BYKdb

Dataset for cluster tadcd of phylum cyanobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

400 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K9SLA9          ----------------------------------------------------------MN
A0A168TT23      ---------------------MSNYGIHDGRHLKPIEDQNTALAQYDPYQSKANEDDDAI
A0A0M1JWX9      ----------------------MQTAPNSQPSSFDQNGKQPQIVPLSYLAEVPDADEEEL
A0A2T1M1V6      ------------------------------------------------------------
A0A2G7GCS2      ------------------------------------------------------------
K9XBH8          ------------------------------------------------------------
A0A1Z4LJ30      ------------------------------------------------------------
K9RI76          ------------------------------------------------------------
A0A352AE27      ------------------------------------------------------------
A0A3B8JH60      ------------------------------------------------------------
A0A3C0N766      ------------------------------------------------------------
K9W9J7          ------------------------------------------------------------
A0A139WSU3      ------------------------------------------------------------
A0A433VN22      ------------------------------------------------------------
Q7NF11          ------------------------------------------------------------
A0A1Z4JCS8      ------------------------------------------------------------
F4XTX2          ------------------------------------------------------------
Q7NJN6          ------------------------------------------------------------
U5QCC3          ------------------------------------------------------------
A0A3S0Y9N9      ---------------------------------------------------------MEE
A0A433UNK7      ---------------------------------------------------------MEE
A0A3M1SVZ4      ---------------------------------------------------------MES
A0A654SFI6      ---------------------------------------MQPSIADRGNYPDTPADYRED
K9SSQ0          -----------------------------------------------------MKVYSSK
A0A2W1JIN9      ---------------------------------------------------------MDQ
A0A318AJV1      ------------------------------------MLKQTSDHRVSHLAPPQDQARLGD
A0A6B3MUB5      ---------------------------------------------------------MET
A0A1U7N2U4      ---------------------------------------------------------MET
A0A1D9G1F2      ---------------------------------------------------------MDT
F4XV38          ---------------------------------------------------------MDT
A0A2P8QIL5      ---------------------------------------------------------MEQ
A0A2T1FLY5      ---------------------------------------------------------MEQ
A0A433W447      ---------------------------------------------------------MEQ
K9U1K8          ---------------------------------------------------------MEQ
K9UYB2          ---------------------------------------------------------MEK
A0A218QN17      ---------------------------------------------------------MEK
K9RKN2          ---------------------------------------------------------MEK
A0A2I8ADV2      ---------------------------------------------------------MGR
A0A1W5CKM3      ---------------------------------------------------------MGK
A0A5Q0GMF5      ---------------------------------------------------------MGK
Q3MEW0          ---------------------------------------------------------MGK
A0A1Z4KIC7      ---------------------------------------------------------MGK
Q8YSM5          ---------------------------------------------------------MGK
A0A1Q4S1H4      ---------------------------------------------------------MEK
A0A433VBU6      ---------------------------------------------------------MEK
A0A1Q4RZJ6      ---------------------------------------------------------MEK
A0A1Z4SNV3      ---------------------------------------------------------MEK
A0A2H2XJQ1      ---------------------------------------------------------MEK
A0A3S5K358      ---------------------------------------------------------MEK
A0A0T7BPJ4      ---------------------------------------------------------MAK
A0A0C1QS61      ---------------------------------------------------------MEK
A0A139X3R8      ---------------------------------------------------------MEK
A0A1Z4I7C5      ---------------------------------------------------------MGK
A0A0C2MDK7      ---------------------------------------------------------MEK
A0A1Y0RCK1      ---------------------------------------------------------MEK
A0A1Z4PWZ0      ---------------------------------------------------------MEK
A0A0C2QLT0      ---------------------------------------------------------MEK
A0A1Z4J2K1      ---------------------------------------------------------MEK
A0A3S0ZSX0      ---------------------------------------------------------MEK
A0A2N6K4T3      ---------------------------------------------------------MEK
A0A370CKT2      ---------------------------------------------------------MEK
A0A0S3TL97      ---------------------------------------------------------MEK
A0A2N6M8A0      ---------------------------------------------------------MEK
A0A2N6M9E1      ---------------------------------------------------------MEK
A0A2N6KJI4      ---------------------------------------------------------MEK
A0A2N6MZ77      ---------------------------------------------------------MEK
A0A2N6KT20      ---------------------------------------------------------MEK
G6FSN3          ---------------------------------------------------------MEK
A0A4D9CI02      ---------------------------------------------------------MEK
A0A328I8B9      ------------------------------------------------------------
A0A4Q9J4Z7      ---------------------------------------------------------MEK
A0A0M0SU69      ---------------------------------------------------------MEK
A0A1Z4TIZ8      ---------------------------------------------------------MEK
A0A0S3TYD7      ------------------------------------------MKQPQNPSQTPASDAIEL
A0A3C0N2P0      --------------------MGPDGDYQPLLPNGNGKQLSQLSTLNAAEFSVLNED--KF
K9TLQ0          --------------------MDIDGNSPPFFQQLNGPFPSGQTPLPSTILPPLNDDADAL
A0A6B3M6M6      --------------------MGSDANFQPLLPNSNTQVLLPTSAL-SGGISGIDED--QL
A0A6B3NIJ0      --------------------MGSDANFQPLLPNSNTQVLLPTSVL-SGGISAIDED--KL
A0A352XE00      --------------------MNLNGDGKVLSINGNAQQSLEVPGINSKNVADIPNH--QV
B4VS56          --------------------MGSNGEYQPLPPNRNGHLPSELSSLSLYELVETEDD--KL
A0A352AAQ3      --------------------MALTGDYQPLLPTSNGKQLSELMPIYTNGFSEIQED--KL
A0A350Y472      --------------------MGPKVDYQPLLVNANDKPSSVSPPIYPSGFSLVEEE--KL
A0A355DVB4      --------------------MGPKVDYQPLLVNANDKPSSVSPPIYPSGFSLVEEE--KL
U5QL42          -------------------------------------------MVNPQASLGPPSD--NF
K9QF04          ----------------------------------MTQNVENLTLFKPQALPKPQSD--PW
A0A076HBF2      ----------------MSNLVAAPGQSPDFDARNVQTVRVHEVGT---NEPIGTED--EI
A0A354B169      ------------------------------------------------MGAMGVAE--EI
G4FMX5          ----------------MSNLSAQP--NPQAVDGLLQ---------------VDGSD--EI
Q0IDT5          ----------------MSNLIARPGQSPDLVPQTIQDVQVRDLGLNLSNLKAEASD--EI
A0A2D6FCW3      ----------------MSNLIVNPXQTPDFNRHQAQTVNVQDLGRXVVQA-ADNND--EI
A3ZA21          ----------------MSNLIPRAGHSPNLAVQGIQTVQVRDLGTSVAAGPAAADD--EI
A0A140K3H3      ------------------------------------MNNQLVNPNSLYLPTPETES--AF
K9XUB8          ------------------------------------MNNQLVNSNTLYLPTPETES--TF
Q7NEU3          ------------------------------------MTKQPFADPVDKPAQVVEES--SF
A0A6H2NHD5      ----------MVFPKTSSPSPAQPSANGNGH------HHNGYLPAPPAPVVVEADD--DF
A0A2P8W4F7      ------------MPFPPSSTPRETNGHSNGHGNGHGSGRPEFVPMMAPPSLVEKGD--DV
A0A5Q4E0Z4      ------------MPFSSTPTSEETNGNGNGH------AKHSFVPVSAPSAIVDDSD--DF
A0A2P8VVX1      -------------------------------------------MVSTSTLPTSTDQ--EF
A0A2P8WHY0      -------------------------------------------MTHAAYQPIPDEP--EF
A0A2T1CMT9      --------------------------------------------MDQNNWETETQG--DL
A0A563VQJ3      ----------------------------MTNNGFNYYPPKELESNYYNLPKSRENL--DL
A0A1D8TX52      --------------------------------------------MKELDLNAAAET--DA
A0A1D9G4T2      --------------------------------------------MKELDLNAAGET--DA
F4XP71          --------------------------------------------MKELDLNAAGET--DA
A0A1U7N5X9      --------------------------------------------MKELDLNAAAET--DA
A0A6B3N2I8      --------------------------------------------MKELDLNGAAET--DA
A0A2W6ZAV2      ------------MPDPLPSPDELLPPGTLVTLGASSGQVVLIPQEAETQPAPGGSE--EL
A0A2G7GMH8      --------------------------------------------MNKDNFAMATEQ--EA
K9W742          --------------------------------------------MTQSNLNTVPDT--DP
A0A2T1DWE8      -----------------------------------------MVVVTVGNLANTVET--DP
A0A1U7I8L3      --------------------------------------MVNVNTNNLNPAA---ET--EA
A0A2T1DJL8      MPSVASQKASFSSRSIASFRRFVWHRSDELSFAKGVPIVAESHLNLIAAA----DP--DP
A0A1Z4J9W0      --------------------------------------MAQSNITLFNASPHAQEP--DP
A0A0N7Z5K9      --------------------------------------MAQGNITLFNPSPPAQEP--DP
A0A0S3TXC5      ------------------------------------MIVAQGNITLFNPSSPMQEP--DP
K9SA61          ---------------------------MALVPHTPGNFAPHRSPVTDPRWTDSGDS--DG
A0A3D1PBA3      ----------------------------------------MARVNEHNLPI-NTET--DG
K9XPB0          ----------------------------------------MKQIEWE-----ENSS--DL
A0A350Y7Z1      -------------------------------------------MIQSNLP--GDET--NL
A0A352X2A7      -------------------------------------------MTQSNLP--ETES--DF
A0A0D8ZYV0      ----------------------------------------MVRGIENN-PNVANET--EP
A0A2T1FP73      ----------------------------------------MVRVNESNMPMTVEES--DG
A0A433VMS2      ----------------------------------------MVRVNESNMPMTVEES--DG
K9TYA7          ----------------------------------------MVRVNESNMPMTVEES--DG
A0A2P8QUE1      ----------------------------------------MVRVNESNMPMTVEES--DG
A0A2T1DNG3      ------------------------------------------MTAAQPKLNLSAAT--DP
B8HNB0          ----------------------------------MVQFNAERWLQNQQLLNELYFS--AS
A0A1Z4LN32      ------------------------------------------------MENQNLSE--EI
A0A2I8A9F5      ------------------------------------------------METQNSAE--DI
A0A218Q6R8      ------------------------------------------------METKNYPD--EI
A0A218QGE0      ------------------------------------------------MDTKNYPE--EI
A0A563VS48      --------------------------------------------MNTIEQNVHIDE--YL
A0A318BJ18      ---------------------------MSFISSNLGSPGAIGSAQSAIASPTIADG--PS
A0A3B8Y8H9      ----------------------MTDLPNNSLAVNSPQPQVNQTIQSQLREQNEEDI--SL
A0A2W1JVB9      ----------------------------------------------MPAEYQLEEE--VI
A0A6H1U102      ----------------------------------------MPDRFAGLDRMTLPDD--NN
A0A563VLD6      --------------------------------------MNNPINNPEFVQLPSQET--GF
A0A2P8W9H0      -----------------------------------MASELQLSSKGALHPEGDQEG--GL
A0A6I5P386      ------------------------------------MIAKRLPTVGIPLDERDREG--GL
A0A318BG22      --------------------MIRSLTNDTRPGPIDDLQSRRGAMRPAAEVEQWDGG--SI
A0A1Z3HMQ0      ---------------------------------------------MDGKTYQDYVE--EI
K1XF69          ------------------------------------------MVMDFSNIEHRESI--DL
B5W297          --------------------------------------------MDFSNIEHRESI--DL
A0A6H2AL05      ------------------------------------------MVMDFSNIEHRESI--DL
H1W7M8          ------------------------------------------MVMDFSNIEHRESI--DL
A0A5Q4H6A5      ------------------------------------------MVMDFSNIEHRESI--DL
D5A466          --------------------------------------------MDFSNIEHRESI--DL
U5QJM6          ------------------------------------------------------------
A0A1Z4RPC6      --------------------------------------MTNLQTTNSLSSNHREEL--DI
A0A2T1CMZ0      --------------------------------------MTNLQRNNVYNPNRRAEF--DI
L8M4F7          ---------------------------MFKIPNNNSAYSSQTEGEANASINSRDSI--DL
A0A140K2P2      -----------------------------MTNNYPANNSNNYNYPSETLSASREAI--DV
K9XWX4          -----------------------------MTNNYPANNSNNYNYPSEVSSASREAI--DV
A0A140KB14      ----------------------MSNFTGMSNGQTPENLSLNNSY-----TASRESI--DV
K9XX88          ----------------------MSNFTGMSNGQTPENLSLNNSY-----TASRENI--DV
A0A563VSV6      ---------------------------MVNSLTNNGGSQPDNSYPNYGLEESREST--DI
L8LZE9          -------------------------MYPVNNSSSNG------SYTQGNYPESKEKF--EV
A0A433NM31      ------------------------------------------------MQSNKQEE--YI
A0A1Z4NDS1      ---------------------------------------------MDSVTSTTNVE--EI
K9F4D9          ---------------------------------------------MASQDNSVKEI--EI
U9VXM0          ---------------------------------------------MASQENSVKEV--EI
A0A6I5QPI5      --------------------------------------MVAQQANGETRTYTEYIE--EL
A0A433W533      -------------------------------------------MQERLIETSENLD---L
A0A2P8QWJ3      -------------------------------------------MQERLIETSENLD---L
A0A2T1FKP8      -------------------------------------------MQEQLIETSENLD---L
K9U6L7          -------------------------------------------MQEQLIETSENLD---L
A0A1E5QP61      ------------------------------------------------MDSTDYTE--GI
U5DPF5          -------------------------------------------MEAIDRNLRQDDD--FL
A0A3M1PML8      ----------------------------------------------MSLVSQDYSE--EI
A0A3M2GIL5      ------------------------------------------------MENQIYTE--DI
A0A6H1TSJ9      ------------------------------------------------MENQIYTE--DI
A0A0T7BPZ0      ------------------------------------------------MSNPEHIE--EI
A0A352X442      ------------------------------------------------MESTEYIE--EI
A0A6B3NF44      ------------------------------------------------MEALEYSE--EI
A0A0M0SHU3      ----------------------------------------------MKESEFKEVE--EI
A0A1D2PBN3      ------------------------------------------------MESKPNFE--EI
A0A0C2LVR7      ------------------------------------------------MESKPNFE--EI
A0A1Z4PQB9      ------------------------------------------------MESKPNFE--EI
A0A1Z4SFN6      ------------------------------------------------MESKQNLE--EV
K9PGI8          ------------------------------------------------MESIPKFE--EI
A0A2T1E9V8      ---------------------------------------------------MEAPE--NI
A0A3M2GQQ6      -----------------------------------------MQNAIAINPIQDYKN--DT
A0A6H1U2X0      -----------------------------------------MQNAIAINPIQDYKN--DT
K9SGJ5          -------------------------------------------MPEYSLNPGQPEE--SI
A0A6C2DSN4      ----------------------------------------MTAYPKATYVGKYVDD--SF
L8MYT6          ----------------------------------------MTAYPKATYVGKYVDD--SF
A0A352JGJ6      ----------------------------------------MTEYPKATYAGKYVDD--SF
A0A1J5GLS2      ----------------------------------------MTEYPKANYVGKYVDD--SF
A0A2W4W6M5      ----------------------------------------MSEYPKAISTGKYVDD--SF
A0A2W7AN33      ----------------------------------------MPAYPKATYVGKYVDN--SF
A0A256BLV2      ----------------------------------------MTEYPKATYVGKYVDD--SF
A0A2W6ZXF3      ----------------------------------------MTEYPKANYVGRYVDD--SF
A0A2Z5WX66      ----------------------------------------MTEYPKANYAGKYIDD--SF
K9W1T3          ----------------------------------------------------------MD
A0A1Q4RTR1      -----------------------------------------------MSALNTEND--SI
A0A1Z4SQV2      ------------------------------------------------MQVNAEND--SI
A0A2H2XGN1      ------------------------------------------------MQVNAEND--SI
A0A433UXH8      ------------------------------------------------MAVNTEND--SI
A0A1Z4RMB9      -------------------------------MLSNNSNEQNTNSAYPSIAPKRDSL--DV
B4WP72          ------------------------------------------------MRDKEYTE--EI
A0A318B4H2      -------------------MNTNLTYEEAPFDPSAASVVTPVAVDKPAGQRLDERA--VS
B4WQE3          ------------------------------------MSSANPPVLRDIIQEPDQEG--GL
A0A2K3BR24      -----------------------------------------------MPTTTDQED--YI
K9YXY1          ---------------------------------MDHQEQLPASSVNPIPTTTDQED--YI
A0A1U7HGH0      ----------------------------------------------------MEVT--EL
K9XJD3          ----------------------------------------------------MEVT--EL
K9SX01          ------------------------------------------------MNQSPAED--KN
A0A4P7ZT55      -------------------------------------------------MPAVPDG--EI
A0A1E5QIR9      ------------------------------------------------MTHLEDSD--AI
A0A1Z4IBC7      ----------------------------------------------MTMESLRSIE--EV
A0A1W5CPC7      ----------------------------------------------MTMDSLQGFE--EV
A0A5Q0GKD1      ----------------------------------------------MTMDSLQGFE--EV
Q3MDC6          ----------------------------------------------MTMDSLQGFE--EV
A0A1Z4KM73      ----------------------------------------------MTMDSLQGFE--EV
Q8YNX7          ----------------------------------------------MTMDSLQGFE--EV
A0A367R4K6      ----------------------------------------------MTMESLPNVE--EV
A0A1E2WSV8      ----------------------------------------------MTMESLPNFE--EV
A0A2R5FRT9      ----------------------------------------------MTMESLPHVE--EV
A0A2K8T1B6      ----------------------------------------------MTMESLPQFE--EV
A0A235I9I0      ----------------------------------------------MTMESLPNFE--EV
A0A2D0HQT8      ----------------------------------------------MTMESLPNFE--EV
A0A2L2NU95      ----------------------------------------------MTMESLPSFE--EV
A0A367S084      ----------------------------------------------MTMESLPNFE--EV
A0A0V7ZFJ4      -----------------------------------------MTHNSFDFNQEDDD---FI
A0A367RIS1      ----------------------------------------------MPSHQDDQD---LI
A0A235IXQ2      ----------------------------------------------MLSDQNNQD---LI
A0A1W5CNX3      ----------------------------------------------MPSHQDDQD---LI
A0A5Q0GJJ5      ----------------------------------------------MPSHQDDQD---LI
Q3MEB7          ----------------------------------------------MPSHQDDQD---LI
A0A1Z4KHN9      ----------------------------------------------MPSQQDDQD---LI
Q8YT70          ----------------------------------------------MPSQQDDQD---LI
A0A218Q4C1      ----------------------------------------------MPSYQEDQD---EI
A0A166IWU6      ----------------------------------------------MPSYQEDQD---EI
A0A2S0Q8C0      ----------------------------------------------MPSYQEDQD---EI
W6FSX4          ----------------------------------------------MPSYQEDQD---EI
A0A0V7ZNJ9      ------------------------------------------MTSSPQVEREDTD---YI
A0A0R0M9H9      ----------------------------------------------MAINQEETD---VI
A0A1S1ZVW2      ----------------------------------------------MPINQETTD---VI
A0A1B7WX82      ----------------------------------------------MSINQEDQDS--SI
A0A1B7WTD1      ----------------------------------------------MSINQEDQD---SI
A0A480ABC0      ----------------------------------------------MSINQEDQD---SI
A0A1Z4LRU5      ------------------------------------------MTNEMQVNQEEQD---YI
A0A1Z4JVB4      ----------------------------------------------MPTKQEDRD---SI
K9PIA4          ----------------------------------------------MPTKQEDRD---TI
A0A1Z4HVE1      ----------------------------------------------MPTKQEERE---VI
A0A252ECZ1      ----------------------------------------------MPTKRDDRD---LI
A0A1Z4G5Y1      ----------------------------------------------MPTKRDDRD---LI
A0A252DNA2      ----------------------------------------------MPTKRDDRD---LI
A0A252E1Q4      ----------------------------------------------MPTKRDDRD---LI
A0A6G9SK36      ----------------------------------------------MPTKQEERD---VI
A0A1Z4M597      ----------------------------------------------MPTKQEERE---VI
A0A1Z4MWT1      ----------------------------------------------MPTKQEERE---VI
A0A1Z4TX53      ----------------------------------------------MPTKQEERE---VI
A0A5P8VSD1      ----------------------------------------------MPSHQDEQDL---I
A0A2A2TNQ5      ----------------------------------------------MPSHEEDTDY---I
A0A3S1C4K5      ----------------------------------------------MPSNQEDQNE---V
A0A1X4G3D5      -------------------------------------------MPINQVNQEESDV---I
D4TNI2          -------------------------------------------MPINQVNQEESDV---I
A0A1Z4H6Z8      -----------------MNVIGAIILFVGTEGSDSPNYIWYFGTLFMPTKQDDRDL---I
A0A1Z4NPM1      ----------------------------------------------MASEYEEQDY---I
A0A3F3KPR9      -----------------------------MLIFCVMVEPVIATGVYMPINKKETDV---I
D4TGN7          -----------------------------MLIFCVMVEPVIATGVYMPINKKETDV---I
A0A1Z4UZW9      ----------------------------------------------MSINQEDQDS--SI
A0A0K2M5H0      ----------------------------------------------MSINQEDQDS--PI
A0A1B7VSH4      ----------------------------------------------MSINQETQDS--SV
A0A1B7W126      ----------------------------------------------MSINQETQDS--SV
A0A3D4C6Q6      ----------------------------------------------MSINQETQDS--SV
A0A1B7UVJ4      ----------------------------------------------MSINQEDQDS--SI
A0A1B7UTR1      ----------------------------------------------MSINQEDQDS--SL
K7W0A4          ----------------------------------------------MSINQEDQDS--SF
A0A5C0DRW9      ----------------------------------------------MSINQEDQDS--SF
A0A6H2C088      ----------------------------------------------MSINQEDQDS--SL
A0A2T1CIL7      --------------------------------------------MIPTIVPSTHEE--QI
A0A433V7A0      ----------------------------------------MKYPKHTTTIDSREPE--EI
A0A2T1FTR8      ----------------------------------------------------------MD
K9UA41          ----------------------------------------------------------MD
A0A0C2LBE2      ---------------------------------------------MSAMEPVPNSE--EI
A0A433NN38      ---------------------------------------------MDSIKHTHSLE--EI
A0A2N6K0T2      -----------------------------------------------MKESEFHVE--EI
A0A2N6ML72      -----------------------------------------------MKESEFHVE--EI
G6FQZ6          -----------------------------------------------MKESEFHVE--EI
A0A2N6MQX9      -----------------------------------------------MKESEFHVE--EI
A0A2N6KXT6      -----------------------------------------------MKESEFHVE--EI
A0A2N6KGB9      -----------------------------------------------MKESEFHVE--EI
A0A2N6L3Y5      -----------------------------------------------MKESEFHVE--EI
A0A0S3TIS7      -----------------------------------------------MKESEFHVE--EI
A0A1U7GW28      -----------------------------------------------MKESEFHVE--EI
A0A2N6LW63      -----------------------------------------------MKESEFHVE--EI
A0A328IH74      -----------------------------------------------MKESEFKVE--EI
A0A4D9CIB0      -----------------------------------------------MKESEFKVE--EI
A0A1Z4TQ63      -----------------------------------------------MKESEYQLE--EI
A0A4Q9J8G2      -----------------------------------------------MKESEYQLE--EI
A0A1Z4SMD6      -------------------------------------------------MNQGFIE--EI
A0A2H2Y096      -------------------------------------------------MNQGFIE--EI
K9S8M8          -----------------------------------------------MEFQHYPEE---I
A0A1Z4NFV0      -----------------------------------------------MENPSYLEE---I
B0CAX4          ----------------------------------------------MPMSNEYSHE--SI
A0A350Y0P6      -----------------------------------------------MESKQYVED---I
A0A352X940      -----------------------------------------------MESKQYVED---I
B8HTN4          -------------------------------------------------MQALEDD--RI
A0A2A2TPF8      -----------------------------------------------MEKQSNS-D--DL
A0A1Z4R0P8      -----------------------------------------------MEKQSYP-D--EL
A0A0T7BUI3      -----------------------------------------------MEKQKAL-E--EL
A0A1Z4LP32      -----------------------------------------------MQNKKNN-Q--EV
K9REP9          -----------------------------------------------MKNKNNA-Q--EI
A0A1Z4SIJ3      -----------------------------------------------MENEGYPLQ--EA
A0A2H2XPG4      -----------------------------------------------MENEGYPLQ--EA
K9V3C7          --------------------------------------MLINQEKPDMKPQHYT-E--EI
A0A1Z4T6Y7      ----------------------------------------------MEQQNNRS-E--DI
A0A2H2Y561      ----------------------------------------------MEQQNNRS-E--DI
A0A1Q4S362      ----------------------------------------------MEQQHNRS-E--DI
A0A3S1CIN8      ----------------------------------------------MEQQHNRS-E--DI
A0A2A2TC28      -----------------------------------------------METKGYL-E--EI
A0A0C1NCB0      ----------------------------------------------MEETKGHQ-E--EI
A0A2N6K7Q9      -----------------------------------------------METNSYT-Q--EA
A0A2N6MXH6      -----------------------------------------------METNSYT-Q--AT
A0A2N6M5A8      -----------------------------------------------MENNSYT-Q--AT
A0A2N6LL61      -----------------------------------------------METNSYT-Q--AT
A0A0S3TP66      -----------------------------------------------METNSYT-Q--AT
G6FP91          -----------------------------------------------MENNSYT-Q--AT
A0A1U7GYR5      -----------------------------------------------METNSYT-Q--AT
A0A2N6KY52      -----------------------------------------------METNSYT-Q--AT
A0A2N6KMP5      -----------------------------------------------METNSYT-Q--AT
A0A2N6MA45      -----------------------------------------------METNSYT-Q--AT
A0A4Q9J9V9      -----------------------------------------------METNSYT-Q--ET
A0A328IGA1      -----------------------------------------------METNSYT-Q--ET
A0A4D9CE41      -----------------------------------------------METNSYT-Q--ET
A0A0M0SFT2      -----------------------------------------------METNNYT-Q--ET
A0A1Z4TLC8      -----------------------------------------------METNSYT-Q--ET
A0A0C2LFH0      -----------------------------------------------METRGYQ-E--EV
A0A1Z4IYV4      -----------------------------------------------METKGYQ-E--EV
A0A1Z4Q0T6      -----------------------------------------------METKGYQ-E--EI
A0A0C2PT44      -----------------------------------------------METKGYQ-E--EI
A0A1D2P6J4      -----------------------------------------------METKGYQ-E--EV
A0A3M9ZEU1      -----------------------------------------------MHPKDHLEE---V
A0A1Z4JK72      ------------------------------------------MTSMKMETKQYSED---F
A0A0N7Z489      ------------------------------------------MTSMNIETKRYSED---F
A0A0S3TXS2      ------------------------------------------MTSMNIETKRYSED---F
A0A1Z4RN12      -----------------------------------------------MDSNLHLEE--YI
A0A2T1CMF9      -----------------------------------------------MDSNLPIGE--HI
Q7NDC5          -----------------------------------------------------------M
U5QGK3          -----------------------------------------------------------M
A0A2W4UY24      ------------------------------------------------MPQKELE----I
A0A2T1GMT4      -----------------------------------------------MESQESID----L
K9UI51          -----------------------------------------------MESQESID----L
K9QM62          ------------------------------------MKAKTLEVDSTIKSREAID----L
A0A1Z4FWI3      -----------------------------------------------MESRESID----L
A0A1Z4JYE7      -----------------------------------------------MESRESID----L
A0A2T1FXY4      -----------------------------------------------MESRESID----L
K9TYI2          -----------------------------------------------MESRESID----L
A0A1Z4QL41      -----------------------------------------------MESREAVD----L
A0A252D4T4      -----------------------------------------------MESRESID----F
A0A252DJH5      -----------------------------------------------MESRESID----F
A0A252EB80      -----------------------------------------------MESRESID----F
A0A6G9SKZ9      -----------------------------------------------MESRESID----F
A0A1Z4HPW5      -----------------------------------------------MESRESID----F
A0A1Z4MSN1      -----------------------------------------------MESRESID----F
A0A1Z4U1C2      -----------------------------------------------MESRESID----F
A0A0D6KV51      ------------------------------------------------------------
A0A1Z4MKF8      -----------------------------------------------MESRESID----F
A0A2C6WC43      -----------------------------------------------MESRETLD----L
A0A1Z4L5A1      -----------------------------------------------MESRETID----L
A0A367QD86      -----------------------------------------------MESRETID----L
A0A235IZ96      -----------------------------------------------MESRESID----L
A0A2L2NGP0      -----------------------------------------------MESRESID----L
A0A2K8SM78      ------------------------------------------------------------
A0A2R5FPC0      -----------------------------------------------MESRESID----L
A0A5P8W5T6      -----------------------------------------------MESRESID----L
A0A140KBA0      -----------------------------------------------MESNLYIDE--YL
K9XSG1          -----------------------------------------------MESNLYTDE--YL
A0A0F5YE28      -----------------------------------------------MEDRESID----L
U7QEH7          -----------------------------------------------MEDRESID----L
A0A3S1ATK5      ------------------------------------------MSKTPMESREDID----L
A0A2Z6CPH0      ------------------------------------------MAKNIMESRESLD----L
A0A1Z4GT50      -----------------------------------------------MESRESID----L
A0A1Z4GIX0      ------------------------------------------MSKNSMESRETID----L
A0A2H6LC24      ------------------------------------------MSKNSMESRETID----L
B2J6N5          ------------------------------------------MSAKSTESRESID----L
A0A367RMI4      ------------------------------------------MSEKSMESRESID----L
A0A235HUM0      ------------------------------------------MSEKSMESRESID----L
A0A2L2NW47      ------------------------------------------MSEKSMESRESID----L
A0A1E2WUR1      ------------------------------------------MSEKSMESRESID----L
A0A235IKU3      ------------------------------------------MSEKSMESRESID----L
F4XKF3          -------------------MAGLVANSHQYQKLFYCAIYLGGAPEELMESRSSID----L
A0A1D9FX10      -----------------------------------------------MESRSSID----L
A0A1D8TNX9      -----------------------------------------------MESRSSID----L
A0A1U7MYU6      -----------------------------------------------MESRSSID----L
A0A3C0NJ41      -----------------------------------------------MESRESLD----L
A0A352AG88      -----------------------------------------------MDSAESLD----L
A0A350Y374      -----------------------------------------------MQSTDSPD----L
A0A355DPX0      -----------------------------------------------MQSTDSPD----L
A0A0D8ZUV2      --------------------------------------------------MEFID----A
A0A433VDI0      ----------------------------------------MEPTKPIVEYSESIN----I
A0A3D1PG43      -----------------------------------------------MESREAID----I
A0A2P8QQ72      -------------------------------------------MESRVESREAVD----I
K9TZQ7          -------------------------------------------MESRVESREAVD----I
A0A2G7GPR0      -----------------------------------------------MESNETID----I
K9XH68          -----------------------------------------------MESNETID----I
A0A1U7HW70      -----------------------------------------------MQSNDTID----I
A0A2S6VEJ8      -----------------------------------------------MESNETID----I
                                                                            

K9SLA9          KLNRGWV------ALRQH---KFPALVAFGIIFGGAALVTV--RI----Q---PIYEAKG
A0A168TT23      DLLEIWR------TILKRKWVVVSILAVFIATAALSSWLTI------------PVYRATA
A0A0M1JWX9      DLGQLFA------VIRRR---AFVILGVAIAVTGAVWVWTD--NQ----T---PQYEGKF
A0A2T1M1V6      -MNHALS------VVRRH---WPPLLALNLLLIAATVYVIT--NIEKFVS---PTWKANA
A0A2G7GCS2      -MNHIVN------IIRRH---WMPLLLLNGVILAGTLYAVI--YTKTNVA---PVWKASA
K9XBH8          -MNHIVN------IIRRH---WMPLLLLNGVVLAATLYAVI--YSKTSVP---PVWKANA
A0A1Z4LJ30      -MNRIAK------IAIRH---WKLLLAWNILILGITAINIK--VA----P---RVWSSQA
K9RI76          -MSRIAT------IAIRH---WKLLLAWNILLIGITAINIK--LT----P---RVWEGKA
A0A352AE27      MLARIAT------ITARH---WKFLLALNVLVLAAAASNYV--TS----P---KVWTAKA
A0A3B8JH60      -MGKIAA------IASRH---WKSLLVLNLLVLAATAGKLA--TS----P---KVWTANA
A0A3C0N766      -MGKIAA------IASRH---WKSLLVLNLLVLAATAGKLA--TS----P---KVWTANA
K9W9J7          -MGKVAA------IATRH---WKSLFILNLLVIAATAGKLA--TS----P---KVWTATA
A0A139WSU3      -MNKLVT------ISTKH---WKSLIAFNVLVVLATAVAVS--NA----K---PVWIAKT
A0A433VN22      -----MT------IAARH---WKSLLVLNALVVSATIAAYS--TS----K---PVWTTTA
Q7NF11          --MHVIQ------VLKRH---WRPLLVLNGLVLAATIGVAC--YY----P---RTWTATT
A0A1Z4JCS8      -MKKIAL------IASRH---WKALLGLNAVVIFGTLGAML--TT----P---KVWTAQA
F4XTX2          -MKKVVA------ILNRH---WILLLVFNSLVLAASFGAFS--LL----K---PFWIAKA
Q7NJN6          -MSSIVA------IGRRH---WRPLLALNTVLLAATVGIAV--FY----P---RTWTASA
U5QCC3          --MSTLA------IARRH---LRPLLILNGAILTTAIGIAL--FF----P---KSWTATT
A0A3S0Y9N9      YLQYWL-------IFKRR---WLPVSIVFFTVVALSIVKTL--LE----T---PIYQATA
A0A433UNK7      YLRYWS-------ILKRR---WLPTSIVFLSLLALSIVKTV--LE----T---PIYQAGG
A0A3M1SVZ4      GGESTIQLDRAFPIVKRR---WLPASVVFAAIFTVFYIAAQ--KD----R---PVYIAEG
A0A654SFI6      GLHIDLARYWIEARALRF---WIAAIIALALIAGLVVTLL----S----T---PLYRAGA
K9SSQ0          VFSPLLSTFLVRRLVRKH---LVTVISTTALTLGGAAIYTF--NQ----P---FLYESKG
A0A2W1JIN9      SLSRLPL------VFSRH---RWSALAAFSAVMCGLCLYVV--FA----P---RLYTSKV
A0A318AJV1      AVAAAKR------MLRRR---WATMLGVSSVVFVVALSVVA--CL----P---PRYVAVA
A0A6B3MUB5      SLSSLVS------VLKRR---FWPALATFASVIGASIAYLV--YT----S---PVYEVKA
A0A1U7N2U4      SLSSLPL------ALRRR---LLAALATFTSVIGGGMAYLV--VT----P---PVYQVKA
A0A1D9G1F2      SLSSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKA
F4XV38          SLSSLPL------ALKRR---LLPALVTFTSVIGGAIAYLV--VT----P---PVYQVKA
A0A2P8QIL5      KYALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEA
A0A2T1FLY5      KYALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEA
A0A433W447      KYALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEA
K9U1K8          KYALLPT------IFYRR---RLPALATFISVMLGALVYLI--FA----P---RTYEAEA
K9UYB2          SISSVFT------ILKRR---SFPALLMFAAVLGGAYAYIS--TA----P---KMYESAI
A0A218QN17      GISSLLA------ILKRR---ALPALVTFTAVIGGAVAYLT--VT----P---RLYEASA
K9RKN2          GISSLLT------IVMRR---SLPALATFVAVMGGAFAYLS--IT----P---RVYETSA
A0A2I8ADV2      GISTLFA------VLRRR---GLPAVSTLAAVIGASVAYLA--IT----P---RFYATSA
A0A1W5CKM3      GISTLLG------VLGRR---GFPAVTVFASVIGASFAYLA--VT----P---RLYETSA
A0A5Q0GMF5      GISTLLG------VLGRR---GFPAVTVFASVIGASFAYLA--VT----P---RLYETSA
Q3MEW0          GISTLLG------VLGRR---GFPAVTVFASVIGASFAYLA--VT----P---RLYETSA
A0A1Z4KIC7      GISTLLG------VLGRR---GFPAVTVFAAVIGASFAYLA--VT----P---RLYETSA
Q8YSM5          GISTLLG------VLGRR---GFPAVTVFAAVIGASFAYLA--VT----P---RLYETSA
A0A1Q4S1H4      GVSSLWT------VAKRR---SLPAFLTLSAVIAGAVTYLA--VA----P---RMYETSS
A0A433VBU6      GVSSLWA------VVRRR---SLPAFLTLSAVMAGAVTYLA--VA----P---RMYETSS
A0A1Q4RZJ6      GFWSVLS------VLKRR---GLPALITFTAVIGGAVAYLK--VT----P---RLYESSS
A0A1Z4SNV3      GFWSVLA------VIKRR---GLPALITFTAVISGAVAYLK--VT----P---RLYETSA
A0A2H2XJQ1      GFWSVLA------VIKRR---GLPALITFTAVISGAVAYLK--VT----P---RLYETSA
A0A3S5K358      GFWSVLS------VLKRR---GLPALITFTAVIGGAVAYLK--VT----P---RLYESSS
A0A0T7BPJ4      GISSLVA------VLKRR---GLPAAAAFVAVMGAAGAYLL--LS----P---KLYEASA
A0A0C1QS61      SVSSVLG------VLKRR---SLPAVAAFVATIGGAIAYLA--VT----P---SQYEASA
A0A139X3R8      SVSSVLS------VLKRR---SLPAVAAFVAAIGGAIAYLA--VT----P---SQYEASA
A0A1Z4I7C5      GISTLLA------VLGRR---GFPAITVFAAVIGTSFAYLQ--VT----P---RLYESSA
A0A0C2MDK7      GISSVLA------VLRRR---SLPAVAAFVAVMGGAIAYLA--VT----P---SKYEAYA
A0A1Y0RCK1      RISNVLA------VLKRR---SAPAIAAFAAVIGGAIAYLA--VT----P---SKYEAYA
A0A1Z4PWZ0      GISSVIG------VLRRR---SLPAIAAFVAVIGGAMAYLT--VT----P---SKYAASA
A0A0C2QLT0      GISSVIG------VLRRR---SLPAIAAFVAVIGGAIAYLA--VT----P---SKYEAYA
A0A1Z4J2K1      GISSVIA------VLRRR---SLPAIAAFVAVIGGAIAYLA--VT----P---SKYEASA
A0A3S0ZSX0      GFSSLLL------IFKRR---AFPALATFAAVIGGAIAYLQ--VT----P---HRYQTSA
A0A2N6K4T3      GLSSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--MT----P---RQYQTST
A0A370CKT2      GLSSLPS------ILKRR---ALPALVTFAAVISGAIAYLQ--IT----P---RQYQTST
A0A0S3TL97      GLSSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---HQYQTST
A0A2N6M8A0      GLSSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---HQYQTST
A0A2N6M9E1      GLSSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---RQYQTST
A0A2N6KJI4      GLSSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---RQYQTST
A0A2N6MZ77      GLSSLPS------ILKRR---ALPALVTFAAVIGGAIAYLQ--IT----P---RQYQTST
A0A2N6KT20      GLSSLPS------ILKRR---ALPALVTFAAVISGAIAYLQ--IT----P---RQYQTST
G6FSN3          GLSSLPS------ILKRR---ALPALVTFAAVISGAIAYLQ--IT----P---RQYQTST
A0A4D9CI02      GLSSLPF------ILKRR---ALPALVTFAAVIGGAIAYLL--IT----P---RLYEIST
A0A328I8B9      ----------------------LPALVTFAAVIGGAIAYLI--IT----P---RLYEIST
A0A4Q9J4Z7      GLSSLPF------ILKRR---ALPALVTFAAVIGGAIAYLI--IT----P---RLYEIST
A0A0M0SU69      GLSSLPF------ILKRR---ALPALATFIAVIGGAIIYLQ--IT----P---RLYETST
A0A1Z4TIZ8      GLSSLLF------ILKRR---TLPALATFAAVIGGAIAYLQ--IT----P---RLYETST
A0A0S3TYD7      DLRKTFM------MLTRY---WLPATLAFSLVTVPAAVFLM--TR----K---SSYQATG
A0A3C0N2P0      DLRRLLA------VARRR---IILVAGVAIAVTSGVAAKVL--RQ----V---PIYEGSF
K9TLQ0          NLRHLLS------VARRR---IFVFAGVSIAVACGVLVKVL--TQ----T---PIYEGNF
A0A6B3M6M6      DLSRIIS------LVRRR---VLVIAGVAIAISSGIIAKTL--GK----T---PQYQGKF
A0A6B3NIJ0      DLSQILS------LVRRR---MVVIAGVAIAISSGIIAKTL--GK----T---PQYQGKF
A0A352XE00      DMRQIIA------IARRR---FILTAGVAVAVTSGVATRVL--QQ----V---PKYEGKF
B4VS56          DLRQILA------VARRR---ALVVAGMAIAVTSGIVTKVL--QQ----T---PNYEGKF
A0A352AAQ3      DLGQILG------VVRRR---FIVIAGVAIAVTSGIVARVL--KQ----T---PNYEGKF
A0A350Y472      DLRQILA------VAQRR---AIIIAGVAIAVSGGIVSQVL--KQ----E---PNYEGKF
A0A355DVB4      DLRQILA------VAQRR---AIIIAGVAIAVSGGIVSQVL--KQ----E---PNYEGKF
U5QL42          NLLSIWR------TLRKR---KLLSLSVAVAVFGGVAAFTY--TR----P---YIYESET
K9QF04          ELHQLGA------IARRR---LVVFIAVSGVIIAGVICKQW--LQ----K---PIYKQQF
A0A076HBF2      DLRELWR------ALQRR---KKLVGVTAGSIIVLAALFTT--YQ----RLFRPVYEGSF
A0A354B169      DLRELWL------ALRRR---RKLVTVTASTVLALTVMVTA--YQ----RIFTPVYLGSF
G4FMX5          DLRDLWR------ALKRR---KKLVGVTAAGVISLTCVSTA--YQ----RIFRPVYQGSF
