-IPDVEAR
K9U6L7          ---TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-IPDVEAR
A0A1E5QP61      ---TDVLMIAFKSQYPKEAADAVNKLMDVYINNNILVNRREATAAREFIMQQ-LPDTEET
U5DPF5          ---THILELTYQSTDPEEAARVVDSFMEVYRDNDVRINRSEAAAAREFIEEQ-LPLTERS
A0A6P0X488      ---TDVLKVSFNGPDPKDAAEVVNQLMQVYLQNNVLTNREEAVAAREFIAKQ-LPATEKT
A0A6P0UVD5      ---TDVLKVSFNGPNPEDAAEVVNQLMQVYLQNNVLTNREEAVAAREFIAKQ-LPATEKT
A0A6P0VDM0      ---TDVLKVSFNGPNPEDAAEVVNQLMQVYLQNNVLTNREEAVAAREFIAKQ-LPATEKT
A0A6M0G142      ---TDVLKLSFSGPNPEDTAKVVNQLMNVYLQNNVLTNRAEAVAAREFIAQQ-LPQTQEN
A0A6P0MR53      ---TDVLELSFESPNSEDAAAVVNQLMKVYLQNNVLTNRAEAVAAREFIAQQ-LPKTQET
A0A3M2GIL5      ---TDVLLITYQAGNPEEAATVVNKVMEVYIENNILVNRSEAAAAREFINKE-LPEIEAR
A0A6H1TSJ9      ---TDVLLITYQAGNPEEAATVVNKVMEVYIENNILVNRSEAAAAREFINKE-LPEIEAR
A0A3M1PML8      ---TDLLRVTYASEDPEETAAVINRLVDIYTKNNVLVNRAEAAAARDFIAKE-LPKTEAA
A0A6M8BE85      ---TDLLRVTYASDDPEEAAAVLNRLVEVYTKNNVLVNRAEAAAAREFIAKE-LPKTEAA
A0A0T7BPZ0      ---SEVMQISFTHENAQLAANVVNQVMDNYITENIRANRAEAESARKFIISQ-LPISESS
A0A352X442      ---TDVMTLTYQSKKPDVAAAVVNKVMEVYIADDIQANRAKAAAAREFITEQ-LPRLKQN
A0A6B3NF44      ---TDVMGISYVSEDPEEAAKVANNIMEVYIKNDIQTNRQKAVAAREFIDQQ-LPQVEAN
A0A6M0EPL4      ---TDVMGISYVSEDPEEAAKVANNIMEVYIKNDIQTNRQKAVAAREFIDQQ-LPQVEAN
A0A6P0K6L6      ---TDVMGISYVSEDPEEAAKVANNIMEVYIKNDIQTNRQKAVAAREFIDQQ-LPQVEAN
A0A6P0MRR9      ---TDVLNVTYESDNPELVAAVVNKTMEGYIENNIETNRAQAVAARKFLEGQ-VPRMKAR
A0A6P0UX57      ---TDVLDVTYKSDDPEVAVAVVNTTMDGYIENNIETNRAQAVAARKFLEKQ-VPKIEQR
A0A6P0X1X4      ---TDVLDVTYKSDDPELAAAIVNTTMDGYIENNIETNRAQAVAAREFLEKQ-VPKIEQR
A0A0M0SHU3      ---TDVLEISYTNENPQLAAKVINKVVDTYIKQNIQANREEATSAGRFILQQ-LPKTEEA
A0A1D2PBN3      ---TEVLEVSYTDTNPTLAAKVVNKLMQAYIKNNIEANREEAVSARKFIQRQ-LPATETS
A0A0C2LVR7      ---TEVLEVSYTDTNPTLAAKVVNKLMQAYIKNNIRANREEAVSARKFIQKQ-LPATEIS
A0A1Z4PQB9      ---TEVLEVSYTDTNPTLAAKVVNKLMQAYIKNNIGANREEAVSVRKFIQKQ-LPATERS
A0A1Z4SFN6      ---TEVLDIYYKDEDPYLAAKVVNQMMEVYIKNNIEANRAEAVSARKFIMKE-LPATELS
K9PGI8          ---TDILQISYTDKDPTLAAKVVNKVMDAYIRNNIEANRAEAVSARKFISQQ-LPATEIS
Q7NEU3          ---TQVAVVSFEDTDPQVVKAILDELSRTYIDYSLEIQKSKLDGAIAFIENE-LPPVRKE
A0A3C0N2P0      ---TKILEVRYQDSNPEKIQFVLERVAQGYVNYSAKEQQDSVTQGLGFVNEQ-TKNLQKR
A0A6P0JR04      ---TKILEVSYQDSDPEKIKYILDQVAAGFVDYSQREQKTGRQKGLTFVEDQ-LPELQNR
A0A6B3M6M6      ---TKILEARYQDSDPEKIKFVLEQVVKGYIKYSEQEQQTTTRQGIQFVESQ-LPKLQER
A0A6P0KD09      ---TKILETRYQDSDPEKIKFVLEQIVKGYIKYSEQEQQTTTRQGIQFVESQ-LPKLKER
A0A6B3NIJ0      ---TKILETRYQDSDPEKIKFVLEQIVKGYIKYSEQEQQTTTRQGIQFVESQ-LPKLKER
A0A6M0F053      ---TKILETRYQDSDPEKIKFVLEQIVKGYIKYSEQEQQTTTRQGIQFVESQ-LPKLKER
A0A6P2ATU9      ---TKIMEVSYQDSDPHKIQFVLDKLAAGLIAYSQMEQQTGRQKGLGFVEEQ-LPILEER
A0A352XE00      ---TKILEIRYQDSDPEKIKFILDQVANGYINYSRQEQQTTTQQGIQFVKDQ-LPKLQER
A0A6P0QC14      ---TKILEVRYQDSDPEKIQFILKELADGYVEYSKIEQRNSVEKGLEFVNGQ-TKELQKR
B4VS56          ---TKILEVRYQDSDPEKIQFILEQIATGYVNYSLSEQQTSTRQGIQFVEEQ-LPKLQGR
A0A352AAQ3      ---TKILEVRYQDSDPEKIRFILEQVADGYVKYSETEQRTAVTQGLAFVNKQ-AKELQGI
A0A350Y472      ---TKILEVRYQDSDPNKIQFILEQVANGYVQYSEAEQRTAVTQGLAFVNKQ-TQKLQEL
A0A355DVB4      ---TKILEVRYQDSDPDKIQFILEQVANGYVKYSEAEQRTAVTQGLAFVNKQ-TQKLQEL
A0A1Z4RMB9      ---TDVVDVKYRHPNPKTASEVVNALMDVYVKEQIRGNQSQPAAAKDFITKE-LPSIESK
A0A318B4H2      ---SALVDITFKSPSAELSSKVANSWAAEYIQSNLDRRFATTADARGFLEQR-LAQLRSR
B4WQE3          ---GKTLTVQYRSDDPYKVTTVLEVVLQTYLNYSLEDRQNDIYRGVDFVNDQ-LPAVRAR
A0A2K3BR24      ---TEILEIAYEHPEPEKAATIVNELMNVYRENNVLNNRSEATAAREFIEEQ-LPKTEQS
K9YXY1          ---TEILEIAYEHPDPEKAATIVNELMNVYRENNVLNNRSEATAAREFIEEQ-LPKTEQS
A0A0V7ZFJ4      ---TDILNLSYESNDPQKAAAIVNSLMKDYQENNISTNTAEARSAREFLNKQ-LPEVEQR
A0A0V7ZNJ9      ---TDVLEISYKGTDPQQAAAIVNSLMQDYIDNNIRVNTAEARAAREFLNNQ-LPEVESR
A0A367RIS1      ---TDILQLSYRSANPQQATAIINKLMSAYLENNVRINRSQARAAREFLNKQ-LPLVEAK
A0A235IXQ2      ---TDILQLSYRSTNPQEATAIINRLMSAYLANNVRINRSEARAAREFLNKQ-LPLVEAK
A0A1W5CNX3      ---TDILQLTYRSANPEEATAIINRLMNTYLENNVRNNRSEATAAREFLSKQ-LPLVEAK
A0A5Q0GJJ5      ---TDILQLTYRSANPEEATAIINRLMNTYLENNVRNNRSEATAAREFLSKQ-LPLVEAK
Q3MEB7          ---TDILQLTYRSANPEEATAIINRLMNTYLENNVRNNRSEATAAREFLSKQ-LPLVEAK
A0A1Z4KHN9      ---TDILQLSYRSADPKEATAIVNKLMSAYLENNVRNNRSEATAAREFLSKQ-LPLVEAK
Q8YT70          ---TDILQLSYRSADPKEATAIVNKLMSAYLENNVRNNRSEATAAREFLSKQ-LPLVEAK
A0A166IWU6      ---TDVLQLSYRSVDPELAKAIVNKLMNVYIDDNVMTNRSQATAAREFLNKQ-LPLVEKQ
A0A2S0Q8C0      ---TDLLQLSYRSVDPEVGKAVVNKLMNVYIDDNVMTNRSQATAAREFLNKQ-LPLVEKQ
W6FSX4          ---TDLLQLSYRSVDPEVGKAVVNKLMNVYIDDNVMTNRSQATAAREFLNKQ-LPLVEKQ
A0A218Q4C1      ---TDVLQLSYNSIDPQEAQSTVNQLMAAYLNNNVLNNRSQAAAAREFLTEQ-LPLVEAK
A0A6P1ZT04      ---TDVLQLSYLNTDPQEAQATVNQLMAAYLEDNVLTNRSQAAAAREFLSKQ-LPQVEAQ
A0A0R0M9H9      ---TDVMELSYNSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQ
A0A1S1ZVW2      ---TDVMELSYNSTNPQEAADTVNTLMKYYLDNNILINRSQATAARKFLSQE-LPRIEKQ
A0A1B7WX82      ---TDVLQVSYSSTNPQEAANVVNSLMKYYLESNILNNRTEARSAREFLAKQ-LPEVERQ
A0A1B7WTD1      ---TDVMELSYKSTDKQEAANVVNSLMKHYLASNINTNRAEAIAAREFLSQE-LPKVERR
A0A480ABC0      ---TDVMELSYKSTDKREAANVVNSLMKHYLASNVSTNRAEAIAAREFLSKE-LPKVERR
A0A1Z4LRU5      ---TDVLQLSYKSTDPKEAANVVNSLMGDYMENNVETNTAEVRAAREFLQKE-LPQVEGR
A0A1Z4JVB4      ---TDVMQISYRSKNPQESADVVNFLMKSYIESNISNNRTEARSLREFLSKQ-LPEVENR
K9PIA4          ---TDVMQLSYRSPNPKEAADVINTLMKYYLESNVRTNRSTAKSAREFLNKE-LPQVEKR
A0A1Z4HVE1      ---TDVMQLSYRSTNPQEAASVINSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKR
A0A252ECZ1      ---TDVMQLSYRSTNPQEAASVINSLMNYYLESNVRTNSAEARSAREFLNRQ-LPEVEKR
A0A1Z4G5Y1      ---TDVMQLSYNSTNPEEAATVLNSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKR
A0A252DNA2      ---TDVMQLSYRSTNPQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKR
A0A252E1Q4      ---TDVMQLSYRSTNPQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKR
A0A6G9SK36      ---TDVMQLSYRSTNPQEAATVINSLMKYYLESNVRTNRAEARSAREFLTKQ-LPEVEQR
A0A1Z4M597      ---TDVMQLSYRSTNPQEAASVINSLMNYYLENNVRTNRAEARSAREFLNRQ-LPEVEKR
A0A1Z4MWT1      ---TDVMQLSYRSTNPQEAASVINSLMSYYLENNVRTNRAEARSAREFLNRQ-LPEVEKR
A0A1Z4TX53      ---TDVMQLSYRSTNPQEAASVINSLMSYYLENNVRTNRAEARSAREFLNRQ-LPEVEKR
A0A5P8VSD1      ---TNILQLSYRSANPQEATAILNRLMSAYLENNIRINRSEATATREFLNKQ-LPLVQAK
A0A2A2TNQ5      ---TDVMELTYRGTNPLETAKVINTLMNNYLENNIRSNRTEVTAARDFLRKQ-LPEIENK
A0A3S1C4K5      ---TDVLEMTYRDTDPKVAADVINTLVKYYIENNIRVNRLDATSAREFLSKQ-LPNIEGR
A0A1X4G3D5      ---TNVMEFTYDSKIPDEAAKIVNGLMNEYLLSNIVINNSASSKARQVLAKK-LPRVERE
D4TNI2          ---TNVMEFTYDSKIPDEAAKVVNGLMNEYLLSNIVINNSASAKARQVLAKK-LPRVERE
A0A1Z4H6Z8      ---TDVMQLSYRSTNAQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKR
A0A1Z4NPM1      ---TDVMELSYRSTDPQEAANVINFLMKSYLEGNILNNRAEATAAKEFLSKQ-VPQLERR
A0A3F3KPR9      ---TDVMELSYNSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQ
D4TGN7          ---TDVMELSYSSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQ
A0A1Z4UZW9      ---TDVMQLSYRSTNPQEAAKVVNSIMKYYLESNVRTNRTEARSAREFLSKQ-LPEVEKR
A0A0K2M5H0      ---TDVMQLSYRSTNPQEAADVVNSLMKYYLESNVRTNRTEARSAREFLSKE-LPEVEHR
A0A1B7VSH4      ---TDVMQLSYKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAREFLSKQ-LPEVESR
A0A1B7W126      ---TDVMQLSYKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAREFLSKQ-LPEVESR
A0A3D4C6Q6      ---TDVMQLSYKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAREFLSKQ-LPEVESR
A0A1B7UVJ4      ---TDVLQVSYSSTNPQEAANVVNSLMKYYLESNILNNRTEARSARQFLAKQ-LPEVERQ
A0A1B7UTR1      ---TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-LPEVEKR
K7W0A4          ---TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-LPEVEKR
A0A5C0DRW9      ---TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-LPEVEKR
A0A6H2C088      ---TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-LPEVEKR
A0A1Q4RTR1      ---TDILQISYRSPDKKMAAAVVDSVIKNYLENDIRANRTEVVSAREFISKQ-LPEVEAK
A0A1Z4SQV2      ---TDVLEVSYRSPDAKQAANIVNTLIKNYLENDIRTNRTEAVAAREFISKQ-LPEVETK
A0A2H2XGN1      ---TDVLEVSYRSPDAKQAANIVNTLIKNYLENDIRTNRTEAVAAREFISKQ-LPEVETK
A0A433UXH8      ---TEVLQISYRSSNPKLAANVVNTLIKNYLENDIRTNRTEVVAAREFISKE-LPEVETK
A0A1U7HGH0      ---TEILQVVYRGEEPEQAALIVNQLMNVYVSKNLLNNRAAAISAGNFITAQ-LPKVKAN
K9XJD3          ---TEILQVVYRGEDPAQAALVVNQLMNIYVNKNLLNNRAAAISAGNFITAQ-LPKVKAN
K9SX01          ---TDVIQVSYLSSSPQDAAKIVNGLMKSYIDNDLLTNREDTASARKFIDEQ-LPKLQIS
A0A4P7ZT55      ---DGVLKVSLQWRNPQQGEQLLKALSQSYLAYSLRQRQEKLSQGLKFLDEQ-APGLQER
A0A1E5QIR9      ---TDVLQISFKSNDPQEAVDVVNRLMQFYQENDIQTNRAQAAAVRRFIEEQ-LPKSEFT
A0A1Z4IBC7      ---TDVVQISYKSNNAEQAAKVVNTVIKSYIDLNIQANQDEAVTAKQVILRE-IPKAEES
A0A1W5CPC7      ---TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETS
A0A5Q0GKD1      ---TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETS
Q3MDC6          ---TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETS
A0A1Z4KM73      ---TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETS
Q8YNX7          ---TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETS
A0A367R4K6      ---TDVVQLSYQSNNPELAAKIINQVIDNYIDLNIKANQNEAFAAKQVLVAE-LPKAEEI
A0A1E2WSV8      ---TDVVQLSYKGGDPELAAKIVNEVIDSYIDLNIKANQNEALTAKQVLVTE-VPKAEEI
A0A2R5FRT9      ---TDVVQISYKGGNPELAAKIVNEVIDSYIELNIKANQNEALIAKEVLVTE-VPKAEEI
A0A2K8T1B6      ---TDVVQLSYKGSDPELAAKIVNEVIDSYIDLNIKANQNEALTAKEVLVTE-VPKAEEI
A0A235I9I0      ---TDVVQLSYKGGDPKLAAKIVNEVIDSYIDLNIKANQNEARTAKQVLVTE-VPKAEEV
A0A2D0HQT8      ---TDVVQLSYKGGDPKLAAKIVNEVIDSYIDLNIKANQNEARTAKQVLVTE-VPKAEEV
A0A2L2NU95      ---TDVVQLSYKGGDPELAAKIINEVIDSYIDLNIKANQNEARTAKQVLVTE-VPKAEEV
A0A367S084      ---TDVVQLSYKGGDPELAAKIVNEVIDSYIDLNIKANQNEARTAKQVLVTE-VPKAEEV
A0A6P1A9A0      ---TQILEVRYQDSNPEKVKIVLDRVAAGYINYSLNEQQSGLQQGLEFTEDQ-LPQLQER
A0A1Z4SMD6      ---TDVLKISYSSKDPEVASSVVNQVMKTYVEKNIESNRSQVFAAGSFIKKQ-LPDSKAE
A0A2H2Y096      ---TDVLKISYSSKDPEVASSVVNQVMKTYVEKNIESNRSQVFAAGSFIKKQ-LPDSKAE
K9S8M8          ---TDVLLITYTSDDPQEAANVVNVLMEIYIKENIRANRAEATAARKFITEL-LPKTEAS
A0A1Z4NFV0      ---TDVLKVSHISDNPNLAAAVVNQVMESYVESNIQSNRAEAQSAGKFIEQQ-LPRARAE
A0A3M9ZEU1      ---TDVLHLAYTDSDPERAAKVVNQVINVYIENNVAANRAEAAAAREFISRE-IPRVEAA
A0A1Z4JK72      ---TDILNLKYSDNDAEMAANVVNQIMKAYIDNNLKTNQEEANKAGRFIESQ-LPRAEAE
A0A0N7Z489      ---TDILDVKYADDDPEMAANVVNQVLKAYIDNNLKTNQEEANKAGRFIDNQ-IPPAEEA
A0A0S3TXS2      ---TDILELKYADDDPEMAANVINQIVKAYIDSNLKTNQEEANKAGRFIDSQ-IPPAEEA
A0A2A2TPF8      ---TDVLDVVYISENGKEAAAIVNQLMRSYVENNIRNNRSEALAARKFIEAQ-LPRAKGE
A0A1Z4R0P8      ---TDVLNVSFISDKPKEAAAIVNQLMRSYVDNNIKNNRSEALAARKFIEAQ-LPRAKGE
A0A0T7BUI3      ---TDVLKVSHASDNPKLAAKIVNQVMATYAENNVESNRTQVTAAGEFIKKQ-LPSSRKE
A0A1Z4LP32      ---TDVINVSYTSEKPRLAAAIVNQVMRTYVKNNIESNRAQVVAAGQFLKQQ-VPLSRLE
K9REP9          ---TDVINVSYTSDKPRLAASIVNQVMESYVDNNIESNRAQVVAAGEFLKKQ-VPLSKIE
A0A1Z4SIJ3      ---TDVLKVSYVSINPELAKKVVNQVMQTYVDKNIESNRTQVYAAGEFIKKQ-LPFSRAE
A0A2H2XPG4      ---TDVLKVSYVSINPELAKKVVNQVMQTYVDKNIESNRTQVYAAGEFIKKQ-LPFSRAE
K9V3C7          ---TDILNVSFTWDNPEIASAVVNKLMDVYVANNLANSRSEAVSAGKFIELQ-IPQAKIE
A0A1Z4T6Y7      ---ADVLNVSHISSDSRLAADVINYVMRSYVENNIQTNRLEAVSARKFIENQ-LPRAEQE
A0A2H2Y561      ---ADVLNVSHISSDSRLAADVINYVMRSYVENNIQTNRLEAVSARKFIENQ-LPRAEQE
A0A1Q4S362      ---TDVLNVAHISGESKKAADVVNQIMRSYVNSNIQNNRQETIAARKFIEGQ-LPRAEGQ
A0A3S1CIN8      ---TDVLKVAHISGESKKAADVVNQIMRSYVNSNIQNNRQETIAARKFIEGQ-LPRAEGE
A0A2A2TC28      ---TDVIKVSYQSNNPEMTAEVVNQVMNTYIKNNIQSNRTQVFAAGDFIRKR-LPSSRAE
A0A0C1NCB0      ---TDVLKVSYTAKAPNLAANVVNLVMQAYVNNNIQSNQEQVLAAGEFIKKQ-LPYARAD
A0A2N6K7Q9      ---TDVLRVSYASNDPELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQE
A0A2N6MXH6      ---TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQE
A0A2N6M5A8      ---TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQE
A0A2N6LL61      ---TDVLRVSYASNDPKLAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQE
A0A0S3TP66      ---TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQE
G6FP91          ---TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQE
A0A1U7GYR5      ---TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQE
A0A2N6KY52      ---TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQE
A0A2N6KMP5      ---TDVLRVSYTSNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQE
A0A2N6MA45      ---TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQE
A0A4Q9J9V9      ---TDVLKVSYASNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPNSRRE
A0A328IGA1      ---TDVLKVSYASNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPNSRRE
A0A4D9CE41      ---TDVLKVSYTSNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAGDFIKEQ-LPNSRRE
A0A0M0SFT2      ---TDVLKVSYTSNDPELAAAIVNQLMKSYVQNNIQNNRAQVSAAGEFIKEQ-LPNSRRE
A0A1Z4TLC8      ---TDVLKVSYASNDPELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPNSRRE
A0A0C2LFH0      ---TDVLKVSYTSENPELTASVVNQVMKSYVAKNIQYNRTQVVAAGEFIKKQ-LPQARVE
A0A1Z4IYV4      ---TDVLQVSYTSENPELAASVVNQLMKSYVANNIQSNRSQVFAAGEFIKKQ-LPYARAE
A0A1Z4Q0T6      ---TDVLKVSYISENPELAASVVNQLMKSYVANNIQSNRVQVFAAGEFIKKQ-LPYARAE
A0A0C2PT44      ---TDVLKVSYTSENPELAASVVNQLMKSYVANNIQSNRAQVFAAGEYIKKQ-LRYARAE
A0A1D2P6J4      ---TDVLKVSYTSENAELAASVVNQLMKSYVANNIQSNRAQVFAAGEFIKKQ-LPYARAE
B4WP72          ---TDILEISYQSPDDQTAPVIVNALMEAYIENNVETNREEAIAARRFIAGQ-LPQTESA
A0A2T1CIL7      ---TDVLQVFYQDSDPKRAASIVNEVIDLYVQEDTLSNRAAPASAREFIKAQ-LPKVELT
A0A433V7A0      ---ADVMQISYTSKDPQESASVVNQLMSIYIKNNISANRLQAVAARKFISSQ-LPTSEAD
A0A2T1FTR8      ---TDLLEVTFQDPSRELSRDVVEKIMEIYIRDDRTNQRREAEAARKFVAQE-LPKIENE
K9UA41          ---TDLLEVTFQDPSRELARDVVEKIMEIYIRDDRTNQRREAEAARKFVAQE-LPKIETE
A0A0C2LBE2      ---TEILQVSYIDKDPKLAAKVVNKVMQAYIKNNIEANRQEAVSARKFIQKQ-LPTTEVS
A0A433NN38      ---TDLLEIYYADSDPIMAAKVVNKLVEIYIKQNIQTNRAEAVSARKFMWEQ-VPKTEQA
A0A2N6K0T2      ---TDVLEVSYTHEDPQLAAKVINKVVDTYIKQNIQVNREEAISAGKFMLQQ-LPKTEEA
A0A2N6ML72      ---TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEA
G6FQZ6          ---TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEA
A0A2N6MQX9      ---TDVLEVSYTHEDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEA
A0A2N6KXT6      ---TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEA
A0A2N6KGB9      ---TDVLEVSYTHEDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEA
A0A2N6L3Y5      ---TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEA
A0A0S3TIS7      ---TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEA
A0A1U7GW28      ---TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEA
A0A2N6LW63      ---TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEA
A0A328IH74      ---TDVLEISYTDENPELAAKVINKIVDTYIQQNIQANREEATSAGRFILQQ-LPKTEEA
A0A4D9CIB0      ---TDVLEISYTDENPELAAKVINKIVDTYIQQNIQANREEATSAGRFILQQ-LPKTEEA
A0A1Z4TQ63      ---TDVLEISYTDENPQLAAKIINRVVDTYIKQNIQANREEATSAGRFILQQ-LPKTEEA
A0A4Q9J8G2      ---TDVLEISYTDENPQLAAKVINKVVDAYIKQNIQANREEATSAGKFILQQ-LPKTEEA
A0A350Y0P6      ---TDVMEVSFTSDNPKKAAAVVNQLMNVYVENNILTNRAEAVAAGEFIAKQ-LPQIQNR
A0A352X940      ---TDVMTVSVKSQKPKEAAAIVNKLMEVYLENNIQTNRSEAVAARKFIERQ-LPKTEST
B8HTN4          ---TDLLQVSYRSTDPKQAVAIVDLLIKIYKRNNILANRLETTNSREFIERK-LPDVTEQ
A0A6P1AFJ5      ---TKILEISYQNSDPEKIKFVLEQVAEGYIAYSWQKQQGSLQQGLEFVNVQ-LPKLQEE
B0CAX4          ---TDVLKVTYKSIDPKESADVVNRLMDDYLKNNIETNRAEAASARVFIEKQ-VPEVAAK
A0A1Z4RN12      ---TDLLKITFTDQDPEVALAFVNRAIELYSEDYASYNRSETASARDFIAKQ-LPKAEEN
A0A2T1CMF9      ---TDLLQISYENSDPDVAVSFVNRAVELYSDGYALFNSEAALKDGDFIKQQ-LPKLETE
Q7NDC5          ---TDLLVIKYRDRDPAVATRVVNTLARHYIDLNMQQNRAEAASTRGFVEAQ-LPAMEQR
U5QGK3          ---TDLLVIRYREFNPELAAKVVNTLAQAYIVENVQQNRAEASSTRTFVESQ-LPKMEQR
A0A2W4UY24      ---TDVLAVSYESTSPALAQAVVNAMMAAFIQANVQANRTAAIAAQSFVASQ-LPASKAK
A0A0D8ZUV2      ---TDVLEVTYKSNDPQEAAAVVNKLMSLYIENNVLSNRTAAVEASKFIANQ-LPKTEAR
A0A433VDI0      ---TDILQLAYKSTNPEEATAVVNKLMNLYIENNILTNRDQAVEAVEFIAKQ-LPRTETT
A0A3D1PG43      ---TDVVQVAYESKNPEEAAAVVNKLMSLYVQNNIQSNRAQTTAVGEFIAKQ-LPTVQGT
A0A2P8QQ72      ---TDVLQVAYESKDPQEAAAVVNKLMSAYVDYNIQSNRAEASAAEDFIVKQ-LPQTEST
K9TZQ7          ---TDVLQVAYESKDPQEAAAVVNKLMSAYVDYNIQSNRAEASAAEDFIVKQ-LPQTEST
A0A6N8G584      ---TDVLQISYQSEDPEEAAAIVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMEAT
A0A2G7GPR0      ---TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMEAT
K9XH68          ---TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMETT
A0A1U7HW70      ---TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMETT
A0A2S6VEJ8      ---TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMEAT
A0A140KBA0      ---GNVIKISYEDSDAERAALVVNKIIELYQEKDTENNRSEAIAARQFISEE-LPEVEAK
K9XSG1          ---SNVIKIAYEDSDPERAALVVNKIIELYQEKDTENNRSEAIAAREFISQE-LPEVEAK
A0A2T1GMT4      ---ADILQVSFKGRNPKDAANIVNTLMNVYLENDIQASQLEAETARQFIEQQ-MPKTLAA
K9UI51          ---SDILQIGFKGRNSKDAANIVNTLMNVYLENDIQASRLEAENARQFIEQQ-MPKTLAA
K9QM62          ---TDVLQITYKSRNPEEAAAVVNSVMNVYLENDILTNRTEVEATRRFMARQ-LPQTQAA
A0A1Z4FWI3      ---TDVLLVSYKSPDPETAAAVVNTVMNIYLENDSNTNRAEAEATRRFMAKQ-LPNTRAA
A0A1Z4JYE7      ---TDVLEITYQSNDPKQAAAVVNALMNVYVDNDISTNREEAEATRKFMERQ-LPQTQAA
A0A2T1FXY4      ---TDVLRITYKHHDPEKAAAVVNKIMELYLENDILTSRSEAEATRLFMAKQ-LPKTQAD
K9TYI2          ---TDVLQITYKHHDPEKAAAVVNKIMELYLENDILTSRSEAEATRLFMAKQ-LPKSQAA
A0A1Z4QL41      ---TDVLKITYKSNKPEEAAEVVNTIMNFYIENDISTNRAEAEETRQFLDKQ-LPKTQTA
A0A252D4T4      ---TDVLLVSYNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATRKFMAKQ-LPNTKNA
A0A252DJH5      ---TDVLLVSYNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATRKFMAKQ-LPNTKNA
A0A252EB80      ---TDVLLVSYNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATRKFMAKQ-LPNTKNA
A0A6G9SKZ9      ---TDVLQVSYKSRSPEEAAAVVNNIMNLYLENDILTNRAEAESTRKFMARQ-LPNNRSA
A0A1Z4HPW5      ---ADVLQISYKSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSA
A0A1Z4MSN1      ---TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSA
A0A1Z4U1C2      ---TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSA
A0A0D6KV51      ---TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSA
A0A1Z4MKF8      ---TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSA
A0A2C6WC43      ---TDVLRVTYASLNAEEAAAVVNTVMNVYLENDILTNRSEAASTRQFIARQ-LPKTQEA
A0A1Z4L5A1      ---TDVLRITYSSLDPEEAASVVNTVMNVYVESDILTSRSEAASTRQFIARQ-LPKTQEA
A0A367QD86      ---TDVLRITYSSLNPEEAAAVVNTVMNVYVENDILTNRSEAASTRQFIARQ-LPKTQEA
A0A235IZ96      ---TDVLKITYSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATRQFMAKQ-LPKTQAA
A0A2L2NGP0      ---TDVLRITYSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATRQFMAKQ-LPKTQAA
A0A2K8SM78      ---TDVLRISYTSRDPEQSAAVVNTIMSLYLENDILTNRSEAAATRQFMAKQ-LPKTQEA
A0A2R5FPC0      ---TDVLRISYASRDPEQAAAVVNTIMNLYLENDILTNRSEAAATRQFMAKQ-LPKTQEA
A0A5P8W5T6      ---TDVLRISYTSRDPKQSADVVNTIMNLYLENDILTNRSEAAATRQFIAKQ-LPKTQQA
A0A0F5YE28      ---TDIVSLSYESPDPLEAANIVNTLMEVYIQTNVNMNQDEAREAREFISQQ-LPPVQQE
U7QEH7          ---TDIVSLSYESKDPKEAADIINTLMEVYMQTNVDMNQEDAIEAREFISQQ-LPKVQEE
A0A3S1ATK5      ---TDVLKLTYKSRDPKEAAVVVNTVMNFYLENDIETNRAEAETTYKFMARQ-LPKTQAA
A0A2Z6CPH0      ---TDVLRVSYQSNNPEEAAAVVNTLMNLYLENDILTSRAEAEATRKFMAKQ-LPISQAS
A0A1Z4GT50      ---TDVLQLNYKSRNPEEAAAVVNTIMKMYVENDITTSRAEAEDTREFMSKQ-LPKMQAA
A0A1Z4GIX0      ---TDVLRIAYKSTNPEEASAVVNTIIDAYLENDILTSRSEAEATRKFMAKQ-LPNTQAA
A0A2H6LC24      ---TDVLRIAYKSTNPEEAAAVVNTIIDAYLENDILTSRSEAEATRKFMAKQ-LPNTQAA
B2J6N5          ---TDVLRISYTSPDPEQSAAVVNTIMSLYLDNDILTNRSEAAATRQFIAKQ-LPKTQEV
A0A367RMI4      ---TDVLRISYKSHNPEEAAAVVNTIMRFYLENDILTNRSEAGAARQFMAKQ-LPTTQAA
A0A235HUM0      ---TDVLRISYSSHDPEEAAAVVNTVMRFYLENDVLTNRSEAGATRQFMAKQ-LPTTQAA
A0A2L2NW47      ---TDVLRIAYRSHDPEEAAAVVNTIMRFYLENDILTNRSEAGATRQFMAKQ-LPTTQAA
A0A1E2WUR1      ---TDVLLISYSSSDPEEAAAVVNTIMNFYLENDILTNRSEAAAARQFMAKQ-LPKTQAA
A0A235IKU3      ---TDVLKITYSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATRQFMAKQ-LPKTQAA
A0A1U7MYU6      ---TDVVRLSYKGNNSDKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEAN
A0A1D8TNX9      ---TDVVRLSYKGNNSDKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEAN
A0A6P0L6C2      ---TDVVRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEAN
A0A6P0MVH0      ---TDVVRLSYKGKNSEKGATVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEAN
A0A6P0KJV0      ---TDVVRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEAN
A0A6L9ZJG4      ---TDVVRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEAN
F4XKF3          ---TDVVRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEAN
A0A1D9FX10      ---TDVVRLSYKGKNSEKGAAVINKLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEAN
A0A6P0Q0T0      ---TDVVRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEAN
A0A6P0W5I0      ---TDVVRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEAN
A0A3C0NJ41      ---TDVVELSYKGANPQQIAAVVNKLMSLYIEDNLRTNRAELVAAQDFIAKQ-LPKAETN
A0A352AG88      ---TDVLELAYESSNPQEAAAVVNYLMNLYIKNNVKANRAEVVAAVKFLNEQ-LPKAEAN
A0A350Y374      ---TDVIEIIYKNKDAKTAAAVVNQLMKLYIENNLRNNRTELVTAQEFITKQ-LPKAEAN
A0A355DPX0      ---TDVIEITYKNKDAKTAAAVVNELMKLYIENNLRNNRTELVTAQEFITKQ-LPKAEAN
                                                                            

K9SLA9          LESAEIKLRQFKENYRLVDLEI----------EKVTTVKAIKEIEAQMLGLQAELAEVGA
A0A168TT23      LERADQNLIDFAQANGVADLEE----------RVDMSQSSVRTLNDRLSAARGDLVQLRA
A0A0M1JWX9      VDTLQGQLQKFRQDYNLIDPKI----------QGEQLAGQITKIDDQLLEAQTALIQQQQ
A0A2T1M1V6      LILAQNKLTQFQQSTGLFESET----------QTQELMQSINKLRATQTEISSEAESHAT
A0A2G7GCS2      LAKAQAELANFQQSTGLTEVTE----------QTRSLINQQRELRTTYTNVLSQAQANQA
K9XBH8          LEQAQAALASFQEATGISEAVE----------QTRSLIAQLRDLKTNYTTILAQAQGSQA
A0A1Z4LJ30      LFKTQKNLSEFKQKTNLVSSEE----------QTKEIVSTINALETEQAQTIAQAQEFQS
K9RI76          LLKAQKALSEFKQKTNLVSSEE----------QTQQIVSAINTLNTQQAQAIAEAESAAA
A0A352AE27      LNQAQMELAQFQKSSGLVNSEE----------QTRGLVQSISELTTAQAQAQAQALASIN
A0A3B8JH60      LAQAQMALAQFKQSSGLVNSEA----------QTEGIVTTINNLSTAQAQAQALAQAGQN
A0A3C0N766      LAQAQMALAQFKQSSGLVNSEA----------QTEGIVTTINNLSTAQAQAQALAQAGQN
K9W9J7          LDQAQRAVAQWKQSTGLVNSEA----------QTQGIVTTINNLTSVQAQALAQAQASEN
A0A139WSU3      LAQAQSKLTIFKQSSGLINNED----------QAKGIVDSISTLTTVRAQVLATAEASEN
A0A433VN22      LSNAQTKIARFKQATGIVNNDA----------QTQGIVTTINALVGSRAQALSLAQASAS
Q7NF11          LTRAEAALARFKRSTGLVNTDQ----------QTGGLVGVISSLTTSQAQAVAEGTADKA
A0A1Z4JCS8      LTEAQTALAQFKQSTGLVNNEE----------QTKGLVGTINTLEAAQAQVQAESQATRD
A0A6P0PI80      LDQSQEALAKFQESSGLVNSEA----------QTEGLVRAITDLSISQAQAQAEAQASQH
A0A6P0WGT6      LDQSQEALAKFQESSGLVNSEA----------QTEGLVRAITDLSISQAQAQAEAQASQH
F4XTX2          LDQSQEALAKFQESSGLVNSEA----------QTEGLVRAITDLSISQAQAQAEAQASQH
Q7NJN6          LQTAQVELYGYQRRTGLVNADD----------QTRGIVETLNSLRSTQTLTLAQAEAAAR
U5QCC3          LQQTQSELASYQQTTGLVNVDE----------QTRGLVETLNTLRSSATLAQAQAKAAED
A0A3M1SVZ4      LSQAEQELRQFKEENNFFALQE----------EAAAATQLMTGLQQRITDTQSQIASTNS
A0A654SFI6      LSISERDLVEYANENEILVLET---GNREEGSGTASQTLIATDLAALNEALA--------
K9SSQ0          LDQNSTALTRFRQQYNITDPDT----------YAASIFSTKQGLATQIQDLQIKMAQTQR
A0A2W1JIN9      LLQVEARMSKFKQEYGYVTLSA----EGNNNEANQLLVNSYAQLEGQIRDLTSQIQEVDA
A0A318AJV1      VNDADTRLAAYRAGTGLSADGA----------GSNVVDQQIATLSGQLANAEAEAAGARS
A0A6P0IC70      TEAAEVAESKYRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEVNA
A0A6B3MUB5      TEAAEVAESKYRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEINA
A0A6M0B7N4      TEAAEVAESKYRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEINA
A0A6P0J9W3      TEAAEVAESKYRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEINA
A0A6P0ZWE1      TEAAEVAESKYRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEINA
A0A1U7N2U4      VEATEAALNKFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT
A0A1D9G1F2      VAAAEAALNKFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT
A0A6P0PNZ7      VAAAEAALNKFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT
F4XV38          VAAAEAALNKFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT
A0A6P0W137      VAAAEAALNKFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT
A0A6L9Y9E2      VAAAEAALNKFKQTTGLVSPEE----------QTQLLVRSLASLEDQERAVSIQLQDAKT
A0A6P0SGR0      VEAAEAALNQFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQEAKT
A0A6M0BK48      VAAAEAALNKFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT
A0A6L9YZL1      VAAAEAALNQFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT
A0A6P0KYM4      VAAAEAALNKFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT
A0A6P0LSD6      VAAAEAALNKFKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT
A0A6P0X384      AEAAEAALSKYKQATGLVSVEE----------QTNNLITSLASLEQEKQLLAAQVQEANG
A0A2P8QIL5      LAQVEATLSQYKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKA
A0A2T1FLY5      LAQVEATLSQYKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKA
A0A433W447      LAQVEATLSQYKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKA
K9U1K8          LAQVEATLSQYKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKA
K9UYB2          LMVAEMEESAYRERTGIISFDE----------QTKSLVQSLAALEDQQRTLGTQLQEARS
A0A218QN17      LATAEQNESNYRHISGIISFEE----------QTKSAVESLATLEDQERALTAQLQEAKG
K9RKN2          LREAEATESQYRQASGIVSFAE----------QTESLVENLSSLEEQERTLSALLEQVRS
A0A2I8ADV2      LQQAEVAESRYRQKSGVVADTD----------QTKSLVQSLTNLEDQERTLIAQLQEARS
A0A1W5CKM3      LLQAELAETKYRQQSGVVATDD----------QTRSLVNSLAELENQERILAVQLQETRS
A0A5Q0GMF5      LLQAELAETKYRQQSGVVATDD----------QTRSLVNSLAELENQERILAVQLQETRS
Q3MEW0          LLQAELAETKYRQQSGVVATDD----------QTRSLVNSLAELENQERILAVQLQETRS
A0A1Z4KIC7      LLQAELAETKYRQQSGVVATDD----------QTRSLVGSLAELENQERTLAVQLQETRS
Q8YSM5          LLQAELAETKYRQQSGVVATDD----------QTRSLVGSLAELENQERTLAVQLQETRS
A0A1Q4S1H4      LKVAEIKENKYRQTSGIVSFDD----------QSKSLVTSLANLEDQERMLFAQLQEARS
A0A433VBU6      LKAAEIKENKYRQTSGVVSFDE----------QSKSLVTSLANLEDQERMLFAQLQEARS
A0A1Q4RZJ6      LQAAEVAENNYRQQSSIVDFDE----------QTKSLVQSVASLEDQQRNLATQLQEANS
A0A1Z4SNV3      LQAAEAAENKYRQASIIVNYDE----------QTKSLVQSVASLEDQQRTLATQLQDANS
A0A2H2XJQ1      LQAAEAAENKYRQASIIVNYDE----------QTKSLVQSVASLEDQQRTLATQLQDANS
A0A3S5K358      LQAAEAAENNYRQQSSIVDFDE----------QTKSLVQSVASLEDQQRTLATQLQEANS
A0A0T7BPJ4      LTVAEANENRQKQASGIVSFDE----------QSKSVVTSLASLEDQERTALAQLQELRS
A0A0C1QS61      LENAELTENRYRRSSGIISFTK----------QSESLVDSLAALENQERTLSAQLRELRS
A0A139X3R8      LEDAELKENKYRQSSGIISFTK----------QSESLVDSLATLENQERTLSAQLQELRS
A0A1Z4I7C5      LQQAELAETRYRQQSGVVAADD----------QTKSLVGSLADLENQERTLAAQLQEARS
A0A0C2MDK7      LLQAEDLENKYRKSSGIVSVEE----------QTKSLVQSIATLEHQERTLSAQLQEIKT
A0A1Y0RCK1      LRQAEAQENKYRQLSGIVSLEE----------QTKSLVQSIATVEDQERTLSAQLQEIKA
A0A1Z4PWZ0      LLQAEEKENKYRKSSGIVSFEE----------QTKSLVQSIATVEDQERTLSAQLQEIKA
A0A0C2QLT0      LRLAEATENKYRKLSGIVSLEE----------QTKSLVQSIATVEDQERTLSTQLQEIKA
A0A1Z4J2K1      LRLAEATENKYRKLSGIVSLEE----------QTKSLVQSIATVEDQERTLSAQLQEIKA
A0A3S0ZSX0      LEKAELIENKYRQDSGIVSFDE----------QTKSLVNSLATLEEQEGTLSAQLQELRS
A0A2N6K4T3      LQEAEQKENRYRQSSGIVSFDE----------QTKSIVESLATLEEQENTLSAQLQELRS
A0A370CKT2      LQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLANLEQQENTLSAQLQELRS
A0A0S3TL97      LQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLATLEQQENTLSAQLQELRS
A0A2N6M8A0      LQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLATLEQQENTLSAQLQELRS
A0A2N6M9E1      LQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLATLEEQENTLSAQLQELRS
A0A2N6KJI4      LQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLANLEEQENTLSAQLQELRS
A0A2N6MZ77      LQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLANLEEQENTLSAQLQELRS
A0A2N6KT20      LQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLANLEQQENTLSAQLQELRS
G6FSN3          LQEAEQKENRYRQSSGIVSFDE----------QTKSLVESLANLEQQENTLSAQLQELRS
A0A4D9CI02      VEEAEQKENKYRQSSGIVSFDE----------QTKSLVNSLATVEEQENTLVAQLQELRS
A0A328I8B9      VEEAEQKENKYRQSSGIVSFDE----------QTKSLVNSLATVEEQENTLVAQLQELRS
A0A4Q9J4Z7      VEEAEQKENKYRQSSGIVSFDE----------QTKSLVNSLATVEEQENTLVAQLQELRS
A0A0M0SU69      VEEAEQKENKYRQSSGIVSFDE----------QTKSLVNSLAIVEEQENTLVAQLQELRS
A0A1Z4TIZ8      VEEAEQKENKYRQSSGIVSFDE----------QTKSLVNSLATLEEQENTLVAQLQELRS
A0A0S3TYD7      VRQVEGEIRAFKENNQIVALDQ----------EQRNSVEITSDFNKRIEDTRAKLVGAIQ
A0A2T1DNG3      VKDAEAALEQFRRDQSLIEPSA----------EAAAQTEMLNRLQADKQATLVQIRELQT
A0A3S0Y9N9      LQAAEKKLQDFKQQYKVLDLKS----------EATSSVTILTDLEKQVAETISELASQTA
A0A433UNK7      LQTSERRLQFFKQQNRVLDLKA----------EASASVAILTDLDKQVAATRSDLSSQTA
A0A6P0ZKB8      LQAAERKLQLFKQQNRVLDLKA----------EAASSVGILTALDKQVADTRSDLSSQTA
U5QL42          LNQTAIAIREFRKRYDIPDPDG----------YATSVAEVQQSLQQRIQDLQINLAQTQR
A0A076HBF2      LDQLQGELADFRTRYSLLEPTA----------EGGALKKRETAMAAQVLGLEADRNRLLK
A0A354B169      TSQLQSDLAKFRERHNLIEPTE----------EGGAIKGRLAQLESQLLGLEAERNRLQR
G4FMX5          TEQIQSEVAAFRIKHSLLEPTA----------EGGALRQQEAGLSSQVLALQAGRNRLSK
Q0IDT5          ADAIQGELAEFRRRHSLLEPAI----------EGTALKQREATLATQIFGFEAERSRLKR
A0A2D6FCW3      TEEIQSEVSDFRQRHSLLEPTT----------EGGALKQREAAIAAQVLDLEAGRNRLLR
A3ZA21          TEAIQNELAAFRRQHSLLEPTA----------EGGALKDRETAVATEILGLEAERSRLQR
A0A140K3H3      LNEVAKAIRNFRQTYNIVDPDE----------YALRVIQFRDGLEQQEKQAEIALARTQR
K9XUB8          LDDVAKKIRNFRQSYHIVDPNE----------YASRVIQFRDGLEQQEKQAEISLAAAQR
A0A6H2NHD5      VSDIEDNLSDFQKQYDLVDVNA----------ASESVTQRLNQMQANQEKLRVELASQIS
A0A2P8W4F7      VEAIESDLSEFQKRYDIVDVNA----------TSESVTQRLNQMLADQEQLRVDLTAMEP
A0A5Q4E0Z4      VDTIESGLSDFQKRYDLVNVTT----------TTESVTQRLNQMLADQEQLRVQLTALGP
A0A2P8VVX1      LRDSQSALEQFRINQNLIDPNS----------QAISVVESLNQVQTQQQQLMVELSGLEQ
A0A2P8WHY0      LQQAQAALEKFRQSQNLIDPTL----------QSQAVVTSLNEVQSEQRQLMSQLTELKS
A0A2T1CMT9      LTQTETNLTKLTKENNLVSPEA----------EATSVKENIRQIAQEREALKAQVGEIAG
A0A563VQJ3      VETAESELEQFRTENSIIDLQE----------EKRTIVQDAGAINRQIATLGASYQGKQA
A0A1D8TX52      LEQAEQQLEQFRKSKNLIDPSQ----------QAVAVSQTLNGIEQERRAIRAQYMETQT
A0A1D9G4T2      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A6P0PR27      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A6P0WER7      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
F4XP71          LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A6L9YR57      LEQAEQQLEQFRKSKNLIDPSQ----------QAVAVSQTLNGIEQERRAIRAQYMETQT
A0A6P0KZ31      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A6P0LPB8      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A6P0SEV1      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A6B3N2I8      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A6M0B891      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A6P0IJQ1      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A6P0J8J8      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A6P0ZSH6      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A1U7N5X9      LEQAEQQLEQFRKSKNLIDPSQ----------QAVAVSQTLNGIEQERRAIRAQYMETQT
A0A6L9Z1V0      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A6P0LC12      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A6P0MVJ3      LEQAEQRLEQFRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT
A0A2W6ZAV2      VVELQQQLSSFRRQNSFLDPSS----------QGEAIQTQRQALNVRLDDLRQTEAKLLG
K9W742          VTQSEAALEKFRKTQNLIEPDA----------QTTALTTALNAIQDERRRNQAQYRELQA
A0A3D1PBA3      VDQAENKLEQFRKNYNLIDPEQ----------QATAVSQSLNAIAQERQVIRAQYKDLQA
K9XPB0          VAAIEAKLTQLRSENNLVSPQG----------ESESIKAVLNNIQQERATLKAEQKQTQG
A0A350Y7Z1      VIQAEKALEQFRETQNLIDPVQ----------QATTITDALSTVEQEQQAIRAQYQETQA
A0A352X2A7      VNKAERSLEEFRENQNLIDPLQ----------EASNVGETLTKIEQERQAVRAQYQETLA
A0A0D8ZYV0      VAQSEAQLEKFRTNQNLIDPEQ----------QAAAINNSLNAVVQQRQVLRAQFQDTEA
A0A2T1FP73      VDQAENKLEEFRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRAQYNDLQA
A0A433VMS2      VDQAENKLEDFRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRAQYNDLQA
K9TYA7          VDQAENKLEEFRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRAQYNDLQA
A0A2P8QUE1      VDQAENKLEEFRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRAQYNDLQA
K9SA61          VREAEAALEAFRKNQNLIDPEA----------QSQTILEALSRTRQEQQTNQAELQATQA
A0A2G7GMH8      VNQAENALELFRESNNLIDPEL----------QAKALTDALNNVKQEQRTNRNQIQQTQS
A0A6N8FU92      VNQAENALELFRESNNLIDPEL----------QAKALTDALNNVRLEQQTNRNQIQQTQS
A0A2T1DWE8      VDRAEDAMERFRKSQNLVDPEV----------QSRALIDALSNLQKEQQTNQAQIREVQG
A0A1U7I8L3      TVRTEAALEKFRKSQNLIQPEL----------QAKALIESLKDIQYELRTARAQYQEAQS
A0A2T1DJL8      VNQAEAALERFRKNQDLIDPEL----------QSKSMVDSLAAVQKDQRANRTELQDLQA
A0A1Z4J9W0      VNQAESNLERFRSTSNLVDPEV----------QAKSLVDSLKELQQNQQENRGLLASSRA
A0A0N7Z5K9      VNKAEADLERFRKSSNLVDPED----------QSRALIESLRELQKDQQSNRGELASAQA
A0A0S3TXC5      VDKAEADLEQFRKSSNLVDPED----------QSRALVESLRELQKDQQSNRGELASAQA
B8HNB0          LAQSAQAVRNFRKQYGLVTPDA----------YAEAVVSTRMELEKQGKDAEIAVKTTQR
A0A563VS48      VQEAESELRKFKNQYQIANLTE----------ETSATINSISNIRSQIDTIEAELEDVNA
A0A318BJ18      LDDSQRQLVAYASAQQIINLPA------PGSGIGGTTTVERSIVADDLAALNASLAQATA
A0A3B8Y8H9      VSSLQKELERFRKKHNFIDPQS----------QSRILSSNLTNIIQKKQENQSLLQEQEI
A0A2W1JVB9      IENLEEQLRRFKETNKIVAIDK----------EAEVAVEAVIRLAEKINEAQGRAISAQA
A0A6H1U102      LNETAQAIQKFRQDYGIVDPES----------YANQVLEQKQLLEKDGQQLEISLSRTQR
A0A7C3ZEJ3      LNQSASAIREFREKNGIVDPDT----------HATQVVSIKQSLEQQARDVEIALNRTQR
A0A563VLD6      LDKVAYDIRSFRQENNLVDPNI----------YASDVSKFRQSLEQDSRSTEIALARAKS
A0A2P8W9H0      VSSLEAELEDLRQRSNLIDPLK----------QGEQLSTQTAKFTAEQFDLRLQLEQSQQ
A0A6I5P386      VQDLETELENLRKSYNLIDPLL----------QGEQLALQASKFRSERFDLWVEIQENQS
A0A318BG22      LEESERQLVAYAEQNGIISVTD---------AKTAGTGSGAQSLDSASMAALNDRVAAAR
A0A2T1E9V8      VYNADAAIRKFKEKYKLTDLAQ----------TQRSVAENIERIGSQVDSIEAQLSDLNS
A0A1Z4LN32      LSKVTEELRDFKQKNKVIELKE----------ETTKAVQIIHEIDKELTEARSELADVGG
A0A2I8A9F5      LEEAQKALLQFKTQNKIVNLEE----------ESSGLVKNAITIDSEINNARAQLAETIT
A0A218Q6R8      LEEITEALRQFKTQNQIVDLQE----------EKNATVTIVLALDEELNNARALLADVSA
A0A218QGE0      LEKAAEALRKFKLKNQILELAE----------ETKASVKNISDVEIELAKARSELADARA
A0A3M2GQQ6      LSESALAIQSFRQTYGIVDPES----------YANQVLDIKQSLEKDAQSLEITLTRSQR
A0A6H1U2X0      LSESALAIQSFRQTYGIVDPES----------YANQVLDIKQSLEKDAQSLEITLTRSQR
K9TLQ0          VDTLQEYLEKFRQHYNLIDPGQ----------SGQILSQQIGSLVNERQETESQLVQAQA
K9QF04          VDQLQVQLQRFRRQNNLVDPEK----------QSQVLTERLSNIIQQRQETQALLGETQS
K9W1T3          VRQAEQDLRKFKEQNKVLDLAG----------EATSTTEVLNNLTQQISEAQSKYAAETS
K9SGJ5          LDESALTVTKFREKYKIVDPDT----------YAASVYTMKQDLDTQAQQLQIQMAQTQR
A0A6N2JS94      LDKSALAVTQFRKTYNIVDPDT----------YAASVYKMREALENQAQDLQIKIAQVQQ
A0A6C2DSN4      LEKSALAVTQFRKTYNIVDPDT----------YAAAVFKMREALETQAQELQIKIAQSQQ
L8MYT6          LEKSALAVTQFRKTYNIVDPDT----------YAAAVFKMREALETQAQELQIKIAQSQQ
A0A352JGJ6      LDKSALAVTRFRKTYNIVDPET----------YAAAVFKMREVLEVQAQELQIKIAQTQQ
A0A1J5GLS2      LEKSALAVTQFRKSYNIVDPET----------YAASVYSMREALEKQAQELQIRIAQVEQ
A0A2W4W6M5      LDKSALAVTQFRKTYNIVDPET----------YAASVYKMREALEVKAQELQIQIAQVQQ
A0A2W7AN33      LDKSALAVTQFRKTYNIVDPDI----------YAASVYKMREALETQAQDLQIKIAQVQQ
A0A256BLV2      LDKSALAVTQFRKTYNIVDPDT----------YAASVYKMREALENQAQDLQIKMAQVQQ
A0A2W6ZXF3      LDKSALAVTQFRKTYNIVDPET----------YAASVYSMREALEKQAQDLQIRIAQLQQ
A0A2Z5WX66      LDKSALAVTQFRKTYNIVDPEV----------YAAAVFKMREALEAQAQDLQIKIAQFQQ
K1XF69          LFLAEKSIQDFKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS
B5W297          LFLAEKSIQDFKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS
A0A6H2AL05      LFLAEKSIQDFKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS
H1W7M8          LFLAEKSIQDFKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS
A0A5Q4H6A5      LFLAEKSIQDFKERNYVVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS
D5A466          LFLAEKSIQNFKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS
U5QJM6          VEASEEALRDFRSKNNILDPEE----------QAKALSGVMSDLMEEAEKAKVELQTSRK
A0A1Z4RPC6      LQTLESRLQNFYERNQVVDLQE----------EKRILVGEVGNLNRQIADTGAQLQGAKA
A0A2T1CMZ0      LNSLEANLQSFYEKNQVVDLQE----------EKKSLVDEIGTLNRAISGVGAQLQGKKA
L8M4F7          VESAESALAKFRADNKIVDLQQ----------EKQTVIEETANLNRQIAFIGSQYRGTKA
A0A140K2P2      VSQAESELRNFKESNQVVNLTK----------EAESTVMQMAEMNSEISKVAAQLQGTMA
K9XWX4          VSQAESELRNFKESNQVVNLTR----------EAESTVVQMANLNSEIANVAAQLQGTMA
A0A140KB14      LSKAESDLRRFKEANRVVNLAK----------EKETLVLELGNLNQQIANVAAQYQGTQA
K9XX88          LSQAESDLRRFKEANRVVNLAK----------EKETLVVELANLNQQIANVAAQFQGTQA
A0A563VSV6      LKQNESILQEFRTKHKIVDLQE----------EKKVLVAELGTLNRQIATTGSQLKGTQA
L8LZE9          LEEYESILQNIRERNNIVDLTQ----------EKRVLVQEIGTLNRQISAIGAQLQGAKA
A0A433NM31      VQKAEAQLREFKERNNILDLEN----------EAKAAVTLVTDLENQIAQAQINLANANM
A0A1Z4NDS1      VQAAELELRRFKEENKVINLQE----------EATASVNAIARLEDQITQVQAKLVDATA
U9VXM0          VNEAEEALRQFREGNSIVDLEE----------ESRNLVESLFTLDNALIQLKSELADSTA
A0A6M0RI13      VEEAEASLRRFKEGNNIVDLEE----------ESRNLVESLFTLDNALIQLKSQLADSSA
A0A6M0S1N5      VEEAEASLRRFKEGNNIVDLEE----------ESRNLVESLFTLDNALIQLKSQLADSSA
K9F4D9          VEEAEASLRRFKEGNNIVDLEE----------ESRNLVESLFTLDNALIQLKSQLADSSA
A0A6I5QPI5      VLRVEGALREFKETNDIISLDQ----------EASNAVSVLAGLDQDIGNIQAQLADISA
A0A1Z3HMQ0      VEQAAEALRQFKDQNQIIALES----------EANAAVSMINNLETQIGQAQAQLASAIT
A0A433W533      VRRAESALRRFKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRAELANANT
A0A2P8QWJ3      VRRAESALRRFKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRAELANANT
A0A2T1FKP8      VRRAESALRRFKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRAELANANT
K9U6L7          VRRAESALRRFKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRAELANANT
A0A1E5QP61      VRQAEAALRAFKEENSVVSLQD----------EATSAVISISNLDSEVIKAQAQYEDATA
U5DPF5          VREAEEALRRFKERNRIIVLNE----------EAQTTVRLLGSIDEELVKSQTSLNDTQA
A0A6P0X488      LRQAESALRSFKEQNNIVSLKE----------EATYAVANIANLDQKISQTRSELEDVAA
A0A6P0UVD5      LRKAESDLRSFKEQNNIVSLKE----------EATYAVANIAELDKKISQTRSDLEDVAA
A0A6P0VDM0      LRKAESDLRSFKEQNNIVSLKE----------EATYAVANIAELDNKISQTRSELEDVAA
A0A6M0G142      LRQAESALRRFKEQNNIVSLEE----------EASFAVENIAELDKKISQTQSELEDVAA
A0A6P0MR53      LRQAESALRRFKEQNNIVSLEE----------EASFAVENIAELDRKISQTQSEMEDAAA
A0A3M2GIL5      LSRAEAELRNFKERNNIVELEE----------EARSAVFVMGEIETEKSKKEAALADATA
A0A6H1TSJ9      LSRAEAELRNFKERNNIVELEE----------EARSAVFVMGEIETEKSKKEAALADATA
A0A3M1PML8      VKAADSDLRRFKEANGVVLLES----------EAQEAVNIISKLEDQVTQARAELSDTSA
A0A6M8BE85      VRAADSDLRRFKEENGVVLLES----------EAQEAVNIISKLEDQVTQARAELSDTSA
A0A0T7BPZ0      VRAAESAFRQFQERNKIIILQE----------QESNAVKMISSLEDEIAQAEIKLTEVNA
A0A352X442      VSIADAELRNFKEQNKIVDLVN----------EAKSSVETVADLDTQIAQTQAKLAEATA
A0A6B3NF44      VSKSEEALRRFKEENRVVALQE----------EASASVSIISSLDNQIAQAQARLADVTA
A0A6M0EPL4      VSKSEEALRRFKEENRVVALQE----------EASASVSIISSLDNQIAQAQARLADVTA
A0A6P0K6L6      VSKSEEALRRFKEENRVVALQE----------EASASVSIISSLDNQIAQAQARLADVTA
A0A6P0MRR9      VSRAEEDLRRFKEENKVVSLVA----------EATATVDNIARLDRTIAETQAELANISS
A0A6P0UX57      VKRAEEDLRKFKEENKVVSLVD----------EATQTVKSIALLDQQIAAKKAELANISS
A0A6P0X1X4      VRLAEENLRKFKEENKVVSLVD----------EATQTIRTIAILDQQITQKEAELANVSS
A0A0M0SHU3      VQKAELALRRFKEKNKVIVLQE----------EATAAVNTISKLEDEIAEAQAQLVDANA
A0A1D2PBN3      VKRAEAELRRFKEENKVIALQE----------EATAAVNEISKLEEQISQAQAQLADVSA
A0A0C2LVR7      VKRAEAQLRRFKEENKVIALQE----------EATAAVNEISKLEEQISQAEAQLADVTA
A0A1Z4PQB9      VKRAEAELRRFKEENKVIALQE----------EATAAVNEISKLEEQISQAQAQLADVSA
A0A1Z4SFN6      VRAAESTLRKFKEENKIINLES----------EAGLAVERISNLEQQLAQAQAEYANVTA
K9PGI8          VRGAELALRKFKEENKIIALQE----------EASTAVQVISRLEEQINQTQAKLVEVGA
Q7NEU3          VERAEEQLRTFRRQYSILDPQV----------QGTELAATLNTLNRDYEQSKAELEASKE
A0A3C0N2P0      VNELQKSIQSLRENYKIVDPES----------QGQQLSNRASEIVKQRQDTESQLSEAQK
A0A6P0JR04      VDTLQADLQTFRQENNLLDPEV----------QGQKVADRLNQIQQQRQETQAELKAKQA
A0A6B3M6M6      VNKFQEQLQRFRQRYNLTDPET----------QGKLLTSRLSTIVGQRQETTTTFRETQE
A0A6P0KD09      VNKLQEQLQRFRQRYNLTDPET----------QGKLLTSRLSTIVEQRQTTDTTLQETQE
A0A6B3NIJ0      VNKLQEQLQRFRQRYNLTDPET----------QGKLLTSRLSTIVEQRQTTDTTLQETQE
A0A6M0F053      VNKLQEQLQRFRQRYNLTDPET----------QGKLLTSRLSTIVEQRQTTDTTLQETQE
A0A6P2ATU9      VNTLQNDLQAFRQRHNILDPDV----------QGQSVAERLNRLSEESRAARTTLNEVRS
A0A352XE00      VNQLQAQLQEFRQAYNLIDPDS----------QAQLLTQRATSIVQQRQDAQSQLAEAKA
A0A6P0QC14      VKDLQQKIQTLREDYRIVDPET----------QGSLLTNRISDVVKQRQEAQTQLDESKQ
B4VS56          VDSLQQKLQRFRQQYNLVNPDS----------QGQLLTSRVSTIVQERQNTQTQLDEART
A0A352AAQ3      VNDLQQKVQDLRQNYKIVDPET----------QGQLLTNRVSEIVKQRQETESQLVEAQR
A0A350Y472      VNDLQQQIQNLRQTYQIVDPET----------QGQLLTNRVSDIVKQRQETQSQLIESQQ
A0A355DVB4      VNDLQQQIQNLRQTYQIVDPET----------QGQLLTNRVSDIVKQRQETQSQLIESQQ
A0A1Z4RMB9      VQQAESQISAFRTQNNIVDIEE----------EKRGVVESIGALNQQISTTGSELQGLKA
A0A318B4H2      LEASERELVAYASGKGIVSFSSGSTEKGGGGGERTLVTDDLSSLNTALNAAVAERVAAES
B4WQE3          VNELEAELEALRQNSNLIDPLA----------QGDQLSQQMAQFTSDHLNLQVEIAQTTE
A0A2K3BR24      VQAAEEKFREFKEENNIIALSQ----------EASSTVDILASLDQQLIQAQASLDDAQT
K9YXY1          VQAAEEKFREFKEENDIIALSQ----------EASSTVSILASLDQQLIQAQASLDDAQT
A0A0V7ZFJ4      LIRAEAELREFKEKNGIVALEQ----------EAQTGVEALKDLSEEIVKAQAYLGEVTT
A0A0V7ZNJ9      VVKAEAELRKFKEENKVVALKE----------EAQFGVEGLKDSLQELNQAEAKLAAANE
A0A367RIS1      VAEGEAALRQFKEKYEVVSLEV----------EAQEGVRSLNELSNQITQLRARLVDARS
A0A235IXQ2      VTEEEAALRRFKEKYEVVSLEE----------EAKEGVKRLNELSSQITELRARLVDARS
A0A1W5CNX3      VTEAEAALRRFKEKYEVVSLQE----------EAIQGVKRLNDLSGQVTQLRAQLVDART
A0A5Q0GJJ5      VTEAEAALRRFKEKYEVVSLQE----------EAIQGVKRLNDLSGQVTQLRAQLVDART
Q3MEB7          VTEAEAALRRFKEKYEVVSLQE----------EAIQGVKRLNDLSGQVTQLRAQLVDART
A0A1Z4KHN9      VTEAEAALRRFKEKYEVVSLQE----------EAIQGVKRLNELSGQVTLLRAQLVDART
Q8YT70          VTEAEAALRRFKEKYEVVSLQE----------EAIQGVKRLNELSGQVTLLRAQLVDART
A0A166IWU6      VAESELALRQFKEKYEVVLLEE----------EAKQGVERLYQISNQLTLLRARLIDASS
A0A2S0Q8C0      VAESELALRQFKEKYEVVLLEE----------EAKQGVERLYQISNQITLLRARLIDASS
W6FSX4          VAESELALRQFKEKYEVVLLEE----------EAKQGVERLYQISNQITLLRARLIDASS
A0A218Q4C1      VSEAELALRRFKERNEVVALEE----------EAKQGVERVYEISNQITLLRARLVDASS
A0A6P1ZT04      VSDAELALRRFKERNEVVALEE----------EAKKGVERVYEISNQITLLRARLVDASS
A0A0R0M9H9      VIKAELELRRFKEINRVVALDA----------EAKVGIETLGKIDEVITQAQGQLAAAST
A0A1S1ZVW2      VTKAELELRRFKEVNRVVALDA----------EAKVGIESLGRIDEVITQAQGQLAAAYT
A0A1B7WX82      VTKAEMSLRRFKENNRVAVLDV----------EAKTGLESLAKLDQAIIESQGELVAAST
A0A1B7WTD1      VTEAEIALRRFKEKNRVVALDV----------EARVSLESLGRLTESITQSQGELAAAYT
A0A480ABC0      VTEAEIALRRFKEKNRVVALDV----------EARVSLESLGNLTEAITQSQGELAAAYT
A0A1Z4LRU5      VVQAEAALRQFKEQNNVVALEE----------EAKFGVESLKDLSENITQSQANLVEAMT
A0A1Z4JVB4      VLRAEMALRRFKEKNRVVALDE----------EAKVGVEGLNQLSQEIISTQGQLVAAKT
K9PIA4          VMKAEMSLREFKEKNKVIALEI----------EAKAGVEGLKDLAAIITKVEAELVGANT
A0A1Z4HVE1      VLKAEMALRRFKEKNRVVALDV----------EAKVGVEGLKDLLEEITKAQANLVDANT
A0A252ECZ1      VLKAEMALRRFKEKNRVVALDI----------EAKAGVEGLKDLLEEITTAQAELADANT
A0A1Z4G5Y1      VLKAEMALRRFKEQNKVVALEV----------EAKTGVEGLKDLLGEITKAQAGLADATS
A0A252DNA2      VLKAEMSLRRFKEQNRVVALDV----------EAKAGVEGLKDLLEEITKAQAELADAST
A0A252E1Q4      VLKAEMSLRRFKEQNRVVALDV----------EAKAGVEGLKDLLEEITKAQAELADAST
A0A6G9SK36      VLRAEMALRRFKEKNKVIALDV----------EAKVGVEALKDLAEEITKTQGELIAAKT
A0A1Z4M597      VLKAEMALRRFKEKNRVVALDV----------EAKVGVEGLKELAEEITRTQGELTAAKT
A0A1Z4MWT1      VLKAEMALRRFKEKNRVVALDV----------EAKVGVEGLKELAEEITRTQGQLTAAKT
A0A1Z4TX53      VLKAEMALRRFKEKNRVVALDV----------EAKVGVEGLKELAEEITRTQGQLTAAKT
A0A5P8VSD1      LAESQAALRRFKEKHEVVSLEA----------EAIEGVKRLNELSSQMTQLHAQLVDFRS
A0A2A2TNQ5      VVQAEATLRRFKDDNKVVSLAE----------EAKVGVEGMRNIAEESTRALAVLEEAKS
A0A3S1C4K5      VIAAEAGLRKFKDENKVVSLPE----------EAKYGVEALKDLSGDITKAQALLSDASS
A0A1X4G3D5      LAKAETDLRQFKESNEIISLEA----------EAESGMKNVSTVDAAINQAQAELAVVYT
D4TNI2          LAKAETDLRQFKESNEIISLEA----------EAESGMKNVSTVDAAINQAQAELAVVYT
A0A1Z4H6Z8      VLKAEMALRRFKEKNRVVALEV----------EAKVGVEGLKDLAEEITTAQGELVAAKT
A0A1Z4NPM1      VVVAEADLRRFKDENRVVELTE----------EAKVGVEAMRNLSAELTRAQAALAEKNT
A0A3F3KPR9      VIKAELELRRFKEINRVVALDA----------EAKVGIETLGRINEVITQAQGQLAAAYT
D4TGN7          VIKAELELRRFKEINRVVALDA----------EAKVGIETLGRINEVITQAQGQLAAAST
A0A1Z4UZW9      VTKAEMNLRRFKENNRVVALDV----------EAKTGLESLGKLDEAITKSQGELAAVLT
A0A0K2M5H0      VTKAEMNLRRFKENNRVVALDV----------EAKTGLESLGKLNEAITQSQGELAAALT
A0A1B7VSH4      VTKAEMNLRRFKENNRVVALDV----------EAKTGLESLGRLNEAITQSQGQLAAALT
A0A1B7W126      VTKAEMNLRRFKENNRVVALDV----------EAKTGLESLGRLNEAITQSQGQLAAALT
A0A3D4C6Q6      VTKAEMNLRRFKENNRVVALDV----------EAKTGLESLGRLNEAITQSQGQLAAALT
A0A1B7UVJ4      VTKAEMSLRRFKENNRVAVLDV----------EAKTGLESLAKLDQAIIESQGELVAAST
A0A1B7UTR1      VTKAEMTLRRFKENNRVVALDV----------EARTGLESLGKLDEAITRSQGELAAAYT
K7W0A4          VTKAEMTLRRFKENNRVVALDV----------EAKTGLESLGKLDEAITRSQGELAAAYT
A0A5C0DRW9      VIKAEMTLRRFKENNRVVALDV----------EAKTGLESLGKLDEAITRSQGELAAAYT
A0A6H2C088      VIKAEMTLRRFKENNRVVALDV----------EAKTGLESLGKLDEAITRSQGELAAAYT
A0A1Q4RTR1      VRQAEVSLRLFKEKNRVVELQQ----------EAKTSIANQSDLADEIIKTEATLVDTSS
A0A1Z4SQV2      VRSAEYGLRQFKEKNRVVELQE----------EAKTSIKNQSDLADQIIKSEAQLVDISS
A0A2H2XGN1      VRSAEYGLRQFKEKNRVVELQE----------EAKTSIKNQSDLADQIIKSEAQLVDISS
A0A433UXH8      VRSAEYGLRQFKEKNRIVELQE----------EAKTSIKNQSDLADEIIKSEAQLVNISS
A0A1U7HGH0      LQRADLAVRNFKEKNQLTNIEQ----------SQTALAANIERVGSQIDAVEAQLVDLNS
K9XJD3          LQRADLAVRNFKEKNQLTNIEQ----------SQTALAANIERVGSQIDTVEAQLVDLNS
K9SX01          LRQAEAALRRFKEVNKAYLPEA----------EAQSAVAAVTSLDTQITASKSDLAKVNS
A0A4P7ZT55      VSQIQQELANFRRANALLIPED----------RAKQIELERADLEARERQLQQGQAQLVG
A0A1E5QIR9      VQEAEANLRVFKENNRIVALDQ----------EASATVTLLGGLEGEITQAKVALNSANT
A0A1Z4IBC7      VKKAESELRIFKEINKIVALEQ----------EATVAVDTVSKLSNQISQAQAQLNDVKG
A0A1W5CPC7      VKKAESELRIFKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVTG
A0A5Q0GKD1      VKKAESELRIFKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVTG
Q3MDC6          VKKAESELRIFKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVTG
A0A1Z4KM73      VKKAESELRIFKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVKG
Q8YNX7          VKKAESELRIFKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVKG
A0A367R4K6      VSRAESQLRLFKEKNKVIVLDQ----------EASAAVDTISKLDNQIYQAQAQLDDVKG
A0A1E2WSV8      VRRAESKLRLFKETNKIVVLEQ----------EATAAVDTISKLGNQISQALAQLDDVKG
A0A2R5FRT9      VRRTESKLRLFKEKNKVVVLGQ----------EASAAVDTISKLGNQISQALAQLDDVKG
A0A2K8T1B6      VRRAESKLRLFKEKNKVVVLGQ----------EASAAVDTISKLGNQISQALAQLDDVKG
A0A235I9I0      VRRAESKLRVFKETNKVVVLDQ----------EAAAAVDTISKLGNQISQALAQLDDVKG
A0A2D0HQT8      VRRAESKLRVFKETNKVVVLEQ----------EAAAAVDTISKLGNQISQALAQLDDVKG
A0A2L2NU95      VRRAESKLRLFKETNKVVVLEQ----------EAAAAVDTISKLGNQISQALAQLDDVKG
A0A367S084      VRRAESKLRLFKETNKVVVLEQ----------EAAAAVDTISKLGNQISQALAQLDDVKG
A0A6P1A9A0      VDKLQERLQIFRQQYDLIEPQS----------QGQQLSGKLSAIKQQQQETQAQLAEIQS
A0A1Z4SMD6      LEQAAEALRQFKNQFQIIELKD----------ESTAAINNVAKIDEEMNQVKAAIAEAIA
A0A2H2Y096      LEQAAEALRQFKNQFQIIELKD----------ESTAAINNVAKIDEEMNQVKAAIAEAIA
K9S8M8          LRQAEAQLRDFKERNGVISLNE----------EARTAVESIATLSTMIAQSEAMLQDATA
A0A1Z4NFV0      LEKSAEELRKFRTQNQIANLPE----------EAKTTVESIAKLTDELNSTQAELAQVTS
A0A3M9ZEU1      VRQAERALREFKEANQIVALDT----------EATAAVNIIASIDQQIADTEAELAKMVA
A0A1Z4JK72      LQKASEELRLFRTQNQIVDLER----------ESAANINSLSLLQDQLNQARSQLADVAR
A0A0N7Z489      LNRASEDLKNFRARNGIVDLER----------ESAANINSAAVLQDQLSQARAQLADVGR
A0A0S3TXS2      LNKASEDLRNFRAQNGIVDLER----------ESAANINSAAVLQDQLSQARAQLADVGR
A0A2A2TPF8      LDKTAEESRRFKEQNQIINLEE----------ESNETVKTIGELDKQLNETRGQLAEATS
A0A1Z4R0P8      LDKTTEDLRRFKERNQIINLEE----------ESNETVKTIGELDKQLNEAQGQLAEVIS
A0A0T7BUI3      LESAAEALRQFKNKNKIVQLEQ----------ESSSAITSMAKLDEEINQATANLAETLA
A0A1Z4LP32      LENATEALLQFKNQNQVIQLAE----------EATAAIQNISKLDDEINQARALLADVSA
K9REP9          LEQATQALLQFKNKNQVIQLPE----------EATAAIQNISTLDGEINQARASLAELTA
A0A1Z4SIJ3      LESASEALRRFKTENKIIQLSQ----------ESTAGINNIAQLDEQINQSKASLADISA
A0A2H2XPG4      LESASEALRRFKTENKIIQLSQ----------ESTAGINNIAQLDEQINQSKASLADISA
K9V3C7          LDKTSEALRNFKARNQIISLKE----------ESDSTVKIIEELSNKLNEARGQLADVAS
A0A1Z4T6Y7      LNKTTEELRSFKTNNKVINLDK----------ETEETVKNIGELDKQLNEVKGQLAEVTS
A0A2H2Y561      LNKTTEELRSFKTNNKVINLDK----------ETEETVKNIGELDKQLNEVKGQLAEVTS
A0A1Q4S362      LNRATEDLRSFKAANQVINLEK----------ETEETVKNIGELDKQLNEVKGQLAEVTS
A0A3S1CIN8      LNRATEQLRSFKAANQVINLEQ----------ETEETVKSIGELDKQLNEVKGQLAEVTS
A0A2A2TC28      LERATEALRRFKIQNNIVQLPQ----------EATAAITNISNLNEQVSQNQAALADIIA
A0A0C1NCB0      LERASEALRQFKTSNKIVELKQ----------EATSAISNVAQLDDTINQAQAELAEVSA
A0A2N6K7Q9      LERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA
A0A2N6MXH6      LERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA
A0A2N6M5A8      LERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA
A0A2N6LL61      LERAAEALRQFKIQNKVIQLAE----------ESTAAIDIIAKLDQEINQVKAALADVSA
A0A0S3TP66      LERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA
G6FP91          LERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA
A0A1U7GYR5      LERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA
A0A2N6KY52      LERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA
A0A2N6KMP5      LERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVST
A0A2N6MA45      LERAAEALRQFKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA
A0A4Q9J9V9      LERAAEALRQFKIQNRVIQLAE----------ESSAAIDIISKLDQEMNQIKAALADVTA
A0A328IGA1      LERAAEALRQFKIQNRVIQLAE----------ESSAAIDIISKLDQEMNQIKAALADVTA
A0A4D9CE41      LERAAEALRQFKIQNRVIQLAE----------ESSAAIDIISKLDQEMNQIKAALADVTA
A0A0M0SFT2      LERAAEALRQFKIQNRVIQLAE----------ESTAAIEIISKLDQEMNQIKAALSDVSA
A0A1Z4TLC8      LERAAEALRQFKIQNRVIQLAE----------ESTAAIDIISKLDQEMNQIKAALADVSA
A0A0C2LFH0      LNQAAEALREFKTRYKIIELPE----------EASAAVQNVASIDEEINQARAALADTSA
A0A1Z4IYV4      LDRSAEALRQFKIQYKIIELPE----------EASAAVKNLGQIDQEINQARAALADVSA
A0A1Z4Q0T6      LDRSAEALRQFKIQYKIIQLPE----------EASAAVQNLGQIDQEINQARAALADVSA
A0A0C2PT44      LERSAEALRQFKTRYKIIELPE----------EASAAVQNLGQIDQEINQARAALADVSA
A0A1D2P6J4      LDRSAEALRQFKTRYKIIELPE----------EASAAVKNLGEIDQEINQARAALADVSA
B4WP72          VSAAEANLRQFKEENGVVDLEQ----------EAAQAVDSIGNLDTQIDQAKTELANVNA
A0A2T1CIL7      VAKAEEDLRRFKTKNKIANLAQ----------EASNNINATKSLESEIDAVRANLKDVNG
A0A433V7A0      VVRAEMALRKFKELNQVVDLNQ----------EATSTVKVIEDLEKAITQTQAELAEVNN
A0A2T1FTR8      VKQAENDLRLFKEQYNVVDLPT----------ESVKAVETITSLNKEITSASAQLAAETS
K9UA41          VKQAENDLRLFKEQYNVVDLPT----------ESVKAVETITSLNKEITSASAQLAAETS
A0A0C2LBE2      VKQAESALRQFKENNKIITLQE----------EASAAVQAIAKLNEQISQAQAQLEDVTA
A0A433NN38      VKQAEANLRKFKEANKVVVLQQ----------EAAEAVSTISKLEDNIATAQAQLVNVTA
A0A2N6K0T2      VQKAELALRRFKERNKIIVLQE----------EATAAVNTISKLEDEIAQAQAQLVDVNA
A0A2N6ML72      VQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA
G6FQZ6          VQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA
A0A2N6MQX9      VQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA
A0A2N6KXT6      VQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA
A0A2N6KGB9      VQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA
A0A2N6L3Y5      VQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA
A0A0S3TIS7      VQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA
A0A1U7GW28      VQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA
A0A2N6LW63      VQKAELALRRFKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA
A0A328IH74      VQKAELALRRFKEKNKVIVLQE----------EATAAVNSISKLEDEIAEAQAQLVDANA
A0A4D9CIB0      VQKAELALRRFKEKNKVIVLQE----------EATAAVNSISKLEDEIAEAQAQLVDANA
A0A1Z4TQ63      VQKAELALRRFKEKNKVIVLQE----------EATAAVNTISKLEDEIAQAQAQLVDANA
A0A4Q9J8G2      VQKAELALRRFKEKNKVIVLQE----------EATAAVNTISKLEDEIAQAQAQLVDANA
A0A350Y0P6      VRQAESALRNFKEQHNIVSIDE----------EGTAAVEIMADLDKKISETKAQLQEKTT
A0A352X940      VRQAEAALRRFKEENNIVAIEE----------EAKSAVQAMAELDSKLSQTKSNLEDATA
B8HTN4          LRGLDRQIRSFKETHGIVDLPT----------EQIESVKFKSLLARDLAQAKSLLATAQA
A0A6P1AFJ5      VNQLQAELQKFRQENNFIEPSA----------QAQTLSSTLNNLAVAKEENQTQLAEMES
B0CAX4          LKNLDLSLRRFKETNGIIALEE----------EAKVSVEVEGNFYQEAAKMQSLLINARA
A0A1Z4RN12      VREAEANLRIFKNRNRTINLDE----------ETASTIESISTIENQIDQVEAELSDINA