Q0IDT5          DLRELWR------ALKRR---KKIVGFTAAAVLVLSGVVTT--YQ----RLFMPVYEGSF
A0A2D6FCW3      DXRELWR------ALRRR---KNLVGVTAAGVLALSGLNTA--YQ----RIFRPVYQGSF
A3ZA21          DLRELWR------ALKRR---KKLVGVTAAAVVALAGMVTA--YQ----RIFRPVYQGSF
A0A140K3H3      SLTELKQ------TLSRQ---WKPALLVASTVCAGIFLSTV--LQ----N---PKYQSQT
K9XUB8          SLTELKQ------TLSRQ---WKPALLVASTVCIGMFLSTV--LQ----T---PKYRSQT
Q7NEU3          DWQTYAR------TIWRR---RYAFIGVFVATFSLAAAYTF--LS----N---PVYEGEM
A0A6H2NHD5      DLGHLVG------VLKRR---AITFLGVTLLSLGGLTLWHL--TR----P---AVYSGGF
A0A2P8W4F7      DLKRLLG------VFKRR---AGVFLGVAALSFGGLTLWHL--SQ----P---PAYSGSV
A0A5Q4E0Z4      DLGHLIG------VLKRR---VGVFVGVAALSFGGLTLWHL--SR----P---PVYSGTA
A0A2P8VVX1      GYGQLFQ------ILLRR---WPWIIASLGVATAGAVFVSL--RQ----E---PIYRSNM
A0A2P8WHY0      GYGQLLG------ILLRR---WPWIAGTLVLSVAGAVLVFL--RE----D---PTYRSSM
A0A2T1CMT9      GYGELFS------KLWHR---RLWFIGAFTGVLAIAVPLAL--LK----P---AVYQSYM
A0A563VQJ3      DLGQYLL------KLKRR---WKPAILVFLATLGGSVFLSL--FL----Q---NSYQAAG
A0A1D8TX52      GYGQLLA------VLWRR---RLWIISVLLTSLPIAFYLTI--KK----E---PNYISSL
A0A1D9G4T2      GYGQLLA------VLWRR---RLWIISVLLTSLPIAFYITL--KK----E---PNYISSL
F4XP71          GYGQLLA------VLWRR---RLWIISVLLTSLPIAFYITL--KK----E---PNYISSL
A0A1U7N5X9      GYGQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PNYISSL
A0A6B3N2I8      GYGQLLA------VLWRR---RLWIISVLLTSLPIAFYLTL--KK----E---PTYISSL
A0A2W6ZAV2      KLGNLLP------ILRRR---QRLLVAVFAATVAIGAAATL--FQ----RVVSPVYQGDF
A0A2G7GMH8      GYGQLLS------VLMRR---RFLLLSVFFGILSMATVLTI--IT----K---PTYKSSM
K9W742          GYGQLFA------ILIRR---RLWLLGILCLALGIATFKAF--TT----K---STYVSSL
A0A2T1DWE8      GYGQLVA------ALFRR---KLWLLGIFLTVLSAVTIYTL--LK----K---PIYQSSM
A0A1U7I8L3      GYGQLLA------ILLRR---RYWLLGIFSVVLAITAIVTI--TT----K---PTYKSSM
A0A2T1DJL8      GYGQLLS------VLMRR---RLWLIGGLGLSLIGAALFTL--FS----K---PTFRSSM
A0A1Z4J9W0      GYGQLFG------VLLRR---KLWFLGALAGTLALAAGVTA--VL----P---PTYRSTM
A0A0N7Z5K9      GYGQLFG------VLMRR---KIWFLGAVAGTIALAAAVTA--FM----P---PTYRSTM
A0A0S3TXC5      GYGQLFG------VLMRR---KIWFLGALAGTIALAAGVTA--FM----P---PTYRSTM
K9SA61          GYGQIFA------VLARR---RLWLLGVFGSVVAAAAGLTF--LT----T---PVYQSSL
A0A3D1PBA3      GYGQLFS------VLMRR---RFWLLGVLGSVLTIATVFTL--IS----K---PTYQSTM
K9XPB0          GYGQLLG------ILWRR---RFWIGGVFLGVLAVAIPLAL--MK----Q---PLYMSQM
A0A350Y7Z1      GYGQLFS------ILLRR---RFWMLGVFCGVLAIAIPIAL--NK----E---PTYQSSM
A0A352X2A7      GYGQLFA------ILLRR---KFWLLGVFCSVLAIAIPIAL--KK----E---PTYQSSI
A0A0D8ZYV0      GYGQLFA------VLSRR---RYWLLGVLGGVLTIATALTL--TA----E---PTFQSTM
A0A2T1FP73      GYGQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEM
A0A433VMS2      GYGQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEM
K9TYA7          GYGQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEM
A0A2P8QUE1      GYGQLLA------VLMRR---RYWLLGVMGAVLTIATVFTL--IS----K---PTYQSEM
A0A2T1DNG3      GYGQLFA------ILKRH---YLWVLAAGTVSVAIAFAYTL--KQ----E---STYISGM
B8HNB0          DKVELLR------TLKKR---WIPALATAVTVFAGCYIYSA--LQ----T---PLYRSEA
A0A1Z4LN32      DVQKYLL------VLKRR---WLIASVVFAGFASFGVLHWV--SQ----K---PAYQATG
A0A2I8A9F5      DIQKYLL------VLKRR---WLVIAGVFVLFATLGGTLAL--KQ----P---KSYEATG
A0A218Q6R8      DIQKYWL------VLKRR---WLIIAAVSTACAALGGVNFF--IQ----P---TTYQASG
A0A218QGE0      DVQKYLL------VLKRR---WLIASGVFAVFATLGGINFV--IQ----P---PVYEASG
A0A563VS48      DFQKYWL------VLKRR---WLPATLTLCGVLGISLGYAL--SQ----E---QIYEAEA
A0A318BJ18      VLRHYLR------IAMRW---RWVILGVTIACVLLGLVVTL--LM----T---PTYTATA
A0A3B8Y8H9      SVSQIVP------WLRRR---FWLIGSISLAVSLSAVSYAF--TR----A---PVYEESF
A0A2W1JVB9      DLGKYWL------ILKRR---WLPATIIFLLMFSTATLAAF--LK----A---PIYQSQG
A0A6H1U102      DLSEVLR------ILRKR---AGSAAAIATAVFAGVGLSTA--TK----T---PEYQSET
A0A563VLD6      SLSELKQ------IIFRR---WKPALIVGTTVFAGIFIPTM--LQ----T---PKYQSET
A0A2P8W9H0      RLDRFVA------ALRRH---LLLIAGITTLTASAAVLKAI--TD----A---PTYQSSF
A0A6I5P386      RIDYLLS------SLKRH---FLLITGVTVLTTALAVTKAV--TD----E---PVYQAEF
A0A318BG22      SLQRYVA------TLTKH---RLLILGTTIAAALLALIVTM--LT----E---PRYVART
A0A1Z3HMQ0      DLQRYWL------VLKRR---WLPASLVFAACVVAAALVGL--SQ----K---DTYQASG
K1XF69          DLGRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSG
B5W297          DLGRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSG
A0A6H2AL05      DLGRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSG
H1W7M8          DLGRYLQ------TLKRR---WFWLLGVFVLSVSGAVYATQ--FL----T---PTYENSG
A0A5Q4H6A5      DLGRYLQ------TLKRR---WFWLLGVFVLTVSGAVYATQ--FL----S---PTYQNSG
D5A466          DLGRYLQ------TLKRR---WFWLLGVFVLTVSGAVYATQ--FL----S---PTYQNSG
U5QJM6          -------------------------MMTMAATFTLAVAYTF--LS----Q---PVYKSEM
A0A1Z4RPC6      NIGNYLQ------KLKRR---WIPALAVFIVTVGTTAFLSG--FL----E---KNYKSEG
A0A2T1CMZ0      NIEEYLL------KLKRR---WLPALSVFVVTVGTTLFLTS--FL----E---KTYKSEG
L8M4F7          DIGEYLL------KLKRR---WKIASALFLLTVGAAGLLST--KL----S---TKYEAEG
A0A140K2P2      NISQYLI------KLRRR---WKLALAVFLLTAGITTALSL--LL----Q---KTYQAQG
K9XWX4          NISGYLI------KLRRR---WKLALAVFLLTAGVTTALSL--LL----Q---KTYQAQG
A0A140KB14      NLYNYLQ------KLSRR---WKPALAVFLLTVGSMAALST--LL----K---KSYQAEG
K9XX88          NLYNYLQ------KLRRR---WKPALAVFLLTVGSVAALST--LL----K---KSYQAEG
A0A563VSV6      EIASYFQ------KLKRR---WKPALAVFLLTVVSTFAATS--LL----E---EKYQAEG
L8LZE9          EILSYLQ------KIQRR---WKPALAVFLLTAGSIGLASV--FL----T---TKYQAGG
A0A433NM31      DLRQYWL------ILKRR---WLPASAVFGFVLLLTALVTF--LQ----K---PVYQAQG
A0A1Z4NDS1      DLQKYVQ------VLQRR---WLPGLAIFGTCVTLATIYAF--SL----Q---PSYKAEG
K9F4D9          DLQKYWR------VLKRR---WLIALTVFGLTTTAAVGVGI--TQ----K---PEYQAES
U9VXM0          DLQKYWR------VLKRR---WLIALTIFGLTTTAAVGVGI--TQ----K---PEYEAEA
A0A6I5QPI5      DFQKYWL------VLKRR---WIPAFAVFSTTVALSVFAAL--SE----E---SVYKAEG
A0A433W533      DFSKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATG
A0A2P8QWJ3      DFSKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATG
A0A2T1FKP8      DFSKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATG
K9U6L7          DFSKLWI------ILKRR---WLPGTGVFTAILGLAIIAVC--LQ----K---PVYEATG
A0A1E5QP61      DFQKYWL------VLKRH---WLPASSVFALIVTLATYKAA--TA----D---PVYEAQG
U5DPF5          DLQKYWS------ILKRR---WLPASLVTISTIGLTGIYSA--RQ----T---PIYEARA
A0A3M1PML8      DFQKYWN------VLKRR---WLPATSVFLTLTLLSAAVAI--RQ----K---SSYQAET
A0A3M2GIL5      DFQKYWL------VLKRH---WLPSSCVFLLIFALAFAFAY--TR----K---PTYEASG
A0A6H1TSJ9      DFQKYWL------VLKRH---WLPSSCVFLLIFALAFAFAY--TR----K---PTYEASG
A0A0T7BPZ0      DLTKYWL------ILQRR---WLPTLGIVGIALTMAFGYVL--SI----K---PTYKAQG
A0A352X442      DFQKYWL------VLKRR---WLPAVGVFGGIVAVAGLAVI--RQ----V---PSYQAQG
A0A6B3NF44      DFQKYWL------VLKRR---WLPATGVVAMTVALSALAVS--RQ----K---DSYKAEG
A0A0M0SHU3      DFQKYLL------VLQRR---WMTAVGIFGAVVTLALLYAF--SL----K---PTYTAQA
A0A1D2PBN3      DFQKYLL------VLQRR---WVSAVGVFGVVVTVASLYAF--SL----K---PTYNAEG
A0A0C2LVR7      DFQKYLL------VLQRR---WVPAVGVFGAVVTLVSLYAF--SL----K---PTYNAEG
A0A1Z4PQB9      DFQKYLL------VLQRR---WVPAVGVFGVAVTLVSLYAF--SL----K---PTYKAEG
A0A1Z4SFN6      DFQSYLL------VVQRR---WLAAVSVFGVVVALASLQAF--SS----K---PSYEAQG
K9PGI8          DFQKYLL------ILQRR---WIPAAGVFGVVVTLAFLYAV--SL----K---PAYKAEG
A0A2T1E9V8      QFYNYWC------IFKRH---WLPALAIFSTITGGSYLYTS--AK----T---PIYSAQG
A0A3M2GQQ6      DFVELGR------TLVKR---WSIIAIVMTSVFATVAVSTL--RT----T---PQYRSET
A0A6H1U2X0      DFVELGR------TLVKR---WSIIAIVMTSVFATVAVSTL--RT----T---PQYRSET
K9SGJ5          DLSRFLR------TLRKR---WLVVASISATLFATVAAYTY--IK----E---PVYQSET
A0A6C2DSN4      KLAKFLR------VLRKR---WIVIVAVSVTVFAGNTYYTI--TR----I---PQYRSSA
L8MYT6          KLAKFLR------VLRKR---WIVIVAVSVTVFAGNTYYTI--TR----I---PQYRSSA
A0A352JGJ6      KLAKFFR------VLRKR---WIVIVAVSASVFVGNAYYTF--TR----T---PQYRSSA
A0A1J5GLS2      KLAKFFR------ILRKR---WIVIVAVSASVFAGTTYYTF--TR----V---PQYKAGA
A0A2W4W6M5      KLAKFFR------VLRKR---WIVVAAVSVTVFAGNAYYTF--SR----T---PQYRSNA
A0A2W7AN33      KFAKVLR------VFRDR---WTVIATVSVTMLAGSALYTF--TR----T---PQYRSIA
A0A256BLV2      KLAKFFR------VLRKR---WIVIVAVSVSVFAGNTYYTF--TR----T---PQYRSSA
A0A2W6ZXF3      KLAKFFR------VLRKR---WIVIVAVSASVFAGTTYYTF--TR----T---PQYKAGA
A0A2Z5WX66      KLAKFFR------VLRKR---WMVIVAVSVTVFAGNTYYTF--TR----T---PQYRSNA
K9W1T3          EFTQYWF------IFKRR---WLPASLVFTLVLGVTALVTF--QQ----K---PIYQAQG
A0A1Q4RTR1      NFRQAWR------ILKRR---WLAVTIVISSAIGVTGAITF--SQ----T---PIYEAEG
A0A1Z4SQV2      NFRQAWR------IMKRR---WLAVTVVLSSVVGITGAVTF--SQ----T---PIYEAEG
A0A2H2XGN1      NFRQAWR------IMKRR---WLAVTVVLSSVVGITGAVTF--SQ----T---PIYEAEG
A0A433UXH8      NFRQAWR------IMKRR---WLAVTIVLSSVVGITGAVTF--SQ----T---PIYEAEG
A0A1Z4RMB9      NFNEYLL------KVKRR---WKPALGVFLLTLGVTGALSL--LQ----T---KTYQAEG
B4WP72          DLQKYWC------VLRRR---WRLATFVFSSSICLTVLALA--SQ----E---AEYEATG
A0A318B4H2      ALERYWR------AMLNR---RLLILAVLLASMTVGVIVYL--MA----T---PQYLATA
B4WQE3          RLGRVVD------VLKRH---VFLITGITALATSAVVARAL--TE----T---PLYRADF
A0A2K3BR24      DLQQYWM------ALKRR---SLSAIIVFASTIGIAAAYSF--QQ----E---PIYQAKA
K9YXY1          DLQQYWM------ALKRR---SLSAIIVFASTIGITAAYSF--QQ----E---PIYQAKA
A0A1U7HGH0      DLHKYWY------ILKRR---WLPAVAAFGTVMGITYLHTL--SR----V---PIYQAQG
K9XJD3          DLHKYWC------ILKRR---WLPAVAAFGTVMGITYLHTL--SR----V---PIYQAQG
K9SX01          PLFELLS------IVRRY---WFLEISIFSLVFGVSAFLTF--QE----K---PIYQATG
A0A4P7ZT55      NLKEIWM------ALRRRRRWFLAGFGVTLAITGVLTLGQR--LF----R---PTYEGSF
A0A1E5QIR9      DLKQYGL------VFKRR---FFPAAIVFCAAIGATAAITF--LQ----K---PTYQAQG
A0A1Z4IBC7      DIHKYIE------VLQRR---WLAVVGVFGLSLALGCLYAF--SL----K---PSYKADG
A0A1W5CPC7      DIHKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEG
A0A5Q0GKD1      DIHKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEG
Q3MDC6          DIHKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEG
A0A1Z4KM73      DIHKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEG
Q8YNX7          DIHKYVE------VLQRR---WLAVVGIFGLSLTLGCVYAF--SQ----K---PSYKAEG
A0A367R4K6      NIQKYLE------VLQRR---WLTVIGIFSIAVTLGCLYAF--SL----K---PSYKAEG
A0A1E2WSV8      NIQKYLE------VIQRR---WLPLVGIFSIAVTLGCLYAF--SL----K---PSYKAEG
A0A2R5FRT9      NIQKYLE------VIQRR---WLPLVGIFGITVTLGCLYAF--SL----K---PSYKAEG
A0A2K8T1B6      NIQKYLE------VIQRR---WLPLVGIFGISVTLGCLYAF--SL----K---PSYKAEG
A0A235I9I0      NIQKYLE------VFQRR---WLPLVGIFAISVSLGCLYAF--SL----K---PSYKAEG
A0A2D0HQT8      NIQKYLE------VFQRR---WLPLVGIFAISVSLGCLYAF--SL----K---PSYKAEG
A0A2L2NU95      NIQKYLE------VIQRR---WLPLVGIFAISVTLGCLYAF--SL----K---PSYKAEG
A0A367S084      NIQKYLE------VFQRR---WLPLVGIFAISVSLGCLYAF--SL----K---PSYKAEG
A0A0V7ZFJ4      DLQQYWL------TLKRR---WLPALIVSSSVFGMAAFNTL--KQ----E---PIYSAEG
A0A367RIS1      NFQQYWR------ILKRR---WFLIAIIMGSVFGVTGLVAF--SK----K---PIYESEG
A0A235IXQ2      NFQQYWL------TVKRR---WFLILIIIGSVFGVTGVVTF--SE----K---PIYEAEG
A0A1W5CNX3      NFQQYWL------IAKRR---WLLIATIMGSVFGVTGLLTF--SQ----K---PIYEAEG
A0A5Q0GJJ5      NFQQYWL------IAKRR---WLLIATIMGSVFGVTGLLTF--SQ----K---PIYEAEG
Q3MEB7          NFQQYWL------IAKRR---WLLIATIMGSVFGVTGLLTF--SQ----K---PIYEAEG
A0A1Z4KHN9      NFQQYWL------IVKRR---WLLIAAIIGSVFGVTGLVTF--SQ----K---PIYEADG
Q8YT70          NFQQYWL------IVKRR---WLLIAAIIGSVFGVTGLVTF--SQ----K---PIYEADG
A0A218Q4C1      NLQQYWL------TVKRR---WLLIATIITSVFGFTAFVTF--SQ----K---PIYQAEG
A0A166IWU6      DLRQYWL------AVKRR---WLLIVIIIGSVFGITSFVTF--NQ----K---QIYEAEG
A0A2S0Q8C0      DLRQYWL------AVKRR---WFLIVIIIGSVFGITSFVTF--NQ----K---PIYEAEG
W6FSX4          DLRQYWL------AVKRR---WFLIVIIIGSVFGITSFVTF--NQ----K---PIYEAEG
A0A0V7ZNJ9      DLEQYWL------ILKRR---WVPASVVAGSVVGLAALVTF--MQ----K---PIYEAKA
A0A0R0M9H9      DLQVYWL------ILKRR---WLVILLVMASVLGAAISYTY--SQ----K---PVYQAKG
A0A1S1ZVW2      DLQVYWL------ILKRR---WLVILLVMASVLGAAISYTY--SQ----K---PVYQAKG
A0A1B7WX82      DIQQYWL------IFKRR---WLVSSIVFASVFGITAFVTY--TT----K---PVYESEG
A0A1B7WTD1      DIQQYWL------ILKRR---WFVASVVMASVISATAFMTY--TQ----K---PVYESQG
A0A480ABC0      DIQQYWL------ILKRR---WFVASVVMASVISATAFMTY--TQ----K---PVYESQG
A0A1Z4LRU5      DLGQYWL------ILKRR---WLPALLVTSSIFGLAAFVTF--RQ----K---PVYQAEG
A0A1Z4JVB4      DFQQYWL------ILKRR---WLLTSFVTGSVFGLAALLTF--LQ----K---PAYESPA
K9PIA4          DLQHYWT------VLKRR---WLVTSIVISTVFGLTALVTF--LK----T---PVYESKA
A0A1Z4HVE1      DVQQYWT------VLKRR---WPVTTVVIGSVFGLTCLFTF--LQ----K---PVYESQA
A0A252ECZ1      DFHQYWP------ILKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQA
A0A1Z4G5Y1      DFQEYWP------ILKRR---WPVTAVVIGSVFGLTALVTF--VQ----K---PVYESQA
A0A252DNA2      DFQEYWP------ILKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQA
A0A252E1Q4      DFQEYWP------ILKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQA
A0A6G9SK36      DVQQYWT------IIKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQA
A0A1Z4M597      DVQQYWT------VLKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQA
A0A1Z4MWT1      DVQQYWT------VLKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQA
A0A1Z4TX53      DVQQYWT------VLKRR---WPVTTVVIGSVFGLTALVTF--LQ----K---PVYESQA
A0A5P8VSD1      NFQQYWL------TLKRR---WLLIITIMGSVFGVTGLVTF--IQ----K---PIYEAES
A0A2A2TNQ5      NLQEYLL------VLKRR---WLAAAIVMGSVFGITAFVTY--SQ----K---PIYEASG
A0A3S1C4K5      DFQQYLR------ILKRR---WLVTAGVMGSVFGLTALVTF--SQ----K---PVYESQG
A0A1X4G3D5      DLQLYWM------ILRRR---WLVVLLVMASVLGGAISYTL--FQ----K---PVYQAKG
D4TNI2          DLQLYWM------ILRRR---WLVVLLVMASVLGGAISYTL--FQ----K---PVYQAKG
A0A1Z4H6Z8      DFQEYWP------ILKRR---WPVTAVVIGSVFGMTALVTF--LQ----K---PVYESQA
A0A1Z4NPM1      DIQQYWL------ILRRR---WLVILLVLGSVFGLAAFYTF--TL----K---PVYEAGG
A0A3F3KPR9      DLQIYWL------ILKRR---WLVILLVIASVLGAAISYTY--SQ----K---PVYQAKG
D4TGN7          DLQIYWL------ILKRR---WLVILLVIASVLGAAISYTY--SQ----K---PVYQAKG
A0A1Z4UZW9      DIQQYWL------IFKGR---WPMASIVFAVVFGVTALVTY--ST----K---PVYESEG
A0A0K2M5H0      DIQQYWL------IFKRR---WPVASVVFAFVFGVTALVTY--ST----K---PVYESEG
A0A1B7VSH4      DIQQYWL------IFKRR---WLVASIVFASVFGATALVTY--LT----K---PVYESEG
A0A1B7W126      DIQQYWL------IFKRR---WLVASIVFASVFGATALVTY--LT----K---PVYESEG
A0A3D4C6Q6      DIQQYWL------IFKRR---WLVASIVFASVFGATALVTY--LT----K---PVYESEG
A0A1B7UVJ4      DIQQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PVYESEG
A0A1B7UTR1      DIQQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PVYESEG
K7W0A4          DIQQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PIYESEG
A0A5C0DRW9      DIQQYWL------TFKRH---WLVTSIVFASVLGVTALLTY--SA----K---PVYESEG
A0A6H2C088      DIQQYWL------TFKRH---WLVTSIVFASVLGVTALFTY--SA----K---PVYESEG
A0A2T1CIL7      DFQKYWL------VLKRR---WLPATMIFTGVTGIFVLSAL--SK----P---PTYMAEA
A0A433V7A0      DFQKGWL------TIKRH---WKPALGIFGVVFIITGIGVL--MK----S---PSYTAYG
A0A2T1FTR8      EIAQYWL------VLKRR---WMPAALVFALTTAVATVWTF--KQ----Q---EIFQAKG
K9UA41          EIAQYWL------VLKRR---WMPAALVFALTTAVATVWTF--KQ----Q---EIFQAKG
A0A0C2LBE2      DFQKYWL------ILQRR---WLPAVGVCGVVVSLASLLAF--SS----K---PTFKAEG
A0A433NN38      DFQKYWL------VLQRR---WLPAVGIFGTVLTLASVYAF--SL----K---PYYQAQA
A0A2N6K0T2      DFQKYLL------VLQRR---WMTAVGVFGVIVSLALLYAL--ST----K---PTYTAQA
A0A2N6ML72      DFQKYLL------VLQRR---WMTAVGVFGVIVTLALLHAL--ST----K---PTYTAQA
G6FQZ6          DFQKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--SI----K---PTYTAQA
A0A2N6MQX9      DFQKYLL------VLQRR---WMTAVGVFGVVFTLALLHAL--ST----K---PTYTAQA
A0A2N6KXT6      DFQKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQA
A0A2N6KGB9      DFQKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQA
A0A2N6L3Y5      DFQKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQA
A0A0S3TIS7      DFQKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQA
A0A1U7GW28      DFQKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQA
A0A2N6LW63      DFQKYLL------VLQRR---WMTAVGVFGVVFTLALLYAL--ST----K---PTYTAQA
A0A328IH74      DFQKYLL------VLQRR---WLTAVGICGVVLSLALLYAF--SL----K---PTYTAQA
A0A4D9CIB0      DFQKYLL------VLQRR---WMTAVGICGVVLSLALLYAF--SL----K---PTYTAQA
A0A1Z4TQ63      DVQKYLL------VLQRR---WMTAVGVFGAVVTLALLYAF--SL----K---PTYTAQA
A0A4Q9J8G2      DVQKYLL------VLQRR---WMTAVGVFGVVLTLALLYAL--SS----K---PTYTAQA
A0A1Z4SMD6      DVQNYWL------VLKRR---WLIAAGVLLTFVGLSGVAIY--MQ----K---PEYEASG
A0A2H2Y096      DVQNYWL------VLKRR---WLIAAGVLLTFVGLSGVAIY--MQ----K---PEYEASG
K9S8M8          DFQKYWL------ILKRH---WLPATGAFLLAVCGAAAMAF--TA----E---PIYEAQG
A0A1Z4NFV0      DVHRYWL------VLKRR---WLVVVGILAASTALSGFVLS--TQ----R---PQFEAIG
B0CAX4          DVRNYFR------ILRRR---WIPATAVFGSVFVLTALATF--LQ----K---PVYEAEG
A0A350Y0P6      DFQKYWL------ILRRR---WLPSTVVFGFIFTLATTVAF--VK----K---PSYSAYG
A0A352X940      DFQKYWL------ILKRR---WLPATMVFLLSIGVAVGVAY--TR----Q---PIYEAGG
B8HTN4          DLGKYLT------ILKRR---WLGGAIAFGSILSLVIAYTL--LQ----K---PVYQAQG
A0A2A2TPF8      DLQNYWL------VLKRR---WLIASGIFLTSVALSGFVIS--LQ----R---ANYEAKG
A0A1Z4R0P8      DLQNYWL------VLKRR---WPIALGIFLTSVALSGFAIS--LQ----K---ANYEAEG
A0A0T7BUI3      DIQQYFL------VLQRR---WKILLALIITSVGFSGFAIL--RQ----K---PQYQATG
A0A1Z4LP32      DIQQYWL------IIKRR---WLFIVAAMLGSIGLSWFVIL--QQ----K---PQYQANG
K9REP9          DIQQYWL------IVKRR---WLFLVAAMLGSIGLSWLLIL--RQ----K---PEYQATG
A0A1Z4SIJ3      EIQKYWL------VLKRR---WLFVAVTVAASVGVAGIFIV--RQ----H---PEYRANG
A0A2H2XPG4      EIQKYWL------VLKRR---WLFVAVTVAASVGVAGIFIV--RQ----H---PEYRANG
K9V3C7          DLKNYWL------VLKRR---WLIAAGIFLTSVAMSGFVIS--LQ----K---ATYEASG
A0A1Z4T6Y7      DIRNYWL------ALKRR---WLVASGIFITTVALSGFAIS--LQ----R---PTYQASG
A0A2H2Y561      DIRNYWL------ALKRR---WLVASGIFITTVALSGFAIS--LQ----R---PTYQASG
A0A1Q4S362      DIRSYWL------VLKRR---WLVASGILFTSIALSGFAIS--LQ----R---PTYQASG
A0A3S1CIN8      DIRSYWL------VLKRR---WLIASGILFTSIALSGFAIS--LQ----R---PTYQASG
A0A2A2TC28      DIQQYWL------VLKRR---WLIAATVFCASVGLSGLVVL--RQ----K---PQYEASG
A0A0C1NCB0      DIQKYLL------VIQRR---WHIVAGVMLVSMVLSGLGIY--LQ----K---PKYQATG
A0A2N6K7Q9      EIQQYLL------ILKRR---WRLIAAIILASIGLSGSALF--MQ----K---PEYQADG
A0A2N6MXH6      EIQQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADG
A0A2N6M5A8      EIQQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADG
A0A2N6LL61      EIQQYLL------ILQRR---WRLITTIILASIGLSGSALF--MQ----K---PEYQADG
A0A0S3TP66      EIQQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADG
G6FP91          EIQQYLL------ILKRR---WRLITTIILASIGLSGSALF--MQ----K---PEYQADG
A0A1U7GYR5      EIQQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADG
A0A2N6KY52      EIQQYLL------ILKRR---WRLITAIILASIGLSGSALF--MQ----K---PEYQADG
A0A2N6KMP5      EIQQYLL------ILKRR---WQLITTIIVASIGLSGSVLF--MQ----K---PEYQADG
A0A2N6MA45      EIQQYLL------ILQRR---WRLITTIIVASIGLSGSALF--MQ----K---PEYQADG
A0A4Q9J9V9      EIQQYIL------VLKRR---WQLIASIIIASIGLSGLALF--MQ----K---PEYQADG
A0A328IGA1      EIQQYIL------VLKRR---WQLIASIILASIGLSGLALF--MQ----K---PEYQADG
A0A4D9CE41      EIQQYIL------VLKRR---WQLIASIILASIGLSGLALF--MQ----K---PEYQADG
A0A0M0SFT2      EIQQYIL------VLKRR---WRLIASIVLAAIGLSGLALF--MQ----K---PEYQADG
A0A1Z4TLC8      EIQQYIL------VLKRR---WRLIASIIIASIGLSGLALF--MQ----K---PEYQADG
A0A0C2LFH0      EIQKYWL------VLKRR---WPIVVGVLLASIGFSSFLIF--LQ----K---PEYQASG
A0A1Z4IYV4      DIQKYWL------VLKRR---WPIVAGVVLASVGLSSFAVF--LQ----K---PKYQASG
A0A1Z4Q0T6      DIQKYWL------VLKRR---WPIVAGVVLASIGLTTFAVF--LQ----K---PEYQATG
A0A0C2PT44      DIQKYWL------VLKRR---WPIVAGSVLTSIGLTTFAVF--LQ----K---PEYQATG
A0A1D2P6J4      DIQKYWL------VLKRR---WPIVAGVVLASVGLSSFAVF--LQ----K---PEYQATG
A0A3M9ZEU1      DLQKYWL------VLKRR---WLPATGVFGTVVALSTLAAV--MQ----K---PTYTATA
A0A1Z4JK72      DLQNYWL------ILKRR---WLTAATVLAATVGLVGLATS--MQ----R---PSFEANG
A0A0N7Z489      DLQSYWL------VLKRR---WLVAAGVFAATVGVAGLATS--LQ----R---PNYEANG
A0A0S3TXS2      DLQSYWL------VLKRR---WLVAAGVFAATVGLAGLATS--LQ----R---PNYEATG
A0A1Z4RN12      DFNKYWQ------VLKRR---WLPATATFTGVVLLSLIAAL--SS----Q---KVYEAEA
A0A2T1CMF9      DFSRYWQ------VVRRH---WIPASATFAGVLALSLIAAL--AS----K---NIYQAEA
Q7NDC5          GLREYLR------ILNRH---WPYAAGTALAVVTVVTVWTF--AL----P---PVWEAQG
U5QGK3          GLRDYLR------VLNRH---RLYAGGVFVLVVAGVAVWTF--TS----P---SVWEAKG
A0A2W4UY24      DFQKYWL------VLKRH---WLLALAVCGLTTAAAAFLGS--TQ----A---LLYKAEG
A0A2T1GMT4      NLSHYLF------AVKRH---WIPAVSIFAATVALSIAATS--LL----K---PSYQAEG
K9UI51          NLSHYLF------AVKRH---WIPAVSIFAATVALSIAAAS--LL----K---PSYQAEG
K9QM62          DFHRYLL------MLKRR---WILTVGIFFATAGFGVFATT--LM----K---PSYEAAG
A0A1Z4FWI3      DFGRYLS------VLKRQ---WIPATTIFASTVAVSVMATT--FM----K---PSYESEG
A0A1Z4JYE7      DLKIYLY------LLRRR---WISVTSIFLGTVSLSILATT--LL----K---PAYESSG
A0A2T1FXY4      DLSQYLL------SLKRR---WLPAVSIFATTVTLSVVAAT--LM----R---PSYEGEG
K9TYI2          NLSQYLL------SLKRR---WLPAVSIFATTVTLSVVAAA--FM----K---PSYEGEG
A0A1Z4QL41      DFGRYLS------SVKRH---WIPATCIFATTVILSALAST--RL----K---PSYESEG
A0A252D4T4      DLGRYLS------IVKRQ---WLPAVTIFASTVALSAVATT--FL----K---PTYEAEG
A0A252DJH5      DLGRYLS------IVKRQ---WLPAVTIFASTVALSAVATT--FL----K---PTYEAEG
A0A252EB80      DLGRYLS------IVKRQ---WIPAVTIFASTVALSAVATT--FL----K---PTYQAEG
A0A6G9SKZ9      DFGRYLS------IVKRQ---WIPAASIFASTVALSVVATT--FL----K---PSYEAEG
A0A1Z4HPW5      DFGRYLS------IVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEG
A0A1Z4MSN1      DLSRYLS------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEG
A0A1Z4U1C2      DLSRYLS------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEG
A0A0D6KV51      -------------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEG
A0A1Z4MKF8      DLSRYLS------MVKRQ---WIPAASIFASTVALSVVATT--LL----K---PSYEAEG
A0A2C6WC43      DLNRYLL------MLKRW---WVPAATIFIATVMLSAVATR--FI----K---PSYEAEG
A0A1Z4L5A1      DLNRYLL------MLKRW---WIPAATIFLATVMLSAVATR--FM----K---PSYEAEG
A0A367QD86      DLNRYLL------MLKRW---WIPAATIFIATVMLSAVATR--FM----K---PSYEAEG
A0A235IZ96      DLNRYLL------ILKRW---WIPAVGIFVGTVMLSAISTT--FM----K---PSYEAEG
A0A2L2NGP0      DLNRYLL------ILKRW---WIPAVGIFVGTVMLSAISTT--FM----K---PSYEAEG
A0A2K8SM78      --------------------------------------------M----K---PSYEAEG
A0A2R5FPC0      DLSRYLL------ILKRW---WLPGTAIFAATVMLSAVATQ--FM----K---PSYEAEG
A0A5P8W5T6      DLGRYLL------ILKRW---WLPATAIFAATVMLSAIATQ--FM----K---PSYEAEG
A0A140KBA0      DFKKYWL------VLKRR---IVPASITCLGVMTLSLVTAL--SL----E---QVYQAEG
K9XSG1          NFQKYWL------VVKRR---IVPASVTCLGVITLSLVTAL--SL----E---QIYEAEG
A0A0F5YE28      DIGKYLQ------TVKRY---WLIVISVFLLCVGLSVYGTK--YL----K---PTYAASG
U7QEH7          DIGKYFK------TVQRY---WLVVIGVFALCVGLSVYGTK--YL----E---PTYAASG
A0A3S1ATK5      DLSRYLL------MIKRQ---WIPAASIFVATIALSALATT--RL----Q---PSYEAEG
A0A2Z6CPH0      DFSHYLM------ILKRR---WLCVTSIVIGTIALSALAAT--LI----K---PSYEAEG
A0A1Z4GT50      DLSRYLL------MLKRQ---WLPANSIFAATVAMSALATT--YM----K---PSYEAQG
A0A1Z4GIX0      DINRYLL------VLRRR---WILILSILAASVGLSVAATT--LL----K---ASYEAEA
A0A2H6LC24      DINRYLL------VLRRR---WILILSILAASVGLSVAATT--LL----K---ASYEAEA
B2J6N5          DLSRYLL------ILKRW---WLPATVIFTATVILSAIATQ--FM----K---PSYEAEG
A0A367RMI4      DLNRYLL------ILKRW---WLPAFSVFVATVILSAISTQ--FL----K---PDYEAEG
A0A235HUM0      DLNRYLL------ILKRW---WVPAFSIFVATVILSAISTK--FL----K---PDYEAEG
A0A2L2NW47      DLSRYLL------ILKRW---WLPAFSIFVATVILSAISTQ--FL----K---PDYEAEG
A0A1E2WUR1      DLNRYLL------ILKRW---WLPAVSIFVATVILSAVSTR--FM----K---PDYEAEG
A0A235IKU3      DLNRYLL------ILKRW---WIPAVGIFVGTVMLSAISTT--FM----R---PSYEAEG
F4XKF3          DLSQYKL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEG
A0A1D9FX10      DLSQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEG
A0A1D8TNX9      DISQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEG
A0A1U7MYU6      DISQYLL------LLKRR---WLPAVAIFLFTVISAAWSTL--FL----K---PSYEAEG
A0A3C0NJ41      DFQKLWL------ALKRR---WLPGVAVFAVVVGLTVPLALSKKQ----K---TDYEAKG
A0A352AG88      DLQKLGL------VIKRR---WLIGAVVFLGMVGLTIPMALLQSQ----Q---TSYEAKG
A0A350Y374      DFYKLWL------VIKRR---WLVGGGVFVLMVGLTIPVALTQMQ----K---GDYEAQG
A0A355DPX0      DFYKLWL------VIKRR---WLVGGGVFVLMVGLTIPVALAQMQ----K---GDYEAQG
A0A0D8ZUV2      DIHKLWL------ILKRR---WLPAAGVFSCVVGLSVVAAM--MP----K---SSYQAEG
A0A433VDI0      DFQKYWS------ILKRR---WLPAVIVFSGVVGLSVVVVL--LQ----K---PVYQAEG
A0A3D1PG43      NLQNLWL------SIKRR---WLPAAGIFGCVLGCSALAAS--LQ----Q---PMYQAQG
A0A2P8QQ72      NLQNLQL------AIKRR---WLAAAGVFGFVLGLSTIVTL--LQ----A---PLYQAEG
K9TZQ7          NLQNLQL------AIKRR---WLAAAGVFGFVLGLSTIVTL--LQ----A---PLYQAEG
A0A2G7GPR0      DLKRVWL------ILKRR---WLPAAGVFGVVVAAAAALAS--MQ----R---PVYEAQG
K9XH68          DPKRVWL------ILKRR---WLPAAGVFGVVVAAATAFAS--MQ----R---PVYEAQG
A0A1U7HW70      DLKRVWL------ILKRR---WLPAAGVFGVVVAAATAFAS--MQ----R---PVYEAQG
A0A2S6VEJ8      DLKRVWL------ILKRR---WLPAAGVFGVVVAAATALAS--MQ----R---PVYEAQG
                                                                       :    

K9SLA9          QVLIESTIESTTGS-------VAAPTTTASIPNPNQDNIASSEGLPPLPTDTAISTIPPG
A0A168TT23      VVQINHETANILRIEDFEA------------------------------------APRSW
A0A0M1JWX9      QLLVEPVTGEGANS--LSS------------------------RLGALAGGLGMGIPGSS
A0A2T1M1V6      QLNIPIKG-DKLNA-----------------------------NLGTLGNLSDGGS--DF
A0A2G7GCS2      KLNLPQPT-TRLDT-----------------------------NLGTLGQLQNSAL--GF
K9XBH8          ELNLPQST-NSINA-----------------------------SLGTLGQLQNSGL--GF
A0A1Z4LJ30      QLILPNVT-NDSDA-----------------------------DLGKLGSVRDGGV--VF
K9RI76          QLILPNVT-NQSDA-----------------------------DLGKLGNVRDEGI--VF
A0A352AE27      QLILPDTT-SSLDA-----------------------------NLGTLGSLTNDEP--VF
A0A3B8JH60      QLILPNTT-GDLDA-----------------------------NLGTLGSLRNGGS--GF
A0A3C0N766      QLILPNTT-GDLDA-----------------------------NLGTLGSLRNGGS--GF
K9W9J7          QLILPQKS-GNLDA-----------------------------NLGTLGSLRNGDP--GF
A0A139WSU3      QLILPKTT-SNLDA-----------------------------NLGTLGSLRNGDS--AF
A0A433VN22      QLILPKTT-SNLDA-----------------------------SLGTLGTFKNGNL--DF
Q7NF11          RIILPSTN-KNAEI-----------------------------SLGALGEVRETGT--SF
A0A1Z4JCS8      QLILPSSNGGNLDA-----------------------------NLGTLGSYRNSDP--SF
F4XTX2          QLILPET--GKLQA-----------------------------SLGTLGSLTKGDS--EL
Q7NJN6          QLILPNAS-SNLSA-----------------------------NLGPLGNIQQQGL--PF
U5QCC3          QLILPDTS-SNLSA-----------------------------SLGPLGNLQQQGL--TF
A0A3S0Y9N9      QLVLKK-NATSSLT-----------------------------GVGSQLGQLENSVSG--
A0A433UNK7      QLVLKK-NSTSSLT-----------------------------GVGNQLGQLESSVSG--
A0A3M1SVZ4      EILIEKVSSTPSVT-----------------------------GVGSEVGLLDPLTKE-N
A0A654SFI6      R---------IEIS-----------------------------QISANVTSLDPLENESR
K9SSQ0          SLLIEN-------------------------------------------------APTDG
A0A2W1JIN9      RLILDG-TPSTSVS-----------------------------DFGSTIAQQP-----GN
A0A318AJV1      RIRIDP-SLNPMSQ-----------------------------DQGQGVI--------GA
A0A6B3MUB5      RLMLDN-KQ-VSVS-----------------------------PLGRDLSQLPNRGPGGA
A0A1U7N2U4      RLMLEN-KK-VSVS-----------------------------ELGRNLSQVPANTPGEA
A0A1D9G1F2      RLMLDN-KK-VSVS-----------------------------ELGDNLSQVPANTPGGA
F4XV38          RLMLDN-KK-VSVS-----------------------------ELGDNLSQVPANTPGGA
A0A2P8QIL5      RLMLDG-KQLSLAG-----------------------------ETGRDLTQESARLD--S
A0A2T1FLY5      RLMLDG-KQLSLAG-----------------------------ETGRDLTQESARLD--S
A0A433W447      RLMLDG-KQLSLAG-----------------------------ETGRDLTQESARLD--S
K9U1K8          RLMLDG-KQLSLAG-----------------------------ETGRDLTQESARLD--S
K9UYB2          RLMVDE-KRGTSVS-----------------------------ELGRNLTQV--SNSPGN
A0A218QN17      RLMQDD-RR-VSVS-----------------------------ELGRDLTQVSSGAPGGP
K9RKN2          RLMLDE-KQ-ISVS-----------------------------ELGRDLTQVANSTPGGP
A0A2I8ADV2      KMMVDA-KG-VSVS-----------------------------ELGRDLTQP-SVVGRSS
A0A1W5CKM3      RLMLDD-KK-ASVS-----------------------------ELGRDLTQI-NSTAIGR
A0A5Q0GMF5      RLMLDD-KK-ASVS-----------------------------ELGRDLTQI-NSTAIGR
Q3MEW0          RLMLDD-KK-ASVS-----------------------------ELGRDLTQI-NSTAIGR
A0A1Z4KIC7      RLMLDD-KK-ASVS-----------------------------ELGRDLTQI-TPTGVGR
Q8YSM5          RLMLDD-KK-ASVS-----------------------------ELGRDLTQI-TPTGVGR
A0A1Q4S1H4      RLMVDD-KG-VSVS-----------------------------DFGRSITQLNAGTPGGA
A0A433VBU6      RLMLDS-KS-VSVS-----------------------------ALGRDITQLDAGTPGGA
A0A1Q4RZJ6      RLIFDD-RR-TSVS-----------------------------ELGRDLSQTSITSAG-N
A0A1Z4SNV3      RLIFDD-KR-VSVS-----------------------------ELGRDLSQTSVSGSG-N
A0A2H2XJQ1      RLIFDD-KR-VSVS-----------------------------ELGRDLSQTSVSGSG-N
A0A3S5K358      RLIFDD-RR-TSVS-----------------------------ELGRDLSQTSVTSPG-N
A0A0T7BPJ4      RMMLDD-KR-VSVS-----------------------------DLGRDLTQVTSTTPGGP
A0A0C1QS61      RLMLDS-KQ-TSVS-----------------------------ELGRNLSQVSSNTPGGP
A0A139X3R8      RLMLDN-KQ-TSIS-----------------------------ELGRDLSQVSSNTPGGP
A0A1Z4I7C5      RLMLED-KK-ASVS-----------------------------ELGRDLTQINSSSVG-R
A0A0C2MDK7      RLMLDD-KR-VSVS-----------------------------ELGRDLTQVSANAPG-I
A0A1Y0RCK1      RLMLDD-KR-VSVS-----------------------------ELGRDLTQVSSNSPG-N
A0A1Z4PWZ0      RVMLDD-KR-VSVS-----------------------------ELGRDLTQVSSNAPG-I
A0A0C2QLT0      RLMQDD-KR-VSVS-----------------------------ELGRDLTQVSSNAPG-I
A0A1Z4J2K1      RLMQDD-KR-VSVS-----------------------------ELGRDLTQVSSSGPG-I
A0A3S0ZSX0      RLMLDD-KR-VSVS-----------------------------ELGRDLTQMPTNIPGGP
A0A2N6K4T3      RLMLDQ-KR-VSVS-----------------------------ELGRDLTQLSSDTPGGS
A0A370CKT2      RLMLDQ-KR-VSVS-----------------------------ELGRDLTQLNSGTPGGS
A0A0S3TL97      RLMLDQ-KR-VSVS-----------------------------ELGRDLTQLNSGTPGGS
A0A2N6M8A0      RLMLDQ-KR-VSVS-----------------------------ELGRDLTQLNSGTPGGS
A0A2N6M9E1      RLMLDQ-KR-VSVS-----------------------------ELGRDLTQLNSGTPGGS
A0A2N6KJI4      RLMLDQ-RR-VSVS-----------------------------ELGRDLTQLNSGTPGGS
A0A2N6MZ77      RLMLDQ-KR-VSVS-----------------------------ELGRDLTQLNSGTPGGS
A0A2N6KT20      RLMLDQ-KR-VSVS-----------------------------ELGRDLTQLNSGTPGGS
G6FSN3          RLMLDQ-KR-VSVS-----------------------------ELGRDLTQLNSGTPGGS
A0A4D9CI02      RLILDQ-KR-VSVS-----------------------------ELGRDLTQLSPGTSGNS
A0A328I8B9      RLILDQ-KR-VSVS-----------------------------ELGRDLTQLSPGTSGNS
A0A4Q9J4Z7      RLILDQ-KR-VSVS-----------------------------ELGRDLTQLSPGTSGNS
A0A0M0SU69      RLILDQ-KR-VSVS-----------------------------ELGRDLTQLSSATPGGS
A0A1Z4TIZ8      RLILDQ-KR-VSVS-----------------------------ELGRDLTQLSPGTPGGS
A0A0S3TYD7      AVLV---KKQASTTSVLGL----------------------QVDVGEIESLD------KS
A0A3C0N2P0      QLLVGPVSSSEDK-----------------------------LGKLAQSLNEGGGSSSNT
K9TLQ0          RLLVEPI-KGQDN-----------------------------LEQLNQALTRNSG-KGEI
A0A6B3M6M6      QLLVEPV-TGEQK-----------------------------LDQLNQSLKTTAGIQTDG
A0A6B3NIJ0      QLLVEPV-TGEQK-----------------------------LDQLNQSLKTTAGIKADG
A0A352XE00      QLLIGPV-SGGDR-----------------------------LDELSQSLAQNTGSQGNA
B4VS56          QLLVGSV-SGEDQ-----------------------------LEQISESLNQSAGVQTNS
A0A352AAQ3      QLLVGSV-SGEDR-----------------------------VEQLTEALSKTANIQVEG
A0A350Y472      QLLVGSP-SGEDQ-----------------------------AEQLTEALSKTGTVQVQG
A0A355DVB4      QLLVGSP-SGEDQ-----------------------------AEQLTEALSKTGTVQVQG
U5QL42          LILVDNRQQIP-------------------------------VVQTTESALPS------A
K9QF04          QLMLDSATSDSDSN--PLA----------------------DSPRRSAV------VPLQF
A0A076HBF2      SLLITDPISNEGGG---RS----------------------GMANVEGTMFEQLARNTTS
A0A354B169      SLLITDPISSENSN--GNS----------------------NATALSGTMFEQLARNTTS
G4FMX5          ALLITDPISNDSGN--NSA----------------------SAGGLNGSMFEELARNTTS
Q0IDT5          ALLITDPISNEGGN--NSA----------------------ASSAASGTVFEQLARNTTQ
A0A2D6FCW3      ALLITDPLNNESGN---RA----------------------AAAALDGGMFEELARNTTS
A3ZA21          ALLITDPISNEGGN--GRN----------------------AAFAASGTMFEQLARNTTQ
A0A140K3H3      LILLENQKTQQSA-----------------------------SVSPEQQSLAT--GYYNL
K9XUB8          LLLLENNKTQQSA-----------------------------LVSPGQQSLNT--GYSNL
Q7NEU3          LLLLEDRNSQPKVL--A-------------------------DEASPMSYFAS--NSA--
A0A6H2NHD5      DLLVEPVTSANSL-----------------------------EGDLLNLSQGT--RSG--
A0A2P8W4F7      NLLVEPVTNAPPV-----------------------------GLEEVVGAQGN--RGA--
A0A5Q4E0Z4      NLLVEPVTAVNPL-----------------------------GLEAMVGVAGA--RNTSG
A0A2P8VVX1      QLLVEPNYQQE-------------------------------LNSSDLSSFAD--QDPRD
A0A2P8WHY0      QLIVEPNYEDD-------------------------------VTARELDGLAN--ASDQS
A0A2T1CMT9      QILAESNYQAKDLQ--D-------------------------NQRDSEEQFAD--ANVEL
A0A563VQJ3      KLLFRQNTAASLT-----------------------------GIGEDISSLDS--IGVNE
A0A1D8TX52      QLLVEPNYID--------------------------------KTRGIESQFTE--STVDI
A0A1D9G4T2      QLLVEPNYID--------------------------------KTRGIESQFTE--STVDI
F4XP71          QLLVEPNYID--------------------------------KTRGIESQFTE--STVDI
A0A1U7N5X9      QLLVEPNYID--------------------------------KTRGIESQFTE--STVDI
A0A6B3N2I8      QLLVEPNYID--------------------------------KTRGIESQFTE--STVDI
A0A2W6ZAV2      RLLVSDPIDASSTE--G-------------------------AADSSLRALAL--QPQDR
A0A2G7GMH8      QLLVEPNYQGKTDQ--G-------------------------QGKTTESEFAD--SNVEV
K9W742          QLLVEPNYQSKRQD----------------------------GQEGAEKQIVD--PNIQV
A0A2T1DWE8      QLLVEPNYQSKKD-----------------------------SGAGSENQFAD--SNVEI
A0A1U7I8L3      QLLVEPNYQGKQE-----------------------------GSKNAENDFAD--SNVEI
A0A2T1DJL8      QLLSESNYRSRKT-----------------------------DNPATPS-FAD--SNVEI
A0A1Z4J9W0      QLMVESNYRERRS-----------------------------PNDTRPS-FAD--PNVET
A0A0N7Z5K9      QMLVESNYRERRA-----------------------------PGDNSPS-FAD--PNVES
A0A0S3TXC5      QMLIESNYRERRT-----------------------------PGDNSVS-FAD--PNVET
K9SA61          QLLVESNYQGRDQN----------------------------GDRASEGQFTD--SNVKL
A0A3D1PBA3      QLLIEPNYQGKRDT----------------------------DAQRPSQQYAE--SGVKI
K9XPB0          QLLIESNYQTKDST--RGN----------------------DNNQYLEEEFAD--SSIEI
A0A350Y7Z1      QLLIEPYVQQKQE-----------------------------GKPQTEEQFTD--SNVEV
A0A352X2A7      QLLIEPLVQEKQQ-----------------------------RRSE-ENQFTE--SNIEV
A0A0D8ZYV0      QILIEANYQGRKD-----------------------------IQPGADSEFTD--ANVEI
A0A2T1FP73      QLLIEPNYQGKKDG----------------------------TTPRQGEQYAD--SGVTI
A0A433VMS2      QLLIEPNYQGKKDG----------------------------TTPRQGEQYAD--SGVTI
K9TYA7          QLLIEPNYQGKKDG----------------------------TTPRQGEQYAD--SGVTI
A0A2P8QUE1      QLLIEPNYQGKKDG----------------------------TTPRQGEQYAD--SGVTI
A0A2T1DNG3      QFLV---EPNYQGK---------------------------NSGADPFTDAT------VE
B8HNB0          LILT---GKEQSTP------L--------------------GEEINSTSSYS---N--WS
A0A1Z4LN32      KLLF---RTDRTSS--LTG-A--------------------GEEIGHLESIK---R--EA
A0A2I8A9F5      KLLF---QMNRTSS--LTG-I--------------------GGKIGDLESI-------GS
A0A218Q6R8      KLLF---QLNRTSS--LTG-V--------------------GGRIGDLESI-------GA
A0A218QGE0      KLLF---QSNQTSS--LTG-V--------------------GEKIGHLESIK---P--EA
A0A563VS48      KVLI---KSNKTDT--LSG-F--------------------ENETGNIEVIS---E--ES
A0A318BJ18      TVEI------------ARE----------------------ASQVTNFQGVERQSSLVDQ
A0A3B8Y8H9      QILV---DTPGDSNRGLPGGI--------------------NSSLGNFLGVS--TN--SD
A0A2W1JVB9      TLRI---KESQSGL------T--------------------ELDLGGISPLS---G--DS
A0A6H1U102      LILL---DNEASTP--LVP----------------------GAP-----------EIATR
A0A563VLD6      FILL---ENPQTKE--SARIV--------------------PGNMTRGSAFS------SL
A0A2P8W9H0      DILT---PSSTLETQIISTLN--------------------PNALSNQTEFG------NS
A0A6I5P386      ELLT---PSVTPESKVVSNLT--------------------SEGLGDAINSA------DI
A0A318BG22      TFEV---QREAPRV------L--------------------DVNSAESDSRP---S--DS
A0A1Z3HMQ0      KLLF---QVDRSTS--LTG-V--------------------GDEIGDLEAVN--PV--NS
K1XF69          KILF---KVDRTSS--LAG-I--------------------GEGLGELKALL---A--DQ
B5W297          KILF---KVDRTSS--LAG-I--------------------GEGLGELKALL---A--DQ
A0A6H2AL05      KILF---KVDRTSS--LAG-I--------------------GEGLGELKALL---A--DQ
H1W7M8          KILF---KVDRTSS--LAG-I--------------------GEGLGELKALL---A--DQ
A0A5Q4H6A5      KILF---KVDRTSS--LAG-I--------------------GEGLGELKALL---A--DQ
D5A466          KILF---KVDRTSS--LAG-I--------------------GEGLGELKALL---A--DQ
U5QJM6          LMLL---EDKSSQTQVLED-A--------------------AQQI----QLGGGAD--FT
A0A1Z4RPC6      KILF---KKNSVDS--FLD-L--------------------QSKPEQLNSI---LP--DQ
A0A2T1CMZ0      KILF---KKNTPNE--LLN-L--------------------SENTNEFNSL---LN--TQ
L8M4F7          KLLF---KSSSLAS--LTG-V--------------------AKNSSALETLNYSLG--QQ
A0A140K2P2      KLLF---KQNSTAS--LTG-V--------------------GKNVGELKPL---LV--NQ
K9XWX4          KLLF---KQNSTAS--LTG-V--------------------GENVGELKPL---LV--NQ
A0A140KB14      KLLF---KQNNTAS--LTK-V--------------------GQGVGELKPL---LN--DQ
K9XX88          KLLF---KQNNTAS--LTK-V--------------------GQGIGELKPL---LN--DQ
A0A563VSV6      KILF---KQKN--N--LLP-V--------------------GEGVGELTTF---LN--NQ
L8LZE9          KILF---EPQD--N--LTD-L--------------------GNPSNDLQSL---TV--GA
A0A433NM31      KLLL---KRTGSTST-VTG-L--------------------GKELGQLDSLVDSPE--SN
A0A1Z4NDS1      NLLI---KTNNTPS--LTG-L--------------------GEAIGKLESLT---R--DS
K9F4D9          KLLF---ELSNQASA-LVG-L--------------------EGGNRELRALT---N--LD
U9VXM0          KLLF---ELSNQTSS-LVG-F--------------------EGGTRELRALT---N--LD
A0A6I5QPI5      RVLF---RSDRTTS--LTG-L--------------------GDDRGRVEILA-------A
A0A433W533      KLIV---KKNDQTAA-LTG-L--------------------GQGIGDLEGLN---L--QS
A0A2P8QWJ3      KLIV---KKNDQTAA-LTG-L--------------------GQGIGDLEGLN---L--QS
A0A2T1FKP8      KLIV---KKNDQTAA-LTG-L--------------------GQGIGDLEGLN---L--QS
K9U6L7          KLIV---KKNDQTAA-LTG-L--------------------GQGIGDLEGLN---L--QS
A0A1E5QP61      KLLF---KKQNTTSALVTD-A--------------------GAKIGQLDTLT---Q--FN
U5DPF5          RLLL---QT-------ADG-A--------------------IPFAGFSGGSS---T--SN
A0A3M1PML8      LLQV---RSSGAAK--LTG-V--------------------GEGLGELEKLT---L--QS
A0A3M2GIL5      KLLI---KKRNTTSALVTE-A--------------------GAKLGELDSVY---Q--LN
A0A6H1TSJ9      KLLI---KKRNTTSALVTE-A--------------------GAKLGELDSVY---Q--LN
A0A0T7BPZ0      SILI---RTNRTSS--LTG-L--------------------GGDIGRLESLT---Q--TN
A0A352X442      TILI---QKDRSAS--LTG-L--------------------DEALSQFDKLA---Q--KS
A0A6B3NF44      KLLF---KEDNSSS--LTG-L--------------------ENEIGELKGLT---N--TS
A0A0M0SHU3      SLLI---KTNRTSS--LTG-L--------------------GEDIGRIESLV---R--EN
A0A1D2PBN3      SLLI---KTNRTSS--LTG-L--------------------GEALGRLESLG---V--NN