A0A2T1CMF9      VENAEANLRNFKNRNGISDLQG----------QITADIDSVAQVENQINQVSADLNDVNA
Q7NDC5          LRASERKLRSFKEQYGSVALAE----------EQQAAVRLLSEFRSQQAQADVALSEAGA
U5QGK3          LRDSERRLREFKERYGSVALPE----------EQQAVVKQLAEFKSEQAQAAVKLAEAQT
A0A2W4UY24      VGKIESDLRAFKEANGIVNLEE----------ESQNTVKTLSTVTDSITQLRSDLADKNA
A0A0D8ZUV2      VRQAEAALRQFKEQNQIVSLDE----------EVKSAVGIIKELESQINTTEAALANANA
A0A433VDI0      VRQAEAALRQFKEQNRVVNLDE----------EAKSAVEIIQELESQINQSQTALAGANA
A0A3D1PG43      LRQAEAKLRRFKEQNQVVNLDE----------EGKSAVEVIKQLEDQVTATQAALVQAKT
A0A2P8QQ72      VRAAEASLRRFKERHQIVSLEH----------EAISAVEVLKELQDQITLAEAALVQTQG
K9TZQ7          VRAAEASLRRFKERHQIVSLEH----------EAISAVEVLKELQDQITLAEAALVQTQG
A0A6N8G584      VRQAEQALRQFKEQNQVVALDE----------EAKTAVAAIKQLENQITETQAQLADTTT
A0A2G7GPR0      VRQAELALRQFKEQNQVVALDE----------EAKTAVAAVKQLENQITETQAQLADTTT
K9XH68          VRQAELALRQFKEQNQVVALDE----------EAKTAVAAIKQLENQITETQAQLADTTT
A0A1U7HW70      VRQAELALRQFKEQNQVVALDE----------EAKTAVAAIKQLENQITETQAQLADTTT
A0A2S6VEJ8      VRQAEQALRQFKEQNQVVALDE----------EAKTAVAAIKQLENQITETQAQLADTTT
A0A140KBA0      VAQAEADLRNFKNENQIANLSE----------ETTTLIETSKLVDTQIDQVAAELGDVNA
K9XSG1          VAQAEADLRNFKNENQIANLSE----------ETTTLIETSKLVDTQIDQVAAQLQDVNA
A0A2T1GMT4      VNAAESAVRSFKQQNNIVDLSE----------EAKSAVSVIGNLDNNINAVRSELEQANA
K9UI51          VNSAESAVRNFKQQNNIVDLSE----------EAKSAVGVIGNLENNINAVRSELEQANA
K9QM62          VSTAEVALRKFKQQNNIVDLTE----------EARSAVTIIGGLDTEINTVKASLNEITA
A0A1Z4FWI3      VQEAEGALRRFKQSNNIVDLIE----------ETRSAVAIIGNLDNSINATRAELDQATA
A0A1Z4JYE7      VNYAEAVLRKFREQNNIVDLAE----------ETKTSVGVITGIDNEINAVKAQLADLVA
A0A2T1FXY4      VHQAEVKLRIFKQKNNIVDLSE----------EAKTAVANIGSLDNQIDNLKAELDQANT
K9TYI2          VHQAEVKLRIFKQKNNIVDLSE----------EAKTAVANIGSLDNQIDNLKAELDQANT
A0A1Z4QL41      VQTAEAALRRFKQQNSVVDLSE----------ETKSAVTIIGNLDNEINTIRAQLADFNA
A0A252D4T4      VQEAEAALRIFKQKYNIVDLVE----------ETRSAVAIIGNLDNGINTAKADLDQATA
A0A252DJH5      VQEAEAALRIFKQKYNIVDLVE----------ETRSAVAIIGNLDNGINTAKADLDQATA
A0A252EB80      VQEAEAALRIFKQKYNIVDLVE----------ETRSAVAIIGNLDNGINTAKADLDQATA
A0A6G9SKZ9      VQEAEAALRIFKQKYKIVDLAE----------ETRSAVAIIGNLDNNINTAKADLDQATA
A0A1Z4HPW5      VQDAEAALRIFKQKYNIVDLAE----------ETRSAVAIIGNLDNNINGVRADLDQATA
A0A1Z4MSN1      VQDAEAALRIFKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKADFDQATA
A0A1Z4U1C2      VQDAEAALRIFKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKADFDQATA
A0A0D6KV51      VQDAEAALRIFKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKADFDQATA
A0A1Z4MKF8      VQDAEAALRIFKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKADFDQATA
A0A2C6WC43      VDKAERELRIFKQKNRIADLTE----------ETKSAVGIIGNLNNEINTVQAQLDEVNA
A0A1Z4L5A1      VDKAERELRIFRQKNRIADLTE----------ETKSAVSIIGNLNTEINTVQAQLDEVNA
A0A367QD86      VDKAERELRIFKQKNRIADLTE----------ETKSAVGIIGNLNNEINTVQAQLDEVNA
A0A235IZ96      VNNAEVALRIFKQKHQIADLSE----------ETKSAVATIGNLDNEMNTVKAQLDEINA
A0A2L2NGP0      VNNAEVALRIFKQKHQIADLSE----------ETKSAVATIGNLDNEMNTVKAQLDEINA
A0A2K8SM78      VNNAEVALRIFKQKHQIANLSE----------ETRSAVETIGNLDNEMNTVRAQLDEVNA
A0A2R5FPC0      VNNAEVALRIFKQKHQIADLSE----------ETRSAVATIGNLDNEMNTVKAQLDEVNA
A0A5P8W5T6      VNNAEVALRIFKQKHQIADLSE----------ETKSAVATIGNLDSEMNTVQAQLDEVNA
A0A0F5YE28      VFRAEQALRSFKEKNQVLDLEE----------EFRTAVLEQAELNRKITVLESELSGVNA
U7QEH7          VFRAEQALRSFKEKNQVLDLDA----------EFRTAVTELAELNRKITVLESELSGVNA
A0A3S1ATK5      VYAAEVALRKFKQENRIVDLPE----------ETKSAVGIIGNLENEINTVKAQLEDLNG
A0A2Z6CPH0      VNRAEVALRVFRQKNNIADLSE----------ETKSSVGIIANLDNEINAIQAQLAEVNA
A0A1Z4GT50      VREAEVALRKFKEKHNIVDLSE----------EAKSGVAIIGNLNNEIHTIQAQLDEVNA
A0A1Z4GIX0      VHKAEVALRIFRQKNNIADLTE----------ETRSGVGIIGNLDNEINTVNSQLAEVTA
A0A2H6LC24      VHKAEVALRIFRQKNNIADLTE----------ETRSGVGIIGNLDNEINTVNSQLAEVTA
B2J6N5          VNNTEVALRIFKQKYQIADLSE----------ETKSAVATIGNLDNEMNTVKAQLDEVNA
A0A367RMI4      VNNAEVALRIFKQKHQIADLSE----------ETRSAVATIGNLDNEMNTVKAQLDEVNA
A0A235HUM0      VNNAEVALRIFKQKHQIADLSE----------ETRSAVATIGNLDNEMNTVKAQLNEVNA
A0A2L2NW47      VDNAEVALRIFKQKHQIADLAE----------ETRSAVATIGNLDNEMNTVKAQLDEVNA
A0A1E2WUR1      VNNAEVALRIFKQKHQIADLSE----------ETRSAVATIGNLDNEMNSVKAQLNEVNA
A0A235IKU3      VNNAEVALRIFKQKHQIADLSE----------ETKSAVATIGNLDNEMNTVKAQLDEINA
A0A1U7MYU6      VRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA
A0A1D8TNX9      VRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA
A0A6P0L6C2      VRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA
A0A6P0MVH0      VRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA
A0A6P0KJV0      VRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA
A0A6L9ZJG4      VRQAEAALRQFKERNQVVSLTE----------ESRSLVAVMADLDSQITTVQAQLEEANA
F4XKF3          VRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA
A0A1D9FX10      VRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA
A0A6P0Q0T0      VRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA
A0A6P0W5I0      VRQAEAALRQFKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA
A0A3C0NJ41      VGQAETSLRRFKQENQVIALDE----------EAKSAVGVMANLEQQITQVQAELQQANA
A0A352AG88      VNQAEMALRQFKEVNKVVSLEE----------ESRAAVDTLAKLDQQITEVKSQFKDANA
A0A350Y374      VNQAEAAVQEFKERNQVVALDT----------EATTAVEVIAKLDEQIAQVQSDLKNINS
A0A355DPX0      VNQAEAAVQEFKERNQVVALDA----------EATTAVEVIAKLDEQIAQVQADLKNINS
                                                                            

K9SLA9          ----RSKQLQQ---SL-GMDAGL----------------S----VAWSSP-SAQ------
A0A168TT23      ----FSQLIDQ------GRGDSI----------------R----PVVNDG-QIA------
A0A0M1JWX9      ----LYTTLRQ---QV-GLDPDV-AIAS-----------S----VLSEAP-SYQ------
A0A2T1M1V6      ----QARVAAA---QL-GMNPQH-ALNS-----------L----RLAENK-EYQ------
A0A2G7GCS2      ----QAQAASQ---RL-GINAQQ-AMNS-----------L----RLGENR-EYQ------
K9XBH8          ----QAIEASG---RL-GMNAQQ-AMNS-----------L----RLAENK-EYQ------
A0A1Z4LJ30      ----RAKMLSA---RI-EMSPST-AVNS-----------V----KLKENK-EYQ------
K9RI76          ----RVRMLSN---RI-ALSPAA-AVNS-----------V----RLKEYK-EFQ------
A0A352AE27      ----EVRTLSN---RL-GLTPDQ-AIRS-----------L----GLAENP-DYQ------
A0A3B8JH60      ----RVSVLSA---PL-SLTPDQ-AIKS-----------L----GLGENQ-NYQ------
A0A3C0N766      ----RVSVLSA---RL-SLTPDQ-AIKS-----------L----GLGENQ-NYQ------
K9W9J7          ----RIQVLSS---RL-SLTPNQ-AIRS-----------L----GLGENQ-NYQ------
A0A139WSU3      ----RAKALSI---RL-SLTPNE-AIRS-----------L----GLGENK-EYQ------
A0A433VN22      ----RSKVLSE---RI-NMAPAS-AVRS-----------L----SLSENQ-EFK------
Q7NF11          ----RAQMLTA---RL-GMDAPQ-AMRA-----------L----RLGESK-EYQ------
A0A1Z4JCS8      ----RANTLAT---RL-NLSPTD-AVQA-----------L----GLDQNE-DYK------
A0A6P0PI80      ----QLQILST---RL-GLTPKQ-AIRS-----------L----GLAENR-DYQ------
A0A6P0WGT6      ----QLQILST---RL-GLTPKQ-AIRS-----------L----GLAENR-DYQ------
F4XTX2          ----QLQILST---RL-GLTPKQ-AIRS-----------L----GLAENR-DYQ------
Q7NJN6          ----RATALEQ---AV-GMDLRR-ATAA-----------L----NLGEDK-GLQ------
U5QCC3          ----RSRSLEQ---AV-GMDLRR-ATSA-----------L----RVGEDK-EYQ------
A0A3M1SVZ4      ----RYNALQN---QL-GMNPKQAAQRT-----------V-----ISQST-TIQ------
A0A654SFI6      ---------QA---VT-DRISAEASVLS-----------G----EFPAAD-ARN------
K9SSQ0          ----QLQELQR---QV-G-RPADVAISS-----------A----ILSQDA-NYQ------
A0A2W1JIN9      ----RNLSLST---LT-NAGSINNTYTS-----------V----RTGQDP-ELQ------
A0A318AJV1      ----SASVAQG---QV-RSGNVD---AV-----------V----GVQGSN-VIR------
A0A6P0IC70      ----RLKAIEQ---LT-GFNTINNAYVG-----------G----RVGQDE-QLD------
A0A6B3MUB5      ----RLKAIEQ---LT-GFNTINNAYVG-----------G----RVGQDE-QLD------
A0A6M0B7N4      ----RLKAIEQ---LT-GFNTINNAYVG-----------G----RVGQDE-QLD------
A0A6P0J9W3      ----RLKAIEQ---LT-GFNTINNAYVG-----------G----RVGQDE-QLD------
A0A6P0ZWE1      ----RLKAIEQ---LT-GFNTINNAYVG-----------G----RVGQDE-QLD------
A0A1U7N2U4      ----RSQELQT---IT-SLNNTQNAYIA-----------G----RIGQDQ-ELQ------
A0A1D9G1F2      ----RSQELQT---IT-SLNNTQNAYIA-----------G----RIGQDQ-ELQ------
A0A6P0PNZ7      ----RSQELQT---IT-SLNNTQNAYIA-----------G----RIGQDQ-ELQ------
F4XV38          ----RSQELQT---IT-SLNNTQNAYIA-----------G----RIGQDQ-ELQ------
A0A6P0W137      ----RSQELQT---IT-SLNNTQNAYIA-----------G----RIGQDQ-ELQ------
A0A6L9Y9E2      ----RSQELQT---IT-SLNNTQNAYIA-----------G----RIGQDQ-ELQ------
A0A6P0SGR0      ----RSQELQT---IT-SLNNTQNAYIA-----------G----RIGQDQ-ELQ------
A0A6M0BK48      ----RSQELQT---IT-SLNNTQNAYIA-----------G----RIGQDQ-ELQ------
A0A6L9YZL1      ----RSQELQT---IT-SLNNAQNAYIA-----------G----RIGQDE-ELQ------
A0A6P0KYM4      ----RSQELQT---IT-SLNNTQNAYIA-----------G----RIGQDQ-ELQ------
A0A6P0LSD6      ----RSQELQT---IT-SLNNTQNAYIA-----------G----RIGQDQ-ELQ------
A0A6P0X384      ----RVESLRQ---TT-GL-NLEDAYVG-----------G----RIGQDE-ELV------
A0A2P8QIL5      ----RNSSLEQ---VT-DSSTLKNTYAT-----------V----RSGQNE-QLQ------
A0A2T1FLY5      ----RNSSLEQ---VT-DSSTLKNTYAT-----------V----RSGQNE-QLQ------
A0A433W447      ----RNSSLEQ---VT-DSSTLKNTYAT-----------V----RSGQNE-QLQ------
K9U1K8          ----RNSSLEQ---VT-DSSTLKNTYAT-----------V----RSGQNE-QLQ------
K9UYB2          ----RGESIRR---IT-DTSTLNNAYTT-----------V----RGGQDD-ELK------
A0A218QN17      ----RDASLRQ---IT-SAKSLDKAYAS-----------V----RGGQDE-QLK------
K9RKN2          ----QENSLRQ---IT-NADSLNSAYSS-----------V----RSGSDE-ELV------
A0A2I8ADV2      ----REASLRQ---LT-ATKNINNAYTS-----------V----RSGQDE-QLR------
A0A1W5CKM3      ----RDASLRQ---VT-DAKNINTAYAS-----------V----REGQDE-QLK------
A0A5Q0GMF5      ----RDASLRQ---VT-DAKNINTAYAS-----------V----REGQDE-QLK------
Q3MEW0          ----RDASLRQ---VT-DAKNINTAYAS-----------V----REGQDE-QLK------
A0A1Z4KIC7      ----RDASLRQ---VT-DAKNINTAYAS-----------V----REGQDE-QLK------
Q8YSM5          ----RDASLRQ---VT-DAKNINTAYAS-----------V----REGQDE-QLK------
A0A1Q4S1H4      ----RDSSLRQ---VT-NSSNLGNAYAS-----------V----RSGQDE-QIK------
A0A433VBU6      ----RDASLRQ---VT-NSSNLGSAYAS-----------V----RSGQDE-QIK------
A0A1Q4RZJ6      ----RLDSLRQ---VT-QSKGLDTAYES-----------V----RGGQDQ-ELQ------
A0A1Z4SNV3      ----RGESLRQ---IT-QAKGLDRAYES-----------V----RSGQDQ-ELQ------
A0A2H2XJQ1      ----RGESLRQ---IT-QAKGLDRAYES-----------V----RSGQDQ-ELQ------
A0A3S5K358      ----RLDSLRQ---VT-QAKGLDTAYES-----------V----RGGQDQ-ELQ------
A0A0T7BPJ4      ----RAASLEK---IT-KTTSLDKAYSA-----------V----RTGQDE-EVK------
A0A0C1QS61      ----QDASLRQ---IT-NATALKSAYAS-----------V----RGGQDE-QLK------
A0A139X3R8      ----QDASLRQ---IT-NSTAVKSAYAS-----------V----RGGQDE-QLK------
A0A1Z4I7C5      ----RDASLRQ---VT-DAKNITAAYAS-----------V----REGQDE-QLK------
A0A0C2MDK7      ----KDASLGQ---IT-NAGNLNNAYSS-----------V----RSGQDD-EIK------
A0A1Y0RCK1      ----RDVSLRQ---IT-NTENLNNAYSS-----------V----RSGQDE-EIK------
A0A1Z4PWZ0      ----RDASLRQ---IT-DSATLNKAYSS-----------V----RSGQDD-EIK------
A0A0C2QLT0      ----RDASLRQ---IT-NTENLNKAYSS-----------V----RSGQDD-EIK------
A0A1Z4J2K1      ----RDASLRQ---IT-DAGNLNKAYSS-----------V----RSGQDD-EIK------
A0A3S0ZSX0      ----KEVSLRQ---VT-DAKALDQAYAS-----------V----RGGQNE-ELK------
A0A2N6K4T3      ----KEASLQQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A370CKT2      ----KEASLQQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A0S3TL97      ----KEASLQQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A2N6M8A0      ----KEASLQQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A2N6M9E1      ----KEASLQQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A2N6KJI4      ----KEASLQQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A2N6MZ77      ----KEASLQQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A2N6KT20      ----KEASLQQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
G6FSN3          ----KEASLQQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A4D9CI02      ----KEGSLRQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A328I8B9      ----KEGSLRQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A4Q9J4Z7      ----KEGSLRQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A0M0SU69      ----KEASLRQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A1Z4TIZ8      ----KEASLRQ---VT-DAKALNQAYAA-----------V----RGGQDE-ELK------
A0A0S3TYD7      ----KVNALKN---QV-GTSNEI-GVAQ-----------V----ALSQST-GVQ------
A0A2T1DNG3      ----RYGDLQQ---KV-NLSPQQ-AVLT-----------A----RLNQSG-RYQ------
A0A3S0Y9N9      ----KMKSIKQ---LF-GVNSQE-AVVA-----------G----FASESP-STS------
A0A433UNK7      ----RMQSIQK---LF-GVASQD-AVVA-----------G----FVGESP-STV------
A0A6P0ZKB8      ----RMQSIKK---IF-GVTSQD-AVLS-----------G----FVGESP-STT------
U5QL42          ----QYSELRAQ---V-GEDPDI-ALSM-----------T----ILSQDP-TYT------
A0A076HBF2      ----VRGEIASGTLTA-RGFQEA-IGQNNGGG----QANS----GLTVSD-VDQ------
A0A354B169      ----VRAEISSGRLSA-RGFQEA-ISTGSGGS-SSDNSGK----GLSVGD-VDQ------
G4FMX5          ----VREEIANGTLTA-RGFQEA-IG-GMGNGLTAGGGVQ----GLTISD-VDQ------
Q0IDT5          ----VRQDIASGSLSA-RGFQEA-ISTGSGGVVTGNQQSQ----GLAVSD-ADQ------
A0A2D6FCW3      ----VRQEIANGTLTA-RGFQEA-IG-GLGNGTTAGGDVQ----GLTISD-VDQ------
A3ZA21          ----VRAEIAAGTLSA-RGFQEA-ISTGSGGG---GQSAQ----GLSVSD-ADQ------
A0A140K3H3      ----QYQEINRQLRDL-GQNPET-IVAY-----------T----LLSQDQ-VYQ------
K9XUB8          ----RYEEINRQLREL-GQNPET-IVAY-----------T----LLSQDQ-VYQ------
A0A6H2NHD5      ----LYNALQDQ---V-GFQPST-AIRV-----------A----NLSESP-TYQ------
A0A2P8W4F7      ----LYDSLRDQ---V-GFDPDT-AIRV-----------A----NLNESP-TYQ------
A0A5Q4E0Z4      ----LYENLRRQ---V-GFEPTV-AIGV-----------A----NLNESP-TYQ------
A0A2P8VVX1      ----QYATLEQQ---L-NLSPQS-GVIA-----------A----RLSQSP-RIQ------
A0A2P8WHY0      ----RYQTLEQR---T-QLSPAN-ALLA-----------A----RLSQSQ-RVQ------
A0A2T1CMT9      ----SSSALQEQ---L-GVSVEN-ALAL-----------S----RLSQSP-RYQ------
A0A563VQJ3      ----QTKAMQSQ---L-GLNLQQ-AIAA-----------N----QLGNTP-AVK------
A0A1D8TX52      ----RYEAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A1D9G4T2      ----RYEAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6P0PR27      ----RYQAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6P0WER7      ----RYQAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
F4XP71          ----RYQAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6L9YR57      ----RYEAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6P0KZ31      ----RYQAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6P0LPB8      ----RYQAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6P0SEV1      ----RYQAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6B3N2I8      ----RYQAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6M0B891      ----RYQAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6P0IJQ1      ----RYQAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6P0J8J8      ----RYQAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6P0ZSH6      ----RYQAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A1U7N5X9      ----RYEAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6L9Z1V0      ----RYQAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6P0LC12      ----RYEAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A6P0MVJ3      ----RYEAVQQK---L-ARSPQN-ALTS-----------S----RLSQSG-RYQ------
A0A2W6ZAV2      ----MASAVGSG---M-LTGPQV-QGSAGDPGSGSQDKPA----QGTMTT-TTS------
K9W742          ----SYNTLQQQ---V-ARSPQD-ALVS-----------S----RLSQST-RYQ------
A0A3D1PBA3      ----RYNALQQQ---L-ARSPQQ-ALAA-----------S----RLSQSS-RYQ------
K9XPB0          ----NYRQLQQE---L-GLSAEN-SVAM-----------T----RLNQSS-QYQ------
A0A350Y7Z1      ----RYRVLQQQ---L-ERSPQE-ALTS-----------S----RLSQSP-RYQ------
A0A352X2A7      ----RYNSLQKQ---L-NRSTSE-ALTS-----------S----RLSQSP-RYQ------
A0A0D8ZYV0      ----RYRVLQQQ---V-GSTPQV-ALSS-----------S----RLSQSP-RYQ------
A0A2T1FP73      ----RYGQLQQQ---L-ARSPQQ-ALVA-----------S----RLSQSS-RYQ------
A0A433VMS2      ----RYGQLQQQ---L-ARSPQQ-ALVA-----------S----RLSQSS-RYQ------
K9TYA7          ----RYGQLQQQ---L-ARSPQQ-ALVA-----------S----RLSQSS-RYQ------
A0A2P8QUE1      ----RYGQLQQQ---L-ARSPQQ-ALVA-----------S----RLSQSS-RYQ------
K9SA61          ----QFASLQRQ---L-GRSPQA-ALLA-----------S----RLSEST-RYQ------
A0A2G7GMH8      ----RLHNLQQQ---L-ARTPRN-ALVS-----------S----RLSQSQ-RYQ------
A0A6N8FU92      ----RLNDLQQQ---I-ARSPRN-ALVS-----------S----RLSQSQ-RYQ------
A0A2T1DWE8      ----RYQTLQQE---L-ALSPQQ-ALIA-----------A----RLSQSS-RYQ------
A0A1U7I8L3      ----RFQTLQQQ---V-KRSPQD-AVVS-----------S----RLSEST-RYQ------
A0A2T1DJL8      ----RYGALQQQ---L-ARSPQQ-ATIA-----------A----RLSQSP-RYQ------
A0A1Z4J9W0      ----KFIALQQQ---L-QRSPGQ-ATVA-----------A----RLSQSK-QYQ------
A0A0N7Z5K9      ----RFLALQQQ---L-ARSPEQ-ATIA-----------S----RLSQSN-QYQ------
A0A0S3TXC5      ----RFSALQQQ---L-ARSPEQ-ATIA-----------S----RLSQSR-QYQ------
B8HNB0          ----QLEEVNQQLADL-KVNPSQ-AVPI-----------S----VLLQDS-NYQ------
A0A563VS48      ----RYSALNS---QL-GISWEK-ASAI-----------A----TLSQSL-AVQ------
A0A318BJ18      ------ERIQA---EARSQQGGRAGASA-----------E----ALRN------------
A0A3B8Y8H9      ----RYRNLQQ---QL-AMGEQE-AIDL-----------T----ALSESP-RYM------
A0A2W1JVB9      ----QSDSLRK---QL-GIDKQK-SIAS-----------T----TLSQSP-GVQ------
A0A6H1U102      ----QYAELRRQMVAA-GQNPDT-ALVN-----------S----MLAEDS-VYQ------
A0A7C3ZEJ3      ----KYQELRLQVSKA-GQNPDA-ALPA-----------A----ILSQDT-VYQ------
A0A563VLD6      ----KYQELYFQLQQL-GQEPDT-ILAS-----------T----VLSQDG-VYR------
A0A2P8W9H0      ----LYQELQQ------TLNNDGELAAN-----------S----ALLNSN-RYQ------
A0A6I5P386      ----IYQDLQQ------ELARGEELAST-----------S----ALLENE-RYQ------
A0A318BG22      ----ANRILAE---QAWNLARSPRADSL-----------P----EVRDNV-QIA------
A0A2T1E9V8      ----RSKGIQQ---KL-GMSPQE-AIVT-----------A----SVSQSS-AVQ------
A0A1Z4LN32      ----QEKEVSS---QL-NLPLNK-AVDI-----------S----SLSQVK-GVQ------
A0A2I8A9F5      ----REKQILN---QI-NLPADQ-AVDI-----------S----SLSQAA-GVQ------
A0A218Q6R8      ----QEKQIIG---QL-NLPAEQ-ALAI-----------T----SLSQES-GVQ------
A0A218QGE0      ----QEIQIRR---QM-NLRVDR-AVDI-----------T----SLSQVP-RVQ------
A0A3M2GQQ6      ----LYAELRSQMVEA-GQNPDT-ALVH-----------S----LLSQDS-VYQ------
A0A6H1U2X0      ----LYAELRSQMVEA-GQNPDT-ALVH-----------S----LLSQDS-VYQ------
K9TLQ0          ----LYGKLRG---QL-GLELEQ-AMLA-----------T----SLSDSP-RYQ------
K9QF04          ----TIKDLQQ---QL-GIDFKQ-AVAL-----------S----VLGEDP-NYL------
K9W1T3          ----RVQGLQQ---LF-GNDLNA-TVVA-----------A----SVGESP-TTQ------
K9SGJ5          ----QFKELQR---QV-GGSTDL-VLGK-----------A----ILAEDI-TYQ------
A0A6N2JS94      ----QYEALSR---QV-GKSPEA-AIGS-----------A----ILQQDA-PYQ------
A0A6C2DSN4      ----QYEALSR---QV-GKSAES-AIGG-----------A----ILQQDP-TYQ------
L8MYT6          ----QYEALSR---QV-GKSAES-AIGG-----------A----ILQQDP-TYQ------
A0A352JGJ6      ----QYKSLSR---QV-GKSPDA-AISG-----------V----ILQQDT-PYQ------
A0A1J5GLS2      ----QFEILSR---QV-GKTPDA-AISG-----------A----ILQQDI-PYQ------
A0A2W4W6M5      ----QYKALSR---QV-GKSPDA-AIGG-----------A----ILQQDI-PYQ------
A0A2W7AN33      ----QYEVLSR---QV-GKSPEA-AISS-----------A----ILQQDA-PYQ------
A0A256BLV2      ----QYEALSR---QV-GKSPEA-AIGS-----------A----ILQQDT-PYQ------
A0A2W6ZXF3      ----QFEILSR---QV-GKTPDA-AIGS-----------A----ILQQDV-PYQ------
A0A2Z5WX66      ----QYKSLSS---QV-GKSPNA-AISS-----------A----ILQQDT-PYQ------
K1XF69          ----LVNSLGN---QV-GLNLEE-AIAV-----------N----TLSQSP-VVR------
B5W297          ----LVNSLGN---QV-GLNLEE-AIAV-----------N----TLSQSP-VVR------
A0A6H2AL05      ----LVNSLGN---QV-GLNLEE-AIAV-----------N----TLSQSP-VVR------
H1W7M8          ----LVNSLGN---QV-GLNLEE-AIAV-----------N----TLSQSP-VVR------
A0A5Q4H6A5      ----LVNSLGN---QV-GLNLEE-AIAI-----------N----TLSQSP-VVR------
D5A466          ----LVNSLGN---QV-GLNLEE-AIAV-----------N----TLSQSP-VVR------
U5QJM6          ----QYLALAS---RL-GSSPEQ-ALAA-----------A----TLSEDK-IYQ------
A0A1Z4RPC6      ----QTESLQN---QL-GLDLKQ-AIAA-----------N----QLGSTP-QVQ------
A0A2T1CMZ0      ----QTDSLQN---QL-GLNLKQ-AIST-----------V----QLGNTP-QVQ------
L8M4F7          ----QTDALQA---KI-GLSLEQ-AIAA-----------D----QLGSTP-VVK------
A0A140K2P2      ----QSEALQS---QL-NLNLNQ-AIAA-----------N----QLGASP-VVD------
K9XWX4          ----QSEALQS---QL-NLNLNQ-AIAA-----------N----QLGASP-VVD------
A0A140KB14      ----QTATLNQ---QL-GLNLNQ-ALAA-----------N----QLGGTP-VVE------
K9XX88          ----QTATLNQ---QL-GLNLNQ-ALAA-----------N----QLGGTP-VVE------
A0A563VSV6      ----QTASLQK---QL-GLSLNQ-AIAV-----------S----QLGNSP-TVQ------
L8LZE9          ----QTGALSQ---EL-GLSLEQ-AISA-----------N----QLGRTP-IVQ------
A0A433NM31      ----RSAALQR---EI-GINVEQ-AKVI-----------N----ALSQSA-GVQ------
A0A1Z4NDS1      ----RVKTLQE---QA-NINSQQ-AITS-----------S----SLSQIP-GIQ------
U9VXM0          ----QASQLQQ---KL-KLSSQE-AYAV-----------G----LVSESP-GIQ------
A0A6M0RI13      ----QASQLQQ---KL-KLSSDE-AYAV-----------G----LVSESP-GIQ------
A0A6M0S1N5      ----QASQLQQ---KL-KLSSDE-AYAV-----------G----LVSESP-GIQ------
K9F4D9          ----QASQLQQ---KL-KLSSDE-AYAV-----------G----LVSESP-GIQ------
A0A6I5QPI5      ----QLGQLRG---QL-GVNVSE-GIAL-----------S----SLNQSE-GVQ------
A0A1Z3HMQ0      ----RTGELRR---QL-GIPLAQ-ARQV-----------D----SLSQSP-GVQ------
A0A433W533      ----KLAKLRQ---QV-GMDTDT-SLNL-----------N----ALNQAR-GVQ------
A0A2P8QWJ3      ----KLAKLRQ---QV-GMDTDT-SLNL-----------N----ALNQAR-GVQ------
A0A2T1FKP8      ----KLAKLRQ---QV-GMDTDT-SLNL-----------N----ALNQAR-GVQ------
K9U6L7          ----KLAKLRQ---QV-GMDTDT-SLNL-----------N----ALNQAR-GVQ------
A0A1E5QP61      ----RSQALQS---QM-GLNPQQ-ALAI-----------N----TLSQSA-AIQ------
U5DPF5          ----RIQELSA---QL-GLSSAE-ALAA-----------S----ALTQSR-AVR------
A0A6P0X488      ----RSAALQA---KL-GLNSQQ-ALAI-----------S----SLSQSR-AVQ------
A0A6P0UVD5      ----RSAALQG---KL-GLNSQQ-ALAL-----------S----SLSQSR-GVQ------
A0A6P0VDM0      ----RSAALQG---KL-GLNSQQ-ALAL-----------S----SLSQSR-GVQ------
A0A6M0G142      ----RSSALQA---QL-GLNAEQ-ALAL-----------N----SLSQSR-AVQ------
A0A6P0MR53      ----RSTALQG---KL-GLNAQQ-ALAI-----------S----SLSQSR-AVQ------
A0A3M2GIL5      ----RSAALQQ---QM-GLNSAQ-AIAL-----------G----AIGESM-AVQ------
A0A6H1TSJ9      ----RSAALQQ---QM-GLNSAQ-AIAL-----------G----AIGESM-AVQ------
A0A3M1PML8      ----RLSQLQG---RV-GADPRR-ATVI-----------A----ALSQSP-GVQ------
A0A6M8BE85      ----RLAQLQG---RV-GADPRR-ATVI-----------A----ALSQSA-GVQ------
A0A0T7BPZ0      ----QLDKLRS---QA-KIDTWQ-AVTL-----------T----ELSKEP-RTQ------
A0A352X442      ----QTETLRS---QV-GLNSKT-AVAV-----------N----SLNQSA-GVN------
A0A6B3NF44      ----RSTQLRN---QL-QLNSQQ-AVAL-----------S----SLSQSP-AVQ------
A0A6M0EPL4      ----RSTQLRN---QL-QLNSQQ-AVAL-----------S----SLSQSP-AVQ------
A0A6P0K6L6      ----RSTQLRN---QL-QLNSQQ-AVAL-----------S----SLSQSP-AVQ------
A0A6P0MRR9      ----QVSELQQ---QL-DLTPEE-ALSA-----------S----FLSQST-EVK------
A0A6P0UX57      ----QVAEVEQ---QL-GLSPEE-AVAA-----------S----TLSQST-PVK------
A0A6P0X1X4      ----QVAEVEQ---QV-GLSPEE-AVAA-----------S----TLSQST-VVQ------
A0A0M0SHU3      ----RLEKLQN---QA-RVNSQE-AISA-----------V----DLSQVA-GTQ------
A0A1D2PBN3      ----RSQKLQN---QA-KIDSQQ-GVTF-----------T----SLSQTP-GIQ------
A0A0C2LVR7      ----KSQKLQN---QA-KIDSQQ-GVTF-----------T----SLSQTP-GIQ------
A0A1Z4PQB9      ----RSQKLQN---QA-KIDSQQ-GVTF-----------T----SLSQTP-GIQ------
A0A1Z4SFN6      ----KSQKLQN---QG-SIDSPQ-SVTF-----------A----SLSQIP-GIQ------
K9PGI8          ----RTKKLQK---QA-NVNSQQ-AVTL-----------A----SLSQIP-GVQ------
Q7NEU3          ----HYWALSE---RL-GISPGQ-ALAS-----------A----TLSKDG-PYQ------
A0A3C0N2P0      ----LYTELQTQLSQL-GVTPNQ-AIAS-----------S----ALSEAP-RYQ------
A0A6P0JR04      ----LYDKLKS---QL-EVDLDT-AMTA-----------T----ALSQAP-RYQ------
A0A6B3M6M6      ----LYSRLQT---QL-GLSTEQ-ALAA-----------A----TLSEAP-RYQ------
A0A6P0KD09      ----LYSRLQT---QL-GLSTEQ-ALTA-----------A----TLSEAP-RYQ------
A0A6B3NIJ0      ----LYSRLQT---QL-GLSTEQ-ALTA-----------A----TLSEAP-RYQ------
A0A6M0F053      ----LYSRLQT---QL-GLSTEQ-ALTA-----------A----TLSEAP-RYQ------
A0A6P2ATU9      ----LTQTLQ---GQL-DLDLNQ-AMVV-----------A----ALSEAP-RYQ------
A0A352XE00      ----LYNQLESQLAEL-GVSPDR-AIAA-----------S----ALSEAP-RYQ------
A0A6P0QC14      ----LYVELQSQLGQL-GVTPDQ-AIAA-----------T----ALSEGP-RYQ------
B4VS56          ----LAVQLQSQLGEL-GLSPKQ-AIAA-----------S----ALSEAP-RYQ------
A0A352AAQ3      ----LYTELQDQLGQL-GVTPDQ-AIAA-----------A----ALSEAP-RYQ------
A0A350Y472      ----LYAELQTQLGQL-GVTPDG-AIAA-----------S----ALSEAP-RYQ------
A0A355DVB4      ----LYAELQTQLGQL-GVTPDG-AIAA-----------S----ALSEAP-RYQ------
A0A1Z4RMB9      ----QTAALEG---QL-GLNLNQ-AVAA-----------N----QLGASP-EVQ------
A0A318B4H2      ------------------------AVRA-----------A----SVSPNS-ASQ------
B4WQE3          ----LYNDLQQ---EL-SRIDNE-YAST-----------S----ALAQSA-RYQ------
A0A2K3BR24      ----RLEKLTE---QL-GLPPEQ-ALAA-----------G----ALSQSE-AVQ------
K9YXY1          ----RLEKLTE---QL-GLPPEQ-ALAA-----------G----ALSQSE-AVQ------
A0A0V7ZFJ4      ----RSEGLQK---QL-QLETQE-AVAI-----------S----TLNQSP-IVQ------
A0A0V7ZNJ9      ----RSQALQR---EL-DIEKQK-AVEL-----------S----ELSQSP-AVQ------
A0A367RIS1      ----RSGALQN---QL-ALNTKQ-AMAL-----------S----TLSQSR-AVQ------
A0A235IXQ2      ----RSGALQN---QL-ALNTQQ-AMAL-----------S----SLSQSR-AVQ------
A0A1W5CNX3      ----RSGALQN---QL-ALNTKQ-AMAL-----------S----SLSQSN-AVQ------
A0A5Q0GJJ5      ----RSGALQN---QL-ALNTKQ-AMAL-----------S----SLSQSN-AVQ------
Q3MEB7          ----RSGALQN---QL-ALNTKQ-AMAL-----------S----SLSQSN-AVQ------
A0A1Z4KHN9      ----RSGALQN---QL-ELNTKQ-AMAL-----------S----SLSQSN-AVQ------
Q8YT70          ----RSGALQN---QL-ELNTKQ-AMAL-----------S----SLSQSN-AVQ------
A0A166IWU6      ----RSDALQN---QL-ALNTQK-ATAL-----------S----TLSQSR-AVQ------
A0A2S0Q8C0      ----RSDALQN---QL-ALNTQK-ATAL-----------S----TLSQSR-AVQ------
W6FSX4          ----RSDALQN---QL-ALNTQK-ATAL-----------S----TLSQSR-AVQ------
A0A218Q4C1      ----RSSALQN---QL-QLNTEQ-ATAL-----------S----TLSQSR-AVQ------
A0A6P1ZT04      ----RSGALQN---QL-ELNTEQ-ATAL-----------S----TLSQSR-AVQ------
A0A0R0M9H9      ----RSLALQN---EL-QLSTQQ-AVAL-----------S----NISQIP-GVQ------
A0A1S1ZVW2      ----RSLALQN---EL-QLSTQQ-AVAL-----------S----SLSQIP-GVQ------
A0A1B7WX82      ----RSLALQY---EM-KLDTRQ-AVDL-----------S----TLSQSP-GVQ------
A0A1B7WTD1      ----RSVALQN---EM-KLTTQQ-AVDL-----------S----SLSQSP-GVQ------
A0A480ABC0      ----RSVALQN---EM-KLTTQQ-AVDL-----------S----SLSQSP-GVQ------
A0A1Z4LRU5      ----RSEALQN---QL-KLQPQQ-AVAL-----------S----SLSQSP-AVQ------
A0A1Z4JVB4      ----WSVGLQD---QM-ALSTKQ-AVEL-----------T----TLSQSP-GIQ------
K9PIA4          ----RSLALQN---QI-ELNTNQ-AVAL-----------N----TLNESP-GIQ------
A0A1Z4HVE1      ----RTQALQN---QI-ALNTQQ-AVEL-----------S----TLSQSP-GVQ------
A0A252ECZ1      ----RTRALQS---QM-ALNTQQ-AVEL-----------S----TLSQSP-GIQ------
A0A1Z4G5Y1      ----RTKALQS---QI-ALNTQQ-AVEF-----------S----TLSQSP-GIQ------
A0A252DNA2      ----RTRALQS---QI-ALNTQQ-AVEL-----------S----TLSQSP-GIQ------
A0A252E1Q4      ----RTRALQS---QI-ALNTQQ-AVEL-----------S----TLSQSP-GIQ------
A0A6G9SK36      ----RSQSLQN---QM-QLSSEK-AVEL-----------T----TLSQSP-AVQ------
A0A1Z4M597      ----RSLALQN---QM-KLNTDT-AVEL-----------T----TLSQSP-GVQ------
A0A1Z4MWT1      ----RSLALQN---QM-KLNTDT-AVEL-----------T----TLSQSP-GVQ------
A0A1Z4TX53      ----RSLALQN---QM-KLNTDT-AVEL-----------T----TLSQSP-GVQ------
A0A5P8VSD1      ----RSGALQN---QL-ALSTQQ-AMAL-----------T----SLSQSI-AVQ------
A0A2A2TNQ5      ----RSGTLQK---QL-DLTTQK-AVEL-----------S----TLSQTP-GIQ------
A0A3S1C4K5      ----RSVALQK---EL-ELTTQQ-AVEL-----------A----NLNQST-GVQ------
A0A1X4G3D5      ----RSSALQN---EL-QLNKQQ-AVLV-----------S----TLSQIP-GVQ------
D4TNI2          ----RSSALQN---EL-QLNKQQ-AVLV-----------S----TLSQIP-GVQ------
A0A1Z4H6Z8      ----RSVALQS---QM-ELNPHQ-AVEL-----------S----TLSQSP-GIQ------
A0A1Z4NPM1      ----RVQTLQN---QL-ELNRQQ-AVEL-----------S----TLNQSQ-GVQ------
A0A3F3KPR9      ----RSLALQN---EL-QLTTQQ-AVAL-----------S----NISQIP-GVQ------
D4TGN7          ----RSLALQN---EL-QLTTQQ-AVAL-----------S----NISQIP-GVQ------
A0A1Z4UZW9      ----RSVALQN---EM-KLGTQQ-AVDL-----------S----SLSQSP-GVQ------
A0A0K2M5H0      ----RSVALQN---EM-KLGTQQ-AVDL-----------S----TLSQSP-GVQ------
A0A1B7VSH4      ----RSVALQN---EM-KLDRQQ-AVDL-----------S----TLSQSR-GVQ------
A0A1B7W126      ----RSVALQN---EM-KLDRQQ-AVDL-----------S----TLSQSR-GVQ------
A0A3D4C6Q6      ----RSVALQN---EM-KLDRQQ-AVDL-----------S----TLSQSR-GVQ------
A0A1B7UVJ4      ----RSLALQY---EM-KLDTRQ-AVDL-----------S----TLSQSP-GVQ------
A0A1B7UTR1      ----RSVALQD---KM-KATTQE-AVDL-----------S----ALSQSP-GVQ------
K7W0A4          ----RSVALQY---EM-KSTTQE-AVDL-----------S----ALSQSR-GVQ------
A0A5C0DRW9      ----RSVALQD---KM-KSTTQE-AVDL-----------S----ALSQSP-GVQ------
A0A6H2C088      ----RSVALQD---KM-KSTTQE-AVDL-----------S----ALSQSP-GVQ------
A0A1Q4RTR1      ----KIISLQN---QL-GLNSQK-AIAL-----------N----ALSQSK-AVQ------
A0A1Z4SQV2      ----QIQALQN---QL-SLNSRQ-AVAL-----------N----TLSQST-AVQ------
A0A2H2XGN1      ----QIQALQN---QL-SLNSRQ-AVAL-----------N----TLSQST-AVQ------
A0A433UXH8      ----QIQALQN---QL-GFNSRT-AVAL-----------Y----SLSQST-AVQ------
A0A1U7HGH0      ----RTQSLQR---QL-GMNPQQ-AMTI-----------A----TISQSS-AIQ------
K9XJD3          ----RAQSLQR---QL-GMTPQQ-AMTI-----------A----KISQSS-AIQ------
K9SX01          ----EINDIRT---RL-GFTSEQ-AIIL-----------T----KLSASK-PVQ------
A0A4P7ZT55      ----LQASVRR---GQ-LFSPQFQGASG-----------VSGGGGLKPAT-GADLSGALA
A0A1E5QIR9      ----RVAALRS---QT-GIDSQQ-AIAL-----------S----ALSQSE-GVQ------
A0A1Z4IBC7      ----RLEQLRA---QA-QVNSQQ-GVIA-----------S----ELSQAP-GVQ------
A0A1W5CPC7      ----RLEQLRA---QA-QVDSQQ-GVIA-----------S----ELSQAP-GVQ------
A0A5Q0GKD1      ----RLEQLRA---QA-QVDSQQ-GVIA-----------S----ELSQAP-GVQ------
Q3MDC6          ----RLEQLRA---QA-QVDSQQ-GVIA-----------S----ELSQAP-GVQ------
A0A1Z4KM73      ----RLEQLRT---QA-QVDSQQ-GVIA-----------S----ELSQAP-GVQ------
Q8YNX7          ----RLEQLRT---QA-QVDSQQ-GVIA-----------S----ELSQAP-GVQ------
A0A367R4K6      ----RLEQLRA---QA-QVNSQQ-GVIA-----------S----ELSQAP-GVQ------
A0A1E2WSV8      ----RLEQLRS---EA-QVDSQQ-GVIA-----------S----DLSQAP-GVQ------
A0A2R5FRT9      ----RLEQLSS---EA-KIDSKQ-GVIA-----------S----ELTQAP-GVQ------
A0A2K8T1B6      ----RLEQLRS---EA-KIDSQQ-GVIA-----------S----ELTQAP-GVQ------
A0A235I9I0      ----RLEQLSS---EA-QVDSRQ-GVIE-----------S----ELSQAP-GVQ------
A0A2D0HQT8      ----RLEQLSS---EA-QVDSRQ-GVIE-----------S----ELSQAP-GVQ------
A0A2L2NU95      ----RLEQLSS---EA-QVDSRQ-GVIE-----------S----ELSQAP-GVQ------
A0A367S084      ----RLEQLSS---EA-QVDSRQ-GVIE-----------S----ELSQAP-GVQ------
A0A6P1A9A0      ----LSVRLSE---QL-GLEMNE-AITA-----------S----ALSAAP-RYQ------
A0A1Z4SMD6      ----QETQLRS---QL-NIAQNQPVVEI-----------A----SLNQIP-GVQ------
A0A2H2Y096      ----QETQLRS---QL-NIAQNQPVVEI-----------A----SLNQIP-GVQ------
K9S8M8          ----RSGQLQR---SL-GMDARQ-AIAM-----------N----AVGESP-AVQ------
A0A1Z4NFV0      ----QMGQLRS---QM-NISSEQ-AVDI-----------S--------TP-GVQ------
A0A3M9ZEU1      ----RSSALRN---QL-GMDSRQ-AALL-----------A----SLSQTP-GVQ------
A0A1Z4JK72      ----QEQVVRD---QL-GLETGQ-AIDL-----------A----SLSQSP-GVQ------
A0A0N7Z489      ----QERAVAD---QL-GLELGQ-AIDL-----------A----SLSQSA-GVQ------
A0A0S3TXS2      ----QERAVAD---QL-GLELGQ-AIDL-----------A----SLSQSA-GVQ------
A0A2A2TPF8      ----QQTELRS---QL-KIKSDR-AVDV-----------A----SLSLIP-GVQ------
A0A1Z4R0P8      ----QYQELRS---QV-KIPSET-AVDV-----------A----SLSLIP-GVQ------
A0A0T7BUI3      ----QESQVGN---QI-KTVKNQ-AIEI-----------T----SLNQIP-GVQ------
A0A1Z4LP32      ----QESRVAS---KL-DFSTNE-AVEI-----------T----SLNQIS-GVQ------
K9REP9          ----QESQLAS---KL-DFSANQ-AVEI-----------T----SLNQIS-GVQ------
A0A1Z4SIJ3      ----QEALIAS---QL-NMQSKE-AVEV-----------A----SVSQMS-GVQ------
A0A2H2XPG4      ----QEALIAS---QL-NMQSKE-AVEV-----------A----SVSQMS-GVQ------
K9V3C7          ----QQAEVRL---SA-NIPRDR-TVTQ-----------TVNVSSLSVNP-GVQ------
A0A1Z4T6Y7      ----QQAELRA---QI-KIPSNE-AVDR-----------T----SLSLIP-GVQ------
A0A2H2Y561      ----QQAELRA---QI-KIPSNE-AVDR-----------T----SLSLIP-GVQ------
A0A1Q4S362      ----QQAELRS---QI-KIPSSE-AVDR-----------T----SLSLIP-GVQ------
A0A3S1CIN8      ----QQAELRS---QI-KIPSSE-AVDR-----------T----SLSLIP-GVQ------
A0A2A2TC28      ----QETELKK---QL-NLVGEE-AVNI-----------T----SLSQIP-GVQ------
A0A0C1NCB0      ----EQAKVLN---QL-KLAGQD-AVEI-----------T----SLNQIP-GVQ------
A0A2N6K7Q9      ----QEQQIAS---QL-NVSENQ-AVTV-----------T----SLSQIP-GVQ------
A0A2N6MXH6      ----QEQQIAS---QL-NVSENQ-AVTV-----------T----SLSQIP-GVQ------
A0A2N6M5A8      ----QEQQIAS---QL-NVSENQ-AVTV-----------T----SLSQIP-GVQ------
A0A2N6LL61      ----QEQQIAS---QL-NVSENQ-AVTV-----------T----SLSQIP-GVQ------
A0A0S3TP66      ----QEQQIAS---QL-NVSENQ-AVTV-----------T----SLSQIP-GVQ------
G6FP91          ----QEQQIAS---QL-NVSENQ-AVTV-----------T----SLSQIP-GVQ------
A0A1U7GYR5      ----QEQQIAS---QL-NVSENQ-AVTV-----------T----SLSQIP-GVQ------
A0A2N6KY52      ----QEQQIAS---QL-NVSENQ-AVTV-----------T----SLSQIP-GVQ------
A0A2N6KMP5      ----QEQQIAS---QL-NVSENQ-AVTV-----------T----SLSQIP-GVQ------
A0A2N6MA45      ----QEQQIAS---QL-NVSENQ-AVTV-----------T----SLSQIP-GVQ------
A0A4Q9J9V9      ----QEAQIAS---QL-NVSENQ-AVTV-----------A----SLSQIP-GVQ------
A0A328IGA1      ----QEAQIAS---QL-NVSENQ-AVTV-----------A----SLSQIP-GVQ------
A0A4D9CE41      ----QEAQIAS---QL-NVSENQ-AVTV-----------A----SLSQIP-GVQ------
A0A0M0SFT2      ----QEAQIAS---QL-NVSENQ-AVTV-----------A----SLSQIP-GVQ------
A0A1Z4TLC8      ----QEAQIAS---QL-NVSENQ-AVTV-----------A----SLSQIP-GVQ------
A0A0C2LFH0      ----QEEKIRS---QL-NLAGSQ-AVEI-----------T----SISQIP-GVQ------
A0A1Z4IYV4      ----QEAKMNS---QL-NLAGDQ-AVEV-----------T----SISQIP-GVQ------
A0A1Z4Q0T6      ----QEAKMNS---QL-NLAGDQ-AVEV-----------T----SISQIP-GVQ------
A0A0C2PT44      ----QEAKINT---QL-NLAGDQ-AVEV-----------A----SISQIP-GVQ------
A0A1D2P6J4      ----QEAKINT---QL-NLAGDQ-AVEV-----------T----SISQIP-GVQ------
B4WP72          ----RLLELRR---QL-GMELET-AIEL-----------N----TLSQSP-GVQ------
A0A2T1CIL7      ----RFEQLRS---QL-NISWEE-AVAI-----------S----SLSQS--AVP------
A0A433V7A0      YYQILQNQIQS---QI-GMSVQD-ALAR-----------S----TLSQSA-GVQ------
A0A2T1FTR8      ----RLEGLKN---LFGGRDAQA-TIQS-----------G----LVSESP-GLQ------
K9UA41          ----RLEGLKN---LFGGRDAQA-TIQS-----------G----LVSESP-GLQ------
A0A0C2LBE2      ----RSQKLQN---QA-KIDSQQ-TVTN-----------S----SLTQAS-GIQ------
A0A433NN38      ----QSQKLKE---QI-EVESQK-AITY-----------A----ELSQIP-GTQ------
A0A2N6K0T2      ----RLEKLQT---QA-RVNSQE-AVSA-----------V----NLSQVP-GTQ------
A0A2N6ML72      ----RLEKLQT---QA-RVNSQE-AVSA-----------V----DLSQVP-GTQ------
G6FQZ6          ----RLEKLQT---QA-RVNSQE-AVSA-----------V----DLSQVP-GTQ------
A0A2N6MQX9      ----RLEKLQT---QA-RVNSQE-AVSA-----------V----DLSQVP-GTQ------
A0A2N6KXT6      ----RLEKLQT---QA-RVNSQE-AVSA-----------V----DLSQVP-GTQ------
A0A2N6KGB9      ----RLEKLQT---QA-RVNSQE-AVSA-----------V----DLSQVP-GTQ------
A0A2N6L3Y5      ----RLQKLQT---QA-RVNSQE-AVSA-----------V----DLSQVP-GTQ------
A0A0S3TIS7      ----RLEKLQT---QA-RVNSQE-AVSA-----------V----DLSQVP-GTQ------
A0A1U7GW28      ----RLEKLQT---QA-RVNSQE-AVSA-----------V----DLSQVP-GTQ------
A0A2N6LW63      ----RLEKLQT---QA-RVNSQE-AVSA-----------V----DLSQVP-GTQ------
A0A328IH74      ----RLEKLQN---QA-RVSSQE-AVSA-----------V----DLSQVA-GTQ------
A0A4D9CIB0      ----RLEKLQN---QA-RVSSQE-AVSA-----------V----DLSQVA-GTQ------
A0A1Z4TQ63      ----RLEKLQN---QA-RVNSQE-AVSA-----------V----DLSQVA-GTQ------
A0A4Q9J8G2      ----RLEKLQN---QA-RVNSQE-AVSA-----------V----DLSQVA-GTQ------
A0A350Y0P6      ----TATELQD---KL-GLNSQQ-AIAL-----------N----KLNQSR-AVQ------
A0A352X940      ----RSIAIQN---QL-NLNENE-AVAL-----------N----SLSQSR-AVQ------
B8HTN4          ----RATGLSQ---QV-GMSIDL-ARFS-----------N----AVSQSK-GVQ------
A0A6P1AFJ5      ----LATNLQA---QL-ELDLDQ-AVTI-----------S----ALSAAP-RYQ------
B0CAX4          ----KSRALRN---KL-GLTPQQ-GEDI-----------N----ALSQST-VVQ------
A0A1Z4RN12      ----RYSRLQS---QL-GMNWRE-ASAV-----------S----ALSQSP-GVQ------
A0A2T1CMF9      ----RYNRLQS---QL-GVSWQE-ASAI-----------S----SLSQSI-SLQ------
Q7NDC5          ----RVRAIDA---RMGGLSEPE-ALVA-----------G----ALSGSD-GMR------
U5QGK3          ----RAGAIAS---RMGGLSEKE-ALVA-----------G----ALSSSD-GMS------
A0A2W4UY24      ----QFAQIQQ---QL-RLNPQE-AYAV-----------G----LVSESP-GVQ------
A0A0D8ZUV2      ----RYATLQQ---QV-GMSSAQ-AVAT-----------N----SLNQAG-GIQ------
A0A433VDI0      ----RHTSLYK---KV-GMSSEQ-AIAT-----------N----SLNQSS-GVQ------
A0A3D1PG43      ----RSANLQK---EI-GINSSD-IIAV-----------N----SLNQPAGGAQ------
A0A2P8QQ72      ----RATKLQK---EI-ALTSQD-VVPI-----------N----SLKESP-GIQ------
K9TZQ7          ----RATKLQK---EI-ALTSQD-VVPI-----------N----SLKESP-GIQ------
A0A6N8G584      ----RSATLQQ---QV-GMNPQE-GITL-----------T----SLNQSP-GIQ------
A0A2G7GPR0      ----RSATLQQ---QV-GMNPQE-GITL-----------T----SLNQSP-GIQ------
K9XH68          ----RSATLQQ---QV-GMNPQE-GITL-----------T----ALNQSP-GIQ------
A0A1U7HW70      ----RSATLQQ---QV-GMNPQE-GITL-----------T----ALNQSP-GIQ------
A0A2S6VEJ8      ----RSATLQQ---QV-GMNPQE-GITL-----------T----ALNQSP-GIQ------
A0A140KBA0      ----RYTSLSS---QL-GMNVSE-AAAI-----------S----SLNQSV-AVQ------
K9XSG1          ----RYASLSS---QL-GMGVSE-AAAI-----------S----SLNQSV-AVQ------
A0A2T1GMT4      ----QSQELYK---KV-NLNSQD-ALAV-----------S----AISQSP-AIQ------
K9UI51          ----QSQELYK---KV-NLNSQD-ALAV-----------S----AISQSP-AIQ------
K9QM62          ----QSNELRK---KV-GLDSPQ-AIAM-----------S----TLSQSP-AVQ------
A0A1Z4FWI3      ----QSNELRQ---KV-ALNSQQ-ALSA-----------S----AVSQSP-AVQ------
A0A1Z4JYE7      ----QRNQLSQ---QL-GLTTQQ-AIAV-----------T----TLSQSP-AVQ------
A0A2T1FXY4      ----QTKELRQ---KV-GLNPQQ-ASAV-----------S----ALSQSP-AVQ------
K9TYI2          ----QTNELRQ---KV-GLNPQQ-ASTV-----------S----ALSQSP-AVQ------
A0A1Z4QL41      ----QTDALRQ---KI-GLNSQQ-AIVV-----------S----SLSNSP-AIQ------
A0A252D4T4      ----QTNELRQ---KV-ALSSQE-ALSA-----------S----TLSQSP-AVQ------
A0A252DJH5      ----QTNELRQ---KV-ALSSQE-ALSA-----------S----TLSQSP-AVQ------
A0A252EB80      ----QTRELRQ---KV-ALSSQE-ALSA-----------S----TLSQSP-GVQ------
A0A6G9SKZ9      ----QTNELRQ---KV-NLNSQE-ALSA-----------S----AVSQSP-AVQ------
A0A1Z4HPW5      ----QTNELRQ---KV-NLNSQE-ALSA-----------S----AVSQSP-AVQ------
A0A1Z4MSN1      ----QTNELRQ---KV-NLNSQE-ALSA-----------S----AVSQSP-AVQ------
A0A1Z4U1C2      ----QTNELRQ---KV-NLNSQE-ALSA-----------S----AVSQSP-AVQ------
A0A0D6KV51      ----QTNELRQ---KV-NLNSQE-ALSA-----------S----AVSQSP-AVQ------
A0A1Z4MKF8      ----QTNELRQ---KV-NLNSQE-ALSA-----------S----AVSQSP-AVQ------
A0A2C6WC43      ----QTNELRQ---KV-NLSSQN-AIAV-----------S----ALSQSP-AVQ------
A0A1Z4L5A1      ----QTNELRQ---KV-NLSSQN-AIAV-----------S----ALSQSP-AVQ------
A0A367QD86      ----QTNELRQ---KV-NLSSQN-AIAV-----------S----ALSQSP-GVQ------
A0A235IZ96      ----QTNELRQ---KV-ELNSQQ-AIAV-----------S----ALSQSP-AVQ------
A0A2L2NGP0      ----QTNELRQ---KV-ELNSQQ-AIAV-----------S----ALSQSP-AVQ------
A0A2K8SM78      ----QTNELRQ---KV-ELNSQE-AIAV-----------S----ALSQSP-AVQ------
A0A2R5FPC0      ----QTNELRQ---KV-ELNSQE-AIAV-----------S----ALSQSP-AVQ------
A0A5P8W5T6      ----QTNELRQ---KV-ELNSQE-AIAV-----------S----ALSQSP-AVQ------
A0A0F5YE28      ----LAESLQT---QA-GFDLEE-AIAI-----------N----TLSQSP-VLI------
U7QEH7          ----LAESLQT---QA-GFDLEE-AIAI-----------N----TLSQSP-VLI------
A0A3S1ATK5      ----QTETLRQ---KI-ALNSQQ-AIAV-----------S----SLNNSP-AIR------
A0A2Z6CPH0      ----QSSELRQ---KL-GLNSQN-ALAV-----------S----ALSQSP-AVQ------
A0A1Z4GT50      ----QSNELRQ---KV-NLNSPE-AITV-----------M----AISQSP-AIQ------
A0A1Z4GIX0      ----QSNELRQ---KI-NLNSQQ-AIAV-----------S----TLSQSP-AVQ------
A0A2H6LC24      ----QSNELRQ---KI-NLNSQQ-AIAV-----------S----TLSQSP-AVQ------
B2J6N5          ----QTNELRQ---KV-ELNSQE-AIAV-----------S----ALSQSP-AVQ------
A0A367RMI4      ----QTNELRQ---KV-ELNSQE-AIAV-----------S----ALSQSP-AVQ------
A0A235HUM0      ----QTSELRK---KV-ELNSQE-AIAV-----------S----ALSQSP-AVQ------
A0A2L2NW47      ----QTNELRQ---KV-ELNSQE-AIAV-----------S----ALSQSP-AVQ------
A0A1E2WUR1      ----QTNQLRQ---KV-ELNSQE-AIAV-----------S----ALSQSP-AVQ------
A0A235IKU3      ----QTNELRQ---KV-ELNSQQ-AIAV-----------S----ALSQSP-AVQ------
A0A1U7MYU6      ----QAAGLRN---QV-GLNPQQ-AIAI-----------S----ALSQST-SVQ------
A0A1D8TNX9      ----QAAGLRN---QV-GLNPQQ-AIAI-----------S----ALSQST-SVQ------
A0A6P0L6C2      ----QAAGLRN---QV-GLNPQQ-AIAI-----------S----ALSQST-SVQ------
A0A6P0MVH0      ----QAAGLRN---QV-GLNPQQ-AIAI-----------S----ALSQST-SVQ------
A0A6P0KJV0      ----QAAGLRN---QV-GLNPQQ-AIAI-----------S----ALSQST-SVQ------
A0A6L9ZJG4      ----QAAGLRN---QV-GLNPQQ-AIAI-----------S----ALSQST-SVQ------
F4XKF3          ----QAAGLRN---QV-GLNPQQ-AIAI-----------S----ALSQST-SVQ------
A0A1D9FX10      ----QAAGLRN---QV-GLNPQQ-AIAI-----------S----ALSQST-SVQ------
A0A6P0Q0T0      ----QAAGLRN---QV-GLNPQQ-AIAI-----------S----ALSQST-SVQ------
A0A6P0W5I0      ----QAAGLRN---QV-GLNPQQ-AIAI-----------S----ALSQST-SVQ------
A0A3C0NJ41      ----QTAALQN---KV-GMNSQE-AINT-----------T----ALSQSA-GVQ------
A0A352AG88      ----RSAELRD---QV-GMNSQE-AIVA-----------S----SLSQSP-GVQ------
A0A350Y374      ----QSAALRD---KV-GMDAQE-AIAI-----------T----SLNQSP-GVQ------
A0A355DPX0      ----QSAALRD---KV-GMDAQQ-AIAI-----------T----SLNQSP-GVQ------
                                                                            

K9SLA9          -----QLLE--ELQAIEQQIALES----TRYGAEHPSIIDLRAQREALQVVLQGRVGEDL
A0A168TT23      -----ELRS--RKAELETEISGLL----QRFMEDYPVIVELRSQINEIDTQIRERADTII
A0A0M1JWX9      -----SQLS--KLRELENQIAKEL----TRFTINSPQIQTMLEQRQQLEGMLSQEAQRAL
A0A2T1M1V6      -----SIRD--KLSATEIELSESR----GIYTDKMPQVKSLLLKRDELRREANRQMAQVL
A0A2G7GCS2      -----AIRQ--KLSDAETALAEAR----SRYTDESPQVQSLLSQRDELMQIMNQQIAIAA
K9XBH8          -----ATRQ--QLSEVETALAEAR----SRYTDESPQVQSLLARRQQLMQTMNQQLAVAL
A0A1Z4LJ30      -----LFRD--KLSEVEVALVEAR----GKLTNSHPQIQELVYQQRVLRSQLRQYLANTS
K9RI76          -----LIRD--KLSQIEVALIEAQ----GKLTSNHPEVQNLLYQRSVLRQQLNQFIAASR
A0A352AE27      -----FIRQ--KLTEVEAKLVEAK----ATYTMENPRVEGLVIQRDELQRQLQQYITQAA
A0A3B8JH60      -----FVRNXXKLAEVNANLIRTR----ATFTDNHPTVQKLISERDDLQRQLQGYIAQSA
A0A3C0N766      -----FVRN--KLAEVNANLIRTR----ATFTDNHPTVQKLISERDDLQRQLQGYIAQSA
K9W9J7          -----FVRN--KLAEVDANLVKLR----ATFTDNHPAVRKLISERDELQRQLQGYVAQAA
A0A139WSU3      -----FVRQ--QLSEVEASLRQKQ----AIFTDVHPEVKTLLAQRESLQRKIQEHIRQTS
A0A433VN22      -----AVRK--ELSEVEAKLVQKQ----AIFTINHPEVQTLLAQRSTLRRQIGAYITQVA
Q7NF11          -----AMRL--KLSSLDTALAEAR----GLYTEKHARVQSLLVQREELQRSLRELLAKVV
A0A1Z4JCS8      -----ELRS--KLTEVESTLGKLR----STFTDRSPQVQRAIVERDTLRNQLQQYV-GQA
A0A6P0PI80      -----FVRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLLQREQLQQQIQQYI-FLA
A0A6P0WGT6      -----FVRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLLQREQLQQQIQQYI-FLA
F4XTX2          -----FVRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLLQREQLQQQIQQYI-FLA
Q7NJN6          -----ALRQ--RLADIESQLAQAR----GLYTGKNLRVKSLELQREELLGKIKQQVGSIV
U5QCC3          -----SLRQ--KLTDIETQLAQAR----GIYTEKNQRIQSLLLQREELLSKIKLQLSKLV
A0A3M1SVZ4      -----EARQ--QLQEAEAQLAVEK----TRLTENHPTIIDLQDKVATLRSMLQSRVGDV-
A0A654SFI6      -----SLRA--DLAKAEAQLATLN----ANYGPMYPPLVEKAAEVASLRASLGGEARAAL
K9SSQ0          -----ALVK--QFQEAQTNYFLER----ARFQDAYPKVQALRDRRDQIYNLMQAQAQAIL
A0A2W1JIN9      -----NLKS--AVTNLESQVAARR----TELTDSHPIVIQLVQELDAARTLYNQRLSQL-
A0A318AJV1      -----DLRS--QRADIVRNLGEVE----GRYGPKHPESIRAHQQLADIDQQIRDEAQRVV
A0A6P0IC70      -----KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIA
A0A6B3MUB5      -----KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIA
A0A6M0B7N4      -----KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIA
A0A6P0J9W3      -----KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIA
A0A6P0ZWE1      -----KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIA
A0A1U7N2U4      -----ALRA--QLVNLERELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLL
A0A1D9G1F2      -----ALRA--QLVELDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLL
A0A6P0PNZ7      -----ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLL
F4XV38          -----ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLL
A0A6P0W137      -----ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLL
A0A6L9Y9E2      -----ALRA--QLVDLDRELAKMR----SRLTDQNPAVISLVQERYELLALYNQKLSRLL
A0A6P0SGR0      -----ALRA--QLVDLERELAKMR----SRLTDQNPAMISLVQERYELLALYNQKLSRLL
A0A6M0BK48      -----ALRA--QLVDLDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLL
A0A6L9YZL1      -----ALRA--QLVNLERELAKAR----SRLTDQNPAVISLVQERYELLGLYNQKLSRLL
A0A6P0KYM4      -----ALRA--QLVDLDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLL
A0A6P0LSD6      -----ALRA--QLVDLDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLL
A0A6P0X384      -----NLRT--KLAELDEQLTAAR----SRFTDENPTVISLLEEQEALLALYEEKVARLL
A0A2P8QIL5      -----ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET
A0A2T1FLY5      -----ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET
A0A433W447      -----ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET
K9U1K8          -----ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET
K9UYB2          -----KLRA--KLAESETKLIEAR----LKFTESNPIVIQLSEERDALRNLYSQGLNRVS
A0A218QN17      -----TLRA--KLTELNTKLIEAR----LRLTENHPSVIALVEQRDKVNKLYTEQLAIVS
K9RKN2          -----KMRA--NLAELEREFVEAR----LRFTFNHPKLIELSQKRNAFRQMYEQQLANVS
A0A2I8ADV2      -----SLRA--KLTEIETQLIEAR----LQFTDNHPKVVSLLGQREQIRALYAQQVGRVS
A0A1W5CKM3      -----VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQQRDEIRALYGQQMARVS
A0A5Q0GMF5      -----VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQQRDEIRALYGQQMARVS
Q3MEW0          -----VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQQRDEIRALYGQQMARVS
A0A1Z4KIC7      -----VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVEQRNEIRALYGQQMARVS
Q8YSM5          -----VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVEQRNEIRALYGQQMARVS
A0A1Q4S1H4      -----NLRA--RLTELETQIVALQ----QRFTPEHPELNSLIQQRDTLRAMYQQELARIS
A0A433VBU6      -----NLRV--KLTELQTQIVALQ----QRFTPEHPELNSLIQQRDTLRAVYQQELARVS
A0A1Q4RZJ6      -----KLRA--KLAEQETQLIEAR----LKFTDSHPTVVKMLQQRDALRSLYAQELSRVA
A0A1Z4SNV3      -----KLRA--KLADQETLLIEAR----LRFTDSHPTVAKLLQQRDALRSLYAQQLARVA
A0A2H2XJQ1      -----KLRA--KLADQETLLIEAR----LRFTDSHPTVAKLLQQRDALRSLYAQQLARVA
A0A3S5K358      -----KLRA--KLAEQETQLIEAR----LKFTDSHPTVVKMLQQRDALRNLYAQELSRVA
A0A0T7BPJ4      -----KLRS--KLTELEQQVIQAK----LKFTEEHPTVTKLVQERDAVKAMYEQEVARVS
A0A0C1QS61      -----ELRT--KLTELETKLAESR----AKYTEDHPDVRSLLYQRNTIRNLYIQGLNRVS
A0A139X3R8      -----ELRT--KLTEFETKLAESR----AKYTENHPDVQSLLYQRNSVRNLYIQGLNRIS
A0A1Z4I7C5      -----ALRT--KLTDIETKLIEAR----TKFKEAHPTVVDLVQQRDEIKALYGQQMARVS
A0A0C2MDK7      -----KLRA--KLSELENKIIEAR----LRFTENHPVVANLVGERDALRKVLSEQLARVS
A0A1Y0RCK1      -----KLRA--KLSELENKIIEAR----LRFTEEHPNVRNLVGERDALRAIYSEQLARVS
A0A1Z4PWZ0      -----KLRA--KLSELENKIIEAR----LRFTEEHPTVTNLVGERDALRAIYSEQVARVS
A0A0C2QLT0      -----KLRA--NLSELENKIVEAR----LRFTDEHPNVTNLVGQRDALRAMYSEQLARVS
A0A1Z4J2K1      -----KLRA--KLSDVENQLIEAR----LRFTDEHPNVTNLVGERDALRAMYSEQVARVS
A0A3S0ZSX0      -----MLRA--KLAELEAKVIETR----LYFTENHPTVIKLVEQRDGLRAFYQKELARVS
A0A2N6K4T3      -----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVS
A0A370CKT2      -----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVS
A0A0S3TL97      -----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVS
A0A2N6M8A0      -----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVS
A0A2N6M9E1      -----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVS
A0A2N6KJI4      -----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVS
A0A2N6MZ77      -----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVS
A0A2N6KT20      -----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVS
G6FSN3          -----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVS
A0A4D9CI02      -----ALRT--KLAEIETNLVEAR----LSLTDSHPTVMNLLGQRNGLRALYFQGLARVS
A0A328I8B9      -----ALRT--KLAEIETKLVQAR----LSLTDSHPTVMNLLGQRNGLRALYFQGLARVS
A0A4Q9J4Z7      -----ALRT--KLAEIETKLVQAR----LSLTDSHPTVMNLLGQRNGLRALYFQGLARVS
A0A0M0SU69      -----ALRT--KLAEIETKLVQAR----LSLTDSHPTVINMLGQRNGLRALYFQGLARVS
A0A1Z4TIZ8      -----ALRN--KLAEIETKLIQAR----LYLTESHPTVINLLGQRNGLRGLYLQGLARVS
A0A0S3TYD7      -----ETLK--RSQELQNQLAVTL----GRYRAGHPKVTELQRQVSELQELLQQRVATVV
A0A2T1DNG3      -----AVLN--EIQKTELAIQQQR----VRFKENTLNMQPLLDQRQRQLKQLQLEASRLL
A0A3S0Y9N9      -----LVLG--QLKETQQKIEMAR----LRLTDNHPTVINLKEQETVLKQELKRHIEQSF
A0A433UNK7      -----AVLG--QLQDVQQKIQVIG----LRLTDTHPTIMDLKKEEVILRQELKKRIEQSF
A0A6P0ZKB8      -----EVLG--KLQNLQQRIAVTS----LRLTDDHPTMIDLKKEEIILREELEERIEQSF
U5QL42          -----RLVS--KYKDAEADYVSQR----AKFKDAYKPVGDLKKQRDIYLRLLQEQATSVL
A0A076HBF2      -----SLLQ--QLLKVETELAEAR----SRYNPGSSMVLGLEERLNQLRPLLRQ------
A0A354B169      -----SLLQ--LLLKVESELAAAR----SKYKPSSSMVQGIEARQRQLQPMLLR------
G4FMX5          -----SLLQ--QLLKVETELAEAR----STYKPNSSMVTGLEERINQLKPLLLR------
Q0IDT5          -----SLLQ--QLLKVETELAEAR----SKFVNNSSMVLSLEARLEQLQPLLRE------
A0A2D6FCW3      -----SLLQ--QLLKVETELAEAR----AKYNPDSSMVRGLEARLNQLQPLLRK------
A3ZA21          -----SLLQ--QLLKVETELAEAR----AKYNPNSSMVLSLEARLNQLQPLLRQ------
A0A140K3H3      -----SLAS--QLKELETQYALGS----VNFYDSYHVMEDIKLKQAELRTLMQERSQQIL
K9XUB8          -----NLTS--RLKELESQYGLGS----VNFHDSYHVMEEFKLKQVELRKLMKERAQQIL
A0A6H2NHD5      -----RLLS--DLRQVEQSIASEL----ARFQADTPMVEALEDQRQQLLPLLETEANRVL
A0A2P8W4F7      -----ALLG--DLRELEQTIAAES----ARFQTDTPMIEALEDQRQQLLPLLEAEAQRLV
A0A5Q4E0Z4      -----SLLG--DLRAIEQTIAAES----ARFQSDTPMIGALEDQRQQLLPLLAAEAQRLV
A0A2P8VVX1      -----SLLN--SLQEAELALADRQ----ILFTDEDPNVQVLKQQRENQLAQLRAEISAIS
A0A2P8WHY0      -----QLLN--DIQESELALADRQ----LIFTDQDATVQMLRQELDNNRKQLRQEIAAAI
A0A2T1CMT9      -----NLLN--NLKQMEQDLATQQ----TKFTNYNPALKSAIEEKKILQDLLSEEAERIL
A0A563VQJ3      -----STLT--ELSDTEAAIAKER----QRFKDNHPSIVSLQEKKANLRQQLEQSIAETV
A0A1D8TX52      -----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL
A0A1D9G4T2      -----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL
A0A6P0PR27      -----NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVL
A0A6P0WER7      -----NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVL
F4XP71          -----NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVL
A0A6L9YR57      -----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL
A0A6P0KZ31      -----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL
A0A6P0LPB8      -----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL
A0A6P0SEV1      -----NLLN--EIQRIELALVEQS----RIYTEAHPTIQKLIEQRQSVFALLQEETRRVL
A0A6B3N2I8      -----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL
A0A6M0B891      -----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL
A0A6P0IJQ1      -----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL
A0A6P0J8J8      -----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL
A0A6P0ZSH6      -----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL
A0A1U7N5X9      -----NLLN--EIQRIELALVEQS----RIYTEAHPTIQKLIEQRQSVFALLQEETRRVL
A0A6L9Z1V0      -----NLLN--EIQRIELALVEQS----RIYTEAHPTIQKLIEQRQSVFALLQEETRRVL
A0A6P0LC12      -----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL
A0A6P0MVJ3      -----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVL
A0A2W6ZAV2      -----SLLG--DLTDLEKQLAEAE----ASFSPTSPQVRSLRSRVNQLRPLLQRR-----
K9W742          -----SLLD--EIQKTDLALAEQR----KRFTDDNPTIQKLLFQRQQQLALLEKEGERAV