A0A0C2LVR7      SLLI---KTNRTSS--LTG-L--------------------GEALGRLESLG---V--NN
A0A1Z4PQB9      SLLI---KTNRTSS--LTG-L--------------------GEALGRLESLG---V--NN
A0A1Z4SFN6      SLLV---KTNRSTS--LTG-L--------------------GESIGRIESLT---N--TN
K9PGI8          SLLI---KTNRSAS--LTG-L--------------------GEGIGQVDSLV---N--TN
A0A2T1E9V8      QILF---KQDKTSS--LIG-L--------------------DSDAQAMDSQS---N----
A0A3M2GQQ6      LILV---DDRSSVP--VVP--------------------------GLESPYP---G--PQ
A0A6H1U2X0      LILV---DDRSSVP--VVP--------------------------GLESPYP---G--PQ
K9SGJ5          SLLI---DDATISV--SNL----------------------PVND----GLD---KYSKE
A0A6C2DSN4      SLLI---NNSTIPV--SDI----------------------QVPNAPSSGLP---A-SPV
L8MYT6          SLLI---NNSTIPV--SDI----------------------QVPNAPSSGLP---A-SPV
A0A352JGJ6      SLLI---NNSTIAI--SDI----------------------QVP-----GLP---G-SSL
A0A1J5GLS2      ALLI---NNSTIAV--SDI----------------------QIP-----GLP---G-TSS
A0A2W4W6M5      SLLI---NNSTIAV--SDI----------------------QVP-----GLP---S-ASL
A0A2W7AN33      SLLI----NSTISA--PNI----------------------QPT-----GAS---T-SSM
A0A256BLV2      SLLV----NSTIAV--SDI----------------------QLP-----GLS---T-SSL
A0A2W6ZXF3      ALLI---NNSTIAV--SDI----------------------QVP-----GLP---G-ASS
A0A2Z5WX66      SLLI---NNSTIAV--SDI----------------------QVP-----GLP---G-TSL
K9W1T3          QILI---KKNNSTS--LLL------------------------NLDKIDGSA---G--AG
A0A1Q4RTR1      KLTFN--KANLYSS--LTGITG-------------------GQELEMLGRGA---N--AG
A0A1Z4SQV2      KLLFN--RANLYSS--LTGITE-------------------SQNIDV--PGI---N--ST
A0A2H2XGN1      KLLFN--RANLYSS--LTGITE-------------------SQNIDV--PGI---N--ST
A0A433UXH8      KLLFN--KANLYSS--LTGITE-------------------GQNIDV--PGI---N--SN
A0A1Z4RMB9      KILF---KQTSAAS--YTG-I--------------------GEEAGTLKPIL---N--DQ
B4WP72          KLLI---KGGRTSS--LTG-L--------------------NVDIGELEALD---S-LQK
A0A318B4H2      RIEI---QRSQAKV--VNV------------------------GGLEMEDRS---R--DL
B4WQE3          ELLTPL-VTLETQI--ISTIS--------------------PDALSNQSESV---G--VG
A0A2K3BR24      KLLFQ--GESQALA--LPT----------------------LEQQG------------NA
K9YXY1          KLLFQ--GESQALA--LPT----------------------LEQQG------------NA
A0A1U7HGH0      ELLF---RQDRSSS--LIG----------------------LQSATQANPTT---Q--ND
K9XJD3          ELLF---RQDRSSS--LIG----------------------LQSATQANPTT---Q--ND
K9SX01          SLLFK--SQRQSNT--LTG----------------------VNSVAQISDTV---A---G
A0A4P7ZT55      TLLVSDPLSEDRQL--GGP----------------------SNQLSDLALVN---P--GT
A0A1E5QIR9      ELLF---KKNNVTT--NVTVV--------------------GKEVPEIHSP-------PT
A0A1Z4IBC7      SLMI---MTNRTFS--LTG-L--------------------PQDIGKLEPLN---V--ND
A0A1W5CPC7      SVMI---KTNRTSS--LTG-L--------------------PQDIGRLEPLN---V--ND
A0A5Q0GKD1      SVMI---KTNRTSS--LTG-L--------------------PQDIGRLEPLN---V--ND
Q3MDC6          SVMI---KTNRTSS--LTG-L--------------------PQDIGRLEPLN---V--ND
A0A1Z4KM73      SVMI---KTNRTSS--LTG-L--------------------PQDIGRLEPLN---V--ND
Q8YNX7          SVMI---KTNRTSS--LTG-L--------------------PQDIGRLEPLN---V--ND
A0A367R4K6      SLMI---KTNRTSS--LTG-L--------------------PEDIGRLEALN---V--ND
A0A1E2WSV8      SLMI---KTNRSSS--LTG-L--------------------PQDIGRLEALN---V--ND
A0A2R5FRT9      SLMI---KTNRSSS--LTG-L--------------------SEDIGRLEALN---V--ND
A0A2K8T1B6      SLMI---KTNRSSS--LTG-L--------------------SQDIGRLEALN---V--ND
A0A235I9I0      SLMI---KTNRSSS--LTG-L--------------------PDDIGRLEALN---V--ND
A0A2D0HQT8      SLMI---KTNRSSS--LTG-L--------------------PDDIGRLEALN---V--ND
A0A2L2NU95      SLMI---KTNRSSS--LTG-L--------------------PDDIGRLEALN---V--ND
A0A367S084      SLMI---KTNRSSS--LTG-L--------------------PDDIGRLEALN---V--ND
A0A0V7ZFJ4      KLRFN---SDRVSA--LTA-L--------------------NSQMGEVAAIT---G--KG
A0A367RIS1      KLLFN--KESGLSS--LTG-V--------------------NEQLGQLSGVT---N--LS
A0A235IXQ2      KLLFN--KQSGVSS--LTG-V--------------------NEQLGQLSGVT---N--VS
A0A1W5CNX3      KLLFN--KQSGVSS--LTG-V--------------------SEQLGQLSGVT---N--LS
A0A5Q0GJJ5      KLLFN--KQSGVSS--LTG-V--------------------SEQLGQLSGVT---N--LS
Q3MEB7          KLLFN--KQSGVSS--LTG-V--------------------SEQLGQLSGVT---N--LS
A0A1Z4KHN9      KLLFN--KQSGVSS--LTG-V--------------------SEQLGQLSGVT---N--LS
Q8YT70          KLLFN--KQSGVSS--LTG-V--------------------SEQLGQLSGVT---N--LS
A0A218Q4C1      KLIFD--KQSSVSS--LTG-V--------------------SERVGELSRLT---N--LS
A0A166IWU6      KLIFD--KQNSVSS--LTG-V--------------------SEGVGELSGLT---S--SS
A0A2S0Q8C0      KLIFD--KQNSVSS--LTG-V--------------------SEGVGELSGLT---N--SS
W6FSX4          KLIFD--KQNSVSS--LTG-V--------------------SEGVGELSGLT---S--SS
A0A0V7ZNJ9      ELLFN--KQSNVSS--LTG-L--------------------SGAVGELSGIT---N--LS
A0A0R0M9H9      KLLFE--KKDGVSS--LTS-L--------------------ATSVGELGGIG---N--NS
A0A1S1ZVW2      KLLFE--KKDGVSS--LTS-L--------------------ATSVGELGGVG---N--NS
A0A1B7WX82      KLVFT--KKGVASS--LTTNI--------------------SQQMGELGGLT---N--LS
A0A1B7WTD1      KLVFT--KKDAASS--LSS-L--------------------SDKMGELGGLT---N--LS
A0A480ABC0      KLVFT--KKDAASS--LSS-L--------------------SDKMGELGGLT---N--LS
A0A1Z4LRU5      KLRFD--KNNNVSS--LSG-L--------------------GGQIGELSGIT---N--LS
A0A1Z4JVB4      KLIFN--KQNGISS--FSD-I--------------------AAKAGELRGLT---S--FS
K9PIA4          KLLFN--KQNGVSS--LTG-F--------------------SSKMGELGGLT---N--LS
A0A1Z4HVE1      KLLFN--KQNGVSS--LTG-L--------------------SSQVGELSGLT---N--LS
A0A252ECZ1      KLLFN--KQSGVSS--LSG-L--------------------SSQVGELSGLT---N--LS
A0A1Z4G5Y1      KLLFN--KQSGVSS--LTG-L--------------------SSQVGELSGLT---N--LS
A0A252DNA2      KLLFN--KQSGVSS--LTG-L--------------------SSQVGELSGLT---N--LS
A0A252E1Q4      KLLFN--KQSGVSS--LTG-L--------------------SSQVGELSGLT---N--LS
A0A6G9SK36      KLLFD--KQNGVSS--LTG-I--------------------SAQVGELSGLT---N--LS
A0A1Z4M597      KLLFN--KQNGVSS--LTG-L--------------------SSQVGELSGLT---N--LS
A0A1Z4MWT1      KLLFN--KQNGVSS--LTG-L--------------------SSQVGELSGLT---N--LS
A0A1Z4TX53      KLLFN--KQNGVSS--LTG-L--------------------SSQVGELSGLT---N--LS
A0A5P8VSD1      KLLF---NNQSPSS--LTA-V--------------------SQQLGQLTGLT---T--NS
A0A2A2TNQ5      KLLL---KQNEASN--LTG-L--------------------NQKLGELSGLT---N--TS
A0A3S1C4K5      KLLI---KNNGASS--LTG-L--------------------SEKVGALSALT---N--TS
A0A1X4G3D5      KLLFEGDRVSSLTR--LGG-L--------------------AELAQLTGATG---S--GG
D4TNI2          KLLFEGDRVSSLTR--LGG-L--------------------AELAQLTGATS---S--GG
A0A1Z4H6Z8      KLLFN--KQSGASS--LSG-L--------------------SSQVGELSGLT---N--LS
A0A1Z4NPM1      KLML---KQNSSSS--LIG-L--------------------SDKLGELSGLT---N--TS
A0A3F3KPR9      KLLFE--KKDGVSS--LTS-L--------------------ATSVGELGGLG---N--NS
D4TGN7          KLLFE--KKDGVSS--LTS-L--------------------ATSVGELGGLG---N--NS
A0A1Z4UZW9      KLVFT--KKSGASS--LTS-L--------------------SQQMGELGALT---N--LS
A0A0K2M5H0      KLVFT--KKSGASS--LSS-L--------------------SQQMGELGALT---N--LS
A0A1B7VSH4      KLVFT--KKSGASS--LSG-L--------------------SQQMGELGALT---N--LS
A0A1B7W126      KLVFT--KKSGASS--LSG-L--------------------SQQMGELGALT---N--LS
A0A3D4C6Q6      KLVFT--KKSGASS--LSG-L--------------------SQQMGELGALT---N--LS
A0A1B7UVJ4      KLVFT--KRSGASS--LAD-I--------------------SQSMGELGGLT---N--LS
A0A1B7UTR1      KLVFT--KRSGASS--LAD-I--------------------SQSMGELGGLT---N--LS
K7W0A4          KLVFT--KKSGASS--LAG-L--------------------SQSLGELGGLT---N--LS
A0A5C0DRW9      KLVFT--KKSGASS--LAG-L--------------------SQSLGELGGLT---N--LS
A0A6H2C088      KLVFT--KKSGASS--LAG-L--------------------SQSLGELGGLT---N--LS
A0A2T1CIL7      QLLI---RIDKSSQ--LVG-L--------------------EEERGQIEVIG---K--DS
A0A433V7A0      KLLF---RVDTTPF--LIG-IKTK-----------------DENVSPLVPLT---F--EG
A0A2T1FTR8      QVIL---KKTNKTS--ALL-SSATNAAS-------------GGAIGELEGLT---G---S
K9UA41          QVIL---KKTNKTS--ALL-SSATNAAS-------------GGAIGELEGLT---G---S
A0A0C2LBE2      SLLI---KTNRTSS--LTG-L--------------------GEAIGRLDTLT---M--ES
A0A433NN38      SLLI---KTNRTSS--LTG-L--------------------GEDLGRLEALV---S--QS
A0A2N6K0T2      SLLI---KTNRTSS--LTG-L--------------------GEDLGRLESLV---Q--DN
A0A2N6ML72      SLLI---KTSRTSS--LTG-L--------------------GEDLGRLESLV---Q--DN
G6FQZ6          SLLI---KTSRTSS--LTG-L--------------------GEDLGRLESLV---Q--NN
A0A2N6MQX9      SLLI---KTSRTSS--LTG-L--------------------GEDLGRLESLV---Q--DN
A0A2N6KXT6      SLLI---KTSRTSS--LTG-L--------------------GEDLGRLESLV---Q--NN
A0A2N6KGB9      SLLI---KTSRTSS--LTG-L--------------------GEDLGRLESLV---Q--DN
A0A2N6L3Y5      SLLI---KTSRTSS--LTG-L--------------------GEDLGRLESLV---Q--DN
A0A0S3TIS7      SLLI---KTSRTSS--LTG-L--------------------GEDLGRLESLV---Q--DN
A0A1U7GW28      SLLI---KTSRTSS--LTG-L--------------------GEDLGRLESLV---Q--DN
A0A2N6LW63      SLLI---KTSRTSS--LTG-L--------------------GEDLGRLESLV---Q--DN
A0A328IH74      SLLI---KTNRTSS--LTG-L--------------------GEDIGRLESLV---R--EN
A0A4D9CIB0      SLLI---KTNRTSS--LTG-L--------------------GEDIGRLESLV---R--EN
A0A1Z4TQ63      SLLI---KTNRASS--LTG-L--------------------GEDIGRLESLA---E--NN
A0A4Q9J8G2      SLLI---KTNRASS--LTG-L--------------------GEDLGRLESLA---E--KD
A0A1Z4SMD6      MLLF---QSNRTSS--LTK-V--------------------GEKIGDLESVM---R--EG
A0A2H2Y096      MLLF---QSNRTSS--LTK-V--------------------GEKIGDLESVM---R--EG
K9S8M8          KLLL---KKKNTTS--ALV-TDA------------------SAKVGELDTLS---D--KD
A0A1Z4NFV0      QLLF---QSNRTSA--YTK-I--------------------GENTGSLESLR---H--ES
B0CAX4          KLLL---KKQGGAT--IAD-LEIG-------------------GLGGLEALS---S--KS
A0A350Y0P6      KLLL---QKRSATS--ALV-TEA------------------GEKIGQLEALN---N-FIN
A0A352X940      KLLL---QKKNKTS--ALV-TKA------------------GEKIGELDSLN---A-FIN
B8HTN4          LLLL---KDSENPL--ASM-G--------------------ATSVGNLVALG---G--KS
A0A2A2TPF8      KLLF---QANRTNS--LTG-V--------------------DGKFRDLESIR---R--EA
A0A1Z4R0P8      KILF---QANRTNS--LTG-V--------------------DGKFRDLESIR---R--EA
A0A0T7BUI3      MLLF---KSDRISS--LTK-A--------------------GEKIGDLESLI---R--EN
A0A1Z4LP32      LLLF---KSDRISS--LTK-A--------------------GEKIGDLESLM---R--EG
K9REP9          LLLF---KSDRISS--LTK-A--------------------GEKIGDLESLM---R--EG
A0A1Z4SIJ3      MLLF---KSDRISS--LTK-A--------------------GEKIGDLESLM---R--QG
A0A2H2XPG4      MLLF---KSDRISS--LTK-A--------------------GEKIGDLESLM---R--QG
K9V3C7          KLLF---QTNRTSS--LTG-V--------------------GEKIGSLESFR---N--EA
A0A1Z4T6Y7      KLLF---QTNRASF--LTG-V--------------------GEKIGDLETVR---R--EA
A0A2H2Y561      KLLF---QTNRASF--LTG-V--------------------GEKIGDLETVR---R--EA
A0A1Q4S362      KLLF---QANRASL--LTG-V--------------------GEKVGDLESVR---R--EA
A0A3S1CIN8      KLLF---QANRASL--LTG-V--------------------GEKVGDLESVR---R--EA
A0A2A2TC28      MLLF---KSDRTSS--LTK-V--------------------GEKIGDLESLM---R--EG
A0A0C1NCB0      ILLI---QSDRTSS--LTK-A--------------------GEKIGHLESLM---R--EG
A0A2N6K7Q9      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A2N6MXH6      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A2N6M5A8      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A2N6LL61      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A0S3TP66      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
G6FP91          ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A1U7GYR5      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A2N6KY52      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A2N6KMP5      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A2N6MA45      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A4Q9J9V9      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A328IGA1      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A4D9CE41      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A0M0SFT2      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A1Z4TLC8      ILLF---KSDRTSS--LTK-V--------------------GEKIGDLEALM---R--EG
A0A0C2LFH0      MLLF---KSDRTSS--LTK-V--------------------GEKIGDLESLM---R--EG
A0A1Z4IYV4      MLLF---QSDRTSS--LTK-V--------------------GEKIGDLESLM---R--EG
A0A1Z4Q0T6      MLLF---KSDRTSS--LTK-V--------------------GEKIGDLESLM---R--EG
A0A0C2PT44      MLLF---KSDRTSS--LTK-V--------------------GEKIGDLESLM---R--EG
A0A1D2P6J4      MLLF---KSDRTSS--LTK-V--------------------GEKIGDLESLM---R--EG
A0A3M9ZEU1      SLLV---KADRSSS--L--------VGLT------------KVETGELQALT---T--AN
A0A1Z4JK72      RLLV---QSNRTTS--L--------TGVG------------E-KVGTLESLK---R--EG
A0A0N7Z489      RALV---QSNRTTS--L--------TGVG------------E-RVGTLEALR---R--EG
A0A0S3TXS2      RVLV---QSNRTTS--L--------TGVG------------E-RVGTLEALR---R--EG
A0A1Z4RN12      QLLI---KPDRTSK--LIG-ID-------------------T-NPEEIKGLT---Q--DK
A0A2T1CMF9      RLLI---EPEQTSR--RIG-IE-------------------D-GNPEVKKTV---L--EK
Q7NDC5          RLLF---KQKDTAI--DNP-T-AVGLR--------------G-ALGQMGS-V---A--YG
U5QGK3          RLLF---KQKDTAV--GSE-NPARSLR--------------G-SLGQLDS-V---A--FG
A0A2W4UY24      KLLF---ESSKPVT--AIV-GLD------------------T-GEGNLTPLT---S--QS
A0A2T1GMT4      RLLF---KNSTFRV--IGP-NLIPNSMEG------------S-ESGDLKSLV---S--TQ
K9UI51          RLLF---KNSTFRV--IGP-NLIPSNMEG------------S-ESGDLKSLV---S--NQ
K9QM62          KLLF---RIPAFNI--VGS-NLLPNSSEG------------E-FRG-LRALV---S--TQ
A0A1Z4FWI3      KLLF---KSPSFNV--VGT-NLLPNGSEG------------Q-ATGDLKSLV---S--NQ
A0A1Z4JYE7      KLWF---RIPSFKT--IGT-NLLPNNNEG------------D-AAGDLKSLV---S--TQ
A0A2T1FXY4      QLLF---KTPSFNV--VGS-NLLPSISEG------------Q-ETGDLRALV---S--TQ
K9TYI2          KLLF---KTPSFNV--VGS-NLLPSISEG------------Q-ETGDLRALV---S--TQ
A0A1Z4QL41      KLLF---KVPSFQI--LGT-NLLPNSSEG------------G-GIGDLKPLV---S--TQ
A0A252D4T4      KLLF---KTPSFNV--VGT-NLLPSDSEG------------G-TSGDLKPLV---S--TQ
A0A252DJH5      KLLF---KTPSFNV--VGT-NLLPSDSEG------------G-TSGDLKPLV---S--TQ
A0A252EB80      KLLF---KTPSFNV--VGT-NLLPSDSEG------------G-GSGDLKPLV---S--TQ
A0A6G9SKZ9      KLLF---KTPSFSV--VGA-DLLPSESE---------------ARGDLRPLV---S--TQ
A0A1Z4HPW5      KLLF---KTPSFNV--VGT-ELLPTETQ---------------ARGDLRPLV---S--TQ
A0A1Z4MSN1      KLLF---KTPSFNV--VGS-ELLPSESQ---------------ARGDLRPLV---S--TQ
A0A1Z4U1C2      KLLF---KTPSFNV--VGS-ELLPSESQ---------------ARGDLRPLV---S--TQ
A0A0D6KV51      KLLF---KTPTFNV--VGS-ELLPSESQ---------------ARGDLRPLV---S--TQ
A0A1Z4MKF8      KLLF---KTPTFNV--VGS-ELLPSESQ---------------ARGDLRPLV---S--TQ
A0A2C6WC43      KLLF---RIPSFKV--VGS-NLLPTTTEG------------G-STGDLKSLI---A--SQ
A0A1Z4L5A1      KLLF---RIPSFKV--VGS-NLLPTTTEG------------G-STGDLKSLI---A--SQ
A0A367QD86      KLLF---RIPSFKV--VGS-NLLPTTTEG------------G-STGDLKSLI---A--SQ
A0A235IZ96      KLLF---RVPSFKV--AGS-NLSPGSSEG------------G-DSGDLKALV---A--TQ
A0A2L2NGP0      KLLF---RVPSFKV--AGS-NLSPGSSEG------------G-DSGDLKALV---A--TQ
A0A2K8SM78      KLLF---RIPSFKV--VGS-NLFPTNAEG------------G-DPGDLKSLL---A--TQ
A0A2R5FPC0      KLLF---RIPSFKV--VGS-NLFPTNAEG------------G-DPGDLKSLL---A--TQ
A0A5P8W5T6      KLLF---RIPSFKV--VGS-NLLPTNTEG------------G-DAGDLKSLL---A--TQ
A0A140KBA0      QVMI---KTNKSAK--L--------TGLE------------N-DIGKIEVLT---N--ES
K9XSG1          QVMI---KTNKSAK--L--------TGLE------------N-DIGKIEVLT---N--ES
A0A0F5YE28      KLLF---KVDRTSS--L--------AGIG------------E-GLGELKALL---A--DQ
U7QEH7          KLLF---KVDRTSS--L--------AGIG------------E-GLGELKALL---A--DQ
A0A3S1ATK5      KLLF---KLPSFQV--LGN-NLLRSNSEG------------E---GDLKSLV---S--TQ
A0A2Z6CPH0      KLLF---RMPSFKT--VGT-NLLPNNNEG------------D-QAGDLKSLV---S--TQ
A0A1Z4GT50      KLLF---KTPSFKV--IGS-NLLPNNSEG------------E-EA-DLKPLV---S--TQ
A0A1Z4GIX0      KLLF---RMPSFNV--VGT-NLLPSNNEG------------E-ETGDLRSLV---S--TQ
A0A2H6LC24      KLLF---RMPSFNV--VGT-NLLPSNNEG------------E-ETGDLRSLV---S--TQ
B2J6N5          KLLF---RIPSFKV--VGS-NLLPTNTEG------------G-DAGDLKSLL---A--TQ
A0A367RMI4      KLLF---RVPSFKV--AGN-NLYPDTSEG------------G-DAGDLKPLV---A--TQ
A0A235HUM0      KLLF---RVPSFKV--AGN-NLSPGTSEG------------G-DSGDLKPLV---A--TQ
A0A2L2NW47      KLLF---RVPSFKV--GGN-NLSPGTAEG------------G-DSGDLKPLV---A--TQ
A0A1E2WUR1      KLLF---RLPSFKV--AGT-NLSPGSSEG------------G-DSGDLKPLV---A--TQ
A0A235IKU3      KLLF---RVPSFKV--AGS-NLSPGSSEG------------G-DSGDLKALV---A--TQ
F4XKF3          KLLF---KIDRTAF--L--------TGLG------------E-EIDQLRPLV---D--AQ
A0A1D9FX10      KLLF---KIDRTAF--L--------TGLG------------E-EIDQLRPLV---D--AQ
A0A1D8TNX9      KLLF---KIDRTAF--L--------TGLG------------E-EIDQLRPLV---D--AQ
A0A1U7MYU6      KLLF---KIDRTAF--L--------TGLG------------E-EIEQLRPLV---D--AQ
A0A3C0NJ41      KLLF---KVNRTAS--L--------TGVGQVERLEGGQTAQQ-PVGGLGALT---Q--TG
A0A352AG88      KLLF---KVSRTAD--L--------TGVG------------Q-QVGELAPLT---T--NS
A0A350Y374      KLLF---KVNRTTS--L--------TGLG------------K-EVGNFAPLT---T--DS
A0A355DPX0      KLLF---KVNRTTS--L--------TGLG------------K-EVGNFAPLT---T--DS
A0A0D8ZUV2      KLLL---KRVNETS--AAT-GLGS-------------------QIGELDTLA---Q--QT
A0A433VDI0      KLML---KKVDWAS--AAT-GVGE-------------------QIGELDTLA---Q--QS
A0A3D1PG43      KILL---KKIDNAS--SVT-ELSQ-----------------T-DNSELEPLS---Q--LG
A0A2P8QQ72      KLLL---KKPSETS--SLN---PE-----------------K-YEPRLEPLS---A--ES
K9TZQ7          KLLL---KKPSETS--SLN---PE-----------------K-YEPRLEPLS---A--ES
A0A2G7GPR0      KLLF---KRADRTT--AIS-GLKD-----------------I-NVGELEAIA---T--KA
K9XH68          KLLF---RKADRTT--AIS-GLKD-----------------I-NVGELEALA---T--KA
A0A1U7HW70      KLLF---RKADRTT--AIS-GLKD-----------------I-NVGELEAIA---T--KA
A0A2S6VEJ8      KLLF---RKADRTA--AIS-GLKD-----------------I-NVGELEALA---A--KA
                                                                            

K9SLA9          DR----LANEAAVIKSNAIAKEVVGVLNQTATEN--------------------------
A0A168TT23      QGVEQFYQTQYEILRGRQLAENVVEKLE--VWDH---------------------PELSG
A0A0M1JWX9      GSGVD-YQSQIALLRSPKLMEPIIQQLKPKYPEV--------------------------
A0A2T1M1V6      TREVNPLYTQSAILMSDSVLGRVLTVDPEKSE-F--------------------------
A0A2G7GCS2      TRELNPLQIQMTILTSDTVMERALAVDPEKSL-Y--------------------------
K9XBH8          SRELNPLQTQLSILTSDTVMQRVLSVDPEKSS-Y--------------------------
A0A1Z4LJ30      SQQINPLNILSSVAMSDRVIQEVWQNDPEKAD-F--------------------------
K9RI76          SQQLNPLNILSSIATSDHVVEEVWQNDPEKSE-Y--------------------------
A0A352AE27      SNQLNPLKVQAYILTSDALMQRLWASDTENSQ-F--------------------------
A0A3B8JH60      STEVNPLKVQASILTSDELLQKARAIDPEKNK-A--------------------------
A0A3C0N766      STEVNPLKVQASILTSDELLQKARAIDPEKNK-A--------------------------
K9W9J7          SSEVNPLKVQASILTSDALLEQVLVSDPQKTK-F--------------------------
A0A139WSU3      SSEVNPLNVQASILTSDTLLEKVLASDPERGK-F--------------------------
A0A433VN22      SPELNPLKVQTSILMSDALLEKVLDSDPEKNK-F--------------------------
Q7NF11          SSEVNALKVQSAILTSSEVLSKAWQADPQREK-Y--------------------------
A0A1Z4JCS8      SPQVNPLKIQEAILTSDAILEKAWAADPERDA-A--------------------------
F4XTX2          SAKSHPLNMQASILKSDALMRRLLESDPEKTD-F--------------------------
Q7NJN6          SNELNPTSIQSNILLSSDVLRPVWQKDPERTEKF--------------------------
U5QCC3          STELSPTTIQSNILLSDSVLRRVWLKDPEKQEKF--------------------------
A0A3S0Y9N9      KP----MGTEVAVLRSLPIAERTINALS--------------------------------
A0A433UNK7      RP----LGTEVAVLRSLPLAEQTINAIR--------------------------------
A0A3M1SVZ4      SP----LDTEAEIISSVPIVEQTIAALQ--------------------------------
A0A654SFI6      VSELQYLNTQYELLESRFMATRVADAAS--------------------------------
K9SSQ0          NS----LSTQAAILASRPLIETALPKIP--------------------------------
A0A2W1JIN9      GA----LANQEEIVSSKRLLERAL------------------------------------
A0A318AJV1      ET----METEAGLMASRGLAVAVVRKLH--------------------------------
A0A6B3MUB5      NP----IANQAELVKSQRILQQAIDQVF--------------------------------
A0A1U7N2U4      SP----IATQAELVGSQRVLQGALYQI---------------------------------
A0A1D9G1F2      DP----IATQAELVGSERLLQGALDEI---------------------------------
F4XV38          DP----IATQAELVGSERLLQGALDEI---------------------------------
A0A2P8QIL5      NP----VATQAELALSQKVLRQAIYEAY--------------------------------
A0A2T1FLY5      NP----VATQAELALSQKVLRQAIYEAY--------------------------------
A0A433W447      NP----VATQAELALSQKVLRQAIYEAY--------------------------------
K9U1K8          NP----VATQAELALSQKVLRQAIYEAY--------------------------------
K9UYB2          SP----LANQAEVVKSERVLQKALEIAS--------------------------------
A0A218QN17      SP----LANEAELVKSQRVLERAIALAS--------------------------------
K9RKN2          SP----LADQAELVKSQRVLEKAIKIFS--------------------------------
A0A2I8ADV2      NP----LADQAELVKSQAVLDQAIKTLA--------------------------------
A0A1W5CKM3      NP----LADQAELLKSQTVLQLAISKLN--------------------------------
A0A5Q0GMF5      NP----LADQAELLKSQTVLQLAISKLN--------------------------------
Q3MEW0          NP----LADQAELLKSQTVLQLAISKLN--------------------------------
A0A1Z4KIC7      NP----LADQAELLKSQTVLQLAISKLN--------------------------------
Q8YSM5          NP----LADQAELLKSQTVLQLAISKLN--------------------------------
A0A1Q4S1H4      SA----LGDQAELIKSQQVLEKALTALK--------------------------------
A0A433VBU6      SP----LADQAELIKSQQVLEKALTALK--------------------------------
A0A1Q4RZJ6      SP----LANQAELIKSERILTQALAIAG--------------------------------
A0A1Z4SNV3      SA----LANQAELIKSERILNQALAI----------------------------------
A0A2H2XJQ1      SA----LANQAELIKSERILNQALAI----------------------------------
A0A3S5K358      SP----LANQAELIKSERILTQALAIVG--------------------------------
A0A0T7BPJ4      SP----LADQAELVKSEKVLEKAIAATY--------------------------------
A0A0C1QS61      SP----LADQAELVKSQRVLNRALQIFK--------------------------------
A0A139X3R8      SP----LADQAELAKSQRVLNRALQIFQ--------------------------------
A0A1Z4I7C5      NP----LADQAEFLKSQPVLQLAISKLN--------------------------------
A0A0C2MDK7      SP----LADQAELIKSQRVLERAIAIAF--------------------------------
A0A1Y0RCK1      SP----LADQAELIKSQRVLERAIAIAF--------------------------------
A0A1Z4PWZ0      SP----LADQAELVKSQRVLERAIAIAF--------------------------------
A0A0C2QLT0      SP----LADQAELIKSQRVLERAIAIAF--------------------------------
A0A1Z4J2K1      SP----LADQAELIKSQRVLEQAVAIAF--------------------------------
A0A3S0ZSX0      SP----LADQAELIKSQRVLRRAIARVI--------------------------------
A0A2N6K4T3      NP----LADQAELIKSQRVLQRALTEVT--------------------------------
A0A370CKT2      NP----LADQAELIKSQRVLQRALTEVT--------------------------------
A0A0S3TL97      NP----LADQAELIKSQRVLQRALTEVT--------------------------------
A0A2N6M8A0      NP----LADQAELIKSQRVLQRALTEVT--------------------------------
A0A2N6M9E1      NP----LADQAELIKSQRVLQRALTEVT--------------------------------
A0A2N6KJI4      NP----LADQAELIKSQRVLQRALTEVT--------------------------------
A0A2N6MZ77      NP----LADQAELIKSQRVLQRALTEVT--------------------------------
A0A2N6KT20      NP----LADQAELIKSQRVLQRALTEVT--------------------------------
G6FSN3          NP----LADQAELIKSQRVLQRALTEVT--------------------------------
A0A4D9CI02      NP----LADQAELIKSQRVLQKALAKVA--------------------------------
A0A328I8B9      NP----LADQAELIKSQRVLQKALAKVA--------------------------------
A0A4Q9J4Z7      NP----LADQAELIKSQRVLQKALAKVA--------------------------------
A0A0M0SU69      NP----LADQAELIKSQRILQKALTKVA--------------------------------
A0A1Z4TIZ8      NP----LADQAELIKSQRVLQKALAKVS--------------------------------
A0A0S3TYD7      GP----LTTQAELIKSLPIVQRTIEDLN--LQDD----------------------D--N
A0A3C0N2P0      PD----YDTQIQVLWSPQVLSKIVKEIQ-----T----------------------R--Y
K9TLQ0          LD----YETQMEVLLSSPIINPIFTNIQ-----Q----------------------N--Y
A0A6B3M6M6      LD----YESQIEVLKSPQVMSPIVESIQ-----A----------------------R--Y
A0A6B3NIJ0      LD----YESQIEVLRSPQVMLPIVESIQ-----A----------------------R--Y
A0A352XE00      PD----YETQIQVLWSSQIMIPIVKKIQ-----A----------------------Q--Y
B4VS56          ID----YETQIQVLWSPQVMTPIVEQIQ-----S----------------------R--Y
A0A352AAQ3      PD----YETQIQVLWSPQVMAPIVKKIQ-----A----------------------R--Y
A0A350Y472      PD----YETQIQVLWSPQVMAPIVAQIQ-----S----------------------R--Y
A0A355DVB4      PD----YETQIQVLWSPQVMTPIVKQIQ-----S----------------------R--Y
U5QL42          AN----LETEIQILKSRSLIGRAIHRLA-----P----------------------P--F
K9QF04          RD----FKTEIEVLASYKVISPLLPTIQ-----S----------------------R--Y
A0A076HBF2      ND----IPTLIEVLQSPVLLQPVADKFE--------------------------------
A0A354B169      ND----LPTLIEVLRSPMLLNPIAQHFD--------------------------------
G4FMX5          ND----LPTLIELLQSPLLLSPIAERFD--------------------------------
Q0IDT5          ND----IPTLIEVLESPLLLAPIAKRFD--------------------------------
A0A2D6FCW3      ND----IPTLIELLQSPLLLSPIAQRYD--------------------------------
A3ZA21          ND----IPTLIEVLQSPLLLAPIAKRFD--------------------------------
A0A140K3H3      KD----LSTEVLVLRSYPLIAKAVKQVQ-----Q----------------------K--Y
K9XUB8          KD----LSTEILVLRSYPLIAKAVEKVQ-----Q----------------------E--Y
Q7NEU3          -D----INTQIEVLLRRPLIEKALRVLR--PKFP----------------------E--L
A0A6H2NHD5      LD----YTSQIRVLRSPGVINPILESIQ-----Q----------------------R--Y
A0A2P8W4F7      LD----YDSQIRVLRGPAVIEPILADIQ-----R----------------------R--Y
A0A5Q4E0Z4      LD----YTSQIRVLRGPDVINPILANIQ-----R----------------------Q--Y
A0A2P8VVX1      AD----YATQLALMRSGQFLQEAVDVLR-----T----------------------D--Y
A0A2P8WHY0      ID----YNTQLTLMRSEQFLREAVASLE-----A----------------------E--Y
A0A2T1CMT9      -D----YTTQIKVLTSHEILQRVVNQLK--LKDQ----------------------R--S
A0A563VQJ3      TP----LKNEIEKITASPVLQETIDQLE--LTDG----------------------E--G
A0A1D8TX52      -D----YATQLQLMGSSELIQRAVDLLR-----D----------------------D--Y
A0A1D9G4T2      -D----YATQLQLMRSSELIQRAVDLLR-----D----------------------D--Y
F4XP71          -D----YATQLQLMRSSELIQRAVDLLR-----D----------------------D--Y
A0A1U7N5X9      -D----YATQLQLMRSSELMKRAVELLR-----D----------------------D--Y
A0A6B3N2I8      -D----YATQLQLMRSSELIQRAVDLLR-----D----------------------D--Y
A0A2W6ZAV2      AN----TPVLIEVLTSPLLLEPIAQRL---------------------------------
A0A2G7GMH8      -D----IATQINLMSSSILLQRAVSLLQ-----P----------------------E--Y
K9W742          -D----SATQLNLMQGSQLLQKALDLLR-----P----------------------D--Y
A0A2T1DWE8      -D----YSTQLTQMRSSQLLQKAVVLLQ-----A----------------------E--Y
A0A1U7I8L3      -D----YATQLNLMRSSQLIQKAVDLLR-----P----------------------Q--Y
A0A2T1DJL8      -D----NATQLNLMRSSQLLQRAVDQLK-----L----------------------N--G
A0A1Z4J9W0      -D----AATQVNLMRSGQLLQRAVDQLK-----P----------------------R--Y
A0A0N7Z5K9      -D----TATQVNLMRSTQLLQRAVDELQ-----P----------------------R--Y
A0A0S3TXC5      -D----TATQVNLMRSTPLLQRAVDELK-----P----------------------R--Y
K9SA61          -D----YSTQLQLMKSSQLLQRAVDQLK-----P----------------------T--Y
A0A3D1PBA3      DD----YATQINVMRSSLLLQRAADILR-----P----------------------E--Y
K9XPB0          -D----YPTQLKLMRSSYLLKKVVKKLG-----V----------------------E--G
A0A350Y7Z1      -D----YATQLNLMRSSQLIQKAVDRLH-----P----------------------K--Y
A0A352X2A7      -D----YTTQINLMRSSQLIQRAVNLLQ-----D----------------------K--Y
A0A0D8ZYV0      -D----YATQINVMRSTLLLQRAVDLLK-----P----------------------E--Y
A0A2T1FP73      DD----YATQINVMRSSLLIQRAVDILR-----S----------------------E--Y
A0A433VMS2      DD----YATQINVMRSSLLIQRAVDILR-----S----------------------E--Y
K9TYA7          DD----YATQINVMRSSLLIQRAVDILR-----S----------------------E--Y
A0A2P8QUE1      DD----YATQINVMRSSLLIQRAVDILR-----S----------------------E--Y
A0A2T1DNG3      VD----YATQISLMQSSNLLKKAMTLLQTEYPEL----------------------D-PD
B8HNB0          NP----LINEIQVLQSSSLVTKAQQQLKPPHNKT--------------------------
A0A1Z4LN32      NP----LDTQAIILQSEPIIKDVVKSLE--LKGN----------------------N--G
A0A2I8A9F5      NP----LDTQALLVRSKPILEEVVNTLN--LKDK----------------------K--G
A0A218Q6R8      NP----LDTQALLVRSTPIIEDVINTLE--LKDQ----------------------E--N
A0A218QGE0      NP----LDTQAIVMQSEPVMQDAIETLK--LKDK----------------------K--G
A0A563VS48      DP----LATEAEILRSRPILEKLIKELD--LRDE----------------------G--G
A0A318BJ18      EF----YETQYGLLRSRALSERVATQLR-LVDDPKFYEMYKFNSDDPAFQLVNGRYTSTG
A0A3B8Y8H9      NY----FLTQIQILYSYKIIAPVLEKLNKVFPPE----------------------TEEE
A0A2W1JVB9      SP----LDTEIETILSVPVLQEALKQLK--LTDD----------------------E--G
A0A6H1U102      KD----RSTEIQILQSHSLVAKAISRLE--DSTS----------------------Q---
A0A563VLD6      RD----LSTEILVLRSNSLISQAIAQYP--NTFK-------------------------G
A0A2P8W9H0      TI----DETRLRILTSPRVIEPILKELQ--KSQP----------------------S---
A0A6I5P386      AV----DETTLKILESPRVMKPILEELQ--KIYP----------------------E---
A0A318BG22      MF----METQLAFIRSRAMAEGIVKRLH--LDQN----------DAFVDDAATGGGD--G
A0A1Z3HMQ0      DP----LSTQAAILSSLPVLQEAVNALD--LQDA----------------------K--G
K1XF69          TP----LSTQIELMYSNPLLETVIERLN--LTNE----------------------D--G
B5W297          TP----LSTQIELMYSNPLLETVIERLN--LTNE----------------------D--G
A0A6H2AL05      TP----LSTQIELMYSNPLLETVIERLN--LTNE----------------------D--G
H1W7M8          TP----LSTQIELMYSNPLLETVIERLN--LTNE----------------------D--G
A0A5Q4H6A5      TP----LSTQIELMHSNPLLETVIERLN--LTNE----------------------D--G
D5A466          TP----LSTQIELMHSNPLLETVIERLN--LTNE----------------------D--G
U5QJM6          TQ----INTQLQVLLSRPLVNKAVVRLS--KKYP----------------------K--L
A0A1Z4RPC6      TP----LSTEKLRITSEPVLQQTIDQLK--LVDA----------------------A--G
A0A2T1CMZ0      TP----LSTEKLRMISEPVLQQTIDQLK--LENS----------------------L--G
L8M4F7          SP----LHNQREQIFTSAVLQQTVENLD--LKNE----------------------N--G
A0A140K2P2      SP----LSTQIEVITSDPVLQQTIDQLK--LVDD----------------------Q--G
K9XWX4          SP----LSTQIEVITSTPVIQQTIDKLK--LQDD----------------------Q--G
A0A140KB14      SP----LKTEIERMKAEPILVQTIEKLK--LKDE----------------------E--G
K9XX88          SP----LKTEIERMKTEPILVQTIEKLK--LKDE----------------------E--G
A0A563VSV6      TP----LLTQQEVISSAPVLQQTIEILK--LTNE----------------------E--G
L8LZE9          TP----LVSQKEILTSSPILQKTIDQLS--LTDA----------------------E--G
A0A433NM31      YP----VNTQAEIINSVAFAQRTINELD--LKNE----------------------Q--G
A0A1Z4NDS1      NP----SDTQVKIITSNQVIQETIQRLG--LKDS----------------------E--G
K9F4D9          NP----LDTQIEVFRSIPLVQKVIETLK--LQDD----------------------E--G
U9VXM0          NP----LDTQIEVFGSIPLVQQVIEQLK--LQND----------------------E--G
A0A6I5QPI5      DP----LDTQAELIRSLPLMQATVDALG--LTTS----------------------S--G
A0A433W533      NP----VNTEIEVVRSIPLLQKTIAALN--LKDD----------------------R-TS
A0A2P8QWJ3      NP----VNTEIEVVRSIPLLQKTIAALN--LKDD----------------------R-TS
A0A2T1FKP8      NP----VNTEIEVVRSIPLLQKTIAALN--LKDD----------------------R-TS
K9U6L7          NP----VNTEIEVVRSIPLLQKTIAALN--LKDD----------------------R-TS
A0A1E5QP61      NP----LDTEAEVISSMPIVKETVEALN--FRDD----------------------Q--G
U5DPF5          TL----LANEAAIIRSLPIGQQVIERLD--IRNA----------------------D--G
A0A3M1PML8      NP----VDSQAQIIQSAPIVSEVIRSLD--LRDE----------------------K--G
A0A3M2GIL5      SP----LDTEAEIISSTPIIEQTIAELQ--LKGP----------------------E--G
A0A6H1TSJ9      SP----LDTEAEIISSTPIIEQTIAELQ--LKGP----------------------E--G
A0A0T7BPZ0      NP----VETQAKIVASVPVIQKTIRSLD--LKDN----------------------Q--G
A0A352X442      DP----IATAAAIVKSRPIAEKTVAELN--LRDE----------------------T--G
A0A6B3NF44      DP----LATQAEIIRSRPIAQKTIEILQ--LKDE----------------------E--G
A0A0M0SHU3      SP----VDTQAKIVISVPVIQETITSLS--LKND----------------------E--G
A0A1D2PBN3      NP----SDTQAKIVASVPVIQETITELD--LRDN----------------------K--G
A0A0C2LVR7      NP----SDTQAKIVASVPVIQETITELD--LRDK----------------------R--G
A0A1Z4PQB9      NP----SDTQAKIVVSVPVIQETITELD--LRDD----------------------K--G
A0A1Z4SFN6      NP----LETQAKIVESVPVIQETIRTLN--LKDD----------------------E--G
K9PGI8          SP----SDTQAKIVVSVPVIQETIRVLK--LKNE----------------------R--G
A0A2T1E9V8      SS----LNTESRLILSENILRKILDIVN--ENSS----------------------Q--K
A0A3M2GQQ6      KD----LSTEIQILRSHALVAKAIAALG--DTDN--------------------------
A0A6H1U2X0      KD----LSTEIQILRSHALVAKAIAALG--DTDN--------------------------
K9SGJ5          PS----LDTEIAILKSRSLIEPAVAQLD--NIDP----------------------TMT-
A0A6C2DSN4      IN----LGTEIGILKSRPLIESAIAKMR--QSSD----------------------GSS-
L8MYT6          IN----LGTEIGILKSRPLIESAIAKMR--QSSD----------------------GSS-
A0A352JGJ6      IN----LGTEIGILRSRPLIEVAVTKIK--QSSA----------------------SSKI
A0A1J5GLS2      IN----LGTEIGILRSRPLIEVAVAKMK--QSPT----------------------ASAY
A0A2W4W6M5      IN----LGTEIGILRSRPLIEVAVSKMR--QSPS----------------------ANTY
A0A2W7AN33      VD----LGTEIAILKSRPLIETAVCKMQ--QSPT----------------------AIPY
A0A256BLV2      VN----LGTEVAILKSRPLIEIAVSKMQ--QSPS----------------------ALSF
A0A2W6ZXF3      IN----LGTEIGILRSRPLIEIAVAKMR--QSPT----------------------ASSY
A0A2Z5WX66      IN----LGTEIGILRSRPLIEVAVAKLQ--QSAS----------------------SNAS
K9W1T3          NQ----INTQAELINSIPVAQETIATLN--LS------------------------Q---
A0A1Q4RTR1      NP----LETQAEIIRSQPVIQKTIDILE--LKNK----------------------K--G
A0A1Z4SQV2      NP----LETQAEIIRSQPLVQKTIDTLE--LRNN----------------------N--G
A0A2H2XGN1      NP----LETQAEIIRSQPLVQKTIDTLE--LRNN----------------------N--G
A0A433UXH8      NP----LETQAELIRSQPLVQKTIDALE--LKNS----------------------K--G
A0A1Z4RMB9      TP----LTTQIQVLRSEPVVQQVIDQLK--LTDN----------------------E--D
B4WP72          DP----LRTQAEIIQSLPTLEKAIATAE--AAVI-------------------------E
A0A318B4H2      QF----YETQYNLLKARSLAERVARVLG--LQNDDKFFAMYGGEEPSAAAPRTRSAQEQG
B4WQE3          LL----DDTKLKILTSPRVLVSAVEELE--KTYP----------------------D---
A0A2K3BR24      GP----LTNQSQIMQSAPMLQEVIDRLG--LKND----------------------E--G
K9YXY1          GP----LTNQSQIMQSAPMLQEVVDRLG--LKND----------------------E--G
A0A1U7HGH0      TS----LATEAKVIRSIPILQQALEQIN--EASQ----------------------N---
K9XJD3          TS----LATEAKVIRSVPILQQALEQIN--EASQ----------------------N---
K9SX01          DP----RYTQLQVIRSTPVVAQTIKAL--------------------------------A
A0A4P7ZT55      VD----LPNLIEVLTSPMLLQPLANAQG--LEPD----------------------ALVG
A0A1E5QIR9      NP----LDTEVAIVRSVATSEGVMQALD--LRDE----------------------E--G
A0A1Z4IBC7      NP----LETQVRIIGSNPVLERTINTLN--LKEA----------------------N--G
A0A1W5CPC7      NP----LETQVRIIGSNPVLEQTIKALN--LKDK----------------------N--G
A0A5Q0GKD1      NP----LETQVRIIGSNPVLEQTIKALN--LKDK----------------------N--G
Q3MDC6          NP----LETQVRIIGSNPVLEQTIKALN--LKDK----------------------N--G
A0A1Z4KM73      NP----LETQVRIIGSNPVLQQTIKALN--LKDQ----------------------N--G
Q8YNX7          NP----LETQVRIIGSNPVLQQTIKALN--LKDQ----------------------N--G
A0A367R4K6      NP----LETQVKIVGSNPVLEQTIKELN--LTDN----------------------H--G
A0A1E2WSV8      NP----LETQVRVIGSNPVIEKTINSLK--LKDS----------------------Q--G
A0A2R5FRT9      NP----LETQVRVIGSNPVIEKTINSLN--LKDS----------------------K--G
A0A2K8T1B6      NP----LETQVRVIGSNPVIEETINSLN--LKDS----------------------K--G
A0A235I9I0      NP----LETQVRVIGSNPVIEKTINSLN--LKDG----------------------Q--G
A0A2D0HQT8      NP----LETQVRVIGSNPVIEKTINSLN--LKDS----------------------Q--G
A0A2L2NU95      NP----LETQVRVIGSNPVIEKTINSLN--LKDS----------------------Q--G
A0A367S084      NP----LETQVRVIGSNPVIEKTINSLN--LKDS----------------------Q--G
A0A0V7ZFJ4      NP----LATEAQIIRSRPIIQKTISKLN--LRDS----------------------K--G
A0A367RIS1      NP----LETEAEIIRSNPLTQKTIAELH--LKDK----------------------L--G
A0A235IXQ2      NP----LETEAEIIRSYPLTKKTIAELQ--LKDK----------------------L--G
A0A1W5CNX3      NP----LETEAEIIRSNPIIQKTIAESQ--LKDE----------------------Q--G
A0A5Q0GJJ5      NP----LETEAEIIRSNPIIQKTIAESQ--LKDE----------------------Q--G
Q3MEB7          NP----LETEAEIIRSNPIIQKTIAESQ--LKDE----------------------Q--G
A0A1Z4KHN9      NP----LETEAEIIRSNPIIQKTIAESQ--LKDE----------------------Q--G
Q8YT70          NP----LETEAEIIRSNPIIQKTIAESQ--LKDE----------------------Q--G
A0A218Q4C1      NP----LDTQAEIIRSHPLIQQTIDNLQ--LKNQ----------------------E--G
A0A166IWU6      NP----LETQAEIIRSHPLIQKTIVDLQ--LKDQ----------------------E--G
A0A2S0Q8C0      NP----LETQAEIIRSHPLIQKTIVDLQ--LKDQ----------------------E--G
W6FSX4          NP----LETQAEIIRSHPLIEKTIVDLQ--LKDQ----------------------E--G
A0A0V7ZNJ9      NP----LETEAKVIRSNPIIQKTIDKFN--LRDD----------------------D--N
A0A0R0M9H9      NP----IDTEAEVIRSHPLITKTINQLG--IKNT----------------------K--G
A0A1S1ZVW2      NP----IDTEAEVIRSHPLITKTINQLG--TKNT----------------------K--G
A0A1B7WX82      NP----VDTESEIIRSYPIIIKTITTLK--LTDD----------------------K--G
A0A1B7WTD1      NP----VDTEAEVIRSNPIISKTINDLK--LKGK----------------------K--G
A0A480ABC0      NP----VDTEAEVIRSNPIVTKTITELK--LKGR----------------------K--G
A0A1Z4LRU5      NP----LDTEAEVIQSHPLIKETITKLN--LINE----------------------E--G
A0A1Z4JVB4      NP----VDTEAEVIRSYPIIQKTITTLK--LKDK----------------------K--G
K9PIA4          NP----VDTEAEVIRSYPIINKTITTLN--LKDE----------------------T--G
A0A1Z4HVE1      NP----VDTEAEVIRSNPIVLKTITSLN--LKDK----------------------S--G
A0A252ECZ1      NP----VDTEAEVIRSNPIVQKTITSLN--LKDK----------------------S--G
A0A1Z4G5Y1      NP----VDTEAEVIRSNPIVQKTIASLN--LKDK----------------------S--G
A0A252DNA2      NP----VDTEAEVIRSNSIVQKTITSLK--LKDK----------------------S--G
A0A252E1Q4      NP----VDTEAEVIRSNSIVQKTITSLK--LKDK----------------------S--G
A0A6G9SK36      NP----VDTEAEVVRSNPIVQKTIISLN--LKDR----------------------W--G
A0A1Z4M597      NP----VDTEAEVIRSNPIVLKTITSLD--LKDK----------------------S--G
A0A1Z4MWT1      NP----VDTEAEVIRSNPIVLKTITSLN--LKDK----------------------S--G
A0A1Z4TX53      NP----VDTEAEVIRSNPIVLKTITSLN--LKDK----------------------S--G
A0A5P8VSD1      NL----LETEAEIIRSHPLTQKIIDELH--IKDN----------------------L--G
A0A2A2TNQ5      NP----LETEAEIIRSNPLVKKIVNELE--MQDK----------------------K--G
A0A3S1C4K5      SP----LDTEAEVIRSNPLVKKTISELE--LKDK----------------------K--G
A0A1X4G3D5      SG----LENEAEVIRSRPMLEQLVETLE--LQDD----------------------E--G
D4TNI2          SG----LENEAEVIRSRPMLEQLVETLE--LQDD----------------------E--G
A0A1Z4H6Z8      NP----VDTEAEVIRSNPIIQKTITSLN--LKDK----------------------S--G
A0A1Z4NPM1      NP----LDTEAEVIRSTPSVQKTIEKFQ--LRTP----------------------K--G
A0A3F3KPR9      NP----IDTEAEVIRSHPLITKTINQLG--IKNT----------------------K--G
D4TGN7          NP----IDTEAEVIRSHPLITKTINQLG--IKNT----------------------K--G
A0A1Z4UZW9      NP----VDTESEIIRSYPIVNKTITTLK--LTDD----------------------Q--G
A0A0K2M5H0      NP----VDTESEIIRSYPIVIKTITTLK--LTDN----------------------Q--G
A0A1B7VSH4      NP----VDTESEIIRSYPIVIKTITTLN--LTDD----------------------Q--G
A0A1B7W126      NP----VDTESEIIRSYPIVIKTITTLN--LTDD----------------------Q--G
A0A3D4C6Q6      NP----VDTESEIIRSYPIVIKTITTLN--LTDD----------------------Q--G
A0A1B7UVJ4      NP----VDTESEIIRSYPIVIKTITTLN--LTND----------------------Q--G
A0A1B7UTR1      NP----VDTESEIIRSYPIVIKTITTLN--LTND----------------------Q--G
K7W0A4          NP----VDTESEIIRSYPIVIKTITTLN--LTND----------------------Q--G
A0A5C0DRW9      NP----VDTESEIIRSYPIVIKTITTLN--LTND----------------------Q--G
A0A6H2C088      NP----VDTESEIIRSYPIVIKTITTLN--LTND----------------------Q--G
A0A2T1CIL7      NP----VVTEAEILRSRPILEKAIKQLN--LKND----------------------Q--G
A0A433V7A0      NP----LSTEAEILLSEPLIRETISALN--LKDE----------------------Q--D
A0A2T1FTR8      TP----VNTQAEILKSLTTIKGAL--IE--LRDG----------------------KYAN
K9UA41          TP----VNTQAEILKSLTTIKGAL--VE--LRDG----------------------KYAN
A0A0C2LBE2      NP----SETQAKIVASVPVIQETIAELD--LKDD----------------------K--G
A0A433NN38      SP----VDTQVKIVTSVPVLQETIKALD--LRDS----------------------L--G
A0A2N6K0T2      SP----VDTQAKIVTSVPVIQETITSLS--LKND----------------------D--G
A0A2N6ML72      SP----VDTQAKIVTSVPVLQETITSLS--LKND----------------------E--G
G6FQZ6          SP----VDTQAKIVTSVPVLQATITSLS--LKND----------------------E--G
A0A2N6MQX9      SP----VDTQAKIVTSVPVLQETITSLS--LKDD----------------------E--G
A0A2N6KXT6      SP----VDTQAKIVTSVPVLQETITSLS--LKND----------------------E--G
A0A2N6KGB9      SP----VDTQAKIVTSVPVLQETITSLS--LKND----------------------E--G
A0A2N6L3Y5      SP----VDTQAKIVTSVPVLQATITSLS--LKND----------------------E--G
A0A0S3TIS7      SP----VDTQAKIVTSVPVLQATITSLS--LKND----------------------E--G
A0A1U7GW28      SP----VDTQAKIVTSVPVLQATITSLS--LKND----------------------E--G
A0A2N6LW63      SP----VDTQAKIVTSVPVLQATITSLS--LKND----------------------E--G
A0A328IH74      SP----VDTQAKIVISVPVIQETITSLS--LKNN----------------------E--G
A0A4D9CIB0      SP----VDTQAKIVISVPVIQETITSLS--LKNN----------------------E--G
A0A1Z4TQ63      TP----LDTQAKIVTSVPVIQETITSLS--LKND----------------------E--G
A0A4Q9J8G2      SP----LDTQAKIVTSVPVIQETITTLS--LKDD----------------------E--G
A0A1Z4SMD6      NP----LETQAVILNSEPIIQKVINTLK--LKDK----------------------K--G
A0A2H2Y096      NP----LETQAVILNSEPIIQKVINTLK--LKDK----------------------K--G
K9S8M8          TP----LDTEAEVIRSTPIAEEVITSMG--LRSS----------------------S--G
A0A1Z4NFV0      NP----LSTQAVVLQSRPILEQVIAKLN--LRDR----------------------N--G
B0CAX4          SP----VQTEAEIIRSEPILRQTITALK--LVDD----------------------E--D
A0A350Y0P6      TP----LDTEAQIITAQPILEKTIAKLN--LKTA----------------------E--G
A0A352X940      TP----LDTEAQVITSLPLIQKTIERLN--LKTE----------------------N--G
B8HTN4          SP----IDTEAQIIRSTPIIQELITTLQ--LKDP----------------------Q--G
A0A2A2TPF8      NP----LSTQAVILQSRPILQAVVEKLN--LRDK----------------------T--G
A0A1Z4R0P8      NP----LSTQAVILQSRPILQAVIERLN--LRDD----------------------T--G
A0A0T7BUI3      NP----LNTQAVIVNSQPVIKEVIKTLN--LKDN----------------------Q--G
A0A1Z4LP32      NP----LETQAVVIQSEPILQEVIDTLN--LKDD----------------------D--G
K9REP9          NP----LETQAVIVQSEPILQKVIDTLN--LKDD----------------------D--G
A0A1Z4SIJ3      NP----LETQAVIVDSEPVLEEVIRTLD--LKDK----------------------K--G
A0A2H2XPG4      NP----LETQAVIVDSEPVLEEVIRTLD--LKDK----------------------K--G
K9V3C7          NP----LSTQAAILESRPIVQEVIQALD--LKDN----------------------K--G
A0A1Z4T6Y7      NP----LSTQAEILQSRPILEAVIKKLD--LRDK----------------------N--G
A0A2H2Y561      NP----LSTQAEILQSRPILEAVIKKLD--LRDK----------------------N--G
A0A1Q4S362      NP----LSTQAEILQSRPILEEVIKKLD--LRDK----------------------N--G
A0A3S1CIN8      NP----LSTQAEILQSRPIIEEVIKKLD--LRDK----------------------N--G
A0A2A2TC28      NP----LQTQAVIVNSQPILQEVINNLN--LKDK----------------------D--G
A0A0C1NCB0      NP----SDTQAVVVTSAPILQQVIDKLA--LKNN----------------------D--G
A0A2N6K7Q9      NP----LETQAVIVNSHPMLQEVITSLQ--LKDE----------------------Q--G
A0A2N6MXH6      NP----LETQAVIVNSHPMLQEVITALQ--LKDD----------------------Q--G
A0A2N6M5A8      NP----LETQAVIVNSHPMLQEVITALQ--LKDD----------------------Q--G
A0A2N6LL61      NP----LETQAVIVNSHPMLQEVITALQ--LKDD----------------------Q--G
A0A0S3TP66      NP----LETQAVIVNSHPMLQEVITALQ--LKDD----------------------Q--G
G6FP91          NP----LETQAVIVNSHPMLQEVITALQ--LKDD----------------------Q--G
A0A1U7GYR5      NP----LETQAVIVNSHPMLQEVITALQ--LKDD----------------------Q--G
A0A2N6KY52      NP----LETQAVIVNSHPMLQEVITALQ--LKDD----------------------Q--G
A0A2N6KMP5      NP----LETQAVIVNSHPMLQEVITALQ--LKDD----------------------Q--G
A0A2N6MA45      NP----LETQAVIVNSHPMLQEVITALQ--LKDD----------------------Q--G
A0A4Q9J9V9      NP----LETQAVIVNSHPMLQEVITALD--LKDE----------------------Q--G
A0A328IGA1      NP----LETQAVIVNSHPMLQEVITALD--LKDE----------------------Q--G
A0A4D9CE41      NP----LETQAVIVNSHPMLQEVITALD--LKDE----------------------Q--G
A0A0M0SFT2      NP----LETQAVIVNSHPMLQEVITALD--LKDE----------------------Q--G
A0A1Z4TLC8      NP----LETQAVIVNSHPMLQEVITALD--LKNE----------------------Q--G
A0A0C2LFH0      NP----LETQAVILKSEPILKEVIDTLG--LKDK----------------------K--G
A0A1Z4IYV4      NP----LETQSVILTSQPILEEVIKTLE--LKDK----------------------K--G
A0A1Z4Q0T6      NP----LETQAVILQSQPILEEVINTLR--LKDK----------------------K--G
A0A0C2PT44      NP----LETQAVILKSEPILEEVIKTLE--LKDK----------------------K--G
A0A1D2P6J4      NP----LETQAVILKSEPILEEVINTLG--LKDK----------------------K--G
A0A3M9ZEU1      SP----VETQAEIVRSAAIARATIEALD--LRDD----------------------N--G
A0A1Z4JK72      NP----LDTQAVVVTSYPILQRVIDTLQ--LKNS----------------------K--G
A0A0N7Z489      NP----LDTQAAVVTSYPILQRVIDTLQ--LKNA----------------------Q--G
A0A0S3TXS2      NP----LDTQAAVVTSYPILQRVIDTLQ--LKNS----------------------Q--G
A0A1Z4RN12      DP----IETEAKILQSRPIVERLIKELE--LKND----------------------D--G
A0A2T1CMF9      DP----IETEAEILGSRTIVEKVIQELD--LKSE----------------------K--G
Q7NDC5          NP----LDTQAEILQSRPVAAGVIRDLQ--LGDP----------------------RRPG
U5QGK3          NP----LDTQAEIIQSRPLVEKVIRTLQ--LKDP----------------------QRRG
A0A2W4UY24      NP----LDTQVEIFLSKPIAEKVINQLK--IEDS----------------------E--G
A0A2T1GMT4      NP----ITTQMEVIASRPLLQKTADRLK--LKND----------------------R--G
K9UI51          NP----ITTQMEVIASRPLLQRTADRLK--LKND----------------------R--G
K9QM62          NP----ISTEVEVITSYPLLQRTIDALK--LKNN----------------------Q--G
A0A1Z4FWI3      NP----ISSQIEVISSPTLLQRTIDELQ--LKND----------------------K--G
A0A1Z4JYE7      NP----ISTQVEVISSPPLLEKVINKLE--LTNE----------------------K--G
A0A2T1FXY4      NP----ISSQMEVISSPALLQRTIDELQ--LKND----------------------R--G
K9TYI2          NP----VSSQIEVISSPTLLQQAIDELQ--LKNN----------------------R--G
A0A1Z4QL41      NP----ISTQIEVISSPPVLQKTIDKLK--LKNQ----------------------K--G
A0A252D4T4      NP----ISTQIEVISSPILLQRTIDELQ--LKNA----------------------I--G
A0A252DJH5      NP----ISTQIEVISSPILLQRTIDELQ--LKNA----------------------I--G
A0A252EB80      NP----ISTQIEVISSPILLQRTIDELQ--LKNA----------------------I--G
A0A6G9SKZ9      NP----ITTQIEVITSPLLLQKTIDELQ--LKNN----------------------E--G
A0A1Z4HPW5      NP----ITTQIEVITSPLLLQKTIDELQ--LKNN----------------------Q--G
A0A1Z4MSN1      NP----ITTQIEVITSPLLLQKTIDELQ--LKNK----------------------E--G
A0A1Z4U1C2      NP----ITTQIEVITSPLLLQKTIDELQ--LKNK----------------------E--G
A0A0D6KV51      NP----ITTQIEVITSPLLLQKTIDELQ--LKNK----------------------E--G
A0A1Z4MKF8      NP----ITTQIEVITSPLLLQKTIDELQ--LKNK----------------------E--G
A0A2C6WC43      NP----INTQIEVISSPALLQKTIDKLQ--LKDQ----------------------E--G
A0A1Z4L5A1      NP----INTQIEVISSPALLQKTIDKLQ--LKDK----------------------E--G
A0A367QD86      NP----INTQIEVISSPPLLQKTIDKLQ--LKDK----------------------E--G
A0A235IZ96      NP----VSTQIEVITSPSLLQRAIDKLK--LKDK----------------------E--D
A0A2L2NGP0      NP----VSTQIEVITSPSLLQRAIDKLK--LKDK----------------------E--D
A0A2K8SM78      NP----INTQIEVISSPNLLQRTIDKLQ--LKDE----------------------E--G
A0A2R5FPC0      NP----INTQIEVISSPNLLQRTIDKLG--LKDE----------------------E--G
A0A5P8W5T6      NP----INTQIEVISSPTLLQRTIDKLG--LKDD----------------------E--G
A0A140KBA0      DP----LTTEVEVVSSRPIIDRVIKELD--LRNK----------------------Q--D
K9XSG1          DP----LTTEVEVVSSRPIIDRVIKELD--LRNK----------------------Q--D
A0A0F5YE28      TP----LSTQIEIISSNRLLNQVIEQLN--LVDD----------------------E--G
U7QEH7          TP----LSTQIEIIYSNRLLNQVINQLN--LVDS----------------------E--G
A0A3S1ATK5      NP----ISTEIEVISSRPLLQQTIDKLG--LKNK----------------------K--G
A0A2Z6CPH0      NP----ISTQIEVISSPLLLEQIIDKIQ--LKDE----------------------N--G
A0A1Z4GT50      NP----ISTQIEVITSPPLLQRTIDQLH--LKNN----------------------N--G
A0A1Z4GIX0      NP----INTQIEVISSPPLLQRTIDKLQ--LKND----------------------K--G
A0A2H6LC24      NP----INTQIEVISSPPLLQRTIDKLQ--LKND----------------------K--G
B2J6N5          NP----INTQIEVISSPTLLQRTIDKLQ--LKDQ----------------------E--G
A0A367RMI4      NP----ISSQIEVISSPALLQRTIDKLQ--LKDN----------------------D--G
A0A235HUM0      NP----ISSQIEVISSPALLQRTIDKLQ--LKDK----------------------E--G
A0A2L2NW47      NP----ISSQIEVISSPALLQRTIDKLQ--LKDN----------------------E--G
A0A1E2WUR1      NP----ISSQIEVITSPKLLQRTIDKLQ--LKDN----------------------E--G
A0A235IKU3      NP----VSTQIEVITSPNLLQRAIDKLK--LKDK----------------------E--D
F4XKF3          NP----LSTEVEVIYSHPLLQQIIDQLN--LTDN----------------------E--G
A0A1D9FX10      NP----LSTEVEVIYSHPLLQQIIDQLN--LTDN----------------------E--G
A0A1D8TNX9      NP----LSTEVEVIYSHPLLQQIIDQLN--LTDN----------------------E--G
A0A1U7MYU6      NP----LSTEVEVIYSHPLLQQIIDQLN--LTDN----------------------E--G
A0A3C0NJ41      NP----VSTEMEILHSIPLAQKTIAAFN--LKDN----------------------K--G
A0A352AG88      NP----ITTEIEILRSVPLAKETIAALN--LKSE----------------------D--G
A0A350Y374      NP----ISTEIEILSSLPLLDKTLNTLN--LKDD----------------------Q--G
A0A355DPX0      NP----ISTEIEILSSVPLLDKTLNTLN--LKDD----------------------Q--G
A0A0D8ZUV2      NP----LKTEAAVLSSIPLAQQTITALN--LKDN----------------------D--G
A0A433VDI0      NP----LKTETEVLRSIPLVQRTIAELN--LKDE----------------------A--G
A0A3D1PG43      NP----SQTEIEIMSSRPLAKETIAALN--LKDK----------------------K--G
A0A2P8QQ72      NP----VSTESEIVSSIPLAQKTIAALT--LKDE----------------------E--G
K9TZQ7          NP----VSTESEIVSSIPLAQKTIAALT--LKDE----------------------E--G
A0A2G7GPR0      NP----LNTEIEIIRSVPFVEKTISALN--LRNS----------------------G--G
K9XH68          NP----LNTEIEIIRSVPFLEKTITALN--LRND----------------------G--G
A0A1U7HW70      NP----LNTEIEIIRSVPFLEKTIASLN--LRND----------------------S--G
A0A2S6VEJ8      NP----LNTEIEIIRSVPFLEKTITALN--LRND----------------------N--G
                                                                            

K9SLA9          --------------------------------EL---------EAEQSIESFLANLQVTN
A0A168TT23      EISQRNLYRELRALPGRLVQLIRSDPPSAQPAAV---------QSPEA----ARAAAIRS
A0A0M1JWX9      -------------------------------------------EYKTLVTGEKPPLIIEQ
A0A2T1M1V6      -------------S-----------------------------NLEDY----KKLFTIEP
A0A2G7GCS2      -------------P-----------------------------RLSDY----KLAFSATP
K9XBH8          -------------L-----------------------------RLSDY----KSLFTVSP
A0A1Z4LJ30      -------------S-----------------------------RLNNF----KKLFEVSP
K9RI76          -------------S-----------------------------RLSQF----KKLFEVTP
A0A352AE27      -------------G------------------------------LRSY----KKLFEISP
A0A3B8JH60      -------------P-----------------------------KPSQY----KKLFKVSP
A0A3C0N766      -------------P-----------------------------KPSQY----KKLFKVSP
K9W9J7          -------------S-----------------------------RLAKY----KRLFQVKP
A0A139WSU3      -------------N-----------------------------SISRY----RQLFKVTP
A0A433VN22      -------------K-----------------------------NLEQY----KALFQVSP
Q7NF11          -------------P-----------------------------QLGSY----EKLFKAVP
A0A1Z4JCS8      -------------N-----------------------------KPRNY----GQFFEVTS
F4XTX2          -------------Q-----------------------------RLVQY----KQLFAVSP
Q7NJN6          -------------T-----------------------------RLDTY----GKLFKGKP
U5QCC3          -------------P-----------------------------RLEDY----TKLFKSKI
A0A3S0Y9N9      -------------L------------------NL---------NPLVF----LKELQVKN
A0A433UNK7      -------------L------------------NI---------NPLVF----LKDLEVKN
A0A3M1SVZ4      -------------L--------KNSEGK----LV---------EYSDV----LKNLKLSK
A0A654SFI6      -------------LETD--PAFIEAFDLDEETPV---------TRRDVEQVLLDNIKVTP
K9SSQ0          -------------A-----NLSTNLSKQ----DL---------IT-------QISDHLTI
A0A2W1JIN9      -------------------QSYRQQWDDPVDIPL---------SVGEL----KQSLQTGI
A0A318AJV1      -------------LDR---DPEFASPSRLTHRPA---------TPDQIVTRVTKSVGVSR
A0A6B3MUB5      -------------S-----QYVSNLVT-----KI---------TPKEL----KKDLTVKN
A0A1U7N2U4      -------------------GILGSSPE-----GL---------TINTL----RRDLKVKI
A0A1D9G1F2      -------------------ALLGSSQE-----GL---------TIDTL----REDLKVKI
F4XV38          -------------------ALLGSSQE-----GL---------TIDTL----REDLKVKI
A0A2P8QIL5      -------------T-----ANNRNSNAE----PP---------TVEEL----RKQLKVKT
A0A2T1FLY5      -------------T-----ANNRNSNAE----PP---------TVEEL----RKQLKVKT
A0A433W447      -------------T-----ANNRNSNAE----PP---------TVEEL----RKQLKVKT
K9U1K8          -------------T-----ANNRNSNAE----PP---------TVEEL----RKQLKVKT
K9UYB2          -------------A-----KTSPETLN-----SI---------TTKQL----RRGLRVKV
A0A218QN17      -------------L-----KSYNGSPPS----QI---------TSGDL----SKGLGVKI
K9RKN2          -------------S-----QYKIKNDQNFGKDGL---------TSEYL----RKNLSVKI
A0A2I8ADV2      ----------------------SKHPQI----QL---------TPTDI----SSALKVSI
A0A1W5CKM3      -------------P-----PIKDSSTQK----PL---------TASDI----RSNLKVII
A0A5Q0GMF5      -------------P-----PIKDSSTQK----PL---------TASDI----RSNLKVII
Q3MEW0          -------------P-----PIKDSSTQK----PL---------TASDI----RSNLKVII
A0A1Z4KIC7      -------------P-----PIKDSSTQK----PL---------TPSDI----RSNLKVII
Q8YSM5          -------------P-----PIKDSSTQK----PL---------TPSDI----RSNLKVII
A0A1Q4S1H4      -------------A-----NSQTASQAE----KT---------TLKKL----SRDLKVKI
A0A433VBU6      -------------A-----NPQTASSSE----KL---------SFKQL----SRDLKVKI
A0A1Q4RZJ6      -------------N-----SDGGQNGST----KL---------TVDEF----SQGIRVKT
A0A1Z4SNV3      -------------------AETSEAGRS----TI---------TTAEL----SRGIRIKT
A0A2H2XJQ1      -------------------AETSEAGRS----TI---------TTAEL----SRGIRIKT
A0A3S5K358      -------------NSDVENSEDGQNGST----KL---------TVDEL----SQGIRVKT
A0A0T7BPJ4      -------------P-----PG----VKD----SI---------TPEKL----RKKLKVKI
A0A0C1QS61      -------------S-----SYK---STT----QV---------KIQDL----NKGLGVKI
A0A139X3R8      -------------S-----SHK---TNT----QV---------KTPDL----SKGLGVKI
A0A1Z4I7C5      -------------R-----QQG-NSTQK----KL---------SPSDI----KSNLKVVI
A0A0C2MDK7      -------------P-----QTKGNLSLS----PV---------STAEL----SHNLKVKI
A0A1Y0RCK1      -------------P-----QIKGNLSQS----PV---------STAEL----SHNLKVKI
A0A1Z4PWZ0      -------------P-----EIKGNLSLS----PV---------TTGEL----SHNLKVTI
A0A0C2QLT0      -------------P-----EIKGNLQRS----PV---------TTTEL----SRNLKVKI
A0A1Z4J2K1      -------------P-----EIKGNLQRS----PV---------STAEL----SHNLKVKI
A0A3S0ZSX0      -------------P-----QLNSSSLST----PL---------TPEKV----RQGLKVKI
A0A2N6K4T3      -------------A-----ESGFRSPEN----EL---------TVDQL----TQGLKVKI
A0A370CKT2      -------------A-----ESGFRSPEN----EL---------TVDQL----SQGLKIKI
A0A0S3TL97      -------------A-----ESGFRSPEN----EL---------TVDQL----SQGLKIKI
A0A2N6M8A0      -------------A-----ESGFRSPEN----EL---------TVDQL----SQGLKIKI
A0A2N6M9E1      -------------A-----ESGFRSPEN----EL---------TVDQL----SQGLKVKI
A0A2N6KJI4      -------------A-----ESGFRSPEN----EL---------TVDQL----SQGLKIKI
A0A2N6MZ77      -------------A-----ESGFRSPEN----EL---------TVDQL----SQGLKIKI
A0A2N6KT20      -------------A-----ESGFRSPEN----EL---------TVDQL----SQGLKIKI
G6FSN3          -------------A-----ESGFRSPEN----EL---------TVDQL----SQGLKIKI
A0A4D9CI02      -------------A-----ESGFSSPEN----EL---------TVGQL----SRNLKVKI
A0A328I8B9      -------------A-----ESGFSSLEN----EL---------TVGQL----SRNLKVKI
A0A4Q9J4Z7      -------------A-----ESGFSSVEN----EL---------TVGQL----SRNLKVKI
A0A0M0SU69      -------------A-----ESGFSLPEN----EL---------TVGQL----SQNLKVKI
A0A1Z4TIZ8      -------------A-----ESGFSPPGN----EL---------TVEQL----SQNLKVKI
A0A0S3TYD7      -------------A------------------PL---------KVEDF----LKRLKVTP
A0A3C0N2P0      -------------P------------------DI---------DANTL----RSQLQISR
K9TLQ0          -------------P------------------EL---------KFEEL----IKNLSVRR
A0A6B3M6M6      -------------P------------------EF---------DYNTL----QEQLTVSQ
A0A6B3NIJ0      -------------P------------------EF---------DYDSF----QDKLTVTQ
A0A352XE00      -------------P------------------EI---------DYNLL----RTKLTISR
B4VS56          -------------P------------------EI---------DYNTL----RSQLAINQ
A0A352AAQ3      -------------P------------------TV---------DYDTL----RTKLIISR
A0A350Y472      -------------P------------------EV---------DYSAL----RTKLTISR
A0A355DVB4      -------------P------------------EV---------DYSAL----RTKLTISR
U5QL42          -------------N------------------IL---------NSTTA----ADNISISQ
K9QF04          -------------P------------------DI---------DYRQL----VKQLKIKH
A0A076HBF2      ---------------------------------L---------TTDAL----RSRVDIST
A0A354B169      ---------------------------------L---------TYLNL----SSRLKISI
G4FMX5          ---------------------------------L---------SENGL----ASRITITT
Q0IDT5          ---------------------------------V---------SENEL----AERINITT
A0A2D6FCW3      ---------------------------------L---------NANAL----AKRITITT
A3ZA21          ---------------------------------L---------AENAL----ASRIEIST
A0A140K3H3      -------------G------------------DL---------TVTDV----MENLSITQ
K9XUB8          -------------S------------------DL---------TVGNV----IGNLSIIQ
Q7NEU3          -------------L------------------DQ---------DAEDI----TKRLEIIR
A0A6H2NHD5      -------------P------------------DI---------TYGTL----LNNLTITR
A0A2P8W4F7      -------------P------------------NI---------TYNAL----LSRLSIVQ
A0A5Q4E0Z4      -------------P------------------EI---------TYTTL----LNDLVISQ
A0A2P8VVX1      -------------P------------------EI---------TVDEL----RAGFTLAR
A0A2P8WHY0      -------------P------------------DL---------DVDQV----VNTFSLQR
A0A2T1CMT9      EQASSSYGGVISDS------------------EA---------TTAAIIAALRESIGVYQ
A0A563VQJ3      -------------E------------------PL---------KPKNF----AQNLTVEL
A0A1D8TX52      -------------P------------------DI---------TIRDI----RGSLRLAQ
A0A1D9G4T2      -------------P------------------DI---------TVGDI----RGSLRLAQ
F4XP71          -------------P------------------DI---------TVGDI----RGSLRLAQ
A0A1U7N5X9      -------------P------------------NI---------TVGDI----RGSLRLAQ
A0A6B3N2I8      -------------P------------------DI---------TVGDI----RGSLRLAQ
A0A2W6ZAV2      --------------------------------NV---------SPDKI----ASGLKIVS
A0A2G7GMH8      -------------P------------------DI---------DIKSL----RKSLTLSP
K9W742          -------------P------------------DL---------TLKEL----RKSLSVFQ
A0A2T1DWE8      -------------P------------------KL---------EAAEL----QKALVLTQ
A0A1U7I8L3      -------------P------------------KI---------KVKDI----KEALVVNQ
A0A2T1DJL8      -------------S------------------NL---------DVGDL----QKGLTVSQ
A0A1Z4J9W0      -------------S------------------DI---------DVDRL----RKRLNIAQ
A0A0N7Z5K9      -------------S------------------DI---------DVDRL----RNRLNIAQ
A0A0S3TXC5      -------------S------------------DI---------DVDRL----TRRLNIVQ
K9SA61          -------------P------------------DI---------TVGHL----KEALIVTQ
A0A3D1PBA3      -------------P------------------TI---------TAKEI----KANLKLRQ
K9XPB0          -------------S------------------DA---------EIAEIVEQLKSSLSVYQ
A0A350Y7Z1      -------------P------------------EI---------QVTDI----KESFSLTG
A0A352X2A7      -------------P------------------TI---------KVEEI----REFLTITR
A0A0D8ZYV0      -------------P------------------DM---------TVKEL----KQTLVLTP
A0A2T1FP73      -------------P------------------TL---------TVAEV----KKNLVLKQ
A0A433VMS2      -------------P------------------TL---------TVAEV----KKNLVLKQ
K9TYA7          -------------P------------------TL---------TVAEV----KKNLVLKQ
A0A2P8QUE1      -------------P------------------TL---------TVAEV----KKNLVLKQ
A0A2T1DNG3      -------------N------------------PG---------SVGGF----RGALTIVQ
B8HNB0          -------------------------------------------SVGSI----AGGLSITQ
A0A1Z4LN32      -------------K------------------PL---------DPNSI----S--IGTGS
A0A2I8A9F5      -------------E------------------RL---------KIESV----D--IQVEA
A0A218Q6R8      -------------N------------------LL---------RPESI----N--INIER
A0A218QGE0      -------------N------------------PL---------SPDAI----S--IKTEA
A0A563VS48      -------------E------------------LI---------RYQSF----RESFQVRP
A0A318BJ18      -------------R------------------AERVRI-----AGEIL----RDNLTIGS
A0A3B8Y8H9      -------------K------------------VE---------YQAFI----ENQLSINR
A0A2W1JVB9      -------------E------------------PL---------KIFDF----EEQLSIKK
A0A6H1U102      ---------------------------------L---------SVSQV----VRHLSIRQ
A0A563VLD6      -------------L------------------SV-----------GEV----ISKLSINT
A0A2P8W9H0      ---------------------------------V---------SYGQL----ITNLKIVP
A0A6I5P386      ---------------------------------M---------TYRQL----IFSLGIKK
A0A318BG22      -------------K------------------APAVRQRRIDAATAVV----MRNIEAAP
A0A1Z3HMQ0      -------------N------------------SI---------PPDVL----RRGLTIAP
K1XF69          -------------E------------------PV---------APEDI----RRNLDMRI
B5W297          -------------E------------------PV---------APEDI----RRNLDMRI
A0A6H2AL05      -------------E------------------PV---------APEDI----RRNLDMRI
H1W7M8          -------------E------------------PV---------APEDI----RRNLDMRI
A0A5Q4H6A5      -------------D------------------PI---------YPEDI----RRNLDIRI
D5A466          -------------D------------------PI---------YPEDI----RRNLDIRI
U5QJM6          -------------K------------------DD---------DIDDV----IKRLEIEQ
A0A1Z4RPC6      -------------K------------------PL---------KTEDF----KKKLTVEI
A0A2T1CMZ0      -------------E------------------PL---------KVKEF----KEKLAIEI
L8M4F7          -------------E------------------FI---------DPNGL----RPQLKVKL
A0A140K2P2      -------------K------------------PI---------KPKDF----EKKLSIEL
K9XWX4          -------------K------------------PI---------KPKDF----EKKLNIEL
A0A140KB14      -------------K------------------AL---------KPEVL----NNKLKIEI
K9XX88          -------------K------------------AL---------KPEAL----NKKLKIEI
A0A563VSV6      -------------E------------------TL---------TAKDL----RRKLQVGL
L8LZE9          -------------E------------------PL---------TPEKM----TKKLKADL
A0A433NM31      -------------E------------------PL---------KIKEF----QQRLEVKN
A0A1Z4NDS1      -------------N------------------PL---------QIKAF----RSKLKVDS
K9F4D9          -------------E------------------LL---------QPEDL----LKGLTVTG
U9VXM0          -------------E------------------LL---------QPDEL----LRDLTITG
A0A6I5QPI5      -------------R------------------PL---------NPRAL----LGKVSAQP
A0A433W533      -------------E------------------PL---------KPADI----IGKLKLKN
A0A2P8QWJ3      -------------E------------------PL---------KPADI----IGKLKLKN
A0A2T1FKP8      -------------E------------------PL---------KPADI----IGKLKLKN
K9U6L7          -------------E------------------PL---------KPADI----IGKLKLKN
A0A1E5QP61      -------------K------------------FI---------PPGDF----LSQLNVKK
U5DPF5          -------------T------------------PM---------APQNI----VGNLKVYE
A0A3M1PML8      -------------E------------------PV---------LVKDF----LSKLKANS
A0A3M2GIL5      -------------N------------------LI---------PPGGL----LSGLGVKG
A0A6H1TSJ9      -------------N------------------LI---------PPGGL----LSGLGVKG
A0A0T7BPZ0      -------------K------------------PL---------TIEDL----TKNIKVEV
A0A352X442      -------------N------------------PI---------KPEVV----LQGLQVKP
A0A6B3NF44      -------------N------------------PL---------DPKTL----WAGLEVKP
A0A0M0SHU3      -------------E------------------PL---------TVEEL----LEDLKVES
A0A1D2PBN3      -------------K------------------PL---------TIQEL----SKKLKIKG
A0A0C2LVR7      -------------K------------------PL---------TIQEL----SKKLKIKG
A0A1Z4PQB9      -------------K------------------PL---------TIQEL----SKELKIKG
A0A1Z4SFN6      -------------Q------------------LL---------TIPNF----TAKLKTKN
K9PGI8          -------------K------------------FI---------QTQDL----SHKLKVES
A0A2T1E9V8      -------------T------------------PL---------SVGDL----QAGLEVIN
A0A3M2GQQ6      --------------------------------PI---------GVKQV----ASNLSIHK
A0A6H1U2X0      --------------------------------PI---------GVKQV----ASNLSIHK
K9SGJ5          -------------Q------------------DQ---------MVSYV----LENLYIRQ
A0A6C2DSN4      -------------K------------------PI---------DASSV----INGLDIRP
L8MYT6          -------------K------------------PI---------DASSV----INGLDIRP
A0A352JGJ6      -------------K------------------DI---------DAVTI----MSGLEIRP
A0A1J5GLS2      -------------R------------------EI---------DAGTI----MGGLEIRP
A0A2W4W6M5      -------------K------------------EI---------DAGTI----MGGLEIRP
A0A2W7AN33      -------------K------------------DI---------DTLAI----MDGLDIQP
A0A256BLV2      -------------K------------------DL---------DPLTI----MNGLDIRP
A0A2W6ZXF3      -------------K------------------EI---------DAGTI----MNGLEIRP
A0A2Z5WX66      -------------K------------------DI---------DAVTI----MNGLEIRP
K9W1T3          -------------------------------------------KPESF----LKPLKVTN
A0A1Q4RTR1      -------------Q------------------PL---------AFEEF----SKNLKVSG
A0A1Z4SQV2      -------------Q------------------PL---------TVEEF----SQKLKVAG
A0A2H2XGN1      -------------Q------------------PL---------TVEEF----SQKLKVAG
A0A433UXH8      -------------Q------------------PL---------TIEEF----SQKLKVTG
A0A1Z4RMB9      -------------K------------------PL---------KPEDF----RKKLVTEV
B4WP72          -------------E------------------AL---------TPTSL----KEGLEVKA
A0A318B4H2      -------------K------------------RL-------DQAASIL----LDNITVEP
B4WQE3          ---------------------------------I---------SYDSL----KNNLTITP
A0A2K3BR24      -------------E------------------PL---------TPGGM----RKNLNVTR
K9YXY1          -------------E------------------PL---------TPGGV----RKNLNVTR
A0A1U7HGH0      -------------T------------------TL---------SLESL----RQGLDIVA
K9XJD3          -------------T------------------AL---------SLESL----RQGLDIVD
K9SX01          -------------L------------------PL---------DNDVF----LKPLSLDV
A0A4P7ZT55      -------------R------------------VT---------------------ARSVQ
A0A1E5QIR9      -------------Q------------------PL---------KRKDF----LRRLSIST
A0A1Z4IBC7      -------------K------------------KL---------SIRIF----AQQLKIEG
A0A1W5CPC7      -------------K------------------PL---------SIRIF----AKQLKIEG
A0A5Q0GKD1      -------------K------------------PL---------SIRIF----AKQLKIEG
Q3MDC6          -------------K------------------PL---------SIRIF----AKQLKIEG
A0A1Z4KM73      -------------K------------------PL---------SIRIF----AKQLKIEG
Q8YNX7          -------------K------------------PL---------SIRIF----AKQLKIEG
A0A367R4K6      -------------K------------------LL---------SIRDL----AQQLKVEG
A0A1E2WSV8      -------------K------------------PL---------SIPDL----AKQLKIEG
A0A2R5FRT9      -------------K------------------LL---------SIPDL----AKQLKIEG
A0A2K8T1B6      -------------K------------------RL---------SIPDL----AKKLKIEG
A0A235I9I0      -------------K------------------LL---------SIPDL----AKQLKIEG
A0A2D0HQT8      -------------K------------------LL---------SIPDL----AKQLKIEG
A0A2L2NU95      -------------K------------------LL---------SIPDL----AKQLKIEG
A0A367S084      -------------K------------------LL---------SIPNL----AKQLKIEG
A0A0V7ZFJ4      -------------K------------------LL---------KPSVL----ISKLRVNA
A0A367RIS1      -------------Q------------------PL---------EIDTF----LSNLKIKS
A0A235IXQ2      -------------Q------------------PL---------EIDDF----LHNLKIKS
A0A1W5CNX3      -------------Q------------------PL---------EIDDF----LRSLKIKS
A0A5Q0GJJ5      -------------Q------------------PL---------EIDDF----LRSLKIKS
Q3MEB7          -------------Q------------------PL---------EIDDF----LRSLKIKS
A0A1Z4KHN9      -------------Q------------------PL---------EIDDF----LRNLKIKS
Q8YT70          -------------Q------------------PL---------EIDDF----LRNLKIKS
A0A218Q4C1      -------------E------------------PL---------GVGSF----LGKLKVTT
A0A166IWU6      -------------E------------------PL---------RIDNF----LGSLKVNA
A0A2S0Q8C0      -------------E------------------PL---------KIDHV----LGSLKVQA
W6FSX4          -------------E------------------PL---------KIDHV----LGSLKVQA
A0A0V7ZNJ9      -------------E------------------PI---------SIEDF----LKQLKVKS
A0A0R0M9H9      -------------E------------------PI---------EIDRF----LKQLKLQT
A0A1S1ZVW2      -------------E------------------PI---------EIDVF----LKQLKLQI
A0A1B7WX82      -------------G------------------QI---------SLENF----LKKLKLKS
A0A1B7WTD1      -------------A------------------PM---------TTDAF----LKTLKLKT
A0A480ABC0      -------------A------------------PM---------TTGDF----LKILKLKT
A0A1Z4LRU5      -------------E------------------TL---------SHEAF----LKLLQVKS
A0A1Z4JVB4      -------------Q------------------PL---------SIEDF----LKNLKLKT
K9PIA4          -------------E------------------YL---------PIETF----LKILQLKT
A0A1Z4HVE1      -------------K------------------PL---------TIEKF----LKLLKLKT
A0A252ECZ1      -------------K------------------LV---------SIERF----LKVLKLKT
A0A1Z4G5Y1      -------------K------------------PL---------SIEKF----LKKLKLKT
A0A252DNA2      -------------K------------------PL---------SIEKF----LKLLKLKT
A0A252E1Q4      -------------K------------------PL---------SIEKF----LKLLKLKT
A0A6G9SK36      -------------K------------------PL---------TIEKF----LKILKLKT
A0A1Z4M597      -------------K------------------PL---------TIEKF----LKLLKLKT
A0A1Z4MWT1      -------------K------------------PL---------SIEKF----LKLLKLKT
A0A1Z4TX53      -------------K------------------PL---------SIEKF----LKLLKLKT
A0A5P8VSD1      -------------Q------------------PL---------ELRDF----LRNLKIKN
A0A2A2TNQ5      -------------K------------------PL---------EIDDF----LKNLKVKS
A0A3S1C4K5      -------------K------------------PL---------KVEPF----LKLLKVKS
A0A1X4G3D5      -------------K------------------PL---------DPDVI----LGNLKLQT
D4TNI2          -------------K------------------PL---------DPDVI----LGNLKLQT
A0A1Z4H6Z8      -------------K------------------PL---------TIEKF----LKLLKLKT
A0A1Z4NPM1      -------------K------------------PL---------SVEDF----LKNLKVKS
A0A3F3KPR9      -------------E------------------PI---------EIDRF----LKQLKLQT
D4TGN7          -------------E------------------PI---------EIDRF----LKQLKLQT
A0A1Z4UZW9      -------------K------------------QL---------SLEVF----LKKLKLKT
A0A0K2M5H0      -------------K------------------QL---------SLEVF----LKKLKLKT
A0A1B7VSH4      -------------K------------------QL---------SLEVF----LKKLKLKT
A0A1B7W126      -------------K------------------QL---------SLEVF----LKKLKLKT
A0A3D4C6Q6      -------------K------------------QL---------SLEVF----LKKLKLKT
A0A1B7UVJ4      -------------K------------------QI---------SLENF----LTKLKLKT
A0A1B7UTR1      -------------K------------------QI---------SLENF----LTKLKLKT
K7W0A4          -------------K------------------QI---------SLENF----LKKLKLKT
A0A5C0DRW9      -------------K------------------QI---------SLENF----LKKLKLKT
A0A6H2C088      -------------K------------------QI---------SLENF----LKKLKLKT
A0A2T1CIL7      -------------N------------------FL---------KYQEI----LANLEVKP
A0A433V7A0      -------------N------------------AR---------LETNL----KKQFQVKN
A0A2T1FTR8      -------------R------------------PERKRLDKFINKNESF----VQQLKVSS
K9UA41          -------------R------------------PERKRLDKFINKNESF----VQQLKVSS
A0A0C2LBE2      -------------K------------------AI---------TIEEL----TNTLKISS
A0A433NN38      -------------N------------------PL---------RIEDL----AAALSVVS
A0A2N6K0T2      -------------E------------------PL---------RVEDV----QKNLKVEG
A0A2N6ML72      -------------E------------------PL---------KVEDL----QKKLKVEG
G6FQZ6          -------------E------------------PL---------KVEDL----QKKLKVEG
A0A2N6MQX9      -------------E------------------PL---------KVEDL----QKKLKVEG
A0A2N6KXT6      -------------E------------------PL---------KVEDL----QKKLKVEG
A0A2N6KGB9      -------------E------------------PL---------KVEDL----QKKLKVEG
A0A2N6L3Y5      -------------E------------------PL---------KVEDL----QKKLKVEG
A0A0S3TIS7      -------------E------------------PL---------KVEDL----QKKLKVEG
A0A1U7GW28      -------------E------------------PL---------KVEDL----QKKLKVEG
A0A2N6LW63      -------------E------------------PL---------KVEDL----QKKLKVEG
A0A328IH74      -------------E------------------PL---------TVEEL----LENLKVEG
A0A4D9CIB0      -------------E------------------PL---------TVEEL----LENLKVEG
A0A1Z4TQ63      -------------E------------------PL---------KIEDL----LKNLKVEG
A0A4Q9J8G2      -------------E------------------PL---------KIKDL----LKNLKVEG
A0A1Z4SMD6      -------------K------------------LL---------NPELV----K--VKVET
A0A2H2Y096      -------------K------------------LL---------NPELV----K--VKVET
K9S8M8          -------------K------------------PM---------KPESF----LRGLEVKT
A0A1Z4NFV0      -------------K------------------LL---------DPDLL----K--IKVEP
B0CAX4          -------------Q------------------PL---------ETKDF----IEALTVFN
A0A350Y0P6      -------------T------------------PV---------QPSSI----GAGLKVEG
A0A352X940      -------------S------------------PI---------KPENL----LGRLTVKG
B8HTN4          -------------Q------------------LL---------KPEAF----LESLSVNN
A0A2A2TPF8      -------------K------------------LI---------EPESL----I--IKVEP
A0A1Z4R0P8      -------------K------------------LV---------DPKSL----I--IKVEP
A0A0T7BUI3      -------------K------------------FR---------NPETL----L--IKVEP
A0A1Z4LP32      -------------K------------------PL---------EPESL----P--MEVEA
K9REP9          -------------K------------------PL---------EPEAL----D--LEIEP
A0A1Z4SIJ3      -------------H------------------PL---------DPDQL----K--IKIEA
A0A2H2XPG4      -------------H------------------PL---------DPDQL----K--IKIEA
K9V3C7          -------------R------------------SL---------VPEAF----K--IKVEA
A0A1Z4T6Y7      -------------N------------------LV---------KPESL----N--IKVEP
A0A2H2Y561      -------------N------------------LV---------KPESL----N--IKVEP
A0A1Q4S362      -------------E------------------LL---------EPESI----N--IKIEP
A0A3S1CIN8      -------------E------------------LL---------KPESI----N--IKIDP
A0A2A2TC28      -------------K------------------PV---------DVELF----K--VLVEP
A0A0C1NCB0      -------------T------------------PL---------QPEDL----E--IKVDP
A0A2N6K7Q9      -------------K------------------LI---------APELL----K--VNVKP
A0A2N6MXH6      -------------K------------------LI---------EPELL----K--VNVKP
A0A2N6M5A8      -------------K------------------LI---------DPELL----K--VNVKP
A0A2N6LL61      -------------K------------------LI---------DPELL----K--VNVKP
A0A0S3TP66      -------------K------------------LI---------DPELL----K--VNVKP
G6FP91          -------------K------------------LI---------DPELL----K--VNVKP
A0A1U7GYR5      -------------K------------------LI---------DPELL----K--VNVKP
A0A2N6KY52      -------------K------------------LI---------DPELL----K--VNVKP
A0A2N6KMP5      -------------K------------------LI---------DPELL----K--VNVKP
A0A2N6MA45      -------------K------------------LI---------DPELL----K--VNVKP
A0A4Q9J9V9      -------------K------------------II---------DPELL----K--INVKP
A0A328IGA1      -------------K------------------II---------DPELL----K--INVKP
A0A4D9CE41      -------------K------------------II---------DPELL----K--INVKP
A0A0M0SFT2      -------------K------------------LI---------DPELL----K--INVKP
A0A1Z4TLC8      -------------K------------------LI---------DPELL----K--INVKP
A0A0C2LFH0      -------------N------------------AL---------DPESL----K--IKVEP
A0A1Z4IYV4      -------------N------------------TL---------DPESL----K--IKVEP
A0A1Z4Q0T6      -------------N------------------TL---------EPESL----K--IKVEP
A0A0C2PT44      -------------E------------------TL---------DSESL----K--IKVEP
A0A1D2P6J4      -------------A------------------TL---------EPESL----K--IKVEP
A0A3M9ZEU1      -------------K------------------RL---------QPQDI----SKQLKVKN
A0A1Z4JK72      -------------R------------------PM---------DPEEL----SKQLKVEA
A0A0N7Z489      -------------R------------------PL---------EPDEL----SRQIKVEP
A0A0S3TXS2      -------------R------------------PM---------EPEEL----SRQVKVEA
A0A1Z4RN12      -------------E------------------PL---------TYKSV----STALSVEP
A0A2T1CMF9      -------------E------------------PL---------TYKTV----KKALKVEP
Q7NDC5          -------------E------------------LL---------ATTDF----LRALKVEA
U5QGK3          -------------Q------------------LL---------RPEKF----LKALKVET
A0A2W4UY24      -------------A------------------PL---------EANAL----LQDMSVRA
A0A2T1GMT4      -------------K------------------LI---------AASDL----HSGLTTKI
K9UI51          -------------K------------------LL---------TASDI----HTGLTTKI
K9QM62          -------------K------------------PL---------TVKAL----AKNLDLKI
A0A1Z4FWI3      -------------E------------------PL---------TVEAL----KQRLTLKI
A0A1Z4JYE7      -------------E------------------PL---------TVEEL----QEKLTLKI
A0A2T1FXY4      -------------E------------------LQ---------EVEAF----KKAVKLKI
K9TYI2          -------------E------------------PQ---------EIEAF----KKAVKLKI
A0A1Z4QL41      -------------E------------------PL---------EVEDL----VKDLTLKI
A0A252D4T4      -------------E------------------PL---------TVEAL----KKAINLKI
A0A252DJH5      -------------E------------------PL---------TVEAL----KKAINLKI
A0A252EB80      -------------E------------------PL---------TVESL----KKAINLKI
A0A6G9SKZ9      -------------K------------------PL---------TAEAL----KKALNLKI
A0A1Z4HPW5      -------------Q------------------LL---------TPEAL----KKALNLKI
A0A1Z4MSN1      -------------K------------------PL---------TTEAL----KKALSIKI
A0A1Z4U1C2      -------------K------------------PL---------TTEAL----KKALSIKI