A0A3D1PBA3      -----TLLN--ELQKTELALSQRR----VTFTDEDPQVKKLLEQRQNTIEMLKSEGGRVV
K9XPB0          -----SLLN--KLQQIEIELADKQ----ARFTDDNPVVKDLLAQKNTQTTLLLQEVKKIL
A0A350Y7Z1      -----ALLN--ELQKTELAIAQQR----VKFTDAEPRVEQLLEQRQRQLALLQEEAQRVL
A0A352X2A7      -----SLLD--ELQKTELALAERR----TRFTDADPSVQKLMEQQSRQYRMLQEEGERVL
A0A0D8ZYV0      -----SLLN--ELQRTDLLLAARR----GTFTDADPGVQKLIELRQSQQALLQAEQARVV
A0A2T1FP73      -----TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVL
A0A433VMS2      -----TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVL
K9TYA7          -----TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVL
A0A2P8QUE1      -----TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVL
K9SA61          -----ALLN--EIQKTEIELAQQR----LRFKDASPYVQQVIDKRQRQLALLQQEAQRVL
A0A2G7GMH8      -----NLLN--EIQKTELALAQQR----LRYTDSSPQVELLLSQRDTQRELLQQEMQTVV
A0A6N8FU92      -----NLLN--EIQKTELALAQER----LRYNDSSPQVELLIEQREKQHQLVQEEMQRVL
A0A2T1DWE8      -----SLLN--EIQKSELAIAQQR----LRFKAASPYVQQAIDQRQRQRDLLAAEVQRIL
A0A1U7I8L3      -----TLLS--EIQKIELELAKER----QRFTDSNPVIQNLLEQRQSQLALLQKEQQLVQ
A0A2T1DJL8      -----ALLN--EIQKTEVAIVQQR----LRFK-KGPFIDQLSEQRQKQQALLQQEVQRIL
A0A1Z4J9W0      -----ALLA--EIQKTEVELAQMQ----TKFTSNTPQVQQLAEQRQRQVSLLQQEAQRIL
A0A0N7Z5K9      -----ALLA--EIQKTEVALAQQQ----TRFTSKTPFVQQLLDQRQRQVALLQQEAQRVL
A0A0S3TXC5      -----ALLA--EIQKTEVALAQQQ----TRFTAKTPFVQQLLDQRERQVALLQQEAQRVL
B8HNB0          -----KLTT--RLQEVELSLAQQS----LTLQNNHPTIENLRAERADLLKLMRQRANGLL
A0A563VS48      -----TIYE--RLQQVKVELASTR----NYLSNNAPQVISLQEEAAELEQVLNQEIAQTL
A0A318BJ18      -----QAIN--NLRQRRAELSAEYQRLMVQFEPGYPAALAIQNQIDQLDRSIAREESRVS
A0A3B8Y8H9      -----NLLE--KLREVDTKLAEES----TRFTEDNPTIKKLRQQRRNLVPLIEEEAQAIL
A0A2W1JVB9      -----VVLQ--QLQEVEGQLAVEG----TRLTPENPILQDLQEQASTLRATLQNRVGEAL
A0A6H1U102      -----QLAS--QLKAVEAKYMEER----ARFHDTHPVVKNLQMQRDNLFNLLQYRSARVL
A0A7C3ZEJ3      -----QLAT--QLKEIEAKYTEES----SRFYDTHPVVQNLLRQRESMRQLLQYRSQRVL
A0A563VLD6      -----KLAT--QLSGLETQYLLNS----TNFKDTFPIMQDLKDKGQELQELLRERATQVL
A0A2P8W9H0      -----ALLN--QLLEVDSQLAADL----TLYLENSPEIEVVESRRENLQPLIERE-----
A0A6I5P386      -----SLLD--RLTEIDSRLAEEL----SLYLEGSPEIEVIRDYRDNLQPLIEKE-----
A0A318BG22      -----ALTG--QLATLEADYQQKR----QTYKPGYAPMEALAAQIASVRGQIATLRGRIV
A0A2T1E9V8      -----GVIK--ELQEVQRKLANAR----SLYKDDHPIIVQFKEKEAQLNILLNSETTRIL
A0A1Z4LN32      -----EVLS--ELQKVQTELTTLK----TRMTNAHPSILDLQDKEAALNNLLQTRIMESV
A0A2I8A9F5      -----DAFI--ELQKIQTQLKIQQ----TRYTDANPIVINLKNQEKALNSLLKQRITEYL
A0A218Q6R8      -----EVLG--ELQKVQTNLAIQQ----TRYTDQNPHIANLKNQEAALASLLQQRITESL
A0A218QGE0      -----GLLA--ELQKVETQLAALK----ARYTERHPAIVDLESQKANINSLLQQQISQSL
A0A3M2GQQ6      -----QLAS--ELKAVEAQYTLEA----SRFYETHPVVKNLAIQRDNLFRQLQQRSRRVL
A0A6H1U2X0      -----QLAS--ELKAVEAQYTLEA----SRFYETHPVVKNLAIQRDNLFRQLQQRSRRVL
K9TLQ0          -----DLLN--RFHEIETKLAQES----TRFTVQSPAMQVLIDERNSLLPLLQEEALLVL
K9QF04          -----ALLE--KLQRVDAKIASES----VKLSDEHPSLIALREERQHLLSLIQQQVINLL
K9W1T3          -----KLLS--NLQDIQEKLATER----TRFQEGHPVIEDLKSKEANLKALLQQQLQQTF
K9SGJ5          -----NLVK--QFQEAETHYYLER----TRFQDDHPEVQVAKDRRDQLYKLMQVQAETVL
A0A6N2JS94      -----SLVK--QFQEVETNYFLER----TRFRGDHPSVVALKDRRDELYRLLETRAQSVV
A0A6C2DSN4      -----SLVK--QFQDVETNYFLER----TRFREDYPSVLALKDRRDELYRLLEARAQSVV
L8MYT6          -----SLVK--QFQDVETNYFLER----TRFREDYPSVLALKDRRDELYRLLEARAQSVV
A0A352JGJ6      -----SLVK--QFREVETNYFLER----TRFREDHPTVQALKDRRNELYKLLETRAQALV
A0A1J5GLS2      -----SLVK--QFQEVETNYFLER----TRFREDHPNVLALKDRRDELYRLLETRAQSVV
A0A2W4W6M5      -----SLVK--QFQDVETSYFLER----TRFREDHPNVQALKDRRDELYKLLETRAQSVV
A0A2W7AN33      -----SLVK--QFQEVETNYFLEQ----TRFRGDHPSVIALKDRRDELYRLLETRAQSVV
A0A256BLV2      -----SLVK--QFQEVETNYFLER----TRFREDHPTVIALKDRRDELYRLLETRAQSVV
A0A2W6ZXF3      -----SLVR--QFQEVETNYFLER----TRFREDHPNVLALKDRRDELYRLLETRAQSVV
A0A2Z5WX66      -----SLVK--QFQETETNYFLER----TRFREDHPTVKALKDRRDELYKLLETRAQSVV
K1XF69          -----AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL
B5W297          -----AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL
A0A6H2AL05      -----AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL
H1W7M8          -----AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL
A0A5Q4H6A5      -----SALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLESLLQREIQVYL
D5A466          -----SALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLESLLQREIQVYL
U5QJM6          -----DVLK--QYQDTETQLALEK----TRFRDDYPTVQNLKDKRDSLQKRLNEQAGVLL
A0A1Z4RPC6      -----SILD--QLATTETELAQER----QRFNDNHPTVISLNDKKQALNSQLQQLITQYV
A0A2T1CMZ0      -----SILD--QLSTTETELSQER----QRFKDNHPAVISLQEKKQNLNSQLQGLISQYV
L8M4F7          -----SIID--EMTRTENQLIQER----RRFKEDHPNIVSLQGKKAALNRQLQSLMSQTI
A0A140K2P2      -----GLLK--EMATVESELAKEK----QRFLDNHPSIQSLEEKKASLNKELKDLISQNV
K9XWX4          -----GLLK--EMATVESELAKER----QRFLDNHPSIKSLEEKKASLNQELKNLISQNV
A0A140KB14      -----SIFK--DLADVETELAQQR----QRFRDNHPMIQSLLEKKQDLNQKLQGLITETV
K9XX88          -----SIFK--DLADVETELAQQR----QRFRDNHPMVQSLLEKRQDLNQKLEGLITETV
A0A563VSV6      -----SILT--ELGNTEIELAQER----QRFKDSHPSISSLLEKKANLRQDIEQQVAQAV
L8LZE9          -----SIVT--ELGNTESQLSQER----QRFNDNHPEIVSLLDTKASLRRELQQQIAQKV
A0A433NM31      -----KALA--DYQEVESKLANER----SRYQENTPVIADLKLKQASLREVLEKRVQQVF
A0A1Z4NDS1      -----KVLS--QLQEVQSQLALQQ----TRFHPEHPSIQDLQARVATLQNLLQQRINQVD
U9VXM0          -----NALE--QLQTVQSDLALAR----TRYREEHPEIVTLRNQESSLQALLQQRLDITL
A0A6M0RI13      -----TVLA--QLQTVQSDLTLAR----TRYRDEHPEIITLRNQEAGLQALLQERLDVTL
A0A6M0S1N5      -----TVLA--QLQTVQSDLTLAR----TRYRDEHPEIITLRNQEAGLQALLQERLDVTL
K9F4D9          -----TVLE--QLQTVQSDLTLAR----TRYRDEHPEIITLRNQEAGLQALLQERLDVTL
A0A6I5QPI5      -----EALS--QLQQVQTQLSNER----ARYREGHPAIERLELQQAEIEALLSDRIQEVL
A0A1Z3HMQ0      -----RILE--DLQAVQTELASQR----SRYTASHPLIANLEREQASLQTLLNRRVGEVL
A0A433W533      -----RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV
A0A2P8QWJ3      -----RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV
A0A2T1FKP8      -----RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV
K9U6L7          -----RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV
A0A1E5QP61      -----QVLT--EYQKVQDQLAVQR----TRYQSQHPIITNLERREAALSDLLQERVAQVL
U5DPF5          -----DALE--SYQSIESELAVAE----SRYQPQHPAIVSLVESRDALRQVLNERIQTVL
A0A6P0X488      -----QVLL--EVEQIEDQLNVQR----TRYEEKHPVIVNLKDRKAAREALLGERVEQVL
A0A6P0UVD5      -----QALL--EVEQIEDQLNVQR----TRYEEKHPVIVNLKDRKAAREILLAERVEQVL
A0A6P0VDM0      -----QALL--EVEQIEDQLNVQR----TRYEEKHPVIVNLKDRKAAREILLAERVEQVL
A0A6M0G142      -----QVLL--EVEQIEEQLNVQR----TRYEEKHPVIVNLKDRKAARTGLLGDRIEQVL
A0A6P0MR53      -----QVLL--EVEQIQEQLNVQR----TRYEEKHPVIVNLRDRKAAREALLGERVEQVL
A0A3M2GIL5      -----NLFR--ELQQVENDLAVQR----TRYQSKHPIIANLTRKRVSLQALLQERIRDIL
A0A6H1TSJ9      -----NLFR--ELQQVENDLAVQR----TRYQSKHPIIANLTRKRVSLQALLQERIRDIL
A0A3M1PML8      -----EALT--QLQLAQQELAVER----TRYTEDHPAIANLQRRVRSLEDMLQSRAVSVA
A0A6M8BE85      -----EALT--QLQAAQQELAVER----TRYTEDHPAIANLQRRVQSLEELLRNRAVSVA
A0A0T7BPZ0      -----QMLT--QLREAETKLAVEQ----NRYLPGHPTLVNLQEQIASLKKLLQQRIKQVA
A0A352X442      -----QALA--ELQKVQSQLAVER----GRFLEEAPIVQKLKEQETKLQTLVNQRIGENL
A0A6B3NF44      -----QALT--QLQEVQAELAVER----TRYKEGYPTIENLKRKEAALETLVQKQVAQVL
A0A6M0EPL4      -----QALT--QLQEVQAELAVER----TRYKEGYPTIENLKRKEAALETLVQKQVAQVL
A0A6P0K6L6      -----QALT--QLQEVQAELAVER----TRYKEGYPTIENLKRKEAALETLVQKQVAQVL
A0A6P0MRR9      -----NIRI--QLQKVISQLEIER----ARYKPGHPTVKNLERQAANLRILLKEKIRLVL
A0A6P0UX57      -----NLRV--QLQEIQSELKIER----ARYKPGHPTIKNLERQATNLKSLLEEQIRLAL
A0A6P0X1X4      -----NLRI--QLKDTMSELAMER----ASYKSGHPKIKNLERQATNLRALLEQQIRLVL
A0A0M0SHU3      -----QVLK--ELQEAQTKLTVAR----TRYLPGHPTVSNLEEQVSALKNLLQQRVEQVG
A0A1D2PBN3      -----QVLT--QLQEAQSQLAVER----TRLQPEHPIVINLEEKVAALNSLLQQRLKQVV
A0A0C2LVR7      -----QVLT--QLQEAQSQLAVER----TRLQPEHPIIINLEEKVAALNSLLQQRLKQAV
A0A1Z4PQB9      -----QVLT--QLQEAQSQLAVER----TRLQPEHPIIINLEEKVAALNSLLQQRLKQAV
A0A1Z4SFN6      -----QVLT--QLQEAQNQLTIEQ----TRLQPGHPTIINLEEKIAALNSLLEERIKQVV
K9PGI8          -----QVLT--QRQEAQSQLAIEL----IRLRPNHPTIINLKEKIAVLNLLLKGRIEEGV
Q7NEU3          -----ENLT--QLQKVETQLALEQ----ARFRDDYPAVQSLKSKRDRLRQVLASQAQQIL
A0A3C0N2P0      -----ALLN--QLSEVESKLAKES----ARLTEDHPTILKLREEQRRLKPLVDQEAATVM
A0A6P0JR04      -----SLLN--QLQEIETQIALES----ARFTEQNPTLQALRDRKENLLPLIREEAIAVL
A0A6B3M6M6      -----ELLN--QLAEVERQIAMES----ARFTAESPTIAALEEQRQNLLPLLNQEVAKVV
A0A6P0KD09      -----ELLN--QLAEVERQIAMES----ARFTTDSPAIAALEEQRQNLLPLLNQEVAKVV
A0A6B3NIJ0      -----ELLN--QLAEVERQIAMES----ARFTTDSPAIAALEEQRQNLLPLLNQEVAKVV
A0A6M0F053      -----ELLN--QLAEVERQIAMES----ARFTTDSPAIAALEEQRQNLLPLLNQEVAKVV
A0A6P2ATU9      -----NLLN--QLQDIETQLALES----ARFTAGNPTIVGLRAQREKLLPLIQAEAQAVL
A0A352XE00      -----DLLN--KLSEVETKIAVES----ARFTEESPTIQALRDEQKNLLPLLEKEAGTAL
A0A6P0QC14      -----ELLN--QLTELDTKIATES----ARFTEENPIVQRLLEERERLLPLIEKEASTVI
B4VS56          -----QLLN--QLTEIESKIASES----ARFTEQSPTIQALREKQQNLLPLLSQEAGTVL
A0A352AAQ3      -----QLLN--QLSEVESKIAAES----ARFTEDSPTIQALREKQQRLLPLIEAEAANVV
A0A350Y472      -----DLLN--QLSEVESQIATEL----ARFKEENPAIETLREKKERLLPLIEEEAANVV
A0A355DVB4      -----DLLN--QLSEVESQIATEL----ARFKEENPAIETLREKKERLLPLIEEEAANVV
A0A1Z4RMB9      -----SILD--QLAQTESDLSKER----QRFNDAHPSVVSLNAKKNDLTQQLEGLVANAV
A0A318B4H2      -----GTIA--SLRQKRAELSARYSALLTKFEPGYPEAEALRTEIMGLDKAIAQ------
B4WQE3          -----SLLD--QLLVVDSELADNL----TVYVEDSPEVEVIEERRANLEPLLERE-----
A0A2K3BR24      -----KVLT--EYQAVEQELTLKR----SRYQPEHPIIKRLEEQEATLANLLQERVNAVL
K9YXY1          -----KVLT--EYQAVEQELTLNR----SRYQPEHPIIKRLEEQEATLANLLQERVNAVL
A0A0V7ZFJ4      -----EALT--QYQKVQDELAVAQ----TQFTSEHPMVISLLGKEQALRNQLGKRVGQLI
A0A0V7ZNJ9      -----QALQ--EYQKVQDRLAVAR----TRLTNQHPTVIDLSNKERALRNQLEKRVGQVV
A0A367RIS1      -----EVLS--EYQKVQDLLAVER----SRFTDGHPVITSLLSKEQALKEQLERRVTQTL
A0A235IXQ2      -----QVLS--EYQKVQDQLTVER----SRFTDEHPVITNLLSKEQALKEQLKGRVSQTL
A0A1W5CNX3      -----QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKEQLEGRVSKTL
A0A5Q0GJJ5      -----QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKEQLEGRVSKTL
Q3MEB7          -----QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKEQLEGRVSKTL
A0A1Z4KHN9      -----QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKAQLEGRVSKTL
Q8YT70          -----QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKAQLEGRVSKTL
A0A166IWU6      -----QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNKEQALKEQLEGRITQTL
A0A2S0Q8C0      -----QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNKEQALKEQLEGRITQTL
W6FSX4          -----QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNKEQALKEQLEGRITQTL
A0A218Q4C1      -----QVLL--EYQKVQDQLAVER----SRLTDEHPVVVNLLNEEEALRIQLEGRVTQTL
A0A6P1ZT04      -----QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNEEEALRIQLEGRVTQTL
A0A0R0M9H9      -----QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL
A0A1S1ZVW2      -----QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQSI
A0A1B7WX82      -----QVLT--EYQKTQYDLAIAR----TLYTNDNPKVVDLIMKEASLKTVLKERVAQTV
A0A1B7WTD1      -----QVLT--EYQKTQHELAIAR----TLYTNDNPKVVDLLLKEAAQKKELEARVTETV
A0A480ABC0      -----QVLT--EYQKTQHDLAIAR----TLYTNDNPKVVDLLLKEAAQKKELEARVTETV
A0A1Z4LRU5      -----QVLT--EFQKTQKELAVAR----TKLTDQHPTVINLSKKLEALKNQLEGKVGQIV
A0A1Z4JVB4      -----SVLK--EYQKAEDDLAVAK----TRYTNDNPTIINLEQKAQALRSQLEGRVSQTI
K9PIA4          -----QVLT--EYQKVQDELAVAR----TRYTNNNPNILNLVEKEAALRNQVEGRVAQSL
A0A1Z4HVE1      -----QVLT--DYQKTQDELAVAR----TRFSDEHPLVINLDKKATALRSQLEGRVSKIV
A0A252ECZ1      -----QVLT--DYQKTEDELAVAR----TRFSDEHPTVINLDKKAAALRSQLEGRVSQTI
A0A1Z4G5Y1      -----QVLT--EYQKAEDELAVAR----TRFSEEHPIVINLAQKAAALRSQLEGRVSQTI
A0A252DNA2      -----QVLE--EYQKAEDELAVAR----TRFSEEHPIVINLDKKAAALRSQLEGRVSQTI
A0A252E1Q4      -----QVLE--EYQKAEDELAVAR----TRFSEEHPIVINLDKKAAALRSQLEGRVSQTI
A0A6G9SK36      -----QVLT--EYQKVQDELAVAQ----TRFTEDNPTIINLERKEIALRKQLEGRVAQTI
A0A1Z4M597      -----QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLENQAVALKNQLEGRVAQTI
A0A1Z4MWT1      -----QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLENQEVALRNQLEGRVAQTI
A0A1Z4TX53      -----QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLENQEVALRNQLEGRVAQTI
A0A5P8VSD1      -----QVLL--EYHKVQDLLAVER----SRLTDEHPVITSLLNKEQALRKQLEARVSQTL
A0A2A2TNQ5      -----QVLA--EYQKVQDDLAVAR----SRFTEEHPSVRNLVAKEQAFRQQMEKRVGRVI
A0A3S1C4K5      -----QVLA--EYQKAQDELAVLQ----TRFTAEHPKVRDSEAKVQALREQLEKRVGKIV
A0A1X4G3D5      -----EVLK--EYQKNEQELAVAQ----TTYTNDNPKVVSLTAKGQVLKKQLQERIYQSV
D4TNI2          -----EVLK--EYQKNEQELAVAQ----TTYTNDNPKVVSLTAKGQVLKKQLQERIYQSV
A0A1Z4H6Z8      -----QVLK--EYQKAEDEVAVAR----TRLTDDNPTLINLEQKQAALRNQLEGRVAQTI
A0A1Z4NPM1      -----QVLA--EYQKTQDELAVAK----TRLTNDHPTVINLTEKVNALRSQLEQRVGKVI
A0A3F3KPR9      -----QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL
D4TGN7          -----QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL
A0A1Z4UZW9      -----QVLT--EYQKTQSELAIAR----SLYTNDNPKVVDLVMKEASLKNVLKERVAQTV
A0A0K2M5H0      -----QVLT--EYQKTQSELAVAR----SLYTGDNPKVVDLVMKEASLKNVLEQRVSQTV
A0A1B7VSH4      -----QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVMKEASLKKLLEERVGQTV
A0A1B7W126      -----QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVMKEASLKKLLEERVGQTV
A0A3D4C6Q6      -----QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVMKEASLKKLLEERVGQTV
A0A1B7UVJ4      -----QVLT--EYQKTQYDLAIAR----TLYTNDNPKVVDLIMKEASLKTVLKERVAQTV
A0A1B7UTR1      -----QVLT--EYQKTQYDLAKAR----TLYTSDNPKVVNLVMQEASLKDLLEKRVAQTI
K7W0A4          -----QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLVLKEASLKKLLEERVTQTI
A0A5C0DRW9      -----QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLLMQEASLKDLLEKRVAQTI
A0A6H2C088      -----QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLVMQEASLKDLLEKRVAQTI
A0A1Q4RTR1      -----QLLD--EFRSTQNKLAVER----IRFSDEHPTIIDLADKVQVLRQQLQQRIIQTL
A0A1Z4SQV2      -----PLLN--EFRSSQDKLAVER----TRYSDEHPIIIDLANKIQVLRQQLQLRIVQIL
A0A2H2XGN1      -----PLLN--EFRSSQDKLAVER----TRYSDEHPIIIDLANKIQVLRQQLQLRIVQIL
A0A433UXH8      -----QLLN--EFRSSQDKLAMER----TRYSDEHPIVIDLANKVQVLRQQLELRVVQTL
A0A1U7HGH0      -----GVLA--ELQTVQRQIADAR----SRYRDDHPILDSLQEREARFQQLLQTQTNQVL
K9XJD3          -----GILT--ELQTVQRQITDAR----SRYRDDHPILDSLQEREARFKQLLQTQINQVL
K9SX01          -----ETLS--DLQKIDSQLVTLR----ATYTDNYPTITVLMEQRAPIQKLLQQRIKETL
A0A4P7ZT55      SGAFSQLLA--DLTDVEKQLAEAS----GTFRSSSPLVRSLTAQRNKLRPLLQRR-----
A0A1E5QIR9      -----KAIA--ELQAIENRLELER----SRFLDEAPIIIDLETKQARLRGVLERRIIEVL
A0A1Z4IBC7      -----KVLA--ELQETQSKLAIER----TRFEPEHPAITALEEKVAVLEKLLKERTGEVA
A0A1W5CPC7      -----KVLA--ELQETESKLAVER----TRFESEHPAITSLEEKIVVLKNLLKDRTGQVA
A0A5Q0GKD1      -----KVLA--ELQETESKLAVER----TRFESEHPAITSLEEKIVVLKNLLKDRTGQVA
Q3MDC6          -----KVLA--ELQETESKLAVER----TRFESEHPAITSLEEKIVVLKNLLKDRTGQVA
A0A1Z4KM73      -----KVLA--ELQEAESKLAVER----TRFEAEHPAITSLEEKIVVLKNLLKDRTGQVA
Q8YNX7          -----KVLA--ELQEAESKLAVER----TRFEAEHPAITSLEEKIVVLKNLLKDRTGQVA
A0A367R4K6      -----KVLA--QLQEAESQLALER----TRFQSGHPTIINLEGKVTALRSLLKERIEQVA
A0A1E2WSV8      -----KVLI--QLQETESQLALER----TRFEPEHPTITNLEEKVTALKSLLKERVGQVA
A0A2R5FRT9      -----KVLA--QLQETESQLALER----TRFSPEHPTITNLQEKVAALQSLLKERIGQFA
A0A2K8T1B6      -----KVFA--QLQDTESQLALER----TRFSPEHPTITNLQEKVVALQSLLKERIGQFA
A0A235I9I0      -----KVLA--ELQETESKLAIER----TRFSPEHPTITNLEEKVVALKNLLKERTGQVA
A0A2D0HQT8      -----KVLA--QLQETESQLALER----TRFSPEHPTITNLEEKVLALKNLLKERTGQVA
A0A2L2NU95      -----KVLA--QLQETESQLALER----TRFSPEHPTITSLEEKVAALNNLLKERTGQVA
A0A367S084      -----KVLA--QLQETESQLALER----TRFSPEHPTITNLEEKVLALKNLLKERTGQVA
A0A6P1A9A0      -----ELLN--QLQQIETQIALES----ARLTEISPQMQRLQEQRANLLPLLQQEARAVL
A0A1Z4SMD6      -----EVLS--ELQKAQTQLAVQR----TRYTEDHPSITSLKNQEINLNNLLRSRIEQVL
A0A2H2Y096      -----EVLS--ELQKAQTQLAVQR----TRYTEDHPSITSLKNQEINLNNLLRSRIEQVL
K9S8M8          -----QALS--ELQQIEDELAVAR----TRYQEQHPTIAGLRRKQAALQSLVQERVGQVL
A0A1Z4NFV0      -----DAIT--ELQKLQRQLANER----SRYTEFHPKILNLKQEIAQVQGLIQQRVNASS
A0A3M9ZEU1      -----EVLS--QYQNVQSQLAIEQ----ARYRSSHPTVANLQRQADQLRTLLQERVQQAI
A0A1Z4JK72      -----EALS--QLQQVQTRLVTEQ----ARFKSTTPQIQTLQQQEQDLNALLQSRVSEAV
A0A0N7Z489      -----DVLS--QLQTVESRLVTES----SRFKDTTPQIQTLKQQRDDLNALLQARVSEAV
A0A0S3TXS2      -----DVLA--QLQSVESRLVTEQ----ARFKDTTPQIQTLKQQRDDLNALLQTRVSDAV
A0A2A2TPF8      -----EVLG--ELQKVQSKLATAQ----SRYTSTHPSIANLKEEEKALTNLLQQRVSQSV
A0A1Z4R0P8      -----EVLS--ELQKVQTKLATEK----SRYNSTHPSVINLEEQEKALASLLQQRASQSV
A0A0T7BUI3      -----EVLS--ELQKTQSRLALER----VKYTNNHPNVVYLENQEKTLKSLLNRRTQEIT
A0A1Z4LP32      -----EVLT--ELQKVQTELAAER----ANYTQIHPLIRKLESQESALNALLQQRKSEAS
K9REP9          -----EVLG--ELQKVQTQLASER----ANYTSAHPLIRKLENQATLLQSLLQQRKQEAS
A0A1Z4SIJ3      -----DVLS--ELQKVETKLAAER----GRYTNQHPSIVYLKNQQAALKSILNERAGKAL
A0A2H2XPG4      -----DVLS--ELQKVETKLAAER----GRYTNQHPSIVYLKNQQAALKSILNERAGKAL
K9V3C7          -----GTLA--ELQKVENNLAVAR----ARYTENSPIVMDLREQQATLKQLLQERVADSS
A0A1Z4T6Y7      -----ESLG--ELQKIQSQLATEA----TTYTSNHPKIISLRQKEAALNNLLQQRASQSL
A0A2H2Y561      -----ESLG--ELQKIQSQLATEA----TTYTSNHPKIISLRQKEAALNNLLQQRASQSL
A0A1Q4S362      -----EALG--ELQKVQTQIATQR----ALYTSDNPIMITLREKEASLNKLLQQRASQSL
A0A3S1CIN8      -----EALG--ELQKVQSQIATQQ----ALYTSDNPIMITLREKEASLSQLLQQRASQSL
A0A2A2TC28      -----EVLG--EQQKVQAKLATLK----ARYTDEHPAIADLKSQELALNSLVKQRVEQSL
A0A0C1NCB0      -----DVLT--ELQKVQTKLANER----ARYTEKHPSVVNLENEEVTLKALLKQRVGETA
A0A2N6K7Q9      -----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS
A0A2N6MXH6      -----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS
A0A2N6M5A8      -----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS
A0A2N6LL61      -----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS
A0A0S3TP66      -----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS
G6FP91          -----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS
A0A1U7GYR5      -----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS
A0A2N6KY52      -----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS
A0A2N6KMP5      -----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS
A0A2N6MA45      -----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS
A0A4Q9J9V9      -----EVLT--ELQKVQTKLANAR----AIYTEKNPIIIDLKNQQSTLNSLLQQRTQQYS
A0A328IGA1      -----EVLT--ELQKVQTKLANAR----AIYTERNPIIIDLKNQQSTLNSLLQQRTQQYS
A0A4D9CE41      -----EVLT--ELQKVQTKLANAR----AIYTERNPIIIDLKNQQATLNSLLQQRTQQYS
A0A0M0SFT2      -----EVLT--ELQKVQTKLANAR----AIYTEQHPIITDLKNQQATLNALLQQRTQQYS
A0A1Z4TLC8      -----EVLT--ELQKIQTKLANAR----AIYTEQHPTITDLKNQQATLNSLLQQRTQQYS
A0A0C2LFH0      -----EVLT--ELQKVQTKLANER----ARYTSEHPAITELKNKEITLNALLQQRVEQVL
A0A1Z4IYV4      -----EVLS--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL
A0A1Z4Q0T6      -----EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL
A0A0C2PT44      -----EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL
A0A1D2P6J4      -----EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL
B4WP72          -----EVLT--ELQAVQSQLAIEQ----ARYQSTHPAVLNLQRQVNSLESLLRQRIRTVT
A0A2T1CIL7      -----QLIS--ELQQVRIDLIEQR----DRFSDNAPQVNSLVKREVELEALLENQIEQIQ
A0A433V7A0      -----DILK--KIQQVQSELAVQQ----TRLSNDHPSINNLKKQETALKSLLEDRVKAVV
A0A2T1FTR8      -----KSLK--ELQEVEAKIATER----TRFSDNDPSILNLKEKRQALVEILQKRFKQSL
K9UA41          -----KSLK--ELQEVEAKIATER----TRFSDNDPSILNLKEKRQALVEILQKRFKQSL
A0A0C2LBE2      -----QVLT--QLQEAQSQLAVER----SRLKPEHPIIVNLEEKVAALNSVLQQRMKQVT
A0A433NN38      -----QLLS--QLQKTQADLEVAR----TRFQPEHPQIVNLEEQISALSQVLQQRVEQVA
A0A2N6K0T2      -----KVLT--ELQEAQSQLTVAR----TRYQPGHPTVIDLEEKVAALRNLLQERVGQVA
A0A2N6ML72      -----KVLT--ELQEAQSELTVAR----TRYQPGHPTVVNLEEKVSALRSLLQQRVQQVG
G6FQZ6          -----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG
A0A2N6MQX9      -----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG
A0A2N6KXT6      -----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG
A0A2N6KGB9      -----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG
A0A2N6L3Y5      -----KVLT--ELQEAQSELTVAR----TRYQPGHPTVVNLEEKVSALRSLLQQRIQQVG
A0A0S3TIS7      -----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRVEQVG
A0A1U7GW28      -----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRVEQVG
A0A2N6LW63      -----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRVEQVG
A0A328IH74      -----EVIK--ELQEAQTELAVAR----TRYLPGHPTVSQLAEKVSALKNLLQQRVEQVG
A0A4D9CIB0      -----EVIK--QLQEAQTELAVAR----TRYLPGHPTVSQLAEKVSALKNLLQQRVEQVG
A0A1Z4TQ63      -----QVLK--ELQEAQTELTVAR----TRYLPGHPTVSNLEEKVSALKSLLQQRVEQVG
A0A4Q9J8G2      -----EVIK--ELQEAQTDLAVAR----TRYLPGHPTVSQLEEKVSALKNLLRQRVEQVG
A0A350Y0P6      -----QALI--ELEQVQEQLNIEG----TRFQNEAPIIVSLKEKEAARQRLLNQRVEQVI
A0A352X940      -----QILV--DIEQIEAQLTVQR----TRYQEEHPIIQNLKRREDAQKSLLQERISKVL
B8HTN4          -----VVLD--QYQQVEAELAVAR----TELQPDHPKIKTLEEQLTELNTILRERVRDVA
A0A6P1AFJ5      -----ELLD--RLQQIEQQIALES----ARFTEISPLIQKLQEQKQNLLPLLAAEARAVL
B0CAX4          -----QALA--DYQENERELAEAL----KVFQPTHPTVLDLKEKRIALKGVLGEQTSQII
A0A1Z4RN12      -----RALS--QLQDVKVALAQKQ----AFLSNNAPQIVSLKQEEADLTSLLEQQIASTL
A0A2T1CMF9      -----ETLA--QLQKIKVELAQKS----NVLSDSSPQIISLKEEQADLEDLLRQEVAGTL
Q7NDC5          -----DLRK--TLLEIESKLAVAR----AQYQDSYPEVEQLIKRRGALRALLASEADRLL
U5QGK3          -----ELRK--DLVEVESKLALAR----AQYQDNYPDVDRLIKQRNALRALLKTEAGRLL
A0A2W4UY24      -----EVIT--TLQAVQSQLAIAL----TRYREGHPEIASLRSQEVALLTLLQTRVGLAL
A0A0D8ZUV2      -----KLLE--ESQQLEDRLATER----TRLQEDHPTIVNLKLRQAALKALLDKRV----
A0A433VDI0      -----KTLE--ELRQVEDQLVVQR----TRLQEDHPAIVNLELKKNAFKAQLQGLVK---
A0A3D1PG43      -----KVVA--ELQQVEADLVVLQ----TRFLDGHPKIAELQNKKAALKALLQQRITQTL
A0A2P8QQ72      -----KTLA--ELQRVEGDLVVLQ----TRFEDTYPEVQKLQQKRNALKQLLEGRIGQML
K9TZQ7          -----KTLA--ELQRVEGDLVVLQ----TRFEDTYPEVQKLQQKRNALKQLLEGRIGQML
A0A6N8G584      -----KVLT--EYQQVEAELAVQQ----TRFIGDHPTILGLTERRDALRALLEERVQGAI
A0A2G7GPR0      -----KVLT--EYQQVEAELAVQQ----TRFVGEHPTILGLQERRDALRALLEERVQGAI
K9XH68          -----KVLA--EYQQVEAELAVQQ----TRFVGDHPTLLSLTERRDALRALLEERVQGAI
A0A1U7HW70      -----KVLA--EYQQVEAELAVQQ----TRFVGDHPTLLGLTERRDALRALLEERVQGAI
A0A2S6VEJ8      -----KVLQ--EYQQVEAELAVQQ----TRFVGDHPTILSLTERRDALRALLEERVQGAI
A0A140KBA0      -----KALT--QLQNVKVELASKR----NLFGENAPQIISLKEQEAELTALLEQQIRQTL
K9XSG1          -----KALT--QLQDVKVQLATKR----NLFGENAPQIISLKEQEAELTALLEQQIQQTL
A0A2T1GMT4      -----GILT--QLQDVDRQLATES----SRFSDDNPIIVSLKEKQSKLKTLLSQQIRNTI
K9UI51          -----GILT--QLQDVDRQLATES----SRFSDDNPIIVGLKEKQSKLKALLEQQIRSTI
K9QM62          -----GALT--QYQDIERQLATER----SRFSEAHPTIVNLEARKSNLKTLLQQQINQTL
A0A1Z4FWI3      -----GIVT--QLQDVERQLATER----SRFQDENPVIINLEAKKANLKALLQQEIGQAG
A0A1Z4JYE7      -----GILS--QLQELERQLANER----SRFTDDNPIIVSLEAKKDNLNNLLQLQIAKTV
A0A2T1FXY4      -----GVLI--QLQDTERQLASQR----SRYLNNNPIIVDLEAKKSNLEALLKKQIKQTV
K9TYI2          -----GVLT--QLQDTERQLASQR----SRYLNDNPIIVDLEAKKYNLEALLQKQIKQTV
A0A1Z4QL41      -----AILT--QLQEIDRQLAVER----SRFLDENPVIINLEAKRFNLKNLLQKQIEQTI
A0A252D4T4      -----GILT--QIQEVDRQLATER----SRFQEENPVIVNLVARRANLQALLKQEVGQNG
A0A252DJH5      -----GILT--QIQEVDRQLATER----SRFQEENPVIVNLVARRANLQALLKQEVGQNG
A0A252EB80      -----AILT--QLQEVDRQLATER----SRFQDENPVIVNLVAKKANLQALLKQEVGQNG
A0A6G9SKZ9      -----GIVT--QLQDIDRQLATER----SRFLDDNPVIINLEQRKANLQALLNKELKQTG
A0A1Z4HPW5      -----GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQRKANLQALLKKEIGQTD
A0A1Z4MSN1      -----GILT--QLQDIDRQLASER----SRFLDDNPVIVNLEQRKANLQALLKKEIGQTG
A0A1Z4U1C2      -----GILT--QLQDIDRQLASER----SRFLDDNPVIVNLEQRKANLQALLKKEIGQTG
A0A0D6KV51      -----GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQRKTNLQALLKQEIGQTG
A0A1Z4MKF8      -----GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQRKTNLQALLKQEIGQTG
A0A2C6WC43      -----GILT--QLQDIERQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTV
A0A1Z4L5A1      -----GILT--QLQDIERQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTV
A0A367QD86      -----GILT--QLQDIDRQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTI
A0A235IZ96      -----GVLV--QLQETDRQLAIER----SRFLDDNPVIINLEAKKANLKSLLQQQIGQTI
A0A2L2NGP0      -----GVLV--QLQETDRQLAIEH----SRFLDDNPVIINLEAKKANLKSLLQQQIGQTI
A0A2K8SM78      -----GVLT--QLQDTDRQLAIER----SRFLDDNPVIINLEAKKASLKSLLQQQIGQTV
A0A2R5FPC0      -----GVLA--QLQDTDRQLAIER----SRFLDDNPVIINLQAKKASLQSLLQQQIGQTV
A0A5P8W5T6      -----GVLT--QLQDTDRQLAVER----SRFLDDNPVIINLEAKKASLKSLLQQQIGQTV
A0A0F5YE28      -----GILT--ELENVESELVNER----KRFKDQNPRIIALKQKRDSLNAALQEQVEQVL
U7QEH7          -----GILT--ELENVESELVNER----KRFKDQNPRIIALNQKRDSLNAALQEQVEQTL
A0A3S1ATK5      -----EIVI--QLHEIERQLATER----SRYFDNNPVIISLEAKKANLNNLLQTQIKATI
A0A2Z6CPH0      -----GVLT--QLQDVERQLANER----SRFLDDNPVIVGLEARKANLTNLLQQQITQTL
A0A1Z4GT50      -----GILA--QLQDLERQLATER----SRFYDDNPVITNLEAKKTTLQTLLQKQIEQIV
A0A1Z4GIX0      -----GVLT--QLQEVERQLANER----SRFLDDNPIIVSLEARKANLTALLQQQVGQTL
A0A2H6LC24      -----GVLT--QLQEVERQLANER----SRFLDDNPIIVSLEARKANLTALLQQQVGQTL
B2J6N5          -----GVLT--QLQETERQLAIER----SRFLDDNPVIINLEAKKASLKSLLQQQIGQTV
A0A367RMI4      -----GILT--QLQETDRQLAVER----SRFLDDNPIIINLEAKKANLKSLLQQQVGQTV
A0A235HUM0      -----GILT--QLQETDRQLAVER----SRFLDDNPIIINLEAKKTNLKSLLQQQVGQTV
A0A2L2NW47      -----GILT--QLQETDRQLAVER----SRFLDDNPIIINLEAKKANLKSLLQQQVGQTI
A0A1E2WUR1      -----GVLT--QLQETDRQLAVER----SRFLDDNPVIINLEARKASLNSLLQQQIGQTI
A0A235IKU3      -----GVLV--QLQETDRQLAIER----SRFLDDNPVIINLEAKKANLKSLLQQQIGQTI
A0A1U7MYU6      -----GVLQ--ELQEVERQLAVGN----NRYGKNHPVMIRLTKQQSSLRGHLQQQIDQIL
A0A1D8TNX9      -----GVLQ--ELQEVERQLAVGR----NRYGKNHPIMIRLTKQQRSLTGHLQQQINQIL
A0A6P0L6C2      -----GVLQ--ELQEVERQLAVGK----NRYGKNHPVMIRLTKQQRSLRGHLQQQINQIL
A0A6P0MVH0      -----GVLQ--ELQEVERQLAVGR----NRYGKNHPVMIRLSKQQRSLRGHLQQQINQIL
A0A6P0KJV0      -----GVLQ--ELQEVERQLAVGR----NRYGKNHPVMVRLTKQQRSLRGHLQQQIDQIL
A0A6L9ZJG4      -----GVLQ--ELQEVERQLAVGK----NRYGKNHPVMIRLTKQQRSLRGHLQQQINQIL
F4XKF3          -----GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL
A0A1D9FX10      -----GVLQ--ELQEVERQLAVSK----NRYGKNHPVMIRLTKQQRSLRGHLQQQIDQIL
A0A6P0Q0T0      -----GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL
A0A6P0W5I0      -----GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL
A0A3C0NJ41      -----EVLK--QYQDIQAQLTLQR----TRFLDDSPVIVSLKEKEASLKSLLQDRVSQTV
A0A352AG88      -----QVLQ--EFQQVQSKLRVEQ----TRFQDEDPTIISLKEREAALRNLLQERVVQTI
A0A350Y374      -----DILK--EFQKVQADLTIQR----TRFQEADPTIISLKQKEAALKSLLEERVGQTI
A0A355DPX0      -----DILK--EFQTVQADLTIQR----TRFQEADPTIISLKQKEAALKSLLEERVGQTI
                                                                            

K9SLA9          -----------------------------------------------------------L
A0A168TT23      -G----------------------------------------------------------
A0A0M1JWX9      -G---------------------------------------------------REIVTVA
A0A2T1M1V6      PG-------------------------------------------------VS-SSQVDV
A0A2G7GCS2      PG-------------------------------------------------AS-ANQIDP
K9XBH8          PN-------------------------------------------------AA-SNQVDP
A0A1Z4LJ30      S-----------------------------------------------------VAGVDT
K9RI76          AN----------------------------------------------------AGGVNP
A0A352AE27      GD----------------------------------------------------A-SIDT
A0A3B8JH60      AG----------------------------------------------------T-RVDT
A0A3C0N766      AG----------------------------------------------------T-RVDT
K9W9J7          AG----------------------------------------------------T-QVDT
A0A139WSU3      AG----------------------------------------------------T-KVDT
A0A433VN22      GN----------------------------------------------------I-PVDP
Q7NF11          PA-------------------------------------------------SRTERALDD
A0A1Z4JCS8      AG----------------------------------------------------RISANT
A0A6P0PI80      AG----------------------------------------------------DTLVDP
A0A6P0WGT6      AG----------------------------------------------------DTLVDP
F4XTX2          AG----------------------------------------------------DTLVDP
Q7NJN6          PD----------------------------------------------------ASKVNV
U5QCC3          PD----------------------------------------------------SEKVDT
A0A3M1SVZ4      ---------------------------------------------------------SGS
A0A654SFI6      K-----------------------------------------------------------
K9SSQ0          ---------------------------------------------------------GTK
A0A2W1JIN9      ---------------------------------------------------------GGG
A0A318AJV1      G-----------------------------------------------------------
A0A6P0IC70      P--------------------------------------------------------NPQ
A0A6B3MUB5      P--------------------------------------------------------NPQ
A0A6M0B7N4      P--------------------------------------------------------NPQ
A0A6P0J9W3      P--------------------------------------------------------NPQ
A0A6P0ZWE1      P--------------------------------------------------------NPQ
A0A1U7N2U4      PT-----------------------------------N---------QP----TNQLTNQ
A0A1D9G1F2      P----------------------------------------------------TNQSNNQ
A0A6P0PNZ7      P----------------------------------------------------TNQSNNQ
F4XV38          P----------------------------------------------------TNQSNNQ
A0A6P0W137      P----------------------------------------------------TNQSNNQ
A0A6L9Y9E2      PT-----------------------------------N---------QLTNQSTNQSNNQ
A0A6P0SGR0      PT-----------------------------------N---------QLTNQSTNQPNNQ
A0A6M0BK48      PT-----------------------------------N---------QLTNQPTNQLTNQ
A0A6L9YZL1      PT-----------------------------------N---------QLTNQSTNQSNNQ
A0A6P0KYM4      PT-----------------------------------N---------QPTNQFT----NQ
A0A6P0LSD6      PT-----------------------------------N---------QPTNQFT----NQ
A0A6P0X384      P--------------------------------------------------------PNQ
A0A2P8QIL5      ---------------------------------------------------------GNP
A0A2T1FLY5      ---------------------------------------------------------GNP
A0A433W447      ---------------------------------------------------------GNP
K9U1K8          ---------------------------------------------------------GNP
K9UYB2          P--------------------------------------------------------DNQ
A0A218QN17      P--------------------------------------------------------ANS
K9RKN2          N--------------------------------------------------------TNN
A0A2I8ADV2      A--------------------------------------------------------NNQ
A0A1W5CKM3      S--------------------------------------------------------SNQ
A0A5Q0GMF5      S--------------------------------------------------------SNQ
Q3MEW0          S--------------------------------------------------------SNQ
A0A1Z4KIC7      S--------------------------------------------------------SGQ
Q8YSM5          S--------------------------------------------------------SGQ
A0A1Q4S1H4      N-----------------------------------------------------------
A0A433VBU6      S-----------------------------------------------------------
A0A1Q4RZJ6      P-------------------------------------------------------KAGA
A0A1Z4SNV3      P----------------------------------------------------VDTSSSN
A0A2H2XJQ1      P----------------------------------------------------VDTSSSN
A0A3S5K358      P--------------------------------------------------------GAG
A0A0T7BPJ4      P--------------------------------------------------------DGQ
A0A0C1QS61      S--------------------------------------------------------GER
A0A139X3R8      S--------------------------------------------------------ENQ
A0A1Z4I7C5      S--------------------------------------------------------SNQ
A0A0C2MDK7      T--------------------------------------------------------KDQ
A0A1Y0RCK1      S--------------------------------------------------------ENQ
A0A1Z4PWZ0      P--------------------------------------------------------QGQ
A0A0C2QLT0      S--------------------------------------------------------QNQ
A0A1Z4J2K1      P--------------------------------------------------------KDQ
A0A3S0ZSX0      P--------------------------------------------------------QNQ
A0A2N6K4T3      P--------------------------------------------------------RNQ
A0A370CKT2      P--------------------------------------------------------RNQ
A0A0S3TL97      P--------------------------------------------------------RNQ
A0A2N6M8A0      P--------------------------------------------------------RNQ
A0A2N6M9E1      P--------------------------------------------------------RNQ
A0A2N6KJI4      P--------------------------------------------------------RNQ
A0A2N6MZ77      P--------------------------------------------------------RNQ
A0A2N6KT20      P--------------------------------------------------------RNQ
G6FSN3          P--------------------------------------------------------RNQ
A0A4D9CI02      P--------------------------------------------------------RSK
A0A328I8B9      P--------------------------------------------------------RSK
A0A4Q9J4Z7      P--------------------------------------------------------RSK
A0A0M0SU69      P--------------------------------------------------------GNT
A0A1Z4TIZ8      P--------------------------------------------------------GNT
A0A0S3TYD7      -G------------------------------------------------------QTTA
A0A2T1DNG3      -G-------------------------------------------------SSSPGSGES
A0A3S0Y9N9      IG----------------------------------------------------------
A0A433UNK7      IG----------------------------------------------------------
A0A6P0ZKB8      IG----------------------------------------------------------
U5QL42          -G---SAKVAKLGLKSGAVPALGDSAITGSGGANPPVA-------------PAASAPTPA
A0A076HBF2      ------------------------------------------------------------
A0A354B169      ------------------------------------------------------------
G4FMX5          ------------------------------------------------------------
Q0IDT5          ------------------------------------------------------------
A0A2D6FCW3      ------------------------------------------------------------
A3ZA21          ------------------------------------------------------------
A0A140K3H3      -GDAVSQVNLEAIIVSQGSTSQVMGINGADTQAQALNP-------------GQPVDSQGA
K9XUB8          -GDAVSQVNLEAIIVNQGSTSQIMGINTANTQVSAANT-------------NQAVESQGG
A0A6H2NHD5      -A-----------------------------ANAEVDH-------------D--------
A0A2P8W4F7      -G-----------------------------EA--VEA-------------N--------
A0A5Q4E0Z4      -G-----------------------------ST--VET-------------D--------
A0A2P8VVX1      -R-----------------------------Q---------------------NVTELDP
A0A2P8WHY0      -R-----------------------------R---------------------PVETLNP
A0A2T1CMT9      -G-----------------------------EL----P---------------PNFSSDL
A0A563VQJ3      -G-----------------------------IG----------------------VEVSD
A0A1D8TX52      -G-----------------------------QV----P-------------T-QLVSTGS
A0A1D9G4T2      -G-----------------------------QV----P-------------T-QLVSTGS
A0A6P0PR27      -G-----------------------------QV----P-------------T-KLVTTGN
A0A6P0WER7      -G-----------------------------QV----P-------------T-KLVTTGN
F4XP71          -G-----------------------------QV----P-------------T-KLVTTGN
A0A6L9YR57      -G-----------------------------QV----P-------------T-QLVSTGS
A0A6P0KZ31      -G-----------------------------QV----P-------------T-QLVSTGS
A0A6P0LPB8      -G-----------------------------QV----P-------------T-QLVSTGS
A0A6P0SEV1      -G-----------------------------QV----P-------------T-QLVTTGN
A0A6B3N2I8      -G-----------------------------QV----P-------------T-QLVTTGS
A0A6M0B891      -G-----------------------------QV----P-------------T-QLVTTGS
A0A6P0IJQ1      -G-----------------------------QV----P-------------T-QLVTTGS
A0A6P0J8J8      -G-----------------------------QV----P-------------T-QLVTTGS
A0A6P0ZSH6      -G-----------------------------QV----P-------------T-QLVSTGS
A0A1U7N5X9      -G-----------------------------QV----P-------------T-QLVTTGN
A0A6L9Z1V0      -G-----------------------------QV----P-------------T-QLVTTGN
A0A6P0LC12      -G-----------------------------QV----P-------------T-QLVSTGS
A0A6P0MVJ3      -G-----------------------------QV----P-------------T-QLVSTGS
A0A2W6ZAV2      ------------------------------------------------------------
K9W742          -G-----------------------------KN--------------------SSQLKGE
A0A3D1PBA3      -G-----------------------------KE----Q-------------A-QSGSTGE
K9XPB0          -G-----------------------------AV----P-------------P-NFAVQLQ
A0A350Y7Z1      -G-----------------------------ET----S-------------T-QIAFSTQ
A0A352X2A7      -G-----------------------------RV----A-------------R-GEDLTSN
A0A0D8ZYV0      -G-----------------------------AN------------------V-AQANAAG
A0A2T1FP73      -G-----------------------------EGQASQA-------------A-AAGNAAD
A0A433VMS2      -G-----------------------------EGQASQA-------------A-AAGNAAD
K9TYA7          -G-----------------------------EGQASQA-------------A-AAGNAAD
A0A2P8QUE1      -G-----------------------------EGQASQA-------------A-AAGNAAD
K9SA61          -S-----------------------------ST----S-------------T-GTSSQGD
A0A2G7GMH8      -G-----------------------------EN----A-------------I-ASEEDTT
A0A6N8FU92      -G-----------------------------ED----V-------------A-ASDEDTT
A0A2T1DWE8      -G-----------------------------NN----A-------------A-QVNVKGD
A0A1U7I8L3      -G-----------------------------NN----N-------------PLPPTTTNS
A0A2T1DJL8      -G-----------------------------AQ----A-------------A-AIAQSGD
A0A1Z4J9W0      -G-----------------------------SE----A-------------G---AASSE
A0A0N7Z5K9      -G-----------------------------AD----A-------------G-AIAGSDS
A0A0S3TXC5      -G-----------------------------SE----A-------------S-SIAGSDA
B8HNB0          -R-----------------------------------T-------------QLNRDLTTL
A0A563VS48      GG-----------------------------------E-------------QQ------A
A0A318BJ18      -G-----------------------------------S----------------------
A0A3B8Y8H9      -G-----------------------------------N---------------------I
A0A2W1JVB9      -G-----------------------------------V-------------PS------S
A0A6H1U102      -G-----------------------------------D---------------------A
A0A7C3ZEJ3      -G-----------------------------------S---------------------A
A0A563VLD6      -G-----------------------------------N---------TVSQAVLDKAIAT
A0A2P8W9H0      -G-----------------------------------L----------------------
A0A6I5P386      -G-----------------------------------V----------------------
A0A318BG22      GG-----------------------------------F----------------------
A0A2T1E9V8      QG-----------------------------------Q---------------------K
A0A1Z4LN32      -G-----------------------------------Y---------------------R
A0A2I8A9F5      -G-----------------------------------Y---------------------P
A0A218Q6R8      -G-----------------------------------Y---------------------P
A0A218QGE0      -G-----------------------------------Y---------------------K
A0A3M2GQQ6      -G-----------------------------------D---------------------A
A0A6H1U2X0      -G-----------------------------------D---------------------A
K9TLQ0          -G-----------------------------------P-------------NVSQFRGDI
K9QF04          -G-----------------------------------I-------------QLFKEIQQL
K9W1T3          LG-----------------------------------Q---------------------Q
K9SGJ5          -G-----------------------------------G----------------------
A0A6N2JS94      -G-----------------------------------V----------------------
A0A6C2DSN4      -G-----------------------------------V----------------------
L8MYT6          -G-----------------------------------V----------------------
A0A352JGJ6      -G-----------------------------------T----------------------
A0A1J5GLS2      -G-----------------------------------V----------------------
A0A2W4W6M5      -G-----------------------------------V----------------------
A0A2W7AN33      -G----------------------------------------------------------
A0A256BLV2      -G-----------------------------------V----------------------
A0A2W6ZXF3      -G-----------------------------------V----------------------
A0A2Z5WX66      -G-----------------------------------L----------------------
K1XF69          -G-----------------------------------S----------------------
B5W297          -G-----------------------------------S----------------------
A0A6H2AL05      -G-----------------------------------S----------------------
H1W7M8          -G-----------------------------------S----------------------
A0A5Q4H6A5      -G-----------------------------------S----------------------
D5A466          -G-----------------------------------S----------------------
U5QJM6          -G-----------------------------------G----------------------
A0A1Z4RPC6      -G-----------------------------------T----------------------
A0A2T1CMZ0      -G-----------------------------------A----------------------
L8M4F7          -G-----------------------------------Q----------------------
A0A140K2P2      -G-----------------------------------Q----------------------
K9XWX4          -G-----------------------------------Q----------------------
A0A140KB14      -G-----------------------------------S----------------------
K9XX88          -G-----------------------------------S----------------------
A0A563VSV6      -G-----------------------------------T----------------------
L8LZE9          -G-----------------------------------S----------------------
A0A433NM31      -K-----------------------------------G----------------------
A0A1Z4NDS1      -G-----------------------------------N----------------------
U9VXM0          -G-----------------------------------A----------------------
A0A6M0RI13      -G-----------------------------------A----------------------
A0A6M0S1N5      -G-----------------------------------A----------------------
K9F4D9          -G-----------------------------------A----------------------
A0A6I5QPI5      -G-----------------------------------Q----------------------
A0A1Z3HMQ0      -G-----------------------------------T----------------------
A0A433W533      -G-----------------------------------K----------------------
A0A2P8QWJ3      -G-----------------------------------K----------------------
A0A2T1FKP8      -G-----------------------------------K----------------------
K9U6L7          -G-----------------------------------K----------------------
A0A1E5QP61      -G-----------------------------------N----------------------
U5DPF5          -S-----------------------------------E----------------------
A0A6P0X488      -G-----------------------------------F----------------------
A0A6P0UVD5      -G-----------------------------------F----------------------
A0A6P0VDM0      -G-----------------------------------F----------------------
A0A6M0G142      -G-----------------------------------F----------------------
A0A6P0MR53      -G-----------------------------------F----------------------
A0A3M2GIL5      -G-----------------------------------S----------------------
A0A6H1TSJ9      -G-----------------------------------S----------------------
A0A3M1PML8      -K-----------------------------------S----------------------
A0A6M8BE85      -R-----------------------------------S----------------------
A0A0T7BPZ0      -G-----------------------------------E----------------------
A0A352X442      -G-----------------------------------S----------------------
A0A6B3NF44      -G-----------------------------------G----------------------
A0A6M0EPL4      -G-----------------------------------G----------------------
A0A6P0K6L6      -G-----------------------------------G----------------------
A0A6P0MRR9      -G-----------------------------------D----------------------
A0A6P0UX57      -G-----------------------------------D----------------------
A0A6P0X1X4      -G-----------------------------------D----------------------
A0A0M0SHU3      -G-----------------------------------S----------------------
A0A1D2PBN3      -G-----------------------------------S----------------------
A0A0C2LVR7      -G-----------------------------------N----------------------
A0A1Z4PQB9      -G-----------------------------------S----------------------
A0A1Z4SFN6      -G-----------------------------------S----------------------
K9PGI8          -G-----------------------------------S----------------------
Q7NEU3          GD-----------------------------------RTVPAIVSGGASLQDS------I
A0A3C0N2P0      GN-----------------------------------AA------------SG------V
A0A6P0JR04      GQ-----------------------------------DA------------KN-------
A0A6B3M6M6      PN-----------------------------------GT------------G--------
A0A6P0KD09      PK-----------------------------------GT------------G--------
A0A6B3NIJ0      PK-----------------------------------GT------------G--------
A0A6M0F053      PK-----------------------------------GT------------G--------
A0A6P2ATU9      GE-----------------------------------AA------------GD------E
A0A352XE00      SS-----------------------------------AK------------LT------Q
A0A6P0QC14      GN-----------------------------------ST------------SG------V
B4VS56          GA-----------------------------------NA------------SA------V
A0A352AAQ3      GS-----------------------------------GS------------SG------V
A0A350Y472      GN-----------------------------------AA------------FG------I
A0A355DVB4      GN-----------------------------------AA------------FG------I
A0A1Z4RMB9      -G-----------------------------------Q---------G-----------V
A0A318B4H2      ------------------------------------------------------------
B4WQE3          -G-----------------------------------V---------R------------
A0A2K3BR24      ---------------------------------------------------QEELPSNAL
K9YXY1          ---------------------------------------------------QEELPSNAL
A0A0V7ZFJ4      -D-----------------------------------N---------G---NS------I
A0A0V7ZNJ9      -N-----------------------------------N---------NSNDSS------I
A0A367RIS1      -G-----------------------------------S---------A---QP------I
A0A235IXQ2      -G-----------------------------------S---------S---EP------I
A0A1W5CNX3      -G-----------------------------------S---------W---QP------I
A0A5Q0GJJ5      -G-----------------------------------S---------W---QP------I
Q3MEB7          -G-----------------------------------S---------W---QP------I
A0A1Z4KHN9      -G-----------------------------------S---------S---QP------I
Q8YT70          -G-----------------------------------S---------S---QP------I
A0A166IWU6      -G-----------------------------------S---------S---QP------I
A0A2S0Q8C0      -G-----------------------------------S---------S---QP------I
W6FSX4          -G-----------------------------------S---------S---QP------I
A0A218Q4C1      -G-----------------------------------S---------S---QP------I
A0A6P1ZT04      -G-----------------------------------R---------S---QP------I
A0A0R0M9H9      -G-----------------------------------N---------A---EV------L
A0A1S1ZVW2      -G-----------------------------------N---------V---EV------L
A0A1B7WX82      -G-----------------------------------S---------S---DA------L
A0A1B7WTD1      -G-----------------------------------N---------S---NS------L
A0A480ABC0      -G-----------------------------------N---------S---NS------L
A0A1Z4LRU5      -G-----------------------------------N---------G---VS------V
A0A1Z4JVB4      -G-----------------------------------T---------S---AD------V
K9PIA4          -G-----------------------------------N---------S---KY------V
A0A1Z4HVE1      -G-----------------------------------T---------S---ES------V
A0A252ECZ1      -G-----------------------------------N---------S---EF------V
A0A1Z4G5Y1      -G-----------------------------------S---------S---EF------V
A0A252DNA2      -G-----------------------------------S---------S---EF------V
A0A252E1Q4      -G-----------------------------------S---------S---EF------V
A0A6G9SK36      -G-----------------------------------D---------S---EY------M
A0A1Z4M597      -G-----------------------------------N---------S---EY------M
A0A1Z4MWT1      -G-----------------------------------N---------S---EY------T
A0A1Z4TX53      -G-----------------------------------N---------S---EY------T
A0A5P8VSD1      -S-----------------------------------S---------S---QP------I
A0A2A2TNQ5      -G-----------------------------------V---------G---ES------V
A0A3S1C4K5      -D-----------------------------------T---------K---QP------V
A0A1X4G3D5      -G-----------------------------------N---------V---GA------L
D4TNI2          -G-----------------------------------N---------V---GA------L
A0A1Z4H6Z8      -G-----------------------------------S---------S---ES------V
A0A1Z4NPM1      -G-----------------------------------G---------G---VA------V
A0A3F3KPR9      -G-----------------------------------N---------A---EV------L
D4TGN7          -G-----------------------------------N---------A---EV------L
A0A1Z4UZW9      -G-----------------------------------S---------S---ES------L
A0A0K2M5H0      -G-----------------------------------S---------S---EF------L
A0A1B7VSH4      -G-----------------------------------N---------F---ES------L
A0A1B7W126      -G-----------------------------------N---------F---ES------L
A0A3D4C6Q6      -G-----------------------------------N---------F---ES------L
A0A1B7UVJ4      -G-----------------------------------S---------S---DA------L
A0A1B7UTR1      -G-----------------------------------S---------S---KS------L
K7W0A4          -G-----------------------------------S---------S---KS------L
A0A5C0DRW9      -G-----------------------------------S---------S---KS------L
A0A6H2C088      -G-----------------------------------S---------S---KS------L
A0A1Q4RTR1      -G-----------------------------------G-------------------APQ
A0A1Z4SQV2      -G-----------------------------------S-------------------T-Q
A0A2H2XGN1      -G-----------------------------------S-------------------T-Q
A0A433UXH8      -G-----------------------------------K-------------------V-Q
A0A1U7HGH0      QG-----------------------------------Q---------------------T
K9XJD3          QG-----------------------------------Q---------------------A
K9SX01          -G-----------------------------------T---------N---EL------I
A0A4P7ZT55      ------------------------------------------------------------
A0A1E5QIR9      -G-----------------------------------N-----------------SPGAI
A0A1Z4IBC7      -G-----------------------------------N---------------------A
A0A1W5CPC7      -G-----------------------------------T---------------------A
A0A5Q0GKD1      -G-----------------------------------T---------------------A
Q3MDC6          -G-----------------------------------T---------------------A
A0A1Z4KM73      -G-----------------------------------T---------------------A
Q8YNX7          -G-----------------------------------T---------------------A
A0A367R4K6      -G-----------------------------------E---------------------A
A0A1E2WSV8      -G-----------------------------------T---------------------A
A0A2R5FRT9      -G-----------------------------------T---------------------A
A0A2K8T1B6      -G-----------------------------------T---------------------G
A0A235I9I0      -G-----------------------------------G---------------------A
A0A2D0HQT8      -G-----------------------------------G---------------------A
A0A2L2NU95      -G-----------------------------------K---------------------A