A0A0D6KV51      -------------K------------------PL---------TPEVL----KKALNIKI
A0A1Z4MKF8      -------------K------------------PL---------TPEVL----KKALNIKI
A0A2C6WC43      -------------Q------------------PL---------TVKAL----QKSLILKI
A0A1Z4L5A1      -------------Q------------------PL---------TVKAL----QKSLVLKI
A0A367QD86      -------------Q------------------PL---------TVKAL----QKSLVLKI
A0A235IZ96      -------------K------------------PL---------EVQAL----QKSLTLKI
A0A2L2NGP0      -------------K------------------PL---------EVKAL----QKSLTLKI
A0A2K8SM78      -------------K------------------PL---------EVEKL----RNSLTLKI
A0A2R5FPC0      -------------K------------------PI---------EVEKL----RKAVILKI
A0A5P8W5T6      -------------K------------------PI---------EVEKL----RKAVIMKI
A0A140KBA0      -------------E------------------LY---------RYKDL----INKLEIKP
K9XSG1          -------------E------------------LY---------RYKDL----INNLEIKA
A0A0F5YE28      -------------K------------------LI---------DPESI----RKSLEVKI
U7QEH7          -------------K------------------LR---------EAESI----RKSLEVKI
A0A3S1ATK5      -------------E------------------VL---------EVEDL----QKSLTLKI
A0A2Z6CPH0      -------------E------------------SL---------KVEEL----QKKLKLKI
A0A1Z4GT50      -------------E------------------VL---------AVEEL----AEALELKI
A0A1Z4GIX0      -------------E------------------PL---------KVEEL----QKNLTLKI
A0A2H6LC24      -------------E------------------PL---------KVEEL----QKNLTLKI
B2J6N5          -------------K------------------PL---------EVEKL----RKSLTLKI
A0A367RMI4      -------------E------------------PL---------EVKKL----LKLLNLKV
A0A235HUM0      -------------E------------------PL---------EVKAL----QKALNLKI
A0A2L2NW47      -------------E------------------PL---------EVKEL----LKVLNLKI
A0A1E2WUR1      -------------I------------------PL---------EVQAL----KKALNLKI
A0A235IKU3      -------------K------------------PL---------EVQAL----QKSLTLKI
F4XKF3          -------------L------------------PL---------QPEAL----KRKLTVKI
A0A1D9FX10      -------------L------------------PL---------EPEAL----KKKLTVKI
A0A1D8TNX9      -------------L------------------PL---------EPEAL----KRRLTIKI
A0A1U7MYU6      -------------L------------------PL---------EPEAL----KRRLTIKI
A0A3C0NJ41      -------------K------------------SL---------TPEDF----QKKLKAKI
A0A352AG88      -------------T------------------PL---------SPEAL----HEKLTIEN
A0A350Y374      -------------E------------------PI---------SPESL----QKKLKIKT
A0A355DPX0      -------------E------------------PI---------SPESL----QKKLKIKT
A0A0D8ZUV2      -------------E------------------VL---------LPEGF----LKKQNIKQ
A0A433VDI0      -------------V------------------PL---------EPEDF----IKELKVKQ
A0A3D1PG43      -------------A------------------TV---------QPTEL----LGKLKLKN
A0A2P8QQ72      -------------K------------------PL---------KPTAL----ISQLTLKN
K9TZQ7          -------------K------------------PL---------KPTAL----ISQLTLKN
A0A2G7GPR0      -------------S------------------LM---------KPQTL----ATRINAKN
K9XH68          -------------S------------------LI---------KPQAL----AGKMSAKN
A0A1U7HW70      -------------S------------------LI---------KPQAL----AGKMSARN
A0A2S6VEJ8      -------------S------------------LL---------KPQVL----ASRVNARN
                                                                            

K9SLA9          LP----D-------------SEILEISYHDPDPKRAASIVNTVSKIYIASDLETKSLEAK
A0A168TT23      AG----GRLRARISVSPRENSRLVYVSVNSFDPAFAAQLANAVVEEYVRSTMQRRYDAGQ
A0A0M1JWX9      KK---EA-------------TKIIEVRYQDEDPEKIDFILKKLAENYLRYSFEDRQTNTR
A0A2T1M1V6      QT----Q-------------TTVIDLEVEATSPELAYQRVKTLMNSYQKRLNELRQQDVK
A0A2G7GCS2      QE----Q-------------STIINLQVKASSPEIAQKRLSNLINVYQLRLNELRHQDTN
K9XBH8          QE----Q-------------TTIIALEVKASSPEIAQQRLNNLINIYQLRLNELRYQDTS
A0A1Z4LJ30      EK----E-------------STVISVSVEGSSPELAQQRANGLIKAFRDRLQELRKDEAQ
K9RI76          EK----E-------------STVISLEVQGSSPELAKNRAAALIAAFSNRLQELRLDEAK
A0A352AE27      QE----Q-------------STTISLTVKGSSPELAHQRAIALIEAYQQRLNELRQTDGV
A0A3B8JH60      QE----Q-------------STIISLAVNGSTPEVARQRAIALLKVYQARLNELRQADGM
A0A3C0N766      QE----Q-------------STIISLAVNGSTPEVARQRAIALLKVYQARLNELRQADGM
K9W9J7          QE----Q-------------STIISLAVSGSTPELAKGRANNLLQVYQQRLNQLRQADSA
A0A139WSU3      QE----Q-------------STIMLLTVSGSSPKLANQRAIAITEAYQNRLNELRQANSR
A0A433VN22      QE----Q-------------STVLSLTVSGSQPDLATLRTQNLIKAYQARLDELREGNSK
Q7NF11          QS----Q-------------TTILAVEAKGNAPEVAEARADLVVRSYVARLEELRNAYAA
A0A1Z4JCS8      LE----Q-------------TSVMLLSVTGSSPDIAKQRAEAILNAYRQRLSELRQANNN
F4XTX2          HQ----E-------------STTIWLNATGASPELARDRVRALISAYQERLNELRQADGT
Q7NJN6          GD----Q-------------STIVQLEAKGSSPELAQQRAEWVLQSYQTRLNALRLDDAR
U5QCC3          ED----Q-------------STIVQVQVKGSSPEIAKNRANALLQSYQRRLNELRLDDAR
A0A3S0Y9N9      IE----Q-------------TDILEISYADTNPRMAASIVNTLMKIYIENDIDINRAQTR
A0A433UNK7      IE----N-------------TDILEVYYTSTDPRTAASVVNTLMKVYIENDINANRAQTR
A0A3M1SVZ4      VQ----S-------------SDILTISYQDENPKKAATFVNSLIEVYLEDDILRKRAELT
A0A654SFI6      IS----Q-------------SSLVDIEFSSPSPEISSKISNLWADEFIRANYEKRFGANI
K9SSQ0          TP----D-------------AKVLNISYSDRNPKTAATIL----QGLLETYKAYGANKAN
A0A2W1JIN9      VP----G-------------TDIFQLQYTSSDPELASRMLNSIAQTVVQENTETIQAEAK
A0A318AJV1      DQ----L-------------SYIISLGFKSRDAAKSSRIANAFADTYLDMRVHGEASSSV
A0A6B3MUB5      IP----A-------------TNILEISYQNQNPELATVLLNAVANAMVYESTEAIRQEAR
A0A1U7N2U4      VP----A-------------TNILELSYQSQNPELATTVLNAVANAMVSESAQGIRSEAR
A0A1D9G1F2      VP----A-------------TNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRSEAR
F4XV38          VP----A-------------TNILELSYQGQNPELVTTVLNAVANAMVTESAEGIRSEAR
A0A2P8QIL5      VP----A-------------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAG
A0A2T1FLY5      VP----A-------------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAG
A0A433W447      VP----A-------------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAG
K9U1K8          VP----A-------------TSILEIKYSNKDPLIAAKLLNALTEAMINEDTAVIRREAG
K9UYB2          VP----A-------------TNIIDLSYQSEDSQLAANLVNSVAMAMIRDHVQAISSEAT
A0A218QN17      VP----A-------------TNILELSYKSKDPELAAQLLNAVSQAMIEENTKTISSEAT
K9RKN2          VP----A-------------TNILQISYENQDPLLAARLLNAVSSAMVEYDIKAISSEAT
A0A2I8ADV2      LP----A-------------TNILQLNYFHQDPQFAADVLNAVSQAMVEENIQAISSEAT
A0A1W5CKM3      VP----A-------------TNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTISSEAT
A0A5Q0GMF5      VP----A-------------TNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTISSEAT
Q3MEW0          VP----A-------------TNILDLRYQSPNPNQAAQILNAVSQAMVEENIKTISSEAT
A0A1Z4KIC7      VP----A-------------TNILDLRYQSPEPNQAAQVLNAVSQAMVEENIKTISSEAT
Q8YSM5          VP----A-------------TNILDLRYQSPEPNQAAQVLNAVSQAMVEENIKTISSEAT
A0A1Q4S1H4      IP----A-------------TNILELSYKASDPVFAARLLNAVSNAMVEENIKTISSEAT
A0A433VBU6      IP----A-------------TNILELRYKAADPVFATRLVNAVTDAMVEENIKTMSSEAT
A0A1Q4RZJ6      IP----A-------------TNILEISYQSKNPDLAATYANAVAMATIRDNIKSISSEAT
A0A1Z4SNV3      IP----A-------------TSILEISYQSKNPELAATYVNAVAMATIRDNTKSISTEAT
A0A2H2XJQ1      IP----A-------------TSILEISYQSKNPELAATYVNAVAMATIRDNTKSISTEAT
A0A3S5K358      IP----A-------------TNILEISYQSKNPDLAAAYANAVAMATIRDNIKSISSEAT
A0A0T7BPJ4      VP----A-------------TNILEFKYEARDAQLAAKLLNVIAQTMVEENTRTISSQAT
A0A0C1QS61      VP----A-------------TNILQLSYQSKNPKLAAQLLNSVARAMEEESANTIRQEAA
A0A139X3R8      VP----A-------------TNILQLSYQSKDPILAAQLLNAVSRAMEEESANTIRQEAA
A0A1Z4I7C5      VP----A-------------TNILELRYQSPNPEQTAQVLNAVSQAMVEENIKTINSEAT
A0A0C2MDK7      VP----A-------------TNILELSYQSRDPQLAAKVLNAVSQAMVEDNVKSIGLEAT
A0A1Y0RCK1      VP----A-------------TNILELNYQSKNPQLAAQLLNAISQAMVEDNTKSINSEAT
A0A1Z4PWZ0      VP----A-------------TNILELSYQSEYPKLAARLLNAVAQAMVEDNIKAISSEAT
A0A0C2QLT0      VP----A-------------TNILELSYQSKDPRLAAKLLNAISQAMVEDNTKAISSEAT
A0A1Z4J2K1      VP----A-------------TNILELSYQSKDPQLAAKLLNAISQAMVEDNTKAISSEAT
A0A3S0ZSX0      VP----A-------------TNILEVSYEHKDPALASKLVNAVSQAMVEDNTQIIRQEAA
A0A2N6K4T3      VP----A-------------TNILEVSYLNKDPILATKVVNAVSKAMVEDNTQVIRQEAA
A0A370CKT2      VP----A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAA
A0A0S3TL97      VP----A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAA
A0A2N6M8A0      VP----A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAA
A0A2N6M9E1      VP----A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAA
A0A2N6KJI4      VP----A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAA
A0A2N6MZ77      VP----A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAA
A0A2N6KT20      VP----A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAA
G6FSN3          VP----A-------------TNILEVSYLNEDPILATKVVNAVSRAMVEDNTQVIRQEAA
A0A4D9CI02      VP----A-------------TNILEVSYLNKDPTLATKVVNAVSQAMVEDNTQVIRQEAA
A0A328I8B9      VP----A-------------TNILEVSYLNKDPTLATKVVNAISQAMVEDNTQVIRQEAA
A0A4Q9J4Z7      VP----A-------------TNILEVSYLNKDPTLATKVVNAISQAMVEDNTQVIRQEAA
A0A0M0SU69      VP----A-------------TNILEVSYLNKDPTLATRVVNAVSQAMVEDNTQVIRQEAA
A0A1Z4TIZ8      VP----A-------------TNILEVSYLNKNPTLATKVVNAISQAMVEDNTQVIRQEAA
A0A0S3TYD7      VN----R-------------SDILRVEYRSNDPMEAAEVVNHLMQLYVQDNLTANRAEAK
A0A3C0N2P0      LG----E-------------TKILEVRYQDSNPEKIQFVLERVAQGYVNYSAKEQQDSVT
K9TLQ0          LK----S-------------TKILDIRYQDTDPQKIQIILKELATGYIHYSEMEQQTTLR
A0A6B3M6M6      LR----E-------------TKILEARYQDSDPEKIKFVLEQVVKGYIKYSEQEQQTTTR
A0A6B3NIJ0      LR----E-------------TKILETRYQDSDPEKIKFVLEQIVKGYIKYSEQEQQTTTR
A0A352XE00      LQ----Q-------------TKILEIRYQDSDPEKIKFILDQVANGYINYSRQEQQTTTQ
B4VS56          LQ----E-------------TKILEVRYQDSDPEKIQFILEQIATGYVNYSLSEQQTSTR
A0A352AAQ3      LQ----Q-------------TKILEVRYQDSDPEKIRFILEQVADGYVKYSETEQRTAVT
A0A350Y472      LQ----E-------------TKILEVRYQDSDPNKIQFILEQVANGYVQYSEAEQRTAVT
A0A355DVB4      LQ----E-------------TKILEVRYQDSDPDKIQFILEQVANGYVKYSEAEQRTAVT
U5QL42          IG----D-------------AGVLRVAYRDTNPERAKAVLTALGATYVEYSLESKRGQAD
K9QF04          KE----N-------------TAIVEVSYQDTDPEKIEFVLDKLAEGYTAYYLEKLQTSSK
A0A076HBF2      GG----AKRKEA--------EGVLNVRLTGRNPIEDERLLNALSNTYLQAALQQRQQRLA
A0A354B169      GG----EKSQEA--------EGVLNVSLTGHDPVQDELVLKAISAAYLHAALEQRQKRLA
G4FMX5          GG----EKRTEA--------EGILRVSLVGRDKDEDQQLLTALSDTYLKVALQERQQRLA
Q0IDT5          GG----AKRKEA--------EGVLKVSLTGRNPKEDGQLLEAISAAYLQTALQQRQKRLT
A0A2D6FCW3      GG----EKRKEA--------EGILNVSVTGRDPVEDKQLLDDLSSTYLQAALQQRQQRLS
A3ZA21          GG----AKRKEA--------DGVLNVSLTGRDPEQDEVLLQAISTAYLQAALQQRQQRLA
A0A140K3H3      AA----V----NEMP-----TDVLVVSYTDTNPERAKAVLDALGSTYVEYSLNRQRSQAG
K9XUB8          AN----V----NEIP-----TDVLVVSYIDSNPERAKAVLEALGSTYVEYSLNRQRSQAA
Q7NEU3          EE----R-------------TQVAVVSFEDTDPQVVKAILDELSRTYIDYSLEIQKSKLD
A0A6H2NHD5      DG----E-------------SKVLRVNYRDQDPEVVAFVLSEVAEGFVDYSVDDRQAELR
A0A2P8W4F7      EG----E-------------SKVLRVTYNGADPAVVSFVLNQVVEGFVDYSVQDRQGDLR
A0A5Q4E0Z4      EG----E-------------SKVLRITYKNSDPEVVTTVISEVVKGFVAYSVQDRQGELR
A0A2P8VVX1      LS------EGRTG-------TRIFQASYTANDPTQPQRVLAALQDIYLNYNQEQQAQRLS
A0A2P8WHY0      VG----GEERDKA-------TRVFQATYVDSDPIKTQRLLEALKEAYLEFNEAQQARRLE
A0A2T1CMT9      VL----DESTDSNKDSA---TKIIQVSYVGSSPVETKKVLTAIQEVYLKYNLEQQEKRLR
A0A563VQJ3      VG----G-------------SDVIEVGYNADRPEIAAEIVNTLMTIYVREQIRNNQAEPA
A0A1D8TX52      VL----Q----GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLN
A0A1D9G4T2      VL----Q----GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLN
F4XP71          VL----Q----GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLN
A0A1U7N5X9      VL----Q----GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLN
A0A6B3N2I8      VL----Q----GKTE-----TKVFQAVYTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLN
A0A2W6ZAV2      GG----DA------------SGVMDVSLLWDDRREGQQILEAISAEYLAFSMRQRQERLA
A0A2G7GMH8      VQ----G----QDGTGKKVRTKIVEVLYTDNDPQRTQNVLNAMQQVYQDYNLEQQKLRLA
K9W742          VE----GSQDDSK-------TKIFAANYTANDPVKTQKVLQAVQRVYLNYNREQQRLRLA
A0A2T1DWE8      VE----E----DKVK-----TKIFQAVYTSDDPEKTQKVLMAVQQVYKDYNREQQKLRLT
A0A1U7I8L3      LQ----E----DKVN-----TKIFEVTYIDNDPIKTQTVLETIKRVYQDYNREQQQLRLT
A0A2T1DJL8      VI----EQRGNDKIN-----TSIFEMVYTGHDRQQTQAVLQAIQQVYQQYNLEQQKARLT
A0A1Z4J9W0      VQ----ELRGNERVT-----TNLVEVTYIDHDRIKTREVLKALEKVYQDYNLEQQRNRLT
A0A0N7Z5K9      VQ----ELRGSERVN-----TSIVEMSYIDYDRVKTREVLKSLQRVYQDYNLEQQRNRLA
A0A0S3TXC5      VQ----ELRGNERVN-----TNIVEMSYIDHDRVKTREVLKALQRVYQDYNLEQQRNRLA
K9SA61          VE----D----DKTK-----TKIFEAIYTGDDPEKTQAVLQAVQKVYQDYNREQQELRLS
A0A3D1PBA3      VL----E----EK-----VNTKIVEATYTANDPVKAEKVLEAVYKVYQIYNREQQQQRLQ
K9XPB0          VI----D----ESEDNKGTETKIIEVAYVSQDYNDSKKILEAIEQVYIEYNVEQQEKRLR
A0A350Y7Z1      VQ----E----EDTDIKDTQTKIVKVVYTSNDPIQTQDVLAAIQTVYQDYNLQQQQVRLT
A0A352X2A7      II----E----DETE-----TKIVKIDYISKDPIQTQEVLKAIQKIYQNYNLEQQKQRLV
A0A0D8ZYV0      LV----E----ENSNTKY--TKIVEANYVSNDPVKTQKVLQTIYQVYQSYNREQQEQRLK
A0A2T1FP73      VV----E----EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLK
A0A433VMS2      VV----E----EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLK
K9TYA7          VV----E----EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLK
A0A2P8QUE1      VV----E----EKAN-----TKIVEATYTANDPIKAQKVLKAVHTVYQIYNREQQEQRLK
A0A2T1DNG3      VGTKKVD-------------TKIFSITYTSNDPIKTQKVLQAVQKVYQDYNLQQQQDRLT
B8HNB0          VG----D-------------SDVLKVTYTGTDPKTVQAILDALNKTYIDYSLEKRRSQVS
A0A1Z4LN32      IV----G-------------TDILRVSYTSGKPELAIKVVDKVMEAYIKKNIYTNRSEAI
A0A2I8A9F5      IP----G-------------TDGLKVGYVSEDPYLAKAIVNQVMKSYIANNILTNRSEVM
A0A218Q6R8      IM----G-------------TDGLQVSYVSEEPQLAKEVVNQVMKSYIANNILANRSEAI
A0A218QGE0      VV----G-------------TDVLKVSYTSDNPESAKAIVDQVMKSYIANNILSNRTQAI
A0A563VS48      IT----G-------------TDILNIRYEGNDPEVVASVVNQALMLYKDQDRLSNRTEAV
A0A318BJ18      TR----L-------------SRLVDITFSSPDPDFSARIANAWAENFIQTNLERKIQATS
A0A3B8Y8H9      PK----D-------------TNIIIVSYQDIDPRKVTFILNELAKVYLDYSLNDPRMKKT
A0A2W1JVB9      AR----A-------------GDVIELAYESEDPEEAALVINTLMKVYLADNLRINRLEAS
A0A6H1U102      AG----E-------------ADVLIVSYTDTDPSRAKAILEALGSTYVDYSLERQLSQAT
A0A563VLD6      QEVNEIP-------------TDVLTVSFIDSSPQRAKEVLDALGKVYVQYSLDKQRSQAA
A0A2P8W9H0      NQ----D-------------GEILTVTYSSEDPEQVTDVLEVVMAGYLRYSLEDRQNDIF
A0A6I5P386      SN----E--------------DVLVVSYKSTDSEKVTYVLDLLLSTYLRYSLEDRQNDIN
A0A318BG22      LV----G-------------SSVIELRYTSNDARLSAAIANAAVDQFIESTTQRQYAASS
A0A1Z3HMQ0      LE----G-------------TDVLRVAYQSPNGELSAAVVNQVMTSYIERNITMNRSEAT
K1XF69          IG----G-------------TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDAS
B5W297          IG----G-------------TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDAS
A0A6H2AL05      IG----G-------------TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDAS
H1W7M8          IG----G-------------TDIVLLTYQSRNPQEVADVINTVMEVYIEANVSSIRQDAS
A0A5Q4H6A5      IG----G-------------TDIVLLTYQSKNPQEVADVINTIMEVYIDANVSGIRQEAS
D5A466          IG----G-------------TDIVLLTYQSKNPQEVADVINTIMEVYIEANVSGIRQEAS
U5QJM6          VT----R-------------TQVVSVAFKDTDRQLVQDMLKELAKIYIDYSQDVQKSQVS
A0A1Z4RPC6      VG----G-------------TDVIQIAYKDPDPVIASKVINTLMDVYIKEQVNSNKKATA
A0A2T1CMZ0      VG----G-------------SDVISIEYKDPDPIIASKVVNTLMGVYIKEHVRSNKSATV
L8M4F7          LP----G-------------TDLIQILYKDPNPKFAADIVNSLMNVYVEAQIRGNQSDPA
A0A140K2P2      VG----G-------------SDVIEITYAHPNPKVAADVVNTLMNTYINEQIRTNQSEPA
K9XWX4          VG----G-------------SDVVEITYAHPNPKVAADVVNTLMNTYINEQIRANQSEPA
A0A140KB14      IG----G-------------TDVISVRYQDQDPYTAADVINTLMKLYLDEQVKSTQAETA
K9XX88          VS----G-------------TDVISLRYQDQDPYTAADVINTLMKLYLDEQVKSTQAETA
A0A563VSV6      VG----G-------------SDVIEIIYKDSDPIQASQVVNTLMDVYIKNQVRSNQAETE
L8LZE9          VG----A-------------SDVIEITYEDKDPQIASNVVNTLMNIFLENKIANNQKDTE
A0A433NM31      IK----G-------------TDTLLISYKSTVPEQAQAVVNKLMDSYLRNNMMATRTEAI
A0A1Z4NDS1      AK----G-------------TDIIQVSYQDNDPELAAKVVNKLMEVYVQNNIRENRAEAS
K9F4D9          VP----G-------------TDVLKVTYTSEEPEIAATVVNTLADIYIENDIQTNRAAAL
U9VXM0          IP----G-------------TDVLKVTYTSDDPELAANVVNTLTDIYIENDIQTNRAAAV
A0A6I5QPI5      VG----G-------------TDVLRISVESEDPEEAAAIVNQVIESYREQNIESNREEAA
A0A433W533      IG----G-------------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTAT
A0A2P8QWJ3      IG----G-------------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTAT
A0A2T1FKP8      IG----G-------------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTAT
K9U6L7          IG----G-------------TDVMQVTYKSISPDEAAAVVNKLMNVYLENNIQTNRVTAT
A0A1E5QP61      IE----G-------------TDVLMIAFKSQYPKEAADAVNKLMDVYINNNILVNRREAT
U5DPF5          VP----N-------------THILELTYQSTDPEEAARVVDSFMEVYRDNDVRINRSEAA
A0A3M1PML8      IP----A-------------TDLLRVTYASEDPEETAAVINRLVDIYTKNNVLVNRAEAA
A0A3M2GIL5      IK----G-------------TDVLLITYQAGNPEEAATVVNKVMEVYIENNILVNRSEAA
A0A6H1TSJ9      IK----G-------------TDVLLITYQAGNPEEAATVVNKVMEVYIENNILVNRSEAA
A0A0T7BPZ0      VK----G-------------SEVMQISFTHENAQLAANVVNQVMDNYITENIRANRAEAE
A0A352X442      VA----G-------------TDVMTLTYQSKKPDVAAAVVNKVMEVYIADDIQANRAKAA
A0A6B3NF44      VT----G-------------TDVMGISYVSEDPEEAAKVANNIMEVYIKNDIQTNRQKAV
A0A0M0SHU3      VK----G-------------TDVLEISYTNENPQLAAKVINKVVDTYIKQNIQANREEAT
A0A1D2PBN3      DK----G-------------TEVLEVSYTDTNPTLAAKVVNKLMQAYIKNNIEANREEAV
A0A0C2LVR7      DK----G-------------TEVLEVSYTDTNPTLAAKVVNKLMQAYIKNNIRANREEAV
A0A1Z4PQB9      DK----G-------------TEVLEVSYTDTNPTLAAKVVNKLMQAYIKNNIGANREEAV
A0A1Z4SFN6      YK----G-------------TEVLDIYYKDEDPYLAAKVVNQMMEVYIKNNIEANRAEAV
K9PGI8          SK----G-------------TDILQISYTDKDPTLAAKVVNKVMDAYIRNNIEANRAEAV
A0A2T1E9V8      IE----G-------------TDILQVTYKSNNPEIASLVVNQLMNVYVNRNLLGNRAAAI
A0A3M2GQQ6      AG----E-------------ADVLIVSYTDTDPARAKAILDVLGKTYVDYSLERQVSQAS
A0A6H1U2X0      AG----E-------------ADVLIVSYTDTDPARAKAILDVLGKTYVDYSLERQVSQAS
K9SGJ5          EK----G-------------ASVLWLIYRDPDPQRAKDVLDSLASAYSQYSLKDRRSRSS
A0A6C2DSN4      EK----D-------------ALILRLTYTDSDPKRAREVLGALSQTYVEYSLKDRRTKSS
L8MYT6          EK----D-------------ALILRLTYTDSDPKRAREVLGALSQTYVEYSLKDRRTKSS
A0A352JGJ6      EK----D-------------ALILRLNYIDSDPKRAREVLNALAQTYVEYSLKDRRTKSS
A0A1J5GLS2      EK----D-------------ALILRLIYTDSDPKRAREVLNALSQTYVEYSLSDRRTKSS
A0A2W4W6M5      EK----D-------------ALILRLTYTDSDPKRAREVLNALSQTYVEYSLSDRRTKSS
A0A2W7AN33      EK----N-------------AMVLRLIYTDSNPKRAQEVLNALSQTYVEYSLNNRRTNSS
A0A256BLV2      EK----D-------------TMVLRLTYTDSDPKRAREVLTALTQTYVEYSLKDRRTKSS
A0A2W6ZXF3      ER----D-------------ALILRLIFTDSDPKRAREVLNALSQTYVEYSLSDRRTKSS
A0A2Z5WX66      EK----D-------------ALILRLTYTDSNPKRAREVLTALSETYVEYSLKDRRTKSS
K9W1T3          IR----S-------------TDILQVSYTDTDPAKAAKIINTVMSIYIKSDVNAQRSEAK
A0A1Q4RTR1      VK----G-------------TDILQISYRSPDKKMAAAVVDSVIKNYLENDIRANRTEVV
A0A1Z4SQV2      VK----G-------------TDVLEVSYRSPDAKQAANIVNTLIKNYLENDIRTNRTEAV
A0A2H2XGN1      VK----G-------------TDVLEVSYRSPDAKQAANIVNTLIKNYLENDIRTNRTEAV
A0A433UXH8      VK----G-------------TEVLQISYRSSNPKLAANVVNTLIKNYLENDIRTNRTEVV
A0A1Z4RMB9      VG----G-------------TDVVDVKYRHPNPKTASEVVNALMDVYVKEQIRGNQSQPA
B4WP72          IP----G-------------TDILEISYQSPDDQTAPVIVNALMEAYIENNVETNREEAI
A0A318B4H2      IG----A-------------SALVDITFKSPSAELSSKVANSWAAEYIQSNLDRRFATTA
B4WQE3          ND----N-------------GKTLTVQYRSDDPYKVTTVLEVVLQTYLNYSLEDRQNDIY
A0A2K3BR24      LS----D-------------TEILEIAYEHPEPEKAATIVNELMNVYRENNVLNNRSEAT
K9YXY1          LS----D-------------TEILEIAYEHPDPEKAATIVNELMNVYRENNVLNNRSEAT
A0A1U7HGH0      VE----G-------------TEILQVVYRGEEPEQAALIVNQLMNVYVSKNLLNNRAAAI
K9XJD3          VE----G-------------TEILQVVYRGEDPAQAALVVNQLMNIYVNKNLLNNRAAAI
K9SX01          IK----Y-------------TDVIQVSYLSSSPQDAAKIVNGLMKSYIDNDLLTNREDTA
A0A4P7ZT55      RD----A-------------DGVLKVSLQWRNPQQGEQLLKALSQSYLAYSLRQRQEKLS
A0A1E5QIR9      LK----D-------------TDVLQISFKSNDPQEAVDVVNRLMQFYQENDIQTNRAQAA
A0A1Z4IBC7      IK----G-------------TDVVQISYKSNNAEQAAKVVNTVIKSYIDLNIQANQDEAV
A0A1W5CPC7      IK----G-------------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEAL
A0A5Q0GKD1      IK----G-------------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEAL
Q3MDC6          IK----G-------------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEAL
A0A1Z4KM73      IK----G-------------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEAL
Q8YNX7          IK----G-------------TDVVQLSYKSNDPALAAKVVNKVIDNYIALNIKANQDEAL
A0A367R4K6      IK----G-------------TDVVQLSYQSNNPELAAKIINQVIDNYIDLNIKANQNEAF
A0A1E2WSV8      IK----G-------------TDVVQLSYKGGDPELAAKIVNEVIDSYIDLNIKANQNEAL
A0A2R5FRT9      IK----G-------------TDVVQISYKGGNPELAAKIVNEVIDSYIELNIKANQNEAL
A0A2K8T1B6      IK----G-------------TDVVQLSYKGSDPELAAKIVNEVIDSYIDLNIKANQNEAL
A0A235I9I0      IK----G-------------TDVVQLSYKGGDPKLAAKIVNEVIDSYIDLNIKANQNEAR
A0A2D0HQT8      IK----G-------------TDVVQLSYKGGDPKLAAKIVNEVIDSYIDLNIKANQNEAR
A0A2L2NU95      IK----G-------------TDVVQLSYKGGDPELAAKIINEVIDSYIDLNIKANQNEAR
A0A367S084      IK----G-------------TDVVQLSYKGGDPELAAKIVNEVIDSYIDLNIKANQNEAR
A0A0V7ZFJ4      VG----D-------------TDILNLSYESNDPQKAAAIVNSLMKDYQENNISTNTAEAR
A0A367RIS1      IR----G-------------TDILQLSYRSANPQQATAIINKLMSAYLENNVRINRSQAR
A0A235IXQ2      VR----G-------------TDILQLSYRSTNPQEATAIINRLMSAYLANNVRINRSEAR
A0A1W5CNX3      VR----G-------------TDILQLTYRSANPEEATAIINRLMNTYLENNVRNNRSEAT
A0A5Q0GJJ5      VR----G-------------TDILQLTYRSANPEEATAIINRLMNTYLENNVRNNRSEAT
Q3MEB7          VR----G-------------TDILQLTYRSANPEEATAIINRLMNTYLENNVRNNRSEAT
A0A1Z4KHN9      VR----G-------------TDILQLSYRSADPKEATAIVNKLMSAYLENNVRNNRSEAT
Q8YT70          VR----G-------------TDILQLSYRSADPKEATAIVNKLMSAYLENNVRNNRSEAT
A0A218Q4C1      IR----G-------------TDVLQLSYNSIDPQEAQSTVNQLMAAYLNNNVLNNRSQAA
A0A166IWU6      VR----G-------------TDVLQLSYRSVDPELAKAIVNKLMNVYIDDNVMTNRSQAT
A0A2S0Q8C0      IR----G-------------TDLLQLSYRSVDPEVGKAVVNKLMNVYIDDNVMTNRSQAT
W6FSX4          IR----G-------------TDLLQLSYRSVDPEVGKAVVNKLMNVYIDDNVMTNRSQAT
A0A0V7ZNJ9      AK----G-------------TDVLEISYKGTDPQQAAAIVNSLMQDYIDNNIRVNTAEAR
A0A0R0M9H9      IR----G-------------TDVMELSYNSTNPQEAADTVNTLMKYYLDNNILINRSEAT
A0A1S1ZVW2      IR----G-------------TDVMELSYNSTNPQEAADTVNTLMKYYLDNNILINRSQAT
A0A1B7WX82      IR----G-------------TDVLQVSYSSTNPQEAANVVNSLMKYYLESNILNNRTEAR
A0A1B7WTD1      IR----G-------------TDVMELSYKSTDKQEAANVVNSLMKHYLASNINTNRAEAI
A0A480ABC0      IR----G-------------TDVMELSYKSTDKREAANVVNSLMKHYLASNVSTNRAEAI
A0A1Z4LRU5      IR----G-------------TDVLQLSYKSTDPKEAANVVNSLMGDYMENNVETNTAEVR
A0A1Z4JVB4      IR----G-------------TDVMQISYRSKNPQESADVVNFLMKSYIESNISNNRTEAR
K9PIA4          IR----G-------------TDVMQLSYRSPNPKEAADVINTLMKYYLESNVRTNRSTAK
A0A1Z4HVE1      IR----G-------------TDVMQLSYRSTNPQEAASVINSLMNYYLESNVRTNRAEAR
A0A252ECZ1      IR----G-------------TDVMQLSYRSTNPQEAASVINSLMNYYLESNVRTNSAEAR
A0A1Z4G5Y1      IR----G-------------TDVMQLSYNSTNPEEAATVLNSLMNYYLESNVRTNRAEAR
A0A252DNA2      IR----G-------------TDVMQLSYRSTNPQEAATVINSLMNYYLESNVRTNRAEAR
A0A252E1Q4      IR----G-------------TDVMQLSYRSTNPQEAATVINSLMNYYLESNVRTNRAEAR
A0A6G9SK36      IR----G-------------TDVMQLSYRSTNPQEAATVINSLMKYYLESNVRTNRAEAR
A0A1Z4M597      IR----G-------------TDVMQLSYRSTNPQEAASVINSLMNYYLENNVRTNRAEAR
A0A1Z4MWT1      IR----G-------------TDVMQLSYRSTNPQEAASVINSLMSYYLENNVRTNRAEAR
A0A1Z4TX53      IR----G-------------TDVMQLSYRSTNPQEAASVINSLMSYYLENNVRTNRAEAR
A0A5P8VSD1      IR----G-------------TNILQLSYRSANPQEATAILNRLMSAYLENNIRINRSEAT
A0A2A2TNQ5      VK----G-------------TDVMELTYRGTNPLETAKVINTLMNNYLENNIRSNRTEVT
A0A3S1C4K5      VK----G-------------TDVLEMTYRDTDPKVAADVINTLVKYYIENNIRVNRLDAT
A0A1X4G3D5      VR----G-------------TNVMEFTYDSKIPDEAAKIVNGLMNEYLLSNIVINNSASS
D4TNI2          VR----G-------------TNVMEFTYDSKIPDEAAKVVNGLMNEYLLSNIVINNSASA
A0A1Z4H6Z8      IR----G-------------TDVMQLSYRSTNAQEAATVINSLMNYYLESNVRTNRAEAR
A0A1Z4NPM1      VR----G-------------TDVMELSYRSTDPQEAANVINFLMKSYLEGNILNNRAEAT
A0A3F3KPR9      IR----S-------------TDVMELSYNSTNPQEAADTVNTLMKYYLDNNILINRSEAT
D4TGN7          IR----G-------------TDVMELSYSSTNPQEAADTVNTLMKYYLDNNILINRSEAT
A0A1Z4UZW9      IR----G-------------TDVMQLSYRSTNPQEAAKVVNSIMKYYLESNVRTNRTEAR
A0A0K2M5H0      VR----G-------------TDVMQLSYRSTNPQEAADVVNSLMKYYLESNVRTNRTEAR
A0A1B7VSH4      VR----G-------------TDVMQLSYKSTNPQEAANVVNSLMKYYLESNVRTNRREAT
A0A1B7W126      VR----G-------------TDVMQLSYKSTNPQEAANVVNSLMKYYLESNVRTNRREAT
A0A3D4C6Q6      VR----G-------------TDVMQLSYKSTNPQEAANVVNSLMKYYLESNVRTNRREAT
A0A1B7UVJ4      IR----G-------------TDVLQVSYSSTNPQEAANVVNSLMKYYLESNILNNRTEAR
A0A1B7UTR1      IR----G-------------TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEAR
K7W0A4          IR----G-------------TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEAR
A0A5C0DRW9      IR----G-------------TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEAR
A0A6H2C088      IR----G-------------TDVIQLSYRSTNPQEAADVVNSLMKYYLESNIRTNRTEAR
A0A2T1CIL7      IV----G-------------TDVLQVFYQDSDPKRAASIVNEVIDLYVQEDTLSNRAAPA
A0A433V7A0      IA----G-------------ADVMQISYTSKDPQESASVVNQLMSIYIKNNISANRLQAV
A0A2T1FTR8      IK----N-------------TDLLEVTFQDPSRELSRDVVEKIMEIYIRDDRTNQRREAE
K9UA41          IK----N-------------TDLLEVTFQDPSRELARDVVEKIMEIYIRDDRTNQRREAE
A0A0C2LBE2      LK----G-------------TEILQVSYIDKDPKLAAKVVNKVMQAYIKNNIEANRQEAV
A0A433NN38      VK----G-------------TDLLEIYYADSDPIMAAKVVNKLVEIYIKQNIQTNRAEAV
A0A2N6K0T2      VK----G-------------TDVLEVSYTHEDPQLAAKVINKVVDTYIKQNIQVNREEAI
A0A2N6ML72      VK----G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAI
G6FQZ6          VK----G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAI
A0A2N6MQX9      VK----G-------------TDVLEVSYTHEDPQLAAKVINKIVEEYTKQNIQANREEAI
A0A2N6KXT6      VK----G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAI
A0A2N6KGB9      VK----G-------------TDVLEVSYTHEDPQLAAKVINKIVEEYTKQNIQANREEAI
A0A2N6L3Y5      VK----G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAI
A0A0S3TIS7      VK----G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAI
A0A1U7GW28      VK----G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAI
A0A2N6LW63      VK----G-------------TDVLEVSYTHQDPQLAAKVINKIVEEYTKQNIQANREEAI
A0A328IH74      VK----G-------------TDVLEISYTDENPELAAKVINKIVDTYIQQNIQANREEAT
A0A4D9CIB0      VK----G-------------TDVLEISYTDENPELAAKVINKIVDTYIQQNIQANREEAT
A0A1Z4TQ63      LK----G-------------TDVLEISYTDENPQLAAKIINRVVDTYIKQNIQANREEAT
A0A4Q9J8G2      LK----G-------------TDVLEISYTDENPQLAAKVINKVVDAYIKQNIQANREEAT
A0A1Z4SMD6      IT----G-------------TDVLKISYSSKDPEVASSVVNQVMKTYVEKNIESNRSQVF
A0A2H2Y096      IT----G-------------TDVLKISYSSKDPEVASSVVNQVMKTYVEKNIESNRSQVF
K9S8M8          IR----G-------------TDVLLITYTSDDPQEAANVVNVLMEIYIKENIRANRAEAT
A0A1Z4NFV0      VM----G-------------TDVLKVSHISDNPNLAAAVVNQVMESYVESNIQSNRAEAQ
B0CAX4          VR----D-------------TDVLKVTYKSIDPKESADVVNRLMDDYLKNNIETNRAEAA
A0A350Y0P6      IK----G-------------TDVMEVSFTSDNPKKAAAVVNQLMNVYVENNILTNRAEAV
A0A352X940      LK----G-------------TDVMTVSVKSQKPKEAAAIVNKLMEVYLENNIQTNRSEAV
B8HTN4          IR----G-------------TDLLQVSYRSTDPKQAVAIVDLLIKIYKRNNILANRLETT
A0A2A2TPF8      IA----G-------------TDVLDVVYISENGKEAAAIVNQLMRSYVENNIRNNRSEAL
A0A1Z4R0P8      VA----G-------------TDVLNVSFISDKPKEAAAIVNQLMRSYVDNNIKNNRSEAL
A0A0T7BUI3      IV----G-------------TDVLKVSHASDNPKLAAKIVNQVMATYAENNVESNRTQVT
A0A1Z4LP32      LV----G-------------TDVINVSYTSEKPRLAAAIVNQVMRTYVKNNIESNRAQVV
K9REP9          LV----G-------------TDVINVSYTSDKPRLAASIVNQVMESYVDNNIESNRAQVV
A0A1Z4SIJ3      IP----G-------------TDVLKVSYVSINPELAKKVVNQVMQTYVDKNIESNRTQVY
A0A2H2XPG4      IP----G-------------TDVLKVSYVSINPELAKKVVNQVMQTYVDKNIESNRTQVY
K9V3C7          VP----G-------------TDILNVSFTWDNPEIASAVVNKLMDVYVANNLANSRSEAV
A0A1Z4T6Y7      II----G-------------ADVLNVSHISSDSRLAADVINYVMRSYVENNIQTNRLEAV
A0A2H2Y561      II----G-------------ADVLNVSHISSDSRLAADVINYVMRSYVENNIQTNRLEAV
A0A1Q4S362      IP----G-------------TDVLNVAHISGESKKAADVVNQIMRSYVNSNIQNNRQETI
A0A3S1CIN8      IP----G-------------TDVLKVAHISGESKKAADVVNQIMRSYVNSNIQNNRQETI
A0A2A2TC28      VV----G-------------TDVIKVSYQSNNPEMTAEVVNQVMNTYIKNNIQSNRTQVF
A0A0C1NCB0      VV----G-------------TDVLKVSYTAKAPNLAANVVNLVMQAYVNNNIQSNQEQVL
A0A2N6K7Q9      IV----G-------------TDVLRVSYASNDPELAAAVVNQLMKSYVENNIQTNRAQVS
A0A2N6MXH6      IV----G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVS
A0A2N6M5A8      IV----G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVS
A0A2N6LL61      IV----G-------------TDVLRVSYASNDPKLAAAVVNQLMKSYVENNIQTNRAQVS
A0A0S3TP66      IV----G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVS
G6FP91          IV----G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVS
A0A1U7GYR5      IV----G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVS
A0A2N6KY52      IV----G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVS
A0A2N6KMP5      IV----G-------------TDVLRVSYTSNDRELAAAVVNQLMKSYVENNIQTNRAQVS
A0A2N6MA45      IV----G-------------TDVLRVSYASNDRELAAAVVNQLMKSYVENNIQTNRAQVS
A0A4Q9J9V9      IV----G-------------TDVLKVSYASNDPELAAAIVNQLMKSYVENNIQTNRAQVS
A0A328IGA1      IV----G-------------TDVLKVSYASNDPELAAAIVNQLMKSYVENNIQTNRAQVS
A0A4D9CE41      IV----G-------------TDVLKVSYTSNDPELAAAIVNQLMKSYVENNIQTNRAQVS
A0A0M0SFT2      IV----G-------------TDVLKVSYTSNDPELAAAIVNQLMKSYVQNNIQNNRAQVS
A0A1Z4TLC8      IV----G-------------TDVLKVSYASNDPELAAAVVNQLMKSYVENNIQTNRAQVS
A0A0C2LFH0      IV----G-------------TDVLKVSYTSENPELTASVVNQVMKSYVAKNIQYNRTQVV
A0A1Z4IYV4      IV----G-------------TDVLQVSYTSENPELAASVVNQLMKSYVANNIQSNRSQVF
A0A1Z4Q0T6      IV----G-------------TDVLKVSYISENPELAASVVNQLMKSYVANNIQSNRVQVF
A0A0C2PT44      IV----G-------------TDVLKVSYTSENPELAASVVNQLMKSYVANNIQSNRAQVF
A0A1D2P6J4      IV----G-------------TDVLKVSYTSENAELAASVVNQLMKSYVANNIQSNRAQVF
A0A3M9ZEU1      IP----S-------------TDVLHLAYTDSDPERAAKVVNQVINVYIENNVAANRAEAA
A0A1Z4JK72      VP----T-------------TDILNLKYSDNDAEMAANVVNQIMKAYIDNNLKTNQEEAN
A0A0N7Z489      VP----T-------------TDILDVKYADDDPEMAANVVNQVLKAYIDNNLKTNQEEAN
A0A0S3TXS2      VP----T-------------TDILELKYADDDPEMAANVINQIVKAYIDSNLKTNQEEAN
A0A1Z4RN12      II----G-------------TDLLKITFTDQDPEVALAFVNRAIELYSEDYASYNRSETA
A0A2T1CMF9      VI----G-------------TDLLQISYENSDPDVAVSFVNRAVELYSDGYALFNSEAAL
Q7NDC5          LR----R-------------TDLLVIKYRDRDPAVATRVVNTLARHYIDLNMQQNRAEAA
U5QGK3          LR----R-------------TDLLVIRYREFNPELAAKVVNTLAQAYIVENVQQNRAEAS
A0A2W4UY24      IP----G-------------TDVLAVSYESTSPALAQAVVNAMMAAFIQANVQANRTAAI
A0A2T1GMT4      VG----G-------------ADILQVSFKGRNPKDAANIVNTLMNVYLENDIQASQLEAE
K9UI51          IG----G-------------SDILQIGFKGRNSKDAANIVNTLMNVYLENDIQASRLEAE
K9QM62          VG----G-------------TDVLQITYKSRNPEEAAAVVNSVMNVYLENDILTNRTEVE
A0A1Z4FWI3      VG----G-------------TDVLLVSYKSPDPETAAAVVNTVMNIYLENDSNTNRAEAE
A0A1Z4JYE7      IG----G-------------TDVLEITYQSNDPKQAAAVVNALMNVYVDNDISTNREEAE
A0A2T1FXY4      VG----G-------------TDVLRITYKHHDPEKAAAVVNKIMELYLENDILTSRSEAE
K9TYI2          VG----G-------------TDVLQITYKHHDPEKAAAVVNKIMELYLENDILTSRSEAE
A0A1Z4QL41      IG----G-------------TDVLKITYKSNKPEEAAEVVNTIMNFYIENDISTNRAEAE
A0A252D4T4      IG----G-------------TDVLLVSYNSPNPEEAAAVVNTIMNLYLENDILTNRGEAE
A0A252DJH5      IG----G-------------TDVLLVSYNSPNPEEAAAVVNTIMNLYLENDILTNRGEAE
A0A252EB80      IG----G-------------TDVLLVSYNSPNPEEAAAVVNTIMNLYLENDILTNRGEAE
A0A6G9SKZ9      IG----G-------------TDVLQVSYKSRSPEEAAAVVNNIMNLYLENDILTNRAEAE
A0A1Z4HPW5      IG----G-------------ADVLQISYKSPNPQEAAAVVNNVMNLYLENDILTNRAEAE
A0A1Z4MSN1      IG----G-------------TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAE
A0A1Z4U1C2      IG----G-------------TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAE
A0A0D6KV51      IG----G-------------TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAE
A0A1Z4MKF8      IG----G-------------TDVLLVSYQSPNPQEAAAVVNNVMNLYLENDILTNRAEAE
A0A2C6WC43      IG----G-------------TDVLRVTYASLNAEEAAAVVNTVMNVYLENDILTNRSEAA
A0A1Z4L5A1      IG----G-------------TDVLRITYSSLDPEEAASVVNTVMNVYVESDILTSRSEAA
A0A367QD86      IG----G-------------TDVLRITYSSLNPEEAAAVVNTVMNVYVENDILTNRSEAA
A0A235IZ96      VG----G-------------TDVLKITYSSHDPEEAAAVVNTVMNLYLENDILTNRSEAA
A0A2L2NGP0      VG----G-------------TDVLRITYSSHDPEEAAAVVNTVMNLYLENDILTNRSEAA
A0A2K8SM78      VN----G-------------TDVLRISYTSRDPEQSAAVVNTIMSLYLENDILTNRSEAA
A0A2R5FPC0      IN----G-------------TDVLRISYASRDPEQAAAVVNTIMNLYLENDILTNRSEAA
A0A5P8W5T6      VN----G-------------TDVLRISYTSRDPKQSADVVNTIMNLYLENDILTNRSEAA
A0A140KBA0      VT----G-------------GNVIKISYEDSDAERAALVVNKIIELYQEKDTENNRSEAI
K9XSG1          LT----G-------------SNVIKIAYEDSDPERAALVVNKIIELYQEKDTENNRSEAI
A0A0F5YE28      IG----G-------------TDIVSLSYESPDPLEAANIVNTLMEVYIQTNVNMNQDEAR
U7QEH7          IG----G-------------TDIVSLSYESKDPKEAADIINTLMEVYMQTNVDMNQEDAI
A0A3S1ATK5      VG----G-------------TDVLKLTYKSRDPKEAAVVVNTVMNFYLENDIETNRAEAE
A0A2Z6CPH0      IG----G-------------TDVLRVSYQSNNPEEAAAVVNTLMNLYLENDILTSRAEAE
A0A1Z4GT50      VG----G-------------TDVLQLNYKSRNPEEAAAVVNTIMKMYVENDITTSRAEAE
A0A1Z4GIX0      VG----G-------------TDVLRIAYKSTNPEEASAVVNTIIDAYLENDILTSRSEAE
A0A2H6LC24      VG----G-------------TDVLRIAYKSTNPEEAAAVVNTIIDAYLENDILTSRSEAE
B2J6N5          VS----A-------------TDVLRISYTSPDPEQSAAVVNTIMSLYLDNDILTNRSEAA
A0A367RMI4      IG----G-------------TDVLRISYKSHNPEEAAAVVNTIMRFYLENDILTNRSEAG
A0A235HUM0      VG----G-------------TDVLRISYSSHDPEEAAAVVNTVMRFYLENDVLTNRSEAG
A0A2L2NW47      VG----G-------------TDVLRIAYRSHDPEEAAAVVNTIMRFYLENDILTNRSEAG
A0A1E2WUR1      IG----G-------------TDVLLISYSSSDPEEAAAVVNTIMNFYLENDILTNRSEAA
A0A235IKU3      VG----G-------------TDVLKITYSSHDPEEAAAVVNTVMNLYLENDILTNRSEAA
F4XKF3          VG----G-------------TDVVRLSYKGKNSEKGAAVINQLMRLYIENQILSKKSEAA
A0A1D9FX10      VG----G-------------TDVVRLSYKGKNSEKGAAVINKLMRLYIENQILSKKSEAA
A0A1D8TNX9      VG----G-------------TDVVRLSYKGNNSDKGAAVINQLMRLYIENQILSKKSEAA
A0A1U7MYU6      VG----G-------------TDVVRLSYKGNNSDKGAAVINQLMRLYIENQILSKKSEAA
A0A3C0NJ41      VG----G-------------TDVVELSYKGANPQQIAAVVNKLMSLYIEDNLRTNRAELV
A0A352AG88      LA----E-------------TDVLELAYESSNPQEAAAVVNYLMNLYIKNNVKANRAEVV
A0A350Y374      IG----A-------------TDVIEIIYKNKDAKTAAAVVNQLMKLYIENNLRNNRTELV
A0A355DPX0      IG----A-------------TDVIEITYKNKDAKTAAAVVNELMKLYIENNLRNNRTELV
A0A0D8ZUV2      LA----A-------------TDVLEVTYKSNDPQEAAAVVNKLMSLYIENNVLSNRTAAV
A0A433VDI0      LS----A-------------TDILQLAYKSTNPEEATAVVNKLMNLYIENNILTNRDQAV
A0A3D1PG43      VP----A-------------TDVVQVAYESKNPEEAAAVVNKLMSLYVQNNIQSNRAQTT
A0A2P8QQ72      IP----A-------------TDVLQVAYESKDPQEAAAVVNKLMSAYVDYNIQSNRAEAS
K9TZQ7          IP----A-------------TDVLQVAYESKDPQEAAAVVNKLMSAYVDYNIQSNRAEAS
A0A2G7GPR0      VP----L-------------TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEAS
K9XH68          IP----L-------------TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEAS
A0A1U7HW70      IP----L-------------TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEAS
A0A2S6VEJ8      IP----L-------------TDVLQISYQSEDPEEAAAVVNKVMNLYIENNIITNRAEAS
                                                                            

K9SLA9          SLLQFVERQ-LPTSKSALESAEIKLRQFKENYRLVDLEI-------EKVT---TVKAIKE
A0A168TT23      EAREFLEGQ-LADMRIALERADQNLIDFAQANGVADLEE-------RVDM---SQSSVRT
A0A0M1JWX9      KGIQFIEEQ-LPQLRQRVDTLQGQLQKFRQDYNLIDPKI-------QGEQ---LAGQITK
A0A2T1M1V6      SQDQFAENA-LKKAQNNLILAQNKLTQFQQSTGLFESET-------QTQE---LMQSINK
A0A2G7GCS2      VRKQFSQTD-LEDAQAQLAKAQAELANFQQSTGLTEVTE-------QTRS---LINQQRE
K9XBH8          VREEFSRGD-IEKARQQLEQAQAALASFQEATGISEAVE-------QTRS---LIAQLRD
A0A1Z4LJ30      QRSQFMQDE-VKQAYQKLFKTQKNLSEFKQKTNLVSSEE-------QTKE---IVSTINA
K9RI76          QRSQFMQGE-VKLANTKLLKAQKALSEFKQKTNLVSSEE-------QTQQ---IVSAINT
A0A352AE27      ARAQFSQKQ-LEQAQQRLNQAQMELAQFQKSSGLVNSEE-------QTRG---LVQSISE
A0A3B8JH60      SRKQFSQKE-LEQAKERLAQAQMALAQFKQSSGLVNSEA-------QTEG---IVTTINN
A0A3C0N766      SRKQFSQKE-LEQAKERLAQAQMALAQFKQSSGLVNSEA-------QTEG---IVTTINN
K9W9J7          SRKQFSQKE-LNQAKARLDQAQRAVAQWKQSTGLVNSEA-------QTQG---IVTTINN
A0A139WSU3      TRQKFSQIE-LEQAKLKLAQAQSKLTIFKQSSGLINNED-------QAKG---IVDSIST
A0A433VN22      ERQKFNVKE-LEQAKAKLSNAQTKIARFKQATGIVNNDA-------QTQG---IVTTINA
Q7NF11          SRDTLSQKE-LDRARRELTRAEAALARFKRSTGLVNTDQ-------QTGG---LVGVISS
A0A1Z4JCS8      TRDGFSQKQ-LEQAQRRLTEAQTALAQFKQSTGLVNNEE-------QTKG---LVGTINT
F4XTX2          TRVEFNKKA-LDRAKQKLDQSQEALAKFQESSGLVNSEA-------QTEG---LVRAITD
Q7NJN6          RRDEFSRVE-TAKAQNNLQTAQVELYGYQRRTGLVNADD-------QTRG---IVETLNS
U5QCC3          RRDQFSHEE-LERAKRTLQQTQSELASYQQTTGLVNVDE-------QTRG---LVETLNT
A0A3S0Y9N9      SARSFIAQQ-LPLSKAALQAAEKKLQDFKQQYKVLDLKS-------EATS---SVTILTD
A0A433UNK7      SARDFIAQQ-LPLRKAALQTSERRLQFFKQQNRVLDLKA-------EASA---SVAILTD
A0A3M1SVZ4      ATREFIEAK-LPDAEYTLSQAEQELRQFKEENNFFALQE-------EAAA---ATQLMTG
A0A654SFI6      DAREFLNKQ-IEELRERLSISERDLVEYANENEILVLETGNREEGSGTAS---QTLIATD
K9SSQ0          QATQLIQAQ-IPDAKKQLDQNSTALTRFRQQYNITDPDT-------YAAS---IFSTKQG
A0A2W1JIN9      SAREFLEGQ-IPQRRQELLQVEARMSKFKQEYGYVTLSA-EGNNNEANQL---LVNSYAQ
A0A318AJV1      QQAAFFRQR-LDELARQVNDADTRLAAYRAGTGLSADGA-------GSNV---VDQQIAT
A0A6B3MUB5      AVREFLEKE-LPQQRALTEAAEVAESKYRKSSGLVSFNE-------QTES---LVESLAK
A0A1U7N2U4      AVREFLEKE-VPLRRLEVEATEAALNKFKQTTGLVSPEE-------QTQL---LVRSLAT
A0A1D9G1F2      AVREFLEKE-VPLRRLEVAAAEAALNKFKQTTGLVSPEE-------QTQL---LVRSLAT
F4XV38          AVREFLEKE-VPLRRLEVAAAEAALNKFKQTTGLVSPEE-------QTQL---LVRSLAT
A0A2P8QIL5      SARQFLAVE-VPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTTS---IVESLAQ
A0A2T1FLY5      SARQFLAVE-VPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTTS---IVESLAQ
A0A433W447      SARQFLAVE-VPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTTS---IVESLAQ
K9U1K8          SARQFLAVE-VPKKRAQLAQVEATLSQYKQSQGIVSIADDQGRDNAQTTS---IVESLAQ
K9UYB2          KIREFLETKELPKARQALMVAEMEESAYRERTGIISFDE-------QTKS---LVQSLAA
A0A218QN17      KVREFLENNEIPNARKRLATAEQNESNYRHISGIISFEE-------QTKS---AVESLAT
K9RKN2          KVKDFLENKQLPIARKKLREAEATESQYRQASGIVSFAE-------QTES---LVENLSS
A0A2I8ADV2      KVRKFLEKE-VPVARNRLQQAEVAESRYRQKSGVVADTD-------QTKS---LVQSLTN
A0A1W5CKM3      KVREFLAEK-VPIARQRLLQAELAETKYRQQSGVVATDD-------QTRS---LVNSLAE
A0A5Q0GMF5      KVREFLAEK-VPIARQRLLQAELAETKYRQQSGVVATDD-------QTRS---LVNSLAE