A0A367S084      -G-----------------------------------G---------------------A
A0A6P1A9A0      -G-----------------------------------T---------D---RVSQNAQSM
A0A1Z4SMD6      -G-----------------------------------PSGMNLVFGNR---QT------V
A0A2H2Y096      -G-----------------------------------PSGMNLVFGNR---QT------V
K9S8M8          -N-----------------------------------G-------TPA---SD------I
A0A1Z4NFV0      -G-----------------------------------A---------N---FN------T
A0A3M9ZEU1      -G-----------------------------------M---------Q---IP------I
A0A1Z4JK72      -G-----------------------------------A---------S---VQ------V
A0A0N7Z489      -G-----------------------------------S---------S---VQ------V
A0A0S3TXS2      -G-----------------------------------A---------N---VS------V
A0A2A2TPF8      -P-----------------------------------S--------KN---VK------I
A0A1Z4R0P8      -G-----------------------------------A---------N---VK------I
A0A0T7BUI3      -G-----------------------------------N---------Q---LE------V
A0A1Z4LP32      -G-----------------------------------R---------Q---QN------I
K9REP9          -G-----------------------------------R---------Q---QN------I
A0A1Z4SIJ3      -G-----------------------------------T---------T---DN------I
A0A2H2XPG4      -G-----------------------------------T---------T---DN------I
K9V3C7          -G-----------------------------------S---------S---QQ------I
A0A1Z4T6Y7      -G-----------------------------------T---------N---VK------V
A0A2H2Y561      -G-----------------------------------T---------N---VK------V
A0A1Q4S362      -G-----------------------------------T---------N---VK------V
A0A3S1CIN8      -G-----------------------------------T---------N---VK------V
A0A2A2TC28      -G-----------------------------------S----GKIGST---KN------I
A0A0C1NCB0      -G-----------------------------------S---------Q---RE------I
A0A2N6K7Q9      -G-----------------------------------I-------------PI------V
A0A2N6MXH6      -G-----------------------------------I-------------PI------V
A0A2N6M5A8      -G-----------------------------------I-------------PI------V
A0A2N6LL61      -G-----------------------------------I-------------PI------V
A0A0S3TP66      -G-----------------------------------I-------------PI------V
G6FP91          -G-----------------------------------I-------------PI------V
A0A1U7GYR5      -G-----------------------------------I-------------PI------V
A0A2N6KY52      -G-----------------------------------I-------------PI------V
A0A2N6KMP5      -G-----------------------------------I-------------PI------V
A0A2N6MA45      -G-----------------------------------I-------------PI------V
A0A4Q9J9V9      -G-----------------------------------I-------------PL------V
A0A328IGA1      -G-----------------------------------I-------------PL------V
A0A4D9CE41      -G-----------------------------------I-------------PL------V
A0A0M0SFT2      -G-----------------------------------I-------------PL------V
A0A1Z4TLC8      -G-----------------------------------I-------------PL------V
A0A0C2LFH0      -G-----------------------------------PSGVKQVLGTQ---QN------V
A0A1Z4IYV4      -G-----------------------------------TKGIKQVLGTQ---KN------V
A0A1Z4Q0T6      -G-----------------------------------TKGIKQVLGTQ---QN------V
A0A0C2PT44      -G-----------------------------------AKGIKQVLGTQ---QN------V
A0A1D2P6J4      -G-----------------------------------TKGIEQVLGTQ---KN------V
B4WP72          TN-----------------------------------G---------R---QQ------F
A0A2T1CIL7      -G-----------------------------------G---------K---QL------G
A0A433V7A0      MQ-----------------------------------Q---------P---IP-------
A0A2T1FTR8      VG-----------------------------------E---------Q---QFQGKLVEL
K9UA41          IG-----------------------------------E---------Q---QFQGKLVEL
A0A0C2LBE2      -G-----------------------------------S---------N---QQ------I
A0A433NN38      -G-----------------------------------K---------N---QQ------V
A0A2N6K0T2      -G-----------------------------------N---------N---QP------V
A0A2N6ML72      -G-----------------------------------N---------N---QQ------I
G6FQZ6          -G-----------------------------------N---------N---QQ------I
A0A2N6MQX9      -G-----------------------------------N---------N---QQ------I
A0A2N6KXT6      -G-----------------------------------N---------N---QQ------I
A0A2N6KGB9      -G-----------------------------------N---------N---QQ------I
A0A2N6L3Y5      -G-----------------------------------N---------N---QQ------I
A0A0S3TIS7      -G-----------------------------------N---------N---QQ------I
A0A1U7GW28      -G-----------------------------------N---------N---QQ------I
A0A2N6LW63      -G-----------------------------------N---------N---QQ------I
A0A328IH74      -G-----------------------------------N---------N---QQ------I
A0A4D9CIB0      -G-----------------------------------N---------N---QQ------I
A0A1Z4TQ63      -G-----------------------------------N---------N---PQ------I
A0A4Q9J8G2      -G-----------------------------------N---------S---QQ------M
A0A350Y0P6      -G-----------------------------------L---------K---QS------I
A0A352X940      -G-----------------------------------T---------G---EI------L
B8HTN4          QA-----------------------------------S---------R---KG------G
A0A6P1AFJ5      -G-----------------------------------S---------D---NVDSEVQFL
B0CAX4          -E-----------------------------------T---------K---QP------Q
A0A1Z4RN12      -G-----------------------------------P---------G---QQG-----L
A0A2T1CMF9      -G-----------------------------------P---------Q---QQG-----L
Q7NDC5          -G-----------------------------------R---------R---GLPDSLLDA
U5QGK3          -G-----------------------------------Q---------P---GLPDSLVDA
A0A2W4UY24      GS-----------------------------------D---------Q---IA------L
A0A0D8ZUV2      -------------------------------------A---------N---TN------S
A0A433VDI0      -D-----------------------------------A---------G---VR------R
A0A3D1PG43      -G-----------------------------------E--------------P------K
A0A2P8QQ72      -G-----------------------------------N--------------S------K
K9TZQ7          -G-----------------------------------N--------------S------K
A0A6N8G584      -G-----------------------------------N---------A---AA------T
A0A2G7GPR0      -G-----------------------------------N---------A---AA------T
K9XH68          -G-----------------------------------N---------A---AA------T
A0A1U7HW70      GG-----------------------------------N---------A---AA------T
A0A2S6VEJ8      -G-----------------------------------N---------A---AA------T
A0A140KBA0      -G-----------------------------------S---------Q---SASSV---A
K9XSG1          -G-----------------------------------S---------Q---SASSV---A
A0A2T1GMT4      -G-----------------------------------S---------Q---AQ------I
K9UI51          -G-----------------------------------S---------Q---AQ------I
K9QM62          -G-----------------------------------K---------R---TT------V
A0A1Z4FWI3      -G-----------------------------------N---------P---SN------I
A0A1Z4JYE7      -G-----------------------------------L---------G---QK------L
A0A2T1FXY4      -G-----------------------------------S---------Q---TK------V
K9TYI2          -G-----------------------------------S---------Q---TK------V
A0A1Z4QL41      -G-----------------------------------S---------Q---TQ------F
A0A252D4T4      -G-----------------------------------T---------S---AN------I
A0A252DJH5      -G-----------------------------------T---------S---AN------I
A0A252EB80      -G-----------------------------------T---------Q---VN------I
A0A6G9SKZ9      -A-----------------------------------V---------Q---PN------S
A0A1Z4HPW5      -A-----------------------------------G---------P---VN------Y
A0A1Z4MSN1      -A-----------------------------------G---------P---VN------Y
A0A1Z4U1C2      -A-----------------------------------G---------P---VN------Y
A0A0D6KV51      -A-----------------------------------G---------P---VN------Y
A0A1Z4MKF8      -A-----------------------------------G---------P---VN------Y
A0A2C6WC43      -G-----------------------------------S---------N---AQ------V
A0A1Z4L5A1      -G-----------------------------------S---------N---AQ------V
A0A367QD86      -G-----------------------------------N---------N---AQ------V
A0A235IZ96      -G-----------------------------------N---------Q---TQ------V
A0A2L2NGP0      -G-----------------------------------N---------Q---TQ------V
A0A2K8SM78      -G-----------------------------------N---------Q---TQ------I
A0A2R5FPC0      -G-----------------------------------N---------Q---TQ------I
A0A5P8W5T6      -G-----------------------------------N---------Q---TQ------I
A0A0F5YE28      -G-----------------------------------S---------Q---AV------V
U7QEH7          -G-----------------------------------S---------Q---AV------V
A0A3S1ATK5      -G-----------------------------------S---------S---AK------I
A0A2Z6CPH0      -G-----------------------------------Q---------Q---SQ------F
A0A1Z4GT50      -G-----------------------------------N---------Q---VK------I
A0A1Z4GIX0      -G-----------------------------------T---------Q---AQ------V
A0A2H6LC24      -G-----------------------------------T---------Q---AQ------V
B2J6N5          -G-----------------------------------N---------K---TE------V
A0A367RMI4      -G-----------------------------------N---------Q---TQ------V
A0A235HUM0      -G-----------------------------------N---------Q---TQ------V
A0A2L2NW47      -G-----------------------------------N---------Q---TQ------V
A0A1E2WUR1      -G-----------------------------------N---------Q---AP------V
A0A235IKU3      -G-----------------------------------N---------Q---TQ------I
A0A1U7MYU6      -G-----------------------------------S---------Q---SLAGTQIQI
A0A1D8TNX9      -G-----------------------------------S---------Q---SLASTQIQI
A0A6P0L6C2      -G-----------------------------------S---------Q---SLASTQIQI
A0A6P0MVH0      -G-----------------------------------S---------Q---SLAATQIQI
A0A6P0KJV0      -G-----------------------------------S---------Q---SLAGTQIQI
A0A6L9ZJG4      -G-----------------------------------S---------Q---SLAATQIQI
F4XKF3          -G-----------------------------------S---------Q---SLAGTQIQI
A0A1D9FX10      -G-----------------------------------S---------Q---SLAGTQIQI
A0A6P0Q0T0      -G-----------------------------------S---------Q---SLAGTQIQI
A0A6P0W5I0      -G-----------------------------------S---------Q---SLAGTQIQI
A0A3C0NJ41      -G-----------------------------------S---------Q---QQ------V
A0A352AG88      -G-----------------------------------V---------V---RP------V
A0A350Y374      -G-----------------------------------Y---------D---QF------V
A0A355DPX0      -G-----------------------------------Y---------D---QF------V
                                                                            

K9SLA9          ENLTTQNL----------------------RISDT---------QAQLISNLANLETSKY
A0A168TT23      ----------------------------------NVL-------------------AEYS
A0A0M1JWX9      RVPEA-------------------------QAFQNSV-------RVGLIQQMVAAASQIE
A0A2T1M1V6      TL-GD-------------------------SSTDS---------RTAIVADLIRSQSTAQ
A0A2G7GCS2      TLGGN-------------------------GTRDS---------RIEMIAELIRSQNNAA
K9XBH8          TLSGS-------------------------GTRDS---------RIDMIAELIRAQNTAS
A0A1Z4LJ30      SVGQN-------------------------T--------------AALAEQMILAESQAF
K9RI76          AIGEN-------------------------T--------------ASLAEQVILAESQVI
A0A352AE27      TMTGE-------------------------R--QG---------RATLIQQLILAESTAS
A0A3B8JH60      TVSTN-------------------------N--EG---------RATLIQQLATAESEAS
A0A3C0N766      TVSTN-------------------------N--EG---------RATLIQQLATAESEAS
K9W9J7          TVSTN-------------------------S--DG---------RATLIQQLVLAESEAS
A0A139WSU3      TVATD-------------------------S--QG---------RAALIQQQVLAESEAT
A0A433VN22      TIATD-------------------------S--QG---------RAVLIQQQLLSESEAE
Q7NF11          SLAGG-------------------------GNRDS---------RIDLILSLLEAERAAE
A0A1Z4JCS8      DFTTG-------------------------A--EG---------RNTLIEQLVLAETNAN
A0A6P0PI80      TLTDS-------------------------A--QG---------RAMLIQQLILAESAAS
A0A6P0WGT6      TLTDS-------------------------A--QG---------RAMLIQQLILAESAAS
F4XTX2          TLTDS-------------------------A--QG---------RAMLIQQLILAESAAS
Q7NJN6          SLGGN-------------------------SYRDS---------RIDLILQLVQSQAENG
U5QCC3          TLGGN-------------------------TYRDS---------RIDLILQLIQARSEGL
A0A3M1SVZ4      LKSIG-------------------------NLEFSQM-------EQELTQELVSLESERQ
A0A654SFI6      ------------------------------------------------------------
K9SSQ0          PADVT-------------------------PEGQSSI-------KQNLATQLFDTQTRLA
A0A2W1JIN9      SSVNI-------------------------APESARV-------GQDLSVQLIQGKIERL
A0A318AJV1      -----------------------------------------------------SLQAQAR
A0A6P0IC70      TISPS-------------------------DVASDQL-------SQELTSRYIISNTEQL
A0A6B3MUB5      TISPS-------------------------DVASDQL-------SQELTSRYIISNTEQL
A0A6M0B7N4      TISPS-------------------------DVASDQL-------SQELTSRYIISNTEQL
A0A6P0J9W3      TISPS-------------------------DVASDQL-------SQELTSRYIISNTEQL
A0A6P0ZWE1      TISPS-------------------------DVASDQL-------SQELTSRYIISNTEQL
A0A1U7N2U4      IIPPA-------------------------DVASDQL-------SQDFTSRFILAETERS
A0A1D9G1F2      IIAPG-------------------------DVASDQL-------SQDFTSRFILAETERS
A0A6P0PNZ7      IIAPG-------------------------DVASDQL-------SQDFTSRFILAQTERS
F4XV38          IIAPG-------------------------DVASDQL-------SQDFTSRFILAQTERS
A0A6P0W137      IIAPG-------------------------DVASDQL-------SQDFTSRFILAQTERS
A0A6L9Y9E2      IIPPA-------------------------DVASDQL-------SQDFTSRFILAETERS
A0A6P0SGR0      IIPPA-------------------------DVASDQL-------SQDFTSRFILAETERS
A0A6M0BK48      IIPPG-------------------------DVASDQL-------SQDFTSRFILAETERS
A0A6L9YZL1      IIPPG-------------------------DVASDQL-------SQDFTSRFILAETERS
A0A6P0KYM4      IIPPG-------------------------DVASDQL-------SQDFTSRFILSETERS
A0A6P0LSD6      IIPPG-------------------------DVASDQL-------SQDFTSRFILAETERS
A0A6P0X384      SISSL-------------------------DIASDEL-------SQTIITKFIEAETERL
A0A2P8QIL5      AASTS-------------------------NPATDKL-------SQDLATQLITGEVEAS
A0A2T1FLY5      AASTP-------------------------NAATDKL-------SQDLATQLITGEVEAS
A0A433W447      AASTP-------------------------NAATDKL-------SQDLATQLITGEVEAS
K9U1K8          AASTP-------------------------NAATDKL-------SQDLATQLITGEVEAS
K9UYB2          SIPDN-------------------------NIADDQI-------SQQLVSSLITSNIERA
A0A218QN17      SVATN-------------------------SVAGDQI-------SQELTSKLLANETERS
K9RKN2          SVRDN-------------------------QIASDEI-------SQELTSKLITNEIERL
A0A2I8ADV2      TIPTE-------------------------DVASDQI-------SQNLTTQLINNEVERV
A0A1W5CKM3      TANFN-------------------------NLSNDQI-------SQTLISDLITNDITRL
A0A5Q0GMF5      TANFN-------------------------NLSNDQI-------SQTLISDLITNDITRL
Q3MEW0          TANFN-------------------------NLSNDQI-------SQTLISDLITNDITRL
A0A1Z4KIC7      TDNFQ-------------------------DLANDQI-------SQTLISDLITNDITRL
Q8YSM5          TDNFQ-------------------------DLANDQI-------SQTLISDLITNDITRL
A0A1Q4S1H4      GNAVA-------------------------NISNDTL-------SQTLNSQLVTNTVEGT
A0A433VBU6      GNALT-------------------------SVSNDNL-------SQTLNSQLVTNTVEGT
A0A1Q4RZJ6      NNSNN-------------------------NIAGDPI-------SQDLTSQLITNEIERA
A0A1Z4SNV3      NSNLN-------------------------NVAGDAI-------SQDLTSKLITNEIERA
A0A2H2XJQ1      NSNLN-------------------------NVAGDAI-------SQDLTSKLITNEIERA
A0A3S5K358      VNNSN-------------------------NIAGDPI-------SQDLTSQLITNEIERA
A0A0T7BPJ4      S-QTT-------------------------NFASDDL-------TKDLTAQLITNQTESL
A0A0C1QS61      PVSPN-------------------------NVAADQV-------SQNFSAQLIANDIERT
A0A139X3R8      PVSPN-------------------------NVAADQV-------SQNFSAQLIANDIERT
A0A1Z4I7C5      TANFQ-------------------------DLANDQI-------SQNLISELITNDITRL
A0A0C2MDK7      SVSTK-------------------------NFAGDQL-------SQELNSKFILNRIEES
A0A1Y0RCK1      NASAK-------------------------NFAGDQL-------SQDLNSKFIVNRIEES
A0A1Z4PWZ0      TVSAN-------------------------NFAGDQL-------SQELNSKFILNRIEES
A0A0C2QLT0      TTSAN-------------------------NFAGDQL-------SQELNSKFILNSIEES
A0A1Z4J2K1      TSSAN-------------------------NFAGDQL-------SQELNSKFILNSIEES
A0A3S0ZSX0      AIPTN-------------------------AVASDRI-------SQDLTSQLLVNDVERT
A0A2N6K4T3      SISSG-------------------------SVAGDQI-------SQDLTSQLIINDVERL
A0A370CKT2      SISSG-------------------------SVAGDQI-------SQDLTSQLIINDVERL
A0A0S3TL97      SISSG-------------------------SVAGDQI-------SQDLTSQLIINDVERL
A0A2N6M8A0      SISSG-------------------------SVAGDQI-------SQDLTSQLIINDVERL
A0A2N6M9E1      SISSG-------------------------SVAGDQI-------SQDLTSQLIINDVERL
A0A2N6KJI4      SISSG-------------------------SVAGDQI-------SQDLTSQLIINDVERL
A0A2N6MZ77      SISSD-------------------------SVAGDQI-------SQDLTSQLIINDVERL
A0A2N6KT20      SISSG-------------------------SVAGDQI-------SQDLTSQLIINDVERL
G6FSN3          SISSG-------------------------SVAGDQI-------SQDLTSQLIINDVERL
A0A4D9CI02      SISSS-------------------------SVAGDKI-------SQDLTSELIINDVERL
A0A328I8B9      SISSS-------------------------SVAGDKI-------SQDLTSELIVNDVERL
A0A4Q9J4Z7      SISSS-------------------------SVAGDKI-------SQDLTSELIVNDVERL
A0A0M0SU69      SISSS-------------------------SVAGDQI-------SQDLTSQLIVNDVERL
A0A1Z4TIZ8      SISSS-------------------------SVAGDKI-------SQDLTSQLIVNDVERL
A0A0S3TYD7      PRATEDDL----------------------QMGQF---------RQQLVTELVMAEIEQM
A0A2T1DNG3      LLSTG-------------------------QLGGF---------DQTLIGQFVETQGSLS
A0A3S0Y9N9      ---EAGRLNKSKDSESIV------------QLKPQGL-------QQGLLTNYASAEAERL
A0A433UNK7      ---KSGRLNQSVEPEKIV------------QLRGQGL-------QQGLLGNYANVEAERL
A0A6P0ZKB8      ---KAGRLNQVKDAENIV------------QLRTLGL-------QQGLLGQFASVEAERL
U5QL42          TVASKGEPAPPAAPTSKAPAALPEARSLAAAPVRQTI-------QQSLASQLLSTQVTLS
A0A076HBF2      -------------------------------------------------NQLEAADAALS
A0A354B169      -------------------------------------------------SQLEAVDGALK
G4FMX5          -------------------------------------------------NQLEAVDAALN
Q0IDT5          -------------------------------------------------NQLEAVDAALG
A0A2D6FCW3      -------------------------------------------------NQLEAVDAALN
A3ZA21          -------------------------------------------------NQLEAVDAALS
A0A140K3H3      STQVSGTIS--------------------------TI-------Q-SLASMRSQVETEQA
K9XUB8          STQVSGTIS--------------------------TI-------Q-NLASMRLQVETEQA
A0A6H2NHD5      ---SLGHQG--------------------------AV-------SRDLMQQLVNTANQVE
A0A2P8W4F7      ---SLGYKG--------------------------SV-------SQGLMQQLVNTANQMQ
A0A5Q4E0Z4      ---ALGYQG--------------------------SV-------SRGLMQQLVDTANQMQ
A0A2P8VVX1      TLLSYLQLG--------------------------GI-------DFGLVSQILEADVTLE
A0A2P8WHY0      DIASLLQLG--------------------------GV-------DLSLVTDLLEADVAIA
A0A2T1CMT9      KLLQKQGLV--------------------------GS-------DTGIANTVNDSQARLT
A0A563VQJ3      GLLNAGD----------------------------NN-------KETILENFINLKIEEL
A0A1D8TX52      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A1D9G4T2      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A6P0PR27      NLLTEGQLG--------------------------GV-------DLNLVNELITSQINLV
A0A6P0WER7      NLLTEGQLG--------------------------GV-------DLNLVNELITSQINLV
F4XP71          NLLTEGQLG--------------------------GV-------DLNLVNELITSQINLV
A0A6L9YR57      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A6P0KZ31      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A6P0LPB8      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A6P0SEV1      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A6B3N2I8      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A6M0B891      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A6P0IJQ1      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A6P0J8J8      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A6P0ZSH6      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A1U7N5X9      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A6L9Z1V0      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A6P0LC12      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A6P0MVJ3      NLLTEGQLG--------------------------GV-------DINLVNELITSQINLV
A0A2W6ZAV2      --------------------------------------------------KLDSIKATLA
K9W742          NLLTEGQLG--------------------------ET-------DVNLTNKLLELESSIR
A0A3D1PBA3      NILTQGQLG--------------------------GI-------DLNLTNQLVDVQTNLN
K9XPB0          SLLRQGELV--------------------------NS-------KTNFIETITQSQADLK
A0A350Y7Z1      NLLTEGQLG--------------------------NN-------DLTLSSQLAEAQTTLQ
A0A352X2A7      TLLTEGQLG--------------------------EN-------DLDLSQKLAEAQSSIQ
A0A0D8ZYV0      DLLSQGQRG--------------------------GL-------DLNITAQLAEVQTSLS
A0A2T1FP73      GILQQGQLG--------------------------AL-------DLNLAGQLIEVQTNMN
A0A433VMS2      GILQQGQLG--------------------------AL-------DLNLAGQLIEVQTNMN
K9TYA7          GILQQGQLG--------------------------AL-------DLNLAGQLIEVQTNMN
A0A2P8QUE1      GILQQGQLG--------------------------AL-------DLNLAGQLIEVQTNMN
K9SA61          RLLTEGQMG--------------------------EL-------DLNLAGQLVETQTRLQ
A0A2G7GMH8      ---TAGQQG--------------------------QL-------DINLAGELVEAQTNLV
A0A6N8FU92      ---TAGQQG--------------------------QL-------DIDLAGKLVEAQTNLA
A0A2T1DWE8      GGLSVGQLS--------------------------AT-------DLTLANALVDAQVNLV
A0A1U7I8L3      NLLEKGQLG--------------------------KL-------DVNLSSKLLEEQTNVQ
A0A2T1DJL8      GLVAIGQLG--------------------------EN-------DLKFASALVESQVNLV
A0A1Z4J9W0      SLFATGQLG--------------------------EN-------DLKFASDLTDAQVEFF
A0A0N7Z5K9      ALFSTGQLG--------------------------EN-------DLKFASDLTQAQVDFF
A0A0S3TXC5      GLFSTGQLG--------------------------EN-------DLKFASDLTQAQVDFF
B8HNB0          PSSASSGS----------------------SDG-S-V-------VQGLTDKALEAQISLA
A0A563VS48      LLGNTNIL----------------------ALGES---------EEGQINEFANLGLERK
A0A318BJ18      -----------------------------------------------IQAEYREAVQREN
A0A3B8Y8H9      PQTSLTDLTA--------------------LTSPNTI-------REDILSSLLKAETQLE
A0A2W1JVB9      PTQGTGQL----------------------QVG-E-L-------QQRATSELVRFETERL
A0A6H1U102      VSQVDLSD----------------------VAGYGAI-------QQGLATQLLQLETELE
A0A7C3ZEJ3      VGQVDITD----------------------VSGYGKI-------QQDLAAQLLEVETELA
A0A563VLD6      SAEIINNTNTTTSITNATESESTTENSEVNSQG-N-I-------LASLGNQLLAAKHEIA
A0A2P8W9H0      ----------------------------------R-V-------QRELASYIRELENRDR
A0A6I5P386      ----------------------------------R-V-------QDQIANRIRELSERER
A0A318BG22      ------------------------------RAAYE-L-----------------ALNQER
A0A2T1E9V8      ISSYS-NL----------------------QVG-S-I-------QQDLITTLTKLEIDRL
A0A1Z4LN32      TQIAPSSL----------------------QIG-R-V-------KQELISRFVNLRSQRL
A0A2I8A9F5      IQIETARL----------------------QIG-E-I-------KRDLSLELGKLQSQRL
A0A218Q6R8      MQIPPTML----------------------QMG-E-I-------RQEIVSEFVKLKSQRL
A0A218QGE0      AAIAPGKL----------------------QMG-E-I-------KQNLTSDFVRLQSQRL
A0A3M2GQQ6      VAKVDLDE----------------------VTGSGAI-------KESLATQLLQVETEMS
A0A6H1U2X0      VAKVDLDE----------------------VTGSGAI-------KESLATQLLQVETEMS
K9TLQ0          R-----GL----------------------STP-NSL-------RSDLTGKLIETVNLME
K9QF04          PGVAS-------------------------PSK---I-------RTEIIEKLIAASNQFQ
K9W1T3          PLPNR-IV----------------------PLA-DGV-------QQSLITDFARASAERA
K9SGJ5          ---RAAQV----------------------GISTAVPASADGSIQQNLAGALFETQTTMA
A0A6N2JS94      ---KGNTA----------------------NITN----EPNSAIQQNLASQLFDAQTTLA
A0A6C2DSN4      ---KGNTT----------------------NIAN----EPSSLIQQNLASQLFDAQTNLA
L8MYT6          ---KGNTV----------------------NIAN----EPSSLIQQNLASQLFDAQTNLA
A0A352JGJ6      ---KG--T----------------------NITN----EPNSPIQQTLATQLFEAQTSLA
A0A1J5GLS2      ---GANSR----------------------NLTN----EPNSLIQQTLATQLFETQTNLA
A0A2W4W6M5      ---RGGNV----------------------NLTN----EPNSTIQQNLATQLFEAQTTLA
A0A2W7AN33      ----DSTA----------------------NITN----QPNSAIQQNLASQLFDAQTTLA
A0A256BLV2      ---RGSTT----------------------NITN----EPNSAIQQNLASQLFDAQTTLA
A0A2W6ZXF3      ---GVG-N----------------------NFTN----EPNSPIQQGLATQLFETQTTLA
A0A2Z5WX66      ---KGS-A----------------------NIAR----EPNSTIQQTLATQLFETQTSLA
K1XF69          ---SR-PFSR---------G------LL--RVM-D-V-------KNNKIEEFVNAEIRRL
B5W297          ---SR-PFSR---------G------LL--RVM-D-V-------KNNKIEEFVNAEIRRL
A0A6H2AL05      ---SR-PFSR---------G------LL--RVM-D-V-------KNNKIEEFVNAEIRRL
H1W7M8          ---SR-PFSR---------G------LL--RVM-D-V-------KNNKIEEFVNAEIRRL
A0A5Q4H6A5      ---GR-AFSR---------G------LL--RVM-D-V-------KNNQIEEFVNAEIRRM
D5A466          ---GR-AFSR---------G------LL--RVM-D-V-------KNNKIEEFVNAEIRRM
U5QJM6          ---DGKQAESLRDSLAGTLESNRTSSSTADRYG-E-L-------RVSLAGDLVKAENLYL
A0A1Z4RPC6      ------KVSE---------G------LL--QAG-N-V-------RENQLERFISLKIDEL
A0A2T1CMZ0      ------KVSE---------G------LL--QSD-N-L-------KDNQIEKFINLKIEEL
L8M4F7          ------QVSP---------G------LI--KNN-Q-Y-------APGQLEKFIELKIQEL
A0A140K2P2      ---GV-EISE---------G------LF--NND-G-L-------KENQLEKFITLEIDKI
K9XWX4          ---GV-EISE---------G------LF--NND-G-L-------KENQLEKFITLEIDKI
A0A140KB14      ---NT-KISE---------G------LL--RSD-G-N-------KENQLEKYISLEIDRI
K9XX88          ---NT-KISE---------G------LL--RSD-G-N-------KENPLEKYISLEIDRI
A0A563VSV6      ---GV-KVSD---------G------LL--QDN-R-F-------QENPLEKFINLKIEEL
L8LZE9          ---NV-QISD---------G------LL--QSDLG-Q-------KENPLERFISLKIDEL
A0A433NM31      ---QQPLLDQ----------------NL--QIG-E-L-------QQKLTEDYVKTEVERI
A0A1Z4NDS1      ---QQIQL-----------D------NL--QLG-D-L-------RQKLMEDYARAEAERS
U9VXM0          ---NQLDLPE---------D------DL--QSG-D-L-------EQELIAEYLRLDGEQS
A0A6M0RI13      ---NELNLPS---------D------DL--QSG-Q-L-------EQDLIAEYLRLDGATS
A0A6M0S1N5      ---NELNLPS---------D------DL--QSG-Q-L-------EQDLIAEYLRLDGATS
K9F4D9          ---NELNLPS---------D------DL--QSG-Q-L-------EQDLIAEYLRLDGATS
A0A6I5QPI5      ---EL-TVPV---------D-SLNVGRL--QLG-E-L-------RQNLIAELTSLEIERI
A0A1Z3HMQ0      ---QA-NISP---------G------DL--QMS-E-L-------SRQLTSQLTEAEVNRL
A0A433W533      ---TR-TLAD---------G------KL--QIG-E-S-------KQKLTEAYIQLEVERL
A0A2P8QWJ3      ---TR-TLAD---------G------KL--QIG-E-S-------KQKLTEAYIQLEVERL
A0A2T1FKP8      ---TR-TLAD---------G------KL--QIG-E-S-------KQKLTEAYIQLEVERL
K9U6L7          ---TR-TLAD---------G------KL--QIG-E-S-------KQKLTEAYIQLEVERL
A0A1E5QP61      ---NQ-AVDR---------R------DL--QIG-E-L-------QQQLTADLVNAEVQRL
U5DPF5          ---SP-AAGG-----AIPVDVAIASGTL--QLS-E-V-------EIQLTGDLVRAEVDRL
A0A6P0X488      ---EQ-LIPG---------D------SL--QMG-D-L-------EQSMTEDLVNAEIERL
A0A6P0UVD5      ---EQ-LIPG---------E------SL--QMG-E-L-------EQSMTENLINAEVERL
A0A6P0VDM0      ---EQ-LIPG---------E------SL--QMG-E-L-------EQSMTENLINAEVERL
A0A6M0G142      ---RQ-LVPG---------E------NW--QMG-E-L-------EQSMTEALVNAEVERL
A0A6P0MR53      ---EQ-QIPG---------E------SL--QMG-D-L-------EQSMTEALVNAEVERL
A0A3M2GIL5      ---QL-QLPR---------E------SF--EIG-L-V-------QQQLLLDLVDSEVQRL
A0A6H1TSJ9      ---QL-QLPR---------E------SF--EIG-L-V-------QQQLLLDLVDSEVQRL
A0A3M1PML8      ---DW-SSIR---------N------DL--QAG-A-L-------QQDLIGELVRLEVQRQ
A0A6M8BE85      ---DW-NNIR---------N------DL--QAG-A-L-------QQDLIGELVRLEVQRQ
A0A0T7BPZ0      ---ST-KLSI---------Q------NL--QIG-D-V-------RYELIADIVKTERERV
A0A352X442      ---EA-EVAT---------T------NL--QIG-Q-T-------KQDLAAKLVAAEVEQS
A0A6B3NF44      ---KQ-QVPT---------E------NL--QIG-E-L-------KEELAAALVDSQVERS
A0A6M0EPL4      ---KQ-QVPT---------E------NL--QIG-E-L-------KEELAAALVDSQVERS
A0A6P0K6L6      ---KQ-QVPT---------E------NL--QIG-E-L-------KEELAAALVDSQVERS
A0A6P0MRR9      ---KP-EVVNLASGQSQLLE------NV--ELS-S-D-------GQKIIHAYANLEAERL
A0A6P0UX57      ---RP-GVVTLASGQIQSLE------NV--EVS-R-D-------GQQIMYAYANLEAERL
A0A6P0X1X4      ---KP-GFITLASGQIQALE------NL--EFS-R-N-------GQETIHAYANLEAKRL
A0A0M0SHU3      ---NQ-QMST---------A------SL--QMG-E-V-------RQKLIEDLANTDKERA
A0A1D2PBN3      ---GR-QIPT---------L------NL--QTG-E-L-------RQKLLEDYARSEAERV
A0A0C2LVR7      ---SR-QIPT---------L------NL--QTG-E-L-------RQKLLEDYARSEAERV
A0A1Z4PQB9      ---DR-QIPT---------L------NL--QTG-E-L-------RQKLLEDYARSEAERV
A0A1Z4SFN6      ---NQ-QIPL---------ENVQNLQNL--QIG-E-L-------RQNLIQNFATTEAERV
K9PGI8          ---TK-TVIK---------G------NL--QIG-E-L-------RQGLIADFARSEVERA
Q7NEU3          ADSVN-NT----------------------GSP-KGITDRLGDLQVNLAAELIKAENAYR
A0A3C0N2P0      PDNAE-SL----------------------ASP-SSI-------RKDLAQKLVDTQNQIQ
A0A6P0JR04      TDLGD-LN----------------------TSP-NSI-------RLSLTQNLIETLNQQQ
A0A6B3M6M6      INSAE-AL----------------------AAP-SSV-------RLNLIENLVNASNQMR
A0A6P0KD09      TNSAE-AL----------------------AAP-SSV-------RLNLIENLVNASNQMR
A0A6B3NIJ0      TNSAE-AL----------------------AAP-SSV-------RLNLIENLVNASNQMR
A0A6M0F053      TNSAE-AL----------------------AAP-SSV-------RLNLIENLVNASNQMR
A0A6P2ATU9      AKSLA-------------------------ASP-NPI-------RLQLTQDFIGATNEKM
A0A352XE00      SDNLA-SL----------------------ASP-SSV-------RLEITKKLIDTKNEIQ
A0A6P0QC14      PSDAP-SL----------------------ASP-SSI-------RQDLTQKLVETTNQIQ
B4VS56          PENPE-SL----------------------ASP-SSL-------RLALTQQLVETTNQIN
A0A352AAQ3      PNNAE-SL----------------------ASP-SSL-------RLDLTQKLVETENQIQ
A0A350Y472      PNNPE-SL----------------------ASP-SSI-------RLNLTQKLVETKNQIQ
A0A355DVB4      PNNPE-SL----------------------ASP-SSI-------RLNLTQKLVETKNQIQ
A0A1Z4RMB9      QVSQG-LL----------------------EGQ-DGT-------KENQLERFITLKIDEL
A0A318B4H2      ------------------------------EGG-R-S-------RSDAEAALRAAQSKEA
B4WQE3          ------------------------------------V-------QEQLASRIRELNARDQ
A0A2K3BR24      ADDNF-SL----------------------QLS-S-L-------KIDLVGDLVKAQINYL
K9YXY1          ADDNF-SL----------------------QLS-S-L-------KIGLVGDLVKAQINYL
A0A0V7ZFJ4      S--ER-NL----------------------QIG-E-I-------KQNLTAELVKSEVERL
A0A0V7ZNJ9      T--ED-NL----------------------QVG-E-I-------KQTLTSELLKSEVERL
A0A367RIS1      P--DQ-DL----------------------QIG-E-L-------KQTLTANLVQVEVERL
A0A235IXQ2      P--EQ-DL----------------------QIG-E-L-------KQTLTANLVQVEVEKL
A0A1W5CNX3      P--EQ-DL----------------------QIG-E-L-------KQTLTANLVQVEVERL
A0A5Q0GJJ5      P--EQ-DL----------------------QIG-E-L-------KQTLTANLVQVEVERL
Q3MEB7          P--EQ-DL----------------------QIG-E-L-------KQTLTANLVQVEVERL
A0A1Z4KHN9      P--EQ-DL----------------------QIG-E-L-------KQALTANLVQVEVERL
Q8YT70          P--EQ-DL----------------------QIG-E-L-------KQALTANLVQVEVERL
A0A166IWU6      P--EQ-DL----------------------QIG-E-L-------KQALTANLVQVEVERL
A0A2S0Q8C0      P--EQ-DL----------------------QIG-E-L-------KQALTANLVQVEVERL
W6FSX4          P--EQ-DL----------------------QIG-E-L-------KQALTANLVQVEVERL
A0A218Q4C1      P--EQ-NL----------------------QIG-E-L-------KQALTANLVQVEVERL
A0A6P1ZT04      P--DQ-DL----------------------QIG-E-L-------KQALTANLVQVEVERL
A0A0R0M9H9      Q--QS-NL----------------------QIG-E-L-------KQGLTQDLVRSEVERL
A0A1S1ZVW2      Q--QS-NL----------------------QIG-E-L-------KQALTQDLVRSEVERL
A0A1B7WX82      P--QQ-NL----------------------QIG-E-L-------KQSLTEALVKSEVERL
A0A1B7WTD1      P--KQ-NL----------------------QIG-E-L-------KQALTQDLVKSEVERL
A0A480ABC0      P--KQ-NL----------------------QIG-E-L-------KQALTQDLVKSEVERL
A0A1Z4LRU5      R--EP-DL----------------------QIG-E-L-------KQSLTAELIKSEVERL
A0A1Z4JVB4      P--EQ-NL----------------------QIG-D-L-------KQNLSQDLVKAEVERL
K9PIA4          P--EQ-KL----------------------QMG-K-L-------KQTLTTDLVKSEVERL
A0A1Z4HVE1      P--EQ-NL----------------------QIG-Q-L-------KQILSQDLVKAEVERL
A0A252ECZ1      P--EQ-NL----------------------QIG-K-L-------KQNLTEELVKSEVNRL
A0A1Z4G5Y1      P--EQ-NL----------------------QIG-V-L-------KQNLTEALVKSEVDRL
A0A252DNA2      P--EQ-NL----------------------QIG-K-L-------KQNLTEELVKSEVDRL
A0A252E1Q4      P--EQ-NL----------------------QIG-K-L-------KQNLTEELVKSEVDRL
A0A6G9SK36      P--EQ-NL----------------------QIG-K-L-------KQTLTEELVKSEVERL
A0A1Z4M597      P--EQ-NL----------------------QIG-N-L-------KQTLTENLVKSEVERL
A0A1Z4MWT1      P--EQ-NL----------------------QIG-N-L-------KQTLTENLVKSEVERL
A0A1Z4TX53      P--EQ-NL----------------------QIG-N-L-------KQTLTENLVKSEVERL
A0A5P8VSD1      P--EQ-DL----------------------QIG-E-L-------KQTLTANLVQLEVQRL
A0A2A2TNQ5      K--EQ-DL----------------------QIG-E-L-------KQSLTGELVKSEVERL
A0A3S1C4K5      S--EK-NL----------------------QIG-Q-L-------KQTLTLDLVKSEVDRL
A0A1X4G3D5      G--ER-SL----------------------YMP-S-L-------KQGLTEELVKSEIEKL
D4TNI2          G--ER-SL----------------------YMP-D-L-------KQGLTEELVKSEIEKL
A0A1Z4H6Z8      P--EQ-NL----------------------QIG-E-L-------KQTLSEDLVKSEVEGL
A0A1Z4NPM1      P--ER-DL----------------------QIG-Q-L-------KQSLTADLVRAEADRL
A0A3F3KPR9      Q--QS-NL----------------------QIG-E-L-------KQGLTQDLVRSEVERL
D4TGN7          Q--QS-NL----------------------QIG-E-L-------KQGLTQDLVRSEVERL
A0A1Z4UZW9      P--KQ-NL----------------------HIG-E-L-------KQSLTQDLVKSEVERL
A0A0K2M5H0      S--KQ-NL----------------------QIG-E-L-------KQALTQDLVKSEVERL
A0A1B7VSH4      S--QQ-NL----------------------QIG-E-L-------KQTLTQDLVKSEVERL
A0A1B7W126      S--QQ-NL----------------------QIG-E-L-------KQTLTQDLVKSEVERL
A0A3D4C6Q6      S--QQ-NL----------------------QIG-E-L-------KQTLTQDLVKSEVERL
A0A1B7UVJ4      S--QQ-NL----------------------QIG-E-L-------KQSLTQELVKSEVERL
A0A1B7UTR1      P--QQ-NL----------------------QVG-E-L-------KQALTQDLVKSEVERL
K7W0A4          P--QQ-NL----------------------QVG-E-L-------KQALTQDLVKSEVERL
A0A5C0DRW9      P--QQ-NL----------------------QVG-E-L-------KQALTQDLVKSEVERL
A0A6H2C088      P--QQ-NL----------------------QVG-E-L-------KQALTQDLVKSEVERL
A0A1Q4RTR1      GLNER-DL----------------------NLD-S-L-------KQNLIAELVKLEVERT
A0A1Z4SQV2      ALNER-DL----------------------QID-P-L-------KQNLIAELVKLEVERT
A0A2H2XGN1      ALNER-DL----------------------QID-P-L-------KQNLIAELVKLEVERT
A0A433UXH8      NLNER-DL----------------------QID-P-L-------KQNLTAELVKLEVERT
A0A1U7HGH0      PNGNN-QL----------------------QVG-Q-I-------QQDLISDLIAAEIERQ
K9XJD3          LN-NS-QL----------------------QVG-E-I-------QQELISDLIAAEVERQ
K9SX01          S--DQ-DL----------------------QIG-G-A-------QLELITQLVTKEIERV
A0A4P7ZT55      ------------------------------QLD-A------------VASALQENAAQQA
A0A1E5QIR9      A--PG-NL----------------------QMG-Q-L-------QLDLMQQLVNSEVDRL
A0A1Z4IBC7      PVTQG-SL----------------------QVG-Q-L-------RQSLIADITRAEAQRV
A0A1W5CPC7      QVTQG-SL----------------------QVG-Q-L-------KQSIIADITRAESQRV
A0A5Q0GKD1      QVTQG-SL----------------------QVG-Q-L-------KQSIIADITRAESQRV
Q3MDC6          QVTQG-SL----------------------QVG-Q-L-------KQSIIADITRAESQRV
A0A1Z4KM73      QVTQG-SL----------------------QVG-Q-L-------KQSLIADITRAESQRV
Q8YNX7          QVTQG-SL----------------------QVG-Q-L-------KQSLIADITRAESQRV
A0A367R4K6      QVTEG-SL----------------------QVG-Q-L-------RQSLIADITRAEAQGV
A0A1E2WSV8      QITEG-SL----------------------QVG-Q-L-------RQSLIADITRAQAERV
A0A2R5FRT9      QITEG-SL----------------------QVG-Q-L-------RQSLIADITRAQAERV
A0A2K8T1B6      QITEG-SL----------------------QVG-Q-L-------RQSLIADITRAQAERV
A0A235I9I0      QITQG-SL----------------------QVG-Q-L-------RQSLIADITRAQAERV
A0A2D0HQT8      QITQG-SL----------------------QVG-Q-L-------RQSLIADITRAQAERV
A0A2L2NU95      QITQG-SL----------------------QVG-Q-L-------RQSLIADITRAQAERV
A0A367S084      QITQG-SL----------------------QVG-Q-L-------RQSLIADITRAQAERV
A0A6P1A9A0      A-----------------------------ASP-NPI-------RLQLTQQLIEATNQRQ
A0A1Z4SMD6      S--TG-KL----------------------QIG-Q-I-------KQNLASQLSQLQTQRQ
A0A2H2Y096      S--TG-KL----------------------QIG-Q-I-------KQNLASQLSQLQTQRQ
K9S8M8          N--PS--Y----------------------QSG-E-L-------HRTLTNNLVETENQRR
A0A1Z4NFV0      T--PE-RL----------------------EVQ-G-L-------REKLLNEYVQLQAQQA
A0A3M9ZEU1      S--EG-GL----------------------QLG-T-L-------RETLTANLIDAEVERI
A0A1Z4JK72      A--PG-AL----------------------QVG-D-I-------KRKLAESLATLQSQKL
A0A0N7Z489      S--PN-RL----------------------QVG-D-I-------KRNLAAALSTLQSQRA
A0A0S3TXS2      A--PG-AL----------------------QVG-D-I-------KRNLAAALSTLQSQRI
A0A2A2TPF8      D--PN-SL----------------------QLG-A-L-------KEQLLGESVRLQAQRL
A0A1Z4R0P8      S--PN-SL----------------------QLG-G-L-------KEQLVGESVRLQAQRL
A0A0T7BUI3      S--LS-NL----------------------QVG-K-I-------REDLANQYVQLKTKRQ
A0A1Z4LP32      S--NS-RL----------------------QIG-D-I-------KQNLVNQLVQLQTQKD
K9REP9          P--NN-RL----------------------QIG-E-I-------KQSLVNQLVQVQTQKD
A0A1Z4SIJ3      S--TN-KL----------------------QVG-K-I-------KQDLAVQYLQFQGQRQ
A0A2H2XPG4      S--TN-KL----------------------QVG-K-I-------KQDLAVQYLQFQGQRQ
K9V3C7          T--PG-NL----------------------QIG-D-I-------KQDLANQYVSLQSQRA
A0A1Z4T6Y7      S--PN-KL----------------------QLG-Q-L-------KEQLVGESVRLQAQRL
A0A2H2Y561      S--PN-KL----------------------QLG-Q-L-------KEQLVGESVRLQAQRL
A0A1Q4S362      S--PD-KL----------------------QLG-Q-L-------KEQLVGESVRLQAQRL
A0A3S1CIN8      S--PD-KL----------------------QLG-Q-L-------KEQLVGESVRLQAQRL
A0A2A2TC28      S--PT-NL----------------------QIG-K-I-------KEDLASQYVQLLAQRQ
A0A0C1NCB0      S--TD-KL----------------------QLG-K-I-------KQDMTVEYANLEKKRQ
A0A2N6K7Q9      S--PG-KL----------------------QIG-K-I-------REELTDKYVELKAERQ
A0A2N6MXH6      S--PG-KL----------------------QIG-K-I-------REELTDKYVEFKAERQ
A0A2N6M5A8      S--PD-KL----------------------QIG-K-I-------REELTDKYVEFKAERQ
A0A2N6LL61      S--PG-KL----------------------QIG-K-I-------REELTDKYVEFKAERQ
A0A0S3TP66      S--PG-KL----------------------QIG-K-I-------REELTDKYVEFKAERQ
G6FP91          S--PG-KL----------------------QIG-K-I-------REELTDKYVEFKAERQ
A0A1U7GYR5      S--PG-KL----------------------QIG-K-I-------REELTDKYVEFKAERQ
A0A2N6KY52      S--PG-KL----------------------QIG-K-I-------REELTDKYVEFKAERQ
A0A2N6KMP5      S--PG-KL----------------------QIG-K-I-------REELTDKYVEFKAERQ
A0A2N6MA45      S--PG-KL----------------------QIG-K-I-------REELTDKYVEFKAERQ
A0A4Q9J9V9      S--PS-KL----------------------QIG-K-I-------RESLVDNYVQLKAERQ
A0A328IGA1      S--PS-KL----------------------QIG-K-I-------RESLVDNYVQLKAERQ
A0A4D9CE41      S--PS-KL----------------------QIG-K-I-------RESLVDNYVQLKAERQ
A0A0M0SFT2      S--PS-KL----------------------QIG-K-I-------RENLVDNYVQLKAERQ
A0A1Z4TLC8      S--PG-KL----------------------QIG-K-I-------REEMVGNYVQLKAERQ
A0A0C2LFH0      A--PG-KL----------------------QIG-K-I-------KENLTTQYALIQAQRQ
A0A1Z4IYV4      P--PG-KL----------------------QVG-K-I-------KENLTSEFAKIQAQRQ
A0A1Z4Q0T6      P--PG-KL----------------------QVG-K-I-------KENLTSEFARIQAQRQ
A0A0C2PT44      P--PG-KL----------------------QVA-K-I-------KENLTSEFAKIQAQRQ
A0A1D2P6J4      P--PG-KL----------------------QIG-K-I-------KENLTSEFAKVQAQRQ
B4WP72          E--NS-NM----------------------QLG-E-L-------QQSLIELYLQLEVDRV
A0A2T1CIL7      SLKSK-LLSI--------------------SDG-A-S-------EQKMVAEYANLGVERS
A0A433V7A0      ---KG-NF----------------------QFG-E-T-------HQKLLEELVKTQAKNL
A0A2T1FTR8      Q-----------------------------PSG---I-------QGNLIADYAKSEAQRT
K9UA41          Q-----------------------------PSG---I-------QGNLIADYAKSEAQRT
A0A0C2LBE2      S--LG-NL----------------------QNG-S-L-------RQKLLEDYAGTEAQRV
A0A433NN38      S--LK-NL----------------------QIG-G-V-------RQNLIQDLANTEKVRL
A0A2N6K0T2      S--PA-NL----------------------QMG-E-V-------RQRLIEDLANTEKERV
A0A2N6ML72      S--TA-NL----------------------QMG-E-V-------RQKLIEDLANTDKERV
G6FQZ6          S--TA-NL----------------------QMG-E-V-------RQKLIEDLANTDKERV
A0A2N6MQX9      S--TA-NL----------------------QMG-E-V-------RQKLIEDLANTDKERV
A0A2N6KXT6      S--TA-NL----------------------QMG-E-V-------RQKLIEDLANTDKERV
A0A2N6KGB9      S--TA-NL----------------------QMG-E-V-------RQKLIEDLANTDKERV
A0A2N6L3Y5      S--TA-NL----------------------QMG-E-V-------RQKLIEDLANTDKERV
A0A0S3TIS7      S--TA-NL----------------------QMG-E-V-------RQKLIEDLANTDKERV
A0A1U7GW28      S--TA-NL----------------------QMG-E-V-------RQKLIEDLANTDKERV
A0A2N6LW63      S--TA-NL----------------------QMG-E-V-------RQKLIEDLANTDKERV
A0A328IH74      S--TA-NL----------------------QMG-E-V-------RQKLIEDLANTDKERA
A0A4D9CIB0      S--TA-NL----------------------QMG-E-V-------RQKLIEDLANTDKERA
A0A1Z4TQ63      S--TA-NL----------------------QMG-E-V-------RQKLIEDLANTDKERA
A0A4Q9J8G2      S--TA-NL----------------------QMG-E-V-------RQKLIEDLASTDKERA
A0A350Y0P6      P--LN-NL----------------------QSN-E-F-------QQQMMATLVNAEAERL
A0A352X940      P--TE-NL----------------------QIG-D-L-------KESMTKDLVKAEVERL
B8HTN4          SLPTS-NL----------------------QTG-A-S-------EQQLVDNFINAEVERL
A0A6P1AFJ5      A-----------------------------ASP-NPL-------RLQLTQSLVETNNKIL
B0CAX4          P--LR-NL----------------------QAG-E-S-------RQSLTDALVEAEVERL
A0A1Z4RN12      VNSVN-IA----------------------SLG-E-L-------KQSQLAEFAELGLQKE
A0A2T1CMF9      AGQIN-IL----------------------RLG-E-L-------KQGQLTEFADLGLRKE
Q7NDC5          NLGTG-RTEPAAVPDDLP------------RLD-A-V-------RQQLLKDLIAARVEEL
U5QGK3          SVAAE-AQAPAT-KDNLP------------RLD-L-V-------RQKLLKDLVDARVEEL
A0A2W4UY24      P--DD-DL----------------------QAG-E-L-------EQSLILSFLQLDAERA
A0A0D8ZUV2      PVQGA-NL----------------------QIG-E-S-------KQKLNEELVQSEAERL
A0A433VDI0      QVTSQ-QL----------------------QIG-E-S-------QQKLNEALVKLEEERS
A0A3D1PG43      QVPIK-DL----------------------QMG-A-L-------KQKLTEDFATSEVERL
A0A2P8QQ72      QVSNR-NL----------------------EAG-E-L-------QQKLAEDLVRAEVERL
K9TZQ7          QVSNR-NL----------------------EAG-E-L-------QQKLAEDLVRAEVERL
A0A6N8G584      EVSPS-NL----------------------QMG-Q-L-------RQELTQNYVNSEIQRL
A0A2G7GPR0      EVSPS-NL----------------------QMG-E-I-------RQELTQNYVNSEIQRL
K9XH68          EVSPG-NL----------------------QMG-E-I-------RQELTQNYVNSEIQRL
A0A1U7HW70      EVSPG-NL----------------------QMG-E-I-------RQELTQNYVNSEIQRL
A0A2S6VEJ8      EVSPG-NL----------------------QMG-Q-I-------RQELTQNYVNSEIQRL
A0A140KBA0      Q--LN-IL----------------------GLG-R-L-------KQEQISEFASLGLKKT
K9XSG1          Q--LN-IL----------------------GLG-K-L-------KQEQISEFANLGLQKT
A0A2T1GMT4      P--QG-LL----------------------KIG-D-L-------KQNLITELLRSQVQQT
K9UI51          P--QG-LL----------------------KIG-D-L-------KQNLITELLRSQVQQT
K9QM62          S--PK-LL----------------------QIG-E-L-------QQGLITDFLRSEVQRL
A0A1Z4FWI3      Q--PR-TL----------------------QIG-E-T-------KQNLINTFLQAEVQRQ
A0A1Z4JYE7      QFSPT-LL----------------------QIG-E-V-------RQNLINNFLQLELQST
A0A2T1FXY4      A--AG-LL----------------------QIG-E-L-------RQDLIENLLQSDVQRR
K9TYI2          A--AG-LL----------------------QIG-E-L-------RQDLIENLLQSDVQRR
A0A1Z4QL41      T--QG-FL----------------------QIG-E-L-------RQKLIQDFLQSEVQRI
A0A252D4T4      Q--PK-TL----------------------QIG-P-T-------KQDLIKEFLQSEVQRQ
A0A252DJH5      Q--PK-TL----------------------QIG-P-T-------KQDLIKEFLQSEVQRQ
A0A252EB80      Q--PQ-SL----------------------QIG-E-T-------KQNLIRDFLQSEVQRQ
A0A6G9SKZ9      Q--PK-TL----------------------QIG-E-T-------KQNLIRDFLQSEVQRR
A0A1Z4HPW5      Q--PK-TL----------------------QIG-E-T-------KQNLIREFLQSDVQRR
A0A1Z4MSN1      Q--PK-TL----------------------QIG-E-T-------KQNLIRDFLQSDVQRR
A0A1Z4U1C2      Q--PK-TL----------------------QIG-E-T-------KQNLIRDFLQSDVQRR
A0A0D6KV51      P--PK-TL----------------------QIG-E-T-------KQNLIRDFLQSEVQRR
A0A1Z4MKF8      P--PK-TL----------------------QIG-E-T-------KQNLIRDFLQSEVQRR
A0A2C6WC43      P--QN-LL----------------------QIG-E-L-------RQTLIQDFLQSEVQRF
A0A1Z4L5A1      P--QN-LL----------------------QIG-E-L-------RQNLIRDFLQSEVQRF
A0A367QD86      P--QN-LL----------------------QIG-E-L-------RQNLIQDFLQSEVQRY
A0A235IZ96      P--QS-LL----------------------QIG-E-L-------RQGLIQNFLQSEIQRF
A0A2L2NGP0      P--QS-LL----------------------QIG-E-L-------RQGLIQNFLQSEIQRF
A0A2K8SM78      P--QS-LL----------------------QIG-E-L-------RQNLIQNFLQSEIQRF
A0A2R5FPC0      P--QR-LL----------------------QIG-D-L-------RQNLIQSFLQSEIQRF
A0A5P8W5T6      P--QN-LL----------------------QIG-E-L-------RQNLIQSFLQSEVQRF
A0A0F5YE28      P--EG-LL----------------------QVP-QGQ-------KNNQLERFIANEIQRV
U7QEH7          P--EG-LL----------------------QVP-QGQ-------KNNQLERFIANEIQRV
A0A3S1ATK5      P--EE-QLQKTIASIGSGTQ------FPQGQAG-E-I-------RQKFIQDFLQVEVQRI
A0A2Z6CPH0      A--PR-LL----------------------QIG-E-L-------RQNLIQNFLQLEVQSF
A0A1Z4GT50      P--QG-QL----------------------QIG-E-L-------KQNLIKDFLQSEVQRN
A0A1Z4GIX0      P--QR-LL----------------------QIG-E-L-------RQTLIQNFLQLEVQRF
A0A2H6LC24      P--QR-LL----------------------QIG-E-L-------RQTLIQNFLQLEVQRF
B2J6N5          S--QN-LL----------------------QIG-G-L-------KQNLIQNFLQSEIQRI
A0A367RMI4      P--QN-LL----------------------QIG-E-L-------RQSLIQNFLQSEIQRF
A0A235HUM0      P--TS-LL----------------------QIG-E-L-------RQSLIQNFLQSEIQRF
A0A2L2NW47      P--QS-LL----------------------QIG-E-L-------RQSLIQNFLQSEIQRF
A0A1E2WUR1      P--QS-LL----------------------QIG-E-L-------RQNLIQNFLQSEIQRF
A0A235IKU3      P--QS-LL----------------------QIG-E-L-------RQGLIQNFLQSEIQRF
A0A1U7MYU6      T--QG-LL----------------------EVD-Q-L-------KQKLISDFIESEVKRR
A0A1D8TNX9      T--QG-LL----------------------EVD-Q-L-------KQKLINDFIESEVKRQ
A0A6P0L6C2      T--QG-LL----------------------EVD-Q-L-------KQKLINDFIESEVKRQ
A0A6P0MVH0      T--QG-LL----------------------EVD-Q-L-------KQKLINDFIESEVKRQ
A0A6P0KJV0      T--EG-LL----------------------EVD-E-L-------KQKLISDFIESEVKRR
A0A6L9ZJG4      T--QG-LL----------------------EVD-Q-L-------KQKLISDFIESEVKRR
F4XKF3          T--QG-LL----------------------EVD-Q-L-------KQKLINDFIESEVKRQ
A0A1D9FX10      T--EG-LL----------------------EVD-E-L-------KQKLINDFIESEVKRQ
A0A6P0Q0T0      T--QG-LL----------------------EVD-Q-L-------KQKLINDFIESEVKRQ
A0A6P0W5I0      T--QG-LL----------------------EVD-Q-L-------KQKLINDFIESEVKRQ
A0A3C0NJ41      P--TG-NL----------------------QIG-Q-F-------KEQLTSDFVKAEVERL
A0A352AG88      S--AS-SL----------------------QMG-D-F-------RQELTLNLVNAEVERL
A0A350Y374      A--TQ-NL----------------------QIG-E-F-------KNQLIKDFVNSEVNRL
A0A355DPX0      A--TQ-NL----------------------QIG-E-F-------KNQLIKDFVNSEVNRL
                                                                            

K9SLA9          GLRSRLEALSKLHQDYQKRIDSLPKIEQQQSQLERDLTLARVNYDHLLQQQTSLRSQLRQ
A0A168TT23      NLEAEVAALEDEIAANEERILALNQQGVQYNILRREFETNRELYDGMLQRLKEIGVAAGA
A0A0M1JWX9      VLKMRNQVLAQAAGMLSEYREQFPIVIRQYTDLMRELEVASQTLNQLLAQREQLRLEAAQ
A0A2T1M1V6      GLKQQASLLEKELDKLNNEVKFIAKNQGILIELQRKYEIAEGVYKGIIAQLSQNKINAFD
A0A2G7GCS2      GLQQQANQIASEINRVNAELNSITQNRSQLINLQRQYEIAEGVYKSILGQVEQTKTNPFS
K9XBH8          GLQQQANQISSEINRVSTELNNITKNRAQLLDLQRRYEIAEGVYKSIIAQVEQAKTNPFN
A0A1Z4LJ30      GMLKKAEQLQPTIDNLIKTLNGLPQKQATLLELQRQYDIAEGVYNGVVAQAEQAKLGSFS
K9RI76          GMQKKAEKLQPQIDKLSASLNSLPQKQAKLLELQRQYDIAEGVYNGVVAQIEQAKLGAFS
A0A352AE27      AQQRQATQLQSQAEQLNATLKLIPGHQAKLLELKRQYEVAEGVYKGLVAQIQKVNIDAFN
A0A3B8JH60      AQQRQADQLKSEIEKLNASLKALPGNQARVLELQRQVDVAEGVYKGLVAQVQKNNIDAFN
A0A3C0N766      AQQRQADQLKSEIEKLNASLKALPGNQARVLELQRQVDVAEGVYKGLVAQVQKNNIDAFN
K9W9J7          GQRRQAEQLQNEIQKLSTTLRTFPANQSRLLELQRQVDVAEGIYKGLVAQVQQNNIDAFD
A0A139WSU3      AQRRQAQQLNNQITQLQTTLKSFPVNQARLVELQRQVDVTEGVYKGLIAQIQQSNIDAFD
A0A433VN22      AQFQQARQLEKQITELQRYLNSLPAKQAQLLELQRQLDVAEGIYKGLVAQVQQKSVDAFD
Q7NF11          ARSRQSAQLGRTIEQATERLSAISTRQATLLDLQRRYELAEAAYKAIVAQMQQARLSAFN
A0A1Z4JCS8      GQQRQAEQLQQQIDQRQKILNQLPANQAKLNALQRQADVAEGVYKGLVAQTQQSNIDAFN
A0A6P0PI80      GQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFS
A0A6P0WGT6      GQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFS
F4XTX2          GQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLELTRQYDVAAGVYNGLVAQMEQVNLDAFS
Q7NJN6          ALTNQAARIGEKAASLEERLRTLAPQQSRLKELQRRYEIAEGIYRGLVAQVQQAKVNAFD
U5QCC3          AQNSQANQITEKIDSIDSQLRTMAPQQSKLLELNRRYGIAEGVYKAMLAQVQQAKINAFD
A0A3M1SVZ4      GLNSQISALAQLQAGYQERLNVLPQLEQEERRLERQLELAQATYSQLQQKLQEVRLAESQ
A0A654SFI6      AASTREREIRKKLEEAKNKFLGQQTLTIQYGILKREVETNRQIYDALLQRYKELGAAGAG
K9SSQ0          TQTAELGSLKIAQTQVEQVFAQIPQLQQTYIELQRQLKQASTRLSTLSQKLEEAKSQEVQ
A0A2W1JIN9      SLQERLEAARGSMKQLESRRQQFPILEQWFTQMDRRREALFNSIQLLERKLDEVRVAEAQ
A0A318AJV1      AGDAQVASLRSTMAGLEAARARNTRNSADAERLERDAASARAQFDKMSAMSLESTQAAHA
A0A6P0IC70      ALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQREEATESLKFLQNKLEEARIAEAQ
A0A6B3MUB5      ALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQREEATESLKFLQNKLEEARIAEAQ
A0A6M0B7N4      ALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQREEATESLKFLQNKLEEARIAEAQ
A0A6P0J9W3      ALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQREEATESLKFLQNKLEEARIAEAQ
A0A6P0ZWE1      ALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQREEATESLKFLQNKLEEARIAEAQ
A0A1U7N2U4      ALEQKLYLVQTERIKLQNRLGQIPVLQQPFGTLVRRQDEAIASLKLLQNKLEEARIAETQ
A0A1D9G1F2      ALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARIAEAQ
A0A6P0PNZ7      ALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARIAEAQ
F4XV38          ALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARIAEAQ
A0A6P0W137      ALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEARIAEAQ
A0A6L9Y9E2      ALEQKLYLVQTERIKLQNRLGQIPVLQQPFATLVRRQEEAIASLKLLQNKLEEARIAEAQ
A0A6P0SGR0      ALEQKLYLVQTERIKLQNRLGQIPVLQQPFATLVRRQEEALASLKLLQNKLEEARIAEAQ
A0A6M0BK48      VLEQKLYLVQTERIKLQNRLGQIPVLGQPFATLVRRQDEAIASLKLLQNKLEEARIAEAQ
A0A6L9YZL1      VLEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQEEAIASLKLLQNKLEEAGIAEAQ
A0A6P0KYM4      VLEQKLYLVQTERIKLQNRLGQIPVLRQPFANLVRRQEEAIASLKLLQNKLEEARIAEAQ
A0A6P0LSD6      VLEQKLYLVQTERIKLQNRLGQIPVLRQPFANLVRRQEEAIASLKLLQNKLEEARIAEAQ
A0A6P0X384      ALQEKLKAVQVELTQLQYRLEQLPIAQKPFAALLRQQEEANNSLKFLQSKLEEARIAEAQ
A0A2P8QIL5      ALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIAEAQ
A0A2T1FLY5      ALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIAEAQ
A0A433W447      ALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIAEAQ
K9U1K8          ALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQRQEAVTSLEFLQRKLEEARIAEAQ
K9UYB2          AIENKLTLVNASVSELRSRLNQLPAQQRPLTALTRKREETATSLKFLQDKLEEARIAEAQ
A0A218QN17      AIENKLTTVKAQRTQLQVQIAKLPIQQKPLIALTREREDATASLKSLQSKLEEARITEAQ
K9RKN2          AVERKLAVVRAQTADLKARVAQLPIKQQPLTALVRQREESASTLKFLQGKLEEARLAQAQ
A0A2I8ADV2      AVENKLQTVQSLRKNLQAQLAVLPLRQQPLTMLTRQREEAAESLKLLQSKLEEARIAEAQ
A0A1W5CKM3      AVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAEAQ
A0A5Q0GMF5      AVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAEAQ
Q3MEW0          AVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAEAQ
A0A1Z4KIC7      AVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAEAQ
Q8YSM5          AVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQREEAAESLKFLQSKLEEAQIAEAQ
A0A1Q4S1H4      AVANKLRTLQAERVRLQNRLAQLPIKQEPLTALTRAREEAAESFKGLQRKLEEARIAEAQ
A0A433VBU6      AIANKLRTLQAERVKLQTRLAQLPIKQEPLTALTRTREQAAESFKALERKLEEARIAEAQ