Q3MEW0          KVREFLAEK-VPIARQRLLQAELAETKYRQQSGVVATDD-------QTRS---LVNSLAE
A0A1Z4KIC7      KVREFLAEK-VPIARQRLLQAELAETKYRQQSGVVATDD-------QTRS---LVGSLAE
Q8YSM5          KVREFLAEK-VPIARQRLLQAELAETKYRQQSGVVATDD-------QTRS---LVGSLAE
A0A1Q4S1H4      KVRQFLEKNEVPNAQQRLKVAEIKENKYRQTSGIVSFDD-------QSKS---LVTSLAN
A0A433VBU6      KVREFLEKKEVPNAQQRLKAAEIKENKYRQTSGVVSFDE-------QSKS---LVTSLAN
A0A1Q4RZJ6      KVRQFLQQQ-LPQARTQLQAAEVAENNYRQQSSIVDFDE-------QTKS---LVQSVAS
A0A1Z4SNV3      KVRQFLQQQ-LPQARAQLQAAEAAENKYRQASIIVNYDE-------QTKS---LVQSVAS
A0A2H2XJQ1      KVRQFLQQQ-LPQARAQLQAAEAAENKYRQASIIVNYDE-------QTKS---LVQSVAS
A0A3S5K358      KVRQFLQQQ-LPQARTQLQAAEAAENNYRQQSSIVDFDE-------QTKS---LVQSVAS
A0A0T7BPJ4      KVREFLEKKEVPAAQRNLTVAEANENRQKQASGIVSFDE-------QSKS---VVTSLAS
A0A0C1QS61      NVRKFLEME-VPKAREKLENAELTENRYRRSSGIISFTK-------QSES---LVDSLAA
A0A139X3R8      NVRKFLATE-VPKARQNLEDAELKENKYRQSSGIISFTK-------QSES---LVDSLAT
A0A1Z4I7C5      KVREFLSQK-VPQARQRLQQAELAETRYRQQSGVVAADD-------QTKS---LVGSLAD
A0A0C2MDK7      KVKQFLEQKQVPEAEKKLLQAEDLENKYRKSSGIVSVEE-------QTKS---LVQSIAT
A0A1Y0RCK1      KVKEFLEEKQVPEADKQLRQAEAQENKYRQLSGIVSLEE-------QTKS---LVQSIAT
A0A1Z4PWZ0      KVKAFLEKKQVPSAEKQLLQAEEKENKYRKSSGIVSFEE-------QTKS---LVQSIAT
A0A0C2QLT0      KVKKFLEEKQVPEADKQLRLAEATENKYRKLSGIVSLEE-------QTKS---LVQSIAT
A0A1Z4J2K1      KVKKFLEEKQVPEADKQLRLAEATENKYRKLSGIVSLEE-------QTKS---LVQSIAT
A0A3S0ZSX0      NVRKFLQQQ-VPEARQRLEKAELIENKYRQDSGIVSFDE-------QTKS---LVNSLAT
A0A2N6K4T3      NVRKFLETK-VPDARKRLQEAEQKENRYRQSSGIVSFDE-------QTKS---IVESLAT
A0A370CKT2      NVRKFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTKS---LVESLAN
A0A0S3TL97      NVRKFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTKS---LVESLAT
A0A2N6M8A0      NVRKFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTKS---LVESLAT
A0A2N6M9E1      NVRKFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTKS---LVESLAT
A0A2N6KJI4      NVRKFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTKS---LVESLAN
A0A2N6MZ77      NVRKFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTKS---LVESLAN
A0A2N6KT20      NVRKFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTKS---LVESLAN
G6FSN3          NVRKFLEKK-VPEARKQLQEAEQKENRYRQSSGIVSFDE-------QTKS---LVESLAN
A0A4D9CI02      NVRKFLEKK-VPDARKRVEEAEQKENKYRQSSGIVSFDE-------QTKS---LVNSLAT
A0A328I8B9      NVRKFLEKK-VPDARKRVEEAEQKENKYRQSSGIVSFDE-------QTKS---LVNSLAT
A0A4Q9J4Z7      NVRKFLEKK-VPDARKRVEEAEQKENKYRQSSGIVSFDE-------QTKS---LVNSLAT
A0A0M0SU69      NVRKFLEKK-VPDARKRVEEAEQKENKYRQSSGIVSFDE-------QTKS---LVNSLAI
A0A1Z4TIZ8      NVRKFLEKK-VPDARKRVEEAEQKENKYRQSSGIVSFDE-------QTKS---LVNSLAT
A0A0S3TYD7      SAREFIQSQ-LPEVERNVRQVEGEIRAFKENNQIVALDQ-------EQRN---SVEITSD
A0A3C0N2P0      QGLGFVNEQ-TKNLQKRVNELQKSIQSLRENYKIVDPES-------QGQQ---LSNRASE
K9TLQ0          QGLEFVETQ-LPRLQQRVDTLQEYLEKFRQHYNLIDPGQ-------SGQI---LSQQIGS
A0A6B3M6M6      QGIQFVESQ-LPKLQERVNKFQEQLQRFRQRYNLTDPET-------QGKL---LTSRLST
A0A6B3NIJ0      QGIQFVESQ-LPKLKERVNKLQEQLQRFRQRYNLTDPET-------QGKL---LTSRLST
A0A352XE00      QGIQFVKDQ-LPKLQERVNQLQAQLQEFRQAYNLIDPDS-------QAQL---LTQRATS
B4VS56          QGIQFVEEQ-LPKLQGRVDSLQQKLQRFRQQYNLVNPDS-------QGQL---LTSRVST
A0A352AAQ3      QGLAFVNKQ-AKELQGIVNDLQQKVQDLRQNYKIVDPET-------QGQL---LTNRVSE
A0A350Y472      QGLAFVNKQ-TQKLQELVNDLQQQIQNLRQTYQIVDPET-------QGQL---LTNRVSD
A0A355DVB4      QGLAFVNKQ-TQKLQELVNDLQQQIQNLRQTYQIVDPET-------QGQL---LTNRVSD
U5QL42          NAIKFIEAK-LPRAKKVLNQTAIAIREFRKRYDIPDPDG-------YATS---VAEVQQS
K9QF04          QALKLVEAL-SPQQRQRVDQLQVQLQRFRRQNNLVDPEK-------QSQV---LTERLSN
A0A076HBF2      DGLAFLNKQ-APSLQTRLDQLQGELADFRTRYSLLEPTA-------EGGA---LKKRETA
A0A354B169      DGLTFLNKN-APTLQQKTSQLQSDLAKFRERHNLIEPTE-------EGGA---IKGRLAQ
G4FMX5          DGLNFLNKQ-APALEAKTEQIQSEVAAFRIKHSLLEPTA-------EGGA---LRQQEAG
Q0IDT5          DGIAFLDLQ-APALQAKADAIQGELAEFRRRHSLLEPAI-------EGTA---LKQREAT
A0A2D6FCW3      DGLNFLNKQ-APALEAKTEEIQSEVSDFRQRHSLLEPTT-------EGGA---LKQREAA
A3ZA21          DGIDFLNKQ-APALQQKTEAIQNELAAFRRQHSLLEPTA-------EGGA---LKDRETA
A0A140K3H3      NAINFIDEQ-LPKAQAELNEVAKAIRNFRQTYNIVDPDE-------YALR---VIQFRDG
K9XUB8          NAINFIDQQ-LPKAQAELDDVAKKIRNFRQSYHIVDPNE-------YASR---VIQFRDG
Q7NEU3          GAIAFIENE-LPPVRKEVERAEEQLRTFRRQYSILDPQV-------QGTE---LAATLNT
A0A6H2NHD5      RGLTFLDEQ-LQEKWQEVSDIEDNLSDFQKQYDLVDVNA-------ASES---VTQRLNQ
A0A2P8W4F7      RGLTFLDEQ-LQEKWQEVEAIESDLSEFQKRYDIVDVNA-------TSES---VTQRLNQ
A0A5Q4E0Z4      RGLEFLDEQ-LQEKWQEVDTIESGLSDFQKRYDLVNVTT-------TTES---VTQRLNQ
A0A2P8VVX1      RGLDNVNNR-LANTQQNLRDSQSALEQFRINQNLIDPNS-------QAIS---VVESLNQ
A0A2P8WHY0      RGLEHTNNR-LDNTQKNLQQAQAALEKFRQSQNLIDPTL-------QSQA---VVTSLNE
A0A2T1CMT9      DALTFINQQ-IPQARKELTQTETNLTKLTKENNLVSPEA-------EATS---VKENIRQ
A0A563VQJ3      NAKEFINRQ-LPEIEVKVETAESELEQFRTENSIIDLQE-------EKRT---IVQDAGA
A0A1D8TX52      KGLAFINQQ-LPKARKDLEQAEQQLEQFRKSKNLIDPSQ-------QAVA---VSQTLNG
A0A1D9G4T2      KGLAFINQQ-LPTARNNLEQAEQRLEQFRKSKNLIDPSQ-------QALA---VSQTLNG
F4XP71          KGLAFINQQ-LPTARNNLEQAEQRLEQFRKSKNLIDPSQ-------QALA---VSQTLNG
A0A1U7N5X9      KGLAFINQQ-LPKARKDLEQAEQQLEQFRKSKNLIDPSQ-------QAVA---VSQTLNG
A0A6B3N2I8      KGLAFINQQ-LPTARNNLEQAEQRLEQFRKSKNLIDPSQ-------QALA---VSQTLNG
A0A2W6ZAV2      QGLEFLDTQ-APVLQQGVVELQQQLSSFRRQNSFLDPSS-------QGEA---IQTQRQA
A0A2G7GMH8      KGLTFINEQ-LPVIKDRVNQAENALELFRESNNLIDPEL-------QAKA---LTDALNN
K9W742          KGLAFIDEQ-LPKARLSVTQSEAALEKFRKTQNLIEPDA-------QTTA---LTTALNA
A0A2T1DWE8      RGLAFVDEQ-LPLVEKQVDRAEDAMERFRKSQNLVDPEV-------QSRA---LIDALSN
A0A1U7I8L3      KGLSFIDAQ-LPSLRESTVRTEAALEKFRKSQNLIQPEL-------QAKA---LIESLKD
A0A2T1DJL8      KGLGFINEQ-IPQVEARVNQAEAALERFRKNQDLIDPEL-------QSKS---MVDSLAA
A0A1Z4J9W0      KGLSFIDRQ-IPEVQAKVNQAESNLERFRSTSNLVDPEV-------QAKS---LVDSLKE
A0A0N7Z5K9      KGLSFIDRQ-IPQVQEKVNKAEADLERFRKSSNLVDPED-------QSRA---LIESLRE
A0A0S3TXC5      KGLSFIDRQ-IPQVQAKVDKAEADLEQFRKSSNLVDPED-------QSRA---LVESLRE
K9SA61          RGLAFINDQ-LPKVQAEVREAEAALEAFRKNQNLIDPEA-------QSQT---ILEALSR
A0A3D1PBA3      KGLKFINEQ-IPVVSKTVDQAENKLEQFRKNYNLIDPEQ-------QATA---VSQSLNA
K9XPB0          DGLAFIAKQ-IPAAQQEVAAIEAKLTQLRSENNLVSPQG-------ESES---IKAVLNN
A0A350Y7Z1      EGLAFINDQ-LPTARDNVIQAEKALEQFRETQNLIDPVQ-------QATT---ITDALST
A0A352X2A7      DGLSFIDNQ-LVTAANNVNKAERSLEEFRENQNLIDPLQ-------EASN---VGETLTK
A0A0D8ZYV0      KGLKFINEQ-IPGVRNQVAQSEAQLEKFRTNQNLIDPEQ-------QAAA---INNSLNA
A0A2T1FP73      KGLKFINEQ-IPAVTKTVDQAENKLEEFRKNNNLIDPEQ-------QAAT---VNNSLNA
A0A433VMS2      KGLKFINEQ-IPAVTKTVDQAENKLEDFRKNNNLIDPEQ-------QAAT---VNNSLNA
K9TYA7          KGLKFINEQ-IPAVTKTVDQAENKLEEFRKNNNLIDPEQ-------QAAT---VNNSLNA
A0A2P8QUE1      KGLKFINEQ-IPAVTKTVDQAENKLEEFRKNNNLIDPEQ-------QAAT---VNNSLNA
A0A2T1DNG3      RGLAFVDKQ-LPQVEGKVKDAEAALEQFRRDQSLIEPSA-------EAAA---QTEMLNR
B8HNB0          SGVRFIEEQ-LPAAQAKLAQSAQAVRNFRKQYGLVTPDA-------YAEA---VVSTRME
A0A1Z4LN32      AARSFIEKQ-LPSAKRGLSKVTEELRDFKQKNKVIELKE-------ETTK---AVQIIHE
A0A2I8A9F5      AAGDFIAKQ-LPGAKTELEEAQKALLQFKTQNKIVNLEE-------ESSG---LVKNAIT
A0A218Q6R8      AAATFIQQQ-LPQAKKELEEITEALRQFKTQNQIVDLQE-------EKNA---TVTIVLA
A0A218QGE0      SAGAFIEKE-LPRAKAQLEKAAEALRKFKLKNQILELAE-------ETKA---SVKNISD
A0A563VS48      AARTFITEQ-LPQVKANVQEAESELRKFKNQYQIANLTE-------ETSA---TINSISN
A0A318BJ18      YGRNLLQRQ-LALQKERLDDSQRQLVAYASAQQIINLPA-------PGSGIGGTTTVERS
A0A3B8Y8H9      QGLQFVEDQ-LPKLDQEVSSLQKELERFRKKHNFIDPQS-------QSRI---LSSNLTN
A0A2W1JVB9      SARQYIDQE-LPKTREKIENLEEQLRRFKETNKIVAIDK-------EAEV---AVEAVIR
A0A6H1U102      NAIDFIEEQ-LPKAQAELNETAQAIQKFRQDYGIVDPES-------YANQ---VLEQKQL
A0A563VLD6      NAIDFIDEQ-LPDSQLDLDKVAYDIRSFRQENNLVDPNI-------YASD---VSKFRQS
A0A2P8W9H0      RGLDFLDEQ-LPEVRERVSSLEAELEDLRQRSNLIDPLK-------QGEQ---LSTQTAK
A0A6I5P386      RGISFVDEQ-LPVVRQQVQDLETELENLRKSYNLIDPLL-------QGEQ---LALQASK
A0A318BG22      YARSFVGNR-LTQQRARLEESERQLVAYAEQNGIISVTD-------AKTA---GTGSGAQ
A0A1Z3HMQ0      AARQFVQEQ-LPKAEAEVEQAAEALRQFKDQNQIIALES-------EANA---AVSMINN
K1XF69          GAKEFIQEQ-LPRVQQELFLAEKSIQDFKERNEIVDLGT-------EFAI---SVQEMAQ
B5W297          GAKEFIQEQ-LPRVQKELFLAEKSIQDFKERNEIVDLGT-------EFAI---SVQEMAQ
A0A6H2AL05      GAKEFIQEQ-LPRVQKELFLAEKSIQDFKERNEIVDLGT-------EFAI---SVQEMAQ
H1W7M8          GAKEFIQEQ-LPRVQKELFLAEKSIQDFKERNEIVDLGT-------EFAI---SVQEMAQ
A0A5Q4H6A5      GAKEFIQEQ-LPRVQQELFLAEKSIQDFKERNYVVDLGT-------EFAI---SVQEMAQ
D5A466          GAKEFIQEQ-LPRVQQELFLAEKSIQNFKERNEIVDLGT-------EFAI---SVQEMAQ
U5QJM6          GAITFINAE-LPRVRMNVEASEEALRDFRSKNNILDPEE-------QAKA---LSGVMSD
A0A1Z4RPC6      SADSFVTST-IPKIEDKLQTLESRLQNFYERNQVVDLQE-------EKRI---LVGEVGN
A0A2T1CMZ0      SADSFISST-IPKIETKLNSLEANLQSFYEKNQVVDLQE-------EKKS---LVDEIGT
L8M4F7          VAKKFINQQ-IPTLKAKVESAESALAKFRADNKIVDLQQ-------EKQT---VIEETAN
A0A140K2P2      SAREFINKQ-LPQIESQVSQAESELRNFKESNQVVNLTK-------EAES---TVMQMAE
K9XWX4          SAREFINKQ-LPQIESQVSQAESELRNFKESNQVVNLTR-------EAES---TVVQMAN
A0A140KB14      NADSFISNQ-LPQIEQKLSKAESDLRRFKEANRVVNLAK-------EKET---LVLELGN
K9XX88          NADGFISNQ-LPQIEQKLSQAESDLRRFKEANRVVNLAK-------EKET---LVVELAN
A0A563VSV6      NADSFVTTQ-IPQVEDKLKQNESILQEFRTKHKIVDLQE-------EKKV---LVAELGT
L8LZE9          SADFFVESQ-LPQVEKRLEEYESILQNIRERNNIVDLTQ-------EKRV---LVQEIGT
A0A433NM31      AARNFIESQ-LPKSKISVQKAEAQLREFKERNNILDLEN-------EAKA---AVTLVTD
A0A1Z4NDS1      AAGTFLDDQ-RPNAARIVQAAELELRRFKEENKVINLQE-------EATA---SVNAIAR
K9F4D9          AAQEFITAQ-LPESEEAVEEAEASLRRFKEGNNIVDLEE-------ESRN---LVESLFT
U9VXM0          AAQEFISAQ-LPESEAAVNEAEEALRQFREGNSIVDLEE-------ESRN---LVESLFT
A0A6I5QPI5      AARQFIEEQ-LPTTEAEVLRVEGALREFKETNDIISLDQ-------EASN---AVSVLAG
A0A433W533      AAGDFIAKQ-IPDVEARVRRAESALRRFKEQNHLIALEV-------EAQG---AVTVIQT
A0A2P8QWJ3      AAGDFIAKQ-IPDVEARVRRAESALRRFKEQNHLIALEV-------EAQG---AVTVIQT
A0A2T1FKP8      AAGDFIAKQ-IPDVEARVRRAESALRRFKEQNHLIALEV-------EAQG---AVTVIQT
K9U6L7          AAGDFIAKQ-IPDVEARVRRAESALRRFKEQNHLIALEV-------EAQG---AVTVIQT
A0A1E5QP61      AAREFIMQQ-LPDTEETVRQAEAALRAFKEENSVVSLQD-------EATS---AVISISN
U5DPF5          AAREFIEEQ-LPLTERSVREAEEALRRFKERNRIIVLNE-------EAQT---TVRLLGS
A0A3M1PML8      AARDFIAKE-LPKTEAAVKAADSDLRRFKEANGVVLLES-------EAQE---AVNIISK
A0A3M2GIL5      AAREFINKE-LPEIEARLSRAEAELRNFKERNNIVELEE-------EARS---AVFVMGE
A0A6H1TSJ9      AAREFINKE-LPEIEARLSRAEAELRNFKERNNIVELEE-------EARS---AVFVMGE
A0A0T7BPZ0      SARKFIISQ-LPISESSVRAAESAFRQFQERNKIIILQE-------QESN---AVKMISS
A0A352X442      AAREFITEQ-LPRLKQNVSIADAELRNFKEQNKIVDLVN-------EAKS---SVETVAD
A0A6B3NF44      AAREFIDQQ-LPQVEANVSKSEEALRRFKEENRVVALQE-------EASA---SVSIISS
A0A0M0SHU3      SAGRFILQQ-LPKTEEAVQKAELALRRFKEKNKVIVLQE-------EATA---AVNTISK
A0A1D2PBN3      SARKFIQRQ-LPATETSVKRAEAELRRFKEENKVIALQE-------EATA---AVNEISK
A0A0C2LVR7      SARKFIQKQ-LPATEISVKRAEAQLRRFKEENKVIALQE-------EATA---AVNEISK
A0A1Z4PQB9      SVRKFIQKQ-LPATERSVKRAEAELRRFKEENKVIALQE-------EATA---AVNEISK
A0A1Z4SFN6      SARKFIMKE-LPATELSVRAAESTLRKFKEENKIINLES-------EAGL---AVERISN
K9PGI8          SARKFISQQ-LPATEISVRGAELALRKFKEENKIIALQE-------EAST---AVQVISR
A0A2T1E9V8      SAGNFITSQ-LPKVKANVYNADAAIRKFKEKYKLTDLAQ-------TQRS---VAENIER
A0A3M2GQQ6      NAIEFIEEQ-LPKAQQELSESALAIQSFRQTYGIVDPES-------YANQ---VLDIKQS
A0A6H1U2X0      NAIGFIEEQ-LPKAQQELSESALAIQSFRQTYGIVDPES-------YANQ---VLDIKQS
K9SGJ5          TAIQFIEDK-LPQVKKDLDESALTVTKFREKYKIVDPDT-------YAAS---VYTMKQD
A0A6C2DSN4      NAIKFIQDK-LPQVKQKLEKSALAVTQFRKTYNIVDPDT-------YAAA---VFKMREA
L8MYT6          NAIKFIQDK-LPQVKQKLEKSALAVTQFRKTYNIVDPDT-------YAAA---VFKMREA
A0A352JGJ6      TAIKFIQDK-LPQVKQQLDKSALAVTRFRKTYNIVDPET-------YAAA---VFKMREV
A0A1J5GLS2      TAIKFIQEK-LPQVKQQLEKSALAVTQFRKSYNIVDPET-------YAAS---VYSMREA
A0A2W4W6M5      TAIKFIQDK-LPQVKQQLDKSALAVTQFRKTYNIVDPET-------YAAS---VYKMREA
A0A2W7AN33      TAIKFIQDK-LPQVKQQLDKSALAVTQFRKTYNIVDPDI-------YAAS---VYKMREA
A0A256BLV2      TAIKFIQDK-LPQVKQQLDKSALAVTQFRKTYNIVDPDT-------YAAS---VYKMREA
A0A2W6ZXF3      TAIKFIQEK-LPQVKQQLDKSALAVTQFRKTYNIVDPET-------YAAS---VYSMREA
A0A2Z5WX66      TAIKFIQGK-LPQVKQQLDKSALAVTQFRKTYNIVDPEV-------YAAA---VFKMREA
K9W1T3          AAREFVEKQ-LPIIEVTVRQAEQDLRKFKEQNKVLDLAG-------EATS---TTEVLNN
A0A1Q4RTR1      SAREFISKQ-LPEVEAKVRQAEVSLRLFKEKNRVVELQQ-------EAKT---SIANQSD
A0A1Z4SQV2      AAREFISKQ-LPEVETKVRSAEYGLRQFKEKNRVVELQE-------EAKT---SIKNQSD
A0A2H2XGN1      AAREFISKQ-LPEVETKVRSAEYGLRQFKEKNRVVELQE-------EAKT---SIKNQSD
A0A433UXH8      AAREFISKE-LPEVETKVRSAEYGLRQFKEKNRIVELQE-------EAKT---SIKNQSD
A0A1Z4RMB9      AAKDFITKE-LPSIESKVQQAESQISAFRTQNNIVDIEE-------EKRG---VVESIGA
B4WP72          AARRFIAGQ-LPQTESAVSAAEANLRQFKEENGVVDLEQ-------EAAQ---AVDSIGN
A0A318B4H2      DARGFLEQR-LAQLRSRLEASERELVAYASGKGIVSFSS-------GSTEKGGGGGERTL
B4WQE3          RGVDFVNDQ-LPAVRARVNELEAELEALRQNSNLIDPLA-------QGDQ---LSQQMAQ
A0A2K3BR24      AAREFIEEQ-LPKTEQSVQAAEEKFREFKEENNIIALSQ-------EASS---TVDILAS
K9YXY1          AAREFIEEQ-LPKTEQSVQAAEEKFREFKEENDIIALSQ-------EASS---TVSILAS
A0A1U7HGH0      SAGNFITAQ-LPKVKANLQRADLAVRNFKEKNQLTNIEQ-------SQTA---LAANIER
K9XJD3          SAGNFITAQ-LPKVKANLQRADLAVRNFKEKNQLTNIEQ-------SQTA---LAANIER
K9SX01          SARKFIDEQ-LPKLQISLRQAEAALRRFKEVNKAYLPEA-------EAQS---AVAAVTS
A0A4P7ZT55      QGLKFLDEQ-APGLQERVSQIQQELANFRRANALLIPED-------RAKQIELERADLEA
A0A1E5QIR9      AVRRFIEEQ-LPKSEFTVQEAEANLRVFKENNRIVALDQ-------EASA---TVTLLGG
A0A1Z4IBC7      TAKQVILRE-IPKAEESVKKAESELRIFKEINKIVALEQ-------EATV---AVDTVSK
A0A1W5CPC7      TAKQVLIAE-IPKAETSVKKAESELRIFKEINKIIALEQ-------EATV---AVDTVSK
A0A5Q0GKD1      TAKQVLIAE-IPKAETSVKKAESELRIFKEINKIIALEQ-------EATV---AVDTVSK
Q3MDC6          TAKQVLIAE-IPKAETSVKKAESELRIFKEINKIIALEQ-------EATV---AVDTVSK
A0A1Z4KM73      TAKQVLIAE-IPKAETSVKKAESELRIFKEINKIIALEQ-------EATV---AVDTVSK
Q8YNX7          TAKQVLIAE-IPKAETSVKKAESELRIFKEINKIIALEQ-------EATV---AVDTVSK
A0A367R4K6      AAKQVLVAE-LPKAEEIVSRAESQLRLFKEKNKVIVLDQ-------EASA---AVDTISK
A0A1E2WSV8      TAKQVLVTE-VPKAEEIVRRAESKLRLFKETNKIVVLEQ-------EATA---AVDTISK
A0A2R5FRT9      IAKEVLVTE-VPKAEEIVRRTESKLRLFKEKNKVVVLGQ-------EASA---AVDTISK
A0A2K8T1B6      TAKEVLVTE-VPKAEEIVRRAESKLRLFKEKNKVVVLGQ-------EASA---AVDTISK
A0A235I9I0      TAKQVLVTE-VPKAEEVVRRAESKLRVFKETNKVVVLDQ-------EAAA---AVDTISK
A0A2D0HQT8      TAKQVLVTE-VPKAEEVVRRAESKLRVFKETNKVVVLEQ-------EAAA---AVDTISK
A0A2L2NU95      TAKQVLVTE-VPKAEEVVRRAESKLRLFKETNKVVVLEQ-------EAAA---AVDTISK
A0A367S084      TAKQVLVTE-VPKAEEVVRRAESKLRLFKETNKVVVLEQ-------EAAA---AVDTISK
A0A0V7ZFJ4      SAREFLNKQ-LPEVEQRLIRAEAELREFKEKNGIVALEQ-------EAQT---GVEALKD
A0A367RIS1      AAREFLNKQ-LPLVEAKVAEGEAALRQFKEKYEVVSLEV-------EAQE---GVRSLNE
A0A235IXQ2      AAREFLNKQ-LPLVEAKVTEEEAALRRFKEKYEVVSLEE-------EAKE---GVKRLNE
A0A1W5CNX3      AAREFLSKQ-LPLVEAKVTEAEAALRRFKEKYEVVSLQE-------EAIQ---GVKRLND
A0A5Q0GJJ5      AAREFLSKQ-LPLVEAKVTEAEAALRRFKEKYEVVSLQE-------EAIQ---GVKRLND
Q3MEB7          AAREFLSKQ-LPLVEAKVTEAEAALRRFKEKYEVVSLQE-------EAIQ---GVKRLND
A0A1Z4KHN9      AAREFLSKQ-LPLVEAKVTEAEAALRRFKEKYEVVSLQE-------EAIQ---GVKRLNE
Q8YT70          AAREFLSKQ-LPLVEAKVTEAEAALRRFKEKYEVVSLQE-------EAIQ---GVKRLNE
A0A218Q4C1      AAREFLTEQ-LPLVEAKVSEAELALRRFKERNEVVALEE-------EAKQ---GVERVYE
A0A166IWU6      AAREFLNKQ-LPLVEKQVAESELALRQFKEKYEVVLLEE-------EAKQ---GVERLYQ
A0A2S0Q8C0      AAREFLNKQ-LPLVEKQVAESELALRQFKEKYEVVLLEE-------EAKQ---GVERLYQ
W6FSX4          AAREFLNKQ-LPLVEKQVAESELALRQFKEKYEVVLLEE-------EAKQ---GVERLYQ
A0A0V7ZNJ9      AAREFLNNQ-LPEVESRVVKAEAELRKFKEENKVVALKE-------EAQF---GVEGLKD
A0A0R0M9H9      AARKFLSQE-LPRIEKQVIKAELELRRFKEINRVVALDA-------EAKV---GIETLGK
A0A1S1ZVW2      AARKFLSQE-LPRIEKQVTKAELELRRFKEVNRVVALDA-------EAKV---GIESLGR
A0A1B7WX82      SAREFLAKQ-LPEVERQVTKAEMSLRRFKENNRVAVLDV-------EAKT---GLESLAK
A0A1B7WTD1      AAREFLSQE-LPKVERRVTEAEIALRRFKEKNRVVALDV-------EARV---SLESLGR
A0A480ABC0      AAREFLSKE-LPKVERRVTEAEIALRRFKEKNRVVALDV-------EARV---SLESLGN
A0A1Z4LRU5      AAREFLQKE-LPQVEGRVVQAEAALRQFKEQNNVVALEE-------EAKF---GVESLKD
A0A1Z4JVB4      SLREFLSKQ-LPEVENRVLRAEMALRRFKEKNRVVALDE-------EAKV---GVEGLNQ
K9PIA4          SAREFLNKE-LPQVEKRVMKAEMSLREFKEKNKVIALEI-------EAKA---GVEGLKD
A0A1Z4HVE1      SAREFLNRQ-LPEVEKRVLKAEMALRRFKEKNRVVALDV-------EAKV---GVEGLKD
A0A252ECZ1      SAREFLNRQ-LPEVEKRVLKAEMALRRFKEKNRVVALDI-------EAKA---GVEGLKD
A0A1Z4G5Y1      SAREFLNRQ-LPEVEKRVLKAEMALRRFKEQNKVVALEV-------EAKT---GVEGLKD
A0A252DNA2      SAREFLNRQ-LPEVEKRVLKAEMSLRRFKEQNRVVALDV-------EAKA---GVEGLKD
A0A252E1Q4      SAREFLNRQ-LPEVEKRVLKAEMSLRRFKEQNRVVALDV-------EAKA---GVEGLKD
A0A6G9SK36      SAREFLTKQ-LPEVEQRVLRAEMALRRFKEKNKVIALDV-------EAKV---GVEALKD
A0A1Z4M597      SAREFLNRQ-LPEVEKRVLKAEMALRRFKEKNRVVALDV-------EAKV---GVEGLKE
A0A1Z4MWT1      SAREFLNRQ-LPEVEKRVLKAEMALRRFKEKNRVVALDV-------EAKV---GVEGLKE
A0A1Z4TX53      SAREFLNRQ-LPEVEKRVLKAEMALRRFKEKNRVVALDV-------EAKV---GVEGLKE
A0A5P8VSD1      ATREFLNKQ-LPLVQAKLAESQAALRRFKEKHEVVSLEA-------EAIE---GVKRLNE
A0A2A2TNQ5      AARDFLRKQ-LPEIENKVVQAEATLRRFKDDNKVVSLAE-------EAKV---GVEGMRN
A0A3S1C4K5      SAREFLSKQ-LPNIEGRVIAAEAGLRKFKDENKVVSLPE-------EAKY---GVEALKD
A0A1X4G3D5      KARQVLAKK-LPRVERELAKAETDLRQFKESNEIISLEA-------EAES---GMKNVST
D4TNI2          KARQVLAKK-LPRVERELAKAETDLRQFKESNEIISLEA-------EAES---GMKNVST
A0A1Z4H6Z8      SAREFLNRQ-LPEVEKRVLKAEMALRRFKEKNRVVALEV-------EAKV---GVEGLKD
A0A1Z4NPM1      AAKEFLSKQ-VPQLERRVVVAEADLRRFKDENRVVELTE-------EAKV---GVEAMRN
A0A3F3KPR9      AARKFLSQE-LPRIEKQVIKAELELRRFKEINRVVALDA-------EAKV---GIETLGR
D4TGN7          AARKFLSQE-LPRIEKQVIKAELELRRFKEINRVVALDA-------EAKV---GIETLGR
A0A1Z4UZW9      SAREFLSKQ-LPEVEKRVTKAEMNLRRFKENNRVVALDV-------EAKT---GLESLGK
A0A0K2M5H0      SAREFLSKE-LPEVEHRVTKAEMNLRRFKENNRVVALDV-------EAKT---GLESLGK
A0A1B7VSH4      SAREFLSKQ-LPEVESRVTKAEMNLRRFKENNRVVALDV-------EAKT---GLESLGR
A0A1B7W126      SAREFLSKQ-LPEVESRVTKAEMNLRRFKENNRVVALDV-------EAKT---GLESLGR
A0A3D4C6Q6      SAREFLSKQ-LPEVESRVTKAEMNLRRFKENNRVVALDV-------EAKT---GLESLGR
A0A1B7UVJ4      SARQFLAKQ-LPEVERQVTKAEMSLRRFKENNRVAVLDV-------EAKT---GLESLAK
A0A1B7UTR1      SAREFLDKQ-LPEVEKRVTKAEMTLRRFKENNRVVALDV-------EART---GLESLGK
K7W0A4          SAREFLDKQ-LPEVEKRVTKAEMTLRRFKENNRVVALDV-------EAKT---GLESLGK
A0A5C0DRW9      SAREFLDKQ-LPEVEKRVIKAEMTLRRFKENNRVVALDV-------EAKT---GLESLGK
A0A6H2C088      SAREFLDKQ-LPEVEKRVIKAEMTLRRFKENNRVVALDV-------EAKT---GLESLGK
A0A2T1CIL7      SAREFIKAQ-LPKVELTVAKAEEDLRRFKTKNKIANLAQ-------EASN---NINATKS
A0A433V7A0      AARKFISSQ-LPTSEADVVRAEMALRKFKELNQVVDLNQ-------EATS---TVKVIED
A0A2T1FTR8      AARKFVAQE-LPKIENEVKQAENDLRLFKEQYNVVDLPT-------ESVK---AVETITS
K9UA41          AARKFVAQE-LPKIETEVKQAENDLRLFKEQYNVVDLPT-------ESVK---AVETITS
A0A0C2LBE2      SARKFIQKQ-LPTTEVSVKQAESALRQFKENNKIITLQE-------EASA---AVQAIAK
A0A433NN38      SARKFMWEQ-VPKTEQAVKQAEANLRKFKEANKVVVLQQ-------EAAE---AVSTISK
A0A2N6K0T2      SAGKFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EATA---AVNTISK
A0A2N6ML72      SAGKFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EATA---AVNTISR
G6FQZ6          SAGKFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EATA---AVNTISR
A0A2N6MQX9      SAGKFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EATA---AVNTISR
A0A2N6KXT6      SAGKFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EATA---AVNTISR
A0A2N6KGB9      SAGKFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EATA---AVNTISR
A0A2N6L3Y5      SAGKFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EATA---AVNTISR
A0A0S3TIS7      SAGKFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EATA---AVNTISR
A0A1U7GW28      SAGKFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EATA---AVNTISR
A0A2N6LW63      SAGKFMLQQ-LPKTEEAVQKAELALRRFKERNKIIVLQE-------EATA---AVNTISR
A0A328IH74      SAGRFILQQ-LPKTEEAVQKAELALRRFKEKNKVIVLQE-------EATA---AVNSISK
A0A4D9CIB0      SAGRFILQQ-LPKTEEAVQKAELALRRFKEKNKVIVLQE-------EATA---AVNSISK
A0A1Z4TQ63      SAGRFILQQ-LPKTEEAVQKAELALRRFKEKNKVIVLQE-------EATA---AVNTISK
A0A4Q9J8G2      SAGKFILQQ-LPKTEEAVQKAELALRRFKEKNKVIVLQE-------EATA---AVNTISK
A0A1Z4SMD6      AAGSFIKKQ-LPDSKAELEQAAEALRQFKNQFQIIELKD-------ESTA---AINNVAK
A0A2H2Y096      AAGSFIKKQ-LPDSKAELEQAAEALRQFKNQFQIIELKD-------ESTA---AINNVAK
K9S8M8          AARKFITEL-LPKTEASLRQAEAQLRDFKERNGVISLNE-------EART---AVESIAT
A0A1Z4NFV0      SAGKFIEQQ-LPRARAELEKSAEELRKFRTQNQIANLPE-------EAKT---TVESIAK
B0CAX4          SARVFIEKQ-VPEVAAKLKNLDLSLRRFKETNGIIALEE-------EAKV---SVEVEGN
A0A350Y0P6      AAGEFIAKQ-LPQIQNRVRQAESALRNFKEQHNIVSIDE-------EGTA---AVEIMAD
A0A352X940      AARKFIERQ-LPKTESTVRQAEAALRRFKEENNIVAIEE-------EAKS---AVQAMAE
B8HTN4          NSREFIERK-LPDVTEQLRGLDRQIRSFKETHGIVDLPT-------EQIE---SVKFKSL
A0A2A2TPF8      AARKFIEAQ-LPRAKGELDKTAEESRRFKEQNQIINLEE-------ESNE---TVKTIGE
A0A1Z4R0P8      AARKFIEAQ-LPRAKGELDKTTEDLRRFKERNQIINLEE-------ESNE---TVKTIGE
A0A0T7BUI3      AAGEFIKKQ-LPSSRKELESAAEALRQFKNKNKIVQLEQ-------ESSS---AITSMAK
A0A1Z4LP32      AAGQFLKQQ-VPLSRLELENATEALLQFKNQNQVIQLAE-------EATA---AIQNISK
K9REP9          AAGEFLKKQ-VPLSKIELEQATQALLQFKNKNQVIQLPE-------EATA---AIQNIST
A0A1Z4SIJ3      AAGEFIKKQ-LPFSRAELESASEALRRFKTENKIIQLSQ-------ESTA---GINNIAQ
A0A2H2XPG4      AAGEFIKKQ-LPFSRAELESASEALRRFKTENKIIQLSQ-------ESTA---GINNIAQ
K9V3C7          SAGKFIELQ-IPQAKIELDKTSEALRNFKARNQIISLKE-------ESDS---TVKIIEE
A0A1Z4T6Y7      SARKFIENQ-LPRAEQELNKTTEELRSFKTNNKVINLDK-------ETEE---TVKNIGE
A0A2H2Y561      SARKFIENQ-LPRAEQELNKTTEELRSFKTNNKVINLDK-------ETEE---TVKNIGE
A0A1Q4S362      AARKFIEGQ-LPRAEGQLNRATEDLRSFKAANQVINLEK-------ETEE---TVKNIGE
A0A3S1CIN8      AARKFIEGQ-LPRAEGELNRATEQLRSFKAANQVINLEQ-------ETEE---TVKSIGE
A0A2A2TC28      AAGDFIRKR-LPSSRAELERATEALRRFKIQNNIVQLPQ-------EATA---AITNISN
A0A0C1NCB0      AAGEFIKKQ-LPYARADLERASEALRQFKTSNKIVELKQ-------EATS---AISNVAQ
A0A2N6K7Q9      AAGEFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------ESTA---AIDIISK
A0A2N6MXH6      AAGEFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------ESTA---AIDIISK
A0A2N6M5A8      AAGEFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------ESTA---AIDIISK
A0A2N6LL61      AAGEFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------ESTA---AIDIIAK
A0A0S3TP66      AAGEFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------ESTA---AIDIISK
G6FP91          AAGEFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------ESTA---AIDIISK
A0A1U7GYR5      AAGEFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------ESTA---AIDIISK
A0A2N6KY52      AAGEFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------ESTA---AIDIISK
A0A2N6KMP5      AAGEFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------ESTA---AIDIISK
A0A2N6MA45      AAGEFIKEQ-LPASRQELERAAEALRQFKIQNKVIQLAE-------ESTA---AIDIISK
A0A4Q9J9V9      AAGEFIKEQ-LPNSRRELERAAEALRQFKIQNRVIQLAE-------ESSA---AIDIISK
A0A328IGA1      AAGEFIKEQ-LPNSRRELERAAEALRQFKIQNRVIQLAE-------ESSA---AIDIISK
A0A4D9CE41      AAGDFIKEQ-LPNSRRELERAAEALRQFKIQNRVIQLAE-------ESSA---AIDIISK
A0A0M0SFT2      AAGEFIKEQ-LPNSRRELERAAEALRQFKIQNRVIQLAE-------ESTA---AIEIISK
A0A1Z4TLC8      AAGEFIKEQ-LPNSRRELERAAEALRQFKIQNRVIQLAE-------ESTA---AIDIISK
A0A0C2LFH0      AAGEFIKKQ-LPQARVELNQAAEALREFKTRYKIIELPE-------EASA---AVQNVAS
A0A1Z4IYV4      AAGEFIKKQ-LPYARAELDRSAEALRQFKIQYKIIELPE-------EASA---AVKNLGQ
A0A1Z4Q0T6      AAGEFIKKQ-LPYARAELDRSAEALRQFKIQYKIIQLPE-------EASA---AVQNLGQ
A0A0C2PT44      AAGEYIKKQ-LRYARAELERSAEALRQFKTRYKIIELPE-------EASA---AVQNLGQ
A0A1D2P6J4      AAGEFIKKQ-LPYARAELDRSAEALRQFKTRYKIIELPE-------EASA---AVKNLGE
A0A3M9ZEU1      AAREFISRE-IPRVEAAVRQAERALREFKEANQIVALDT-------EATA---AVNIIAS
A0A1Z4JK72      KAGRFIESQ-LPRAEAELQKASEELRLFRTQNQIVDLER-------ESAA---NINSLSL
A0A0N7Z489      KAGRFIDNQ-IPPAEEALNRASEDLKNFRARNGIVDLER-------ESAA---NINSAAV
A0A0S3TXS2      KAGRFIDSQ-IPPAEEALNKASEDLRNFRAQNGIVDLER-------ESAA---NINSAAV
A0A1Z4RN12      SARDFIAKQ-LPKAEENVREAEANLRIFKNRNRTINLDE-------ETAS---TIESIST
A0A2T1CMF9      KDGDFIKQQ-LPKLETEVENAEANLRNFKNRNGISDLQG-------QITA---DIDSVAQ
Q7NDC5          STRGFVEAQ-LPAMEQRLRASERKLRSFKEQYGSVALAE-------EQQA---AVRLLSE
U5QGK3          STRTFVESQ-LPKMEQRLRDSERRLREFKERYGSVALPE-------EQQA---VVKQLAE
A0A2W4UY24      AAQSFVASQ-LPASKAKVGKIESDLRAFKEANGIVNLEE-------ESQN---TVKTLST
A0A2T1GMT4      TARQFIEQQ-MPKTLAAVNAAESAVRSFKQQNNIVDLSE-------EAKS---AVSVIGN
K9UI51          NARQFIEQQ-MPKTLAAVNSAESAVRNFKQQNNIVDLSE-------EAKS---AVGVIGN
K9QM62          ATRRFMARQ-LPQTQAAVSTAEVALRKFKQQNNIVDLTE-------EARS---AVTIIGG
A0A1Z4FWI3      ATRRFMAKQ-LPNTRAAVQEAEGALRRFKQSNNIVDLIE-------ETRS---AVAIIGN
A0A1Z4JYE7      ATRKFMERQ-LPQTQAAVNYAEAVLRKFREQNNIVDLAE-------ETKT---SVGVITG
A0A2T1FXY4      ATRLFMAKQ-LPKTQADVHQAEVKLRIFKQKNNIVDLSE-------EAKT---AVANIGS
K9TYI2          ATRLFMAKQ-LPKSQAAVHQAEVKLRIFKQKNNIVDLSE-------EAKT---AVANIGS
A0A1Z4QL41      ETRQFLDKQ-LPKTQTAVQTAEAALRRFKQQNSVVDLSE-------ETKS---AVTIIGN
A0A252D4T4      ATRKFMAKQ-LPNTKNAVQEAEAALRIFKQKYNIVDLVE-------ETRS---AVAIIGN
A0A252DJH5      ATRKFMAKQ-LPNTKNAVQEAEAALRIFKQKYNIVDLVE-------ETRS---AVAIIGN
A0A252EB80      ATRKFMAKQ-LPNTKNAVQEAEAALRIFKQKYNIVDLVE-------ETRS---AVAIIGN
A0A6G9SKZ9      STRKFMARQ-LPNNRSAVQEAEAALRIFKQKYKIVDLAE-------ETRS---AVAIIGN
A0A1Z4HPW5      ATRKFMAKQ-LPNNRSAVQDAEAALRIFKQKYNIVDLAE-------ETRS---AVAIIGN
A0A1Z4MSN1      ATRKFMAKQ-LPNNRSAVQDAEAALRIFKQKYNIVDLAE-------ETRS---AVAIIGN
A0A1Z4U1C2      ATRKFMAKQ-LPNNRSAVQDAEAALRIFKQKYNIVDLAE-------ETRS---AVAIIGN
A0A0D6KV51      ATRKFMAKQ-LPNNRSAVQDAEAALRIFKQKYNIVDLAE-------ETRS---AVAIIGN
A0A1Z4MKF8      ATRKFMAKQ-LPNNRSAVQDAEAALRIFKQKYNIVDLAE-------ETRS---AVAIIGN
A0A2C6WC43      STRQFIARQ-LPKTQEAVDKAERELRIFKQKNRIADLTE-------ETKS---AVGIIGN
A0A1Z4L5A1      STRQFIARQ-LPKTQEAVDKAERELRIFRQKNRIADLTE-------ETKS---AVSIIGN
A0A367QD86      STRQFIARQ-LPKTQEAVDKAERELRIFKQKNRIADLTE-------ETKS---AVGIIGN
A0A235IZ96      ATRQFMAKQ-LPKTQAAVNNAEVALRIFKQKHQIADLSE-------ETKS---AVATIGN
A0A2L2NGP0      ATRQFMAKQ-LPKTQAAVNNAEVALRIFKQKHQIADLSE-------ETKS---AVATIGN
A0A2K8SM78      ATRQFMAKQ-LPKTQEAVNNAEVALRIFKQKHQIANLSE-------ETRS---AVETIGN
A0A2R5FPC0      ATRQFMAKQ-LPKTQEAVNNAEVALRIFKQKHQIADLSE-------ETRS---AVATIGN
A0A5P8W5T6      ATRQFIAKQ-LPKTQQAVNNAEVALRIFKQKHQIADLSE-------ETKS---AVATIGN
A0A140KBA0      AARQFISEE-LPEVEAKVAQAEADLRNFKNENQIANLSE-------ETTT---LIETSKL
K9XSG1          AAREFISQE-LPEVEAKVAQAEADLRNFKNENQIANLSE-------ETTT---LIETSKL
A0A0F5YE28      EAREFISQQ-LPPVQQEVFRAEQALRSFKEKNQVLDLEE-------EFRT---AVLEQAE
U7QEH7          EAREFISQQ-LPKVQEEVFRAEQALRSFKEKNQVLDLDA-------EFRT---AVTELAE
A0A3S1ATK5      TTYKFMARQ-LPKTQAAVYAAEVALRKFKQENRIVDLPE-------ETKS---AVGIIGN
A0A2Z6CPH0      ATRKFMAKQ-LPISQASVNRAEVALRVFRQKNNIADLSE-------ETKS---SVGIIAN
A0A1Z4GT50      DTREFMSKQ-LPKMQAAVREAEVALRKFKEKHNIVDLSE-------EAKS---GVAIIGN
A0A1Z4GIX0      ATRKFMAKQ-LPNTQAAVHKAEVALRIFRQKNNIADLTE-------ETRS---GVGIIGN
A0A2H6LC24      ATRKFMAKQ-LPNTQAAVHKAEVALRIFRQKNNIADLTE-------ETRS---GVGIIGN
B2J6N5          ATRQFIAKQ-LPKTQEVVNNTEVALRIFKQKYQIADLSE-------ETKS---AVATIGN
A0A367RMI4      AARQFMAKQ-LPTTQAAVNNAEVALRIFKQKHQIADLSE-------ETRS---AVATIGN
A0A235HUM0      ATRQFMAKQ-LPTTQAAVNNAEVALRIFKQKHQIADLSE-------ETRS---AVATIGN
A0A2L2NW47      ATRQFMAKQ-LPTTQAAVDNAEVALRIFKQKHQIADLAE-------ETRS---AVATIGN
A0A1E2WUR1      AARQFMAKQ-LPKTQAAVNNAEVALRIFKQKHQIADLSE-------ETRS---AVATIGN
A0A235IKU3      ATRQFMAKQ-LPKTQAAVNNAEVALRIFKQKHQIADLSE-------ETKS---AVATIGN
F4XKF3          KAREFITNQ-LPQSEANVRQAEAALRQFKERNQVVSLTE-------EARS---LVAVMAD
A0A1D9FX10      KAREFITNQ-LPQSEANVRQAEAALRQFKERNQVVSLTE-------EARS---LVAVMAD
A0A1D8TNX9      KAREFITNQ-LPQSEANVRQAEAALRQFKERNQVVSLTE-------EARS---LVAVMAD
A0A1U7MYU6      KAREFITNQ-LPQSEANVRQAEAALRQFKERNQVVSLTE-------EARS---LVAVMAD
A0A3C0NJ41      AAQDFIAKQ-LPKAETNVGQAETSLRRFKQENQVIALDE-------EAKS---AVGVMAN
A0A352AG88      AAVKFLNEQ-LPKAEANVNQAEMALRQFKEVNKVVSLEE-------ESRA---AVDTLAK
A0A350Y374      TAQEFITKQ-LPKAEANVNQAEAAVQEFKERNQVVALDT-------EATT---AVEVIAK
A0A355DPX0      TAQEFITKQ-LPKAEANVNQAEAAVQEFKERNQVVALDA-------EATT---AVEVIAK
A0A0D8ZUV2      EASKFIANQ-LPKTEARVRQAEAALRQFKEQNQIVSLDE-------EVKS---AVGIIKE
A0A433VDI0      EAVEFIAKQ-LPRTETTVRQAEAALRQFKEQNRVVNLDE-------EAKS---AVEIIQE
A0A3D1PG43      AVGEFIAKQ-LPTVQGTLRQAEAKLRRFKEQNQVVNLDE-------EGKS---AVEVIKQ
A0A2P8QQ72      AAEDFIVKQ-LPQTESTVRAAEASLRRFKERHQIVSLEH-------EAIS---AVEVLKE
K9TZQ7          AAEDFIVKQ-LPQTESTVRAAEASLRRFKERHQIVSLEH-------EAIS---AVEVLKE
A0A2G7GPR0      AAGEFIAKQ-LPQMEATVRQAELALRQFKEQNQVVALDE-------EAKT---AVAAVKQ
K9XH68          AAGEFIAKQ-LPQMETTVRQAELALRQFKEQNQVVALDE-------EAKT---AVAAIKQ
A0A1U7HW70      AAGEFIAKQ-LPQMETTVRQAELALRQFKEQNQVVALDE-------EAKT---AVAAIKQ
A0A2S6VEJ8      AAGEFIAKQ-LPQMEATVRQAEQALRQFKEQNQVVALDE-------EAKT---AVAAIKQ
                                                                            

K9SLA9          I-EAQMLGLQAELAEVGA----RSKQLQQS---L----------GMDAGLSVAW------
A0A168TT23      L-NDRLSAARGDLVQLRA----FSQLIDQG--------------RGDSIRPVVN------
A0A0M1JWX9      I-DDQLLEAQTALIQQQQ----LYTTLRQQ---V----------GLDPDVAIAS------
A0A2T1M1V6      L-RATQTEISSEAESHAT----QARVAAAQ---L----------GMNPQHALNS------
A0A2G7GCS2      L-RTTYTNVLSQAQANQA----QAQAASQR---L----------GINAQQAMNS------
K9XBH8          L-KTNYTTILAQAQGSQA----QAIEASGR---L----------GMNAQQAMNS------
A0A1Z4LJ30      L-ETEQAQTIAQAQEFQS----RAKMLSAR---I----------EMSPSTAVNS------
K9RI76          L-NTQQAQAIAEAESAAA----RVRMLSNR---I----------ALSPAAAVNS------
A0A352AE27      L-TTAQAQAQAQALASIN----EVRTLSNR---L----------GLTPDQAIRS------
A0A3B8JH60      L-STAQAQAQALAQAGQN----RVSVLSAP---L----------SLTPDQAIKS------
A0A3C0N766      L-STAQAQAQALAQAGQN----RVSVLSAR---L----------SLTPDQAIKS------
K9W9J7          L-TSVQAQALAQAQASEN----RIQVLSSR---L----------SLTPNQAIRS------
A0A139WSU3      L-TTVRAQVLATAEASEN----RAKALSIR---L----------SLTPNEAIRS------
A0A433VN22      L-VGSRAQALSLAQASAS----RSKVLSER---I----------NMAPASAVRS------
Q7NF11          L-TTSQAQAVAEGTADKA----RAQMLTAR---L----------GMDAPQAMRA------
A0A1Z4JCS8      L-EAAQAQVQAESQATRD----RANTLATR---L----------NLSPTDAVQA------
F4XTX2          L-SISQAQAQAEAQASQH----QLQILSTR---L----------GLTPKQAIRS------
Q7NJN6          L-RSTQTLTLAQAEAAAR----RATALEQA---V----------GMDLRRATAA------
U5QCC3          L-RSSATLAQAQAKAAED----RSRSLEQA---V----------GMDLRRATSA------
A0A3S0Y9N9      L-EKQVAETISELASQTA----KMKSIK----------------QLFGVNSQEA------
A0A433UNK7      L-DKQVAATRSDLSSQTA----RMQSIQ----------------KLFGVASQDA------
A0A3M1SVZ4      L-QQRITDTQSQIASTNS----RYNALQ----------------NQLGMNPKQA------
A0A654SFI6      L---------AALNEALA----QAVTDR----------------ISAEASVLSG------
K9SSQ0          L-ATQIQDLQIKMAQTQR----QLQELQ----------------RQVG-RPADV------
A0A2W1JIN9      L-EGQIRDLTSQIQEVDA----RNLSLS----------------TLTNAGSINN------
A0A318AJV1      L-SGQLANAEAEAAGARS----SASVAQ----------------GQVRSGNVD-------
A0A6B3MUB5      V-EDQERLLYAQLEEINA----RLKAIE----------------QLTGFNTINN------
A0A1U7N2U4      L-EDQERAVSIQLQDAKT----RSQELQ----------------TITSLNNTQN------
A0A1D9G1F2      L-EDQERAVSIQLQDAKT----RSQELQ----------------TITSLNNTQN------
F4XV38          L-EDQERAVSIQLQDAKT----RSQELQ----------------TITSLNNTQN------
A0A2P8QIL5      I-EEQERTTLAQLQEVKA----RNSSLE----------------QVTDSSTLKN------
A0A2T1FLY5      I-EEQERTTLAQLQEVKA----RNSSLE----------------QVTDSSTLKN------
A0A433W447      I-EEQERTTLAQLQEVKA----RNSSLE----------------QVTDSSTLKN------
K9U1K8          I-EEQERTTLAQLQEVKA----RNSSLE----------------QVTDSSTLKN------
K9UYB2          L-EDQQRTLGTQLQEARS----RGESIR----------------RITDTSTLNN------
A0A218QN17      L-EDQERALTAQLQEAKG----RDASLR----------------QITSAKSLDK------
K9RKN2          L-EEQERTLSALLEQVRS----QENSLR----------------QITNADSLNS------
A0A2I8ADV2      L-EDQERTLIAQLQEARS----REASLR----------------QLTATKNINN------
A0A1W5CKM3      L-ENQERILAVQLQETRS----RDASLR----------------QVTDAKNINT------
A0A5Q0GMF5      L-ENQERILAVQLQETRS----RDASLR----------------QVTDAKNINT------
Q3MEW0          L-ENQERILAVQLQETRS----RDASLR----------------QVTDAKNINT------
A0A1Z4KIC7      L-ENQERTLAVQLQETRS----RDASLR----------------QVTDAKNINT------
Q8YSM5          L-ENQERTLAVQLQETRS----RDASLR----------------QVTDAKNINT------
A0A1Q4S1H4      L-EDQERMLFAQLQEARS----RDSSLR----------------QVTNSSNLGN------
A0A433VBU6      L-EDQERMLFAQLQEARS----RDASLR----------------QVTNSSNLGS------
A0A1Q4RZJ6      L-EDQQRNLATQLQEANS----RLDSLR----------------QVTQSKGLDT------
A0A1Z4SNV3      L-EDQQRTLATQLQDANS----RGESLR----------------QITQAKGLDR------
A0A2H2XJQ1      L-EDQQRTLATQLQDANS----RGESLR----------------QITQAKGLDR------
A0A3S5K358      L-EDQQRTLATQLQEANS----RLDSLR----------------QVTQAKGLDT------
A0A0T7BPJ4      L-EDQERTALAQLQELRS----RAASLE----------------KITKTTSLDK------
A0A0C1QS61      L-ENQERTLSAQLRELRS----QDASLR----------------QITNATALKS------
A0A139X3R8      L-ENQERTLSAQLQELRS----QDASLR----------------QITNSTAVKS------
A0A1Z4I7C5      L-ENQERTLAAQLQEARS----RDASLR----------------QVTDAKNITA------
A0A0C2MDK7      L-EHQERTLSAQLQEIKT----KDASLG----------------QITNAGNLNN------
A0A1Y0RCK1      V-EDQERTLSAQLQEIKA----RDVSLR----------------QITNTENLNN------
A0A1Z4PWZ0      V-EDQERTLSAQLQEIKA----RDASLR----------------QITDSATLNK------
A0A0C2QLT0      V-EDQERTLSTQLQEIKA----RDASLR----------------QITNTENLNK------
A0A1Z4J2K1      V-EDQERTLSAQLQEIKA----RDASLR----------------QITDAGNLNK------
A0A3S0ZSX0      L-EEQEGTLSAQLQELRS----KEVSLR----------------QVTDAKALDQ------
A0A2N6K4T3      L-EEQENTLSAQLQELRS----KEASLQ----------------QVTDAKALNQ------
A0A370CKT2      L-EQQENTLSAQLQELRS----KEASLQ----------------QVTDAKALNQ------
A0A0S3TL97      L-EQQENTLSAQLQELRS----KEASLQ----------------QVTDAKALNQ------
A0A2N6M8A0      L-EQQENTLSAQLQELRS----KEASLQ----------------QVTDAKALNQ------
A0A2N6M9E1      L-EEQENTLSAQLQELRS----KEASLQ----------------QVTDAKALNQ------
A0A2N6KJI4      L-EEQENTLSAQLQELRS----KEASLQ----------------QVTDAKALNQ------
A0A2N6MZ77      L-EEQENTLSAQLQELRS----KEASLQ----------------QVTDAKALNQ------
A0A2N6KT20      L-EQQENTLSAQLQELRS----KEASLQ----------------QVTDAKALNQ------
G6FSN3          L-EQQENTLSAQLQELRS----KEASLQ----------------QVTDAKALNQ------
A0A4D9CI02      V-EEQENTLVAQLQELRS----KEGSLR----------------QVTDAKALNQ------
A0A328I8B9      V-EEQENTLVAQLQELRS----KEGSLR----------------QVTDAKALNQ------
A0A4Q9J4Z7      V-EEQENTLVAQLQELRS----KEGSLR----------------QVTDAKALNQ------
A0A0M0SU69      V-EEQENTLVAQLQELRS----KEASLR----------------QVTDAKALNQ------
A0A1Z4TIZ8      L-EEQENTLVAQLQELRS----KEASLR----------------QVTDAKALNQ------
A0A0S3TYD7      F-NKRIEDTRAKLVGAIQ----KVNALKNQ---V----------GTSNEIGVAQ------
A0A3C0N2P0      I-VKQRQDTESQLSEAQK----LYTELQTQLSQL----------GVTPNQAIAS------
K9TLQ0          L-VNERQETESQLVQAQA----LYGKLRGQ---L----------GLELEQAMLA------
A0A6B3M6M6      I-VGQRQETTTTFRETQE----LYSRLQTQ---L----------GLSTEQALAA------
A0A6B3NIJ0      I-VEQRQTTDTTLQETQE----LYSRLQTQ---L----------GLSTEQALTA------
A0A352XE00      I-VQQRQDAQSQLAEAKA----LYNQLESQLAEL----------GVSPDRAIAA------
B4VS56          I-VQERQNTQTQLDEART----LAVQLQSQLGEL----------GLSPKQAIAA------
A0A352AAQ3      I-VKQRQETESQLVEAQR----LYTELQDQLGQL----------GVTPDQAIAA------
A0A350Y472      I-VKQRQETQSQLIESQQ----LYAELQTQLGQL----------GVTPDGAIAA------
A0A355DVB4      I-VKQRQETQSQLIESQQ----LYAELQTQLGQL----------GVTPDGAIAA------
U5QL42          L-QQRIQDLQINLAQTQR----QYSELRAQ---V----------GEDPDIALSM------
K9QF04          I-IQQRQETQALLGETQS----TIKDLQQQ---L----------GIDFKQAVAL------
A0A076HBF2      M-AAQVLGLEADRNRLLK----VRGEIASGTLTA----------RGFQEAIGQNNGGG--
A0A354B169      L-ESQLLGLEAERNRLQR----VRAEISSGRLSA----------RGFQEAISTGSGGS-S
G4FMX5          L-SSQVLALQAGRNRLSK----VREEIANGTLTA----------RGFQEAIG-GMGNGLT
Q0IDT5          L-ATQIFGFEAERSRLKR----VRQDIASGSLSA----------RGFQEAISTGSGGVVT
A0A2D6FCW3      I-AAQVLDLEAGRNRLLR----VRQEIANGTLTA----------RGFQEAIG-GLGNGTT
A3ZA21          V-ATEILGLEAERSRLQR----VRAEIAAGTLSA----------RGFQEAISTGSGGG--
A0A140K3H3      L-EQQEKQAEIALARTQR----QYQEINRQLRDL----------GQNPETIVAY------
K9XUB8          L-EQQEKQAEISLAAAQR----RYEEINRQLREL----------GQNPETIVAY------
Q7NEU3          L-NRDYEQSKAELEASKE----HYWALSER---L----------GISPGQALAS------
A0A6H2NHD5      M-QANQEKLRVELASQIS----LYNALQDQ---V----------GFQPSTAIRV------
A0A2P8W4F7      M-LADQEQLRVDLTAMEP----LYDSLRDQ---V----------GFDPDTAIRV------
A0A5Q4E0Z4      M-LADQEQLRVQLTALGP----LYENLRRQ---V----------GFEPTVAIGV------
A0A2P8VVX1      V-QTQQQQLMVELSGLEQ----QYATLEQQ---L----------NLSPQSGVIA------
A0A2P8WHY0      V-QSEQRQLMSQLTELKS----RYQTLEQR---T----------QLSPANALLA------
A0A2T1CMT9      I-AQEREALKAQVGEIAG----SSSALQEQ---L----------GVSVENALAL------
A0A563VQJ3      I-NRQIATLGASYQGKQA----QTKAMQSQ---L----------GLNLQQAIAA------
A0A1D8TX52      I-EQERRAIRAQYMETQT----RYEAVQQK---L----------ARSPQNALTS------
A0A1D9G4T2      I-EQERRAIRAQYMETQT----RYEAVQQK---L----------ARSPQNALTS------
F4XP71          I-EQERRAIRAQYMETQT----RYQAVQQK---L----------ARSPQNALTS------
A0A1U7N5X9      I-EQERRAIRAQYMETQT----RYEAVQQK---L----------ARSPQNALTS------
A0A6B3N2I8      I-EQERRAIRAQYMETQT----RYQAVQQK---L----------ARSPQNALTS------
A0A2W6ZAV2      L-NVRLDDLRQTEAKLLG----MASAVGSG---M----------LTGPQVQGSAGDPGSG
A0A2G7GMH8      V-KQEQRTNRNQIQQTQS----RLHNLQQQ---L----------ARTPRNALVS------
K9W742          I-QDERRRNQAQYRELQA----SYNTLQQQ---V----------ARSPQDALVS------
A0A2T1DWE8      L-QKEQQTNQAQIREVQG----RYQTLQQE---L----------ALSPQQALIA------
A0A1U7I8L3      I-QYELRTARAQYQEAQS----RFQTLQQQ---V----------KRSPQDAVVS------
A0A2T1DJL8      V-QKDQRANRTELQDLQA----RYGALQQQ---L----------ARSPQQATIA------
A0A1Z4J9W0      L-QQNQQENRGLLASSRA----KFIALQQQ---L----------QRSPGQATVA------
A0A0N7Z5K9      L-QKDQQSNRGELASAQA----RFLALQQQ---L----------ARSPEQATIA------
A0A0S3TXC5      L-QKDQQSNRGELASAQA----RFSALQQQ---L----------ARSPEQATIA------
K9SA61          T-RQEQQTNQAELQATQA----QFASLQRQ---L----------GRSPQAALLA------
A0A3D1PBA3      I-AQERQVIRAQYKDLQA----RYNALQQQ---L----------ARSPQQALAA------
K9XPB0          I-QQERATLKAEQKQTQG----NYRQLQQE---L----------GLSAENSVAM------
A0A350Y7Z1      V-EQEQQAIRAQYQETQA----RYRVLQQQ---L----------ERSPQEALTS------
A0A352X2A7      I-EQERQAVRAQYQETLA----RYNSLQKQ---L----------NRSTSEALTS------
A0A0D8ZYV0      V-VQQRQVLRAQFQDTEA----RYRVLQQQ---V----------GSTPQVALSS------
A0A2T1FP73      I-AQEREVIRAQYNDLQA----RYGQLQQQ---L----------ARSPQQALVA------
A0A433VMS2      I-AQEREVIRAQYNDLQA----RYGQLQQQ---L----------ARSPQQALVA------
K9TYA7          I-AQEREVIRAQYNDLQA----RYGQLQQQ---L----------ARSPQQALVA------
A0A2P8QUE1      I-AQEREVIRAQYNDLQA----RYGQLQQQ---L----------ARSPQQALVA------