A0A1Q4RZJ6      AVAEKLQLTQNNIAQLRNRLTQLPLQQQPLTALIRKREEAAASLKFLQAKFEEARIAEAQ
A0A1Z4SNV3      AITDKLRVTQNNIAQLRNRLTQLPLQQQPLTALVRKREEAAASLKFLQAKFEEARIAEAQ
A0A2H2XJQ1      AITDKLRVTQNNIAQLRNRLTQLPLQQQPLTALVRKREEAAASLKFLQAKFEEARIAEAQ
A0A3S5K358      AVAQKLQLTQNNIAQLRNRLTQLPLQQQPLTALIRKREEAAASLKFLQAKFEEARIAEAQ
A0A0T7BPJ4      AVQKKLRVIQAERANLQARLGKLPLQQQSVAALTRKREEAAESLKTLQRKLEEARIAEAQ
A0A0C1QS61      AVENKLKSVQTQRANLQLRLAQLPIQQQNLTPLTRQREEAAETLKLLQGKYEEARIAEAQ
A0A139X3R8      AVENKLKSVQAQRANLQTRFEQLPFKQQQLTPLTRQREEAAETLKLLQSKYEEARIAEAQ
A0A1Z4I7C5      AVENRLNAIRQMRADIQRRLALIPIRQQPLTVLTRQREEAAESLKFLQSKLEEAQIAEAQ
A0A0C2MDK7      AVKERLTLLQKKEADLQNRLAQLPIKQQQLTILTRKREEAAASLKFLQGKLEEARLTEAQ
A0A1Y0RCK1      AVNDRLKLLQTKKVNLQARLAQLPIKQQTLTVLTRKREEAAASLKFLQSKLEEARLTEAQ
A0A1Z4PWZ0      AVNDRLKLLQTTKTDLQKRLAQLPINQQTLMLLTRKREEAAVSLKFLQSKLEEARLTEAQ
A0A0C2QLT0      AVNNRLKLLQVKKANLQARLAQLPITQQTLTVLTRKREEAAASLKFLQSKLEEARLTEAQ
A0A1Z4J2K1      AVNNRLKLLQVKKANLQARLSQLPITQQTLTVLTRKREEAAASLKFLQSKLEEARLTEAQ
A0A3S0ZSX0      AVENKLRVVQANRANLQTRLAELPIRQQKLTPLIRQREESAASLKLLQSKLEEARIAEAQ
A0A2N6K4T3      AVENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQ
A0A370CKT2      ALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQ
A0A0S3TL97      AQENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQ
A0A2N6M8A0      ALENKLKLVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQ
A0A2N6M9E1      ALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQ
A0A2N6KJI4      ALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQ
A0A2N6MZ77      ALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQ
A0A2N6KT20      ALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQ
G6FSN3          ALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQREESAESLKLLQSKLEEARIAEAQ
A0A4D9CI02      AVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIAEAQ
A0A328I8B9      AVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIAEAQ
A0A4Q9J4Z7      AVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIAEAQ
A0A0M0SU69      AVEKRFRSVQAHRANLQARLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIAEAQ
A0A1Z4TIZ8      AIENKFRSVQANRANLQTRLAQLPIKQQQLTPLTRKREEAVESLKLLQSKLEEARIAEAQ
A0A0S3TYD7      SLEGQVESLSGALSAQQQRASTLPRLSTRQAELERRLRASQSTYESLLSKLQEIQVAEQQ
A0A2T1DNG3      TAQARYLSLLSSEQKVRAELQRFPQLLAQYERLKPDIELNRDTLKQLLKAQQDLGLEIAR
A0A3S0Y9N9      SLQVRLKALAEMIQSYRQRADTIPQLELQQRQLEREISATESSYQTLLARYQELQVAENL
A0A433UNK7      SLQVRLKSLAGVIESYRQRANTLPQLELQQRQLEREIAATDLSYQNLLARYQELQVAENL
A0A6P0ZKB8      SLQVRLTSLADVIESYRARANTLPQLELQQRELEREIVATESSYNSLLNRYQELQVAENL
U5QL42          VQKAQLASLTKAQNDIVARFKKIPQLQQQYTELQRDYNVNSQIVNGLLTKLEELRITEAQ
A0A076HBF2      LNAGRLATARMQQATLNQQFLQQPGLIKQYEALQQRLEIAKQNLAGLVSAREKFQLEIAQ
A0A354B169      LNAGRLAMARSQQQALTFQFLRQPALIKQFTDIMQDLKIAEENLAGLVSARENFQLEMAQ
G4FMX5          LNNGRLQTAQQQVAQLNAQFLKQPALIKQYEALQTRLTIANQNLAGLVSARENFQLEIAQ
Q0IDT5          LNANRLATARAQERTLQDNFLKQPALIKQYETLQTKLTLAQENLSGLVSARETFRLESAQ
A0A2D6FCW3      LNAGRLETAKAQETSLNNQFLKQPALIKQYEALQTRLKIAQENLTGLVTARENFQLEIAQ
A3ZA21          LNAGRLATAQAQERQLNVQFLRQPALIKQYEALQTRLKIAQDNLAGLVSARENFQLEIAQ
A0A140K3H3      ALQSQIAGIQQAKTKVEKTFKQIPQLQQYYAEVKRQFDIKSKAVDYLMQRRQELYIEQAQ
K9XUB8          SLQTQIAGIQRAKTQVENTFNSIPQLQQYYAELTRQFEVKSGAVNYLMQRRQELDINKAQ
A0A6H2NHD5      VLRTQDQATSQVTQQLQGEIQRLADLSRSYQQIARELAVTEDSLNQLLASRQDLRFKMAQ
A0A2P8W4F7      VLQTQDQAIGQVVQQLQAEIQRLADLSRSFQQIDRELTVAESSLNQLLASRQELRLQMAR
A0A5Q4E0Z4      VLETQDQAIGQAVQQLRAEIQRLADLSRSYQQITRELTVAESSLDQLLTSRQDMRLQMAR
A0A2P8VVX1      SLEARMETLASLESILRDEVNRYPSLMAEYDRLQPAVDTERSTLQELLIQREQISAELSR
A0A2P8WHY0      GISARWESLATQEQSLRQELNRYPSWIAEYDRLQPRVEIERATLQDLLLQREQISAELAR
A0A2T1CMT9      GIRQRDLSLAQTEAALKQRLVGFPELISQYRNLTQESEIKRQAVQRLLEAKQKLEIELSR
A0A563VQJ3      SLQQQLSSVSQSQQEYLKRADELPRLEKKEQELMRKADTANKTYTALLESLQQARLAENQ
A0A1D8TX52      SLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIKQNTLQQLLQARQELSIELAR
A0A1D9G4T2      SLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6P0PR27      SLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6P0WER7      SLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
F4XP71          SLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6L9YR57      SLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIKQNTLQQLLQARQELSIELAR
A0A6P0KZ31      SLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6P0LPB8      SLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6P0SEV1      SLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6B3N2I8      SLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6M0B891      SLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6P0IJQ1      SLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6P0J8J8      SLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6P0ZSH6      SLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A1U7N5X9      SLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6L9Z1V0      SLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6P0LC12      SLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A6P0MVJ3      SLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQVAIQQNTLQQLLQARQELSIELAR
A0A2W6ZAV2      ENRSEQAEVNRQALQLSRQFATNPNLVKQYEAIEQRLEIARANLSTYIKTREDFRLEVAQ
K9W742          GLMAREQTLAEKEQQLRVELERFPSVLADYNRLQPEIKLKRETLDQLEKARQELSLEIAR
A0A3D1PBA3      ALRARDVSLEQTQKQLRTDLNRFPVLLAEYNRLQPLLQINRNKLQQLLQAQQELSLEIAR
K9XPB0          GLEERDRSLAQTESELREKLTQFPALIARYDSLTQEANLKKNALQRLLAAKQELEIALSR
A0A350Y7Z1      ALQARDRSLAITQQQLRAKLNRLPELMAEYERLQPEVQIRRDTLQKLLEARQELGIEIAR
A0A352X2A7      GLQARDRSLAQTEQKLRTKINTLPQLMARYERMQPEVQLKRDTLQKLMQARQDLGIEIAR
A0A0D8ZYV0      ALQAQDVSLAKTEQGLRSQLNRFPKLLEEYNRLLPIVQINREKLQQLLRAQQELSLEIAR
A0A2T1FP73      AMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLEIAR
A0A433VMS2      AMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLEIAR
K9TYA7          AMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLEIAR
A0A2P8QUE1      AMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFVQINRDKLQQLLRAQQELSLEIAR
K9SA61          ALQARGRSLSQTEQQLTGELQRFPQLLAEYGRLEPQLQLRRETLQELLKARQELGLEIAR
A0A2G7GMH8      SLQANAQSLANAEQQLSAEIQRFPTLLAQYNRLLPEVSVNRETLQQLMTARQELGLQLAR
A0A6N8FU92      SLQANAQSLANAEQQLSAELQRFPGLLAQYNRLLPEVAVNRDTLQQLMTARQELGLQLAR
A0A2T1DWE8      ALQGRAQSLNEAERSLQQQLRRFPSLLAEYGRLQPNVQIGRNTLQQLLKARQDIALEIAR
A0A1U7I8L3      GWQARVQSLTQKAQQIQAELQRFPGMLSQYNRLEPEVKLNRDTLEQLLKARQELSLEIAR
A0A2T1DJL8      AAQARDRSLTNNELQLRGELKRFPSLLAEYNRLQPNVQVNRDTLQQLLKARQDLGLEIAR
A0A1Z4J9W0      GARARDQELARTEQQLRGQLQRFPSLLAEYNRLQPLVTLNRDTLDELQKARQDLSLEIAR
A0A0N7Z5K9      AARARDQTLAAEAQRLQSQLQRFPTLLAEYNRLLPTVKLQRDTLDQLEKARQGLGLEIAR
A0A0S3TXC5      AARARDQSLVAEAQRLQAQLQRFPTLLAEYNRLLPTVKLQRDTLDQLEKARQELGLEIAR
B8HNB0          TQTAQLNGIRQAQQQVAERFQALPQLQQQYAELQRQLKVNEDVVGRFMERLQELRIAEAQ
A0A563VS48      GLQKRLAAFNKIYSSNQERSSILPQLEEEQKELVRRVEASQTTYETLLNKLQEIQIAEEQ
A0A318BJ18      ALQARVNQLKASYLDNRRR-------SIQYNIYQQEVDTNRALYDGLLQRYKEVGVAGGV
A0A3B8Y8H9      ELRARQKELIGLENDIRQEIAQLARLTSEYVDLQRKIEIANQSLTSYLVFQQELELERAK
A0A2W1JVB9      AAEQVAAALATSQTDFQQRTEAIPALEKQLRQLLRDVEISQEIYANLVRKLQEIQVLEQQ
A0A6H1U102      AQRSQLQEIRNAQGKVAVQFEQIPQLQQRYADLQREFQVKSQAVNRFLEKLQELQIAEAQ
A0A7C3ZEJ3      AQSSQLQSIRQAQAQVENNFEKIPTLQQAYADLEREFKVKSEAVNRFLEKLQELQISEAQ
A0A563VLD6      ILESQIGGTDKAKAKVENSFQDVPQLQEAYAELERQLVVKSESLDYLLKRRQELQISLAQ
A0A2P8W9H0      ALSETIVTL-------NQTTNRLSTVTRQYNALQRELEIATTNLNQFLTKREALRIDAAQ
A0A6I5P386      ALSETIEAL-------NVETKSLSTVARQYNDIQRELDIATANLNQFLTKREALRIDAAQ
A0A318BG22      ALQVQLDQLKGSVSDLQTR-------SIQYMILQREVDTNRALYDALLQRFKEIGVAGGS
A0A2T1E9V8      GLITQKTTLLKQQAFYQKKAATLPELQQQQGELERQLLASQSTYETLLKSLQEIKVKENR
A0A1Z4LN32      GLTQKIDSLSDLKNRYKQRADVIPDLEKRQKELEQKLSIAQKNYENLETRLQEIKVAESQ
A0A2I8A9F5      GLEKRITSLSNLKSAYEQRLGAIPDLEKTHGELEQKMLIAQKNYENLLTKYQEIKIVESQ
A0A218Q6R8      GLAEKIQSISNFRNSYSQRVSNLPSLEKRQGELERKLSRAEKNYENLLTRFQDIKIVESQ
A0A218QGE0      GLEKKVEALSAVIASYKRRAQVMPNLEKQEGDLERRLSIAQKSYENLLTRQLEIEVAKNQ
A0A3M2GQQ6      AGLSQLARIRQAQQDVAIQFENIPQLQQRYAELQREFKVKSEAFNRFLEKLQELQIAEAQ
A0A6H1U2X0      AGLSQLARIRQAQQDVAIQFENIPQLQQRYAELQREFKVKSEAFNRFLEKLQELQIAEAQ
K9TLQ0          MTRARQWAIAQAETIVQQQMQEQATLMRQYTDLQRELELGTESLNRFLAVRENLQIESAQ
K9QF04          ALLARQKALAIAENQARRNLQQFAGIARQYADLSRDLEIANQSLNRFLVAKENLQIETAR
K9W1T3          SLEKQIYALANVEAAYRERINTLPKLEQQQRELERRLKTAQSTYEILSPKLQEIRVQENQ
K9SGJ5          VQAAQMGSVKLAQERVSAIFAQIPQLQQRYTELQRQLELDSAVFTSLSEKLEELRIAEAQ
A0A6N2JS94      VSQAQLESIRNAQTEVSTAFSKIPQIQQKYVEIQRQLALDSSTYNKLSEKLEELRISEAQ
A0A6C2DSN4      VSQAQLESIRNAQSEVAAVFSKIPQIQQRYVEIQRQLDLDTSTYNKLTEKLEELRISEAQ
L8MYT6          VSQAQLESIRNAQSEVAAVFSKIPQIQQRYVEIQRQLDLDTSTYNKLTEKLEELRISEAQ
A0A352JGJ6      VNQAQLESIRGAQSEVAKAFSQIPQIQQRYIEIQRKLALDTSTYQKLTEKLEELRISEAQ
A0A1J5GLS2      VSEAQLASIRSAQSEVSRAFSGIPQIQQRYVEIQRQLALDTSTYNKLTEKLEELRISEAQ
A0A2W4W6M5      VSQAQLESIRNAQAEVSSAFSKIPQIQQRYVEIQRQLALDTSTYNKLTEKLEELRISEAQ
A0A2W7AN33      VSQAQLQSIRNAQSEVSKAFSQIPQIQQKYVEIQRQLAIDSSTYNKLSEKLEELKVSEAQ
A0A256BLV2      VSQAQLESIRNAQSEVATAFSKIPQIQQRYVEIQRQLALDTSTYNKLSEKLEELRISEAQ
A0A2W6ZXF3      VSEAQLESIRSAQSEVSRAFSGIPQIQQRYVEIQRQLALDTSTYNKLTEKLEELRISEAQ
A0A2Z5WX66      VSQAQLESIRSAQAEVAKAFSQIPQIQQKYIEIQRQLALDTSTYNKLTEKLEELRISEAQ
K1XF69          DLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANK
B5W297          DLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANK
A0A6H2AL05      DLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANK
H1W7M8          DLTKQLDSLYEARDGLERRARILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANK
A0A5Q4H6A5      DLTKQLDSLYEARDGLERRASILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANK
D5A466          DLTKQLDSLYEARDGLERRASILPQLEQQQQELERKAEVARLTYRTLLQNLEEAQVAANK
U5QJM6          VQSARVTGLEAAKERLLGKFQLVPGLAKRYQELNRNAVIASDSLNRLLQRLQELEIKAAQ
A0A1Z4RPC6      SLQTELASLYKYQQVYLDRAKEVPRLEKEEQALLREVESTRSTYNTLLDNKQEIDILVNQ
A0A2T1CMZ0      SLQTELSSLYQYQQVYLNRAKQIPSLEQQEQSLLREVDSARSTYKTLLENKSDLDVLVNQ
L8M4F7          SLRRQNLALAQAQQIASKRAQAIPKLDSKEQELLLELKIADANYKNLLDSLEQVELELLQ
A0A140K2P2      NQQRQLSSLYQTQESYLERAQKLPSLEQKEKDLIRKVKAAQNTYETLLTSLQEVQLAENQ
K9XWX4          NQQRQLSSLYQTQQSYLERAQKLPSLEQKEKDLIRKVKAAQTTYETLLTSLQEVQLAENQ
A0A140KB14      SQQRQLASLYQSQQAYLQRARQLPQIEQQQQDLVRQVEAAEKVYQNLLDSQQELQLLQNQ
K9XX88          SQQRQLASLSQSQQAYLQRAKQLPQIEQQQQDLLRQVEAAEKVYQNLLDSQQELKLLQNQ
A0A563VSV6      SLQQQLSSTYDYQQAYLKRAEQLPKLEQREREINQKVETARSTYENLLSTQQELQILRNK
L8LZE9          SLQQQFASMNDYQQAYLQRAKELPRLEKEEQEAIRKVENIRTTYENLLNTQVELDILQNK
A0A433NM31      VFNNQLSALSKVYSNYKQRAGIIPQLQQKQRELEREVDAAQSTYATLLKKLEEVRIAENQ
A0A1Z4NDS1      GLARQLVSLQKQWLTYKQRANILPRLEQKQRELERKLKAAQTTYENLLNREQEIRIAENQ
U9VXM0          GLQQQVEQLANARLSQQSRARVIPVLEKQERGLERQLDAAQTTYETLLQNLQQAQVLENQ
A0A6M0RI13      GLQQQVEELTTARLGQQSRARVIPVLEKQERALDRQLAAAQTTYETLLQNLQQAQVLENQ
A0A6M0S1N5      GLQQQVEELTTARLGQQSRARVIPVLEKQERALDRQLAAAQTTYETLLQNLQQAQVLENQ
K9F4D9          GLQQQVEELTTARLGQQSRARVIPVLEKQERALDRQLAAAQTTYETLLQNLQQAQVLENQ
A0A6I5QPI5      GLSNRMSQLMEARANYLERANDLPELEKQQRELDRQLEAAQTTYETLLSQLQETRVIENQ
A0A1Z3HMQ0      SLASQVQALLDSRQAYIEWSQAFPALEKRQLELEQRLLAAKTNYETLLVRLQEAQLAENQ
A0A433W533      GLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTYEILLQKLQEVRVAENQ
A0A2P8QWJ3      GLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTYEILLQKLQEVRVAENQ
A0A2T1FKP8      GLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTYEILLQKLQEVRVAENQ
K9U6L7          GLASRLASLSGEYNLYKQRANILPKLEQQQRELERQLKAAQSTYEILLQKLQEVRVAENQ
A0A1E5QP61      GLGSNVSALVRAQGSYRDRANALPRLEQQQRDLQRQLDAAQSAYQILLRNLQEVRIAENQ
U5DPF5          GTSSRLSSLQREREAYQSRASVLPRLEQGQRELERQLNAAQSTYEALLQRLQEVRVTENQ
A0A6P0X488      GLINRVAALDSAKFTNQQRANILPRLQEGLRDLERKLAAAQSTYEILLKNYQEVQIAENQ
A0A6P0UVD5      GLTNRVAALDRAKLTKQQRANILPRLQEGLRDRERKLAAAQSTYEILLKNYQEVQIAENQ
A0A6P0VDM0      GLTNRVAALDRAKFTNQQRANILPRLQEGLRDRERKLAAAQSTYEILLKNYQEVQIAENQ
A0A6M0G142      GLANRVAALDRAKFNNQQRANILPRLQEGLRDRERKLAAAQSTYEILLKNYNEVQIAENQ
A0A6P0MR53      GLANRVAALDRAKFTNQQRANILPKLQEGLRDLQRKLEAAQSTYEILLKNYQEVQIAENQ
A0A3M2GIL5      GLVSQVRALEEARYSQQQRANVLPRLQEGLRELERKVNAAQSTYEILLKNLQEVQIVENQ
A0A6H1TSJ9      GLVSQVRALEEARYSQQQRANVLPRLQEGLRELERKVNAAQSTYEILLKNLQEVQIVENQ
A0A3M1PML8      GIVLRLNTLSEASNAYRQRASALPRLEQQQRELERRLNAAQTTYEALLLRLQEIQVAENQ
A0A6M8BE85      GIVLRLETLAQASNAYRQRAGALPRLEQQQRELERRLNAAQTTYEALLVRLQEIQVAENQ
A0A0T7BPZ0      VLERKLAKQKSTWAKYRERANALPKLAQTQRELERRLKASQTTYETLLTRLQEIHVAENQ
A0A352X442      GLSRQLAVLTTARIAYKERSNSLPRLQEKEKELERRVEATQLTYSQLLQKLDETRLIENQ
A0A6B3NF44      GLGDHLKELQKTRTAYKTRSNALPRLEQKQRELERKLEAAQSTYGILLSKLQETRVAENQ
A0A6M0EPL4      GLGDHLKELQKTRTAYKTRSNALPRLEQKQRELERKLEAAQSTYGILLSKLQETRVAENQ
A0A6P0K6L6      GLGDHLKELQKTRTAYKTRSNALPRLEQKQRELERKLEAAQSTYGILLSKLQETRVAENQ
A0A6P0MRR9      GLASKLTDLANTRATYKEQTRSFPKLEQKLGEMQRKLDIAQSTYQIILGKLQEAQVAENQ
A0A6P0UX57      GLVSELAVLSSTRATYKAQTRAFPRLEQKLGEKERELDIAQSTYQIIEGKLQEAQVAENQ
A0A6P0X1X4      GLASELAALSQKRATYKAQTRSFPRLEQKLGEKERELQIAQSTYQVIEGKLQEAQVAENQ
A0A0M0SHU3      GLEKRIAELKQTWSLYKQRANILPQLEQTQRELERKLKAAQTTYETLLTRLQEINVAENQ
A0A1D2PBN3      GLERQITTLSNKRSAYKQRANVLPKLEQTQRELERKLKAAQTTYETLLTRLQEIQVAENQ
A0A0C2LVR7      GLERQIITLSSKRSAYKQRANVLPKLEQNQRQLERKLKAAQTTYETLLTRLQEIQVAENQ
A0A1Z4PQB9      GLEKKIITLSSKRSAYKQRANVLPKLEQNQRQLERKIKAAQTTYETLLTRLQEIQVAENQ
A0A1Z4SFN6      GLSQQIATLSSKLSSYKQRVNVLPRLEQIQRQLERKLKASQTTYEALLTRLQEVQVAENQ
K9PGI8          GLEGEITTLSNKLSVYKKRANGLPKFEQTQRQLERKLKAAQTTYEALLTKLQEVQVAENQ
Q7NEU3          VQTARVAGLENVKNRMIGQFKVVPSLAKRYQELVRDSNLASNSLNRLLERLQELRIQAAQ
A0A3C0N2P0      VLEVRRNKIAKAESVVGQQLTALPDIARRYTDLQQQLKVATESLGRFLTVQETLQVEKAR
A0A6P0JR04      VLTVREAALQSAENQAKAEMQKFAVLNRQYTDLQRQLEVATESLKRFLSVQEDLQIEAAQ
A0A6B3M6M6      VLEARQTAIAKAESEMKNNLENLAVISRQYTDLQRQLKVSTESLNRFLAVRETLEIESAQ
A0A6P0KD09      VLEARQTSIAKAEGEMKKNLENLAVISRQYTDLQRQLKVSTESLNRFLAVRETLEIESAQ
A0A6B3NIJ0      VLEARQTSIAKAEGEMKKNLENLAVISRQYTDLQRQLKVSTESLNRFLAVRETLEIESAQ
A0A6M0F053      VLEARQTSIAKAEGEMKKNLENLAVISRQYTDLQRQLKVSTESLNRFLAVRETLEIESAQ
A0A6P2ATU9      VLEVRSAALALAENQTRQDLNRFADLSRQYMDLQRQLSVATESLNRFLAVQEDLQIESAQ
A0A352XE00      SLSVREAALERTENLMESQIKQLPIIARQYTDLQRELKVATESLNRFLAVRETLQIESAQ
A0A6P0QC14      LLEVRTREIAAAEGQLNQQLRNLPAIARNYTDYQRDLTAATESLGRFLAVRETLQIEASQ
B4VS56          MLEVRSGAIAKAERLMSQQLKNLAVVARQYTDLQRELKVATESLNRFLAVRETLQIEAAQ
A0A352AAQ3      VLQVRQTEIADAESRVSQQIKELPIIARRYTDLNRRLNVATESLSRFLAVREKLQIEESQ
A0A350Y472      VLEVRRNEIADAEIRLSQQLKTLPVIARRYGDLQRRLTVATESLNRFLAVQEKLQIDESQ
A0A355DVB4      VLEVRRNEIADAEIRLSQQLKTLPVIARRYGDLQRRLTVATESLNRFLAVQEKLQIDESQ
A0A1Z4RMB9      SRQRQVESLYQSQQEYLKRAKELPSLEKRDRELVRSAEAASKTYQTLLDSLQKAQIAENQ
A0A318B4H2      QFREQVANLTKNFNTQRTNL-------IEYQILQREVDTNRTLYDGLLQRYKEIGVA-GV
B4WQE3          ALRESIATL-------DEQIRNLSTVTRSYNSIQRDLEIAATNLNEFLTKRETLRIEAAQ
A0A2K3BR24      AQKSRIKGLKAEKADYQARAKILPKLEQRQRELERQLNASQSTYQALLKRLQEVRVAENQ
K9YXY1          AQKSRIKGLKAEKADYQARAKILPKLEQRQRELERQLNASQSTYQALLKRLQEVRVAENQ
A0A0V7ZFJ4      AAANRVGILRKNFITQQGRLRSLPKLEQTQRQLQRKLEVAQLTYTELLKKLQEVQVVENR
A0A0V7ZNJ9      AVAKQVGVLRKAFALQQARLTVLPKLEQQQRQVERKLQIAQLTYQNLLKKLQEVQVIENQ
A0A367RIS1      GLENQVGVLMKAFVLYQARLRTLPKLEQLQLQRQRQLQVAQTTYEQMLKRLQEVQVLENQ
A0A235IXQ2      GLKNQVSVLMKAFLLYQARLRSLPKLEQEQLEVKRQLEVAQTTYEQMLKRLQEVQVLENQ
A0A1W5CNX3      GLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVVENQ
A0A5Q0GJJ5      GLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVVENQ
Q3MEB7          GLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVVENQ
A0A1Z4KHN9      GLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVVENQ
Q8YT70          GLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQLQIAQTTYEQMLKRLQDVEVVENQ
A0A166IWU6      GLENQVGVLTNAFKQDRARLRILPKLQQQELQLQRQLQVARITYEQMLRRLQEVQVAENQ
A0A2S0Q8C0      GLENQVGVLTNAFKQDRARLKILPKLEQQQLQLQRQLQVARTTYEQMLRRLQEVQVAENQ
W6FSX4          GLENQVGVLTNAFKQDRARLKILPKLEQQQLQLQRQLQVARTTYEQMLRRLQEVQVAENQ
A0A218Q4C1      GLENQVDVLTQAFTFDQVRLRSLPRLEQQQLQLQRQLQVARNTYEQLLGRLQEVQLVENQ
A0A6P1ZT04      GLENQVDVLTQAFTFDQVRLRSLPRLEQQQLQLQRQLQVARTTYEQLLGRFQEVQLVENQ
A0A0R0M9H9      ALANQVKALQSVFIINRRRLDSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVLENQ
A0A1S1ZVW2      ALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVLENQ
A0A1B7WX82      ALTNKIGELQRVFIVNRRRLDSLPRLEQQQLQLQRQLSVAQLTYQEFLKQFQLVAVLENQ
A0A1B7WTD1      ALTNQVGELRKVFMVNKSRLDSLPRLEQQQLQLQRQLMVAQTTYQELLRQFQLVQVMENQ
A0A480ABC0      ALTNQVGELRKVFIVNKSRLDSLPRLEQQQLQLQRQLMVAQTTYQELLRQFQLVQVMENQ
A0A1Z4LRU5      AATNRVGLLRKAFVSNQARLSVLPKLEQQQRQLQRKLQVAQSTYQQLLKQLQEVQVVEKQ
A0A1Z4JVB4      ALANRVMELQRAYLLNKRRLDILPALEQQQLQLERQLKVARITYEQVSKQLQESEIIENQ
K9PIA4          ALARQLADLQQTFILSQKRLNSLPRLEQQQLQLQRQLQVARVTYEQFLRQLQEIQVLENQ
A0A1Z4HVE1      ALAKRVAELRQAYLINQRRLDILPRLEQQQLQLQRQLQVARVTYEQLLKQLQEVEVIENQ
A0A252ECZ1      AITNRLAELRQVYIVNQRRLDILPRLEQQQLQLQRQLQVARLTYEQLSKQLQEVEVIENQ
A0A1Z4G5Y1      AFTNRVATLRQVYLTNQRRLDILPRLEQQQLQLQRQLQVAKITYEQLMKQLQEVEVIENQ
A0A252DNA2      AVANRLAELRQVYVVNQRRLDILPRLEQQQLQLQRQLQVARVTYEQLLKQLQEVEVLENQ
A0A252E1Q4      AVANRLAELRQVYVVNQRRLDILPRLEQQQLQLQRQLQVARVTYEQLLKQLQEVEVLENQ
A0A6G9SK36      ALANQVGELQQTFIVNKERLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVENQ
A0A1Z4M597      ALTNQVAELKQVLLVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVENQ
A0A1Z4MWT1      ALTNQVAELQQVLIVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVENQ
A0A1Z4TX53      ALTNQVAELQQVLIVNKNRLDSLPRLEQQQLQLQRQLKVAQVTYEQLSKQLQEVEVVENQ
A0A5P8VSD1      GLENQVGVLRKDFVLYQARIRSLPKLEQLQLQLQLELEIAQTTYGQMMKRLQETQILENQ
A0A2A2TNQ5      AALQRVQVLRNAYITYETRMRQLPKLEQRQRGLERRLEVAQTTYQQVQKQLQEVEVVEQQ
A0A3S1C4K5      AVNNQVQVLQTAYLNYQGRLTAIPRLEQQQRALERKLQVAQSTYQQVLKQLQEVEVVEQQ
A0A1X4G3D5      TLSSNINALQNVLSIYKRRLTSLPRLGQQEARLRLRLEIVVTTYKQLQKQLQELEILQGE
D4TNI2          TLSSNINALQNVLSIYKRRLTSLPRLGQQEARLRLRLEIVVTTYKQLQKQLQELEILQGE
A0A1Z4H6Z8      ALQNRVAELRKAFIINKSRLDILPRLEQQQLQLQRQLQVARVTYEQLVKQLQEVEMIENQ
A0A1Z4NPM1      AAEQQVQVLSRALTDYQNRLAALPKLQQRQRALERKLQVAQSTYQQVLKQLQEVEVAEQQ
A0A3F3KPR9      ALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVLENQ
D4TGN7          ALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQLQVAQGTYQQLLKQLQEVQVLENQ
A0A1Z4UZW9      ALTKQVEELQRVFIVNRRRLDSLPRLEQQQLQLQRQLTVAQLTYQELLKQFQFIEVLENQ
A0A0K2M5H0      ALTKQIEELQRVFIVNRRRLDSLPRLEQQQQQLQRQLTVAQITYQEFLKQFQLVQVLENQ
A0A1B7VSH4      ALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQ
A0A1B7W126      ALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQ
A0A3D4C6Q6      ALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQLTVAQITYQEFLKQYQLVQVLENQ
A0A1B7UVJ4      ALTNKIGELQRVFIVKRRRLDSLPRLEQQQLQLQRQLSVAQLTYQEFLKQFQLVAVLENQ
A0A1B7UTR1      ALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITYQEFLKQFQLVQVLENQ
K7W0A4          ALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITYQEFLKQSQLVQVLENQ
A0A5C0DRW9      ALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITYQEFLKQFQLVQVLENQ
A0A6H2C088      ALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQLSVAQITYQEFLKQFQLVQVLENQ
A0A1Q4RTR1      GLSNRISTLSNALTLYKQRATSLPRLEQNQSQLERDLQVARQTYEQLLRRFQEVQVIENK
A0A1Z4SQV2      GLSNRVSTLGNAFTLYKQRAGILPRLEQNQRQLERNLQVARQTYEQLLRRYQEVQVIENK
A0A2H2XGN1      GLSNRVSTLGNAFTLYKQRAGILPRLEQNQRQLERNLQVARQTYEQLLRRYQEVQVIENK
A0A433UXH8      GLSNRVATLGNAFNLYKQRAKILPSLEQNQRQLERNLQVARQTYEQLLRRLQEVQVIENK
A0A1U7HGH0      GLISQQATLTQQQKAYLQKATNLPRLEQQQRELERELSAAQSTYEALLRSLQEIKVIENR
K9XJD3          GLISQQATLTQQQEAYLQKATHLPKLEQQQRELERELSAAQSTYEALLRSLQEIKVIENR
K9SX01          GLEKQIATINDSFIEYQKRLVNIPKLEQQLLVLQRAVEISRTAYEGLLVKQQDIQLTEEQ
A0A4P7ZT55      EVQRQLAQLEKAFRV------VGPELVKQYDALNQRLEIASENLSSYLKARESFRLEVAQ
A0A1E5QIR9      VVNSQLNELLNEYAIHKQRANALPRLQESQRDLERQVEVAQSTYQTLLTRLQEVRIAEEQ
A0A1Z4IBC7      GLERQITTLIQQRDAYIKRANYLPKLEQNQRELERRLQAAQGTYETLLKKRQEIDIAQNQ
A0A1W5CPC7      GLERQISTLLQQREAYIKRANYLPKLEQNQRELERRLQAAQGTYETLLKKRQEIDIAQNQ
A0A5Q0GKD1      GLERQISTLLQQREAYIKRANYLPKLEQNQRELERRLQAAQGTYETLLKKRQEIDIAQNQ
Q3MDC6          GLERQISTLLQQREAYIKRANYLPKLEQNQRELERRLQAAQGTYETLLKKRQEIDIAQNQ
A0A1Z4KM73      GLERQISTLLQQREAYIKRANYLPKLEQNQRELERKLQAAQGTYETLLKKRQEIDIAQNQ
Q8YNX7          GLERQISTLLQQREAYIKRANYLPKLEQNQRELERKLQAAQGTYETLLKKRQEIDIAQNQ
A0A367R4K6      GLERQINTLLQQRYAYARRANYLPKLEQTQRELERRLKAAQTTYETLLKKRQEIDIAQNQ
A0A1E2WSV8      GLERQIGTLLRQQDAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDVAQNQ
A0A2R5FRT9      GLERQIATLVRQQEAYIKRANNLPKLEQTQRELERKLQAAQTTYETLLKKRQEIDIAQNQ
A0A2K8T1B6      GLERQIATLLRQQDAYIKRANNLPKLEQSQRELERKLQAAQTTYETLLKKRQEIDIAQNQ
A0A235I9I0      GLERQIATLKEQQNAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDIAQNQ
A0A2D0HQT8      GLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDIAQNQ
A0A2L2NU95      GLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDIAQNQ
A0A367S084      GLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKLQAAQTTYETLLKKRQEIDIAQNQ
A0A6P1A9A0      ILEVRQVAIALAENQARQELQKMAAVIREYTDLQRELQVATESLNRFLTVRETLKIEEAQ
A0A1Z4SMD6      GLEKKILALSNIRDSYKQRLSILPNLEKKQGDLERTLSVAQKNYESLVNRSQEIQVAERQ
A0A2H2Y096      GLEKKILALSNIRDSYKQRLSILPNLEKKQGDLERTLSVAQKNYESLVNRSQEIQVAERQ
K9S8M8          GLREQVTALRESQVQYQQRANVLPQLEQRQRDLERQLATYQSTYDILSRNLQQVQIIENQ
A0A1Z4NFV0      GLASRVQELSNLHRIYRQRTTIIPNLEKRQGDLERRLGVAQKTYEHLLSRLQEIRVAENQ
A0A3M9ZEU1      SLLGQTQTLRNTLSAYRQRASTLPKLAQTQGELARRLQAAQSTYETLLTRLQEVQVAENQ
A0A1Z4JK72      GLEGRVGTLAGLQSSFRSRMAATPTLVKQQSELERKQDLAQKAYENLTSRLQEIQVARNQ
A0A0N7Z489      GLEGRITTLSGLLINYSSRAARTPALIQQESELERRQEIALTAYQNLNARKQEIEVAKNQ
A0A0S3TXS2      GLEGRISTLAGLLANYRSRAAQTPALIQQEGELQRRQEIALTAYQNLNARKQEIEVAKNQ
A0A2A2TPF8      GFENKVQTLTNLHQEYKKRANILPNLEKKQGDLERRLTVAQESYKQLLTRLQEVRVAENQ
A0A1Z4R0P8      GLANKVQTLTNLHQIYKRRANVLPNLEKKQGDLERRLEVAQESYKNLLTRLQEVRVAENQ
A0A0T7BUI3      GLQKKIAALQGVQQIYQKRLNAIPNLEKKQSDLERKLSVAKLNHENLNARLQEIQVAEKQ
A0A1Z4LP32      GLQNKLATLNNIKNDYQRKLAILPNLEKRQQDLERRLSVAQTDYENLITRQQEIELAEKQ
K9REP9          GLQTKLQTLTNIRDNYQQKLAILPNLEKQQTELERRLSVAQTDYENLITRLQEIELAEKQ
A0A1Z4SIJ3      GLEKKIRAMEAVQANYQQRLNVIPNLEKNLGDLERRQTLAQTNFQNLQDRLQEIEIAEKQ
A0A2H2XPG4      GLEKKIRAMEAVQANYQQRLNVIPNLEKNLGDLERRQTLAQTNFQNLQDRLQEIEIAEKQ
K9V3C7          GLEEKVQTLSSLHEAYKRRANIFPNLEKQQGELERSLTIAQKTYEELLTRQQAIRLAENQ
A0A1Z4T6Y7      GLENKVQTLSGLHEQFKQRAEVLPNLEKKQGDLERRLMVAQKSYETLLGRLQEIRVAENQ
A0A2H2Y561      GLENKVQTLSGLHEQFKQRAEVLPNLEKKQGDLERRLMVAQKSYETLLGRLQEIRVAENQ
A0A1Q4S362      GLESKVQTLSGIYEQFKQRAQVLPNLEKKQGDLERRLIVAQKTYETLLGRLQEIRVAENQ
A0A3S1CIN8      GLESKVQTLSGLHQQFRQRAQVLPNLEKKQGDLERRVMVAQKTYETLLGRLQEIRVAENQ
A0A2A2TC28      GLEKKVQTLLNIREGYQRKLSILPNLDKLQTDLERKFNIAQTDYQNLVARLQEIEIVEKQ
A0A0C1NCB0      GLEEKIKSLSDIRNGYKQRLTVMPNLEKKHGDLERRLDLAQKNYENLTLRLQEIQVAEKQ
A0A2N6K7Q9      GLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQ
A0A2N6MXH6      GLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQ
A0A2N6M5A8      GLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQ
A0A2N6LL61      GLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQ
A0A0S3TP66      GLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQ
G6FP91          GLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQ
A0A1U7GYR5      GLEKKIRTLSNIRANYQQQLAMVPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQ
A0A2N6KY52      GLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQ
A0A2N6KMP5      GLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQ
A0A2N6MA45      GLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRLEAAKTGYENLVTRLQEIQVAEKQ
A0A4Q9J9V9      GLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKLESAKNGYENLVTRLQEIQVAEKQ
A0A328IGA1      GLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKLESAKNGYENLVTRLQEIQVAEKQ
A0A4D9CE41      GLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKLESAKNGYENLVTRLQEIQVAEKQ
A0A0M0SFT2      GLEKKFRTLSNIRANYQQQLAVMPSLEKQQQGLERKLESAKNGYENLVSRLQEIQVAEKQ
A0A1Z4TLC8      GLEKKFRTLSNIRANYQQQLAVMPSLEKQQQGLERKLESAKNGYENLVSRLQEIQVAEKQ
A0A0C2LFH0      GLENKIQALSNIRGTYKQRLSALPNLEKKQGDLERRLSIAQKNYENLVTRLQDIEVAEKQ
A0A1Z4IYV4      GLESKIQALSNIQASYKQRLAMMPNLEKKQGDLERKLSISKKNYENLVSTLQEIEVAEKQ
A0A1Z4Q0T6      GLESKIQALSNIQASYKQRLAMMPNLEKKQGDFERKLSISKKNYENLVTRLQEIEVAEKQ
A0A0C2PT44      GLESKIQALSKIQASYKERLAMMPNLEKKQGDYERKLSISKKNYENLVTRLQEIEVAEKQ
A0A1D2P6J4      GLESKIEALSNIQASYKQRLAMMPNLEKKQGDFERKLSISKKNYENLVSRLQEIEVAEKQ
B4WP72          GLSQRVSELSDLQGVYRRRASTLPALEKTQRELERRLQASQTTYEALLTKLQEVQVAENQ
A0A2T1CIL7      GLLGKLAELESNLQVRQQNLEKLPLLEKQQRELERRVEATQSTYQTLLGQLQDTQVAENQ
A0A433V7A0      SLSSRLTSLENAKVRSQRRVSNIPKLEKDQRELQRKLDAAQSTYQLLLQRLQEVRVAENQ
A0A2T1FTR8      SLQKQIAALVYVVDAYKQRMNALPKLEQQQNALGRKLETTRTNYKTLLSKLQEIEIAENQ
K9UA41          SLQKQIAALVYVVDAYKQRMNALPKLEQQQNALGRKLETTRTNYKTLLSKLQEIEIAENQ
A0A0C2LBE2      GLVKQIATLSNQRTVYKERANILPKLEQTQRELERKLKAAQTTYETLLTRLQEVQVAENQ
A0A433NN38      GLEKQIADLNNTLFEYKQRANILPKLEETQRELERKVKAAQTTYENLLTRMQEVDVAENQ
A0A2N6K0T2      GLERRIAELTNTWSVYKQRANVLPKLEQTQRELERKLKAAQTTYETLLTRLQEINVAENQ
A0A2N6ML72      GLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQ
G6FQZ6          GLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQ
A0A2N6MQX9      GLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQ
A0A2N6KXT6      GLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQ
A0A2N6KGB9      GLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQ
A0A2N6L3Y5      GLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQ
A0A0S3TIS7      GLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQ
A0A1U7GW28      GLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQ
A0A2N6LW63      GLERRIAELTNTWSVYKQRANILPKLEQTQRELERKLKAAQTTYETLLTRIQEINVAENQ
A0A328IH74      GLEKRIADLRNTWSLYKQRANTLPRLEQTQRELERKLKAAQTTYETLLTRLQEINVAENQ
A0A4D9CIB0      GLEQRIADLRNTWSLYKQRANVLPRLEQTQRELERKLKAAQTTYETLLTRLQEINVAENQ
A0A1Z4TQ63      GLEKRLADLRNTWSLYKQRANIMPRLEQTQRELERKLKAAQTTYETLLTRLQEINVAENQ
A0A4Q9J8G2      GLEKRIADLRNTWSLYKQRANTLPRLEQTQRELERKLKAAQTTYETLLTRLQEINVAENQ
A0A350Y0P6      SLAQRVASLEQTKLTYKRRANILPKLQEGLRDLERQLEASQATYDILLKNYQQIRIAENQ
A0A352X940      GFVRQAAYLERAKLAYQQRANLLPRLQEGLRDFERQLGAAQSTYEILLRNYQDVRIAENQ
B8HTN4          ALSSQVTSLSRTEQTYQQRMNALPKLEQWLGELERRRVVAQTIYEGLLKTLQSLQISEQQ
A0A6P1AFJ5      LLKVREENLAKTELELRNSLDKLAELDRKHTDLQRNLKLKAENLQRFLLLRENLRIQQAQ
B0CAX4          GLEKQVLSLAQTQAENKRRQGIIPKLEQQLIALERDRIVAQTTYEELLKALQQITISENQ
A0A1Z4RN12      GLDKRLASLRSNYNNYQQRSDNLPQLQEQQRELQRRVDATQSTYKTLLAKLQEAEIIEQR
A0A2T1CMF9      GLEQRLASLKNSYNNYQKRSNLSPQLEEQQRQLERKLKSVTENYQTLLSKANEISIRQDY
Q7NDC5          AARTRTEALARVSAEYDARVAALPRLEESQRRLARQVEADQEAYRLLQKKFYEYRILEAQ
U5QGK3          AARTRTDALNSVSERYSSQVAAMPRLEETQRQLERQVEADSAAYKLLQTKFHEYRILEAQ
A0A2W4UY24      GLQQRLNQLTSAQAAQQSRAQLLPGLEKRNRELERELDAAQTTYETLLASRQQAQVLEKQ
A0A0D8ZUV2      GLAKQLALLSSTQDTYKQRANVFPKLEQNQRELERQLQASQSTYQSLLQKLQELKVAENQ
A0A433VDI0      GLTSQLAELSNAQATYKQRVSILPKLEQEQRELERRLAAAQSTYETLLKKIQEVRVAANQ
A0A3D1PG43      SLSSRLAYLSKNLSAYKQRANVIPKLEQQQQELERQVKASQATYEILLRKQQEVKVEENR
A0A2P8QQ72      SLSNRLKFLAQARTNYRQRATVLPQLEQQQRELERQVRAAQATYELMLKKLQELRVEQNR
K9TZQ7          SLSNRLKFLAQARTNYRQRATVLPQLEQQQRELERQVRAAQATYELMLKKLQELRVEQNR
A0A6N8G584      GLSSRLSSLNNTYNAYRQRVNVLPRLEQTQRELERRLNAAQSTYETLLRRLQEVRVAENQ
A0A2G7GPR0      GLTSRLSSLNNTYSAYRQRINVLPRLEQTQRELERRLEAAQSTYETLLRRLQEVRVAENQ
K9XH68          GLTSRLNSLNNTYNAYRQRVNVLPRLEQTQRELERRLEAAQSTYETLLRRLQEVRVAENQ
A0A1U7HW70      GLTSRLNSLNNTYNAYRQRVNVLPRLEQTQRELERRLEAAQSTYETLLRRLQEVRVAENQ
A0A2S6VEJ8      GLVSRLNSLNNTYNAYRQRANVLPRLEQTQRELERRLEAAQSTYETLLRRLQEVRVAENQ
A0A140KBA0      GLEQKLANLKQTKTDYQQRLSVLPNLEKRQKELERKTKAAQATYQTLLGKLQETQVAEKQ
K9XSG1          GLEQKLANLKQTKTNYQQRLAVLPNLEKRQKELERKTKAAQATYQTLLGKLQETQVAEKQ
A0A2T1GMT4      GLVNKLNSLQSSRAAYEKRVSVIPKLVQTQRQLERKLEVSQSTYQSLLKKLQELQVARNK
K9UI51          GLVNKLNSLQSSRAAYEKRVSVIPKLVQTQRQLERQLEVSQATYQSLLKKVQELQVARNK
K9QM62          GLAQRLTSLSNSRATYEQRMQKMPQLEQTLRELQRTLEVAQSTYQNLLRKTQELQVAEHK
A0A1Z4FWI3      GLAQKLTSLYNSRGAYEKRVKVIPQLEQQQRELERRLEVAQSTYQTLLKKIQELQVAEND
A0A1Z4JYE7      GLNQKLNSLLNTRSAHEKRMQILPKLAQQQRQLERKVEVAESTYQTLLKKVQELQVAENA
A0A2T1FXY4      SLAQKLASLSNSRSTYEQRKNIIPQLVQNQHELERRLVVAQSTYQTLLKKVQELQVAENK
K9TYI2          SLAQKLASLSNSRSTYEQRKNIIPQLVQNQQELERRLVVAQSTYQTLLKKVQELQVAENK
A0A1Z4QL41      GLAKRLASLYNSRSAYEQRTKIIPRLAQTQSELERTIEVAQSTYGTLLKKIQALQVAENQ
A0A252D4T4      GLAQKLNSLYNSRSIYEQRVKIIPQLEQQQRELQRRLDVAQSTYQTLLKKVQELQVAENN
A0A252DJH5      GLAQKLNSLYNSRSIYEQRVKIIPQLEQQQRELQRRLDVAQSTYQTLLKKVQELQVAENN
A0A252EB80      GLAQKLSSLYNSRSTYEQRVKIIPQLEQQQRELQRRLEVAQSTYQTLLKKVQELQVAENN
A0A6G9SKZ9      GFEQKLTSLYNSRSVYEQRVKIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENN
A0A1Z4HPW5      GLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENN
A0A1Z4MSN1      GLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENN
A0A1Z4U1C2      GLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENN
A0A0D6KV51      GLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENN
A0A1Z4MKF8      GLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRLEVAQSTYQTLLKKVQELQLAENN
A0A2C6WC43      GLSQRLASLYNSRTNYQKRVQVIPQLIQNQRELERKLEVAESTYQTLLKKVQELQLVENT
A0A1Z4L5A1      GLSQRLASLYNSRSNYQKRVQVIPQLIQNQRELERKLEVAESTYQTLLKKVQELQLVENT
A0A367QD86      GLSQRLASLYNSRSNYQKRVQVIPQLIQNQRELERKLEVAESTYQTLLKKVQELQLVENT
A0A235IZ96      GLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENT
A0A2L2NGP0      GLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENT
A0A2K8SM78      GLAKRLSSLSNSRSTYEQRVKIIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENT
A0A2R5FPC0      GLAKRLSSLSNSRFTYEQRVKIIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENT
A0A5P8W5T6      GLAKRLSSLSNSRLAYEQRVKIIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENT
A0A0F5YE28      ELTRQLDSLYASRINYEQRSQNLPQLEQEQQELQRKVQVAQVTYETLLKNLEEVQVAENK
U7QEH7          ELTRQLESLYTSRRNYEQRSQNLPQLEQEQQELQRKVQIAQVTYETLLKNLEEVQVAENK
A0A3S1ATK5      GLSKRLASLYNSRSGYQRRVKIIPMLVQNQRDLERKVEVAQSTYETILKKAQELQVAQNK
A0A2Z6CPH0      GFKQRLASLYNSRSVYERRMRFIPQLIQTQHELERKVEVDQSTYQNLLKKVQELQLAENR
A0A1Z4GT50      GLTKKLASLYNSRSAYEQRLKIIPLLVQNQRELEQKLEVAQSTYQTLLKKVQELQVAANK
A0A1Z4GIX0      GLTNRLASLYNSRSAYERRMKVIPQLAQTQRELERKVDVAESTYQTVLKKVQELQVAENK
A0A2H6LC24      GLTNRLASLYNSRSAYGRRMKIIPQLAQTQRELERKVDVAESTYQTVLKKVQELQVAENK
B2J6N5          GLAKRLSSLYNSRSIYEKRVKLIPQLAQNQRELERKAEVAESTYQTLLKKVQELQLVENT
A0A367RMI4      GLTQRLSSLYNSRVSYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENT
A0A235HUM0      GLTQRLSSLYNSRVSYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENT
A0A2L2NW47      GLTQRLSSLYNSRVKYEQRVKLIPQLAQNQRELDRKVEVAESTYQTLLKKVQELQLVENT
A0A1E2WUR1      GLTQRLSSLYNSRSTYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENT
A0A235IKU3      GLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKVEVAESTYQTLLKKVQELQLVENT
A0A1U7MYU6      SLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRLQAARLTYETLLKNLNELKVAENQ
A0A1D8TNX9      SLAEGLATLAKARIGYEQRVNVLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVAENQ
A0A6P0L6C2      SLAEGLSTLANARIAYEQRVNVLPRLEQTQQQLEQRLQAARLTYETLLKNLNELKVAENQ
A0A6P0MVH0      SLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVAENQ
A0A6P0KJV0      SLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRLQAARFTYETLLKNLNELKVAENQ
A0A6L9ZJG4      SLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRIQAARLTYETLLKNLNELKVAENQ
F4XKF3          SLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVAENQ
A0A1D9FX10      SLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRLQAARLTYETLLKNLNELKVAENQ
A0A6P0Q0T0      SLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVAENQ
A0A6P0W5I0      SLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRVQAARLTYETLLKNLNELKVAENQ
A0A3C0NJ41      GLANRLTQLSNTRSAYKQRLSILPKLEKEQRELQRRVEAAQSTYQALLKKQEELKLAENQ
A0A352AG88      GLASQLNELENVRLAYQQRLTILPKLEKDQRELQRRLDASQSTYEILLKKLQEVRVAENQ
A0A350Y374      GLKSKLDQLTNSRLIYKQRLNTLPKLEKEQRELQRRLDAAQLTYQTLLQKLQELRLAENQ
A0A355DPX0      GLKSKLDQLTNARLIYKQRLNTLPKLEKEQRELQRRLDAAQLTYQTLLQKLQELRLAENQ
                                                                            

K9SLA9          ISAGARIVSPATIP--TNA---IAP-NIPLNLSLGAILGLAFAGLVTFILAAIDKSIKTS
A0A168TT23      QENNIAVIDSALRP--GYP---VLP-DISRNLSIALLLGLVVGVGLALLLEFLDSTVHRT
A0A0M1JWX9      SETPWEIIALPEIPRNEDGELIPFSPNLLRNLVLGAMLGLMLGFGAALLVEQLDFVFHNP
A0A2T1M1V6      AYPNVQLIDGPSLN--PKP---LTA--SRKLIALGGLLASLFGSLSVLLLLESRNPLFNS
A0A2G7GCS2      VYPNVQTLDAPVID--PKP---EEP--SKRAIALGGILAGLFGSISLIFFLEKRNPMLRP
K9XBH8          VYPNVQTLDAPTID--PKP---EEP--SRRVIALGGILAALFGSVSLILFLESRNPMLSP
A0A1Z4LJ30      AYPSVQVLDQPIMD--TKP---VGP--KLRLMLLGALLACGFGSAAIILFSENRDPLLSP
K9RI76          AYPSVQVLDKPMVD--NKP---SGP--KLKLMLLGALLASGFGSAAIILFMENRNPLLSP
A0A352AE27      AYPNVQVLDPPTVS--SNP---TDP--KKTLIALNAFVASVVGSIALLLLLEARNPLLSP
A0A3B8JH60      TYPNVQVLDSPTVD--PKP---SSP--KKLLAALNALIASIVGSVALVLFLESRNPLLSP
A0A3C0N766      TYPNVQVLDSPTVD--PKP---SSP--KKLLAALNALIASIVGSVALVLFLESRNPLLSP
K9W9J7          TYPNVQVLDPAKVD--SKP---SGP--KRSIIVLSGLMASIIGSIALVLLLESRNPLLSP
A0A139WSU3      AYPNIQVLDAPQVD--PKP---VSP--KFLLMAVNALLASIIGSIALVLFLESRNPLLNL
A0A433VN22      AYPNVQVLDPPRVN--SKP---ISP--KLFLMAINALLASVIGSIALVLFLESRNPLLSA
Q7NF11          AFPDIEVLDKAYSN--PKE---ANP--RTLLIALGGLVAAVFGSLGLILRKEAINPLLGP
A0A1Z4JCS8      AYPNIQELNAPFVD--AKP---SSP--KKSLIAINALLASVIGSIALILLLEARNPLLTP
A0A6P0PI80      AYPNVQVLDPPTVD--EKP---AGP--KKLLIIANGFLASAVGSIALVLLLERRNPLLSP
A0A6P0WGT6      AYPNVQVLDPPTVD--EKP---AGP--KKLLIIANGFLASAVGSIALVLLLERRNPLLSP
F4XTX2          AYPNVQVLDPPTVD--EKP---AGP--KKLLIIANGFLASAVGSIALVLLLERRNPLLSP
Q7NJN6          AYPNVQILDAPSVD--SKP---S-P--SGLLVAVGGLVAMLSGSIALALWLERRNPMLGV
U5QCC3          TYPNVQVLDPPAVD--PKP---S-P--RLFLIVLGALLAMIAGSVALALLLERRNPLLAK
A0A3M1SVZ4      SLGNASLVSPALVP--DKP----IS-KKSLYQAMGIFLGGLAGVATALLLEVQDRSIKSV
A0A654SFI6      Q-NNIKLIDKADAP--LFP---YAP-SLLQNLLVALITGLIGAGALIYGRVVLSQTIKDP
K9SSQ0          EATAWQILQSPSLP--SYP---SSP-NVILNLLLAGLAGILVAAIIITVLENSDDRLQQV
A0A2W1JIN9      LLSNFRILDLSEPS--GKP---SDP-NIPVVLILGTLAGAVLSIGTVILLEALNRKLYSA
A0A318AJV1      AIAQAQIIDRADPP--VSP---APP-GKVLLSGLAMLASLGCGLATVIVMEMLQGGLRTI
A0A6P0IC70      LVSNIRIIAEAQVP--SLP---SEP-NKKVVLVLATAAGITLAIGIILLLEVIDNKLYDV
A0A6B3MUB5      LVSNIRIIAEAQVP--SLP---SEP-NKKVVLVLATAAGITLAIGIILLLEVIDNKLYDV
A0A6M0B7N4      LVSNIRIIAEAQVP--SLP---SEP-NKKVVLVLATAAGITLAIGIILLLEVIDNKLYDV
A0A6P0J9W3      LVSNIRIIAEAQVP--SLP---SEP-NKKVVLVLATAAGITLAIGIILLLEVIDNKLYDV
A0A6P0ZWE1      LVSNIRIIAEAQVP--SLP---SEP-NKKVVLVLATAAGITLAIGIILLLEVIDNKLYDV
A0A1U7N2U4      LVNNIQIIERAKLP--SSP---KEP-NPKVVLLIASAAGIALAVGMVLLLEVMDNTLHDG
A0A1D9G1F2      LVSNIQIIERAKLP--SSP---KEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNTLHDA
A0A6P0PNZ7      LVSNIQIIERAKLP--SSP---QEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNTLHDA
F4XV38          LVSNIQIIERAKLP--SSP---QEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNTLHDA
A0A6P0W137      LVSNIQIIERAKLP--SSP---QEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNTLHDA
A0A6L9Y9E2      LVNNIQIIERAKLP--SSP---KEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNTLHDA
A0A6P0SGR0      LVNNIQIIERAKLP--SSP---KEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNSLHDA
A0A6M0BK48      LVNNIQIIERAKLP--SSP---KEP-NPKVVLVIATAAGIALAVGMVLLLEVMDNTLNDA
A0A6L9YZL1      LVSNIQIIERAKLP--SSP---KQP-NPKVVLVIATAAGIALAVGMVLLLEMMDNTLHDA
A0A6P0KYM4      LVSNIQIIERAKLP--SSP---KQP-NPKLVLVIATAAGIALAVGMVLLLEVMDNTLHDA
A0A6P0LSD6      LVSNIQIIERAKLP--SSP---KQP-NPKLVLVIATAAGIALAVGMVLLLEVMDNTLHDA
A0A6P0X384      LFSNLKIIEEAELP--SEP---SGP-NQKAMLVLAIVAGVILAVGIILVLELIDNTLHED
A0A2P8QIL5      KVSNLRPVDLAEPP--RLP---TWP-NPAIVLVLATVAGGTLALGTVLLQEGLDGTLRNA
A0A2T1FLY5      KVSNLRPVDLAEPP--RLP---TWP-NPAIVLVLATVAGGTLALGTVLLQEGLDGTLRNA
A0A433W447      KVSNLRPVDLAEPP--RLP---TWP-NPAIVLVLATVAGGTLALGTVLLQEGLDGTLRNA
K9U1K8          KVSNLRPVDLAEPP--RLP---TWP-NPAIVLVLATVAGGTLALGTVLLQEGLDGTLRNA
K9UYB2          KVSNILIIDPAKPA--TIP---ASP-KIAVVLALAIAIGIVSAIALIILLEMLDNKLHDQ
A0A218QN17      KVSNLRLIEAAKPP--TIA---SSP-KRSAVLALATVFGTVLGTGVMLLLEVLDNTLKDA
K9RKN2          KVSNIRIIESATVP--ESP---SSP-KKPVVLALATIFGGILATGVILLLELMDNTLRDA
A0A2I8ADV2      KVSNLRIIELALVP--TDY---AYP-KRSVVLAIAIFFGSILATGVVLLLELMDNRLYEV
A0A1W5CKM3      KVSNIRIIETAVAP--ELP---TSP-KRTVVLVIAGFFGSILAVGLVLLLELMDNTLRDA
A0A5Q0GMF5      KVSNIRIIETAVAP--ELP---TSP-KRTVVLVIAGFFGSILAVGLVLLLELMDNTLRDA
Q3MEW0          KVSNIRIIETAVAP--ELP---TSP-KRTVVLVIAGFFGSILAVGLVLLLELMDNTLRDA
A0A1Z4KIC7      KVSNIRIIETAVAP--ELP---TSP-KRTVVLVIAGFFGSILAVGLVLLLELMDNTLRDA
Q8YSM5          KVSNIRIIETAVAP--ELP---TSP-KRTVVLVIAGFFGSILAVGLVLLLELMDNTLRDA
A0A1Q4S1H4      KVSNIRIIEVANVP--TLP---SEP-QPAIILAIAGAFGILLSTGMVLLLEMMDNRLHDV
A0A433VBU6      KVSNIRVIEVATVP--TVP---STP-KSTIILAIAGAFGILLSTGMVLLLEMMDNRLHDV
A0A1Q4RZJ6      KVSTLQVIQAAKAA--SIA---SSP-KPNVVLALAGAFGLLLATGVVILLEIMDNTLHDA
A0A1Z4SNV3      KVSNLQVIQVAQPP--TEA---SSP-KPKVVLALAGAFGLLLATGVVILLELMDNTLRDA
A0A2H2XJQ1      KVSNLQVIQVAQPP--TEA---SSP-KPKVVLALAGAFGLLLATGVVILLELMDNTLRDA
A0A3S5K358      KVSTLQVIQAAKAA--SFA---SSP-KPNVVLALAGAFGLLLATGVVILLEVMDNTLHDA
A0A0T7BPJ4      KVSNLSIIEFAKPG--TSP---SSP-KIPVVLVVATVFGTVLATGIILLLEAMDNTLRSG
A0A0C1QS61      QVGNLRIIEEAQPP--TSA---TSP-KKPAVLVLATVLGTLLATSIVLLLEMMDNTLRDA
A0A139X3R8      QVGNIRIIEEALPP--TVA---TSP-RRSSVLVLATALGTLLATSIVLLLEMMDNTLHDA
A0A1Z4I7C5      KVSNIRILETAVVP--ELP---SSP-KRNVILVMATFFGSVLAVGLVLLLELMDNTLRDA
A0A0C2MDK7      KVSNIRAIENAVAP--SSP---SQP-KQKVVLALAAAFGTMLAVGVVLLLEVMDNTLRDA
A0A1Y0RCK1      KVSNIRVIENAVAP--SSP---SEP-KQKVILALASVFGSVLAVGVVLLLELMDNTLRDA
A0A1Z4PWZ0      KVSNIRVIENAVPA--SSP---SDP-KPNVILALASVFGSMLAVGVVLLLEIMDNTLRDA
A0A0C2QLT0      KVSNIRVIENAVAP--SSP---SEP-KPKVILALASVFGTMLAVGIVLLLEVMDNTLRDA
A0A1Z4J2K1      KVSNIRVIENAVAP--SSP---SEP-KPKVILALASVFGSMLAVGVVLLLEMMDNTLRDA
A0A3S0ZSX0      LVGNIQIIEAAQIP--LKP---TSP-HKKAVLAIAIVFGSALATGIVLLLELMDNTLKDA
A0A2N6K4T3      LVGNIQIIEAAQPP--TKP---SLP-NKRSVLAIATLFGTALATGIVLLLELMDHTLKDA
A0A370CKT2      LVGNIQIIEAAQPP--TQP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTLKDA
A0A0S3TL97      LVGNIQIIEAAQPP--TKP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTLKDA
A0A2N6M8A0      LVGNIQIIEAAQPP--KKP---SLP-NKRSVLVIAIVFGTALATGIVLLLELMDHTLKDA
A0A2N6M9E1      LVGNIQIIEAAQPP--TQP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTLKDA
A0A2N6KJI4      LVGNIQIIEAAQPP--TKP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTLKDA
A0A2N6MZ77      LVGNIQIIEAAQPP--TKP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTLKDA
A0A2N6KT20      LVGNIQIIEAAQPP--TQP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTLKDA
G6FSN3          LVGNIQIIEAAQPP--TQP---SLP-NKRTVLAIAIVFGTALATGIVLLLELMDHTLKDA
A0A4D9CI02      LVGNIQIIEAAQPP--KKP---SLP-NKKAVLAIAIVFGTALATGIVLLLELMDHTLKDA
A0A328I8B9      LVGNIQIIEAAQPP--KKP---SLP-NKKAVLAIAIVFGTALATGIILLLELMDHTLKDA
A0A4Q9J4Z7      LVGNIQIIEAAQPP--KKP---SLP-NKKAVLAIAIVFGTALATGIILLLELMDHTLKDA
A0A0M0SU69      LVGNIQIIEAAQPP--KEP---SLP-NKKAVLAIATVFGIALATGIVLLLEFMDHTLKDA
A0A1Z4TIZ8      LVGNIQIIEAAQPP--KEP---SLP-NKKAILAIATVFGTALATGIVLLLELMDHTLKDA
A0A0S3TYD7      QLGNARITSKALIP--EKPTLLTSALGRSLLLAGSGGAGLLLAFAATVLAYLLDRRIRTV
A0A2T1DNG3      GGFAWQVVEQAQIG---AK---TGP-NLQKNLMLGLVVGILLGGVAAVSREVLDDSVHSS
A0A3S0Y9N9      QVSNARVITPALIP--TVP---IKS-RQYINLLQGFIGGILLGVATAFILEKMDKTIKTP
A0A433UNK7      QVSNARIVTPALIP--GVP---IRS-RQYINLLQGLIGGIVLGVATAFVLERLDKTIKTS
A0A6P0ZKB8      QVSNARVVTPALIP--SAP---VRS-RQYINLLQGFIGGIVLAVTTAFVLERLDKTIKTP
U5QL42          ETSPWRVLEPPDLP--DTP---VSP-KIDQNLLYGFIASVFLGLGAAFVPDLIDERIKGV
A0A076HBF2      RSVPWRVIAEPTIN--PKP---IKP-SVPRNLALGTVLGLVAGAAAGLLRDRMDHVFHHA
A0A354B169      RSVPWRVIAPPQIN--PRP---IEP-SISRNLALGAILGLVAGAFAGLLRDRLDHVFHTA
G4FMX5          RSVPWRVIDPPEIN--PNP---IKP-SIPRNLALGTLLGLVAGAGAGLLRDRKDHVFHSP
Q0IDT5          SSVPWRVIDPPEID--PNP---IKP-SIPRNLALGAMLGLVAGVAAGLIRDRFDHVFHLP
A0A2D6FCW3      RSVPWRVIDPPEIN--PNP---IKP-SIPRNLALGAVLGLVAGAAAGLLRDRMDHVFHHA
A3ZA21          RSVPWRVIDPPKIN--PDP---IQP-SVPRNLALGAVLGLVAGAGAGLLRDRLDHVFHHP
A0A140K3H3      ENAPWQILEAPPLP--SIP---ISP-NLERGILLALVAGSLMGVATAFLLQKLDQRVKQV
K9XUB8          ENAPWQILEAPRLP--NVP---ISP-NLQRGIFLALMAGGFMGVATAFLLQKLDQRVKQV
A0A6H2NHD5      QTSPWQLVSPLDQA--SVV---PVT-NLPRNLLLSTVISLLLGGGAALLRDKFDQVFHDV
A0A2P8W4F7      QASPWEIISPLSES--SIT---QTT-NLPRKLLLSTVIGLMLGGVAALLRDRMDQAFHST
A0A5Q4E0Z4      QTAPWELISPLDES--SIT---EMT-NLPRNLLLSTVVGLLLGGGAALLRDRADTAFHSA
A0A2P8VVX1      GGFSWEVVEPPLPG--QRI---G-P-DPVRPLALGIVAGLFVGGALAFGVESIDQRVRTS
A0A2P8WHY0      GGFDWQIVEPPDVG--DQI---G-P-DPLRPIALGVVAGLFVGGGLAFARDSMDKVVRTS
A0A2T1CMT9      GGNNWQVIEPPQAG--LQI---A-P-NLAKDLLLSLVVASFVGGFAAFVKDFTDETINTS
A0A563VQJ3      QTGNVDIIEEAIAP--ETG---S-S-GRMALILLGFLSGLFLSNLTAIALEWQDRTVKSI
A0A1D8TX52      GGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHSS
A0A1D9G4T2      GGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHSS
A0A6P0PR27      GGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTS
A0A6P0WER7      GGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTS
F4XP71          GGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTS
A0A6L9YR57      GGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHSS
A0A6P0KZ31      GGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHSS
A0A6P0LPB8      GGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHSS
A0A6P0SEV1      GGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHSS
A0A6B3N2I8      GGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTS
A0A6M0B891      GGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTS
A0A6P0IJQ1      GGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTS
A0A6P0J8J8      GGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTS
A0A6P0ZSH6      GGFNWQVVEAPLPG--SKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTS
A0A1U7N5X9      GGFNWQVVEAPLPG--LKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTS
A0A6L9Z1V0      GGFNWQVVEAPLPG--LKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTS
A0A6P0LC12      GGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHSS
A0A6P0MVJ3      GGFNWQVVEAPLPG--FKT---G-P-NMTQDLLLGAVVGLFLGGVAAFVREAMDDGIHTS
A0A2W6ZAV2      RTRPWRIISPPEFE--DTP---DKP-NLRNSLMLSILIGGVAGVGAALLRDRLDHVFHQP
K9W742          GGFDWQVVEQPLLG--EKT---G-P-KKAQIILLGAVAGVMLGGIAAFIRETMDDAVRSS
A0A3D1PBA3      GGFDWQALEEPKQG--QQI---G-P-NLKLNLLLGLVAGLMLGGVAAFLREAVDDSVHTS
K9XPB0          GAYNWQVIESPQLG--VQI---A-P-NTTKDILLSLVVASFLGGTTAFIKESLDEQLYNS
A0A350Y7Z1      GGFKWQVVEPPKPG--KQM---G-P-DTRRDLMLSVVVGLFLGGLAAFGREALDDAVHSS
A0A352X2A7      GGFKWQVVEAPLPG--EQI---G-P-NTKQDIMLAVVVGLFLGGIAAFGREFIDDGVHTS
A0A0D8ZYV0      GGFEWQALEQPVLG--LQV---G-P-NIKQNLLLGLVAGLMLGGVAAFLREATDDAVHTS
A0A2T1FP73      GGFDWQALEEPRLG--LKV---G-P-NLKLNLLLGLVAGLMLGSLAAFLRDAVDDSVHSS
A0A433VMS2      GGFDWQALEEPRLG--LKV---G-P-NLKLNLLLGLVAGLMLGSLAAFLRDAVDDSVHSS
K9TYA7          GGFDWQALEEPRLG--LKV---G-P-NLKLNLLLGLVAGLMLGSLAAFLRDAVDDSVHSS
A0A2P8QUE1      GGFDWQALEEPRLG--LKV---G-P-NLKLNLLLGLVAGLMLGSLAAFLRDAVDDSVYSS
K9SA61          GGFDWQVVEEPRTG--NQI---A-P-NLQRNLLLGAVAGLMLGAVAAFVREGVDDAVHTS
A0A2G7GMH8      GGFDWQVVEQPGIG--EQI---S-P-SIKRNLLLGIVVGLTLGCFAAFIREAVDDAVHSS
A0A6N8FU92      GGFDWQVVEQPDLG--EQI---S-P-SIKRNILLGVVVGLTLGCFAAFIREAVDDAVHSS
A0A2T1DWE8      GGFDWQVVEEPKLG--KQI---G-P-NVKQNILLGAVAGLMLGSVAAFIRDTMDDAVHNA
A0A1U7I8L3      GGFDWQMVEEPQLG--LQI---G-P-SMKRNLLLGAVVGLMLGSIVAFIRDMIDDAVHTS
A0A2T1DJL8      GGFDWQVVEQPKVG--QQI---G-P-NWLRNLLLGAVGGLMLGGVAAFLREAADDAVRTS
A0A1Z4J9W0      GGFDWQMVEQPKLG--RQV---G-P-SWMRNLLIGAAGGLMLGCVAAFLRESADKSIRTS
A0A0N7Z5K9      GGFDWQIVEQAKVG--RQV---G-P-NWLRNLLIGGAAGLMLGSVAAFLRESADKSIRTS
A0A0S3TXC5      GGFDWQVVEQSKVG--RQV---G-P-NWMRNLMVGAAGGLLLGCVAAFLRESADKSIRTS
B8HNB0          RTTSWRVLEPAYLP--TAP---ISP-NMSRAILLGLFAGVLAGIGLALLIERLDSRIHSV
A0A563VS48      DIGKARVVSEAVVP--EFP---IGP-QKKMMMITGGAIGTLLGIAVAFLIDIRDNTIKNT
A0A318BJ18      GVNNISVVDTADAP--RHP---SSP-KLLINLLLSLLAGLGIGALAAFVLEQMDEAIADP
A0A3B8Y8H9      TIYPWRLVSEIRTP--EEP---VSG--PLKLSVLGTFMGIVLGMGAGLLAEKLDDTFHNA
A0A2W1JVB9      NLGNARILSPALIP--EEP---IAP-RKLLYIFSGFVLGSLLAFGVALLLDSRDKSVKTL
A0A6H1U102      ETAPWRILEPPYQP--QNP---ISP-NIRRNLLLGLIAGGLLGVAAVILLERTDQRLQRV
A0A7C3ZEJ3      EIAPWQILEPPYLP--ENP---VSP-NIKRNLLLGLIAGGLLGIGAAILLERTDQRVKGV
A0A563VLD6      ETAPWKVLDKPYLP--HKP---ISP-NIQRGLALALAGGGFIGILTAWLLHQLDTRVKLI
A0A2P8W9H0      RQTPWEVLTPPSQP--RAS---AAS--AKRNLLLGTLLGLLLGAGAAIVVDRFSGKIYTI
A0A6I5P386      RQTPWELLTPAETP--RES---SAS--VKQNLLLGSILGLLLGCGAAIAWDRIKSKINTV
A0A318BG22      GANNVSVIDTARAP--GAP---ASP-ILWLNLLLAIGFGVLAGVGIAFIIEFVDDSIKMP
A0A2T1E9V8      TVGNVQIVEYAEIP--VVA---TNA-SNKSSMIAASLAGILVAGAVVYFLELTDKKIKTV
A0A1Z4LN32      TVGNASIVESAKVS--PSP---QVQKQKFIVTFGSIFVGLVLSIGSAYFVDLIDRRLKTA
A0A2I8A9F5      TIGNARILEYAEVD--SSP---KASKKKGLTLMVSVFGGLLVGIAVAFLLDVIDRRLKTA
A0A218Q6R8      TIGNARVLQYAEIG--SNS---SANKKKIIILLGGGFVGLLLGVAAAFFIDLIDRRVKTA
A0A218QGE0      TVGNAKVVEYAKVA--FSP---SVKKKKLVITLGSGFVGLLLGVASAFFVDLIDRRLKTT
A0A3M2GQQ6      ETAPWRVLEPPYEP--QLP---ISP-NVRRNLLLGLIAGGLLGVAAAILVERSDQRVKHV
A0A6H1U2X0      ETAPWRVLEPPYEP--QLP---ISP-NVRRNLLLGLIAGGLLGVAAAILVERSDQRVKHV
K9TLQ0          KAMPWQLISQPEVG--TVP---ISP-NLSRSLLLGGIAGLMAGIGAALLAEKLDTKFHSV
K9QF04          KVPPWQVISRIEAP--NKP---ISP-NPVRDLLLGGFAGLLAGIGTAIAVEKFDNKYHSP
K9W1T3          TVGNARIVTPASIP--ERA---IAP-KKAQNLAVGGLLGILLGIAVALALETTDKSIKDP
K9SGJ5          EISSWRVLDAALLP--LQP---IEP-NVLRNLVFGGFAGILFGVAIAMYLERSDERIREV
A0A6N2JS94      EISSWKVLEPPLIP--IRP---SSP-DIERSLITGAISGLVLGILLALLLNRLDQRIREV
A0A6C2DSN4      EISSWKILEPPLLP--VRP---SSP-DIERSLFISAIAGLGLGVLIALLLDRLDQRIREV
L8MYT6          EISSWKILEPPLLP--VRP---SSP-DIERSLFISAIAGLGLGVLIALLLDRLDQRIREV
A0A352JGJ6      EISSWRILEPPLIP--TRP---SSP-DIEKSLIAGTFIGLTLGILCALLFNRLDQRIREV
A0A1J5GLS2      EISSWRVLEPPLIP--TRP---SSP-DIERNLMTGAFVGAVLGILSALALDRLDQRIREV
A0A2W4W6M5      EISSWKVLEPPLIP--TRP---SSP-DIEKGLIAGAFFGLVLGISSALILNRLDQRIREV
A0A2W7AN33      EISPWKILEPPLIP--TRP---SSP-DILMNLFVGGISGLALGVLLALLLNRLDQRIRDV
A0A256BLV2      EISSWKILEPPLTP--IKP---SSP-DIERSLITGAISGIALGILFALLLNRLDQRIREV
A0A2W6ZXF3      EISSWRILEPPLIP--TRP---SSP-DIERSLITGAFVGAVLGILSALALDRLDQRIREV
A0A2Z5WX66      EISSWRVLEPPLIP--IRP---SSP-DIEKSLIIGALGGLVLGVLFALLLNRLDQRIREV
K1XF69          ITNNARIIETANVP--DEG---KTA-KVPLLAL-GVMGGLVASTTLLLLMEMGDKSLRTV
B5W297          ITNNARIIETANVP--DEG---KTA-KVPLLAL-GVMGGLVASTTLLLLMEMGDKSLRTV
A0A6H2AL05      ITNNARIIETANVP--DEG---KTA-KVPLLAL-GVMGGLVASTTLLLLMEMGDKSLRTV
H1W7M8          ITNNARIIETANVP--DEG---KTA-KVPLLAL-GVMGGLVASTTLLLLMEMGDKSLRTV
A0A5Q4H6A5      ITNNARIIETANVP--DEG---RTA-KIQLLAL-GVMGGLVASTTLLLLMEMGDKSLRTV
D5A466          ITNNARIIETANVP--DEG---RTA-KIQLLAL-GVMGGLVASTTLLLLMEMGDKSLRTV
U5QJM6          ELSPWRVIEPAVLPDKEKP---VWP-KPLVTLGVGSILSVVFGLLVAVLLETFDDRVKTV
A0A1Z4RPC6      QTGNAEVIELGKVP--DKG---STG-RVFLIAL-GVLMGLFLSNLTVILLEMQDRTLKTI
A0A2T1CMZ0      QTGNAQIIESGIVP--EEG---STG-RLPLIVL-GVLTGLFLANLTAILLEMQDHSLKTI
L8M4F7          ETSNVEIVEPALVP--IKG---TSS-KMKLLAL-GVMGGLFFSNAAVLLLETRDRSLKTI
A0A140K2P2      QNGNAQIIELAKLP--EKG---SSG-RMAFMLV-GILLGLLLSNLSVLLVEMQDRSLKTV
K9XWX4          QNGNAQIIELAKLP--EKG---SSG-RIAFMLV-GILLGLLLSNLSVILVEMQDRSLKTV
A0A140KB14      KSGNAQIIELAQLP--EEG---SSG-RLALMVL-GVILGLLLSNLSVLLLEMQDRSLKTM
K9XX88          TTGNAQIIELAQLP--EKG---SSG-RLALMVL-GLILGLLLSNLSVLLLEMQDRSLKTI
A0A563VSV6      QTGNAEIIEQAIAP--ENG---STG-RMALMLL-GILMGLLLSNLTAIYLDMQDRTIKTI
L8LZE9          QTANARIIEPAIAP--EKG---SSG-QLALMAL-GILSGLLLSNLTAIILDKQDRSLKNI
A0A433NM31      NVGNAQIVDVGRVA--EEP---VAP-KKLLNFALGGVAGIILAVFIALARDAVDTSIKTL
A0A1Z4NDS1      NIGNARIVSYALVP--DTP---AGP-KKILIIAAGAIAGFLCGVITAFALDLIDSSLKTV
U9VXM0          NVGNARIVSPALSP--TEP---IGP-SLKLFLLAGGFVGFLLGLIAAFFADIIDQSITTV
A0A6M0RI13      NIGNARIVSPALIP--NEP---LGP-SLKLFLMTGGFAGLLLGLITAFMADLLDQSVKTV
A0A6M0S1N5      NIGNARIVSPALIP--NEP---LGP-SLKLFLMTGGFAGLLLGLITAFMADLLDQSVKTV
K9F4D9          NIGNARIVSPALIP--NEP---LGP-SLKLFLMTGGFAGLLLGLITAFMADLLDQSVKTV
A0A6I5QPI5      TVGNVRVVSLAQIP--NSP---AGP-DRRMYLVAGGFMGVLLAIATAFLLDLLDSSVKTV
A0A1Z3HMQ0      TVGSAQILEPAAPP--RFP---VGT-STKKYIAAGGAVGLLLGVAMAFFLDLIDKSIKTV
A0A433W533      NMGNARIIESALAP--EKA---LSL-KPMIILAAGILLSVVLSSGTVAVLEIKDTSVKTL
A0A2P8QWJ3      NMGNARIIESALAP--EKA---LLF-KPMIILAAGILLSVVLSSGTVAVLEIKDTSVKTL
A0A2T1FKP8      NMGNARIIESALAP--EKA---LLF-KPMIILAAGILLSVVLSSGTVAVLEIKDTSVKTL
K9U6L7          NMGNARIIESALAP--EKA---LLF-KPMIILAAGILLSVVLSSGTVAVLEIKDTSVKTL
A0A1E5QP61      NVGNARVISYATLP--VNP---VAP-NKKLLVAAGVVGGSMLYVLTAFLLELMDPSIKTA
U5DPF5          NLGNARVVENALVP--INP---IWP-RMQLILMAGGIVGALIGTATAITLDVRDQSLKTV
A0A6P0X488      NVGNARIIAYAQQP--EIA---VGP-NKKLIIGAGVVAGSLLYIITAFVLDLMDPSIKTA
A0A6P0UVD5      NVGNARIIAYAQQP--ELA---VGP-NKKLIIGAGVVAGSLLYIITAFVLDLMDPSIKTA
A0A6P0VDM0      NVGNARIIAYAQQP--ELA---VGP-NKKLIIGAGVVAGSLLYIITAFVLDLMDPSIKTA
A0A6M0G142      NVGNARIIADALVP--EVA---VGP-NKKLIIAGGMIAGSLLYIVTAFVLDLMDPSIKTA
A0A6P0MR53      NVGNARIIAYAQVP--EVP---LGP-KRKLIIAAGVVVGSLLYIVTAFVLDLMDPSIKTA
A0A3M2GIL5      NVGNARVIASASPP--EFP---VGS-GKKLYLAAGIVAGGMLYVVTAFLLELIDPSIKTA
A0A6H1TSJ9      NVGNARVIASASPP--EFP---VGS-GKKLYLAAGIVAGGMLYVVTAFLLELIDPSIKTA
A0A3M1PML8      NIGNVRVVSPAIVP--DDP---LPS-QKKLFLIAGSLAGMLLGVATAFGLDLFDRSIKTV
A0A6M8BE85      NVGNVRVVSSATIP--DEP---LPS-KKKLFLVAGALSGMLLGVATAFGIDLFDRSIKTV
A0A0T7BPZ0      NMGNARIISTALVP--DKP---GNS-RKLLILGGAGFFGLLVGIIAALALDLLDQSVKNV
A0A352X442      NVGNARIVEAAAVP--EKP---TSS-KKKLIAAGGVVVGGLLGIAVAFLVDLIDHSVKNV
A0A6B3NF44      TVGNASIISTAIVP--ENP---TGS-KKKLILAAGGMVGILLGVTTAFLLDLIDSSVKTV
A0A6M0EPL4      TVGNASIISTAIVP--ENP---TGS-KKKLILAAGGMVGILLGVTTAFLLDLIDSSVKTV
A0A6P0K6L6      TVGNASIISTAIVP--ENP---TGS-KKKLILAAGGMVGILLGVTTAFLLDLIDSSVKTV
A0A6P0MRR9      NVGNARIISLATEP--KKP---VAS-KKKLVIAIGGIMGILLGIAIAFLLDLIDGSIKTV
A0A6P0UX57      NVGNAHIISYATEP--EKP---VAS-KKKLVIAAGGVMGILLGLAVAFLLDLIDGSVKTV
A0A6P0X1X4      NVGNAHIISYATEP--EKP---IAS-KKKLVIAAGSIMGILLGLAVAFLLDLIDGSVKNV
A0A0M0SHU3      NIGNARIISPALVP--DEP---SGA-RKALVVLGGGVLGALLGIIAALAADLIDRSIKTV
A0A1D2PBN3      NVGNARIISPALIP--DKP---AGS-RKILMITGGGVLGILLGVIAAFTLDLIDRSVKTV
A0A0C2LVR7      NVGNARIISPALIP--DKP---AGS-QKILVITGGGVLGILLGVIAAFSLDLIDRSVKTV
A0A1Z4PQB9      NVGNARIISPALIP--DKP---AGS-RKILMITGGGVLGILLGVIAAFTLDLIDRSVKTV
A0A1Z4SFN6      NIGNARIISPALVP--DEP---TGP-RKALIIAGGGVLGILLGIMAAFTLDLIDRSLKTV
K9PGI8          NIGNARIISPALIP--DAP---AAS-QKNLIVLGGGIFGAMLGLIAALTLDMIDRSVKTV
Q7NEU3          ELSPWRVIEPAAIP--EKP---IWP-KPLLTLGGGALLGLVFGLGIASLLESVDDRVKSI
A0A3C0N2P0      TSTSWKKISGPQKP--QAP---ISP-NVPRGILLGIVTGLMAGAGVAFLAEKLDKVFHSP
A0A6P0JR04      RTMSWELMNQPHRP--QYP---IAP-NMSRGILLAVVAGLLAGAGAALIAEKLDVRFHSP
A0A6B3M6M6      KTLPWQVIRKPQQP--QEP---ISP-NVPRGMILGVVAGMLAGCGAGLLAEKLDRVFHTP
A0A6P0KD09      KTLPWQVIRKPQQP--QEP---ISP-NVPRGIVLGVVAGMLAGGGAGLLTEKFDRVFHTP
A0A6B3NIJ0      KTLPWQVIRKPQQP--QEP---ISP-NVPRGIVLGVVAGMLAGGGAGLLAEKFDRVFHTP
A0A6M0F053      KTLPWQVIRKPQQP--QEP---ISP-NVPRGIVLGVVAGMLAGGGAGLLAEKFDRVFHTP
A0A6P2ATU9      RTTSWELLNAPDLP--MYP---IAP-DVTRGMAVAVMAGLVAGVGAMLIVEKLDVRFHSA
A0A352XE00      KTLPWQLIAPPQTP--IKP---ISP-NVPRGLVLATVAGLIAGAGAGSLAEKLDKAFHSL
A0A6P0QC14      KTPPWQKLSEPKQP--GAP---ISP-NVPRGLVLSAIAGLLAGAGAGFLAEKLDKVFHSP
B4VS56          KTLPWQLIAEPQQP--QAP---ISP-NIPHGIALGAVAGLLAGAGAGFLAEKLDKVFHSA
A0A352AAQ3      KTPPWQKLSDPQKP--QTP---ISP-NVPRGIVLGTVAGLLAGAGAGMLAEKLDKAFHSP
A0A350Y472      KTPPWQQLSQPQKP--QQP---ISP-NIPRGIALGAIAGLLAGAGAGMLAEKLDKAFHST
A0A355DVB4      KTPPWQQLSQPQKP--QQP---ISP-NIPRGIALGAIAGLLAGAGAGMLAEKLDKAFHST
A0A1Z4RMB9      QSGNTDIVEYATVP--DKG---SAG--RVMLMGLGVILGAFLANLSIILLEMQDRSLQSL
A0A318B4H2      GSNNVAIVDAAEVP--GGP---SEP-NLNKTLLVSLLIGLVLAVGLVVLAEEIDQSLRDP