A0A2T1DNG3      L-QADKQATLVQIRELQT----RYGDLQQK---V----------NLSPQQAVLT------
B8HNB0          L-EKQGKDAEIAVKTTQR----QLEEVNQQ---L-------ADLKVNPSQAVPI------
A0A1Z4LN32      I-DKELTEARSELADVGG----QEKEVSSQ---L----------NLPLNKAVDI------
A0A2I8A9F5      I-DSEINNARAQLAETIT----REKQILNQ---I----------NLPADQAVDI------
A0A218Q6R8      L-DEELNNARALLADVSA----QEKQIIGQ---L----------NLPAEQALAI------
A0A218QGE0      V-EIELAKARSELADARA----QEIQIRRQ---M----------NLRVDRAVDI------
A0A563VS48      I-RSQIDTIEAELEDVNA----RYSALNSQ---L----------GISWEKASAI------
A0A318BJ18      IVADDLAALNASLAQATA----ERIQAEAR---S----------QQGGRAGASA------
A0A3B8Y8H9      I-IQKKQENQSLLQEQEI----RYRNLQQQ---L----------AMGEQEAIDL------
A0A2W1JVB9      L-AEKINEAQGRAISAQA----QSDSLRKQ---L----------GIDKQKSIAS------
A0A6H1U102      L-EKDGQQLEISLSRTQR----QYAELRRQ---M-------VAAGQNPDTALVN------
A0A563VLD6      L-EQDSRSTEIALARAKS----KYQELYFQ---L-------QQLGQEPDTILAS------
A0A2P8W9H0      F-TAEQFDLRLQLEQSQQ----LYQELQQT---L-----------NNDGELAAN------
A0A6I5P386      F-RSERFDLWVEIQENQS----IYQDLQQE---L-----------ARGEELAST------
A0A318BG22      S-LDSASMAALNDRVAAA----RANRILAE---Q----------AWNLARSPRA------
A0A1Z3HMQ0      L-ETQIGQAQAQLASAIT----RTGELRRQ---L----------GIPLAQARQV------
K1XF69          L-NRNITTLEAELNAVQS----LVNSLGNQ---V----------GLNLEEAIAV------
B5W297          L-NRNITTLEAELNAVQS----LVNSLGNQ---V----------GLNLEEAIAV------
A0A6H2AL05      L-NRNITTLEAELNAVQS----LVNSLGNQ---V----------GLNLEEAIAV------
H1W7M8          L-NRNITTLEAELNAVQS----LVNSLGNQ---V----------GLNLEEAIAV------
A0A5Q4H6A5      L-NRNITTLEAELNAVQS----LVNSLGNQ---V----------GLNLEEAIAI------
D5A466          L-NRNITTLEAELNAVQS----LVNSLGNQ---V----------GLNLEEAIAV------
U5QJM6          L-MEEAEKAKVELQTSRK----QYLALASR---L----------GSSPEQALAA------
A0A1Z4RPC6      L-NRQIADTGAQLQGAKA----QTESLQNQ---L----------GLDLKQAIAA------
A0A2T1CMZ0      L-NRAISGVGAQLQGKKA----QTDSLQNQ---L----------GLNLKQAIST------
L8M4F7          L-NRQIAFIGSQYRGTKA----QTDALQAK---I----------GLSLEQAIAA------
A0A140K2P2      M-NSEISKVAAQLQGTMA----QSEALQSQ---L----------NLNLNQAIAA------
K9XWX4          L-NSEIANVAAQLQGTMA----QSEALQSQ---L----------NLNLNQAIAA------
A0A140KB14      L-NQQIANVAAQYQGTQA----QTATLNQQ---L----------GLNLNQALAA------
K9XX88          L-NQQIANVAAQFQGTQA----QTATLNQQ---L----------GLNLNQALAA------
A0A563VSV6      L-NRQIATTGSQLKGTQA----QTASLQKQ---L----------GLSLNQAIAV------
L8LZE9          L-NRQISAIGAQLQGAKA----QTGALSQE---L----------GLSLEQAISA------
A0A433NM31      L-ENQIAQAQINLANANM----RSAALQRE---I----------GINVEQAKVI------
A0A1Z4NDS1      L-EDQITQVQAKLVDATA----RVKTLQEQ---A----------NINSQQAITS------
K9F4D9          L-DNALIQLKSQLADSSA----QASQLQQK---L----------KLSSDEAYAV------
U9VXM0          L-DNALIQLKSELADSTA----QASQLQQK---L----------KLSSQEAYAV------
A0A6I5QPI5      L-DQDIGNIQAQLADISA----QLGQLRGQ---L----------GVNVSEGIAL------
A0A433W533      L-EGQIAQVRAELANANT----KLAKLRQQ---V----------GMDTDTSLNL------
A0A2P8QWJ3      L-EGQIAQVRAELANANT----KLAKLRQQ---V----------GMDTDTSLNL------
A0A2T1FKP8      L-EGQIAQVRAELANANT----KLAKLRQQ---V----------GMDTDTSLNL------
K9U6L7          L-EGQIAQVRAELANANT----KLAKLRQQ---V----------GMDTDTSLNL------
A0A1E5QP61      L-DSEVIKAQAQYEDATA----RSQALQSQ---M----------GLNPQQALAI------
U5DPF5          I-DEELVKSQTSLNDTQA----RIQELSAQ---L----------GLSSAEALAA------
A0A3M1PML8      L-EDQVTQARAELSDTSA----RLSQLQGR---V----------GADPRRATVI------
A0A3M2GIL5      I-ETEKSKKEAALADATA----RSAALQQQ---M----------GLNSAQAIAL------
A0A6H1TSJ9      I-ETEKSKKEAALADATA----RSAALQQQ---M----------GLNSAQAIAL------
A0A0T7BPZ0      L-EDEIAQAEIKLTEVNA----QLDKLRSQ---A----------KIDTWQAVTL------
A0A352X442      L-DTQIAQTQAKLAEATA----QTETLRSQ---V----------GLNSKTAVAV------
A0A6B3NF44      L-DNQIAQAQARLADVTA----RSTQLRNQ---L----------QLNSQQAVAL------
A0A0M0SHU3      L-EDEIAEAQAQLVDANA----RLEKLQNQ---A----------RVNSQEAISA------
A0A1D2PBN3      L-EEQISQAQAQLADVSA----RSQKLQNQ---A----------KIDSQQGVTF------
A0A0C2LVR7      L-EEQISQAEAQLADVTA----KSQKLQNQ---A----------KIDSQQGVTF------
A0A1Z4PQB9      L-EEQISQAQAQLADVSA----RSQKLQNQ---A----------KIDSQQGVTF------
A0A1Z4SFN6      L-EQQLAQAQAEYANVTA----KSQKLQNQ---G----------SIDSPQSVTF------
K9PGI8          L-EEQINQTQAKLVEVGA----RTKKLQKQ---A----------NVNSQQAVTL------
A0A2T1E9V8      I-GSQVDSIEAQLSDLNS----RSKGIQQK---L----------GMSPQEAIVT------
A0A3M2GQQ6      L-EKDAQSLEITLTRSQR----LYAELRSQ---M-------VEAGQNPDTALVH------
A0A6H1U2X0      L-EKDAQSLEITLTRSQR----LYAELRSQ---M-------VEAGQNPDTALVH------
K9SGJ5          L-DTQAQQLQIQMAQTQR----QFKELQRQ---V----------GGSTDLVLGK------
A0A6C2DSN4      L-ETQAQELQIKIAQSQQ----QYEALSRQ---V----------GKSAESAIGG------
L8MYT6          L-ETQAQELQIKIAQSQQ----QYEALSRQ---V----------GKSAESAIGG------
A0A352JGJ6      L-EVQAQELQIKIAQTQQ----QYKSLSRQ---V----------GKSPDAAISG------
A0A1J5GLS2      L-EKQAQELQIRIAQVEQ----QFEILSRQ---V----------GKTPDAAISG------
A0A2W4W6M5      L-EVKAQELQIQIAQVQQ----QYKALSRQ---V----------GKSPDAAIGG------
A0A2W7AN33      L-ETQAQDLQIKIAQVQQ----QYEVLSRQ---V----------GKSPEAAISS------
A0A256BLV2      L-ENQAQDLQIKMAQVQQ----QYEALSRQ---V----------GKSPEAAIGS------
A0A2W6ZXF3      L-EKQAQDLQIRIAQLQQ----QFEILSRQ---V----------GKTPDAAIGS------
A0A2Z5WX66      L-EAQAQDLQIKIAQFQQ----QYKSLSSQ---V----------GKSPNAAISS------
K9W1T3          L-TQQISEAQSKYAAETS----RVQGLQQL---F----------GNDLNATVVA------
A0A1Q4RTR1      L-ADEIIKTEATLVDTSS----KIISLQNQ---L----------GLNSQKAIAL------
A0A1Z4SQV2      L-ADQIIKSEAQLVDISS----QIQALQNQ---L----------SLNSRQAVAL------
A0A2H2XGN1      L-ADQIIKSEAQLVDISS----QIQALQNQ---L----------SLNSRQAVAL------
A0A433UXH8      L-ADEIIKSEAQLVNISS----QIQALQNQ---L----------GFNSRTAVAL------
A0A1Z4RMB9      L-NQQISTTGSELQGLKA----QTAALEGQ---L----------GLNLNQAVAA------
B4WP72          L-DTQIDQAKTELANVNA----RLLELRRQ---L----------GMELETAIEL------
A0A318B4H2      V-TDDLSSLNTALNAAVA----E---------------------RVAAESAVRA------
B4WQE3          F-TSDHLNLQVEIAQTTE----LYNDLQQE---L----------SRIDNEYAST------
A0A2K3BR24      L-DQQLIQAQASLDDAQT----RLEKLTEQ---L----------GLPPEQALAA------
K9YXY1          L-DQQLIQAQASLDDAQT----RLEKLTEQ---L----------GLPPEQALAA------
A0A1U7HGH0      V-GSQIDAVEAQLVDLNS----RTQSLQRQ---L----------GMNPQQAMTI------
K9XJD3          V-GSQIDTVEAQLVDLNS----RAQSLQRQ---L----------GMTPQQAMTI------
K9SX01          L-DTQITASKSDLAKVNS----EINDIRTR---L----------GFTSEQAIIL------
A0A4P7ZT55      R-ERQLQQGQAQLVGLQASVR-RGQLFSPQ---FQGASGVSGGGGLKPATGADL------
A0A1E5QIR9      L-EGEITQAKVALNSANT----RVAALRSQ---T----------GIDSQQAIAL------
A0A1Z4IBC7      L-SNQISQAQAQLNDVKG----RLEQLRAQ---A----------QVNSQQGVIA------
A0A1W5CPC7      L-SNRISEAQAQLNDVTG----RLEQLRAQ---A----------QVDSQQGVIA------
A0A5Q0GKD1      L-SNRISEAQAQLNDVTG----RLEQLRAQ---A----------QVDSQQGVIA------
Q3MDC6          L-SNRISEAQAQLNDVTG----RLEQLRAQ---A----------QVDSQQGVIA------
A0A1Z4KM73      L-SNRISEAQAQLNDVKG----RLEQLRTQ---A----------QVDSQQGVIA------
Q8YNX7          L-SNRISEAQAQLNDVKG----RLEQLRTQ---A----------QVDSQQGVIA------
A0A367R4K6      L-DNQIYQAQAQLDDVKG----RLEQLRAQ---A----------QVNSQQGVIA------
A0A1E2WSV8      L-GNQISQALAQLDDVKG----RLEQLRSE---A----------QVDSQQGVIA------
A0A2R5FRT9      L-GNQISQALAQLDDVKG----RLEQLSSE---A----------KIDSKQGVIA------
A0A2K8T1B6      L-GNQISQALAQLDDVKG----RLEQLRSE---A----------KIDSQQGVIA------
A0A235I9I0      L-GNQISQALAQLDDVKG----RLEQLSSE---A----------QVDSRQGVIE------
A0A2D0HQT8      L-GNQISQALAQLDDVKG----RLEQLSSE---A----------QVDSRQGVIE------
A0A2L2NU95      L-GNQISQALAQLDDVKG----RLEQLSSE---A----------QVDSRQGVIE------
A0A367S084      L-GNQISQALAQLDDVKG----RLEQLSSE---A----------QVDSRQGVIE------
A0A0V7ZFJ4      L-SEEIVKAQAYLGEVTT----RSEGLQKQ---L----------QLETQEAVAI------
A0A367RIS1      L-SNQITQLRARLVDARS----RSGALQNQ---L----------ALNTKQAMAL------
A0A235IXQ2      L-SSQITELRARLVDARS----RSGALQNQ---L----------ALNTQQAMAL------
A0A1W5CNX3      L-SGQVTQLRAQLVDART----RSGALQNQ---L----------ALNTKQAMAL------
A0A5Q0GJJ5      L-SGQVTQLRAQLVDART----RSGALQNQ---L----------ALNTKQAMAL------
Q3MEB7          L-SGQVTQLRAQLVDART----RSGALQNQ---L----------ALNTKQAMAL------
A0A1Z4KHN9      L-SGQVTLLRAQLVDART----RSGALQNQ---L----------ELNTKQAMAL------
Q8YT70          L-SGQVTLLRAQLVDART----RSGALQNQ---L----------ELNTKQAMAL------
A0A218Q4C1      I-SNQITLLRARLVDASS----RSSALQNQ---L----------QLNTEQATAL------
A0A166IWU6      I-SNQLTLLRARLIDASS----RSDALQNQ---L----------ALNTQKATAL------
A0A2S0Q8C0      I-SNQITLLRARLIDASS----RSDALQNQ---L----------ALNTQKATAL------
W6FSX4          I-SNQITLLRARLIDASS----RSDALQNQ---L----------ALNTQKATAL------
A0A0V7ZNJ9      S-LQELNQAEAKLAAANE----RSQALQRE---L----------DIEKQKAVEL------
A0A0R0M9H9      I-DEVITQAQGQLAAAST----RSLALQNE---L----------QLSTQQAVAL------
A0A1S1ZVW2      I-DEVITQAQGQLAAAYT----RSLALQNE---L----------QLSTQQAVAL------
A0A1B7WX82      L-DQAIIESQGELVAAST----RSLALQYE---M----------KLDTRQAVDL------
A0A1B7WTD1      L-TESITQSQGELAAAYT----RSVALQNE---M----------KLTTQQAVDL------
A0A480ABC0      L-TEAITQSQGELAAAYT----RSVALQNE---M----------KLTTQQAVDL------
A0A1Z4LRU5      L-SENITQSQANLVEAMT----RSEALQNQ---L----------KLQPQQAVAL------
A0A1Z4JVB4      L-SQEIISTQGQLVAAKT----WSVGLQDQ---M----------ALSTKQAVEL------
K9PIA4          L-AAIITKVEAELVGANT----RSLALQNQ---I----------ELNTNQAVAL------
A0A1Z4HVE1      L-LEEITKAQANLVDANT----RTQALQNQ---I----------ALNTQQAVEL------
A0A252ECZ1      L-LEEITTAQAELADANT----RTRALQSQ---M----------ALNTQQAVEL------
A0A1Z4G5Y1      L-LGEITKAQAGLADATS----RTKALQSQ---I----------ALNTQQAVEF------
A0A252DNA2      L-LEEITKAQAELADAST----RTRALQSQ---I----------ALNTQQAVEL------
A0A252E1Q4      L-LEEITKAQAELADAST----RTRALQSQ---I----------ALNTQQAVEL------
A0A6G9SK36      L-AEEITKTQGELIAAKT----RSQSLQNQ---M----------QLSSEKAVEL------
A0A1Z4M597      L-AEEITRTQGELTAAKT----RSLALQNQ---M----------KLNTDTAVEL------
A0A1Z4MWT1      L-AEEITRTQGQLTAAKT----RSLALQNQ---M----------KLNTDTAVEL------
A0A1Z4TX53      L-AEEITRTQGQLTAAKT----RSLALQNQ---M----------KLNTDTAVEL------
A0A5P8VSD1      L-SSQMTQLHAQLVDFRS----RSGALQNQ---L----------ALSTQQAMAL------
A0A2A2TNQ5      I-AEESTRALAVLEEAKS----RSGTLQKQ---L----------DLTTQKAVEL------
A0A3S1C4K5      L-SGDITKAQALLSDASS----RSVALQKE---L----------ELTTQQAVEL------
A0A1X4G3D5      V-DAAINQAQAELAVVYT----RSSALQNE---L----------QLNKQQAVLV------
D4TNI2          V-DAAINQAQAELAVVYT----RSSALQNE---L----------QLNKQQAVLV------
A0A1Z4H6Z8      L-AEEITTAQGELVAAKT----RSVALQSQ---M----------ELNPHQAVEL------
A0A1Z4NPM1      L-SAELTRAQAALAEKNT----RVQTLQNQ---L----------ELNRQQAVEL------
A0A3F3KPR9      I-NEVITQAQGQLAAAYT----RSLALQNE---L----------QLTTQQAVAL------
D4TGN7          I-NEVITQAQGQLAAAST----RSLALQNE---L----------QLTTQQAVAL------
A0A1Z4UZW9      L-DEAITKSQGELAAVLT----RSVALQNE---M----------KLGTQQAVDL------
A0A0K2M5H0      L-NEAITQSQGELAAALT----RSVALQNE---M----------KLGTQQAVDL------
A0A1B7VSH4      L-NEAITQSQGQLAAALT----RSVALQNE---M----------KLDRQQAVDL------
A0A1B7W126      L-NEAITQSQGQLAAALT----RSVALQNE---M----------KLDRQQAVDL------
A0A3D4C6Q6      L-NEAITQSQGQLAAALT----RSVALQNE---M----------KLDRQQAVDL------
A0A1B7UVJ4      L-DQAIIESQGELVAAST----RSLALQYE---M----------KLDTRQAVDL------
A0A1B7UTR1      L-DEAITRSQGELAAAYT----RSVALQDK---M----------KATTQEAVDL------
K7W0A4          L-DEAITRSQGELAAAYT----RSVALQYE---M----------KSTTQEAVDL------
A0A5C0DRW9      L-DEAITRSQGELAAAYT----RSVALQDK---M----------KSTTQEAVDL------
A0A6H2C088      L-DEAITRSQGELAAAYT----RSVALQDK---M----------KSTTQEAVDL------
A0A2T1CIL7      L-ESEIDAVRANLKDVNG----RFEQLRSQ---L----------NISWEEAVAI------
A0A433V7A0      L-EKAITQTQAELAEVNNYYQILQNQIQSQ---I----------GMSVQDALAR------
A0A2T1FTR8      L-NKEITSASAQLAAETS----RLEGLKNL---F---------GGRDAQATIQS------
K9UA41          L-NKEITSASAQLAAETS----RLEGLKNL---F---------GGRDAQATIQS------
A0A0C2LBE2      L-NEQISQAQAQLEDVTA----RSQKLQNQ---A----------KIDSQQTVTN------
A0A433NN38      L-EDNIATAQAQLVNVTA----QSQKLKEQ---I----------EVESQKAITY------
A0A2N6K0T2      L-EDEIAQAQAQLVDVNA----RLEKLQTQ---A----------RVNSQEAVSA------
A0A2N6ML72      L-EDEIAQAQAQLVDVNA----RLEKLQTQ---A----------RVNSQEAVSA------
G6FQZ6          L-EDEIAQAQAQLVDVNA----RLEKLQTQ---A----------RVNSQEAVSA------
A0A2N6MQX9      L-EDEIAQAQAQLVDVNA----RLEKLQTQ---A----------RVNSQEAVSA------
A0A2N6KXT6      L-EDEIAQAQAQLVDVNA----RLEKLQTQ---A----------RVNSQEAVSA------
A0A2N6KGB9      L-EDEIAQAQAQLVDVNA----RLEKLQTQ---A----------RVNSQEAVSA------
A0A2N6L3Y5      L-EDEIAQAQAQLVDVNA----RLQKLQTQ---A----------RVNSQEAVSA------
A0A0S3TIS7      L-EDEIAQAQAQLVDVNA----RLEKLQTQ---A----------RVNSQEAVSA------
A0A1U7GW28      L-EDEIAQAQAQLVDVNA----RLEKLQTQ---A----------RVNSQEAVSA------
A0A2N6LW63      L-EDEIAQAQAQLVDVNA----RLEKLQTQ---A----------RVNSQEAVSA------
A0A328IH74      L-EDEIAEAQAQLVDANA----RLEKLQNQ---A----------RVSSQEAVSA------
A0A4D9CIB0      L-EDEIAEAQAQLVDANA----RLEKLQNQ---A----------RVSSQEAVSA------
A0A1Z4TQ63      L-EDEIAQAQAQLVDANA----RLEKLQNQ---A----------RVNSQEAVSA------
A0A4Q9J8G2      L-EDEIAQAQAQLVDANA----RLEKLQNQ---A----------RVNSQEAVSA------
A0A1Z4SMD6      I-DEEMNQVKAAIAEAIA----QETQLRSQ---L---------NIAQNQPVVEI------
A0A2H2Y096      I-DEEMNQVKAAIAEAIA----QETQLRSQ---L---------NIAQNQPVVEI------
K9S8M8          L-STMIAQSEAMLQDATA----RSGQLQRS---L----------GMDARQAIAM------
A0A1Z4NFV0      L-TDELNSTQAELAQVTS----QMGQLRSQ---M----------NISSEQAVDI------
B0CAX4          F-YQEAAKMQSLLINARA----KSRALRNK---L----------GLTPQQGEDI------
A0A350Y0P6      L-DKKISETKAQLQEKTT----TATELQDK---L----------GLNSQQAIAL------
A0A352X940      L-DSKLSQTKSNLEDATA----RSIAIQNQ---L----------NLNENEAVAL------
B8HTN4          L-ARDLAQAKSLLATAQA----RATGLSQQ---V----------GMSIDLARFS------
A0A2A2TPF8      L-DKQLNETRGQLAEATS----QQTELRSQ---L----------KIKSDRAVDV------
A0A1Z4R0P8      L-DKQLNEAQGQLAEVIS----QYQELRSQ---V----------KIPSETAVDV------
A0A0T7BUI3      L-DEEINQATANLAETLA----QESQVGNQ---I----------KTVKNQAIEI------
A0A1Z4LP32      L-DDEINQARALLADVSA----QESRVASK---L----------DFSTNEAVEI------
K9REP9          L-DGEINQARASLAELTA----QESQLASK---L----------DFSANQAVEI------
A0A1Z4SIJ3      L-DEQINQSKASLADISA----QEALIASQ---L----------NMQSKEAVEV------
A0A2H2XPG4      L-DEQINQSKASLADISA----QEALIASQ---L----------NMQSKEAVEV------
K9V3C7          L-SNKLNEARGQLADVAS----QQAEVRLS---A----------NIPRDRTVTQ------
A0A1Z4T6Y7      L-DKQLNEVKGQLAEVTS----QQAELRAQ---I----------KIPSNEAVDR------
A0A2H2Y561      L-DKQLNEVKGQLAEVTS----QQAELRAQ---I----------KIPSNEAVDR------
A0A1Q4S362      L-DKQLNEVKGQLAEVTS----QQAELRSQ---I----------KIPSSEAVDR------
A0A3S1CIN8      L-DKQLNEVKGQLAEVTS----QQAELRSQ---I----------KIPSSEAVDR------
A0A2A2TC28      L-NEQVSQNQAALADIIA----QETELKKQ---L----------NLVGEEAVNI------
A0A0C1NCB0      L-DDTINQAQAELAEVSA----EQAKVLNQ---L----------KLAGQDAVEI------
A0A2N6K7Q9      L-DQEINQVKAALADVSA----QEQQIASQ---L----------NVSENQAVTV------
A0A2N6MXH6      L-DQEINQVKAALADVSA----QEQQIASQ---L----------NVSENQAVTV------
A0A2N6M5A8      L-DQEINQVKAALADVSA----QEQQIASQ---L----------NVSENQAVTV------
A0A2N6LL61      L-DQEINQVKAALADVSA----QEQQIASQ---L----------NVSENQAVTV------
A0A0S3TP66      L-DQEINQVKAALADVSA----QEQQIASQ---L----------NVSENQAVTV------
G6FP91          L-DQEINQVKAALADVSA----QEQQIASQ---L----------NVSENQAVTV------
A0A1U7GYR5      L-DQEINQVKAALADVSA----QEQQIASQ---L----------NVSENQAVTV------
A0A2N6KY52      L-DQEINQVKAALADVSA----QEQQIASQ---L----------NVSENQAVTV------
A0A2N6KMP5      L-DQEINQVKAALADVST----QEQQIASQ---L----------NVSENQAVTV------
A0A2N6MA45      L-DQEINQVKAALADVSA----QEQQIASQ---L----------NVSENQAVTV------
A0A4Q9J9V9      L-DQEMNQIKAALADVTA----QEAQIASQ---L----------NVSENQAVTV------
A0A328IGA1      L-DQEMNQIKAALADVTA----QEAQIASQ---L----------NVSENQAVTV------
A0A4D9CE41      L-DQEMNQIKAALADVTA----QEAQIASQ---L----------NVSENQAVTV------
A0A0M0SFT2      L-DQEMNQIKAALSDVSA----QEAQIASQ---L----------NVSENQAVTV------
A0A1Z4TLC8      L-DQEMNQIKAALADVSA----QEAQIASQ---L----------NVSENQAVTV------
A0A0C2LFH0      I-DEEINQARAALADTSA----QEEKIRSQ---L----------NLAGSQAVEI------
A0A1Z4IYV4      I-DQEINQARAALADVSA----QEAKMNSQ---L----------NLAGDQAVEV------
A0A1Z4Q0T6      I-DQEINQARAALADVSA----QEAKMNSQ---L----------NLAGDQAVEV------
A0A0C2PT44      I-DQEINQARAALADVSA----QEAKINTQ---L----------NLAGDQAVEV------
A0A1D2P6J4      I-DQEINQARAALADVSA----QEAKINTQ---L----------NLAGDQAVEV------
A0A3M9ZEU1      I-DQQIADTEAELAKMVA----RSSALRNQ---L----------GMDSRQAALL------
A0A1Z4JK72      L-QDQLNQARSQLADVAR----QEQVVRDQ---L----------GLETGQAIDL------
A0A0N7Z489      L-QDQLSQARAQLADVGR----QERAVADQ---L----------GLELGQAIDL------
A0A0S3TXS2      L-QDQLSQARAQLADVGR----QERAVADQ---L----------GLELGQAIDL------
A0A1Z4RN12      I-ENQIDQVEAELSDINA----RYSRLQSQ---L----------GMNWREASAV------
A0A2T1CMF9      V-ENQINQVSADLNDVNA----RYNRLQSQ---L----------GVSWQEASAI------
Q7NDC5          F-RSQQAQADVALSEAGA----RVRAIDAR---M---------GGLSEPEALVA------
U5QGK3          F-KSEQAQAAVKLAEAQT----RAGAIASR---M---------GGLSEKEALVA------
A0A2W4UY24      V-TDSITQLRSDLADKNA----QFAQIQQQ---L----------RLNPQEAYAV------
A0A2T1GMT4      L-DNNINAVRSELEQANA----QSQELYKK---V----------NLNSQDALAV------
K9UI51          L-ENNINAVRSELEQANA----QSQELYKK---V----------NLNSQDALAV------
K9QM62          L-DTEINTVKASLNEITA----QSNELRKK---V----------GLDSPQAIAM------
A0A1Z4FWI3      L-DNSINATRAELDQATA----QSNELRQK---V----------ALNSQQALSA------
A0A1Z4JYE7      I-DNEINAVKAQLADLVA----QRNQLSQQ---L----------GLTTQQAIAV------
A0A2T1FXY4      L-DNQIDNLKAELDQANT----QTKELRQK---V----------GLNPQQASAV------
K9TYI2          L-DNQIDNLKAELDQANT----QTNELRQK---V----------GLNPQQASTV------
A0A1Z4QL41      L-DNEINTIRAQLADFNA----QTDALRQK---I----------GLNSQQAIVV------
A0A252D4T4      L-DNGINTAKADLDQATA----QTNELRQK---V----------ALSSQEALSA------
A0A252DJH5      L-DNGINTAKADLDQATA----QTNELRQK---V----------ALSSQEALSA------
A0A252EB80      L-DNGINTAKADLDQATA----QTRELRQK---V----------ALSSQEALSA------
A0A6G9SKZ9      L-DNNINTAKADLDQATA----QTNELRQK---V----------NLNSQEALSA------
A0A1Z4HPW5      L-DNNINGVRADLDQATA----QTNELRQK---V----------NLNSQEALSA------
A0A1Z4MSN1      L-DSNINGVKADFDQATA----QTNELRQK---V----------NLNSQEALSA------
A0A1Z4U1C2      L-DSNINGVKADFDQATA----QTNELRQK---V----------NLNSQEALSA------
A0A0D6KV51      L-DSNINGVKADFDQATA----QTNELRQK---V----------NLNSQEALSA------
A0A1Z4MKF8      L-DSNINGVKADFDQATA----QTNELRQK---V----------NLNSQEALSA------
A0A2C6WC43      L-NNEINTVQAQLDEVNA----QTNELRQK---V----------NLSSQNAIAV------
A0A1Z4L5A1      L-NTEINTVQAQLDEVNA----QTNELRQK---V----------NLSSQNAIAV------
A0A367QD86      L-NNEINTVQAQLDEVNA----QTNELRQK---V----------NLSSQNAIAV------
A0A235IZ96      L-DNEMNTVKAQLDEINA----QTNELRQK---V----------ELNSQQAIAV------
A0A2L2NGP0      L-DNEMNTVKAQLDEINA----QTNELRQK---V----------ELNSQQAIAV------
A0A2K8SM78      L-DNEMNTVRAQLDEVNA----QTNELRQK---V----------ELNSQEAIAV------
A0A2R5FPC0      L-DNEMNTVKAQLDEVNA----QTNELRQK---V----------ELNSQEAIAV------
A0A5P8W5T6      L-DSEMNTVQAQLDEVNA----QTNELRQK---V----------ELNSQEAIAV------
A0A140KBA0      V-DTQIDQVAAELGDVNA----RYTSLSSQ---L----------GMNVSEAAAI------
K9XSG1          V-DTQIDQVAAQLQDVNA----RYASLSSQ---L----------GMGVSEAAAI------
A0A0F5YE28      L-NRKITVLESELSGVNA----LAESLQTQ---A----------GFDLEEAIAI------
U7QEH7          L-NRKITVLESELSGVNA----LAESLQTQ---A----------GFDLEEAIAI------
A0A3S1ATK5      L-ENEINTVKAQLEDLNG----QTETLRQK---I----------ALNSQQAIAV------
A0A2Z6CPH0      L-DNEINAIQAQLAEVNA----QSSELRQK---L----------GLNSQNALAV------
A0A1Z4GT50      L-NNEIHTIQAQLDEVNA----QSNELRQK---V----------NLNSPEAITV------
A0A1Z4GIX0      L-DNEINTVNSQLAEVTA----QSNELRQK---I----------NLNSQQAIAV------
A0A2H6LC24      L-DNEINTVNSQLAEVTA----QSNELRQK---I----------NLNSQQAIAV------
B2J6N5          L-DNEMNTVKAQLDEVNA----QTNELRQK---V----------ELNSQEAIAV------
A0A367RMI4      L-DNEMNTVKAQLDEVNA----QTNELRQK---V----------ELNSQEAIAV------
A0A235HUM0      L-DNEMNTVKAQLNEVNA----QTSELRKK---V----------ELNSQEAIAV------
A0A2L2NW47      L-DNEMNTVKAQLDEVNA----QTNELRQK---V----------ELNSQEAIAV------
A0A1E2WUR1      L-DNEMNSVKAQLNEVNA----QTNQLRQK---V----------ELNSQEAIAV------
A0A235IKU3      L-DNEMNTVKAQLDEINA----QTNELRQK---V----------ELNSQQAIAV------
F4XKF3          L-DSQITTVQAQLEEANA----QAAGLRNQ---V----------GLNPQQAIAI------
A0A1D9FX10      L-DSQITTVQAQLEEANA----QAAGLRNQ---V----------GLNPQQAIAI------
A0A1D8TNX9      L-DSQITTVQAQLEEANA----QAAGLRNQ---V----------GLNPQQAIAI------
A0A1U7MYU6      L-DSQITTVQAQLEEANA----QAAGLRNQ---V----------GLNPQQAIAI------
A0A3C0NJ41      L-EQQITQVQAELQQANA----QTAALQNK---V----------GMNSQEAINT------
A0A352AG88      L-DQQITEVKSQFKDANA----RSAELRDQ---V----------GMNSQEAIVA------
A0A350Y374      L-DEQIAQVQSDLKNINS----QSAALRDK---V----------GMDAQEAIAI------
A0A355DPX0      L-DEQIAQVQADLKNINS----QSAALRDK---V----------GMDAQQAIAI------
A0A0D8ZUV2      L-ESQINTTEAALANANA----RYATLQQQ---V----------GMSSAQAVAT------
A0A433VDI0      L-ESQINQSQTALAGANA----RHTSLYKK---V----------GMSSEQAIAT------
A0A3D1PG43      L-EDQVTATQAALVQAKT----RSANLQKE---I----------GINSSDIIAV------
A0A2P8QQ72      L-QDQITLAEAALVQTQG----RATKLQKE---I----------ALTSQDVVPI------
K9TZQ7          L-QDQITLAEAALVQTQG----RATKLQKE---I----------ALTSQDVVPI------
A0A2G7GPR0      L-ENQITETQAQLADTTT----RSATLQQQ---V----------GMNPQEGITL------
K9XH68          L-ENQITETQAQLADTTT----RSATLQQQ---V----------GMNPQEGITL------
A0A1U7HW70      L-ENQITETQAQLADTTT----RSATLQQQ---V----------GMNPQEGITL------
A0A2S6VEJ8      L-ENQITETQAQLADTTT----RSATLQQQ---V----------GMNPQEGITL------
                                                                            

K9SLA9          -----S--------SP-SAQ--QLLE--ELQAIEQQIALES----TRYGAEHPSIIDLRA
A0A168TT23      -----D----------------GQIA--ELRSRKAELETEISGLLQRFMEDYPVIVELRS
A0A0M1JWX9      -----S----VLSEAP-SYQ--SQLS--KLRELENQIAKEL----TRFTINSPQIQTMLE
A0A2T1M1V6      -----L----RLAENK-EYQ--SIRD--KLSATEIELSESR----GIYTDKMPQVKSLLL
A0A2G7GCS2      -----L----RLGENR-EYQ--AIRQ--KLSDAETALAEAR----SRYTDESPQVQSLLS
K9XBH8          -----L----RLAENK-EYQ--ATRQ--QLSEVETALAEAR----SRYTDESPQVQSLLA
A0A1Z4LJ30      -----V----KLKENK-EYQ--LFRD--KLSEVEVALVEAR----GKLTNSHPQIQELVY
K9RI76          -----V----RLKEYK-EFQ--LIRD--KLSQIEVALIEAQ----GKLTSNHPEVQNLLY
A0A352AE27      -----L----GLAENP-DYQ--FIRQ--KLTEVEAKLVEAK----ATYTMENPRVEGLVI
A0A3B8JH60      -----L----GLGENQ-NYQ--FVRNXXKLAEVNANLIRTR----ATFTDNHPTVQKLIS
A0A3C0N766      -----L----GLGENQ-NYQ--FVRN--KLAEVNANLIRTR----ATFTDNHPTVQKLIS
K9W9J7          -----L----GLGENQ-NYQ--FVRN--KLAEVDANLVKLR----ATFTDNHPAVRKLIS
A0A139WSU3      -----L----GLGENK-EYQ--FVRQ--QLSEVEASLRQKQ----AIFTDVHPEVKTLLA
A0A433VN22      -----L----SLSENQ-EFK--AVRK--ELSEVEAKLVQKQ----AIFTINHPEVQTLLA
Q7NF11          -----L----RLGESK-EYQ--AMRL--KLSSLDTALAEAR----GLYTEKHARVQSLLV
A0A1Z4JCS8      -----L----GLDQNE-DYK--ELRS--KLTEVESTLGKLR----STFTDRSPQVQRAIV
F4XTX2          -----L----GLAENR-DYQ--FVRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLL
Q7NJN6          -----L----NLGEDK-GLQ--ALRQ--RLADIESQLAQAR----GLYTGKNLRVKSLEL
U5QCC3          -----L----RVGEDK-EYQ--SLRQ--KLTDIETQLAQAR----GIYTEKNQRIQSLLL
A0A3S0Y9N9      -----VVAGF-ASESP-STS--LVLG--QLKETQQKIEMAR----LRLTDNHPTVINLKE
A0A433UNK7      -----VVAGF-VGESP-STV--AVLG--QLQDVQQKIQVIG----LRLTDTHPTIMDLKK
A0A3M1SVZ4      -----AQRTVIS-QST-TIQ--EARQ--QLQEAEAQLAVEK----TRLTENHPTIIDLQD
A0A654SFI6      -----EFPAA-----D-ARN--SLRA--DLAKAEAQLATLN----ANYGPMYPPLVEKAA
K9SSQ0          -----AISSAILSQDA-NYQ--ALVK--QFQEAQTNYFLER----ARFQDAYPKVQALRD
A0A2W1JIN9      -----TYTSVRTGQDP-ELQ--NLKS--AVTNLESQVAARR----TELTDSHPIVIQLVQ
A0A318AJV1      -------AVVGVQGSN-VIR--DLRS--QRADIVRNLGEVE----GRYGPKHPESIRAHQ
A0A6B3MUB5      -----AYVGGRVGQDE-QLD--KLRD--KLADLDSELATVR----SRFNENHPTVLSLLE
A0A1U7N2U4      -----AYIAGRIGQDQ-ELQ--ALRA--QLVNLERELAKMR----SRLTDQNPAMISLVQ
A0A1D9G1F2      -----AYIAGRIGQDQ-ELQ--ALRA--QLVELDRELAKMR----SRLTDQNPAVISLVQ
F4XV38          -----AYIAGRIGQDQ-ELQ--ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQ
A0A2P8QIL5      -----TYATVRSGQNE-QLQ--ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIE
A0A2T1FLY5      -----TYATVRSGQNE-QLQ--ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIE
A0A433W447      -----TYATVRSGQNE-QLQ--ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIE
K9U1K8          -----TYATVRSGQNE-QLQ--ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIE
K9UYB2          -----AYTTVRGGQDD-ELK--KLRA--KLAESETKLIEAR----LKFTESNPIVIQLSE
A0A218QN17      -----AYASVRGGQDE-QLK--TLRA--KLTELNTKLIEAR----LRLTENHPSVIALVE
K9RKN2          -----AYSSVRSGSDE-ELV--KMRA--NLAELEREFVEAR----LRFTFNHPKLIELSQ
A0A2I8ADV2      -----AYTSVRSGQDE-QLR--SLRA--KLTEIETQLIEAR----LQFTDNHPKVVSLLG
A0A1W5CKM3      -----AYASVREGQDE-QLK--VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQ
A0A5Q0GMF5      -----AYASVREGQDE-QLK--VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQ
Q3MEW0          -----AYASVREGQDE-QLK--VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQ
A0A1Z4KIC7      -----AYASVREGQDE-QLK--VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVE
Q8YSM5          -----AYASVREGQDE-QLK--VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVE
A0A1Q4S1H4      -----AYASVRSGQDE-QIK--NLRA--RLTELETQIVALQ----QRFTPEHPELNSLIQ
A0A433VBU6      -----AYASVRSGQDE-QIK--NLRV--KLTELQTQIVALQ----QRFTPEHPELNSLIQ
A0A1Q4RZJ6      -----AYESVRGGQDQ-ELQ--KLRA--KLAEQETQLIEAR----LKFTDSHPTVVKMLQ
A0A1Z4SNV3      -----AYESVRSGQDQ-ELQ--KLRA--KLADQETLLIEAR----LRFTDSHPTVAKLLQ
A0A2H2XJQ1      -----AYESVRSGQDQ-ELQ--KLRA--KLADQETLLIEAR----LRFTDSHPTVAKLLQ
A0A3S5K358      -----AYESVRGGQDQ-ELQ--KLRA--KLAEQETQLIEAR----LKFTDSHPTVVKMLQ
A0A0T7BPJ4      -----AYSAVRTGQDE-EVK--KLRS--KLTELEQQVIQAK----LKFTEEHPTVTKLVQ
A0A0C1QS61      -----AYASVRGGQDE-QLK--ELRT--KLTELETKLAESR----AKYTEDHPDVRSLLY
A0A139X3R8      -----AYASVRGGQDE-QLK--ELRT--KLTEFETKLAESR----AKYTENHPDVQSLLY
A0A1Z4I7C5      -----AYASVREGQDE-QLK--ALRT--KLTDIETKLIEAR----TKFKEAHPTVVDLVQ
A0A0C2MDK7      -----AYSSVRSGQDD-EIK--KLRA--KLSELENKIIEAR----LRFTENHPVVANLVG
A0A1Y0RCK1      -----AYSSVRSGQDE-EIK--KLRA--KLSELENKIIEAR----LRFTEEHPNVRNLVG
A0A1Z4PWZ0      -----AYSSVRSGQDD-EIK--KLRA--KLSELENKIIEAR----LRFTEEHPTVTNLVG
A0A0C2QLT0      -----AYSSVRSGQDD-EIK--KLRA--NLSELENKIVEAR----LRFTDEHPNVTNLVG
A0A1Z4J2K1      -----AYSSVRSGQDD-EIK--KLRA--KLSDVENQLIEAR----LRFTDEHPNVTNLVG
A0A3S0ZSX0      -----AYASVRGGQNE-ELK--MLRA--KLAELEAKVIETR----LYFTENHPTVIKLVE
A0A2N6K4T3      -----AYAAVRGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A370CKT2      -----AYAAVRGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A0S3TL97      -----AYAAVRGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A2N6M8A0      -----AYAAVRGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A2N6M9E1      -----AYAAVRGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A2N6KJI4      -----AYAAVRGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A2N6MZ77      -----AYAAVRGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A2N6KT20      -----AYAAVRGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
G6FSN3          -----AYAAVRGGQDE-ELK--ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLG
A0A4D9CI02      -----AYAAVRGGQDE-ELK--ALRT--KLAEIETNLVEAR----LSLTDSHPTVMNLLG
A0A328I8B9      -----AYAAVRGGQDE-ELK--ALRT--KLAEIETKLVQAR----LSLTDSHPTVMNLLG
A0A4Q9J4Z7      -----AYAAVRGGQDE-ELK--ALRT--KLAEIETKLVQAR----LSLTDSHPTVMNLLG
A0A0M0SU69      -----AYAAVRGGQDE-ELK--ALRT--KLAEIETKLVQAR----LSLTDSHPTVINMLG
A0A1Z4TIZ8      -----AYAAVRGGQDE-ELK--ALRN--KLAEIETKLIQAR----LYLTESHPTVINLLG
A0A0S3TYD7      -----V----ALSQST-GVQ--ETLK--RSQELQNQLAVTL----GRYRAGHPKVTELQR
A0A3C0N2P0      -----S----ALSEAP-RYQ--ALLN--QLSEVESKLAKES----ARLTEDHPTILKLRE
K9TLQ0          -----T----SLSDSP-RYQ--DLLN--RFHEIETKLAQES----TRFTVQSPAMQVLID
A0A6B3M6M6      -----A----TLSEAP-RYQ--ELLN--QLAEVERQIAMES----ARFTAESPTIAALEE
A0A6B3NIJ0      -----A----TLSEAP-RYQ--ELLN--QLAEVERQIAMES----ARFTTDSPAIAALEE
A0A352XE00      -----S----ALSEAP-RYQ--DLLN--KLSEVETKIAVES----ARFTEESPTIQALRD
B4VS56          -----S----ALSEAP-RYQ--QLLN--QLTEIESKIASES----ARFTEQSPTIQALRE
A0A352AAQ3      -----A----ALSEAP-RYQ--QLLN--QLSEVESKIAAES----ARFTEDSPTIQALRE
A0A350Y472      -----S----ALSEAP-RYQ--DLLN--QLSEVESQIATEL----ARFKEENPAIETLRE
A0A355DVB4      -----S----ALSEAP-RYQ--DLLN--QLSEVESQIATEL----ARFKEENPAIETLRE
U5QL42          -----T----ILSQDP-TYT--RLVS--KYKDAEADYVSQR----AKFKDAYKPVGDLKK
K9QF04          -----S----VLGEDP-NYL--ALLE--KLQRVDAKIASES----VKLSDEHPSLIALRE
A0A076HBF2      --QANS----GLTVSD-VDQ--SLLQ--QLLKVETELAEAR----SRYNPGSSMVLGLEE
A0A354B169      SDNSGK----GLSVGD-VDQ--SLLQ--LLLKVESELAAAR----SKYKPSSSMVQGIEA
G4FMX5          AGGGVQ----GLTISD-VDQ--SLLQ--QLLKVETELAEAR----STYKPNSSMVTGLEE
Q0IDT5          GNQQSQ----GLAVSD-ADQ--SLLQ--QLLKVETELAEAR----SKFVNNSSMVLSLEA
A0A2D6FCW3      AGGDVQ----GLTISD-VDQ--SLLQ--QLLKVETELAEAR----AKYNPDSSMVRGLEA
A3ZA21          -GQSAQ----GLSVSD-ADQ--SLLQ--QLLKVETELAEAR----AKYNPNSSMVLSLEA
A0A140K3H3      -----T----LLSQDQ-VYQ--SLAS--QLKELETQYALGS----VNFYDSYHVMEDIKL
K9XUB8          -----T----LLSQDQ-VYQ--NLTS--RLKELESQYGLGS----VNFHDSYHVMEEFKL
Q7NEU3          -----A----TLSKDG-PYQ--ENLT--QLQKVETQLALEQ----ARFRDDYPAVQSLKS
A0A6H2NHD5      -----A----NLSESP-TYQ--RLLS--DLRQVEQSIASEL----ARFQADTPMVEALED
A0A2P8W4F7      -----A----NLNESP-TYQ--ALLG--DLRELEQTIAAES----ARFQTDTPMIEALED
A0A5Q4E0Z4      -----A----NLNESP-TYQ--SLLG--DLRAIEQTIAAES----ARFQSDTPMIGALED
A0A2P8VVX1      -----A----RLSQSP-RIQ--SLLN--SLQEAELALADRQ----ILFTDEDPNVQVLKQ
A0A2P8WHY0      -----A----RLSQSQ-RVQ--QLLN--DIQESELALADRQ----LIFTDQDATVQMLRQ
A0A2T1CMT9      -----S----RLSQSP-RYQ--NLLN--NLKQMEQDLATQQ----TKFTNYNPALKSAIE
A0A563VQJ3      -----N----QLGNTP-AVK--STLT--ELSDTEAAIAKER----QRFKDNHPSIVSLQE
A0A1D8TX52      -----S----RLSQSG-RYQ--NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIE
A0A1D9G4T2      -----S----RLSQSG-RYQ--NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIE
F4XP71          -----S----RLSQSG-RYQ--NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIE
A0A1U7N5X9      -----S----RLSQSG-RYQ--NLLN--EIQRIELALVEQS----RIYTEAHPTIQKLIE
A0A6B3N2I8      -----S----RLSQSG-RYQ--NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIE
A0A2W6ZAV2      SQDKPA----QGTMTT-TTS--SLLG--DLTDLEKQLAEAE----ASFSPTSPQVRSLRS
A0A2G7GMH8      -----S----RLSQSQ-RYQ--NLLN--EIQKTELALAQQR----LRYTDSSPQVELLLS
K9W742          -----S----RLSQST-RYQ--SLLD--EIQKTDLALAEQR----KRFTDDNPTIQKLLF
A0A2T1DWE8      -----A----RLSQSS-RYQ--SLLN--EIQKSELAIAQQR----LRFKAASPYVQQAID
A0A1U7I8L3      -----S----RLSEST-RYQ--TLLS--EIQKIELELAKER----QRFTDSNPVIQNLLE
A0A2T1DJL8      -----A----RLSQSP-RYQ--ALLN--EIQKTEVAIVQQR----LRFK-KGPFIDQLSE
A0A1Z4J9W0      -----A----RLSQSK-QYQ--ALLA--EIQKTEVELAQMQ----TKFTSNTPQVQQLAE
A0A0N7Z5K9      -----S----RLSQSN-QYQ--ALLA--EIQKTEVALAQQQ----TRFTSKTPFVQQLLD
A0A0S3TXC5      -----S----RLSQSR-QYQ--ALLA--EIQKTEVALAQQQ----TRFTAKTPFVQQLLD
K9SA61          -----S----RLSEST-RYQ--ALLN--EIQKTEIELAQQR----LRFKDASPYVQQVID
A0A3D1PBA3      -----S----RLSQSS-RYQ--TLLN--ELQKTELALSQRR----VTFTDEDPQVKKLLE
K9XPB0          -----T----RLNQSS-QYQ--SLLN--KLQQIEIELADKQ----ARFTDDNPVVKDLLA
A0A350Y7Z1      -----S----RLSQSP-RYQ--ALLN--ELQKTELAIAQQR----VKFTDAEPRVEQLLE
A0A352X2A7      -----S----RLSQSP-RYQ--SLLD--ELQKTELALAERR----TRFTDADPSVQKLME
A0A0D8ZYV0      -----S----RLSQSP-RYQ--SLLN--ELQRTDLLLAARR----GTFTDADPGVQKLIE
A0A2T1FP73      -----S----RLSQSS-RYQ--TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLE
A0A433VMS2      -----S----RLSQSS-RYQ--TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLE
K9TYA7          -----S----RLSQSS-RYQ--TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLE
A0A2P8QUE1      -----S----RLSQSS-RYQ--TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLE
A0A2T1DNG3      -----A----RLNQSG-RYQ--AVLN--EIQKTELAIQQQR----VRFKENTLNMQPLLD
B8HNB0          -----S----VLLQDS-NYQ--KLTT--RLQEVELSLAQQS----LTLQNNHPTIENLRA
A0A1Z4LN32      -----S----SLSQVK-GVQ--EVLS--ELQKVQTELTTLK----TRMTNAHPSILDLQD
A0A2I8A9F5      -----S----SLSQAA-GVQ--DAFI--ELQKIQTQLKIQQ----TRYTDANPIVINLKN
A0A218Q6R8      -----T----SLSQES-GVQ--EVLG--ELQKVQTNLAIQQ----TRYTDQNPHIANLKN
A0A218QGE0      -----T----SLSQVP-RVQ--GLLA--ELQKVETQLAALK----ARYTERHPAIVDLES
A0A563VS48      -----A----TLSQSL-AVQ--TIYE--RLQQVKVELASTR----NYLSNNAPQVISLQE
A0A318BJ18      -----E----ALRN--------QAIN--NLRQRRAELSAEYQRLMVQFEPGYPAALAIQN
A0A3B8Y8H9      -----T----ALSESP-RYM--NLLE--KLREVDTKLAEES----TRFTEDNPTIKKLRQ
A0A2W1JVB9      -----T----TLSQSP-GVQ--VVLQ--QLQEVEGQLAVEG----TRLTPENPILQDLQE
A0A6H1U102      -----S----MLAEDS-VYQ--QLAS--QLKAVEAKYMEER----ARFHDTHPVVKNLQM
A0A563VLD6      -----T----VLSQDG-VYR--KLAT--QLSGLETQYLLNS----TNFKDTFPIMQDLKD
A0A2P8W9H0      -----S----ALLNSN-RYQ--ALLN--QLLEVDSQLAADL----TLYLENSPEIEVVES
A0A6I5P386      -----S----ALLENE-RYQ--SLLD--RLTEIDSRLAEEL----SLYLEGSPEIEVIRD
A0A318BG22      -----D----SLPEVRDNVQIAALTG--QLATLEADYQQKR----QTYKPGYAPMEALAA
A0A1Z3HMQ0      -----D----SLSQSP-GVQ--RILE--DLQAVQTELASQR----SRYTASHPLIANLER
K1XF69          -----N----TLSQSP-VVR--AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKG
B5W297          -----N----TLSQSP-VVR--AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKG
A0A6H2AL05      -----N----TLSQSP-VVR--AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKG
H1W7M8          -----N----TLSQSP-VVR--AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKG
A0A5Q4H6A5      -----N----TLSQSP-VVR--SALQ--ELENVEGELAQEQ----RRFRDENPRIISLKG
D5A466          -----N----TLSQSP-VVR--SALQ--ELENVEGELAQEQ----RRFRDENPRIISLKG
U5QJM6          -----A----TLSEDK-IYQ--DVLK--QYQDTETQLALEK----TRFRDDYPTVQNLKD
A0A1Z4RPC6      -----N----QLGSTP-QVQ--SILD--QLATTETELAQER----QRFNDNHPTVISLND
A0A2T1CMZ0      -----V----QLGNTP-QVQ--SILD--QLSTTETELSQER----QRFKDNHPAVISLQE
L8M4F7          -----D----QLGSTP-VVK--SIID--EMTRTENQLIQER----RRFKEDHPNIVSLQG
A0A140K2P2      -----N----QLGASP-VVD--GLLK--EMATVESELAKEK----QRFLDNHPSIQSLEE
K9XWX4          -----N----QLGASP-VVD--GLLK--EMATVESELAKER----QRFLDNHPSIKSLEE
A0A140KB14      -----N----QLGGTP-VVE--SIFK--DLADVETELAQQR----QRFRDNHPMIQSLLE
K9XX88          -----N----QLGGTP-VVE--SIFK--DLADVETELAQQR----QRFRDNHPMVQSLLE
A0A563VSV6      -----S----QLGNSP-TVQ--SILT--ELGNTEIELAQER----QRFKDSHPSISSLLE
L8LZE9          -----N----QLGRTP-IVQ--SIVT--ELGNTESQLSQER----QRFNDNHPEIVSLLD
A0A433NM31      -----N----ALSQSA-GVQ--KALA--DYQEVESKLANER----SRYQENTPVIADLKL
A0A1Z4NDS1      -----S----SLSQIP-GIQ--KVLS--QLQEVQSQLALQQ----TRFHPEHPSIQDLQA
K9F4D9          -----G----LVSESP-GIQ--TVLE--QLQTVQSDLTLAR----TRYRDEHPEIITLRN
U9VXM0          -----G----LVSESP-GIQ--NALE--QLQTVQSDLALAR----TRYREEHPEIVTLRN
A0A6I5QPI5      -----S----SLNQSE-GVQ--EALS--QLQQVQTQLSNER----ARYREGHPAIERLEL
A0A433W533      -----N----ALNQAR-GVQ--RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQ
A0A2P8QWJ3      -----N----ALNQAR-GVQ--RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQ
A0A2T1FKP8      -----N----ALNQAR-GVQ--RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQ
K9U6L7          -----N----ALNQAR-GVQ--RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQ
A0A1E5QP61      -----N----TLSQSA-AIQ--QVLT--EYQKVQDQLAVQR----TRYQSQHPIITNLER
U5DPF5          -----S----ALTQSR-AVR--DALE--SYQSIESELAVAE----SRYQPQHPAIVSLVE
A0A3M1PML8      -----A----ALSQSP-GVQ--EALT--QLQLAQQELAVER----TRYTEDHPAIANLQR
A0A3M2GIL5      -----G----AIGESM-AVQ--NLFR--ELQQVENDLAVQR----TRYQSKHPIIANLTR
A0A6H1TSJ9      -----G----AIGESM-AVQ--NLFR--ELQQVENDLAVQR----TRYQSKHPIIANLTR
A0A0T7BPZ0      -----T----ELSKEP-RTQ--QMLT--QLREAETKLAVEQ----NRYLPGHPTLVNLQE
A0A352X442      -----N----SLNQSA-GVN--QALA--ELQKVQSQLAVER----GRFLEEAPIVQKLKE
A0A6B3NF44      -----S----SLSQSP-AVQ--QALT--QLQEVQAELAVER----TRYKEGYPTIENLKR
A0A0M0SHU3      -----V----DLSQVA-GTQ--QVLK--ELQEAQTKLTVAR----TRYLPGHPTVSNLEE
A0A1D2PBN3      -----T----SLSQTP-GIQ--QVLT--QLQEAQSQLAVER----TRLQPEHPIVINLEE
A0A0C2LVR7      -----T----SLSQTP-GIQ--QVLT--QLQEAQSQLAVER----TRLQPEHPIIINLEE
A0A1Z4PQB9      -----T----SLSQTP-GIQ--QVLT--QLQEAQSQLAVER----TRLQPEHPIIINLEE
A0A1Z4SFN6      -----A----SLSQIP-GIQ--QVLT--QLQEAQNQLTIEQ----TRLQPGHPTIINLEE
K9PGI8          -----A----SLSQIP-GVQ--QVLT--QRQEAQSQLAIEL----IRLRPNHPTIINLKE
A0A2T1E9V8      -----A----SVSQSS-AVQ--GVIK--ELQEVQRKLANAR----SLYKDDHPIIVQFKE
A0A3M2GQQ6      -----S----LLSQDS-VYQ--QLAS--ELKAVEAQYTLEA----SRFYETHPVVKNLAI
A0A6H1U2X0      -----S----LLSQDS-VYQ--QLAS--ELKAVEAQYTLEA----SRFYETHPVVKNLAI
K9SGJ5          -----A----ILAEDI-TYQ--NLVK--QFQEAETHYYLER----TRFQDDHPEVQVAKD
A0A6C2DSN4      -----A----ILQQDP-TYQ--SLVK--QFQDVETNYFLER----TRFREDYPSVLALKD
L8MYT6          -----A----ILQQDP-TYQ--SLVK--QFQDVETNYFLER----TRFREDYPSVLALKD
A0A352JGJ6      -----V----ILQQDT-PYQ--SLVK--QFREVETNYFLER----TRFREDHPTVQALKD
A0A1J5GLS2      -----A----ILQQDI-PYQ--SLVK--QFQEVETNYFLER----TRFREDHPNVLALKD
A0A2W4W6M5      -----A----ILQQDI-PYQ--SLVK--QFQDVETSYFLER----TRFREDHPNVQALKD
A0A2W7AN33      -----A----ILQQDA-PYQ--SLVK--QFQEVETNYFLEQ----TRFRGDHPSVIALKD
A0A256BLV2      -----A----ILQQDT-PYQ--SLVK--QFQEVETNYFLER----TRFREDHPTVIALKD
A0A2W6ZXF3      -----A----ILQQDV-PYQ--SLVR--QFQEVETNYFLER----TRFREDHPNVLALKD
A0A2Z5WX66      -----A----ILQQDT-PYQ--SLVK--QFQETETNYFLER----TRFREDHPTVKALKD
K9W1T3          -----A----SVGESP-TTQ--KLLS--NLQDIQEKLATER----TRFQEGHPVIEDLKS
A0A1Q4RTR1      -----N----ALSQSK-AVQ--QLLD--EFRSTQNKLAVER----IRFSDEHPTIIDLAD
A0A1Z4SQV2      -----N----TLSQST-AVQ--PLLN--EFRSSQDKLAVER----TRYSDEHPIIIDLAN
A0A2H2XGN1      -----N----TLSQST-AVQ--PLLN--EFRSSQDKLAVER----TRYSDEHPIIIDLAN
A0A433UXH8      -----Y----SLSQST-AVQ--QLLN--EFRSSQDKLAMER----TRYSDEHPIVIDLAN
A0A1Z4RMB9      -----N----QLGASP-EVQ--SILD--QLAQTESDLSKER----QRFNDAHPSVVSLNA
B4WP72          -----N----TLSQSP-GVQ--EVLT--ELQAVQSQLAIEQ----ARYQSTHPAVLNLQR
A0A318B4H2      -----A----SVSPNS-ASQ--GTIA--SLRQKRAELSARYSALLTKFEPGYPEAEALRT
B4WQE3          -----S----ALAQSA-RYQ--SLLD--QLLVVDSELADNL----TVYVEDSPEVEVIEE
A0A2K3BR24      -----G----ALSQSE-AVQ--KVLT--EYQAVEQELTLKR----SRYQPEHPIIKRLEE
K9YXY1          -----G----ALSQSE-AVQ--KVLT--EYQAVEQELTLNR----SRYQPEHPIIKRLEE
A0A1U7HGH0      -----A----TISQSS-AIQ--GVLA--ELQTVQRQIADAR----SRYRDDHPILDSLQE
K9XJD3          -----A----KISQSS-AIQ--GILT--ELQTVQRQITDAR----SRYRDDHPILDSLQE
K9SX01          -----T----KLSASK-PVQ--ETLS--DLQKIDSQLVTLR----ATYTDNYPTITVLME
A0A4P7ZT55      -----S----GALASG-AFS--QLLA--DLTDVEKQLAEAS----GTFRSSSPLVRSLTA
A0A1E5QIR9      -----S----ALSQSE-GVQ--KAIA--ELQAIENRLELER----SRFLDEAPIIIDLET