B4WQE3          QQTPWEILTPPSAP----Q---AFSQTGKSSLLVGPILGLLLGSGIALLVDRVKGKICTV
A0A2K3BR24      NLGNARIIESASIP--TSP---ISP-RIKLNLALGGILGAMLGIATALALDARDRTVKTV
K9YXY1          NLGNARIIESASMP--TSP---ISP-RIKLNLALGGILGAMLGVATALALDARDRTVKTV
A0A0V7ZFJ4      SVGNATIISEALVP--EHP---ISP-NITRNLLLGGIGGILLGVGTALLLERTDKSLKTV
A0A0V7ZNJ9      NIGNARIISEALVP--DKK---ISP-RIALNLLLGGFLGILLGAGTALILETMDKSLKTV
A0A367RIS1      NVGNARIVSEALLP--KKP---ISP-RILLNLALGGFLGFFLAIAAALLLEAGDTSVKTT
A0A235IXQ2      NVGNATIVSNALVP--KKR---ISP-RISLNLALGGFLGFFFAIGVALLLEAGDKSVKTA
A0A1W5CNX3      NVGNARIVSEALLP--KTP---VSP-RIVLNLALGGFLGFFLAIGAALLLEAGDKSVRTQ
A0A5Q0GJJ5      NVGNARIVSEALLP--KTP---VSP-RIVLNLALGGFLGFFLAIGAALLLEAGDKSVRTQ
Q3MEB7          NVGNARIVSEALLP--KTP---VSP-RIVLNLALGGFLGFFLAIGAALLLEAGDKSVRTQ
A0A1Z4KHN9      NVGNARIVSEALLP--KTP---VSP-RILLNLALGGFLGFFLAIGAALLLEAGDKSVRTL
Q8YT70          NVGNARIVSEALLP--KTP---VSP-RILLNLALGGFLGFFLAIGAALLLEAGDKSVRTL
A0A166IWU6      NVGNARIVSQALLP--EKS---VSP-RINLNLALGGFLGILLAVGSALFLDALDKSVQTA
A0A2S0Q8C0      NVGNARIVSQALLP--EKS---VSP-RINLNLALGGFLGILLAVGSALLLDALDKSVQTA
W6FSX4          NVGNARIVSQALLP--EKS---VSP-RINLNLALGGFLGILLAVGSALLLDALDKSVQTA
A0A218Q4C1      NVGNARIISEALLP--DKS---ISP-RIKLNLALGGFLGILLAFGSALLLDAVDKSVQTA
A0A6P1ZT04      NVGNARIISKALLP--EKS---VSP-RIALNLALGGFLGIVLAFGSALLLDAVDKSVQTA
A0A0R0M9H9      NVGNARVISSALVP--EIP---ISP-RTALNIGIGALVGLVLGVGTALLLETLDKSVKNI
A0A1S1ZVW2      NVGNARVISSALIP--EIP---ISP-RTALNIGIGGIVGLVLGVGTALLLETLDKSVKNI
A0A1B7WX82      NVGNSRIISQALVP--ERP---VSP-KKPLNLAMGGFLGILLGAGTALLLESMNQALKNV
A0A1B7WTD1      NVGNARIISEALVP--EIA---VSP-KKPLNLALGGFLALLLGAGTALLLESMNQTLKNI
A0A480ABC0      NVGNARVISEALVP--EIA---VSP-KKPLNLALGGFLGLLLGAGTALLLESMNQTLKNI
A0A1Z4LRU5      NVGNAKVIASALVP--NKP---ISP-KIALNLALGGFLGILLGVGTALILEAMDKSLKTL
A0A1Z4JVB4      KVGNARVLSEALVP--DKP---ISP-IIAINLALGGALGILLGIGVAILLEAMDSSLKTV
K9PIA4          NIGNARVISQALVP--NRP---VSP-VIHLNLALGGFLGILLGLGTALVLESMDNSLKNV
A0A1Z4HVE1      NIGNARVISQALVP--DKA---ISP-IIPLNLALGGFMGIMLGLGTALILEAMDNSLKTI
A0A252ECZ1      NIGNARVISEALVP--ERP---VSP-VIPLNLALGGFLGILLGVGTGLLLEAMDTSLKTI
A0A1Z4G5Y1      NIGNSRVISDALVP--EKP---VSP-IVPLNLGLGGVLAIALGVGAALMLEAADNSLKTI
A0A252DNA2      NIGNSRVISEALVP--DKP---VSP-IVPLNLGLGGVLGILLGVGVALMLEATDNSLKTI
A0A252E1Q4      NIGNSRVISEALVP--DKP---VSP-IVPLNLGLGGVLGILLGVGVALMLEATDNSLKTI
A0A6G9SK36      NVGNARIISEALVP--DKS---VFP-VIPLNLALGGLLGIVLGAGTALVLESIDNSLKTV
A0A1Z4M597      NVGNARVISEALVA--DKS---VSP-IIPLNLALGGILGIILGAGTALVLESIDNSLKTV
A0A1Z4MWT1      NVGNARVISEALVP--DKS---VSP-IIPLNLALGGILGIILGAGTALVLESIDNSLKTV
A0A1Z4TX53      NVGNARVISEALVP--DKS---VSP-IIPLNLALGGILGIILGAGTALVLESIDNSLKTV
A0A5P8VSD1      NVGNARILSEALLP--KKP---VSP-IILLNLALGGFLGFFLGIGAALLLEAEDKSVKTA
A0A2A2TNQ5      KVGNARIVSEALVP--EKP---VAP-KIPLNLALGGFLGVLLGAGTALLLEALDKSLKNV
A0A3S1C4K5      KVGNARVVSAAEVP--EIP---VSP-KIPLNLALGGVLGIILGVGAALVLEAMDKSLKSV
A0A1X4G3D5      TTGTARVLSSALVP--KRP---VSP-RIPLNIGIGAILGVILGVGTALVLESLDKSVKNI
D4TNI2          TTGTARVLSSALVP--KRP---VSP-RIPLNIGIGAILGVILGVGTALVLESLDKSVKNI
A0A1Z4H6Z8      NVGNARVISDALVP--DKA---VSP-IIPLNVALGGFLGILLGVGAALMLEATDNSLKTI
A0A1Z4NPM1      KVGNARIVSPALVP--DKP---VSP-KIMLNLALGGFLGVLLGAGSALLLEALDKTLRDI
A0A3F3KPR9      NVGNARVISSALVP--EIP---ISP-RTALNIGIGALVGVVLGVGTALLLETLDKSVKNI
D4TGN7          NVGNARVISSALVP--EIP---ISP-RTALNIGIGALVGVVLGVGTALLLETLDKSVKNI
A0A1Z4UZW9      NVGNSRIISEALVP--ERP---VSP-KIPLNLALGGFLGIILGAGTALVLESMNQSLKNI
A0A0K2M5H0      NVGNSRIISGALVP--ERP---ISP-KIPLNLALGGFLGVILGAGTALVLESMNQSLKNI
A0A1B7VSH4      NVGNSRVISEALVP--ELP---VSP-KIPLNLALGGFLGVLLGAGTALLLESMNQSLKNI
A0A1B7W126      NVGNSRVISEALVP--ELP---VFP-KIPLNLALGGFLGVLLGAGTALLLESMNQSLKNI
A0A3D4C6Q6      NVGNSRVISEALVP--ELP---VFP-KIPLNLALGGFLGVLLGAGTALLLESMNQSLKNI
A0A1B7UVJ4      NVGNSRIISQALVP--ERP---VSP-KKPLNLAMGGFLGILLGAGTALLLESMNQALKNV
A0A1B7UTR1      NVGNSRIISEALVP--ERP---VSP-KIPLNLALGGFLGILLGVGTALLLESMNQSLKNV
K7W0A4          NVGNSRIISEALVP--ERP---VSP-KIPLNLALGGFLGILLGAGTALLLESMNQSLKNV
A0A5C0DRW9      NVGNSRIISEALVP--ERP---VSP-KIPLNLALGGFLGILLGAGTALLLESMNQSLKNV
A0A6H2C088      NVGNSRIISEALVP--DRP---VSP-KIPLNLALGGFLGILLGAGTALLLESMNQSLKNV
A0A1Q4RTR1      TVGNARVVSQALVT--DNP---VSP-KIALNLALGGFLGIILAVGAALTLEALDGTVKTI
A0A1Z4SQV2      TVGNARIVSEAQVT--NRP---VSP-KLYLNLALGGFLGIILAVGAALMSEALDGSVRTL
A0A2H2XGN1      TVGNARIVSEAQVT--NRP---VSP-KLYLNLALGGFLGIILAVGAALMSEALDGSVRTL
A0A433UXH8      TIGNARIVSEAQVT--NRP---VSP-KLYLNLALGGFLGIILAVGAALTLEALDGTVKTI
A0A1U7HGH0      TVGNVQIIEYAQVP--SGA---INA-SNTSALAAGSLAGLMIAGGIVYLLELTDKKIKTA
K9XJD3          TVGNVRIIEYAQVP--SGA---INA-SNTSALAAGSLAGLMIAGAIVYLLELTDKRIKTA
K9SX01          NIGNARILSPAVPS--GVP---ISP-KISNNLTTGAVLGIVAAISVALLLNSRDNLLRSG
A0A4P7ZT55      KTLPWQVISPPEVD--ETP---VKP-NLSRNLMLGLLLGAMAGAGAALLRDRLDHVFHSP
A0A1E5QIR9      NIGNVRVIQAAVFP--ERP---IAP-QKKINFGLGGVVGIFLAVVTALVLDAKDTRIKTV
A0A1Z4IBC7      KIPNARVISYALVP--DFP---EGP-RKILFVIGGGAVGIFLGIIAAFSIDLIDRSVKTV
A0A1W5CPC7      KIPNARVISYALIP--DFP---EGP-RKILFIIGGGVAGIFLGIIAAFSIDLIDRSVKTV
A0A5Q0GKD1      KIPNARVISYALIP--DFP---EGP-RKILFIIGGGVAGIFLGIIAAFSIDLIDRSVKTV
Q3MDC6          KIPNARVISYALIP--DFP---EGP-RKILFIIGGGVAGIFLGIIAAFSIDLIDRSVKTV
A0A1Z4KM73      KIPNARVISYALIP--DFP---EGP-RKILFIIGGGVAGIFLGIIAAFSIDLIDRSVKTV
Q8YNX7          KIPNARVISYALIP--DFP---EGP-RKILFIIGGGVAGIFLGIIAAFSIDLIDRSVKTV
A0A367R4K6      KIPNARVISYALIP--DKP---EGP-RKLLFIVGGGAIGFFLGIIAAFSLDLIDRSVKTV
A0A1E2WSV8      KIPNARVISYALIP--DKA---EGP-RKILFIVGGGGIGLFLGIIIAFGLDLIDRSVKTV
A0A2R5FRT9      KIPNARVISYALIP--DKA---EGP-RKILFIVGGGGIGLFLGIIVAFGLDLVDRSVKSV
A0A2K8T1B6      KIPNARVISYALIP--DKA---EGP-RKILFIVGGGGVGLFLGIIVAFGLDLIDRSLKTV
A0A235I9I0      KIPNARVISYALIP--DKA---EGP-RKMLFIIGGAGVGFFLGIIVAFTLDLIDRSVKTV
A0A2D0HQT8      KIPNARVISYALTP--DKA---EGP-RKMLFIIGGAGVGFFLGIIVAFTLDLIDRSVKTV
A0A2L2NU95      KIPNARVISYALIP--DKA---EGP-RKMLFIVGGAGVGFFLGIIVAFTLDLIDRSVKTV
A0A367S084      KIPNARVISYALTP--DKA---EGP-RKMLFIIGGAGIGFFLGIIVAFTLDLIDRSVKTV
A0A6P1A9A0      KATPWQLISNPFQP--SAP---ISP-DVPRGLLIGGMAGLLAGIGAAMLAEKFDNRFHSP
A0A1Z4SMD6      TVGNARVIQHARVP--NKP---TLSKSTLALAGGGVFGGLLFGVAVAFFIDLIDNSLKTV
A0A2H2Y096      TVGNARVIQHARVP--NKP---TLSKSTLALAGGGVFGGLLFGVAVAFFIDLIDNSLKTV
K9S8M8          NVGNARIVSSASFP--SKP---VGPNKKVVLMGGMVVGGMLY-LIVAFVFELIDPTVKTA
A0A1Z4NFV0      TVGNARIIQAAAPP--PLP---AKSKMSLLIGVGGVFAGLSLGIAAAFLIDLVDRSIKSV
A0A3M9ZEU1      NVGNARVISSAIVP--EEP---SGLSKKVYLLAGGI-VGALLAITTAFLLDLCDRSIKTV
A0A1Z4JK72      QVGNARVLQNALVP--TQP---TGRMRLILLAAGTM-IGLLLGVAAAFFRDMMDKSLKTV
A0A0N7Z489      QVGNARVLQSAMVP--TRP---AGRMRLILLAAGAM-VGLLLGIAAAFLVDTIDKSLKTV
A0A0S3TXS2      QVGNARVLQSAMVP--TRP---AGRMRLILLAAGAM-VGLLLGIAAAFLVDSIDKSLKTV
A0A2A2TPF8      NVGSARIVQDAAVS--NQP---VRSKLTMYLAAGGVFVGLMFGIAAAFLIDIIDRSIKTI
A0A1Z4R0P8      NVGSARIVQEAVVP--NQP---VSSKLTLYLAAGGIFVGLMLGIAAAFLIDIIDRSIKTT
A0A0T7BUI3      TIGNAKIIQPAQIP--ETP---MLSKKSLMLALGSLFAGSLLGIAGAFFVDLIDRSLKTV
A0A1Z4LP32      TIGNSRIIQSARIP--NKT---VLSKMTIMLAGGGVFVGLLLGIAAAFTVDLIDRSLKTI
K9REP9          TIGNSSIIQKARVP--KKP---SLSKMTLLLAGGGVFVGLLFGIAAAFTVDLIDRSLKTV
A0A1Z4SIJ3      TIGNARIIQPARLP--NKP---VLSRLTLLLAAGSAFAGLLFGVSIAFFVDLIDNSLKTI
A0A2H2XPG4      TIGNARIIQPARLP--NKP---VLSRLTLLLAAGSAFAGLLFGVSIAFFVDLIDNSLKTI
K9V3C7          AMGNARVIQNAIAP--NSP---ISSKLTLLLAVGGVFVGVFLGIAAAFLVDSIDKSIKTI
A0A1Z4T6Y7      TVGNARVIQNAVVS--PNP---ARLRMMFLLGAGGIFIGALLGVAAAFLVDVIDKSIKTV
A0A2H2Y561      TVGNARVIQNAVVS--PNP---ARLRMMFLLGAGGIFIGALLGVAAAFLVDVIDKSIKTV
A0A1Q4S362      TIGSARIVQNAVVS--PNP---ARMRMMLLLGAGGIFIGALLGVAAAFVVDVIDKSIKTV
A0A3S1CIN8      TIGSARIVQNAVVS--PNP---ARMRMMLLLGAGGIFIGTLLGVAAAFLVDVIDKSIKTV
A0A2A2TC28      TIGNARVVQPALVP--KIA---AMSKMTLLLLGGGVFVGLLVGIASAFFIDLIDRSLKTV
A0A0C1NCB0      TVGNARIIQPAQLP--QKP---ALSKLTLLLPVGGILGGLLLGVAAAFFVDLVDRSLKTA
A0A2N6K7Q9      TIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A2N6MXH6      TIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A2N6M5A8      TIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A2N6LL61      TIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A0S3TP66      TIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTV
G6FP91          TIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A1U7GYR5      TIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A2N6KY52      TIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A2N6KMP5      TIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A2N6MA45      TIGNARIVQPAQIP--KKP---VISKTKILLAGGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A4Q9J9V9      TIGNARIVQPAQIP--KKP---VISKTKILLASGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A328IGA1      TIGNARIVQPAQIP--KKP---VISKTKILLASGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A4D9CE41      TIGNARIVQPAQIP--KKP---VISKTKILLASGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A0M0SFT2      TIGNARIVQPAQTP--KKP---VISKTKILLASGSIFAGVLISIAAAFFVDLIDRSLKTI
A0A1Z4TLC8      TIGNARIVQPAQIP--KKS---VISKTKILLATGSIFAGVLLSIAAAFFVDLIDRSLKTV
A0A0C2LFH0      TVGNAKEIQLAQVP--KRP---SVSKITFLLAGGSVFVGLLLGTAAAFFVDLIDRTLKTV
A0A1Z4IYV4      TVGNAKEIQAAKVP--KKP---VLSKVVLLLAGGGVFVGLLLGIAAAFFVDLVDRSLKTV
A0A1Z4Q0T6      TVGNAKEIQPAKVP--KKP---VLSKLVLLLVGGGVFVGLLLGVAAAFFVDLVDRSLKTV
A0A0C2PT44      TVGNAREIQPAKVP--KKP---VLSKVVLLLAGGGVFVGLLLGVAAAFFVDLVDRSLKTV
A0A1D2P6J4      TVGNAKEIQPAQVP--KKP---VISKVVLLLAGGGVFVGLLVGVAAAFFVDLIDRSLKTV
B4WP72          NVGNARVVEAAIAP--ESP---VDS-RRELILIAGILAGSLVGISAAFAQDLLDRSIKTL
A0A2T1CIL7      NVGNVRIIADAIVP--EKP---TSSTQKKLITLIGSAMGVLLATAFAFLLDFKDRSIKNS
A0A433V7A0      NIGNARIIESASIP-RHAS---DFT-IKIIILGLGGLVGTLLATATIFVLELTDKSIKNI
A0A2T1FTR8      TLGNSRILTHAELP--QEA---LSP-KKGQNIAIGGFLGLFLGAATAFLLDGADKRIKTS
K9UA41          TLGNSRILTHAELP--QEA---LSP-KKGQNIAIGGFLGLFLGAATAFLLDGADKRIKTS
A0A0C2LBE2      NIGNARVISPALVP--DKS---TGS-GKILIIGAGGILGVLFGAVAAFALDTIDPSLKTV
A0A433NN38      NVGNATIISPALIP--DKP---SGP-RKTLLIAAGGILGILLGVVAAFSLELVDQSVKTL
A0A2N6K0T2      NVGNARIISPALVP--DEP---SGV-RKALIAAGGGVLGILLGIIAALAADLIDRSIKTV
A0A2N6ML72      NVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTV
G6FQZ6          NVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTV
A0A2N6MQX9      NVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTV
A0A2N6KXT6      NVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTV
A0A2N6KGB9      NVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTV
A0A2N6L3Y5      NVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTV
A0A0S3TIS7      NVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTV
A0A1U7GW28      NVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTV
A0A2N6LW63      NVSNARIISPALVP--DEP---SGT-RKALIAAGGGVLGIMLGIIAALAVDLIDRSIKTV
A0A328IH74      SIGNARIISPALVP--DEP---SGM-RKALIVFGGGVLGILLGIITALASDLIDRSIKTV
A0A4D9CIB0      SIGNARIISPALVP--DEP---SGM-RKALIVFGGGILGILLGIITALASDLIDRSIKTV
A0A1Z4TQ63      NIGNARIISPALVP--DEP---SGT-RKALIVLGGGVLGILLGIIAALTSDLIDRSIKTV
A0A4Q9J8G2      NIGNARIISPALVP--DEP---SGM-RKALIVFGGGILGILLGIIAALISDLIDRSIKTV
A0A350Y0P6      NVGNARVITYASIP--EAP---VSP-KKKLILVGGIVAGSLLYIVTAFVLDLMDPSIKTA
A0A352X940      NVGNADILARALVP--EDP---VSP-KKKLILGGGIIAGSLLYIIVAFVLDLMDPSIKTA
B8HTN4          NAGNVRLIQAATLS--DEP---VSP-KLLLNLILGTILGSLGAIVVIFILESKDKTLKSL
A0A6P1AFJ5      EALPWQLLDEVKSP--QKN---VSP-SKSRSLLIAAIAGLLAGGGAALVAEKLDRVFHSP
B0CAX4          NIGNVRVIAAALEP--KEP---VSP-RKAFNLAVGFFLGGLLGLGTALLLEALDTSVKTV
A0A1Z4RN12      NTGKVRVTAPAAIA--EDP---VNP-DKKVIVAAGAMMGALFGMALAFLLDLKDNTIKNT
A0A2T1CMF9      KVDKVRVISVAALA--EDP---VNP-DAKVIVAAGAMMGLLFGTALAFLLDLKDNTIKNT
Q7NDC5          NIGNATLIEPAEVP--EIP---AWP-KPLLNLAAGGVLALILAALAAYTREFFDDSLRSV
U5QGK3          NIGNAELIEPAVAP--ELP---AWP-SPLLNLGAGALLGAILAMLVAYGREFFDDSLQTV
A0A2W4UY24      DVGNARTISLADLP--EES---ISP-ALKLYLLAGGVVGALLGIAIAFLADLLETSVKTV
A0A0D8ZUV2      NTGNASIVEPALVP--DKA---SIK-LRVMILGLGVIVSALLAGATIIILEVRDTSVKTL
A0A433VDI0      RIGNAQIIEPAPIP--KKP---SLL-KPAIILALGNMLGILLAAATIVILEVKDTSIKTL
A0A3D1PG43      NIGNASIIETALVP--EQP---TGG-KKLIILGLGSVLATLLATGTILILEISDRTIKTL
A0A2P8QQ72      NIGNASIIETALVP--ETP---LLG-KRVMTLGLGGIAAILLAIATITLLELSDASIKTL
K9TZQ7          NIGNASIIETALVP--ETP---LLG-KRVMTLGLGGIAAILLAIATITLLELSDASIKTL
A0A6N8G584      NMGNARIIEFATVP--ENA---SIR-KRAMILALGNVLALILAILTICILELSDRSVKTL
A0A2G7GPR0      NMGNARIIEFATVP--ENS---SVR-KRAMILALGNVLALILAILTICILELSDRSVKTL
K9XH68          NMGNARIIEFATVP--ENA---SVR-KKAMILALGNILALILAILTICILELSDRSVKTL
A0A1U7HW70      NMGNARIIEFATVP--ENA---SVR-KKAMILALGNILALILAILTICILELSDRSVKTL
A0A2S6VEJ8      NMGNARIIEFATVP--ENA---SVR-KKAMILALGNVLALILAILTICILELSDRSVKTL
A0A140KBA0      NIGTVRVLANAIPP--DEP---TGP-SKKLIVAAGGLLGGLLGIAVAFLLDLKDNSLKNS
K9XSG1          NIGTVRVLANAIPP--DEP---SGP-SKKLIVAAGGLLGGLLGIAVAFLLDLKDNSLKNS
A0A2T1GMT4      STSNARIISSAAVP--EKP---DPG-PKLIIGILGGLVGALFGTSAIAYLELRDGSLKTV
K9UI51          STSNARIISSAAIP--EKP---EPG-PKLILGILGGLVGALLGTSAIAYLELRDSSLKTV
K9QM62          NTANARIISQALVP--EEP---VLK-KKIIVVVLSVMFGAFLSTTTVLLLEMRDRSLKTL
A0A1Z4FWI3      NTPNARIIARGLVP--TKP---GLG-LKPIVWLLGILLGAFLSTTAVVFLETRDRSLKTL
A0A1Z4JYE7      NTANARIIARGSVP--EEP---LAA-KKMLVLVIGAMFGLFLATSTILLLEIKDKSLKTL
A0A2T1FXY4      TTAHARIIAQALVP--NKP---VLE-QKLIVLVLGTMFGALLSTSTVLFLELRDRSLKTL
K9TYI2          TTAHARIIAQALVP--EKP---VLE-QKLIILALGIMIGALLSTSTVLFLELRDRSLKTL
A0A1Z4QL41      NTASARIITEAIIP--KKS---SGG-KKLIVLLLGGTLGVFLASSTIFILEMRDSSLKTV
A0A252D4T4      NTPNARIIAKGLVP--NKA---ALG-LKPFVLVLGILLGAFLATTAVIFLETRDRSLKTL
A0A252DJH5      NTPNARIIAKGLVP--NKA---ALG-LKPFVLVLGILLGAFLATTAVIFLETRDRSLKTL
A0A252EB80      NTPNARIIAKGLVP--TKP---ALG-LKPFVLVLGILLGAFLATTAVVFLETRDRSLKTL
A0A6G9SKZ9      NTPNARIIAKGLVP--KKP---TLG-LKPFVLVLGVLLGAFLATTAVIFLETRDRSLKTL
A0A1Z4HPW5      NTPNARIIAKGSAP--KKP---TLG-LKPFILVLGVLLGAFLATTAVIFLETRDRSLKTL
A0A1Z4MSN1      NTPNARIIAKGSVP--NKP---TLG-LKPFILVLGVLLGAFLATTAVIFLETRDRSLKTL
A0A1Z4U1C2      NTPNARIIAKGSVP--NKP---TLG-LKPFILVLGVLLGAFLATTAVIFLETRDRSLKTL
A0A0D6KV51      NTPNARIIAKGSVP--IKP---TLG-LKPFILVLGVLLGAFLATTAVIFLETRDRSLKTL
A0A1Z4MKF8      NTPNARIIAKGSVP--IKP---TLG-LKPFILVLGVLLGAFLATTAVIFLETRDRSLKTL
A0A2C6WC43      NTASSRIIAQALVP--TDP---VAG-KKFLVLLLGIMLGLFLATTTVLFLGMRDRSLKTL
A0A1Z4L5A1      NTASSRIIAQALVP--ADP---VAG-KKLIVLLLGVMFGLFLATTTVLFLGMRDRSLKTL
A0A367QD86      NTASSRIIAQALMP--TDP---VAG-KKFLVLLLGVMFGLFLATTTVLLLGMRDRSLKTL
A0A235IZ96      NTASSRIIAQALVP--KDP---IVV-KKIIVLVLGVMFGLFFATTTVLFLAMRDKSLKTL
A0A2L2NGP0      NTASSRIIAQALVP--KDP---IVV-KKIIVLVLGVMFGLFFATTTVLFLAMRDKSLKTL
A0A2K8SM78      NTASSRIIAQALVP--KDP---VVG-KKIIILLLGVMFGLFLATTTILFLSMRDRSLKTL
A0A2R5FPC0      NTPSSRIIAPAVVP--NKP---VIG-KKIIILLLGVMFGLFLATTTVLFLSMRDRSLKTL
A0A5P8W5T6      NTASSRIIVPALVP--NKP---VTG-KKIIVLLLGVMFGLFLATTAVLFLSMRDRSLKTL
A0A0F5YE28      STNNARVIEEAIVP---EE---GST-AKTKLIALGIMLGLVGATTSVLILAMGDQNIRTV
U7QEH7          STNNTRIIEEAMVP---EE---GST-AKIQLLALGIMLGLVAATTSVLLLEMGDKYIRSV
A0A3S1ATK5      NTANARIITQAKIP--EKP---ASG-KKPIVVAIGVLLGAFFGTTTILLLEMRDRSLKTL
A0A2Z6CPH0      NTANARIIAQALVP--EKP---TSG-KKLIILVMGVMFGAFLSTTTVLFLEMRDKSLKTL
A0A1Z4GT50      NTANARIIAQASVP--EEA---VLG-KKPIVLSLGVLLGLFLSTSAVAALETRDRSLKTL
A0A1Z4GIX0      TTPNARVVAQATVP--EKP---ESG-KKLIFIALGLTFGAFLSTSAVLFLEMRDKSLKTL
A0A2H6LC24      TTPNARVVAQATVP--EKP---ESG-KKLIFIALGLTFGAFLSTSAVLFLEMRDKSLKTL
B2J6N5          NTASSRIIAQAIVP--DKP---VES-KKIIVLVLGVMFGLFLATTTVLVLGMRDRSLKTL
A0A367RMI4      NAPSSRIIAQALVP--KDP---TLT-KTIIVLVLGVMFGLFFATTTVLFLAMRDRSLKTL
A0A235HUM0      NTPSSRIIAQALVP--KDP---TLG-KKIIVLVLGVMFGLFFATTTILFLAMRDRSLKTL
A0A2L2NW47      NTPSSRIIAQALVP--EDP---TLT-KTIIVLVLGVMFGLFFATTTVLFLAMRDRSLKTL
A0A1E2WUR1      NTASSRIIAQALVP--KDP---VAG-KKIIVLVLGVMFGLFFATTTILLLAMRDRSLKTL
A0A235IKU3      NTASSRIIAQALVP--KDP---ILV-KKIIVLVLGVMFGLFFATTTVLFLAMRDKSLKTL
A0A1U7MYU6      DTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSIKTL
A0A1D8TNX9      DTANARIIEPAIVP--KKP---LGD-KKLKVLALGVMLGVTLATTAILLLEMRDRSIKTL
A0A6P0L6C2      DTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSIKTL
A0A6P0MVH0      DTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSIKTL
A0A6P0KJV0      DTANARIIEPAIVP--KKP---LGD-KKLKVLALGVMLGVTLATTAVLLLEMRDRSIKTL
A0A6L9ZJG4      DTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSIKTL
F4XKF3          DTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSIKTL
A0A1D9FX10      DTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSIKTL
A0A6P0Q0T0      DTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSIKTL
A0A6P0W5I0      DTANARIIEPAIVP--KKP---LGD-KKIKVLALGVMLGVTLATTAVLLLEMRDRSIKTL
A0A3C0NJ41      SIGNARIIEPALVP--ETR---SPI-NAIITLLFGGTAGTLLGMATIILLEVRDVSLKTL
A0A352AG88      NIGNARIIEPAEVPLLPSS---QMV-QTVLPVVGGGALGILLAIVTIITLEVRDTSIKTL
A0A350Y374      NIGNARIVEPAQIP--DSR---SSG-KSVLILLLGAMAGTLLAMATIIILEVRDNSIKTL
A0A355DPX0      NIGNARIVEPAQIP--DSR---SSG-KSVLILLLGAMAGTLLAMATIIILEVRDNSIKTL
                                                      .                     

K9SLA9          EQASDISG-YSLLGIVP--------DFGYVAKHDQMMRKSAKLAKG--------------
A0A168TT23      EDVEKLVG-RPVLGLIPIVKLSEQRKKSGT------------------------------
A0A0M1JWX9      EDLKQATD-KPLLGLIP--------ISDRA------------------------------
A0A2T1M1V6      KDLQQAG--LPLVLRFP--------RLRSLSLEKGLDEKSEVE-----------------
A0A2G7GCS2      KDLEQVE--FPVLGRIS--------RLKRTDMERNLSGEVAIE-----------------
K9XBH8          RDLRQVE--FPVLGRIS--------RLKRPDMERALSAEVPID-----------------
A0A1Z4LJ30      KDIVQTN--IPVLANIP--------YIKNIHGKLEQKLGGEIE-----------------
K9RI76          KDIQQAN--IPVLASIP--------YVRHINAKADRKLGGEIE-----------------
A0A352AE27      KDLQTLK--FAIVVRIP--------RLKQSVVGLGLTTETEVE-----------------
A0A3B8JH60      KDLQAIK--FPIVVRIP--------RFKQSDRALKLGTDTEVE-----------------
A0A3C0N766      KDLQAIK--FPIVVRIP--------RFKQSDRALKLGTDTEVE-----------------
K9W9J7          KDLQATK--FPIVVRIP--------RLRHSNLSWQVGTETEVE-----------------
A0A139WSU3      KDLQGQK--FAIVQSIP--------RIKHSDPKIEMTSVSEVE-----------------
A0A433VN22      KDLQEQK--FAIVERIP--------RIKHSGVISELAIETEVE-----------------
Q7NF11          KDLQSVE--LPVLARLP--------RTKGL---LPSGDPPRLE-----------------
A0A1Z4JCS8      KDLQALK--FSLVARIP--------KLKRLAIEPNSSFEGEIE-----------------
A0A6P0PI80      KDLQAIK--FPMVVNIP--------HLRHAGMGLELGTETDVE-----------------
A0A6P0WGT6      KDLQAIK--FPMVVNIP--------HLRHAGMGLELGTETDVE-----------------
F4XTX2          KDLQAIK--FPMVVNIP--------HLRHAGMGLELGTETDVE-----------------
Q7NJN6          RELDSTG--LPVLGRIP--------KLKDA----ALSAAEAEE-----------------
U5QCC3          RDIEVTG--LPVLARLP--------KFKDN----EL-IATAEE-----------------
A0A3M1SVZ4      GEAKAQLQ-FALLGVIP-------------------------------------------
A0A654SFI6      QDVTRELG-LSLLGTIP-------------------------------------------
K9SSQ0          SQLQTLSD-LPLLGAVP-------------------------------------------
A0A2W1JIN9      DEIEELVE-LPVLSTLP-------------------------------------------
A0A318AJV1      GEVEARLG-LPVLASVP-------------------------------------------
A0A6P0IC70      SDAEVLLK-LPRLGVLP-------------------------------------------
A0A6B3MUB5      SDAEVLLK-LPRLGVLP-------------------------------------------
A0A6M0B7N4      SDAEVLLK-LPRLGVLP-------------------------------------------
A0A6P0J9W3      SDAEVLLK-LPRLGVLP-------------------------------------------
A0A6P0ZWE1      SDAEVLLK-LPRLGVLP-------------------------------------------
A0A1U7N2U4      SEAEALLK-LPRLGVLP-------------------------------------------
A0A1D9G1F2      SEAEALLK-LPRLGVLP-------------------------------------------
A0A6P0PNZ7      SEAEALLK-LPRLGVLP-------------------------------------------
F4XV38          SEAEALLK-LPRLGVLP-------------------------------------------
A0A6P0W137      SEAEALLK-LPRLGVLP-------------------------------------------
A0A6L9Y9E2      SEAEALLN-LPRLGVLP-------------------------------------------
A0A6P0SGR0      SEAEALLK-LPRLGVLP-------------------------------------------
A0A6M0BK48      SEAEALLK-LPRLGVLP-------------------------------------------
A0A6L9YZL1      SEAEALLK-LPRLGVLP-------------------------------------------
A0A6P0KYM4      SEAEALLK-LPRLGVLP-------------------------------------------
A0A6P0LSD6      SEAEALLK-LPRLGVLP-------------------------------------------
A0A6P0X384      LAVEELLN-LPKLGSLP-------------------------------------------
A0A2P8QIL5      TEASSLVE-VPIMGVLP-------------------------------------------
A0A2T1FLY5      TEASSLVE-VPIMGVLP-------------------------------------------
A0A433W447      TEASSLVE-VPIMGVLP-------------------------------------------
K9U1K8          TEASSLVE-VPIMGVLP-------------------------------------------
K9UYB2          DETEELLQ-LPLLGVLP-------------------------------------------
A0A218QN17      SEAEELVS-LPLLGVLP-------------------------------------------
K9RKN2          RDAEQLLN-LPLLGVLP-------------------------------------------
A0A2I8ADV2      AEAEELLK-LPLLGILP-------------------------------------------
A0A1W5CKM3      TEAEELLQ-LPLLGVLP-------------------------------------------
A0A5Q0GMF5      TEAEELLQ-LPLLGVLP-------------------------------------------
Q3MEW0          TEAEELLQ-LPLLGVLP-------------------------------------------
A0A1Z4KIC7      TEAEELLQ-LPLLGVLP-------------------------------------------
Q8YSM5          TEAEELLQ-LPLLGVLP-------------------------------------------
A0A1Q4S1H4      AEAE-LLN-IPLLGILP-------------------------------------------
A0A433VBU6      AEAE-LLE-LPLLGVLP-------------------------------------------
A0A1Q4RZJ6      SEAEELLK-LPLLGVLP-------------------------------------------
A0A1Z4SNV3      SEAEELLK-LPLLGVLP-------------------------------------------
A0A2H2XJQ1      SEAEELLK-LPLLGVLP-------------------------------------------
A0A3S5K358      SEAEELLK-LPLLGVLP-------------------------------------------
A0A0T7BPJ4      WEAQDLLK-LQLLGVLP-------------------------------------------
A0A0C1QS61      SEAEELLK-LSLLGVLP-------------------------------------------
A0A139X3R8      SEAEDLLK-LSLLGVLP-------------------------------------------
A0A1Z4I7C5      SEAEELLQ-LPLLGVVP-------------------------------------------
A0A0C2MDK7      TEAEELLQ-LPLLGILP-------------------------------------------
A0A1Y0RCK1      TEAEELLQ-LPLLGVLP-------------------------------------------
A0A1Z4PWZ0      SEAEELLQ-LPLLGVLP-------------------------------------------
A0A0C2QLT0      SEAEELLQ-LPLLGVLP-------------------------------------------
A0A1Z4J2K1      SEAEELLQ-LPLLGVLP-------------------------------------------
A0A3S0ZSX0      SEAEELLD-LPLLGVLP-------------------------------------------
A0A2N6K4T3      SEAEELLR-LPLLGVLP-------------------------------------------
A0A370CKT2      SEAEELLK-LPLLGVLP-------------------------------------------
A0A0S3TL97      SEAEELLK-LPLLGVLP-------------------------------------------
A0A2N6M8A0      SEAEELLK-LPLLGVLP-------------------------------------------
A0A2N6M9E1      SEAEELLK-LPLLGVLP-------------------------------------------
A0A2N6KJI4      SEAEELLK-LPLLGVLP-------------------------------------------
A0A2N6MZ77      SEAEELLK-LPLLGVLP-------------------------------------------
A0A2N6KT20      SEAEELLK-LPLLGVLP-------------------------------------------
G6FSN3          SEAEELLK-LPLLGVLP-------------------------------------------
A0A4D9CI02      SEAEDLLK-LPLLAVLP-------------------------------------------
A0A328I8B9      SEAEDLLK-LPLLGVLP-------------------------------------------
A0A4Q9J4Z7      SEAEDLLK-LPLLGVLP-------------------------------------------
A0A0M0SU69      SEAEELLK-LPLLGVLP-------------------------------------------
A0A1Z4TIZ8      SEAEELLK-LPLLGVLP-------------------------------------------
A0A0S3TYD7      QDLKDVFD-YPVLGMIP--------SFTDSGLSQVMESLTKNL-----------------
A0A2T1DNG3      DELKQQTA-VPLLGTIP-------------------------------------------
A0A3S0Y9N9      ESARELLG-YNLLGYIP--------PFTNN------------------------------
A0A433UNK7      KSAKDILG-YNLLGYIP--------PFPNG------------------------------
A0A6P0ZKB8      KSAKDLLG-YALLGYIP--------PFPNG------------------------------
U5QL42          EEAKELTG-LPLLGAIP-----------KT------------------------------
A0A076HBF2      GEVKDDLG-LPLLGHIP--------HVEFF------------------------------
A0A354B169      AEAKADLR-LPLLGHIP--------HVNFF------------------------------
G4FMX5          GEVKAEIGDLPLLGHIP--------YVDFF------------------------------
Q0IDT5          AEVKDDLN-LPLLGHIP--------HVAFF------------------------------
A0A2D6FCW3      GEVKMDLG-LPLLGHIP--------HVDLF------------------------------
A3ZA21          GEVKDDLG-LPLLGHIP--------HVSFF------------------------------
A0A140K3H3      EEVKQMVR-LPLLGTIP-------------------------------------------
K9XUB8          EQVKQIAR-LPLLGTIP-------------------------------------------
A0A6H2NHD5      DELAKVTR-LPNLALVP--------EASGL------------------------------
A0A2P8W4F7      DELIKTTQ-LPNLTTIP--------NAPAL------------------------------
A0A5Q4E0Z4      DELVKATQ-LPNLALVP--------NAPAL------------------------------
A0A2P8VVX1      DELKKQVP-LPLLGMLP----RRPSSLPPL------------------------------
A0A2P8WHY0      DDLKRQVP-LPLLGILPVQPIRKGFSLPGR------------------------------
A0A2T1CMT9      KEIERRTS-LPILGTAP--------GLSIS------------------------------
A0A563VQJ3      PELKKKLP-YKVLGVIP--------QMDDV------------------------------
A0A1D8TX52      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A1D9G4T2      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A6P0PR27      DDLKNQVA-LPLLGMIP--------QLPEG------------------------------
A0A6P0WER7      DDLKNQVA-LPLLGMIP--------QLPEG------------------------------
F4XP71          DDLKNQVA-LPLLGMIP--------QLPEG------------------------------
A0A6L9YR57      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A6P0KZ31      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A6P0LPB8      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A6P0SEV1      EDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A6B3N2I8      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A6M0B891      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A6P0IJQ1      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A6P0J8J8      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A6P0ZSH6      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A1U7N5X9      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A6L9Z1V0      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A6P0LC12      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A6P0MVJ3      DDLKNQVA-LPLLGMIP--------ELPEG------------------------------
A0A2W6ZAV2      QDVEDGLG-LPLLGRLP--------FLPVQ------------------------------
K9W742          DELKQQVA-LPVLGMTP--------VLPKA------------------------------
A0A3D1PBA3      EELEKQVE-LPLLGMTP--------ELPKN------------------------------
K9XPB0          RQIQEKIA-LPLLGSTP--------GLPLA------------------------------
A0A350Y7Z1      EELKRQVA-LPLLGIIP--------ELPRT------------------------------
A0A352X2A7      DQLKRNLT-LPFLGIIP--------ELPKT------------------------------
A0A0D8ZYV0      DELEKQVS-IPLLGMTP--------EMPQT------------------------------
A0A2T1FP73      EDLERQFE-LPLLGMTP--------ELPRG------------------------------
A0A433VMS2      EDLERQFE-LPLLGMTP--------ELPRG------------------------------
K9TYA7          EDLERQFE-LPLLGMTP--------ELPRG------------------------------
A0A2P8QUE1      EDLEKQFE-LPLLGMTP--------ELPRG------------------------------
K9SA61          DDLQKQVP-LPLLGMIP--------ELPRS------------------------------
A0A2G7GMH8      DELKKQVA-LPLLGLIP--------ELPP-------------------------------
A0A6N8FU92      DELKKRVE-LPLLGLIP--------ELPP-------------------------------
A0A2T1DWE8      DDL-KQVA-VPLLGMVP--------ALQYE------------------------------
A0A1U7I8L3      DDLKKQVD-LPLLGIIP--------QLNPQ------------------------------
A0A2T1DJL8      EDFKQQVP-LPLLGMVP--------EVPLG------------------------------
A0A1Z4J9W0      EDLTKEAS-IPLIGMVP--------ELPMS------------------------------
A0A0N7Z5K9      EDLTKQAS-IPLIGMVP--------ELPMS------------------------------
A0A0S3TXC5      EDLTKQAS-IPLIGMVP--------ELPLS------------------------------
B8HNB0          EEVKRASG-LPLLGTVP--------RSRSS------------------------------
A0A563VS48      REAEQMLP-YPLRGVIP------------DCKGITQGKQQPVLAESSSA-----------
A0A318BJ18      IEVTRRLG-LPLLGSVP----------------------------KTAE-----------
A0A3B8Y8H9      EELKQETR-LPLLATIP--------QLPRKLL----------------------------
A0A2W1JVB9      EDIKALFSDYTMLGVIP--------AIEGV------QTKIKEKGASVAA-----------
A0A6H1U102      DEAKELTG-LPSLGVVP-------------------------------------------
A0A7C3ZEJ3      EEAKELTG-LPTLALVP-------------------------------------------
A0A563VLD6      DEVKQITQ-LPLLGAVP------------KVLEPRIVLSNEAEINISKG-----------
A0A2P8W9H0      DELKAAVR-LPVLGNIP--------ISSLLNSGGSVLFAVREINSIGLT-----------
A0A6I5P386      EELKDITE-LPVLGAIP--------HSRLLENGQNLALAMTQLGDLGFN-----------
A0A318BG22      DDVEQKLH-LPLLGITP--------TVEGA------------------------------
A0A2T1E9V8      KEARELFD-YRLLGTIP--------IFNKIAE----------------------------
A0A1Z4LN32      KEAEKLFG-YTLLGLIP--------KFDTNNAKSNHNIPVGKDKIA--------------
A0A2I8A9F5      KEAEELFG-YTLLGLIP--------KFSNNFNTT--QLEDSA--LA--------------
A0A218Q6R8      KEAEELFG-YTLLGLIP--------VFETKNISN--TLDTEEPIVE--------------
A0A218QGE0      KEAEALFG-YTLLGLIP--------KYE-KNTST--FLDRS---LE--------------
A0A3M2GQQ6      DEAKELTG-LPSLGMIP-------------------------------------------
A0A6H1U2X0      DEAKELTG-LPSLGMIP-------------------------------------------
K9TLQ0          EDIKDYMG-FPILGTIP---------FEKD------------------------------
K9QF04          EEIQDNTG-LTLLGTIP---------FQKELKAATNQLTHY-------------------
K9W1T3          EDAKRILG-YPLLGTIP--------IIEHMDSSTTIRFGNQQ------------------
K9SGJ5          EEVRELTH-VPLLGSIP-------------------------------------------
A0A6N2JS94      GEVREIID-IPLLASIP-------------------------------------------
A0A6C2DSN4      EEVREIID-VPLLASIP-------------------------------------------
L8MYT6          EEVREIID-VPLLASIP-------------------------------------------
A0A352JGJ6      EEVKEIID-IPLLASVP-------------------------------------------
A0A1J5GLS2      EEVKEIID-VPLLASIP-------------------------------------------
A0A2W4W6M5      EEVREIID-IPLLASIP-------------------------------------------
A0A2W7AN33      GEVREIID-VPLLASIP-------------------------------------------
A0A256BLV2      EEVRELID-IPLLASIP-------------------------------------------
A0A2W6ZXF3      EEVKEIID-IPLLASIP-------------------------------------------
A0A2Z5WX66      EEVKEIID-IPLLASIP-------------------------------------------
K1XF69          AETRDLFG-YTLLGIIP--------SFAAP------PFYRYLTGGDRS------------
B5W297          AETRDLFG-YTLLGIIP--------SFAAP------PFYRYLTGGDRS------------
A0A6H2AL05      AETRDLFG-YTLLGIIP--------SFAAP------PFYRYLTGGDRS------------
H1W7M8          AETRDLFG-YTLLGIIP--------SFAAP------PFYRYLTGGDRS------------
A0A5Q4H6A5      AETRDLLG-YTLLGIIP--------SFAAP------PFYRYFTGGDRS------------
D5A466          AETRDLLG-YTLLGIIP--------SFADP------PFYRYFTGGDRS------------
U5QJM6          ERAKELMQ-LPLLGAIP-YNDELNTTAKSE------KQSKEIAKISKKA-----------
A0A1Z4RPC6      PEVKRKFG-YQVLGIVP--------FDSFQ------DS----------------------
A0A2T1CMZ0      SEIKQKFA-FQVLGIVP--------LDTLQ------NN----------------------
L8M4F7          GEIRKKLP-HTILGIIP--------IDDDA------RS----------------------
A0A140K2P2      AEIKNKFG-YKVLGLVP--------KHAAE------EN----------------------
K9XWX4          AEIKNKFG-YNVLGLVP--------KHEAE------DN----------------------
A0A140KB14      SEIKQRFP-YKVLGLIP--------QYSDD------EP----------------------
K9XX88          PEIKQRFP-YKVLGLIP--------QYTDD------EP----------------------
A0A563VSV6      ADIKKKLP-YKVLGIVP--------INELS------DR----------------------
L8LZE9          SEVKKKLP-YKVLGIIP--------ENKFA------KR----------------------
A0A433NM31      REAKEVLG-YTVLGVIP--------NFDKI------DKLNSRNENPEQT-----------
A0A1Z4NDS1      QEARELFR-YTLLGVIP--------QIPRN------SKRKSEQPERN-------------
U9VXM0          QEGQELYE-YPLLGIIP--------AWKRN------NAKGTD------------------
A0A6M0RI13      QEGQELYE-YPLLGIIP--------AWKRG------NAKGSD------------------
A0A6M0S1N5      QEGQELYE-YPLLGIIP--------AWKRG------NAKGSD------------------
K9F4D9          QEGQELYE-YPLLGIIP--------AWKRG------NAKGSD------------------
A0A6I5QPI5      KEVKELYG-YTVLGVIP--------LVKGA------GRSEAEAADDHP------------
A0A1Z3HMQ0      KDGEALLG-YTLLGLIP--------KFGLL------GNDGPDLELPAGE-----------
A0A433W533      KEARELFG-YTFLGAIP--------SLTKK------A----AADGKNAE-----------
A0A2P8QWJ3      KEARELFG-YTFLGAIP--------SLTKK------A----AADGKSAE-----------
A0A2T1FKP8      KEARELFG-YTFLGAIP--------SLTKK------A----AADGKNAE-----------
K9U6L7          KEARELFG-YTFLGAIP--------SLTKK------A----AADGKNAE-----------
A0A1E5QP61      KELRMLFR-YTLLGMIP--------ATKKR------FGFLGFSSRRE-------------
U5DPF5          QEAKNRLG-YVMLGSIP--------LFGR-------------FNRPVDG-----------
A0A6P0X488      KEVRQLFN-YTWLGMIP--------DYGKK------G----FFGRRKLG-----------
A0A6P0UVD5      KEVRRLFN-YTWLGMIP--------DYGKK------G----FFGRKKLG-----------
A0A6P0VDM0      KEVRRLFN-YTWLGMIP--------DYGKK------G----FFGRKKLG-----------
A0A6M0G142      KEVRQLFR-YTWLGMIP--------DYRRK------G----LFGRRKSG-----------
A0A6P0MR53      KEVRRLFN-YTWLGMIP--------DSRKK------G----LFGRRKSE-----------
A0A3M2GIL5      KEVREVFR-YTVLGMIP--------KYRKK------G--FFFQNKIDQI-----------
A0A6H1TSJ9      KEVREVFR-YTVLGMIP--------KYRKK------G--FFFQNKIDQI-----------
A0A3M1PML8      KEAKEALG-YTLLGVVP--------AFSRN------AKSNVPLGALDYP-----------
A0A6M8BE85      KEAREALG-YTLLGVIP--------VFPRS------GKSSSALGALDHP-----------
A0A0T7BPZ0      KQAKEIFG-YTLLGVIP--------QMNRS------SKSSSGTTEIDRQ-----------
A0A352X442      KEAKELFG-YTLLGVVP--------AFGKL------GNRGFSFKKSEAK-----------
A0A6B3NF44      KEAKELFS-TTLLAVIP--------AYGKP------GKANYLLGESEHR-----------
A0A6M0EPL4      KEAKELFS-TTLLAVIP--------AYGKP------GKANYLLGESEHR-----------
A0A6P0K6L6      KEAKELFS-TTLLAVIP--------AYGKP------GKANYLLGESEHR-----------
A0A6P0MRR9      KEAKELFG-YTLLGIIP--------IYGKS------RRVRRRLGDVEGS-----------
A0A6P0UX57      REAKELFG-YTLLGIIP--------VYGKS------RRTRKRLGELEGG-----------
A0A6P0X1X4      REAKELFR-YTLLGIIP--------VYGKS------RRTRKRLGEVEGS-----------
A0A0M0SHU3      KEAREVFQ-YTLLGVIP--------SVSRT------GKSGYSVEGLDRP-----------
A0A1D2PBN3      KEARELFK-YTLLGVIP--------SINSN------SKKSSFLPGVDQP-----------
A0A0C2LVR7      KEARELFK-YTMLGVIP--------SINSN------SKKSSFLPGVDQP-----------
A0A1Z4PQB9      KEARELFK-YTLLGVIP--------SISSN------STKSSFLRGVDQP-----------
A0A1Z4SFN6      KEARELFQ-YTLLGVIP--------LVGGN------GKKSYYLPGADQQ-----------
K9PGI8          KEARELLQ-YTLLGVIP--------LVGRN------TKNSSLLPGGEQP-----------
Q7NEU3          SQAKELLN-LPLLGAIP---------FTEEEDLQASSQPQFSK-----------------
A0A3C0N2P0      DELKDSTG-LPILGTIP---------FTKKLKEDIGSLSDGSM-----------------
A0A6P0JR04      DDLKDSLG-LPLLGIIP---------YRKDFKERKDSLPSFSR-----------------
A0A6B3M6M6      DEIKETTA-LPVLGTIP---------FRKELKKGFISPVGDLI-----------------
A0A6P0KD09      DEIKEATG-LPVLGTIP---------FHKELKKGLISPVGNLV-----------------
A0A6B3NIJ0      DEIKEATG-LPVLGTIP---------FHKELKKGLSSPVGDLV-----------------
A0A6M0F053      DEIKEATG-LPVLGTIP---------FHKELKKGLSSPVGDLV-----------------
A0A6P2ATU9      EDLKEMVR-IPLLGVIP---------FRKEFRQRRGKTAQSEK-----------------
A0A352XE00      DELKDSTG-LPILGTIP---------FDKVVKNSKKQIKTNSKVYQNSQ-----------
A0A6P0QC14      DELKDSTG-LPVLGTIP---------FTKQLKTRAKEPGAAAI-----------------
B4VS56          EEVKEKTG-LAVLGTIP---------FHKPLKKPSKSAKTAGK-----------------
A0A352AAQ3      DELKDSTG-LAVLGTIP---------FGKELKKGIARPVPAAT-----------------
A0A350Y472      DELKDTTG-LPLLGTIP---------FSKELKKNITRSATPSK-----------------
A0A355DVB4      DELKDSTG-LPLLGTIP---------FSKELKKTITRPATPPK-----------------
A0A1Z4RMB9      AEIKKKFA-YNVIGMTP---------LEPP------------------------------
A0A318B4H2      ADVQRELG-LPLLGTIP--------KVEDK------------------------------
B4WQE3          RELKDLTN-VPLLATIP---------YNHLLEGSKASILPRYEATRQPI-----------
A0A2K3BR24      QEVKDRLG-YTVLGSIP--------LVKTK-----------------MD-----------
K9YXY1          QEVKDRLS-YTVLGSIP--------LVKTK-----------------MD-----------
A0A0V7ZFJ4      DKIKQLLD-YPLLGTIP--------KTPKT----------TKGST---D-----------
A0A0V7ZNJ9      DQAKRLLN-YPVLGTIP--------QFEGK----------G-------F-----------
A0A367RIS1      EEAQELLD-YPLLGTIP--------VFEQK----------DKLAR---G-----------
A0A235IXQ2      EEAQHFLD-YPLLGKIP--------VFDQK----------ARLAR---G-----------
A0A1W5CNX3      EEAQQLLD-YPLLGTIP--------AFDQK----------ARLAR---G-----------
A0A5Q0GJJ5      EEAQQLLD-YPLLGTIP--------AFDQK----------ARLAR---G-----------
Q3MEB7          EEAQQLLD-YPLLGTIP--------AFDQK----------ARLAR---G-----------
A0A1Z4KHN9      EEAQQLLD-YPLLGTIP--------VFDQK----------VRLAR---G-----------
Q8YT70          EEAQQLLD-YPLLGTIP--------VFDQK----------VRLAR---G-----------
A0A166IWU6      AEAEQLLD-YPLLGKIP------------------------KMIR---D-----------
A0A2S0Q8C0      AEAEQLLD-YPLLGKIP------------------------KMIR---D-----------
W6FSX4          AEAEQLLD-YPLLGKIP------------------------KMIR---D-----------
A0A218Q4C1      EEAEKLFD-YPLLGKVP------------------------KLLR---D-----------
A0A6P1ZT04      EEAEKLLG-YPLLGKVP------------------------KLLR---D-----------
A0A0R0M9H9      EELNRILD-LPMLGTIP--------QYENT----------KRRKNQEQE-----------
A0A1S1ZVW2      EELNRILD-LPMLGTIP--------QYENT----------KRRKNQEQE-----------
A0A1B7WX82      EEANRLLG-FPLLGMIP--------LYGGK----------NPKN--Q-E-----------
A0A1B7WTD1      EEANRLLG-FPLLGTIP--------LYGEK----------KTKN--P-V-----------
A0A480ABC0      EEANRFLG-FPLLGTIP--------QYGEK----------KRKN--TVV-----------
A0A1Z4LRU5      DEAKKLLG-YPLLGTIP--------RVDE--------------K----D-----------
A0A1Z4JVB4      EQAQDLLD-YPLLGIIP--------KVETA----------KGNH----D-----------
K9PIA4          EEVKRLLG-YPVLGTIP--------LAEKV----------KGSD----G-----------
A0A1Z4HVE1      EEVKRLLG-YPLLGTIP--------LAEKV----------KDSD----G-----------
A0A252ECZ1      EEVKHLLD-YPLLGIIP--------LAEKA----------KGSD----G-----------
A0A1Z4G5Y1      EEVKRLLD-YPLLGTIP--------LAEKP----------KGVD----G-----------
A0A252DNA2      EEVKRLLD-YPLLGTIP--------LAEKP----------KGSD----G-----------
A0A252E1Q4      EEVKRLLD-YPLLGTIP--------LAEKP----------KGSD----G-----------
A0A6G9SK36      EEAKRILE-YPLLGAIP--------LSEKA----------KNIE----G-----------
A0A1Z4M597      EEAKRLLD-YPLLGAIP--------QAEKA----------KGSE----G-----------
A0A1Z4MWT1      EEAKRLLD-YPLLGAIP--------LAEKA----------KGSE----A-----------
A0A1Z4TX53      EEAKRLLD-YPLLGAIP--------LAEKA----------KGSE----A-----------
A0A5P8VSD1      EEAQQLLD-YPLLGTIP--------LFDQK----------TRLAR---G-----------
A0A2A2TNQ5      DEAKRLLG-YPLLGTVP--------NLAEK------------------G-----------
A0A3S1C4K5      EEAKRLLG-YPLLGTIP--------QLGGS------------------K-----------
A0A1X4G3D5      EEINRLLD-LPLLGSIP--------NFETK----------KRKNKGE-W-----------
D4TNI2          EEINRLLD-LPLLGSIP--------NFETK----------KRKNKGE-W-----------
A0A1Z4H6Z8      EEVKRLLG-YPLLGTIP--------LAEKP----------KGSN----S-----------
A0A1Z4NPM1      DEAKRLLG-LPVLGTIP--------QLMDK----------KGK-----K-----------
A0A3F3KPR9      EELNRILD-LPMLGTIP--------QYENT----------KRQKNAGGE-----------
D4TGN7          EELNRILD-LPMLGTIP--------QYENT----------KRQKNAGGE-----------
A0A1Z4UZW9      EEANRLLG-FPLLGTIP--------LYIGK----------NPKNP---Q-----------
A0A0K2M5H0      EEANRLLG-FPLLGTIP--------QYGEK----------NPKNR---Q-----------
A0A1B7VSH4      EEANRLLG-FPLLGTIP--------QHGEK----------NPKNP---Q-----------
A0A1B7W126      EEANRLLG-FPLLGTIP--------QHGEK----------NPKNR---Q-----------
A0A3D4C6Q6      EEANRLLG-FPLLGTIP--------QHGEK----------NPKNR---Q-----------
A0A1B7UVJ4      EEANRLLG-FPLLGMIP--------LYGGK----------NPKNQ---E-----------
A0A1B7UTR1      EEANRLLG-FPLLGMIP--------LYGGK----------NPKNQ---E-----------
K7W0A4          EEANRLLG-FPLLGAIP--------QYGEK----------NPKHR---Q-----------
A0A5C0DRW9      EEANRLLG-FPLLGTIP--------QYGEK----------NPKHR---Q-----------
A0A6H2C088      EEANRLLG-FPLLGTIP--------QYGKK----------NPKNR---Q-----------
A0A1Q4RTR1      EEAQELLG-YALLGTIP--------RLSVS--------------RHYRN-----------
A0A1Z4SQV2      SEAQELLG-YSLLGTIP--------RLSIT--------------RPHRN-----------
A0A2H2XGN1      SEAQELLG-YSLLGTIP--------RLSIT--------------RPHRN-----------
A0A433UXH8      EEAQELLG-YALLGTIP--------RLSVS--------------RHYRN-----------
A0A1U7HGH0      KEAREIFE-YKLLGTIP--------LFHNE---------------SQTE-----------
K9XJD3          KEAREIFE-YKLLGTIP--------LFHND---------------SQTE-----------
K9SX01          EDIKRLFG-YPLLGILP--------NFATRKLENLPAFVLRNPESVLSKLYLKIRKSKAY
A0A4P7ZT55      RDVEQGID-QPLLGSIP--------FLPLE------RFQSVNGLWEQLD-----------
A0A1E5QIR9      REAREYLG-YTLLGIIP--------NFEKI--------DKGLSYGKDGE-----------
A0A1Z4IBC7      KEAKEVLR-YTVLGVIP--------TLGRN--------SKDESPIPGLD-----------
A0A1W5CPC7      KEAKEVLR-YTVLGVIP--------TLGRN--------TKDDIPIPGLD-----------
A0A5Q0GKD1      KEAKEVLR-YTVLGVIP--------TLGRN--------TKDDIPIPGLD-----------
Q3MDC6          KEAKEVLR-YTVLGVIP--------TLGRN--------TKDDIPIPGLD-----------
A0A1Z4KM73      KEAKEVLR-YTVLGVIP--------TLGRN--------GKDDTPIPGLD-----------
Q8YNX7          KEAKEVLR-YTVLGVIP--------TLGRN--------GKDDTPIPGLD-----------
A0A367R4K6      KEAKEVLR-YTVLGVIP--------TLGRN--------GKEHSSIAGLD-----------
A0A1E2WSV8      KEAKEVLR-YSVLGVIP--------TQGRN--------GKESSSIAGLD-----------
A0A2R5FRT9      KEAKEVMK-YSVLGVIP--------TQSKN--------GKDNPSIAGLD-----------
A0A2K8T1B6      KEAKEVLR-YSVLGVIP--------TQSRN--------GRDHSSIAGLD-----------
A0A235I9I0      KEAKEVLR-YSVLGVIP--------TQGRN--------GKDHSSIPGLD-----------
A0A2D0HQT8      KEAKEVLR-YSVLGVIP--------TQGRN--------GKDHSSIPGLD-----------
A0A2L2NU95      KEAKDVLR-YSVLGVIP--------TQARN--------GKDHSSIAGLD-----------
A0A367S084      KEAKEVLR-YSVLGVIP--------AQGRN--------GKDHSSIPGLD-----------
A0A6P1A9A0      DDLKEITG-LALLGTIP---------YQKQVKGQTSGDWAKPSTRRGDR-----------
A0A1Z4SMD6      KEAEVLFD-LTLLGLIP--------KFEPS-----PSTVPSIK-----------------
A0A2H2Y096      KEAEVLFD-LTLLGLIP--------KFEPS-----PSTVPSIK-----------------
K9S8M8          KEIRNLYQ-YTLLGMIP--------RSKKKRWWFGSGSNTSV------------------
A0A1Z4NFV0      KEAESVFG-YTLLGLIP--------RFDSS--------VSSNRSEELFA-----------
A0A3M9ZEU1      QEAKALFG-YTLLGLIP--------DYTKL--------GASG--RKSAE-----------
A0A1Z4JK72      KEAEAQYG-YTMLGLVP--------KFETS--------DTPTIVSPSAD-----------
A0A0N7Z489      KDAEAQYG-YTLLGLVP--------RFETS--------DTPTILSPGAD-----------
A0A0S3TXS2      KDAEAQYG-YTLLGLVP--------RFETS--------DTPTILSPGAD-----------
A0A2A2TPF8      KEAETIFG-YTLLGLIP--------KFETN--------NNAIAQTFIE------------
A0A1Z4R0P8      KEAQNIFG-YTLLGLIP--------KFSTN--------NAAIEQISIE------------
A0A0T7BUI3      KEAENFFG-WTLLGLIP--------RFEAN--------HKSVAANITDD-----------
A0A1Z4LP32      KEIEEFFG-YTLIGLIP--------KFEPN--------SKSLDSNFIDD-----------
K9REP9          KEIEGFFN-YTLVGLIP--------KFEPD--------SKSTDSNPIVD-----------
A0A1Z4SIJ3      KETEAFFE-YPLLGLIP--------KFESN------NQDSSKETRLLGRINGLLAKYQQK
A0A2H2XPG4      KETEAFFE-YPLLGLIP--------KFESN------NQDSSKETRLLGRINGLLAKYQQK
K9V3C7          KEAQTLFG-YTPLGLIP--------KFDAN--------STSLIEEMSGD-----------
A0A1Z4T6Y7      KEAQDVFG-YTMLGLIP--------KFE-N--------APTIEQTI--E-----------
A0A2H2Y561      KEAQDVFG-YTMLGLIP--------KFE-N--------APTIEQTI--E-----------
A0A1Q4S362      KEAQDVFG-YTLLGLIP--------KFDTN--------SASIQQTM--E-----------
A0A3S1CIN8      KEAQDVFG-YTLLGLIP--------KFDTN--------SASIEQTM--E-----------
A0A2A2TC28      KESEKFFG-YTMLGFIP--------KFEPN------NTHSSLHQ-IMGD-----------
A0A0C1NCB0      KEAEEFFK-YTVLGLIP--------TFESSTKSSSESSTKSSSDRLMGE-----------
A0A2N6K7Q9      KETETFFG-YTLLGLIP--------KYKPN------NSVSGVQ--EIEA-----------
A0A2N6MXH6      KETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIEA-----------
A0A2N6M5A8      KETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIEA-----------
A0A2N6LL61      KETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIEA-----------
A0A0S3TP66      KETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIEA-----------
G6FP91          KETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIET-----------
A0A1U7GYR5      KETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIEA-----------
A0A2N6KY52      KETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--EIET-----------
A0A2N6KMP5      KETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--QIET-----------
A0A2N6MA45      KETETFFG-YTLLGLIP--------KYKLN------NSVSGVQ--QIEA-----------
A0A4Q9J9V9      KETETFFG-YTLLGLIP--------KYKPN------NFVSAVQ--DIED-----------
A0A328IGA1      KETETFFG-YTLLGLIP--------KYKPN------NFVSAVQ--DIED-----------
A0A4D9CE41      KETETFFG-YILLGLIP--------KYKPN------NFVSAVQ--DIED-----------
A0A0M0SFT2      KETETFFG-YTLLGLIP--------KYKPN------NFVNAVQ--DIED-----------
A0A1Z4TLC8      KETETFFG-YTLLGLIP--------KYKPN------NFVNAVQDVDVED-----------
A0A0C2LFH0      KEAETFFG-YTLLGLIP--------KFESK------KTSAPVN--LMSD-----------
A0A1Z4IYV4      KEAETFFG-YTLLGLIP--------KFESN------TTSTPDK--LMSE-----------
A0A1Z4Q0T6      KEAETFFG-YTMLGLIP--------KFESN------STSAPTK--LMSE-----------
A0A0C2PT44      KEAETFFG-YTMLGLIP--------KFESN------STSAATK--LMSE-----------
A0A1D2P6J4      KEAETFFG-YTLLGLIP--------KFESN------STSAPAE--LMSE-----------
B4WP72          NDCREQFG-YALLGAIP--------LFNET----SNLHRSKSHSKQLAS-----------
A0A2T1CIL7      KEAEEIFG-YPLQGVIPDSGYSAETTVSRG----MQELSFATSRDNNSS-----------
A0A433V7A0      EEARKIFD-YTLLGVIP--------YYGSF----EKHSSRH---KEI-E-----------
A0A2T1FTR8      EEAKSLLPGYPILGQIP--------VFEKS----RQLPKLS---KGA-A-----------
K9UA41          EEAKNLLPGYPILGQIP--------VFEKS----RQLPKLS---KGA-A-----------
A0A0C2LBE2      KQAKELFK-YTLLGVIP--------LTGRN----QKKSLRV---PEV-D-----------
A0A433NN38      KEAKELFQ-YTLLGVIP--------NLSRY----GKT--LT---GRL-D-----------
A0A2N6K0T2      REARELFQ-YTLLGVIP--------SVSKT----SKNNYSV---QGL-D-----------
A0A2N6ML72      KEARELFQ-YTLLGVIP--------NVSRN----NKNSYSV---QGL-D-----------
G6FQZ6          KEARELFQ-YTLLGVIP--------NVSRN----NKNSYSV---QGL-D-----------
A0A2N6MQX9      KEARELFQ-YTLLGVIP--------NVSRN----NKNSYSV---QGL-D-----------
A0A2N6KXT6      KEARELFQ-YTLLGVIP--------NVSRN----NKNSYSV---QGL-D-----------
A0A2N6KGB9      KEARELFQ-YTLLGVIP--------NVSRN----NKNSYSV---QGL-D-----------
A0A2N6L3Y5      KEARELFQ-YTLLGVIP--------NVSRN----NKNSYSV---QGL-D-----------
A0A0S3TIS7      KEARELFQ-YTLLGVIP--------NVSRN----TKNSYSV---QGL-D-----------
A0A1U7GW28      KEARELFQ-YTLLGVIP--------NVSRN----TKNSYSV---QGL-D-----------
A0A2N6LW63      KEARELFQ-YTLLGVIP--------NVSRN----TKNSYSV---QGL-D-----------
A0A328IH74      KEARELFQ-YTLLGVIP--------SVSRS----GKNSYSV---EGL-D-----------
A0A4D9CIB0      KEARELFQ-YTLLGVIP--------SVSRS----GKSSYSV---EGL-D-----------
A0A1Z4TQ63      REARELFQ-YTLLGVIP--------SVSRS----GKSSYSV---EGL-D-----------
A0A4Q9J8G2      KEARELFQ-YTLLGVIP--------SVSRS----GKNSYSV---EGL-D-----------
A0A350Y0P6      KEIRQLFK-YTWLGMIP--------ESRKK------GFFWR---QKL-N-----------
A0A352X940      KEVRQLFR-YTWLGMIP--------NLRKK------GLLSR---RKS-D-----------
B8HTN4          EEIQQYFD-YVTLAMIP--------FDKAA----ATANKAFKPTQGL-E-----------
A0A6P1AFJ5      EELHKTTN-LPILGTIP--------FQKKI--------------EESPG-----------
B0CAX4          QEATGLFD-YTVLGNIP--------LLKDA------EKMTR---KGL-D-----------
A0A1Z4RN12      QEVENLFA-YPLHGVVP--------NLNLT------GERKQLQLPGNST-----------
A0A2T1CMF9      QEVENMFA-YPLHGVVP--------DLSLG------GNNQQFQLPGSEK-----------
Q7NDC5          EEARGLLG-TSLLGSVP--------RWNAQ------------------S-----------
U5QGK3          EEATSLLG-TPLLGTIP--------RWTGA------------------E-----------
A0A2W4UY24      TEGQKLYD-YPLLGVIP--------DWRKR------TARNR-------E-----------
A0A0D8ZUV2      KEAQELFG-YTFLGTIP--------MLGKK------ANSRG---KDA-E-----------
A0A433VDI0      EEALELFG-YTLLGVIP--------ALNKK------AIPRG---RDK-E-----------
A0A3D1PG43      REVRDAFG-YTVIACIP--------HV-GK----KVGFRNQ---K-Q-E-----------
A0A2P8QQ72      REVKQLFG-YTLIGSIP--------QL-GK----FIKLKPG---RQE-D-----------
K9TZQ7          REIKQLFG-YTLIGSIP--------QL-GK----FIKLKPE---RQQ-D-----------
A0A6N8G584      REARERLD-YTLLGTIP--------HF-GK------RYATR---RNP-E-----------
A0A2G7GPR0      REARERLD-YTLLGTIP--------YF-GK------RYANR---RNQ-E-----------
K9XH68          REARERLD-YTLLGTIP--------YF-GK------RYANR---RNQ-E-----------
A0A1U7HW70      REARERLD-YTLLGTIP--------YF-GK------RYANR---RNQ-E-----------
A0A2S6VEJ8      REARERLD-YTLLGTIP--------YFGGK------RFANR---RNQ-E-----------
A0A140KBA0      QEIEEIFG-YPLQGVIP--------DLAKE------GSPNL-LVGDV-V-----------
K9XSG1          KEIEEIFG-YPLQGVIP--------DLEKE------GSPHL-LVGDV-V-----------
A0A2T1GMT4      KEIDKVFG-YTLLGMIP--------ATQRK------KNRAR---ATTPE-----------
K9UI51          KEIDKIFG-YTLLGMIP--------ATQKK------KIRSR---ATTPE-----------
K9QM62          QEIRQVFE-YTLLGIIP--------TSPVS------HKTMSFYLQDT-E-----------
A0A1Z4FWI3      NEIREIFGRYTLLGIVP--------SSTKK------LRSRN---REA-E-----------
A0A1Z4JYE7      DKVKEAFNGYTLLGIIP--------LLPQK------TISRK---REG-E-----------
A0A2T1FXY4      EEIRQRFS-YTLLGVIP--------LVGNK------VRSND---WDV-E-----------
K9TYI2          EEIRQRFR-YTLLGVIP--------LVANK------VRSND---GYV-E-----------
A0A1Z4QL41      NEVREIFG-YTLLGMMP--------LLAKK------VPFRH---QKA-Q-----------
A0A252D4T4      KQIREIFG-YTLLGIVP--------SSTKK------LRSRN---RET-D-----------
A0A252DJH5      KQIREIFG-YTLLGIVP--------SSTKK------LRSRN---RET-D-----------
A0A252EB80      KQIREIFG-YTLLGIVP--------SSTKK------LRSRN---RET-D-----------
A0A6G9SKZ9      KEIREIFG-YTLLGIVP--------SSTKK------IRSRY---RET-E-----------
A0A1Z4HPW5      KEIREIFG-YTLLGIVP--------SSTKK------IRSRY---RET-E-----------
A0A1Z4MSN1      KEIREIFG-YTLLGIVP--------SSTKK------IRSRY---RET-E-----------
A0A1Z4U1C2      KEIREIFG-YTLLGIVP--------SSTKK------IRSRY---RET-E-----------
A0A0D6KV51      KEIREIFG-YTLLGIVP--------SSTKK------IRSRY---RET-E-----------
A0A1Z4MKF8      KEIREIFG-YTLLGIVP--------SSTKK------IRSRY---RET-E-----------
A0A2C6WC43      REVRDIFR-YTLLGIVP--------LSVKK------VRSRF---SSA-E-----------
A0A1Z4L5A1      KEVRDVFG-YTLLGIVP--------LSVKK------VRSRF---SSA-E-----------
A0A367QD86      KEVRDVFR-YTLLGIIP--------LSVKK------VRSRF---SSA-E-----------
A0A235IZ96      REVRDVFG-YTLLGIVP--------LSVKK------VRSRY---SNL-E-----------
A0A2L2NGP0      REVRDVFG-YTLLGIVP--------LSVKK------VRSRY---SNL-E-----------
A0A2K8SM78      KEVRDVFR-YTLLGIIP--------LSVKK------VRSRY---SNL-E-----------
A0A2R5FPC0      KEVRDVFR-YTLLGIIP--------LSVKK------VR-RD---SNV-E-----------
A0A5P8W5T6      KEVRDIFR-YTLLGIVP--------LSVKK------VRSRH---SNL-E-----------
A0A0F5YE28      EEAKKTFG-YTLLGIIP--------MFKNK------RFSDY---FQG-E-----------
U7QEH7          EETKKIFG-YTLLGIIP--------MFKNK------RLSSY---FQG-E-----------
A0A3S1ATK5      QEVRDIFG-YTLLGILP--------SLSKK------SLFWH---QNA-D-----------
A0A2Z6CPH0      KEIREVFE-YPLLGVIP--------LSAHK------THSRK---LDTKK-----------
A0A1Z4GT50      KEVKEIFG-YTLLGMLP--------LSTKK------GRSRN---RDA-E-----------
A0A1Z4GIX0      KEIREVFG-YTLLGGIP--------LSTNK------MRSRE---SDG-E-----------
A0A2H6LC24      KEIREVFG-YTLLGGIP--------LSTNK------MRSRE---SDG-E-----------
B2J6N5          QEIRDIFR-YTLLGIVP--------LSVKK------IHSRY---SNT-E-----------
A0A367RMI4      KEIRDVFR-YTLLGIVP--------LSVKK------LRSRY---SNA-E-----------
A0A235HUM0      KEIRDVFG-YTLLGIVP--------LSVKK------LRSRD---SNA-E-----------
A0A2L2NW47      KEIRDVFG-YTLLGIVP--------LSVKK------LRSRY---SNA-E-----------
A0A1E2WUR1      KEVRDIFG-YTLLGIVP--------LSVKK------LRSRY---SDT-E-----------
A0A235IKU3      REVRDVFG-YTLLGIVP--------LSVKK------VRSRY---SNL-E-----------
A0A1U7MYU6      KEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L-----------
A0A1D8TNX9      KEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L-----------
A0A6P0L6C2      KEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L-----------
A0A6P0MVH0      KEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L-----------
A0A6P0KJV0      KEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L-----------
A0A6L9ZJG4      KEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L-----------
F4XKF3          KEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L-----------
A0A1D9FX10      KEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L-----------
A0A6P0Q0T0      KEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L-----------
A0A6P0W5I0      KEVKQLLR-YPVLGVIP--------VFKHK------KLSRR---RDD-L-----------
A0A3C0NJ41      KEVREQFG-YTLLATIP--------LLGKK------PRRRT---KHQ-E-----------
A0A352AG88      REVRELFG-YTLLGVIP--------SLTKK------GISRS---RDL-E-----------
A0A350Y374      KEVKDLFG-YTLLATIP--------TFGKK------TVSRF---TAQ-E-----------
A0A355DPX0      KEIKDLFG-YTLLATIP--------TFGKK------TVPRL---KAQ-E-----------
                                .                                           

K9SLA9          ---------------------------------------------SVLIT----------
A0A168TT23      ------------------------------------------------------------
A0A0M1JWX9      ---------------------------------------------KQLAS----------
A0A2T1M1V6      ------------------------------------------------------------
A0A2G7GCS2      ------------------------------------------------------------
K9XBH8          ------------------------------------------------------------
A0A1Z4LJ30      ------------------------------------------------------------
K9RI76          ------------------------------------------------------------
A0A352AE27      ------------------------------------------------------------
A0A3B8JH60      ------------------------------------------------------------
A0A3C0N766      ------------------------------------------------------------
K9W9J7          ------------------------------------------------------------
A0A139WSU3      ------------------------------------------------------------
A0A433VN22      ------------------------------------------------------------
Q7NF11          ------------------------------------------------------------
A0A1Z4JCS8      ------------------------------------------------------------
A0A6P0PI80      ------------------------------------------------------------
A0A6P0WGT6      ------------------------------------------------------------
F4XTX2          ------------------------------------------------------------
Q7NJN6          ------------------------------------------------------------
U5QCC3          ------------------------------------------------------------
A0A3M1SVZ4      ------------------------------------------------------------
A0A654SFI6      ------------------------------------------------------------
K9SSQ0          ------------------------------------------------------------
A0A2W1JIN9      ------------------------------------------------------------
A0A318AJV1      ------------------------------------------------------------
A0A6P0IC70      ------------------------------------------------------------
A0A6B3MUB5      ------------------------------------------------------------
A0A6M0B7N4      ------------------------------------------------------------
A0A6P0J9W3      ------------------------------------------------------------
A0A6P0ZWE1      ------------------------------------------------------------
A0A1U7N2U4      ------------------------------------------------------------
A0A1D9G1F2      ------------------------------------------------------------
A0A6P0PNZ7      ------------------------------------------------------------
F4XV38          ------------------------------------------------------------
A0A6P0W137      ------------------------------------------------------------
A0A6L9Y9E2      ------------------------------------------------------------
A0A6P0SGR0      ------------------------------------------------------------
A0A6M0BK48      ------------------------------------------------------------
A0A6L9YZL1      ------------------------------------------------------------
A0A6P0KYM4      ------------------------------------------------------------
A0A6P0LSD6      ------------------------------------------------------------
A0A6P0X384      ------------------------------------------------------------
A0A2P8QIL5      ------------------------------------------------------------
A0A2T1FLY5      ------------------------------------------------------------
A0A433W447      ------------------------------------------------------------
K9U1K8          ------------------------------------------------------------
K9UYB2          ------------------------------------------------------------
A0A218QN17      ------------------------------------------------------------
K9RKN2          ------------------------------------------------------------
A0A2I8ADV2      ------------------------------------------------------------
A0A1W5CKM3      ------------------------------------------------------------
A0A5Q0GMF5      ------------------------------------------------------------
Q3MEW0          ------------------------------------------------------------
A0A1Z4KIC7      ------------------------------------------------------------
Q8YSM5          ------------------------------------------------------------
A0A1Q4S1H4      ------------------------------------------------------------
A0A433VBU6      ------------------------------------------------------------
A0A1Q4RZJ6      ------------------------------------------------------------
A0A1Z4SNV3      ------------------------------------------------------------
A0A2H2XJQ1      ------------------------------------------------------------
A0A3S5K358      ------------------------------------------------------------
A0A0T7BPJ4      ------------------------------------------------------------
A0A0C1QS61      ------------------------------------------------------------
A0A139X3R8      ------------------------------------------------------------
A0A1Z4I7C5      ------------------------------------------------------------
A0A0C2MDK7      ------------------------------------------------------------
A0A1Y0RCK1      ------------------------------------------------------------
A0A1Z4PWZ0      ------------------------------------------------------------
A0A0C2QLT0      ------------------------------------------------------------
A0A1Z4J2K1      ------------------------------------------------------------
A0A3S0ZSX0      ------------------------------------------------------------
A0A2N6K4T3      ------------------------------------------------------------
A0A370CKT2      ------------------------------------------------------------
A0A0S3TL97      ------------------------------------------------------------
A0A2N6M8A0      ------------------------------------------------------------
A0A2N6M9E1      ------------------------------------------------------------
A0A2N6KJI4      ------------------------------------------------------------
A0A2N6MZ77      ------------------------------------------------------------
A0A2N6KT20      ------------------------------------------------------------
G6FSN3          ------------------------------------------------------------
A0A4D9CI02      ------------------------------------------------------------
A0A328I8B9      ------------------------------------------------------------
A0A4Q9J4Z7      ------------------------------------------------------------
A0A0M0SU69      ------------------------------------------------------------
A0A1Z4TIZ8      ------------------------------------------------------------
A0A0S3TYD7      ---------------------------------------------QKLGNLNVVDTELVV
A0A2T1DNG3      ----------------------------------------------ELSLGAMSGKPSLR
A0A3S0Y9N9      -----------------------SPI-------------------PEVVV----------
A0A433UNK7      -----------------------NFI-------------------PEVIV----------
A0A6P0ZKB8      -----------------------TFT-------------------PEVIV----------
U5QL42          -----------------------ENL-------------------TETLVAPSRDGV---
A0A076HBF2      -----------------------KGV-------------------REDKRFLLQELD--R
A0A354B169      -----------------------QGV-------------------REGKRFQLQELD---
G4FMX5          -----------------------KGV-------------------REDKRFPLKELD--S
Q0IDT5          -----------------------KGV-------------------REDKRFLLNELDQSS
A0A2D6FCW3      -----------------------KGV-------------------REDKRFLLQELD--I
A3ZA21          -----------------------QGV-------------------REDKRFLLQELD---
A0A140K3H3      -----------------------KVE-------------------KPLIQVNGETNT---
K9XUB8          -----------------------KVE-------------------EPVIQINGETHS---
A0A6H2NHD5      -----------------------EHR---------------SLLMNPRLVSTMEEVL---
A0A2P8W4F7      -----------------------QKQ---------------PLLIEPNLAVTMADVL---
A0A5Q4E0Z4      -----------------------QKQ---------------PLLMVPSLIATTADLL---
A0A2P8VVX1      -----------------------RRS-------------------EPDARGLHPELA---
A0A2P8WHY0      -----------------------QDG-------------------GPPI--LHPELA---
A0A2T1CMT9      -----------------------SSN-------------------NLLTRLPFRSIS---
A0A563VQJ3      -----------------------KEQ----------------------------------
A0A1D8TX52      -----------------------KIS-------------------KPVLNLSLSQSE---
A0A1D9G4T2      -----------------------KIS-------------------KPVLNLSLSQSE---
A0A6P0PR27      -----------------------KIS-------------------KPVLNLGLSQSE---
A0A6P0WER7      -----------------------KIS-------------------KPVLNLGLSQSE---
F4XP71          -----------------------KIS-------------------KPVLNLGLSQSE---
A0A6L9YR57      -----------------------KIS-------------------KPVLNLSLSQSE---
A0A6P0KZ31      -----------------------KIS-------------------KPVLNLNLSQSE---
A0A6P0LPB8      -----------------------KIS-------------------KPVLNLNLSQSE---
A0A6P0SEV1      -----------------------KIS-------------------KPVLNLSLSQSE---
A0A6B3N2I8      -----------------------KIS-------------------KPVLNLSLSQSE---
A0A6M0B891      -----------------------KIS-------------------KPVLNLSLSQSE---
A0A6P0IJQ1      -----------------------KIS-------------------KPVLNLSLSQSE---
A0A6P0J8J8      -----------------------KIS-------------------KPVLNLSLSQSE---
A0A6P0ZSH6      -----------------------KIS-------------------KPVLNLSLSQSE---
A0A1U7N5X9      -----------------------KIS-------------------KPVLNLSLSQSE---
A0A6L9Z1V0      -----------------------KIS-------------------KPVLNLSLSQSE---
A0A6P0LC12      -----------------------KIS-------------------KPVLNLSLSQSE---
A0A6P0MVJ3      -----------------------KIS-------------------KPVLNFNLSQSE---
A0A2W6ZAV2      -----------------------DGL------------------------------S---
K9W742          -----------------------KKSEPRMLLPFGKSQALEPVGNQPIIKLPFGKPK---
A0A3D1PBA3      -----------------------KLA-------------------KPQISLPFGKPH---
K9XPB0          -----------------------KHD-------------------QFVVKLPFLSPK---
A0A350Y7Z1      -----------------------GGS-------------------GLLVHLPFRRTQ---
A0A352X2A7      -----------------------RSS-------------------SIFVNLPFRKSS---
A0A0D8ZYV0      -----------------------KAS-------------------EPVVSLPFGKPN---
A0A2T1FP73      -----------------------RVA-------------------QPEVSLPFGKPL---
A0A433VMS2      -----------------------RVA-------------------QPEVSLPFGKPL---
K9TYA7          -----------------------RVA-------------------QPEVSLPFGKPL---
A0A2P8QUE1      -----------------------RVA-------------------QPEVSLPFGKPL---
K9SA61          -----------------------VSV-------------------AEPTIKLPLRRS---
A0A2G7GMH8      ---------------------------------------------AKPNGLI---KL---
A0A6N8FU92      ---------------------------------------------AKPSGSIINLSL---
A0A2T1DWE8      -----------------------GGL-------------------AALVPF---REV---
A0A1U7I8L3      -----------------------TRT-------------------EPIIHLPFRQQP---
A0A2T1DJL8      -----------------------EIN-------------------PRSIAMPFQKAE---
A0A1Z4J9W0      -----------------------ELM-------------------PTTPNFAFSRNA---
A0A0N7Z5K9      -----------------------ELM-------------------PTT-NFAFGRST---
A0A0S3TXC5      -----------------------ELM-------------------PTT-NFAFGRST---
B8HNB0          -----------------------EPH-------------------KDTDS----------
A0A563VS48      -----------------------ITD-------------------DGLIL----------
A0A318BJ18      -----------------------GTT-------------------PREQL----------
A0A3B8Y8H9      -----------------------QNK-------------------TDFPG----------
A0A2W1JVB9      -----------------------DVK-------------------RDLYV----------
A0A6H1U102      -------------------------K-------------------VKVPLVEGSRMDGDR
A0A7C3ZEJ3      -------------------------R-------------------VSAPVIESYRGQNGE
A0A563VLD6      ------------------------------------------------------------
A0A2P8W9H0      ------------------------------------------------------------
A0A6I5P386      ------------------------------------------------------------
A0A318BG22      ----------------------------------------------EIPAL---------
A0A2T1E9V8      -----------------------IGS-------------------GAVPV----------
A0A1Z4LN32      -----------------------GVS-------------------ERVIV----------
A0A2I8A9F5      -----------------------EPA-------------------RRVIV----------
A0A218Q6R8      -----------------------QFS-------------------PRIVV----------
A0A218QGE0      -----------------------KVS-------------------ERIIV----------
A0A3M2GQQ6      ----------------------------------------------KVSCPLVSQRKGEG
A0A6H1U2X0      ----------------------------------------------KVSCPLVSQRKGEG
K9TLQ0          ------------------------LK-------------------ESLTVSDGENLVQAS
K9QF04          ------------------------------------------------------------
K9W1T3          -----------------------RIV-------------------PSIVV----------
K9SGJ5          -----------------------RTD-------------------MLELSPVVEKETALA
A0A6N2JS94      -----------------------MTE-------------------TASLSAISSQ--GIL
A0A6C2DSN4      -----------------------MTE-------------------VASLAPLLSQ--GIL
L8MYT6          -----------------------MTE-------------------VASLAPLLSQ--GIL
A0A352JGJ6      -----------------------LTE-------------------VASLSAMVSQ--GIL
A0A1J5GLS2      -----------------------ITE-------------------VTSLSAMVGQ--SIL
A0A2W4W6M5      -----------------------MTE-------------------VASLSAMISH--GIL
A0A2W7AN33      -----------------------FTD-------------------PVALISM-AK--GQF
A0A256BLV2      -----------------------MTE-------------------VSSLSAATNQ--GIL
A0A2W6ZXF3      -----------------------MTE-------------------VASLSAMISQ--GIL
A0A2Z5WX66      -----------------------MTE-------------------VASLGAMLSQ--GIL
K1XF69          -------------------------S-------------------VQVPV----------
B5W297          -------------------------S-------------------VQVPV----------
A0A6H2AL05      -------------------------S-------------------VQVPV----------
H1W7M8          -------------------------S-------------------VQVPV----------
A0A5Q4H6A5      -------------------------S-------------------VQVPV----------
D5A466          -------------------------S-------------------VQVPV----------
U5QJM6          -----------------------KSN-------------------GRVQN----------
A0A1Z4RPC6      -------------------------H-------------------GSIIV----------
A0A2T1CMZ0      -------------------------R-------------------GGLVV----------
L8M4F7          -------------------------K-------------------RRVVV----------
A0A140K2P2      -------------------------Q--------------------GIIV----------
K9XWX4          -------------------------Q--------------------GIIV----------
A0A140KB14      -------------------------N--------------------GIVV----------
K9XX88          -------------------------N--------------------GIVV----------
A0A563VSV6      -------------------------Q--------------------GVLV----------
L8LZE9          -------------------------E-------------------DGIMV----------
A0A433NM31      -------------------------L-------------------PKIPV----------
A0A1Z4NDS1      -------------------------L-------------------PQIVG----------
U9VXM0          -------------------------V-------------------PSILV----------
A0A6M0RI13      -------------------------I-------------------PSILV----------
A0A6M0S1N5      -------------------------I-------------------PSILV----------
K9F4D9          -------------------------V-------------------PSILV----------
A0A6I5QPI5      -------------------------Y-------------------PRLLV----------
A0A1Z3HMQ0      -----------------------GIS-------------------PRVIA----------
A0A433W533      -----------------------ATT-------------------IALPV----------
A0A2P8QWJ3      -----------------------ATT-------------------IALPV----------
A0A2T1FKP8      -----------------------ATT-------------------IALPV----------
K9U6L7          -----------------------ATT-------------------IALPV----------
A0A1E5QP61      -------------------------I-------------------PLLPT----------
U5DPF5          -----------------------TRP-------------------VTLPV----------
A0A6P0X488      -----------------------DLV-------------------PLLPV----------
A0A6P0UVD5      -----------------------DLV-------------------PQLPV----------
A0A6P0VDM0      -----------------------DLV-------------------PQLPV----------
A0A6M0G142      -----------------------DMV-------------------PQLPV----------
A0A6P0MR53      -----------------------ALI-------------------PQLPV----------
A0A3M2GIL5      -------------------------T-------------------PDLPV----------
A0A6H1TSJ9      -------------------------T-------------------PDLPV----------
A0A3M1PML8      -------------------------A-------------------PRVVV----------
A0A6M8BE85      -------------------------A-------------------PRVVV----------
A0A0T7BPZ0      -------------------------I-------------------PRVIG----------
A0A352X442      -------------------------D-------------------VRLVA----------
A0A6B3NF44      -------------------------A-------------------PLVFA----------
A0A6M0EPL4      -------------------------A-------------------PLVFA----------
A0A6P0K6L6      -------------------------A-------------------PLVFA----------
A0A6P0MRR9      -------------------------E-------------------RRIIV----------
A0A6P0UX57      -------------------------E-------------------PRILV----------
A0A6P0X1X4      -------------------------E-------------------PRILV----------
A0A0M0SHU3      -------------------------V-------------------PRVIG----------
A0A1D2PBN3      -------------------------I-------------------PRVIG----------
A0A0C2LVR7      -------------------------I-------------------PRVIG----------
A0A1Z4PQB9      -------------------------I-------------------PRVIG----------
A0A1Z4SFN6      -------------------------I-------------------PRVIG----------
K9PGI8          -----------------------FAI-------------------PRLIG----------
Q7NEU3          ------------------------ER-------------------QKPDLPK--------
A0A3C0N2P0      -----------------------IDP-------------------ENLEFQLSAQS----
A0A6P0JR04      ------------------------------------------------------------
A0A6B3M6M6      -----------------------SES-------------------EKVEFN---------
A0A6P0KD09      -----------------------SES-------------------EKVEFN---------
A0A6B3NIJ0      -----------------------SES-------------------EKVEFN---------
A0A6M0F053      -----------------------SES-------------------EKVEFN---------
A0A6P2ATU9      -----------------------ETT-------------------PMLPVPRGDRYGSTG
A0A352XE00      -----------------------VNR-------------------EVLELAFS-GY----
A0A6P0QC14      -----------------------PDP-------------------SEFQ---GRSY----
B4VS56          -----------------------LET-------------------PLLASPISQST----
A0A352AAQ3      -----------------------PEG-------------------QQLESEFNQRS----
A0A350Y472      -----------------------SHS-------------------EPLELELRRRS----
A0A355DVB4      -----------------------SHS-------------------EPLELELRRRS----
A0A1Z4RMB9      -----------------------SYQ-------------------GRIIT----------
A0A318B4H2      -----------------------DVA-------------------EELQN----------
B4WQE3          -----------------------YFN-------------------EGVQH----------
A0A2K3BR24      -----------------------NTS-------------------SFLPL----------
K9YXY1          -----------------------DTS-------------------SFLPL----------
A0A0V7ZFJ4      -----------------------NQE-------------------IELPV----------
A0A0V7ZNJ9      -----------------------DGN-------------------PELPT----------
A0A367RIS1      -----------------------ESI-------------------TELPV----------
A0A235IXQ2      -----------------------ENI-------------------TELPV----------
A0A1W5CNX3      -----------------------ESI-------------------TELPV----------
A0A5Q0GJJ5      -----------------------ESI-------------------TELPV----------
Q3MEB7          -----------------------ESI-------------------TELPV----------
A0A1Z4KHN9      -----------------------ESI-------------------TELPV----------
Q8YT70          -----------------------ESI-------------------TELPV----------
A0A166IWU6      -----------------------DNT-------------------SELPL----------
A0A2S0Q8C0      -----------------------DNT-------------------SELPL----------
W6FSX4          -----------------------DNT-------------------SELPL----------
A0A218Q4C1      -----------------------EHT-------------------TELPL----------
A0A6P1ZT04      -----------------------EGT-------------------SELPL----------
A0A0R0M9H9      -----------------------ENQ-------------------RELPV----------
A0A1S1ZVW2      -----------------------ENQ-------------------RELPV----------
A0A1B7WX82      -----------------------ESR-------------------RELPL----------
A0A1B7WTD1      -----------------------EGL-------------------LEVPL----------
A0A480ABC0      -----------------------EGL-------------------LEVPL----------
A0A1Z4LRU5      -----------------------KDR-------------------QELPV----------
A0A1Z4JVB4      -----------------------ERT-------------------AALPV----------
K9PIA4          -----------------------EGG-------------------AELPV----------
A0A1Z4HVE1      -----------------------EEG-------------------AELPV----------
A0A252ECZ1      -----------------------EGS-------------------TELPV----------
A0A1Z4G5Y1      -----------------------EGS-------------------AELPV----------
A0A252DNA2      -----------------------EGS-------------------AELPT----------
A0A252E1Q4      -----------------------EGS-------------------AELPT----------
A0A6G9SK36      -----------------------EGE-------------------QELPV----------
A0A1Z4M597      -----------------------VGE-------------------VELPV----------
A0A1Z4MWT1      -----------------------ASE-------------------QELPV----------
A0A1Z4TX53      -----------------------ASE-------------------QELPV----------
A0A5P8VSD1      -----------------------ESI-------------------TELPV----------
A0A2A2TNQ5      -----------------------KMA-------------------TEIPA----------
A0A3S1C4K5      -----------------------GNG-------------------DDLPV----------
A0A1X4G3D5      -----------------------EGE-------------------GDLPL----------
D4TNI2          -----------------------EGE-------------------GDLPL----------
A0A1Z4H6Z8      -----------------------EAG-------------------SELPV----------
A0A1Z4NPM1      -----------------------AGD-------------------EELPV----------
A0A3F3KPR9      -----------------------ESQ-------------------RELPI----------
D4TGN7          -----------------------ESQ-------------------RELPI----------
A0A1Z4UZW9      -----------------------EGR-------------------QELPV----------
A0A0K2M5H0      -----------------------EGR-------------------QELPL----------
A0A1B7VSH4      -----------------------EGR-------------------QELPL----------
A0A1B7W126      -----------------------EGR-------------------QELPL----------
A0A3D4C6Q6      -----------------------EGR-------------------QELPL----------
A0A1B7UVJ4      -----------------------ESR-------------------GELPL----------
A0A1B7UTR1      -----------------------ESR-------------------GELPL----------
K7W0A4          -----------------------EGR-------------------QELPL----------
A0A5C0DRW9      -----------------------EGR-------------------QELPL----------
A0A6H2C088      -----------------------EGR-------------------QELPL----------
A0A1Q4RTR1      -----------------------RHI-------------------STLPI----------
A0A1Z4SQV2      -----------------------RDI-------------------STLPI----------
A0A2H2XGN1      -----------------------RDI-------------------STLPI----------
A0A433UXH8      -----------------------RDI-------------------STLPI----------
A0A1U7HGH0      -----------------------REQ-------------------WRVPV----------
K9XJD3          -----------------------REE-------------------WQVPV----------
K9SX01          RSFASSLESFKISILNAVSEPENTTA-------------------LTVFV----------
A0A4P7ZT55      ------------------------------------------------------------
A0A1E5QIR9      -----------------------RVK-------------------AKLPV----------
A0A1Z4IBC7      -----------------------RPV-------------------PKIIG----------
A0A1W5CPC7      -----------------------RAV-------------------PKIIG----------
A0A5Q0GKD1      -----------------------RAV-------------------PKIIG----------
Q3MDC6          -----------------------RAV-------------------PKIIG----------
A0A1Z4KM73      -----------------------RAV-------------------PKIIG----------
Q8YNX7          -----------------------RAV-------------------PKIIG----------
A0A367R4K6      -----------------------RPI-------------------PKIIG----------
A0A1E2WSV8      -----------------------RAI-------------------PKIIG----------
A0A2R5FRT9      -----------------------RAI-------------------PKIIG----------
A0A2K8T1B6      -----------------------RPI-------------------PKIIG----------
A0A235I9I0      -----------------------RAI-------------------PKIIG----------
A0A2D0HQT8      -----------------------RPI-------------------PKIIG----------
A0A2L2NU95      -----------------------RPI-------------------PKIIG----------
A0A367S084      -----------------------RPI-------------------PKIIG----------
A0A6P1A9A0      -----------------------ASV-------------------LSVTP----------
A0A1Z4SMD6      -----------------------GIS-------------------PRIVI----------
A0A2H2Y096      -----------------------GIS-------------------PRIVI----------
K9S8M8          ---------------------------------------------PKVVV----------
A0A1Z4NFV0      -----------------------GVS-------------------PRVIV----------
A0A3M9ZEU1      -----------------------PAT-------------------LRIFP----------
A0A1Z4JK72      -----------------------DIS-------------------PRVIA----------
A0A0N7Z489      -----------------------DIS-------------------PRVIA----------
A0A0S3TXS2      -----------------------DIS-------------------PRVIA----------
A0A2A2TPF8      -----------------------AAS-------------------PRIIV----------
A0A1Z4R0P8      -----------------------GAS-------------------PRVIV----------
A0A0T7BUI3      -----------------------GIS-------------------ERVIV----------
A0A1Z4LP32      -----------------------NIS-------------------PRIIV----------
K9REP9          -----------------------TIS-------------------PRIIV----------
A0A1Z4SIJ3      NQIVSLPSTNFDSKLLPIRLVGLEVS-------------------NRIIV----------
A0A2H2XPG4      NQIVSLPSTNFDSKLLPIRLVGLEVS-------------------NRIIV----------
K9V3C7          -----------------------GVS-------------------PRIIV----------
A0A1Z4T6Y7      -----------------------GAS-------------------PRIVV----------
A0A2H2Y561      -----------------------GAS-------------------PRIVV----------
A0A1Q4S362      -----------------------GAS-------------------PRVIV----------
A0A3S1CIN8      -----------------------GAS-------------------PRVVV----------
A0A2A2TC28      -----------------------NVS-------------------PRVIV----------
A0A0C1NCB0      -----------------------ATS-------------------PRVIV----------
A0A2N6K7Q9      -----------------------GVY-------------------PQVIA----------
A0A2N6MXH6      -----------------------GVY-------------------PQVIT----------
A0A2N6M5A8      -----------------------GVY-------------------PQVIT----------
A0A2N6LL61      -----------------------GVY-------------------PQVIT----------
A0A0S3TP66      -----------------------GVY-------------------PQVIT----------
G6FP91          -----------------------GVY-------------------PQVIT----------
A0A1U7GYR5      -----------------------GVY-------------------PQVIT----------
A0A2N6KY52      -----------------------GVY-------------------PQVIT----------
A0A2N6KMP5      -----------------------GVY-------------------PQVIT----------
A0A2N6MA45      -----------------------GVY-------------------PQVIT----------
A0A4Q9J9V9      -----------------------GVY-------------------PQVIT----------
A0A328IGA1      -----------------------GVY-------------------PQVIT----------
A0A4D9CE41      -----------------------GVY-------------------PQVIT----------
A0A0M0SFT2      -----------------------GVY-------------------PQVIT----------
A0A1Z4TLC8      -----------------------GVY-------------------PQVIT----------
A0A0C2LFH0      -----------------------KAS-------------------ARIIV----------
A0A1Z4IYV4      -----------------------GVS-------------------ARVIV----------
A0A1Z4Q0T6      -----------------------GVS-------------------ARVIV----------
A0A0C2PT44      -----------------------GVS-------------------ARVIV----------
A0A1D2P6J4      -----------------------GVS-------------------GRVIV----------
B4WP72          -----------------------SVF-------------------SNVRT----------
A0A2T1CIL7      -----------------------LSI-------------------PDLNL----------
A0A433V7A0      -----------------------QTA-------------------LNVHV----------
A0A2T1FTR8      -----------------------RAP-------------------GQLVL----------
K9UA41          -----------------------RAP-------------------GQLVL----------
A0A0C2LBE2      -----------------------QSI-------------------PKVIG----------
A0A433NN38      -----------------------RPT-------------------PRVIG----------
A0A2N6K0T2      -----------------------RPI-------------------PRVVG----------
A0A2N6ML72      -----------------------RPI-------------------PRVVG----------
G6FQZ6          -----------------------RPI-------------------PRVVG----------
A0A2N6MQX9      -----------------------RPI-------------------PRVVG----------
A0A2N6KXT6      -----------------------RPI-------------------PRVVG----------
A0A2N6KGB9      -----------------------RPI-------------------PRVVG----------
A0A2N6L3Y5      -----------------------RPI-------------------PRVVG----------
A0A0S3TIS7      -----------------------RPI-------------------PRVVG----------
A0A1U7GW28      -----------------------RPI-------------------PRVVG----------
A0A2N6LW63      -----------------------RPI-------------------PRVVG----------
A0A328IH74      -----------------------RPV-------------------PRVIG----------
A0A4D9CIB0      -----------------------RPV-------------------PRVVG----------
A0A1Z4TQ63      -----------------------RPV-------------------PRVVG----------
A0A4Q9J8G2      -----------------------RPV-------------------PRVVG----------
A0A350Y0P6      -----------------------GNV-------------------PQLVV----------
A0A352X940      -----------------------GDI-------------------PQLPV----------
B8HTN4          -----------------------RAT-------------------PQLYL----------
A0A6P1AFJ5      -----------------------TSE-------------------KNSSR----------
B0CAX4          -----------------------RPT-------------------PDLVV----------
A0A1Z4RN12      -----------------------ANL-------------------PEQVT----------
A0A2T1CMF9      -----------------------ANL-------------------PEQIV----------
Q7NDC5          -----------------------VRG-------------------PLMAL----------
U5QGK3          -----------------------GPG--------------------LVAQ----------
A0A2W4UY24      -----------------------LDA-------------------PRIIV----------
A0A0D8ZUV2      -----------------------ATI-------------------PELPV----------
A0A433VDI0      -----------------------WAV-------------------PELPV----------
A0A3D1PG43      -----------------------WAV-------------------PEISV----------
A0A2P8QQ72      -----------------------CPI-------------------PELAV----------
K9TZQ7          -----------------------CPV-------------------PELAV----------
A0A6N8G584      -----------------------WSI-------------------PELPV----------
A0A2G7GPR0      -----------------------WSI-------------------PELPV----------
K9XH68          -----------------------WSI-------------------PELPV----------
A0A1U7HW70      -----------------------WSI-------------------PELPV----------
A0A2S6VEJ8      -----------------------WSI-------------------PELPV----------
A0A140KBA0      -----------------------DTL-------------------PQLPA----------
K9XSG1          -----------------------DTL-------------------PQLPA----------
A0A2T1GMT4      -----------------------QTT-------------------LEIAV----------
K9UI51          -----------------------QTT-------------------LEIAV----------
K9QM62          -----------------------SIT-------------------PSIAV----------
A0A1Z4FWI3      -----------------------LAP-------------------PEIAV----------
A0A1Z4JYE7      -----------------------YQI-------------------PRIAV----------
A0A2T1FXY4      -----------------------STN-------------------PEIAV----------
K9TYI2          -----------------------STI-------------------PEISV----------
A0A1Z4QL41      -----------------------TNT-------------------QNIVV----------
A0A252D4T4      -----------------------LIN-------------------PEIAV----------
A0A252DJH5      -----------------------LIN-------------------PEIAV----------
A0A252EB80      -----------------------LIN-------------------PEIAV----------
A0A6G9SKZ9      -----------------------IAT-------------------QEIAV----------
A0A1Z4HPW5      -----------------------IAT-------------------QEIAV----------
A0A1Z4MSN1      -----------------------IAT-------------------QEIAV----------
A0A1Z4U1C2      -----------------------IAT-------------------QEIAV----------
A0A0D6KV51      -----------------------IAT-------------------QEIAV----------
A0A1Z4MKF8      -----------------------IAT-------------------QEIAV----------
A0A2C6WC43      -----------------------SIT-------------------QKVAV----------
A0A1Z4L5A1      -----------------------SIT-------------------QKVAV----------
A0A367QD86      -----------------------SIT-------------------QKVAV----------
A0A235IZ96      -----------------------LPT-------------------QTVAV----------
A0A2L2NGP0      -----------------------LPT-------------------QTVAV----------
A0A2K8SM78      -----------------------SIT-------------------QKIAV----------
A0A2R5FPC0      -----------------------P----------------------KIAV----------
A0A5P8W5T6      -----------------------SIT-------------------QKIAV----------
A0A0F5YE28      -----------------------RAS-------------------QQIPV----------
U7QEH7          -----------------------KAT-------------------PDIPV----------
A0A3S1ATK5      -----------------------YIT-------------------PEIAS----------
A0A2Z6CPH0      -----------------------LTT-------------------PEIAV----------
A0A1Z4GT50      -----------------------SIT-------------------PEVPV----------
A0A1Z4GIX0      -----------------------LAS-------------------PEIAV----------
A0A2H6LC24      -----------------------LAS-------------------PEIAV----------
B2J6N5          -----------------------SIN-------------------QTIAV----------
A0A367RMI4      -----------------------SIS-------------------QTIAV----------
A0A235HUM0      -----------------------FTS-------------------QTVAV----------
A0A2L2NW47      -----------------------SIS-------------------QTIAV----------
A0A1E2WUR1      -----------------------STV-------------------QTIAV----------
A0A235IKU3      -----------------------LPT-------------------QTVAV----------
A0A1U7MYU6      -----------------------FFG-------------------GELPV----------
A0A1D8TNX9      -----------------------FFG-------------------GELPV----------
A0A6P0L6C2      -----------------------FFG-------------------GELPV----------
A0A6P0MVH0      -----------------------FFG-------------------GELPV----------
A0A6P0KJV0      -----------------------FFG-------------------GELPV----------
A0A6L9ZJG4      -----------------------FFG-------------------GELPV----------
F4XKF3          -----------------------FFG-------------------GELPV----------
A0A1D9FX10      -----------------------FFG-------------------GELPV----------
A0A6P0Q0T0      -----------------------FFG-------------------GELPV----------
A0A6P0W5I0      -----------------------FFG-------------------GELPV----------
A0A3C0NJ41      -----------------------RTV-------------------PELPV----------
A0A352AG88      -----------------------GTI-------------------PELPV----------
A0A350Y374      -----------------------RTI-------------------PELPV----------
A0A355DPX0      -----------------------RTI-------------------PELPV----------
                                                                            

K9SLA9          RDMPQS-------------TLAET-----------FRILHTNLK-----FL----EP-GK
A0A168TT23      TTRAEDRAVSHYSELHPKSAVSEA-----------FRSLRTSLM-----FS----TP-QG
A0A0M1JWX9      SSWIADSNGRERLQDDRDFGFLEA-----------FRALNTNIR-----FL----ST-DQ
A0A2T1M1V6      -----------------------------------FQRLAAIVS-----SF-------EL
A0A2G7GCS2      -----------------------------------LQRLASAV-------L-------ML
K9XBH8          -----------------------------------LQRLASAV-------L-------ML
A0A1Z4LJ30      -----------------------------------FQRLASAVS-----LM-------QL
K9RI76          -----------------------------------FQRLASAVS-----LM-------QL
A0A352AE27      -----------------------------------FQRLASAIS-----LQ-------PL
A0A3B8JH60      -----------------------------------FQRLASAIS-----LQ-------PL
A0A3C0N766      -----------------------------------FQRLASAIS-----LQ-------PL
K9W9J7          -----------------------------------FQRLASAIS-----LQ-------PL
A0A139WSU3      -----------------------------------FQRLASAIS-----LQ-------PL
A0A433VN22      -----------------------------------FQRLASAIS-----LQ-------PL
Q7NF11          -----------------------------------SRQLASTVS-----LM-------DL
A0A1Z4JCS8      -----------------------------------FQRVASAIS-----LQ-------PL
A0A6P0PI80      -----------------------------------FQRLASVIS-----LR-------SG
A0A6P0WGT6      -----------------------------------FQRLASVIS-----LR-------SG
F4XTX2          -----------------------------------FQRLASVIS-----LR-------SG
Q7NJN6          -----------------------------------FRQLASVVS-----LL-------PL
U5QCC3          -----------------------------------FLQLASIVS-----LM-------PL
A0A3M1SVZ4      QVRKSNRLLGHRRSIPQIIVRDNPRSLISEA----YRMLQTKLK-----FA----CA-EQ
A0A654SFI6      KSDAADVLKDLINSASD---LSEA-----------YQATRANLA-----FL----TS-DG
K9SSQ0          YLATNAKLLSPSLELISERAFLPH-----SYNHSAFTEAVNSLALNIQNLA-----A-QR
A0A2W1JIN9      RLSKNTLNLGEPASFYENSAILEA-----------YRALFKALE-----FR-----G-LE
A0A318AJV1      A--------EGGRRWFRSRGRVSPADLIGVAGATVYSEAIRNLRASLIGVR-----Q-AS
A0A6P0IC70      EIPLSALSLKHPEQFLDDLSLVEP-----------YRLLLKKLE-----FR-----T-QQ
A0A6B3MUB5      EIPLSALSLKHPEQFLDDLSLVEP-----------YRLLLKKLE-----FR-----T-QQ
A0A6M0B7N4      EIPLSALSLKHPEQFLDDLSLVEP-----------YRLLLKKLE-----FR-----T-QQ
A0A6P0J9W3      EIPLSALSLKHPEQFLDDLSLVEP-----------YRLLLKKLE-----FR-----T-QQ
A0A6P0ZWE1      EIPLSALSLKHPEQFLDDLSLVEP-----------YRLLLKKLE-----FR-----T-QQ
A0A1U7N2U4      TIPAQALSVEQPKGFLEDMRLMEP-----------YRLLLTTME-----LR-----A-QK
A0A1D9G1F2      KIPAQALSLEQPNRFLEDMRLMEP-----------YRLLLTTME-----LR-----A-QK
A0A6P0PNZ7      KIPAQALSLEQPNRFLEDMRLMEP-----------YRLLLTTME-----LR-----A-QK
F4XV38          KIPAQALSLEQPNRFLEDMRLMEP-----------YRLLLTTME-----LR-----A-QK
A0A6P0W137      KIPAQALSLEQPNRFLEDMRLMEP-----------YRLLLTTME-----LR-----A-QK
A0A6L9Y9E2      KIPAQALSLKQPNRFLADMRLIEP-----------YRLLLTTME-----LR-----A-QK
A0A6P0SGR0      KIPAQALSLEQPNRFLADMRLMEP-----------YRLLLTTME-----LR-----A-QK
A0A6M0BK48      KIPAQALSLKQPNRFLADMRLIEP-----------YRLLLTTME-----LR-----A-QK
A0A6L9YZL1      KMPAQALSLEQPKRFLADIRLMEP-----------YRLLLTTME-----LR-----A-QN
A0A6P0KYM4      KIPAQALSLEQPKRFLADIRLMEP-----------YRLLLTTME-----LR-----A-QK
A0A6P0LSD6      QIPAQALSLEQPKRFLADIRLMEP-----------YRLLLTTME-----LR-----A-QK
A0A6P0X384      DLPASALVLEPPEQFLDDGKLVEP-----------YRLLLKKLE-----FC----IQ-EE
A0A2P8QIL5      VISPEVRGKEYADALMQEPAILES-----------YRSLLRSSE-----FA-----A-NE
A0A2T1FLY5      VISPEVRGKEYADALMQEPAILES-----------YRSLLRSSE-----FA-----A-NE
A0A433W447      VISPEVRGKEYADALMQEPAILES-----------YRSLLRSSE-----FA-----A-NE
K9U1K8          VISPEVRGKEYADALMQEPAILES-----------YRSLLRSSE-----FA-----A-NE
K9UYB2          RLPAKATILQPANFFFNEISLVEP-----------YRMLFKNLE-----FS-----T-AE
A0A218QN17      RLPAKTLVLEPAERFLDNISLVEP-----------YRMLLKTLE-----FR-----S-ND
K9RKN2          RLPGKTLVLEPSDRFLDQVGLVEP-----------YRMLFKTLE-----FR-----S-DD
A0A2I8ADV2      RLPATKLTLEPAEKFLDDVGLVEP-----------YRMLLKNLE-----FR-----S-HE
A0A1W5CKM3      RLPATKLSLEPAEQFLDDLGLVEP-----------YRMLLKNLE-----FR-----N-VD
A0A5Q0GMF5      RLPATKLSLEPAEQFLDDLGLVEP-----------YRMLLKNLE-----FR-----N-VD
Q3MEW0          RLPATKLSLEPAEQFLDDLGLVEP-----------YRMLLKNLE-----FR-----N-VD
A0A1Z4KIC7      RLPATKLSLEPAEQFLDDLGLVEP-----------YRMLLKNLE-----FR-----N-VD
Q8YSM5          RLPATKLSLEPAEQFLDDLGLVEP-----------YRMLLKNLE-----FR-----N-VD
A0A1Q4S1H4      RLSKSNLALAEADLFLDDMGLVEP-----------YRMLLKTLE-----CR-----S-PG
A0A433VBU6      RLSKSNLALAEADLFLDDMGLVEP-----------YRMLLKTLE-----CR-----S-AS
A0A1Q4RZJ6      RLPAKTLALEPADGFLDNVALVEP-----------YRMLFKSLE-----FR-----T-SE
A0A1Z4SNV3      RLPDRTLVLNPANRFLDNVGLVEP-----------YRMLFKSLE-----FR-----T-SE
A0A2H2XJQ1      RLPDRTLVLNPANRFLDNVGLVEP-----------YRMLFKSLE-----FR-----T-SE
A0A3S5K358      RLPAKTLALEPADGFLDNVALVEP-----------YRMLFKSLE-----FR-----T-SE
A0A0T7BPJ4      RLPGSTLKLQSADTFLDDIGSVEP-----------YRMLLKNIE-----FR-----N-LE
A0A0C1QS61      RLPSKTLVLEPSQRFLDNMSLVEP-----------YRMLFKTLE-----FR-----S--D
A0A139X3R8      RLPSKTLVLEPSHRFLDNVSLVEP-----------YRMLFKTLE-----FR-----S--D
A0A1Z4I7C5      RLPATKLSLEPAEQFLDDLGLVEP-----------YRMLLKNLE-----FR-----S-ID
A0A0C2MDK7      RLPAKTLVLEPANQFLDNMELIEP-----------YRTLFKTLE-----FR-----R-SE
A0A1Y0RCK1      RLPAKTLVLKPANQFLDNISLVEP-----------YRTLFKTLE-----FR-----S-RE
A0A1Z4PWZ0      RLSAKTLVLEPANRFLDNIGLVEP-----------YRTLFKTLE-----FR-----S-SE
A0A0C2QLT0      RLPGKTLVLKPANRFLDNIGLVEP-----------YRTLFKTLE-----FR-----S-PE
A0A1Z4J2K1      RLPAKTLVLEPANRFLDNIGLVEP-----------YRTLFKTLE-----FR-----S-PE
A0A3S0ZSX0      RLPAKTLMLEPSERFLDNSALIEP-----------FRMLFKNLE-----FR-----S-SE
A0A2N6K4T3      CLPSRAIALEPSVRFLDHVGLVEP-----------YRTLFKNLE-----FR-----S-RE
A0A370CKT2      RLPGHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR-----S-SE
A0A0S3TL97      RLPGHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR-----S-SE
A0A2N6M8A0      RLPGHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR-----S-SE
A0A2N6M9E1      RLPGHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR-----S-SE
A0A2N6KJI4      RLPGHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR-----S-SE
A0A2N6MZ77      RLPGHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR-----S-SE
A0A2N6KT20      RLPGHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR-----S-SE
G6FSN3          RLPGHAIALEPSAQFLDHVGLVEP-----------YRTLFKNLE-----FR-----S-SE
A0A4D9CI02      SLPADAIALEPSGQFLDHLGLVEP-----------YRTLLKNLE-----FR-----N-PE
A0A328I8B9      SLPAHAIALEPSGQFLDHVGLVEP-----------YRTLLKNLE-----FR-----N-PE
A0A4Q9J4Z7      SLPAHAIALEPSGQFLDHLGLVEP-----------YRTLLKNLE-----FR-----N-PE
A0A0M0SU69      RLPADAIALEPSGRFLDHVGLVEP-----------YRTLFKNLE-----FR-----S-TE
A0A1Z4TIZ8      RLPTHAIALESSGRFLDHVGLIEP-----------YRTLFKNLE-----FR-----S-NE
A0A0S3TYD7      RDAPRS-------------APAAA-----------YQMLQSNLK-----YV----SS-DR
A0A2T1DNG3      LSGQTQALLPPITQLTKWRPFRES-----------LDLLYQNLQ-----LI----NA-TA
A0A3S0Y9N9      KNKPDS-------------PVSEA-----------FRILQTNLR-----FF----NS-KQ
A0A433UNK7      KNQPDS-------------SVSEA-----------FRMLQTNLR-----FF----NS-EQ
A0A6P0ZKB8      KKQPDS-------------SISEA-----------FRMLQTNLR-----FF----NS-EQ
U5QL42          -----VIGDRLVTRQYTRSPFKEA-----------LRSLALSLR-----YL----G-SNN
A0A076HBF2      SVTGEDDPEAAKQRRYQRFLYQEA-----------FRNLFTSIR-----FL----N-SDQ
A0A354B169      QLVANPASEAFEKYRSQLFYCQEA-----------FRSLFTSLR-----FL----N-SEK
G4FMX5          ETQADVGETERKAARYQRFFYQEA-----------FRNLFTSLR-----FL----N-SDR
Q0IDT5          NNNATNAPESRKQDRYQRFFYQEA-----------FRNLFTSLR-----FL----N-TER
A0A2D6FCW3      NNPSEEDQNTKQKAKYQRFFYQEA-----------FRNLFTSIR-----FL----N-SDQ
A3ZA21          QSVSGGDADDRREQRYQRFFYQEA-----------FRNLFTSIR-----FL----N-SDR
A0A140K3H3      -----KA------HYYNYSSFTEG-----------LRTLAMNLR-----YT----LTEKG
K9XUB8          -----RA------HYYNYSSFTEG-----------LRALAMNLR-----YT----ITETG
A0A6H2NHD5      -----VQH-QGDNSPYTSFSFTEA-----------FYSLDANLR-----LL----S-SDA
A0A2P8W4F7      -----TQS-QSPEKLYTSFSFAEA-----------FYSLEANLR-----ML----S-SDV
A0A5Q4E0Z4      -----AQS-QSPGNLYSSFSFAEA-----------FYSLEANLR-----ML----S-SDT
A0A2P8VVX1      -----D---SDLMKTVMWPQFRDS-----------LDLIANNLQ-----LL----Q-NSH
A0A2P8WHY0      -----D---SDLMQIVQWPTFREA-----------LDLVANNVQ-----LM----L-KGK
A0A2T1CMT9      -----SDT-SSIQNVIQWQPFREA-----------IDLIYENLK-----LAYLNSSLVGS
A0A563VQJ3      ---------GVLVKEEPDSYVSEL-----------YRMLQANLK-----FM----N-SQR
A0A1D8TX52      -----RA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-PGS
A0A1D9G4T2      -----KT--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6P0PR27      -----RT--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6P0WER7      -----RT--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
F4XP71          -----RT--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6L9YR57      -----RA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-PGS
A0A6P0KZ31      -----RA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6P0LPB8      -----RA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6P0SEV1      -----KA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6B3N2I8      -----KA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6M0B891      -----KA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6P0IJQ1      -----KA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6P0J8J8      -----KA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6P0ZSH6      -----KA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A1U7N5X9      -----KA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6L9Z1V0      -----KA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6P0LC12      -----KT--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A6P0MVJ3      -----RA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----LL----N-SGS
A0A2W6ZAV2      -----ITEVVEGMEPEARFGLRES-----------LRNLFSSFR-----LL----R-ADK
K9W742          -----VLA-PWTVEVLHWSPSWQS-----------LDLIYKNIQ-----LL----S-SVS
A0A3D1PBA3      -----LLA-PWTVQVSNWPPTWES-----------LDLIYKNIQ-----LM----N-ELA
K9XPB0          -------E-SSVQEIINWQPFRES-----------LDLIYENLQ-----RL----G-SGF
A0A350Y7Z1      -----VAA-ASTLPMVYWLPFRES-----------LDLIYKHIQ-----LL----N-SSA
A0A352X2A7      -----VTE-ISTSHLAYSSAFRES-----------LDLIYKNIQ-----LV----N-AGR
A0A0D8ZYV0      -----VLA-PWTVQVSNWPPSWES-----------LDLIYKNIQ-----LL----NTAVA
A0A2T1FP73      -----HLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----LM----N-EMA
A0A433VMS2      -----HLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----LM----N-EMA
K9TYA7          -----HLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----LM----N-EMA
A0A2P8QUE1      -----HLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----LM----N-EMA
K9SA61          -----ETFTTASLEVIHWPPFRES-----------MDLIYQNIQ-----LL----N-AAS
A0A2G7GMH8      -----NKQQTQVLPMLCLQSFRDA-----------LDLIYKNIR-----LL------TAF
A0A6N8FU92      -----GKAQPQGLSMLCWQSFRDA-----------LDLIYKNIR-----LL----N-SAF
A0A2T1DWE8      -----GVPAPPIMQVIHWQPFRES-----------LDLIYKNIQ-----LL----P-SAA
A0A1U7I8L3      -----ILT-SSTIELISWQPFRES-----------LDLIYQNIQ-----LV----N-STG
A0A2T1DJL8      -----NLA-PSMMQVIHWAPFRES-----------LDLIYKNIQ-----LL----T-AAN
A0A1Z4J9W0      -----FEENSSMLQVLHWAPFRES-----------LDLIYKNLQ-----LM----T-DGD
A0A0N7Z5K9      -------GDTSMLQVLHWAPFRES-----------LDLIYKNLQ-----LM----T-DGD
A0A0S3TXC5      -----NAGDTSMLQVLHWAPFRES-----------LDLIYKNLQ-----LM----T-DGS
B8HNB0          -------------------PFVEA-----------VRSLGLNLR-----YL----SP-DT
A0A563VS48      -------------------PVKEA-----------FQDIQINLQ-----LL----DP-KE
A0A318BJ18      LDRKSN--------------LVDA-----------YLAINTNLG-----FT----TE-HG
A0A3B8Y8H9      SNPNFS-------------LFLEA-----------FLGLQTNLV-----LL----NP-KQ
A0A2W1JVB9      RDTPNS-------------PPSEA-----------VRMVQSNLK-----YL----NS-DK
A0A6H1U102      YRAHGS-------------PFTEA-----------IRSLALNLR-----YL----GA-KD
A0A7C3ZEJ3      AIRYGS-------------AFTEA-----------VRSLGLNLR-----YL----GA-KD
A0A563VLD6      YNYSYS-------------SFTEA-----------FRAIAMNLG-----YM----MAQSG
A0A2P8W9H0      SDFSLPPLSYELRTDQVAMPFLEA-----------FRILATNIR-----LS----NP-EQ
A0A6I5P386      MDLPLSSGPSNL------TPFLEA-----------FKRLSTNLR-----LN----NP-DT
A0A318BG22      LANKRS-------------SLSEA-----------YYSIQTALQ-----LA----TP-GG
A0A2T1E9V8      IEDPRA-------------FISES-----------YRMLQFNLE-----VA----S--SK
A0A1Z4LN32      ATSPRT-------------VIHEA-----------YQMLQANLK-----FI----SL-DR
A0A2I8A9F5      ETTPRS-------------MIHES-----------FGMLQANLK-----FI----SL-DK
A0A218Q6R8      ETSPRS-------------VIHES-----------YQMLQANLK-----FM----SL-DK
A0A218QGE0      ATSPRT-------------VIHEA-----------YQMLQANLK-----FI----SL-DR
A0A3M2GQQ6      RSLPSYYTE----------PFTEA-----------VRSLALNLR-----YL----GA-ED
A0A6H1U2X0      RSLPSYYTE----------PFTEA-----------VRSLALNLR-----YL----GA-ED
K9TLQ0          GGYLFS-------------RFFEA-----------FRSLHADLY-----FM----SP-DR
K9QF04          GNYTLS-------------HYWEA-----------YISLQTNLD-----FL----DP-DK
K9W1T3          TNTAGS-------------PISEA-----------YRMIHTSLR-----FM----SL-DN
K9SGJ5          PSMMHS-------------AFREA-----------LRSLALNLR-----YL----GG-DL
A0A6N2JS94      PTSSYY-------------AFKEA-----------LGSLALNLR-----YL----GT-DN
A0A6C2DSN4      PTSSYY-------------AFKEA-----------LSSLALNLR-----YL----GT-DN
L8MYT6          PTSSYY-------------AFKEA-----------LSSLALNLR-----YL----GT-DN
A0A352JGJ6      PTSSYY-------------AFKEA-----------LSSLALNLR-----YL----GT-DN
A0A1J5GLS2      PSSSYY-------------AFKEA-----------LSSLALNLR-----YL----GT-DN
A0A2W4W6M5      PTSSYY-------------AFKEA-----------LSSLALNLR-----YL----GT-DN
A0A2W7AN33      PNNNYH-------------AFKEA-----------LGSLALNLR-----HL----GM-DN
A0A256BLV2      PSSSYY-------------AFKEA-----------LGSLALNLR-----YL----GT-DN
A0A2W6ZXF3      PSSSYY-------------AFKEA-----------LSSLALNLR-----YL----GT-DN
A0A2Z5WX66      PTSSYY-------------AFKEA-----------LSSLALNLR-----YL----GT-DN
K1XF69          VDTPGS-------------LISEI-----------YRMIQANLK-----FL----GS-DR
B5W297          VDTPGS-------------LISEI-----------YRMIQANLK-----FL----GS-DR
A0A6H2AL05      VDTPGS-------------LISEI-----------YRMIQANLK-----FL----GS-DR
H1W7M8          VDTPGS-------------LISEI-----------YRMIQANLK-----FL----GS-DR
A0A5Q4H6A5      VDTPGS-------------LISEI-----------YRMIQANLK-----FL----GS-DR
D5A466          VDTPGS-------------LISEI-----------YRMIQANLK-----FL----GS-DR
U5QJM6          PPYTRS-------------AYEEA-----------FRSLLTNIR-----FL----NS-DK
A0A1Z4RPC6      QREPDS-------------FASEI-----------YRMIQTNLK-----FL----AV-KR
A0A2T1CMZ0      QREPDS-------------FASEI-----------YRMIQTNLK-----FL----AV-KQ
L8M4F7          EQSPDS-------------YTSEI-----------YRMIRTNLT-----AR----SS-QV
A0A140K2P2      QKQPDS-------------FASEV-----------YRMIQANLK-----FM----SL-EN
K9XWX4          HKQPDS-------------FASEV-----------YRMIQANLK-----FM----SL-EH
A0A140KB14      QREPDS-------------FNSEL-----------YRMIQANLK-----IL----NQ-DN
K9XX88          QREPDS-------------FNSEI-----------YRMIQANLK-----IL----NQ-DN
A0A563VSV6      QQEPDS-------------YASET-----------YRMIQANLK-----FM----TT-QR
L8LZE9          QQDPDS-------------YTSEI-----------YRMIQANLK-----FM----TS-QR
A0A433NM31      KCTPRS-------------MISEI-----------YGMIYANLK-----FL----GS-DQ
A0A1Z4NDS1      RDTPQF-------------PFSDA-----------YQMLQANLK-----FL----AS-DN
U9VXM0          RNTEYS-------------SVLDA-----------YQSLQANLK-----FS----CV-ES
A0A6M0RI13      KNSEYS-------------SILDA-----------YQALQANLK-----FS----CV-DT
A0A6M0S1N5      KNSEYS-------------SILDA-----------YQALQANLK-----FS----CV-DT
K9F4D9          KNSEYS-------------SILDA-----------YQALQANLK-----FS----CV-DT
A0A6I5QPI5      NQPAHV-------------GVREA-----------YQMMQANLK-----FL----QS-DT
A0A1Z3HMQ0      FSQTQP-------------MVTAA-----------YQMLQANLK-----FI----SS-DT
A0A433W533      RDTPRA-------------PIAEA-----------FRMLQANLK-----FS----SS-DK
A0A2P8QWJ3      RDTPRA-------------PIAEA-----------FRMLQANLK-----FS----SS-DK
A0A2T1FKP8      RDTPRA-------------PIAEA-----------FRMLQANLK-----FS----SS-DK
K9U6L7          RDTPRA-------------PIAEA-----------FRMLQANLK-----FS----SS-DK
A0A1E5QP61      RDQPTT-------------YTSEA-----------YRTLQANLK-----FI----SP-DR
U5DPF5          RDYPRS-------------SMSEA-----------FRMLQANLK-----FS----TT-DR
A0A6P0X488      RDAPHA-------------VISEA-----------YRMLEANLK-----FL----SP-DK
A0A6P0UVD5      RDAPHA-------------VISEA-----------YRMLEANLK-----FL----SP-DK
A0A6P0VDM0      RDAPHA-------------VISEA-----------YRMLEANLK-----FL----SP-DK
A0A6M0G142      RDAPHA-------------VISEA-----------YRMLEANLK-----FL----SP-DK
A0A6P0MR53      RDAPHA-------------ISSEA-----------YRMLEANLK-----FL----SP-DK
A0A3M2GIL5      RDRPHW-------------VVSET-----------YRMLQANLR-----FL----SP-DK
A0A6H1TSJ9      RDRPHW-------------VVSET-----------YRMLQANLR-----FL----SP-DK
A0A3M1PML8      RDMPQS-------------PIAAS-----------YQMLQANLK-----FL----SS-DK
A0A6M8BE85      QDMPQS-------------PIAAS-----------YQMLQANLK-----FL----SS-DK
A0A0T7BPZ0      RDVPSF-------------PMDEV-----------YQMLQANLK-----FL-----S-DR
A0A352X442      RDTPGS-------------PIAQA-----------YQMLRANLK-----FL----SS-DK
A0A6B3NF44      RDLPRS-------------PFNEA-----------YQMLQANLK-----FL----SS-DK
A0A6M0EPL4      RDLPRS-------------PFNEA-----------YQMLQANLK-----FL----SS-DK
A0A6P0K6L6      RDLPRS-------------PFNEA-----------YQMLQANLK-----FL----SS-DK
A0A6P0MRR9      RDLPHS-------------PISAA-----------YQMLQANLK-----FL----SS-DE
A0A6P0UX57      RDLPHS-------------PLSAA-----------YQMLQANLK-----FL----SS-DK
A0A6P0X1X4      RDLPHS-------------PLSAA-----------YQMLQANLK-----FL----SS-DK
A0A0M0SHU3      RDVPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-DK
A0A1D2PBN3      TDIPQF-------------PVGDA-----------YQMLQANLK-----FL----SS-DK
A0A0C2LVR7      TDIPQF-------------PVGDA-----------YQMLQANLM-----FL----SS-DN
A0A1Z4PQB9      TDIPQF-------------PVGDA-----------YQMLQANLK-----FL----SS-DN
A0A1Z4SFN6      RDIPHF-------------PVGDA-----------YQILQANLK-----FL----SS-DK
K9PGI8          RDIPHY-------------PIGNA-----------YQMLQANLK-----FL----GS-DE
Q7NEU3          SSLEKS-------------MLREA-----------FRSLLTNLR-----FL----SS-DR
A0A3C0N2P0      YGYNAS-------------PLLES-----------FRSLNTNLQ-----FV----SP-DE
A0A6P0JR04      -RYRAS-------------PFVEA-----------FRSLNANLS-----FF----TP-DK
A0A6B3M6M6      HSYISS-------------PFLEA-----------FRSLQVNLH-----FL----GT-DE
A0A6P0KD09      NSYISS-------------PFLEA-----------FRSLQVNLH-----FL----GT-DE
A0A6B3NIJ0      NSYISS-------------PFLEA-----------FRSLQVNLH-----FL----GT-DE
A0A6M0F053      NSYISS-------------PFLEA-----------FRSLQVNLH-----FL----GT-DD
A0A6P2ATU9      NRYRTT-------------PFLEA-----------FRSLNANLS-----FL----TP-DK
A0A352XE00      SRYRPS-------------PFLEA-----------FRSLHTNLN-----FI----SP-DR
A0A6P0QC14      GGYSAS-------------PLLEA-----------FRSLNTNLQ-----FL----SP-DQ
B4VS56          YRYHAS-------------PFLEA-----------FRSLQTNLQ-----FI----SP-DQ
A0A352AAQ3      YRYTAS-------------PVLEA-----------FRSLHANLH-----FL----SP-DR
A0A350Y472      SRYNAS-------------PLLEA-----------FRSLHANLH-----FL----SP-DK
A0A355DVB4      SRYNAS-------------PLLEA-----------FRSLHANLH-----FL----SP-DK
A0A1Z4RMB9      REEPDS-------------FSSEI-----------YRMIQANLK-----FL----TS-DK
A0A318B4H2      KKT----------------QLYES-----------YLAVRTNLS-----FL----TD-HG
B4WQE3          LDRTTG-------------PFLEA-----------FKLLATNVC-----QG----GS-QD
A0A2K3BR24      RDLPQS-------------SASEA-----------FRMLQANLK-----FS----SV-DQ
K9YXY1          RDLPQS-------------SASEA-----------FRMLQANLK-----FS----SV-DQ
A0A0V7ZFJ4      LDNPYS-------------SVTSA-----------FEILQTNLA-----FT----VS-DK
A0A0V7ZNJ9      LNNPYS-------------VESSA-----------FEMLQTNLS-----FT----SS-DK
A0A367RIS1      LNNPYS-------------SVNAA-----------FEMLQINLG-----FT----FS-DK
A0A235IXQ2      LNNPYS-------------SVNAA-----------FEMLQINLG-----FS----FS-DK
A0A1W5CNX3      LNNPYS-------------SVNAA-----------FEMLQINLG-----FS----FS-DK
A0A5Q0GJJ5      LNNPYS-------------SVNAA-----------FEMLQINLG-----FS----FS-DK
Q3MEB7          LNNPYS-------------SVNAA-----------FEMLQINLG-----FS----FS-DK
A0A1Z4KHN9      LNNPYS-------------SVNAA-----------FEMLQINLG-----FT----FS-DK
Q8YT70          LNNPYS-------------SVNAA-----------FEMLQINLG-----FT----FS-DK
A0A166IWU6      LNNPYS-------------SVNTA-----------FEMLQINLG-----FT----IS-DK
A0A2S0Q8C0      LNNPYS-------------SVNTA-----------FEMLQINLG-----FT----IS-DK
W6FSX4          LNNPYS-------------SVNTA-----------FEMLQINLG-----FT----IS-DK
A0A218Q4C1      LDNPYS-------------SVNTA-----------FEMLQINLG-----FT----IS-DK
A0A6P1ZT04      LDNPYS-------------SVNTA-----------FEMLQINLG-----FT----IS-DK
A0A0R0M9H9      LDNPYS-------------PVSTS-----------IEMLQTNLG-----FA-----T-DK
A0A1S1ZVW2      LDNPYS-------------PVSTS-----------IEMLQTNLG-----FA-----T-DK
A0A1B7WX82      LDNIYS-------------PVSTS-----------FEMLQTNLG-----FT----LS-DK
A0A1B7WTD1      LDQPYS-------------PVSTS-----------LEMLHTNLG-----FT----IS-DK
A0A480ABC0      LDQPYS-------------PVSTS-----------LEMLNTNLG-----FT----IS-DK
A0A1Z4LRU5      LNNPYS-------------PASTA-----------FEILQTNLG-----FT----MS-DK
A0A1Z4JVB4      LHNPYS-------------PAAVA-----------FEMFQTNLG-----FS----IC-EQ
K9PIA4          LNNPYS-------------PESAA-----------FEMLQTNLG-----FS----IS-DK
A0A1Z4HVE1      LNNPYS-------------AESAA-----------FEMLQANLG-----FS----IS-DK
A0A252ECZ1      LNNPYS-------------PESSA-----------FEMLQANLS-----FS----IS-DK
A0A1Z4G5Y1      LHNPYS-------------PESAA-----------FEMLQTNLG-----FS----IS-DK
A0A252DNA2      LHNPYS-------------PESAA-----------FEMLQANLG-----FS----IS-DK
A0A252E1Q4      LHNPYS-------------PESAA-----------FEMLQANLG-----FS----IS-DK
A0A6G9SK36      LNNPYS-------------PVSSA-----------FEMLQTNLS-----FS----IS-DK
A0A1Z4M597      LNNPYS-------------PVSSA-----------FEMLQTNLS-----FS----IS-DK
A0A1Z4MWT1      LNNPYS-------------PVSSA-----------FEMLQTNLS-----FS----IS-DK
A0A1Z4TX53      LNNPYS-------------PVSSA-----------FEMLQTNLS-----FS----IS-DK
A0A5P8VSD1      LNNPYS-------------SVNAA-----------FEMLQINLG-----FT----FY-DK
A0A2A2TNQ5      RDNPYS-------------SGSMA-----------FEMLMTNLA-----FS----VS-DQ
A0A3S1C4K5      LKDPYS-------------PATSA-----------FEMLVTNLS-----FT----LS-DQ
A0A1X4G3D5      FDQPYS-------------PISRS-----------FQILQTNLG-----FA-----R-DR
D4TNI2          FDQPYS-------------PISRS-----------FQILQTNLG-----FA-----R-DR
A0A1Z4H6Z8      LNNPYS-------------PESTA-----------FEMLQVNLG-----FS----IS-DK
A0A1Z4NPM1      LNNPYS-------------PASVA-----------FEMLQTNLS-----FT----VS-DN
A0A3F3KPR9      LDNPYS-------------PVSTS-----------IEMLQTNLG-----FA-----T-DK
D4TGN7          LDNPYS-------------PVSTS-----------IEMLQTNLG-----FA-----T-DK
A0A1Z4UZW9      LNNPYS-------------PVSTS-----------FEMLQTNLG-----FT----LS-DK
A0A0K2M5H0      LDDPYS-------------PVSTS-----------FEMLQTNLG-----FT----CS-DK
A0A1B7VSH4      LDDPYS-------------PVSTS-----------FEMLQTNLG-----FT----VS-DK
A0A1B7W126      LDDPYS-------------PVSTS-----------FEMLQTNLG-----FT----VS-DK
A0A3D4C6Q6      LDDPYS-------------PVSTS-----------FEMLQTNLG-----FT----VS-DK
A0A1B7UVJ4      LDNIYS-------------PVSTS-----------FEMLQTNLG-----FT----LS-DK
A0A1B7UTR1      LDNIYS-------------PVSTS-----------FEMLQTNLG-----FT----LS-DK
K7W0A4          LDNPYS-------------PVSTS-----------FEMLQTNLG-----FT----LS-DK
A0A5C0DRW9      LDNPYS-------------PVTTS-----------FEMLQTNLG-----FT----LS-DK
A0A6H2C088      LDNPYS-------------PVTTS-----------FEMLQTNLG-----FT----LS-DK
A0A1Q4RTR1      RDNPWS-------------PASAA-----------FEKLQSTLE-----YT----LP-DQ
A0A1Z4SQV2      RDNPWS-------------PASAA-----------FEKLQSTLE-----YT----LP-DQ
A0A2H2XGN1      RDNPWS-------------PASAA-----------FEKLQSTLE-----YT----LP-DQ
A0A433UXH8      RDNPWS-------------PASAA-----------FEKLQSTLE-----YT----LP-DQ
A0A1U7HGH0      LAEPRS-------------FITES-----------YRMLLANLK-----FP----PSLDR
K9XJD3          LAEPRS-------------FVTES-----------YRMLLANLK-----FP----PSLER
K9SX01          RDNPRA-------------PASEA-----------YRMLQTSLR-----FL----NS-DR
A0A4P7ZT55      -DQQRF-------------GLRES-----------LRNLYRSLQ-----LV----RA-GG
A0A1E5QIR9      KDAPRS-------------LISES-----------YRMLYANLK-----FL----GS-DR
A0A1Z4IBC7      RDIPYF-------------PLGDA-----------YQILQVNLK-----FL----CS-DK
A0A1W5CPC7      RDIPYF-------------PLGDA-----------YQILQVNLK-----FL----CS-DK
A0A5Q0GKD1      RDIPYF-------------PLGDA-----------YQILQVNLK-----FL----CS-DK
Q3MDC6          RDIPYF-------------PLGDA-----------YQILQVNLK-----FL----CS-DK
A0A1Z4KM73      RDIPYF-------------PLGDA-----------YQILQVNLK-----FL----CS-DK
Q8YNX7          RDIPYF-------------PLGDA-----------YQILQVNLK-----FL----CS-DK
A0A367R4K6      RDIPYF-------------PLGDA-----------YQILQVNLK-----FL----CS-DK
A0A1E2WSV8      RDIPYF-------------PVGNA-----------YQILQVNLK-----FL----CS-DK
A0A2R5FRT9      RDIPYF-------------PLGNA-----------YQVLQVNLK-----FL----CS-DK
A0A2K8T1B6      RDIPYF-------------PLGNA-----------YQILQVNLK-----FL----CS-DK
A0A235I9I0      RDIPYF-------------PVGNA-----------YQILQVNLK-----FL----CS-DK
A0A2D0HQT8      RDIPYF-------------PVGNA-----------YQILQVNLK-----FL----CS-DK
A0A2L2NU95      RDIPYF-------------PVGNA-----------YQILQVNLK-----FL----CS-DK
A0A367S084      RDIPYF-------------PVGNA-----------YQILQVNLK-----FL----CS-DK
A0A6P1A9A0      AHYHSS-------------PFLDA-----------FRSLHANLY-----FI----SP-DR
A0A1Z4SMD6      GTYPHT-------------IVHDA-----------YQMLQANLK-----FI----S--DK
A0A2H2Y096      GTYPHT-------------IVHDA-----------YQMLQANLK-----FI----S--DK
K9S8M8          QEAPHS-------------IISEN-----------YRMLQANLR-----FL----SP-DR
A0A1Z4NFV0      ATTPRS-------------VIHEA-----------YQMLQANLK-----FI----S--HK
A0A3M9ZEU1      RDLPRS-------------PISEA-----------YHMLQANLK-----FL----SS-DQ
A0A1Z4JK72      MTSPRS-------------MIHEA-----------YQMLQANLK-----FM----SL-DK
A0A0N7Z489      MSTPRS-------------MIHEA-----------YQMLQANLK-----FM----SL-DK
A0A0S3TXS2      MTSPRS-------------MIHEA-----------YQMLQANLK-----FM----SL-DK
A0A2A2TPF8      ATLPRS-------------VIHEA-----------YQMLQANLN-----FI----S--HK
A0A1Z4R0P8      GTLPRS-------------VIHEA-----------YQMLEANLN-----FI----S--HK
A0A0T7BUI3      NSSPRT-------------IIHEA-----------YQMLQANLN-----FI----S--HK
A0A1Z4LP32      ASSPRT-------------MIHEA-----------YQMLQANLK-----FI----S--HK
K9REP9          ASSPRT-------------MIHEA-----------YQMLQANLK-----FI----S--HK
A0A1Z4SIJ3      ASAPHT-------------VIHDA-----------YQMLQANLK-----FI----S--HK
A0A2H2XPG4      ASAPHT-------------VIHDA-----------YQMLQANLK-----FI----S--HK
K9V3C7          ATSPRT-------------VIHEA-----------YQMLRANLK-----FI----S--HK
A0A1Z4T6Y7      GTLPRS-------------VIHEA-----------YQMLQANLK-----FI----S--HK
A0A2H2Y561      GTLPRS-------------VIHEA-----------YQMLQANLK-----FI----S--HK
A0A1Q4S362      GTLPRS-------------VIHEA-----------YQMLQANLK-----FI----S--HK
A0A3S1CIN8      GTLPRS-------------VIHEA-----------YQMLQANLK-----FI----S--HK
A0A2A2TC28      ASSPRT-------------VIHEA-----------YQMLQANLK-----FI----S--HK
A0A0C1NCB0      ATSPRT-------------VVHEA-----------YQMLQANLK-----FI----S--HK
A0A2N6K7Q9      TTSPRT-------------VVHEA-----------YQMLQANLK-----FI----S--HR
A0A2N6MXH6      TTSPRT-------------VVHEA-----------YQMLQANLK-----FI----S--HR
A0A2N6M5A8      TTSPRT-------------VVHEA-----------YQMLQANLK-----FI----S--HR
A0A2N6LL61      TTSPRT-------------VVHEA-----------YQMLQANLK-----FI----S--HR
A0A0S3TP66      TTSPRT-------------VVHEA-----------YQMLQANLK-----FI----S--HR
G6FP91          TTSPRT-------------VVHEA-----------YQMLQANLK-----FI----S--HR
A0A1U7GYR5      TTSPRT-------------VVHEA-----------YQMLQANLK-----FI----S--HR
A0A2N6KY52      TTSPRT-------------VVHEA-----------YQMLQANLK-----FI----S--HR
A0A2N6KMP5      TTSPRT-------------VVHEA-----------YQMLQANLK-----FI----S--HR
A0A2N6MA45      TTSPRT-------------VVHEA-----------YQMLQANLK-----FI----S--HR
A0A4Q9J9V9      TTSPRT-------------LVHEA-----------YQMLQANLK-----FI----S--HR
A0A328IGA1      TTSPRT-------------LVHEA-----------YQMLQANLK-----FI----S--HR
A0A4D9CE41      TTSPRT-------------LVHEA-----------YQMLQANLK-----FI----S--HR
A0A0M0SFT2      TTSPRT-------------LVHEA-----------YQMLQANLK-----FI----S--HR
A0A1Z4TLC8      TTSPRT-------------LVHEA-----------YQMLQANLK-----FI----S--HR
A0A0C2LFH0      ATSPRS-------------VVHEA-----------YQMLQANLK-----FI----S--HR
A0A1Z4IYV4      ATSPRS-------------VIHEA-----------YQMLQANLK-----FI----S--HK
A0A1Z4Q0T6      ATSPRS-------------VIHEA-----------YQMLQANLK-----FI----S--HK
A0A0C2PT44      ATSPRS-------------VIHEA-----------YQMLQANLK-----FI----S--HK
A0A1D2P6J4      ATSPRS-------------VVHEA-----------YQMLQANLK-----FI----S--HK
B4WP72          RSRNVH-----A------SVVTEA-----------YQMLWSNLK-----SV----TS-RQ
A0A2T1CIL7      AAVRYN----------------EA-----------YNMLQANLK-----FL----TT-NW
A0A433V7A0      RDNSRS-------------FIYEL-----------YCMIQANLK-----FL----CS-DK
A0A2T1FTR8      TGMTTG-------------IEGES-----------FRMLQTNLQ-----FL----NA-DD
K9UA41          TGMTTG-------------IEGES-----------FRMLQTNLQ-----FL----NA-DD
A0A0C2LBE2      RDIPHF-------------PVGDA-----------YQMLQANLK-----FL----SS-DR
A0A433NN38      RDIHLF-------------AIRDA-----------YQMLQANLR-----FL-----S-DK
A0A2N6K0T2      RDIPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-DK
A0A2N6ML72      RDIPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-YK
G6FQZ6          RDIPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-YK
A0A2N6MQX9      RDIPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-YK
A0A2N6KXT6      RDIPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-YK
A0A2N6KGB9      RDIPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-YK
A0A2N6L3Y5      RDIPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-YK
A0A0S3TIS7      RDIPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-YK
A0A1U7GW28      RDIPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-YK
A0A2N6LW63      RDIPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-YK
A0A328IH74      RDVPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-DK
A0A4D9CIB0      RDVPYF-------------PVGDA-----------YQMLQANLK-----FL-----S-DK
A0A1Z4TQ63      RDIPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-DK
A0A4Q9J8G2      RDVPHF-------------PVGDA-----------YQMLQANLK-----FL-----S-DK
A0A350Y0P6      RDVPHG-------------ITSEA-----------YRMLEANLK-----FL----SP-DH
A0A352X940      RDAPHA-------------IVSEA-----------YRMLEANLK-----FL----SP-DK
B8HTN4          RDQPNS-------------HLSEA-----------YRTLQANLK-----FL----SSPDH
A0A6P1AFJ5      GRYQVS-------------AFSEA-----------FRSLNTNIQ-----FL----SS-DA
B0CAX4          RDSPRS-------------SVSES-----------YRMLQANLK-----FL----SS-DH
A0A1Z4RN12      TDASML-------------PLKEA-----------YQNIQVNLK-----LL----GA-NV
A0A2T1CMF9      SEVSMM-------------PLKEA-----------YQNIQVNLN-----LL----DA-DA
Q7NDC5          RD-PLS-------------PVSEA-----------YRSIRTHLK-----FL----SS-ER
U5QGK3          SD-PLS-------------PMSEA-----------YRSVRTYLK-----FL----SA-ES
A0A2W4UY24      KQRHRV-------------PLVES-----------YQSLQANLK-----FS----YF-DG
A0A0D8ZUV2      RDMPRS-------------PLSEA-----------YRMLQANLK-----FL----SS-DK
A0A433VDI0      RDIPNS-------------PISEA-----------YRMLQANLK-----FL----GS-DK
A0A3D1PG43      LENSLS-------------PIAEN-----------YRMLQANLK-----FL----SS-ER
A0A2P8QQ72      RNSPRS-------------LTAEA-----------YRMLQANLR-----FL----NL-DR
K9TZQ7          RNSPRS-------------LTAEA-----------YRMLQANLR-----FL----NL-DR
A0A6N8G584      INLPRS-------------PISEA-----------YRMLQANLK-----FL----SS-DK
A0A2G7GPR0      INLPRS-------------PISEA-----------YRMLQANLK-----FL----SS-DK
K9XH68          INLPRS-------------PISEA-----------YRMLQANLK-----FL----SS-DK
A0A1U7HW70      INLPRS-------------PISEA-----------YRMLQANLK-----FL----SS-DK
A0A2S6VEJ8      INLPRS-------------PISEA-----------YRMLQANLK-----FL----SS-DK
A0A140KBA0      GQNDSSHHRHAL------LPIREA-----------YQILQANLK-----LL----SL-SQ
K9XSG1          SQNAHSNNRHVF------LPIREA-----------YQILQANLK-----LL----SL-SQ
A0A2T1GMT4      RDTPQS-------------ITSEM-----------SRTIQSNLR-----FL----GA-DK
K9UI51          RDTPQS-------------ITSEM-----------SRTIQSNLR-----FL----SA-DK
K9QM62          RDRPYS-------------LTSEM-----------YRMLQANLK-----FL----SS-DK
A0A1Z4FWI3      IDTPQS-------------LTSEI-----------YRMIQANLR-----FL----SS-DK
A0A1Z4JYE7      RDTPDS-------------LTSEI-----------YRMIQANLK-----FL----SS-DK
A0A2T1FXY4      RDKPHS-------------LTSEI-----------YRMIQANLK-----FL----SP-DR
K9TYI2          RDKPHS-------------LTSEI-----------YRMIQANLK-----FL----SP-DR
A0A1Z4QL41      RDQPYS-------------LASEM-----------YRMIQANLR-----LV----SS-DQ
A0A252D4T4      IDTPHS-------------LTSEI-----------YRMIQANLR-----FL----SS-DK
A0A252DJH5      IDTPHS-------------LTSEI-----------YRMIQANLR-----FL----SS-DK
A0A252EB80      IDTPHS-------------LTSEI-----------YRMIQANLR-----FL----SS-DK
A0A6G9SKZ9      IDSPNS-------------LTSEI-----------YRMIQANLR-----FL----SS-DK
A0A1Z4HPW5      IDSPSS-------------LTSEI-----------YRMIQANLR-----FL----SS-DK
A0A1Z4MSN1      IDSPTS-------------LTSEI-----------YRMIQANLR-----FL----SS-DK
A0A1Z4U1C2      IDSPTS-------------LTSEI-----------YRMIQANLR-----FL----SS-DK
A0A0D6KV51      IDSPSS-------------LTSEI-----------YRMIQANLR-----FL----SS-DK
A0A1Z4MKF8      IDSPSS-------------LTSEI-----------YRMIQANLR-----FL----SS-DK
A0A2C6WC43      RDMPYS-------------LTSEM-----------YRMIQANLK-----FL----SS-DK
A0A1Z4L5A1      RDMPHS-------------LTSEM-----------YRMIQANLK-----FL----SS-DK
A0A367QD86      RDMPHS-------------LTSEM-----------YRMIQANLK-----FL----SS-DK
A0A235IZ96      RDTPYS-------------LTSEM-----------YRMIQANLK-----FL----SS-DK
A0A2L2NGP0      RDTPYS-------------LTSEM-----------YRMIQANLK-----FL----SS-DK
A0A2K8SM78      RDTPYS-------------LTSEM-----------YRMIQANLK-----FL----SS-DK
A0A2R5FPC0      RDTPYS-------------LTSEM-----------YRMIQANLK-----FL----SS-DK
A0A5P8W5T6      RDTPYS-------------LTSEM-----------YRMIQANLK-----FL----SS-DK
A0A0F5YE28      VEASDS-------------FISEI-----------YRMLQANLK-----FL----SS-DK
U7QEH7          IEASDS-------------FISEI-----------YRMLQANLK-----FL----SS-DK
A0A3S1ATK5      KDAPQS-------------LTSEM-----------YRVIQANLR-----LL----SS-DK
A0A2Z6CPH0      RDMPHS-------------LTSEI-----------YRMIQANLK-----FL----SS-DK
A0A1Z4GT50      RDTPNS-------------LTSEI-----------YRMIQANLR-----FL----SS-DK
A0A1Z4GIX0      RDMPHS-------------LTSEM-----------YRMIQANLK-----FL----SS-DK
A0A2H6LC24      RDMPHS-------------LTSEM-----------YRMIQANLK-----FL----SS-DK
B2J6N5          RDTPYT-------------LTSEM-----------YRMIQANLK-----FL----SS-DK
A0A367RMI4      RDTPHS-------------LTSEM-----------YRMIQANLK-----FL----SS-DN
A0A235HUM0      RDTPHS-------------LTSEM-----------YRMIQANLK-----FL----SS-DN
A0A2L2NW47      RDTPHS-------------LTSEM-----------YRMIQANLK-----FL----SS-DH
A0A1E2WUR1      RDTPHS-------------LTSEM-----------YRMIQANLK-----FL----SS-DK
A0A235IKU3      RDTPYS-------------LTSEM-----------YRMIQANLK-----FL----SS-EK
A0A1U7MYU6      TDQPHS-------------MVSEV-----------YRMIQANLK-----FL----RS-DH
A0A1D8TNX9      RDQPHS-------------MVSEV-----------YRMIQANLK-----FL----KS-DH
A0A6P0L6C2      RDQPHS-------------MVSEV-----------YRMIQANIK-----FL----KS-DH
A0A6P0MVH0      RDQPHS-------------MVSEV-----------YRMIQANLK-----FL----KS-DH
A0A6P0KJV0      TEQPHS-------------MVSEV-----------YRMIQANLK-----FL----RS-DH
A0A6L9ZJG4      TEQPHS-------------MVSEV-----------YRMIQANLK-----FL----RS-DH
F4XKF3          TEQPHS-------------MVSEV-----------YRMIQANLK-----FL----RS-DH
A0A1D9FX10      TEQPHS-------------MVSEV-----------YRMIQANLK-----FL----RS-DH
A0A6P0Q0T0      TEQPHS-------------MVSEV-----------YRMIQANLK-----FL----RS-DH
A0A6P0W5I0      TEQPHS-------------MVSEV-----------YRMIQANLK-----FL----RS-DH
A0A3C0NJ41      RDTPRS-------------PISEA-----------YRMLQANLK-----FL----SS-DK
A0A352AG88      RDTPRL-------------PISEA-----------YRMLQANLK-----FL----SS-DK
A0A350Y374      RDNPLA-------------AISEV-----------YRMLQANLK-----FL----SS-DK
A0A355DPX0      RDNPLA-------------AISEV-----------YRMLQANLK-----FL----SS-DK
                                                                            

K9SLA9          APKVIAITSSIAKEGKSTFTANLAI-AAAQMGAKVLLIDADLRKPTQH-QLWQ--VP--N
A0A168TT23      MPKTILMTSPGPGDGKTTNAINLAT-VLAQNGARVLLIDADLRKPRLH-RDFS--IQ--Q
A0A0M1JWX9      PIRAIAVASAVAAEGKSTAAVNLAQ-AAATMGQRVLLVDGDLRRPQVH-AKLG--IL--N
A0A2T1M1V6      ENRRLMITSATRSEGKTTLTLGLAW-ALVQLGFRVLLVDADLRQAEMS-----------R
A0A2G7GCS2      EHQRLLVTSPTSGEGKTTVTLGLAL-ALVNFGFRVLIVDGDLRQAELS-----------R
K9XBH8          EHQRILITSPTAGEGKTTMTLGLAL-ALVNCGFRVLMVDGDLRQAELS-----------R
A0A1Z4LJ30      GSGRLMIASATTSEGKTTATLGLAN-ALINLGFKVLVVDGDFRKSELS-----------Q
K9RI76          NSGRLMIASANTEEGKTTTTIGLAN-ALLVLGFKVLLVDGDFRRGELS-----------E
A0A352AE27      KNRRLLVTSATMGEGKTTVTLGLAT-ALVDLGFRVLLVDGDFRKAQLS-----------H
A0A3B8JH60      QDHRLLVTSAIMGEGKTTVTLGLAT-ALADLGFRVLLVDGDFRKAELS-----------R
A0A3C0N766      QDHRLLVTSAIMGEGKTTVTLGLAT-ALADLGFRVLLVDGDFRKAELS-----------R
K9W9J7          KDHRLLITSAIMGEGKTTVTLGLAR-ALADLGFRVLLVDGDFRKAELS-----------R
A0A139WSU3      NNRRLLVTSATQGEGKTTVAIGLAY-GLVDLGFRVLLVDGDFRSAELS-----------R
A0A433VN22      ENRRLLVTSAIMGEGKTTVAIGLAN-ALVDLGFKVLLVDADFRQAALS-----------R
Q7NF11          PNRRLMITSSTAGEGKTTLTLGLAN-ALAEMGFRVLLVDADFRQASLS-----------R
A0A1Z4JCS8      KGIRLLIASAITGEGKTTVALQLAH-ALTELGFRVLLVDGDFRKAQLS-----------H
A0A6P0PI80      EDRRILITSAMVSEGKTTVTLGLAT-ALVDLGFRVLVVDGDFRQATLS-----------Q
A0A6P0WGT6      EDRRILITSAMVSEGKTTVTLGLAT-ALVDLGFRVLVVDGDFRQATLS-----------Q
F4XTX2          EDRRILITSAMVSEGKTTVTLGLAT-ALVDLGFRVLVVDGDFRQATLS-----------Q
Q7NJN6          PARRLMITSANTGEGKTTVTLGLAK-ALRELGFRVLVVDADFRQAGLG-----------R
U5QCC3          EGQRLMITSSTFGEGKTTVTLGLAR-ALRSLGFRVLVVDADFRQAGLG-----------R
A0A3M1SVZ4      SVKTIVVTSAIAKEGKSTIAANLAA-AISQVGRRVLLVDADLRRPLQH-EIWN--LG--N
A0A654SFI6      APKLLMLTSSVLAEGKSVSSLALAA-SFARLGKRTLLIDGDLRNSRLM-ALLGGEGA--D
K9SSQ0          TFKTIAFTSSIPSEGKSTIIYNLSL-TLAELGYKVLLVDADMRKPTIH-SLAG--VS--N
A0A2W1JIN9      EFHTLVVSSAISGEGKSVVTSYLAA-VAAMLSRRTLIIDADLRRPTIH-KQFQ--LP--N
A0A318AJV1      GMRVIGFTSALPGEGKSNTALAFAR-MLAVNGARVLLVDADLRNSKFP-GSMA--IG--P
A0A6P0IC70      KLKLIVVSSTVSGEGKSIVASHLAA-VSAMLSRQTLIIDADLRKPKQH-RILG--VT--P
A0A6B3MUB5      KLKLIVVSSTVSGEGKSIVASHLAA-VSAMLSRQTLIIDADLRKPKQH-RILG--VT--P
A0A6M0B7N4      KLKLIVVSSTVSGEGKSIVASHLAA-VSAMLSRQTLIIDADLRKPKQH-RILG--VT--P
A0A6P0J9W3      KLKLIVVSSTVSGEGKSIVASHLAA-VSAMLSRQTLIIDADLRKPKQH-RILG--VT--P
A0A6P0ZWE1      KLKLIVVSSTVSGEGKSIVASHLAA-VSAMLSRQTLIIDADLRKPKQH-RILG--VT--P
A0A1U7N2U4      RLQLIVVSSAVSGEGKSVVVSHLAA-VSARFSRRTLIIDADWRHPMQH-NLFG--LP--P
A0A1D9G1F2      RLQLIVVSSAVSGEGKSVVASHLGA-VSVRFSRRTLIIDADWRHPMQQ-DLFG--LS--P
A0A6P0PNZ7      RLQLIVVSSAVSGEGKSVVASHLGA-VSVRFSRRTLIIDADWRHPMQH-NLFG--LP--P
F4XV38          RLQLIVVSSAVSGEGKSVVASHLGA-VSVRFSRRTLIIDADWRHPMQH-NLFG--LP--P
A0A6P0W137      TLQLIVVSSAVSGEGKSVVASHLGA-VSVRFSRRTLIIDADWRHPMQH-NLFG--LP--P
A0A6L9Y9E2      KLQLIVVSSAVSGEGKSVVASHLAA-VSVRFSWRTLIIDADWRHPMQH-NLFG--LP--P
A0A6P0SGR0      KLQLIVVSSAVSGEGKSVVASHLAA-VSVRFSRRTLIIDADWRHPMQQ-NLFG--LP--P
A0A6M0BK48      RLQLIVVSSAVSGEGKSVVASHLAA-VSARFSRRTLIIDGDWRHPMQH-YFFG--LP--P
A0A6L9YZL1      RLQLIVVSSAVSGEGKSVVASHLAA-VSARFSRRTLIIDADWRHPMQH-NLFG--LP--P
A0A6P0KYM4      RLQLIVVSSAVSGEGKSVVASHLAA-VSVTFSRRTLIIDADWRHPMQQ-DLFG--LP--P
A0A6P0LSD6      RLQLIVVSSAVSGEGKSVVASHLAA-VSVTFSRRTLIIDADWRHPMQQ-DLFG--LP--P
A0A6P0X384      KLQLIVVSSTVSGEGKSVVVSHLAA-VSAMLSQRTLIIDADLRQPRQH-NFLA--VV--P
A0A2P8QIL5      DIKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQH-KLFK--LA--A
A0A2T1FLY5      DIKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQH-KLFK--LA--A
A0A433W447      DIKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQH-KLFK--LA--A
K9U1K8          DIKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQH-KLFK--LA--A
K9UYB2          NLHLFVVSSTISGEGKSIVTSHLGA-ISAMLSRRTLIIDADLRKPVQH-KLFN--LN--P
A0A218QN17      KVQVIVVSSTLSGEGKSIVASHLAA-ISAMLSRRTLIIDADLRRPMQH-TLFN--LA--P
K9RKN2          ELQKIVVSSTISGEGKSVVVSHLAA-VSAMLSRKTLVIDADLRRPVQH-TLFN--LP--P
A0A2I8ADV2      KLQVVVVTSTISGEGKSVVVSHLAA-VAAMLFRRTLIIDADLRRPVQH-TLFN--LP--P
A0A1W5CKM3      NLQVIVVSSPLAGEGKSVIVSHLAA-VSAMLSRRTLIIDADLRKPSQH-TLFN--LP--P
A0A5Q0GMF5      NLQVIVVSSPLAGEGKSVIVSHLAA-VSAMLSRRTLIIDADLRKPSQH-TLFN--LP--P
Q3MEW0          NLQVIVVSSPLAGEGKSVIVSHLAA-VSAMLSRRTLIIDADLRKPSQH-TLFN--LP--P
A0A1Z4KIC7      NLQVIVVSSPLSGEGKSVIVSHLAA-VAAMLSRRTLIIDADLRKPSQH-TLFN--LP--P
Q8YSM5          NLQVIVVSSPLSGEGKSVIVSHLAA-VAAMLSRRTLIIDADLRKPSQH-TLFN--LP--P
A0A1Q4S1H4      KLHLVVVSSALSSEGKSVVVSHLAA-VAAMLSRRTLLIDADLRRPKLH-RAFN--LQ--A
A0A433VBU6      KLHSIVVSSALSGEGKSVVVSHLAA-VSAMLSRRTLLIDADLRRPKLH-RVFN--LQ--N
A0A1Q4RZJ6      -LQLLVVSSTISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQH-TIFN--LP--G
A0A1Z4SNV3      -LQLLVVSSTISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQH-TIFN--LP--A
A0A2H2XJQ1      -LQLLVVSSTISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQH-TIFN--LP--A
A0A3S5K358      -LQLLVVSSTISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQH-TIFN--LP--G
A0A0T7BPJ4      DLNSIVISSTISGEGKSVVASHLGA-VSAMLSRKTLIIDADLRRPEQH-RIFH--LE--H
A0A0C1QS61      RMRVIVVSSSIAGEGKSIVASHLAA-IAGMLSWRTLIIDADLRRPEQH-TLFN--LA--G
A0A139X3R8      QMRLIVVSSSIAGEGKSIVASHLAA-VAAMLSWRTLVIDADLRRPEQH-TLFN--LS--G
A0A1Z4I7C5      NLQVIVVSSPLSGEGKSVIVSHLAA-VCAMLSRRTLIIDADLRKPSQH-TLFN--LP--P
A0A0C2MDK7      QLRAIVVSSTISGEGKSVVASHLAA-VVGMLSWRTLIIDADLRRPSQH-TLFN--LA--P
A0A1Y0RCK1      QLRLIVVSSTISGEGKSVVASHLAA-VAAMLSWRTLVIDADLRKPVQH-TLFH--LA--P
A0A1Z4PWZ0      QLRLIVVSSPISGEGKSVVASHLAA-VAAMLSWRTLIIDADLRRPVQH-TLFN--LT--P
A0A0C2QLT0      QVRLIVVSSPISGEGKSVVASHLAA-VAAMLSWRTLIIDADLRRPVQH-TLFN--LT--G
A0A1Z4J2K1      QVRLIVVSSPISGEGKSVVASHLAA-VAAMLSWRTLIIDADLRRPVQH-TLFN--LT--P
A0A3S0ZSX0      PLRQIVVSSTISGEGKSVVASHLAA-VCAMLSRRTLLIDADLRRPAQH-TLFN--LA--P
A0A2N6K4T3      SLRSIVVSSTITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPILH-TLFN--LA--P
A0A370CKT2      PLRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LA--P
A0A0S3TL97      PLRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LA--P
A0A2N6M8A0      PLRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LA--P
A0A2N6M9E1      PLRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LA--P
A0A2N6KJI4      PLRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LA--P
A0A2N6MZ77      PLRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LA--P
A0A2N6KT20      PLRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LA--P
G6FSN3          PLRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILH-TLFN--LA--P
A0A4D9CI02      SLRSIVVSSTITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPMLH-TLFN--LA--P
A0A328I8B9      SLGSIVVSSTITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPMLH-TLFN--LA--P
A0A4Q9J4Z7      SLRSIVVSSTITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPMLH-TLFN--LA--P
A0A0M0SU69      PLRSIVVSSTVTGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPVLH-TLFN--LV--P
A0A1Z4TIZ8      PLRSIVVSSSITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPVLH-TLFN--LA--P
A0A0S3TYD7      EARAIVVSSCIPSEGKSTVSANLAS-AFAQIGKRVLLIDADLRRPRQH-HVWS--LG-TN
A0A2T1DNG3      ELHSIVVTSTLAGEGKSTLSVGLAI-SAARLHQRVLLIDADLRRPNLH-KLLN--LP--N
A0A3S0Y9N9      HIKVIVVSSAVPQEGKSTIAANLAF-SISQIGRKVLLVDADFRRPSQD-KIWN--IM--N
A0A433UNK7      SIKVIVVSSSVPKEGKSTIAANLAF-SISQLGRNILLVDADLRNPSQH-KIWE--IP--N
A0A6P0ZKB8      TVKVIVVSSAVPKEGKSTVAANLAY-SISQLGRNVLLVDADLRHPSQH-KIWE--IP--N
U5QL42          SVKTLLFTSSIPAEGKSIISYNLGL-VLSEFGKRVLVVDADMRKPNLH-RFLE--LP--N
A0A076HBF2      PLRSIALTSSLPAEGKSLVNVLLAK-TLSEMGQRILLIDADLRKPQMH-VRLG--LN--N
A0A354B169      PLRLIAISSSLPREGKSLIIVLLAK-TLAEMGKKILVIDADMRRPQLH-QRLG--LN--N
G4FMX5          PLRSIALTSSLPAEGKSLVNTLLAK-TLAEMGQRVLLIDADLRKPQLH-TRLG--LN--N
Q0IDT5          PLKAVALTSSLPAEGKSLVNVLLAK-TLAEMGQRVLLVDADLRKPQLH-IRLG--IN--N
A0A2D6FCW3      PLRSIAITSSLPAEGKSLVNVLLAK-TLSEMGQKVLLIDADLRKPQLH-TRLG--LN--N
A3ZA21          PLRAIALTSSLPAEGKSLVNVLLAK-TLSEMGQRVLLIDADLRKPQMH-TRLG--LN--N
A0A140K3H3      KINSLALTSATSAEGKTTVTYNLGI-VLAELGLNVLIIDADMRKPKIH-KLAK--LP--N
K9XUB8          KINSLALTSSTSAEGKTTVTYNLGL-VLAELGLRVLIVDADMRKPKIH-KLAK--LA--N
A0A6H2NHD5      PIQLVVFTSSVPGEGKSTICAHLAI-ASANMGRRVLLIDGDMRKPSQH-LMFE--VP--N
A0A2P8W4F7      PVQVVALTSSVPGEGKSTICAHLAI-AAANMGRRVLLIDGDLRKPSQH-LIFG--QP--N
A0A5Q4E0Z4      PVQVVALTSSVPGEGKSTMCAHLAI-AAANMGRRVLLIDGDLRKPSQH-LIFG--RR--N
A0A2P8VVX1      PSKAIAITSALPGEGKTTLTLGLAF-SLARMGQRVLVIDADLRRSGIQ-AGLG--LV--A
A0A2P8WHY0      GNQAIAVTSSLPSEGKTTVALGLAF-SLARMRQRVLVIDADLRRSGIA-TELG--LS--T
A0A2T1CMT9      ALKSIAITSAVAGEGKSTLTLGLAL-SIARDRQKVLVIDADLRSPSLH-KSFA--LT--N
A0A563VQJ3      APKVILVTSSVPGEGKSTITANLAA-AIAQLGRYVLLIDGDLRKPTQN-TLWK--AP--K
A0A1D8TX52      EWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A1D9G4T2      EWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A6P0PR27      ELKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--H
A0A6P0WER7      ELKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--H
F4XP71          ELKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--H
A0A6L9YR57      EWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A6P0KZ31      EWKSLMITSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A6P0LPB8      EWKSLMITSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A6P0SEV1      EWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A6B3N2I8      EWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A6M0B891      EWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A6P0IJQ1      EWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A6P0J8J8      EWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A6P0ZSH6      EWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A1U7N5X9      EWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A6L9Z1V0      EWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A6P0LC12      DWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-QQLG--LS--N
A0A6P0MVJ3      EWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLH-EQLG--LS--N
A0A2W6ZAV2      VVRLFSVTSTVELEGKSTASALFAQ-TMADLGQRVLLVDADLRRPSLH-RLMS--VA--N
K9W742          TLRSLMVTSAVAGEGKSTLALGLAI-SAARLHQRVLLIDADLRNPTLH-EKLN--LP--N
A0A3D1PBA3      SFKSLMVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDADLRRPNLH-EMLS--LP--N
K9XPB0          AFKSLLLTSAVAGEGKSTLVLGLAF-SIARHQKRVLVIDADLRCPSLH-EKLG--VE--N
A0A350Y7Z1      TLRSIVVTSALPSEGKSTLVVGLAF-SAARLHQRVLLIDADLRRPSLH-KQLN--LA--N
A0A352X2A7      LLKSLAVTSALSGEGKSTLVMGLAL-TAARLQQRVLLIDTDLRFPTLH-RQLN--LP--N
A0A0D8ZYV0      SLQSIMVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDADLRRPNLH-QMLN--LP--N
A0A2T1FP73      AFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLH-QILN--LP--N
A0A433VMS2      AFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLH-QILN--LP--N
K9TYA7          AFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLH-QILN--LP--N
A0A2P8QUE1      AFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLH-QILN--LP--N
K9SA61          PLKSIVVTSALAGEGKSTLAMGLAM-SAARLHQRVLLIDADLRRPSLH-KQLN--LP--N
A0A2G7GMH8      PVKSLAVTSALAGEGKTTLALGLAI-AAARLHQKVLLIDTDLRRPSLH-KQLE--LS--N
A0A6N8FU92      PIKSLVITSALAGEGKTTLALGLAL-TAARLHQKVLLIDIDLRRPSLH-KQLA--LS--N
A0A2T1DWE8      GLRSLVVTSALAGEGKSTIALGLAI-SAARLHQRVLLVDADLRRPSLH-QQLD--LP--N
A0A1U7I8L3      SLKSLVITSALAGEGKSAIALGLAI-SAARLHQRVLLIDADLRRPSLH-KELN--LP--N
A0A2T1DJL8      PLRSLVVTSALAGEGKSTIALGLAI-SAARLHQRVLIIDADLRRPGLH-KQLE--LP--N
A0A1Z4J9W0      PLKSLVVTSALAGEGKSTVALGLAI-SAARLHQRVLLIDADLRRPGLH-KQLQ--LP--N
A0A0N7Z5K9      PMRSLVVTSALAGEGKSTVALGLAI-SAARLHQRVLLIDADLRRPGLH-EQLQ--LP--N
A0A0S3TXC5      PMRSLVVTSALAGEGKSTVALGLAI-SAARLHQRVLLIDADLRRPGLH-HQLQ--LP--N
B8HNB0          ELRTIAFTSTIPSEGKSTIVYNLGR-MLAELGQKVLIVDADTRNPTIH-QIIE--QP--N
A0A563VS48      RIKTIAITSAVAQEGKSSVSANYAI-AQAQCGKRILLIDGDLRRSSQH-DLWQ--IP--N
A0A318BJ18      VPRSFLVTSTRPAEGKSTTALALAT-MLARAGKRTILVDGDMRSPSVH-QLGG--VD--H
A0A3B8Y8H9      TIKSLTISSAIPEEGKSTVAAHLAQ-AAAKMGQKVLLVDGDLRLPQLH-HQPG--LTSSN
A0A2W1JVB9      PLKVIVMTSGIPSEGKSTASANLAM-AMAELGQKVLLVDADLRRPVQH-RTWE--LL--N
A0A6H1U102      EVKTLALTSSTPSEGKSTLTYNLAR-SLAELGQRVLIVDADMRKPTIH-EFIK--QT--N
A0A7C3ZEJ3      EVKTLAFTSSTPSEGKSTLTYNLAR-VLAELGHRVLLVDADMRKPTVH-QMIK--QP--N
A0A563VLD6      KIKSLVLTSSTSSEGKSTTAYNLGL-ALTDLGSRVLIVDADMRKPKMH-KLTK--QS--N
A0A2P8W9H0      PLKSITVSSAVPNSGKTTVSFHLAY-TMALLGYRTLVVDNDFRRPSLH-TLCH--LP--N
A0A6I5P386      HLKSLAISSATPNSGKSTVSFHLAH-TNATLGQKTLLVDMDLRRPTLH-KFCN--HA--N
A0A318BG22      LPRTLLVTSAAMAEGKSTTSAALAQ-GVADRGKRVLLVDADLRKPTLH-HRFA--QT--N
A0A2T1E9V8      ALKVIAITSSVPNEGKSTTCANLAA-VMAQLEHKVLIIDADFRHPSQH-LIWQ--IS--N
A0A1Z4LN32      KIRSIAVTSSVAGEGKTEVAANLAA-VMAQVGRRVLLVDADMRQPSQH-HLWG--LI--N
A0A2I8A9F5      KIRTIAVTSSIAGEGKSEIAANLAA-VIAQTGRRVLLIDADMRRPSQH-HLWN--LI--N
A0A218Q6R8      KVRTIVVTSSVPGEGKSEVSANLAA-VMAQVGRKVLLVDADMRQPSQH-HLWG--LL--N
A0A218QGE0      KVSAIVVTSSISGEGKTEVAANLAA-VMSLAGRRVLLVDADMRQPSQH-HLWG--LI--N
A0A3M2GQQ6      EAKTLALTSATSGEGKSTLTYNLGR-VLSELGQRVLIVDADMRKPTVH-EFIK--QP--N
A0A6H1U2X0      EAKTLALTSATSGEGKSTLTYNLGR-VLSELGQRVLIVDADMRKPTVH-EFIK--QP--N
K9TLQ0          PLKSIVISSTLPAEGKTTISMKLAE-AASAMGNRVLLVDADLRRPQID-QRMD--LP--N
K9QF04          PLKSLVISSALPGEGKSTIAVYLAQ-VAASMGKRVLLIDADLRRPTIHTRVHS--LT--N
K9W1T3          QLKVMVISSSVPKEGKSTTAANLAV-AISQLGQRVLLIDADMRKPSQH-KIWQ--LP--N
K9SGJ5          SIKSIAFTSAVPSEGKSTLVFNLAS-ILAELGHKVLVVDADMRKPNVH-HLAK--LR--N
A0A6N2JS94      MMKVIAFTSSVPSEGKSTMTYNLAI-ILSALGYRILLVDADMRKPTVH-KLAG--LS--N
A0A6C2DSN4      MMKVIAFTSSVPSEGKSTLTYNLAM-ILSSLGYRILLVDADLRKPTVH-KLAR--LS--N
L8MYT6          MMKVIAFTSSVPSEGKSTLTYNLAM-ILSSLGYRILLVDADLRKPTVH-KLAR--LS--N
A0A352JGJ6      TMKVIAFTSSVPSEGKSTLTYNLAT-ILAALGYKVLLVDADMRKPTVH-KLSK--LS--N
A0A1J5GLS2      MMKVIAFTSSVPSEGKSTLTYNLST-ILAVLGYRVLLVDADMRKPTIH-KLSK--LP--N
A0A2W4W6M5      MMKVIAFTSSVPSEGKSTLTYNLAT-ILAALGYKVLLVDADMRKPTVH-KLTK--LS--N
A0A2W7AN33      LMKVIAFTSSVPSEGKSTLTYNLAV-ILSSLGYRVLLVDADMRKPTIH-KLAG--LS--N
A0A256BLV2      MMKVIAFTSSVPSEGKSTLTYNLAT-ILSALGYRVLLVDADMRKPSIH-KLAG--LS--N
A0A2W6ZXF3      MMKVIAFTSSVPSEGKSTLTYNLST-ILAALGYRVLLVDADMRKPTVH-KLSK--LP--N
A0A2Z5WX66      TMKVIAFTSSVPSEGKSTLTYNLST-ILAALGYKVLLVDADMRKPTVH-KLTN--LS--N
K1XF69          KVRVIVVSSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQH-HIWG--LT--N
B5W297          KVRVIVVSSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQH-HIWG--LT--N
A0A6H2AL05      KVRVIVVSSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQH-HIWG--LT--N
H1W7M8          KVRVIVVSSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQH-HIWG--LT--N
A0A5Q4H6A5      KVRVIVVTSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQH-HIWG--LT--N
D5A466          KVRVIVVTSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQH-HIWG--LT--N
U5QJM6          KVNTFVISSSAPGEGKSTVSTNLAR-IAAELNRKVLIIDADLRRPTVA-KRLE--LT--N
A0A1Z4RPC6      QPKVIVITSSVPGEGKSTIAANLAA-AMAQLGRKVLLIDGDLRKASQQ-DLWQ--VS--N
A0A2T1CMZ0      QPKVILMTSSVPGEGKSLVAANLAA-AMAQLGRKVLLIDGDLRKASQH-DLWQ--IS--N
L8M4F7          LPKVILVTSSVPGEGKSTVTANLAA-AISQLGSRVLLVDGDLRRPSQH-LLWN--RN--S
A0A140K2P2      STQVILVTSSVPEEGKSTVSANLAA-AIAQLGKRVLLIDGDLRKPSQH-RLWN--LE--N
K9XWX4          PPQVILVTSSVPEEGKSTVSANLAT-AIAQLGKRVLLIDGDLRKPSQH-HLWN--LD--N
A0A140KB14      PPQVILITSSVPGEGKSTVAANLAA-AIAQLGRRVLLIDGDLRRATQH-HLWS--MS--N
K9XX88          PPQVVLVTSSVPGEGKSTIAANLAT-AIAQLGRRVLLIDGDLRRANQH-HLWN--MS--N
A0A563VSV6      PPKVILITSSAPGEGKSTVTANLAA-AIAQLGRRVLLIDGDLRKSSQH-QLWG--VS--N
L8LZE9          PPKVILVTSSIPGEGKSTVTANLAA-AISQLGRKVLLIDGDLRKASQH-QLWG--VS--N
A0A433NM31      ELRVITITSAVPKEGKSTVSANLAL-AIAQLGFKVLLVDADMRSPSQH-QFWE--LG--N
A0A1Z4NDS1      ELKTIVVSSSVSGEGKSEVSANLAV-TVAQLGRRVLLIDADMRCPIQH-HIWG--LN--N
U9VXM0          QVKTITITSAVGGEGKSEVAANLAL-TLAHLGHMVLVVDADMRKPTQH-LIWD--LP--N
A0A6M0RI13      HVKTVTVTSAVGGEGKSEVAANLAL-TLAHLGHTVLLVDADLRKPTQH-HIWD--LP--N
A0A6M0S1N5      HVKTVTVTSAVGGEGKSEVAANLAL-TLAHLGHTVLLVDADLRKPTQH-HIWD--LP--N
K9F4D9          HVKTVTVTSAVGGEGKSEVAANLAL-TLAHLGHTVLLVDADLRKPTQH-HIWD--LP--N
A0A6I5QPI5      ELKTVMITSAVPGEGKSEIAANLAA-ALAQVGRRVLLIDADMRYPRQH-HALK--VL--N
A0A1Z3HMQ0      PRRALTLTSSVPQEGKSEVAANLAA-TIAQTGKQVLLVDADMRSPWQH-HLWN--VV--N
A0A433W533      -LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQH-HIWE--KA--N
A0A2P8QWJ3      -LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQH-HIWE--KA--N
A0A2T1FKP8      -LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQH-HIWE--KA--N
K9U6L7          -LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQH-HIWE--KA--N
A0A1E5QP61      EIRIIVVTSAVSQEGKSTVAANLAV-ATAQLGRRVLLIDGDMRHSTQH-QIWN--LT--N
U5DPF5          KLKVVAVTSSIPREGKSTVSANLGV-ALAELGNRVLVIDADMRRPSQH-QVWE--LA--N
A0A6P0X488      ELKVIVVTSSVSKEGKSTVSANLAI-AMAQLGRRVLLIDADLRHPLQH-HIWG--LV--N
A0A6P0UVD5      ELKVIVVTSSVSKEGKSTVSANLAI-AMAQLGRRVLLIDADLRHPLQH-HIWG--LV--N
A0A6P0VDM0      ELKVIVVTSSVSKEGKSTVSANLAI-AMAQLGRRVLLIDADLRHPLQH-HIWG--LV--N
A0A6M0G142      ELKVIVVTSSVSKEGKSTVSANLAI-AMAQLGRRVLLIDADLRHPLQH-HIWG--LV--N
A0A6P0MR53      ELKVIVVTSSVSKEGKSTVSANLAI-AMAQLGRRVLLIDADLRHPLQH-HIWG--LV--N
A0A3M2GIL5      ELKTIVVTSSMAKEGKSAVAANLAL-AIAQLGRRVLLIDADLRHPIQH-HIWD--LT--N
A0A6H1TSJ9      ELKTIVVTSSMAKEGKSAVAANLAL-AIAQLGRRVLLIDADLRHPIQH-HIWD--LT--N
A0A3M1PML8      AVRSFVITSSVAQEGKSEIAANLAA-TMAQLGRKVLLVDADLRRPAQH-HTWN--LV--N
A0A6M8BE85      AVRSFVITSSVAQEGKSEIAANLAA-TLAQLGRKVLLVDADLRRPAQH-HTWN--LV--N
A0A0T7BPZ0      RIKAIAVTSSIPKEGKSEVSANLAV-AMAQVGRKVLLIDADMRHPIQH-HIWG--IT--N
A0A352X442      QIKAIVVTSSVPQEGKSEVSANLAA-AIAQVGRRVLLVDADMRHPSQH-HLWN--LT--N
A0A6B3NF44      QIKSIVVTSSVPKEGKSEVCANLAA-AMAQIGRRVLLVDGDMRHPSQH-HIWG--LT--N
A0A6M0EPL4      QIKSIVVTSSVPKEGKSEVCANLAA-AMAQVGRRVLLVDGDMRHPSQH-HIWG--LT--N
A0A6P0K6L6      QIKSIVVTSSVPKEGKSEVCANLAA-AMAQIGRRVLLVDGDMRHPSQH-HIWG--LT--N
A0A6P0MRR9      PLKAIVVTSSVPKEGKSDVCANLAA-AMAQVGRRVLLVDGDMREPSQH-HIWQ--LT--N
A0A6P0UX57      PPKVIVVTSSVPQEGKSDVCANLAA-AMAQVGRRVLLIDGDMREPSQH-HIWQ--LT--N
A0A6P0X1X4      PLKAIVITSSVPKEGKSDVCANLAA-AMAQVGRRVLLIDGDMREPSQH-HIWQ--LT--N
A0A0M0SHU3      QLKAITVTSSIPKEGKSEVSANLAV-AMAEVERRVLLVDADMRHPIQH-HIWQ--LS--N
A0A1D2PBN3      QLKAIVVTSSVAKEGKSEVAVNLAV-AMAQVGRRVLLVDADMRHPVQH-HVWG--MT--N
A0A0C2LVR7      QLKAIVVTSSVAKEGKSEVAVNLAV-AMAQVGRRVLLVDADMRHPVQH-HVWG--MT--N
A0A1Z4PQB9      ELKAIVVTSSVPKEGKSEVAANLAV-AMAQVGRRVLLVDADMRHPVQH-HVWG--MT--N
A0A1Z4SFN6      KLKAIVVSSCVSKEGKSEVAANLAV-AMAQLGHRVLLVDADMRRPVQH-HIWG--MT--N
K9PGI8          ELKAIAVTSSVAKEGKSEVAANLAV-AIAQLGRRVLLVDADMRHPVQH-HIWG--MT--N
Q7NEU3          KLKVFVVSSSMPGEGKSTVATNLAK-VVGGLNRKALLVDADLRRPTVS-NKLE--LS--N
A0A3C0N2P0      AVRSVVISSATPGDGKSTITTFLAQ-AAAAMGQRVLLVDADLRRPRIH-ETTD--LP--N
A0A6P0JR04      PLQTLVISSSVPLEGKSTTSANLAQ-AAAAMGQRVLLVDADLRRPQIH-AMTD--LP--N
A0A6B3M6M6      SIRSLVISSTVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVH-LRMD--LP--N
A0A6P0KD09      SIRSLVISSTVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVH-ERMD--LP--N
A0A6B3NIJ0      SIRSLVISSTVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVH-ERMD--LP--N
A0A6M0F053      PIRSLVISSTVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVH-ERMD--LP--N
A0A6P2ATU9      PLQVLVISSSVPLEGKSTTSIHLAQ-TAASMGQRVLLVDADLRRPQVH-VVAD--LP--N
A0A352XE00      PIRSLVMSSAVPADGKSTTSMFLAQ-AAAAMGEKVLLVDADLRRPQIH-VRMN--LL--N
A0A6P0QC14      PIRSLVLSSSVPADGKSTVAIYLAQ-AAAAMGQRVLLVDADLRRPQVH-VRTD--LP--N
B4VS56          PIRSVVISSAVPADGKSTIATFMAQ-AAAAMGQRVLLVDADLRRPQLH-VRTD--LP--N
A0A352AAQ3      PIRSLVMSSAVPADGKSTTSAFLAQ-AAAAMGERVLLVDADLRRPQVH-VKTD--LP--N
A0A350Y472      SIRSLVVSSAVPADGKSTVAAFLSQ-AAAAMGERVLLVDADLRRPQVH-VKTD--LP--N
A0A355DVB4      TIRSLVVSSAVPADGKSTVAAFLAQ-AAAAMGERVLLVDADLRRPQVH-VKTD--LP--N
A0A1Z4RMB9      PPKVMLITSSVPEEGKSTVVANLAA-AIAQLGRSVLLIDADLRRSSQH-TLWG--VD--N
A0A318B4H2      APGVLMLTSSRPNEGKSLSAYALSR-LFAETGASVVLIDADMRNTRLD-DLVA--LD--A
B4WQE3          IAKSFSVSSAVPNEGKSTISFYLAH-ASASLGKRTLLVDADLRHPTLH-RLCN--LP--N
A0A2K3BR24      KMKVIVLTSSIPNEGKSTVSANLGM-ALAELGHRVLIIDADLRRPSQH-QVWE--EP--N
K9YXY1          KMKVIVLTSSIPSEGKSTISANLGM-ALAELGNKVLIIDGDLRRPSQH-QVWE--EP--N
A0A0V7ZFJ4      TLKVIVVSSSNPNEGKSFVSANLAV-TLSQLGRKVLLVDADMRRPRQH-RIWR--RP--N
A0A0V7ZNJ9      TLKVLMVTSSVPGEGKSLVSANLAV-TISQFGQRVLLIDGDMRRPRQH-KLWK--IH--S
A0A367RIS1      ELKVIVVSSSVMNEGKSFVAANLAV-ATAQMGKRVLLIDADMRRPRQH-EIWQ--KP--N
A0A235IXQ2      ELKVIVVSSSVINEGKSFIAANLAV-ATAQMGRRVLLIDADMRHPHQH-KMWQ--QP--N
A0A1W5CNX3      KLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQH-EMWQ--QP--N
A0A5Q0GJJ5      KLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQH-EMWQ--QP--N
Q3MEB7          KLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQH-EMWQ--QP--N
A0A1Z4KHN9      KLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQH-EMWQ--QP--N
Q8YT70          KLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQH-EMWQ--QP--N
A0A166IWU6      ELKVIVVSSCLPGEGKSFVAANLAV-ATAQMGRRVLLIDADMRRPRQQ-ELWQ--VR--N
A0A2S0Q8C0      ELKVIVVSSCLPGEGKSFVAANLAV-ATAQMGRRVLLIDADMRRPRQQ-EVWQ--VR--N
W6FSX4          ELKVIVVSSCLPGEGKSFVAANLSV-ATAQMGRRVLLIDADMRRPRQR-EVWQ--VR--N
A0A218Q4C1      KLKVIVVSSCLPGEGKSFITANLAV-ATAQMGQRVLLIDADMRRPSQQ-EVWQ--VR--N
A0A6P1ZT04      ELKVIVVSSCLPGEGKSFVTANLAV-ATAQMGRRVLLIDADMRRPRQQ-EVWQ--VR--N
A0A0R0M9H9      ELRVILLTSSSPSEGKSFVSANLAL-AASHLGKRVLIVDADLRRPRQH-KVWG--LP--N
A0A1S1ZVW2      ELQVILVTSSSPAEGKSFVSANLAL-AASHLGKRVLIVDADLRRPRQH-KVWG--LP--N
A0A1B7WX82      ELRVILVTSSTAGEGKSFVAANLAL-AAAHVGRRVLLVDADMRRPRQQ-RIWE--TP--N
A0A1B7WTD1      ELQVILVTSSTSGEGKSFVAGNLAV-AASHVGKRVLLIDCDMRRPRQH-RIWE--IP--N
A0A480ABC0      ELQVILVTSTTSGEGKSFVAANLAV-AASHVGKRVLLIDCDMRRPRQH-RIWE--IP--N
A0A1Z4LRU5      ALKVIVVSSSIPGEGKSFVSSNLAV-AMAQLGRRVLLIDADMRRPTQQ-NIWD--LP--N
A0A1Z4JVB4      KLKVIVVSSAVPGEGKSFIAANLAT-ATAQLGKKVLLLDADMRRSRQH-KIWQ--QS--H
K9PIA4          KLKVIVVSSSIPGEGKSFVTANLAV-AIAQLGRRVLLIDADMRRPRQH-KIWE--QS--N
A0A1Z4HVE1      TLKVIALSSSIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQH-KIWE--QS--N
A0A252ECZ1      KLKVIVVSSSVPGEGKSFVAANLAV-AAAQIGHRVLLVDADMRRPRQH-KIWE--QS--N
A0A1Z4G5Y1      TLKVIVLSSSIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQH-KVWE--QS--N
A0A252DNA2      TLKVIVLSSSIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQH-KVWE--QS--N
A0A252E1Q4      TLKVIVLSSSIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQH-KVWE--QS--N
A0A6G9SK36      MLKVIALSSSIPGEGKSFVAANLAV-AVAQLGRRVLLVDGDMRRPRQH-KIWE--QN--N
A0A1Z4M597      MLKVIAISSSIPGEGKSFVAANLAV-AVAQLGRRVLLVDADMRRPRQH-KIWE--QN--N
A0A1Z4MWT1      MLKVIAISSSIPGEGKSFVAANLAV-AVAQLGRRVLLVDADMRRPRQH-KIWE--QN--N
A0A1Z4TX53      MLKVIAISSSIPGEGKSFVAANLAV-AVAQLGRRVLLVDADMRRPRQH-KIWE--QN--N
A0A5P8VSD1      ELKVVVVSSSVMNEGKSFIAANLAI-ATAQMGKRVLLIDADMRRPRQH-EMWQ--QP--N
A0A2A2TNQ5      ELRVIVVTSSVPGEGKSLVAANLAV-AKAQMGKRVLLIDADMRRPRQH-EIWE--LQ--N
A0A3S1C4K5      ALRVIAVTSSVPGEGKSFVAANLAV-AKVQMGYRVLLIDADMRRPRQH-KVWE--KA--N
A0A1X4G3D5      ELQVMLVTSSSQGEGKSFVSANLAA-ALSYLGKRVLIVDGDLRRPCQH-RVWK--LP--N
D4TNI2          ELQVMLVTSSSQGEGKSFVSANLAA-ALSYLGKRVLIVDGDLRRPCQH-RVWK--LP--N
A0A1Z4H6Z8      TLKVIVVSSSIPSEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQH-KIWE--QS--N
A0A1Z4NPM1      ELRVILVTSSVPGEGKSFVSANLAV-AMSQLGKRVLLIDADMRRPRQH-KVWQ--LA--N
A0A3F3KPR9      ELRVILLTSSSPGEGKSFISANLAL-AASHLGKRVLIVDGDLRRPRQH-KVWG--LP--N
D4TGN7          ELRVILLTSSSPGEGKSFISANLAL-AASHLGKRVLIVDGDLRRPRQH-KVWG--LP--N
A0A1Z4UZW9      ELRVILLTSSIPGEGKSFVAANLALAAAAQPGRRVLLVDADMRRPRQQ-SIWE--IH--N
A0A0K2M5H0      ELRVILVTSATPGEGKSFVAANLAL-AAAYVGRRVLLVDADMRLPRQH-RVWE--IH--N
A0A1B7VSH4      KLRVILVTSATPGEGKSFVAANLAL-AGAYVGKRVLLVDADMRRPRQH-RVWE--IH--N
A0A1B7W126      ELRVILVTSATPGEGKSFVAANLAL-AGAYVGKRVLLVDADMRRPRQH-RVWE--IH--N
A0A3D4C6Q6      ELRVILVTSATPGEGKSFVAANLAL-AGAYVGKRVLLVDADMRRPRQH-RVWE--IH--N
A0A1B7UVJ4      QLRVILVTSSTSGEGKSFMAANLSL-AAAHVGRRVLLVDADMRRPRQH-RIWE--TP--N
A0A1B7UTR1      QLRVILVTSSTSGEGKSFMAANLSL-AAAHVGRRVLLVDADMRRPRQH-RIWE--TP--N
K7W0A4          ELRVILLTSSTPGEGKSFVAANLAL-AAAHVGRRVLLVDADMRRPRQH-RVWE--IP--N
A0A5C0DRW9      KLRVVLLTSSTPEEGKSFVAANLAL-AAAHVGRRVLLVDADMRRPRQH-RVWE--IP--N
A0A6H2C088      ELRVILLTSSNPGEGKSFVAANLAL-AAAHVGRRVLLVDADMRRPRQH-RVWE--IP--N
A0A1Q4RTR1      VLKSIVITSAIPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSSQH-EVWK--VE--N
A0A1Z4SQV2      VLKSIVITSAVPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSRQH-EIWK--VE--N
A0A2H2XGN1      VLKSIVITSAVPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSRQH-EIWK--VE--N
A0A433UXH8      VLKTIVITSAIPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSNQH-QIWK--VE--N
A0A1U7HGH0      SSRVILVTSSIPKEGKSTTCANLAA-VMALLNYKVLIIDADLRHPSQH-QIWE--IA--N
K9XJD3          SSRVILVTSSAPKEGKSTTCANLAA-VMALLNYKVLIIDADLRHPSQH-QIWE--IA--N
K9SX01          QIKAIVITSSVPGEGKSTVSANLAV-AIAQLGKRVLLVDVDMRRPSQH-KIWG--LG--N
A0A4P7ZT55      NLRMLAVTSTASGEGKTTSVALLGQ-ALADLGLKVLLVDGDLRQMQLH-QRFA--AD--G
A0A1E5QIR9      QVRVIAVTSAIPKEGKSTVSANLAL-AIAQLGFRVLLVDADMRHPSQQ-AFWD--TP--K
A0A1Z4IBC7      PLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWE--LS--N
A0A1W5CPC7      PLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWD--LS--N
A0A5Q0GKD1      PLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWD--LS--N
Q3MDC6          PLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWD--LS--N
A0A1Z4KM73      PLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWD--LS--N
Q8YNX7          PLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWD--LS--N
A0A367R4K6      PLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDTDMRHPIQH-HIWE--LK--N
A0A1E2WSV8      PLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWG--LP--N
A0A2R5FRT9      PLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRNPMQH-HIWG--LT--N
A0A2K8T1B6      PLRSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRNPIQH-HIWG--LK--N
A0A235I9I0      PLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWG--LT--N
A0A2D0HQT8      PLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWG--LT--N
A0A2L2NU95      PLKSIVITSSVAREGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWG--LT--N
A0A367S084      PLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWG--LT--N
A0A6P1A9A0      PLRSLAISSSVPAEGKSTTSVNLAQ-AAAAMGQRVLLVDADLRRPQIH-IMMD--LP--N
A0A1Z4SMD6      KVRTIAVASSVALEGKSEVSANLAA-ALANAGRRVLIVDTDMRQPRQH-HLWG--LI--N
A0A2H2Y096      KVRTIAVASSVALEGKSEVSANLAA-ALANAGRRVLIVDTDMRQPRQH-HLWG--LI--N
K9S8M8          ELKVIVVTSPVPQEGKSTVSANLAA-AMAQLGRRVLLVDADMRHPMQH-HVWH--LT--N
A0A1Z4NFV0      KVRTIVITSSVAGEGKSEVAANLAT-SIAQSGRRVLLVDADMRNPSQH-HLWG--RI--N
A0A3M9ZEU1      EIRVVVVTSAVAKEGKSTIAANLAA-AAAQVGRRVLLIDADLRYPQQH-HIWD--LL--N
A0A1Z4JK72      KVKTIVISSAVPREGKSEVAANLAA-TMAQSGRKVLLVDADMRNPSQH-HLWG--IV--N
A0A0N7Z489      PVKTIVISSAVPREGKSEVAANLAA-TMAQSGRRVLLVDADMRNPSQH-HLWG--LV--N
A0A0S3TXS2      KVKTIVISSAVPREGKSEVAANLAA-TMAQSGRKVLLVDADMRNPSQH-HLWG--LV--N
A0A2A2TPF8      KVRTIVVTSSVAGEGKSEVSANLAA-VMAQAGKRVLIIDADMRNPSQH-HLWG--VM--N
A0A1Z4R0P8      RVRTLVVTSSVAGEGKSEVSANLAA-VIAQTGKRVLLIDADMRNPSQH-HLWG--VM--N
A0A0T7BUI3      KVRAIAITSCVPGEGKSEVSANLAA-ILAQAGRRVLLIDADMRKPSQH-HLWG--LI--N
A0A1Z4LP32      EVRTIVVTSSVVGEGKSEVSANLAA-ILAQSGKRVLLVDADMRQPNQH-HLWG--LI--N
K9REP9          EVRTIAVTSSVVGEGKSEVTANLGA-ILAQGGQRVLIVDADMRQPMQH-HLWG--LI--N
A0A1Z4SIJ3      KVCTLAITSSVAGEGKSEVAANLAA-ALAQSGRQVLLVDADMRQPAQH-RLWG--LI--N
A0A2H2XPG4      KVCTLAITSSVAGEGKSEVAANLAA-ALAQSGRQVLLVDADMRQPAQH-RLWG--LI--N
K9V3C7          QVRTIVVTSSVAGEGKSEVSANLAA-AIAQTGKRVLLVDADMRQPSQH-HLWG--LM--N
A0A1Z4T6Y7      KVRTIVITSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDGDMRNPAQH-HLWG--VM--N
A0A2H2Y561      KVRTIVITSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDGDMRNPAQH-HLWG--VM--N
A0A1Q4S362      TVRTIVVTSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDSDMRNPSQH-HLWG--VM--N
A0A3S1CIN8      TVRTIVVTSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDSDMRNPSQH-HLWG--VM--N
A0A2A2TC28      KVCTIVVTSSVAGEGKSEVTANLAA-IIAQSGRRVLLVDADMRQPSQH-HLWG--LI--N
A0A0C1NCB0      RLRTIVVTSSVPGEGKSEVSANLAA-VLAQSERKVLLIDADMRLPSQH-HIWG--LI--N
A0A2N6K7Q9      KVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--N
A0A2N6MXH6      KVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--N
A0A2N6M5A8      KVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--N
A0A2N6LL61      KVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--N
A0A0S3TP66      KVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--N
G6FP91          KVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--N
A0A1U7GYR5      KVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--FI--N
A0A2N6KY52      KVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--N
A0A2N6KMP5      KVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--N
A0A2N6MA45      KVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--N
A0A4Q9J9V9      KVRKIVVTSSVSAEGKSEVSANLAA-IIAQSGKRVLLVDADMRKPTQH-HLWS--LI--N
A0A328IGA1      KVRKIVVTSSVSAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWS--LI--N
A0A4D9CE41      KVRKIVVTSSVSAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWS--LI--N
A0A0M0SFT2      KVRKIVVTSSVSAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWS--LI--N
A0A1Z4TLC8      KVRKIVVTSSVSAEGKSDVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWS--LI--N
A0A0C2LFH0      KVRTIVVTSSVPGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPSQH-HLWG--LV--N
A0A1Z4IYV4      KVRTIVVTSSVPGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQH-HLWG--VI--N
A0A1Z4Q0T6      KVRTIVVTSSVAGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQH-HLWG--VI--N
A0A0C2PT44      KVRTIVVTSSVAGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQH-HFWG--VI--N
A0A1D2P6J4      RVRTIVVTSSVAEEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQH-HLWG--VI--N
B4WP72          ELKTIVITSAAAGEGKSEVSVNLAT-TIAQSGQRVLLIDADMRHPSLH-KTWN--IS--N
A0A2T1CIL7      DRKAIAVTSSVPQ