A0A1Z4IBC7      -----S----ELSQAP-GVQ--KVLA--ELQETQSKLAIER----TRFEPEHPAITALEE
A0A1W5CPC7      -----S----ELSQAP-GVQ--KVLA--ELQETESKLAVER----TRFESEHPAITSLEE
A0A5Q0GKD1      -----S----ELSQAP-GVQ--KVLA--ELQETESKLAVER----TRFESEHPAITSLEE
Q3MDC6          -----S----ELSQAP-GVQ--KVLA--ELQETESKLAVER----TRFESEHPAITSLEE
A0A1Z4KM73      -----S----ELSQAP-GVQ--KVLA--ELQEAESKLAVER----TRFEAEHPAITSLEE
Q8YNX7          -----S----ELSQAP-GVQ--KVLA--ELQEAESKLAVER----TRFEAEHPAITSLEE
A0A367R4K6      -----S----ELSQAP-GVQ--KVLA--QLQEAESQLALER----TRFQSGHPTIINLEG
A0A1E2WSV8      -----S----DLSQAP-GVQ--KVLI--QLQETESQLALER----TRFEPEHPTITNLEE
A0A2R5FRT9      -----S----ELTQAP-GVQ--KVLA--QLQETESQLALER----TRFSPEHPTITNLQE
A0A2K8T1B6      -----S----ELTQAP-GVQ--KVFA--QLQDTESQLALER----TRFSPEHPTITNLQE
A0A235I9I0      -----S----ELSQAP-GVQ--KVLA--ELQETESKLAIER----TRFSPEHPTITNLEE
A0A2D0HQT8      -----S----ELSQAP-GVQ--KVLA--QLQETESQLALER----TRFSPEHPTITNLEE
A0A2L2NU95      -----S----ELSQAP-GVQ--KVLA--QLQETESQLALER----TRFSPEHPTITSLEE
A0A367S084      -----S----ELSQAP-GVQ--KVLA--QLQETESQLALER----TRFSPEHPTITNLEE
A0A0V7ZFJ4      -----S----TLNQSP-IVQ--EALT--QYQKVQDELAVAQ----TQFTSEHPMVISLLG
A0A367RIS1      -----S----TLSQSR-AVQ--EVLS--EYQKVQDLLAVER----SRFTDGHPVITSLLS
A0A235IXQ2      -----S----SLSQSR-AVQ--QVLS--EYQKVQDQLTVER----SRFTDEHPVITNLLS
A0A1W5CNX3      -----S----SLSQSN-AVQ--QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLN
A0A5Q0GJJ5      -----S----SLSQSN-AVQ--QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLN
Q3MEB7          -----S----SLSQSN-AVQ--QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLN
A0A1Z4KHN9      -----S----SLSQSN-AVQ--QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLN
Q8YT70          -----S----SLSQSN-AVQ--QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLN
A0A218Q4C1      -----S----TLSQSR-AVQ--QVLL--EYQKVQDQLAVER----SRLTDEHPVVVNLLN
A0A166IWU6      -----S----TLSQSR-AVQ--QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLN
A0A2S0Q8C0      -----S----TLSQSR-AVQ--QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLN
W6FSX4          -----S----TLSQSR-AVQ--QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLN
A0A0V7ZNJ9      -----S----ELSQSP-AVQ--QALQ--EYQKVQDRLAVAR----TRLTNQHPTVIDLSN
A0A0R0M9H9      -----S----NISQIP-GVQ--QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQL
A0A1S1ZVW2      -----S----SLSQIP-GVQ--QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQL
A0A1B7WX82      -----S----TLSQSP-GVQ--QVLT--EYQKTQYDLAIAR----TLYTNDNPKVVDLIM
A0A1B7WTD1      -----S----SLSQSP-GVQ--QVLT--EYQKTQHELAIAR----TLYTNDNPKVVDLLL
A0A480ABC0      -----S----SLSQSP-GVQ--QVLT--EYQKTQHDLAIAR----TLYTNDNPKVVDLLL
A0A1Z4LRU5      -----S----SLSQSP-AVQ--QVLT--EFQKTQKELAVAR----TKLTDQHPTVINLSK
A0A1Z4JVB4      -----T----TLSQSP-GIQ--SVLK--EYQKAEDDLAVAK----TRYTNDNPTIINLEQ
K9PIA4          -----N----TLNESP-GIQ--QVLT--EYQKVQDELAVAR----TRYTNNNPNILNLVE
A0A1Z4HVE1      -----S----TLSQSP-GVQ--QVLT--DYQKTQDELAVAR----TRFSDEHPLVINLDK
A0A252ECZ1      -----S----TLSQSP-GIQ--QVLT--DYQKTEDELAVAR----TRFSDEHPTVINLDK
A0A1Z4G5Y1      -----S----TLSQSP-GIQ--QVLT--EYQKAEDELAVAR----TRFSEEHPIVINLAQ
A0A252DNA2      -----S----TLSQSP-GIQ--QVLE--EYQKAEDELAVAR----TRFSEEHPIVINLDK
A0A252E1Q4      -----S----TLSQSP-GIQ--QVLE--EYQKAEDELAVAR----TRFSEEHPIVINLDK
A0A6G9SK36      -----T----TLSQSP-AVQ--QVLT--EYQKVQDELAVAQ----TRFTEDNPTIINLER
A0A1Z4M597      -----T----TLSQSP-GVQ--QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLEN
A0A1Z4MWT1      -----T----TLSQSP-GVQ--QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLEN
A0A1Z4TX53      -----T----TLSQSP-GVQ--QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLEN
A0A5P8VSD1      -----T----SLSQSI-AVQ--QVLL--EYHKVQDLLAVER----SRLTDEHPVITSLLN
A0A2A2TNQ5      -----S----TLSQTP-GIQ--QVLA--EYQKVQDDLAVAR----SRFTEEHPSVRNLVA
A0A3S1C4K5      -----A----NLNQST-GVQ--QVLA--EYQKAQDELAVLQ----TRFTAEHPKVRDSEA
A0A1X4G3D5      -----S----TLSQIP-GVQ--EVLK--EYQKNEQELAVAQ----TTYTNDNPKVVSLTA
D4TNI2          -----S----TLSQIP-GVQ--EVLK--EYQKNEQELAVAQ----TTYTNDNPKVVSLTA
A0A1Z4H6Z8      -----S----TLSQSP-GIQ--QVLK--EYQKAEDEVAVAR----TRLTDDNPTLINLEQ
A0A1Z4NPM1      -----S----TLNQSQ-GVQ--QVLA--EYQKTQDELAVAK----TRLTNDHPTVINLTE
A0A3F3KPR9      -----S----NISQIP-GVQ--QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQL
D4TGN7          -----S----NISQIP-GVQ--QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQL
A0A1Z4UZW9      -----S----SLSQSP-GVQ--QVLT--EYQKTQSELAIAR----SLYTNDNPKVVDLVM
A0A0K2M5H0      -----S----TLSQSP-GVQ--QVLT--EYQKTQSELAVAR----SLYTGDNPKVVDLVM
A0A1B7VSH4      -----S----TLSQSR-GVQ--QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVM
A0A1B7W126      -----S----TLSQSR-GVQ--QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVM
A0A3D4C6Q6      -----S----TLSQSR-GVQ--QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVM
A0A1B7UVJ4      -----S----TLSQSP-GVQ--QVLT--EYQKTQYDLAIAR----TLYTNDNPKVVDLIM
A0A1B7UTR1      -----S----ALSQSP-GVQ--QVLT--EYQKTQYDLAKAR----TLYTSDNPKVVNLVM
K7W0A4          -----S----ALSQSR-GVQ--QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLVL
A0A5C0DRW9      -----S----ALSQSP-GVQ--QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLLM
A0A6H2C088      -----S----ALSQSP-GVQ--QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLVM
A0A2T1CIL7      -----S----SLSQS--AVP--QLIS--ELQQVRIDLIEQR----DRFSDNAPQVNSLVK
A0A433V7A0      -----S----TLSQSA-GVQ--DILK--KIQQVQSELAVQQ----TRLSNDHPSINNLKK
A0A2T1FTR8      -----G----LVSESP-GLQ--KSLK--ELQEVEAKIATER----TRFSDNDPSILNLKE
K9UA41          -----G----LVSESP-GLQ--KSLK--ELQEVEAKIATER----TRFSDNDPSILNLKE
A0A0C2LBE2      -----S----SLTQAS-GIQ--QVLT--QLQEAQSQLAVER----SRLKPEHPIIVNLEE
A0A433NN38      -----A----ELSQIP-GTQ--QLLS--QLQKTQADLEVAR----TRFQPEHPQIVNLEE
A0A2N6K0T2      -----V----NLSQVP-GTQ--KVLT--ELQEAQSQLTVAR----TRYQPGHPTVIDLEE
A0A2N6ML72      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVVNLEE
G6FQZ6          -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A2N6MQX9      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A2N6KXT6      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A2N6KGB9      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A2N6L3Y5      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVVNLEE
A0A0S3TIS7      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A1U7GW28      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A2N6LW63      -----V----DLSQVP-GTQ--KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEE
A0A328IH74      -----V----DLSQVA-GTQ--EVIK--ELQEAQTELAVAR----TRYLPGHPTVSQLAE
A0A4D9CIB0      -----V----DLSQVA-GTQ--EVIK--QLQEAQTELAVAR----TRYLPGHPTVSQLAE
A0A1Z4TQ63      -----V----DLSQVA-GTQ--QVLK--ELQEAQTELTVAR----TRYLPGHPTVSNLEE
A0A4Q9J8G2      -----V----DLSQVA-GTQ--EVIK--ELQEAQTDLAVAR----TRYLPGHPTVSQLEE
A0A1Z4SMD6      -----A----SLNQIP-GVQ--EVLS--ELQKAQTQLAVQR----TRYTEDHPSITSLKN
A0A2H2Y096      -----A----SLNQIP-GVQ--EVLS--ELQKAQTQLAVQR----TRYTEDHPSITSLKN
K9S8M8          -----N----AVGESP-AVQ--QALS--ELQQIEDELAVAR----TRYQEQHPTIAGLRR
A0A1Z4NFV0      -----S--------TP-GVQ--DAIT--ELQKLQRQLANER----SRYTEFHPKILNLKQ
B0CAX4          -----N----ALSQST-VVQ--QALA--DYQENERELAEAL----KVFQPTHPTVLDLKE
A0A350Y0P6      -----N----KLNQSR-AVQ--QALI--ELEQVQEQLNIEG----TRFQNEAPIIVSLKE
A0A352X940      -----N----SLSQSR-AVQ--QILV--DIEQIEAQLTVQR----TRYQEEHPIIQNLKR
B8HTN4          -----N----AVSQSK-GVQ--VVLD--QYQQVEAELAVAR----TELQPDHPKIKTLEE
A0A2A2TPF8      -----A----SLSLIP-GVQ--EVLG--ELQKVQSKLATAQ----SRYTSTHPSIANLKE
A0A1Z4R0P8      -----A----SLSLIP-GVQ--EVLS--ELQKVQTKLATEK----SRYNSTHPSVINLEE
A0A0T7BUI3      -----T----SLNQIP-GVQ--EVLS--ELQKTQSRLALER----VKYTNNHPNVVYLEN
A0A1Z4LP32      -----T----SLNQIS-GVQ--EVLT--ELQKVQTELAAER----ANYTQIHPLIRKLES
K9REP9          -----T----SLNQIS-GVQ--EVLG--ELQKVQTQLASER----ANYTSAHPLIRKLEN
A0A1Z4SIJ3      -----A----SVSQMS-GVQ--DVLS--ELQKVETKLAAER----GRYTNQHPSIVYLKN
A0A2H2XPG4      -----A----SVSQMS-GVQ--DVLS--ELQKVETKLAAER----GRYTNQHPSIVYLKN
K9V3C7          -----TVNVSSLSVNP-GVQ--GTLA--ELQKVENNLAVAR----ARYTENSPIVMDLRE
A0A1Z4T6Y7      -----T----SLSLIP-GVQ--ESLG--ELQKIQSQLATEA----TTYTSNHPKIISLRQ
A0A2H2Y561      -----T----SLSLIP-GVQ--ESLG--ELQKIQSQLATEA----TTYTSNHPKIISLRQ
A0A1Q4S362      -----T----SLSLIP-GVQ--EALG--ELQKVQTQIATQR----ALYTSDNPIMITLRE
A0A3S1CIN8      -----T----SLSLIP-GVQ--EALG--ELQKVQSQIATQQ----ALYTSDNPIMITLRE
A0A2A2TC28      -----T----SLSQIP-GVQ--EVLG--EQQKVQAKLATLK----ARYTDEHPAIADLKS
A0A0C1NCB0      -----T----SLNQIP-GVQ--DVLT--ELQKVQTKLANER----ARYTEKHPSVVNLEN
A0A2N6K7Q9      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A2N6MXH6      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A2N6M5A8      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A2N6LL61      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A0S3TP66      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
G6FP91          -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A1U7GYR5      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A2N6KY52      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A2N6KMP5      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A2N6MA45      -----T----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKN
A0A4Q9J9V9      -----A----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEKNPIIIDLKN
A0A328IGA1      -----A----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTERNPIIIDLKN
A0A4D9CE41      -----A----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTERNPIIIDLKN
A0A0M0SFT2      -----A----SLSQIP-GVQ--EVLT--ELQKVQTKLANAR----AIYTEQHPIITDLKN
A0A1Z4TLC8      -----A----SLSQIP-GVQ--EVLT--ELQKIQTKLANAR----AIYTEQHPTITDLKN
A0A0C2LFH0      -----T----SISQIP-GVQ--EVLT--ELQKVQTKLANER----ARYTSEHPAITELKN
A0A1Z4IYV4      -----T----SISQIP-GVQ--EVLS--ELQKVQTKLANEK----ARYTSEHPDIAELKN
A0A1Z4Q0T6      -----T----SISQIP-GVQ--EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKN
A0A0C2PT44      -----A----SISQIP-GVQ--EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKN
A0A1D2P6J4      -----T----SISQIP-GVQ--EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKN
A0A3M9ZEU1      -----A----SLSQTP-GVQ--EVLS--QYQNVQSQLAIEQ----ARYRSSHPTVANLQR
A0A1Z4JK72      -----A----SLSQSP-GVQ--EALS--QLQQVQTRLVTEQ----ARFKSTTPQIQTLQQ
A0A0N7Z489      -----A----SLSQSA-GVQ--DVLS--QLQTVESRLVTES----SRFKDTTPQIQTLKQ
A0A0S3TXS2      -----A----SLSQSA-GVQ--DVLA--QLQSVESRLVTEQ----ARFKDTTPQIQTLKQ
A0A1Z4RN12      -----S----ALSQSP-GVQ--RALS--QLQDVKVALAQKQ----AFLSNNAPQIVSLKQ
A0A2T1CMF9      -----S----SLSQSI-SLQ--ETLA--QLQKIKVELAQKS----NVLSDSSPQIISLKE
Q7NDC5          -----G----ALSGSD-GMR--DLRK--TLLEIESKLAVAR----AQYQDSYPEVEQLIK
U5QGK3          -----G----ALSSSD-GMS--ELRK--DLVEVESKLALAR----AQYQDNYPDVDRLIK
A0A2W4UY24      -----G----LVSESP-GVQ--EVIT--TLQAVQSQLAIAL----TRYREGHPEIASLRS
A0A2T1GMT4      -----S----AISQSP-AIQ--GILT--QLQDVDRQLATES----SRFSDDNPIIVSLKE
K9UI51          -----S----AISQSP-AIQ--GILT--QLQDVDRQLATES----SRFSDDNPIIVGLKE
K9QM62          -----S----TLSQSP-AVQ--GALT--QYQDIERQLATER----SRFSEAHPTIVNLEA
A0A1Z4FWI3      -----S----AVSQSP-AVQ--GIVT--QLQDVERQLATER----SRFQDENPVIINLEA
A0A1Z4JYE7      -----T----TLSQSP-AVQ--GILS--QLQELERQLANER----SRFTDDNPIIVSLEA
A0A2T1FXY4      -----S----ALSQSP-AVQ--GVLI--QLQDTERQLASQR----SRYLNNNPIIVDLEA
K9TYI2          -----S----ALSQSP-AVQ--GVLT--QLQDTERQLASQR----SRYLNDNPIIVDLEA
A0A1Z4QL41      -----S----SLSNSP-AIQ--AILT--QLQEIDRQLAVER----SRFLDENPVIINLEA
A0A252D4T4      -----S----TLSQSP-AVQ--GILT--QIQEVDRQLATER----SRFQEENPVIVNLVA
A0A252DJH5      -----S----TLSQSP-AVQ--GILT--QIQEVDRQLATER----SRFQEENPVIVNLVA
A0A252EB80      -----S----TLSQSP-GVQ--AILT--QLQEVDRQLATER----SRFQDENPVIVNLVA
A0A6G9SKZ9      -----S----AVSQSP-AVQ--GIVT--QLQDIDRQLATER----SRFLDDNPVIINLEQ
A0A1Z4HPW5      -----S----AVSQSP-AVQ--GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQ
A0A1Z4MSN1      -----S----AVSQSP-AVQ--GILT--QLQDIDRQLASER----SRFLDDNPVIVNLEQ
A0A1Z4U1C2      -----S----AVSQSP-AVQ--GILT--QLQDIDRQLASER----SRFLDDNPVIVNLEQ
A0A0D6KV51      -----S----AVSQSP-AVQ--GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQ
A0A1Z4MKF8      -----S----AVSQSP-AVQ--GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQ
A0A2C6WC43      -----S----ALSQSP-AVQ--GILT--QLQDIERQLASER----SRFQDDNPAIINLEA
A0A1Z4L5A1      -----S----ALSQSP-AVQ--GILT--QLQDIERQLASER----SRFQDDNPAIINLEA
A0A367QD86      -----S----ALSQSP-GVQ--GILT--QLQDIDRQLASER----SRFQDDNPAIINLEA
A0A235IZ96      -----S----ALSQSP-AVQ--GVLV--QLQETDRQLAIER----SRFLDDNPVIINLEA
A0A2L2NGP0      -----S----ALSQSP-AVQ--GVLV--QLQETDRQLAIEH----SRFLDDNPVIINLEA
A0A2K8SM78      -----S----ALSQSP-AVQ--GVLT--QLQDTDRQLAIER----SRFLDDNPVIINLEA
A0A2R5FPC0      -----S----ALSQSP-AVQ--GVLA--QLQDTDRQLAIER----SRFLDDNPVIINLQA
A0A5P8W5T6      -----S----ALSQSP-AVQ--GVLT--QLQDTDRQLAVER----SRFLDDNPVIINLEA
A0A140KBA0      -----S----SLNQSV-AVQ--KALT--QLQNVKVELASKR----NLFGENAPQIISLKE
K9XSG1          -----S----SLNQSV-AVQ--KALT--QLQDVKVQLATKR----NLFGENAPQIISLKE
A0A0F5YE28      -----N----TLSQSP-VLI--GILT--ELENVESELVNER----KRFKDQNPRIIALKQ
U7QEH7          -----N----TLSQSP-VLI--GILT--ELENVESELVNER----KRFKDQNPRIIALNQ
A0A3S1ATK5      -----S----SLNNSP-AIR--EIVI--QLHEIERQLATER----SRYFDNNPVIISLEA
A0A2Z6CPH0      -----S----ALSQSP-AVQ--GVLT--QLQDVERQLANER----SRFLDDNPVIVGLEA
A0A1Z4GT50      -----M----AISQSP-AIQ--GILA--QLQDLERQLATER----SRFYDDNPVITNLEA
A0A1Z4GIX0      -----S----TLSQSP-AVQ--GVLT--QLQEVERQLANER----SRFLDDNPIIVSLEA
A0A2H6LC24      -----S----TLSQSP-AVQ--GVLT--QLQEVERQLANER----SRFLDDNPIIVSLEA
B2J6N5          -----S----ALSQSP-AVQ--GVLT--QLQETERQLAIER----SRFLDDNPVIINLEA
A0A367RMI4      -----S----ALSQSP-AVQ--GILT--QLQETDRQLAVER----SRFLDDNPIIINLEA
A0A235HUM0      -----S----ALSQSP-AVQ--GILT--QLQETDRQLAVER----SRFLDDNPIIINLEA
A0A2L2NW47      -----S----ALSQSP-AVQ--GILT--QLQETDRQLAVER----SRFLDDNPIIINLEA
A0A1E2WUR1      -----S----ALSQSP-AVQ--GVLT--QLQETDRQLAVER----SRFLDDNPVIINLEA
A0A235IKU3      -----S----ALSQSP-AVQ--GVLV--QLQETDRQLAIER----SRFLDDNPVIINLEA
F4XKF3          -----S----ALSQST-SVQ--GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTK
A0A1D9FX10      -----S----ALSQST-SVQ--GVLQ--ELQEVERQLAVSK----NRYGKNHPVMIRLTK
A0A1D8TNX9      -----S----ALSQST-SVQ--GVLQ--ELQEVERQLAVGR----NRYGKNHPIMIRLTK
A0A1U7MYU6      -----S----ALSQST-SVQ--GVLQ--ELQEVERQLAVGN----NRYGKNHPVMIRLTK
A0A3C0NJ41      -----T----ALSQSA-GVQ--EVLK--QYQDIQAQLTLQR----TRFLDDSPVIVSLKE
A0A352AG88      -----S----SLSQSP-GVQ--QVLQ--EFQQVQSKLRVEQ----TRFQDEDPTIISLKE
A0A350Y374      -----T----SLNQSP-GVQ--DILK--EFQKVQADLTIQR----TRFQEADPTIISLKQ
A0A355DPX0      -----T----SLNQSP-GVQ--DILK--EFQTVQADLTIQR----TRFQEADPTIISLKQ
A0A0D8ZUV2      -----N----SLNQAG-GIQ--KLLE--ESQQLEDRLATER----TRLQEDHPTIVNLKL
A0A433VDI0      -----N----SLNQSS-GVQ--KTLE--ELRQVEDQLVVQR----TRLQEDHPAIVNLEL
A0A3D1PG43      -----N----SLNQPAGGAQ--KVVA--ELQQVEADLVVLQ----TRFLDGHPKIAELQN
A0A2P8QQ72      -----N----SLKESP-GIQ--KTLA--ELQRVEGDLVVLQ----TRFEDTYPEVQKLQQ
K9TZQ7          -----N----SLKESP-GIQ--KTLA--ELQRVEGDLVVLQ----TRFEDTYPEVQKLQQ
A0A2G7GPR0      -----T----SLNQSP-GIQ--KVLT--EYQQVEAELAVQQ----TRFVGEHPTILGLQE
K9XH68          -----T----ALNQSP-GIQ--KVLA--EYQQVEAELAVQQ----TRFVGDHPTLLSLTE
A0A1U7HW70      -----T----ALNQSP-GIQ--KVLA--EYQQVEAELAVQQ----TRFVGDHPTLLGLTE
A0A2S6VEJ8      -----T----ALNQSP-GIQ--KVLQ--EYQQVEAELAVQQ----TRFVGDHPTILSLTE
                                                                            

K9SLA9          QREALQVVLQGRVGEDLLEN-------------------------LTTQNLRISDTQ---
A0A168TT23      QINEIDTQIRERADTII-------------------------------------------
A0A0M1JWX9      QRQQLEGMLSQEAQRAL-GR------------------EIVTVARVPEAQAFQNS-----
A0A2T1M1V6      KRDELRREANRQMAQVLPGV------------------S---------------------
A0A2G7GCS2      QRDELMQIMNQQIAIAAPGA------------------S---------------------
K9XBH8          RRQQLMQTMNQQLAVALPNA------------------A---------------------
A0A1Z4LJ30      QQRVLRSQLRQYLANTSSVA------------------G---------------------
K9RI76          QRSVLRQQLNQFIAASRANA------------------G---------------------
A0A352AE27      QRDELQRQLQQYITQAAGDA----------------------------------------
A0A3B8JH60      ERDDLQRQLQGYIAQSAAGT----------------------------------------
A0A3C0N766      ERDDLQRQLQGYIAQSAAGT----------------------------------------
K9W9J7          ERDELQRQLQGYVAQAAAGT----------------------------------------
A0A139WSU3      QRESLQRKIQEHIRQTSAGT----------------------------------------
A0A433VN22      QRSTLRRQIGAYITQVAGNI----------------------------------------
Q7NF11          QREELQRSLRELLAKVVPAS------------------R---------------------
A0A1Z4JCS8      ERDTLRNQLQQYVG---QAA------------------G---------------------
F4XTX2          QREQLQQQIQQYI-FLAAGD------------------T---------------------
Q7NJN6          QREELLGKIKQQVGSIVPDA------------------S---------------------
U5QCC3          QREELLSKIKLQLSKLVPDS------------------E---------------------
A0A3S0Y9N9      QETVLKQELKRHIEQSF---------------------IGEAGRLNKSKDSESIVQL---
A0A433UNK7      EEVILRQELKKRIEQSF---------------------IGKSGRLNQSVEPEKIVQL---
A0A3M1SVZ4      KVATLRSMLQSRVGDV-------------------------------SGSLKSIGNL---
A0A654SFI6      EVASLRASLGGEARAAL---------------------K---------------------
K9SSQ0          RRDQIYNLMQAQAQAIL------------------------------GTKPADVTPE---
A0A2W1JIN9      ELDAARTLYNQRLSQL-------------------------------GGGSSVNIAP---
A0A318AJV1      QLADIDQQIRDEAQRVV---------------------G---------------------
A0A6B3MUB5      ERDAIRSLYNDKIATIA---------------------P--------NPQTISPSDV---
A0A1U7N2U4      ERYELLTLYNQKLSRLL---------------------PTNQPTNQLTNQIIPPADV---
A0A1D9G1F2      ERYELLTLYNQKLSRLL---------------------PTNQS----NNQIIAPGDV---
F4XV38          ERYELLTLYNQKLSRLL---------------------PTNQS----NNQIIAPGDV---
A0A2P8QIL5      ERDAARALYQQKIGSET------------------------------GNPAASTSNP---
A0A2T1FLY5      ERDAARALYQQKIGSET------------------------------GNPAASTPNA---
A0A433W447      ERDAARALYQQKIGSET------------------------------GNPAASTPNA---
K9U1K8          ERDAARALYQQKIGSET------------------------------GNPAASTPNA---
K9UYB2          ERDALRNLYSQGLNRVS---------------------P--------DNQSIPDNNI---
A0A218QN17      QRDKVNKLYTEQLAIVS---------------------P--------ANSSVATNSV---
K9RKN2          KRNAFRQMYEQQLANVS---------------------N--------TNNSVRDNQI---
A0A2I8ADV2      QREQIRALYAQQVGRVS---------------------A--------NNQTIPTEDV---
A0A1W5CKM3      QRDEIRALYGQQMARVS---------------------S--------SNQTANFNNL---
A0A5Q0GMF5      QRDEIRALYGQQMARVS---------------------S--------SNQTANFNNL---
Q3MEW0          QRDEIRALYGQQMARVS---------------------S--------SNQTANFNNL---
A0A1Z4KIC7      QRNEIRALYGQQMARVS---------------------S--------SGQTDNFQDL---
Q8YSM5          QRNEIRALYGQQMARVS---------------------S--------SGQTDNFQDL---
A0A1Q4S1H4      QRDTLRAMYQQELARIS---------------------N-----------GNAVANI---
A0A433VBU6      QRDTLRAVYQQELARVS---------------------S-----------GNALTSV---
A0A1Q4RZJ6      QRDALRSLYAQELSRVA---------------------P---K----AGANNSNNNI---
A0A1Z4SNV3      QRDALRSLYAQQLARVA---------------------PVDTS----SSNNSNLNNV---
A0A2H2XJQ1      QRDALRSLYAQQLARVA---------------------PVDTS----SSNNSNLNNV---
A0A3S5K358      QRDALRNLYAQELSRVA---------------------P--------GAGVNNSNNI---
A0A0T7BPJ4      ERDAVKAMYEQEVARVS---------------------P--------DGQS-QTTNF---
A0A0C1QS61      QRNTIRNLYIQGLNRVS---------------------S--------GERPVSPNNV---
A0A139X3R8      QRNSVRNLYIQGLNRIS---------------------S--------ENQPVSPNNV---
A0A1Z4I7C5      QRDEIKALYGQQMARVS---------------------S--------SNQTANFQDL---
A0A0C2MDK7      ERDALRKVLSEQLARVS---------------------T--------KDQSVSTKNF---
A0A1Y0RCK1      ERDALRAIYSEQLARVS---------------------S--------ENQNASAKNF---
A0A1Z4PWZ0      ERDALRAIYSEQVARVS---------------------P--------QGQTVSANNF---
A0A0C2QLT0      QRDALRAMYSEQLARVS---------------------S--------QNQTTSANNF---
A0A1Z4J2K1      ERDALRAMYSEQVARVS---------------------P--------KDQTSSANNF---
A0A3S0ZSX0      QRDGLRAFYQKELARVS---------------------P--------QNQAIPTNAV---
A0A2N6K4T3      QRNGLRALYQQGLARVS---------------------P--------RNQSISSGSV---
A0A370CKT2      QRNGLGALYQQGLARVS---------------------P--------RNQSISSGSV---
A0A0S3TL97      QRNGLRALYQQGLARVS---------------------P--------RNQSISSGSV---
A0A2N6M8A0      QRNGLGALYQQGLARVS---------------------P--------RNQSISSGSV---
A0A2N6M9E1      QRNGLRALYQQGLARVS---------------------P--------RNQSISSGSV---
A0A2N6KJI4      QRNGLRALYQQGLARVS---------------------P--------RNQSISSGSV---
A0A2N6MZ77      QRNGLRALYQQGLARVS---------------------P--------RNQSISSDSV---
A0A2N6KT20      QRNGLGALYQQGLARVS---------------------P--------RNQSISSGSV---
G6FSN3          QRNGLGALYQQGLARVS---------------------P--------RNQSISSGSV---
A0A4D9CI02      QRNGLRALYFQGLARVS---------------------P--------RSKSISSSSV---
A0A328I8B9      QRNGLRALYFQGLARVS---------------------P--------RSKSISSSSV---
A0A4Q9J4Z7      QRNGLRALYFQGLARVS---------------------P--------RSKSISSSSV---
A0A0M0SU69      QRNGLRALYFQGLARVS---------------------P--------GNTSISSSSV---
A0A1Z4TIZ8      QRNGLRGLYLQGLARVS---------------------P--------GNTSISSSSV---
A0A0S3TYD7      QVSELQELLQQRVATVV-GQ--------------------------TTAPRATEDDL---
A0A3C0N2P0      EQRRLKPLVDQEAATVM-GNA---------------------ASGVPDNAES--------
K9TLQ0          ERNSLLPLLQEEALLVL-GPN---------------------VSQFRGDIRG--------
A0A6B3M6M6      QRQNLLPLLNQEVAKVV-PNG---------------------TGI--NSAEA--------
A0A6B3NIJ0      QRQNLLPLLNQEVAKVV-PKG---------------------TGT--NSAEA--------
A0A352XE00      EQKNLLPLLEKEAGTAL-SSA---------------------KLTQSDNLAS--------
B4VS56          KQQNLLPLLSQEAGTVL-GAN---------------------ASAVPENPES--------
A0A352AAQ3      KQQRLLPLIEAEAANVV-GSG---------------------SSGVPNNAES--------
A0A350Y472      KKERLLPLIEEEAANVV-GNA---------------------AFGIPNNPES--------
A0A355DVB4      KKERLLPLIEEEAANVV-GNA---------------------AFGIPNNPES--------
U5QL42          QRDIYLRLLQEQATSVL-GSAKVAKLGLKSGAVPALGDSAITGSGGANPPVAPAASA---
K9QF04          ERQHLLSLIQQQVINLL-GIQLFK-------------EIQQLPGVASPSKIR--------
A0A076HBF2      RLNQLRPLLRQ-------------------------------------------------
A0A354B169      RQRQLQPMLLR-------------------------------------------------
G4FMX5          RINQLKPLLLR-------------------------------------------------
Q0IDT5          RLEQLQPLLRE-------------------------------------------------
A0A2D6FCW3      RLNQLQPLLRK-------------------------------------------------
A3ZA21          RLNQLQPLLRQ-------------------------------------------------
A0A140K3H3      KQAELRTLMQERSQQIL-GDAVSQ-------------VNLEAIIVSQGSTSQ--------
K9XUB8          KQVELRKLMKERAQQIL-GDAVSQ-------------VNLEAIIVNQGSTSQ--------
Q7NEU3          KRDRLRQVLASQAQQIL-GDRTVP-------------AIVSGGASLQDSIADSVNNT---
A0A6H2NHD5      QRQQLLPLLETEANRVL-AANAEV-------------DHD-----------S--------
A0A2P8W4F7      QRQQLLPLLEAEAQRLV-GEA--V-------------EAN-----------S--------
A0A5Q4E0Z4      QRQQLLPLLAAEAQRLV-GST--V-------------ETD-----------A--------
A0A2P8VVX1      QRENQLAQLRAEISAIS-RQN---------------------VTELDPTLLS--------
A0A2P8WHY0      ELDNNRKQLRQEIAAAI-RRP---------------------VETLNPDIAS--------
A0A2T1CMT9      EKKILQDLLSEEAERIL-GEL-------------------PPNFSSDLKLLQ--------
A0A563VQJ3      KKANLRQQLEQSIAETV-GIG----------------------VEVSDGLLN--------
A0A1D8TX52      QRQSVFALLQEETRRVL-GQV-----------------PT-QLVSTGSNLLT--------
A0A1D9G4T2      QRQSVFALLQEETRRVL-GQV-----------------PT-QLVSTGSNLLT--------
F4XP71          QRQSVFALLQEETRRVL-GQV-----------------PT-KLVTTGNNLLT--------
A0A1U7N5X9      QRQSVFALLQEETRRVL-GQV-----------------PT-QLVTTGNNLLT--------
A0A6B3N2I8      QRQSVFALLQEETRRVL-GQV-----------------PT-QLVTTGSNLLT--------
A0A2W6ZAV2      RVNQLRPLLQRR------------------------------------------------
A0A2G7GMH8      QRDTQRELLQQEMQTVV-GEN---------------------AIASEEDTTT--------
K9W742          QRQQQLALLEKEGERAV-GKN--------------------SSQLKGENLLT--------
A0A2T1DWE8      QRQRQRDLLAAEVQRIL-GNN-----------------AA-QVNVKGDGGLS--------
A0A1U7I8L3      QRQSQLALLQKEQQLVQ-GNN-----------------NPLPPTTTNSNLLE--------
A0A2T1DJL8      QRQKQQALLQQEVQRIL-GAQ-----------------AA-AIAQSGDGLVA--------
A0A1Z4J9W0      QRQRQVSLLQQEAQRIL-GSE-----------------AG---AASSESLFA--------
A0A0N7Z5K9      QRQRQVALLQQEAQRVL-GAD-----------------AG-AIAGSDSALFS--------
A0A0S3TXC5      QRERQVALLQQEAQRVL-GSE-----------------AS-SIAGSDAGLFS--------
K9SA61          KRQRQLALLQQEAQRVL-SST-----------------ST-GTSSQGDRLLT--------
A0A3D1PBA3      QRQNTIEMLKSEGGRVV-GKE-----------------QA-QSGSTGENILT--------
K9XPB0          QKNTQTTLLLQEVKKIL-GAV-----------------PP-NFAVQLQSLLR--------
A0A350Y7Z1      QRQRQLALLQEEAQRVL-GET-----------------ST-QIAFSTQNLLT--------
A0A352X2A7      QQSRQYRMLQEEGERVL-GRV-----------------AR-GEDLTSNTLLT--------
A0A0D8ZYV0      LRQSQQALLQAEQARVV-GAN------------------V-AQANAAGDLLS--------
A0A2T1FP73      QRQNLLSMMKQEGGRVL-GEGQAS-------------QAA-AAGNAADGILQ--------
A0A433VMS2      QRQNLLSMMKQEGGRVL-GEGQAS-------------QAA-AAGNAADGILQ--------
K9TYA7          QRQNLLSMMKQEGGRVL-GEGQAS-------------QAA-AAGNAADGILQ--------
A0A2P8QUE1      QRQNLLSMMKQEGGRVL-GEGQAS-------------QAA-AAGNAADGILQ--------
A0A2T1DNG3      QRQRQLKQLQLEASRLL-GS---------S---S----PGSGESLLS------TGQL---
B8HNB0          ERADLLKLMRQRANGLL---------------------RTQLNRDLTTLPSSASSGS---
A0A1Z4LN32      KEAALNNLLQTRIMESV-GY---------RTQIA-------------------PSSL---
A0A2I8A9F5      QEKALNSLLKQRITEYL-GY---------PIQIE-------------------TARL---
A0A218Q6R8      QEAALASLLQQRITESL-GY---------PMQIP-------------------PTML---
A0A218QGE0      QKANINSLLQQQISQSL-GY---------KAAIA-------------------PGKL---
A0A563VS48      EAAELEQVLNQEIAQTL-GG-------------------------EQQALLGNTNIL---
A0A318BJ18      QIDQLDRSIAREESRVS-GS----------------------------------------
A0A3B8Y8H9      QRRNLVPLIEEEAQAIL-GN-------------------------IPQTSLTDLTAL---
A0A2W1JVB9      QASTLRATLQNRVGEAL-G--------------------------VPSSPTQGTGQL---
A0A6H1U102      QRDNLFNLLQYRSARVL-GD------------------A------VS-------------
A0A563VLD6      KGQELQELLRERATQVL-GNTVSQAVLDKAIATSAEIIN--------------NTNTTTS
A0A2P8W9H0      RRENLQPLIEREGLRVQ---------------------R---------------------
A0A6I5P386      YRDNLQPLIEKEGVRVQ---------------------D---------------------
A0A318BG22      QIASVRGQIATLRGRIVGGF---------------------------------RAAY---
A0A1Z3HMQ0      EQASLQTLLNRRVGEVL-GT---------Q---A----N------ISPG------DL---
K1XF69          KRDNLENLLQREIQVYL-GS---------S---R----P------FSRG------LL---
B5W297          KRDNLENLLQREIQVYL-GS---------S---R----P------FSRG------LL---
A0A6H2AL05      KRDNLENLLQREIQVYL-GS---------S---R----P------FSRG------LL---
H1W7M8          KRDNLENLLQREIQVYL-GS---------S---R----P------FSRG------LL---
A0A5Q4H6A5      KRDNLESLLQREIQVYL-GS---------G---R----A------FSRG------LL---
D5A466          KRDNLESLLQREIQVYL-GS---------G---R----A------FSRG------LL---
U5QJM6          KRDSLQKRLNEQAGVLL-GG---------D---GKQAES------LRDSLAGTLESN---
A0A1Z4RPC6      KKQALNSQLQQLITQYV-GT------------------K------VSEG------LL---
A0A2T1CMZ0      KKQNLNSQLQGLISQYV-GA------------------K------VSEG------LL---
L8M4F7          KKAALNRQLQSLMSQTI-GQ------------------Q------VSPG------LI---
A0A140K2P2      KKASLNKELKDLISQNV-GQ---------G---V----E------ISEG------LF---
K9XWX4          KKASLNQELKNLISQNV-GQ---------G---V----E------ISEG------LF---
A0A140KB14      KKQDLNQKLQGLITETV-GS---------N---T----K------ISEG------LL---
K9XX88          KRQDLNQKLEGLITETV-GS---------N---T----K------ISEG------LL---
A0A563VSV6      KKANLRQDIEQQVAQAV-GT---------G---V----K------VSDG------LL---
L8LZE9          TKASLRRELQQQIAQKV-GS---------N---V----Q------ISDG------LL---
A0A433NM31      KQASLREVLEKRVQQVF-KG---------Q---Q----P------LLDQ------NL---
A0A1Z4NDS1      RVATLQNLLQQRINQVD-GN---------Q--------Q------IQLD------NL---
K9F4D9          QEAGLQALLQERLDVTL-GA---------N---EL---N------LPSD------DL---
U9VXM0          QESSLQALLQQRLDITL-GA---------N---QL---D------LPED------DL---
A0A6I5QPI5      QQAEIEALLSDRIQEVL-GQ---------E---L----T------VPVD-SLNVGRL---
A0A433W533      KRTALKALLSQRISQAV-GK---------T---R----T------LADG------KL---
A0A2P8QWJ3      KRTALKALLSQRISQAV-GK---------T---R----T------LADG------KL---
A0A2T1FKP8      KRTALKALLSQRISQAV-GK---------T---R----T------LADG------KL---
K9U6L7          KRTALKALLSQRISQAV-GK---------T---R----T------LADG------KL---
A0A1E5QP61      REAALSDLLQERVAQVL-GN---------N---Q----A------VDRR------DL---
U5DPF5          SRDALRQVLNERIQTVL-SE---------S---PAAGGA------IPVDVAIASGTL---
A0A3M1PML8      RVRSLEDMLQSRAVSVA-KS---------D---W----S------SIRN------DL---
A0A3M2GIL5      KRVSLQALLQERIRDIL-GS---------Q---L----Q------LPRE------SF---
A0A6H1TSJ9      KRVSLQALLQERIRDIL-GS---------Q---L----Q------LPRE------SF---
A0A0T7BPZ0      QIASLKKLLQQRIKQVA-GE---------S---T----K------LSIQ------NL---
A0A352X442      QETKLQTLVNQRIGENL-GS---------E---A----E------VATT------NL---
A0A6B3NF44      KEAALETLVQKQVAQVL-GG---------K---Q----Q------VPTE------NL---
A0A0M0SHU3      QVSALKNLLQQRVEQVG-GS---------N---Q----Q------MSTA------SL---
A0A1D2PBN3      KVAALNSLLQQRLKQVV-GS---------G---R----Q------IPTL------NL---
A0A0C2LVR7      KVAALNSLLQQRLKQAV-GN---------S---R----Q------IPTL------NL---
A0A1Z4PQB9      KVAALNSLLQQRLKQAV-GS---------D---R----Q------IPTL------NL---
A0A1Z4SFN6      KIAALNSLLEERIKQVV-GS---------N---Q----Q------IPLENVQNLQNL---
K9PGI8          KIAVLNLLLKGRIEEGV-GS---------T---K----T------VIKG------NL---
A0A2T1E9V8      KEAQLNILLNSETTRILQGQ-------------K----I------SS------YSNL---
A0A3M2GQQ6      QRDNLFRQLQQRSRRVL-GD---------A---V----AKVDLDEVT-------------
A0A6H1U2X0      QRDNLFRQLQQRSRRVL-GD---------A---V----AKVDLDEVT-------------
K9SGJ5          RRDQLYKLMQVQAETVL-GG---------RAAQV----G------ISTAVPASADGS---
A0A6C2DSN4      RRDELYRLLEARAQSVV-GV---------KGNTT----N------IAN----EPSSL---
L8MYT6          RRDELYRLLEARAQSVV-GV---------KGNTV----N------IAN----EPSSL---
A0A352JGJ6      RRNELYKLLETRAQALV-GT---------KG--T----N------ITN----EPNSP---
A0A1J5GLS2      RRDELYRLLETRAQSVV-GV---------GANSR----N------LTN----EPNSL---
A0A2W4W6M5      RRDELYKLLETRAQSVV-GV---------RGGNV----N------LTN----EPNST---
A0A2W7AN33      RRDELYRLLETRAQSVV-G-----------DSTA----N------ITN----QPNSA---
A0A256BLV2      RRDELYRLLETRAQSVV-GV---------RGSTT----N------ITN----EPNSA---
A0A2W6ZXF3      RRDELYRLLETRAQSVV-GV---------GVG-N----N------FTN----EPNSP---
A0A2Z5WX66      RRDELYKLLETRAQSVV-GL---------KGS-A----N------IAR----EPNST---
K9W1T3          KEANLKALLQQQLQQTFLGQ-------------Q----P------LP------NRIV---
A0A1Q4RTR1      KVQVLRQQLQQRIIQTL-GG-------------A----P------QGL----NERDL---
A0A1Z4SQV2      KIQVLRQQLQLRIVQIL-GS-------------T-----------QAL----NERDL---
A0A2H2XGN1      KIQVLRQQLQLRIVQIL-GS-------------T-----------QAL----NERDL---
A0A433UXH8      KVQVLRQQLELRVVQTL-GK-------------V-----------QNL----NERDL---
A0A1Z4RMB9      KKNDLTQQLEGLVANAV-GQ---------G---V----Q------VS------QGLL---
B4WP72          QVNSLESLLRQRIRTVTTNG---------R---Q----Q------FE------NSNM---
A0A318B4H2      EIMGLDKAIAQ-------------------------------------------------
B4WQE3          RRANLEPLLE--------------------------------------------------
A0A2K3BR24      QEATLANLLQERVNAVL----------------Q----EELPSNALAD----DNFSL---
K9YXY1          QEATLANLLQERVNAVL----------------Q----EELPSNALAD----DNFSL---
A0A1U7HGH0      REARFQQLLQTQTNQVLQGQ-------------------------TPN----GNNQL---
K9XJD3          REARFKQLLQTQINQVLQGQ-------------------------ALN-----NSQL---
K9SX01          QRAPIQKLLQQRIKETL-GT---------N---E----L------IS------DQDL---
A0A4P7ZT55      QRNKLRPLLQRR---------------------Q----L---------------------
A0A1E5QIR9      KQARLRGVLERRIIEVL-GN-------------S----P----GAIA------PGNL---
A0A1Z4IBC7      KVAVLEKLLKERTGEVA-GN-------------A----P------VT------QGSL---
A0A1W5CPC7      KIVVLKNLLKDRTGQVA-GT-------------A----Q------VT------QGSL---
A0A5Q0GKD1      KIVVLKNLLKDRTGQVA-GT-------------A----Q------VT------QGSL---
Q3MDC6          KIVVLKNLLKDRTGQVA-GT-------------A----Q------VT------QGSL---
A0A1Z4KM73      KIVVLKNLLKDRTGQVA-GT-------------A----Q------VT------QGSL---
Q8YNX7          KIVVLKNLLKDRTGQVA-GT-------------A----Q------VT------QGSL---
A0A367R4K6      KVTALRSLLKERIEQVA-GE-------------A----Q------VT------EGSL---
A0A1E2WSV8      KVTALKSLLKERVGQVA-GT-------------A----Q------IT------EGSL---
A0A2R5FRT9      KVAALQSLLKERIGQFA-GT-------------A----Q------IT------EGSL---
A0A2K8T1B6      KVVALQSLLKERIGQFA-GT-------------G----Q------IT------EGSL---
A0A235I9I0      KVVALKNLLKERTGQVA-GG-------------A----Q------IT------QGSL---
A0A2D0HQT8      KVLALKNLLKERTGQVA-GG-------------A----Q------IT------QGSL---
A0A2L2NU95      KVAALNNLLKERTGQVA-GK-------------A----Q------IT------QGSL---
A0A367S084      KVLALKNLLKERTGQVA-GG-------------A----Q------IT------QGSL---
A0A0V7ZFJ4      KEQALRNQLGKRVGQLI-DN---------G---N----S------IS------ERNL---
A0A367RIS1      KEQALKEQLERRVTQTL-GS---------A---Q----P------IP------DQDL---
A0A235IXQ2      KEQALKEQLKGRVSQTL-GS---------S---E----P------IP------EQDL---
A0A1W5CNX3      KEQALKEQLEGRVSKTL-GS---------W---Q----P------IP------EQDL---
A0A5Q0GJJ5      KEQALKEQLEGRVSKTL-GS---------W---Q----P------IP------EQDL---
Q3MEB7          KEQALKEQLEGRVSKTL-GS---------W---Q----P------IP------EQDL---
A0A1Z4KHN9      KEQALKAQLEGRVSKTL-GS---------S---Q----P------IP------EQDL---
Q8YT70          KEQALKAQLEGRVSKTL-GS---------S---Q----P------IP------EQDL---
A0A218Q4C1      EEEALRIQLEGRVTQTL-GS---------S---Q----P------IP------EQNL---
A0A166IWU6      KEQALKEQLEGRITQTL-GS---------S---Q----P------IP------EQDL---
A0A2S0Q8C0      KEQALKEQLEGRITQTL-GS---------S---Q----P------IP------EQDL---
W6FSX4          KEQALKEQLEGRITQTL-GS---------S---Q----P------IP------EQDL---
A0A0V7ZNJ9      KERALRNQLEKRVGQVV-NN---------NSNDS----S------IT------EDNL---
A0A0R0M9H9      KEQALKKQLQERVSQTL-GN---------A---E----V------LQ------QSNL---
A0A1S1ZVW2      KEQALKKQLQERVSQSI-GN---------V---E----V------LQ------QSNL---
A0A1B7WX82      KEASLKTVLKERVAQTV-GS---------S---D----A------LP------QQNL---
A0A1B7WTD1      KEAAQKKELEARVTETV-GN---------S---N----S------LP------KQNL---
A0A480ABC0      KEAAQKKELEARVTETV-GN---------S---N----S------LP------KQNL---
A0A1Z4LRU5      KLEALKNQLEGKVGQIV-GN---------G---V----S------VR------EPDL---
A0A1Z4JVB4      KAQALRSQLEGRVSQTI-GT---------S---A----D------VP------EQNL---
K9PIA4          KEAALRNQVEGRVAQSL-GN---------S---K----Y------VP------EQKL---
A0A1Z4HVE1      KATALRSQLEGRVSKIV-GT---------S---E----S------VP------EQNL---
A0A252ECZ1      KAAALRSQLEGRVSQTI-GN---------S---E----F------VP------EQNL---
A0A1Z4G5Y1      KAAALRSQLEGRVSQTI-GS---------S---E----F------VP------EQNL---
A0A252DNA2      KAAALRSQLEGRVSQTI-GS---------S---E----F------VP------EQNL---
A0A252E1Q4      KAAALRSQLEGRVSQTI-GS---------S---E----F------VP------EQNL---
A0A6G9SK36      KEIALRKQLEGRVAQTI-GD---------S---E----Y------MP------EQNL---
A0A1Z4M597      QAVALKNQLEGRVAQTI-GN---------S---E----Y------MP------EQNL---
A0A1Z4MWT1      QEVALRNQLEGRVAQTI-GN---------S---E----Y------TP------EQNL---
A0A1Z4TX53      QEVALRNQLEGRVAQTI-GN---------S---E----Y------TP------EQNL---
A0A5P8VSD1      KEQALRKQLEARVSQTL-SS---------S---Q----P------IP------EQDL---
A0A2A2TNQ5      KEQAFRQQMEKRVGRVI-GV---------G---E----S------VK------EQDL---
A0A3S1C4K5      KVQALREQLEKRVGKIV-DT---------K---Q----P------VS------EKNL---
A0A1X4G3D5      KGQVLKKQLQERIYQSV-GN---------V---G----A------LG------ERSL---
D4TNI2          KGQVLKKQLQERIYQSV-GN---------V---G----A------LG------ERSL---
A0A1Z4H6Z8      KQAALRNQLEGRVAQTI-GS---------S---E----S------VP------EQNL---
A0A1Z4NPM1      KVNALRSQLEQRVGKVI-GG---------G---V----A------VP------ERDL---
A0A3F3KPR9      KEQALKKQLQERVSQTL-GN---------A---E----V------LQ------QSNL---
D4TGN7          KEQALKKQLQERVSQTL-GN---------A---E----V------LQ------QSNL---
A0A1Z4UZW9      KEASLKNVLKERVAQTV-GS---------S---E----S------LP------KQNL---
A0A0K2M5H0      KEASLKNVLEQRVSQTV-GS---------S---E----F------LS------KQNL---
A0A1B7VSH4      KEASLKKLLEERVGQTV-GN---------F---E----S------LS------QQNL---
A0A1B7W126      KEASLKKLLEERVGQTV-GN---------F---E----S------LS------QQNL---
A0A3D4C6Q6      KEASLKKLLEERVGQTV-GN---------F---E----S------LS------QQNL---
A0A1B7UVJ4      KEASLKTVLKERVAQTV-GS---------S---D----A------LS------QQNL---
A0A1B7UTR1      QEASLKDLLEKRVAQTI-GS---------S---K----S------LP------QQNL---
K7W0A4          KEASLKKLLEERVTQTI-GS---------S---K----S------LP------QQNL---
A0A5C0DRW9      QEASLKDLLEKRVAQTI-GS---------S---K----S------LP------QQNL---
A0A6H2C088      QEASLKDLLEKRVAQTI-GS---------S---K----S------LP------QQNL---
A0A2T1CIL7      REVELEALLENQIEQIQGGK----------------------------------------
A0A433V7A0      QETALKSLLEDRVKAVV-----------MQ---Q----P------IP------KGNF---
A0A2T1FTR8      KRQALVEILQKRFKQSLVGE---------Q---Q----F--------------QGKLVEL
K9UA41          KRQALVEILQKRFKQSLIGE---------Q---Q----F--------------QGKLVEL
A0A0C2LBE2      KVAALNSVLQQRMKQVT-GS---------N---Q----Q------IS------LGNL---
A0A433NN38      QISALSQVLQQRVEQVA-GK---------N---Q----Q------VS------LKNL---
A0A2N6K0T2      KVAALRNLLQERVGQVA-GN---------N---Q----P------VS------PANL---
A0A2N6ML72      KVSALRSLLQQRVQQVG-GN---------N---Q----Q------IS------TANL---
G6FQZ6          KVSALRSLLQQRIQQVG-GN---------N---Q----Q------IS------TANL---
A0A2N6MQX9      KVSALRSLLQQRIQQVG-GN---------N---Q----Q------IS------TANL---
A0A2N6KXT6      KVSALRSLLQQRIQQVG-GN---------N---Q----Q------IS------TANL---
A0A2N6KGB9      KVSALRSLLQQRIQQVG-GN---------N---Q----Q------IS------TANL---
A0A2N6L3Y5      KVSALRSLLQQRIQQVG-GN---------N---Q----Q------IS------TANL---
A0A0S3TIS7      KVSALRSLLQQRVEQVG-GN---------N---Q----Q------IS------TANL---
A0A1U7GW28      KVSALRSLLQQRVEQVG-GN---------N---Q----Q------IS------TANL---
A0A2N6LW63      KVSALRSLLQQRVEQVG-GN---------N---Q----Q------IS------TANL---
A0A328IH74      KVSALKNLLQQRVEQVG-GN---------N---Q----Q------IS------TANL---
A0A4D9CIB0      KVSALKNLLQQRVEQVG-GN---------N---Q----Q------IS------TANL---
A0A1Z4TQ63      KVSALKSLLQQRVEQVG-GN---------N---P----Q------IS------TANL---
A0A4Q9J8G2      KVSALKNLLRQRVEQVG-GN---------S---Q----Q------MS------TANL---
A0A1Z4SMD6      QEINLNNLLRSRIEQVL-GPSGMNLVFGNR---Q----T------VS------TGKL---
A0A2H2Y096      QEINLNNLLRSRIEQVL-GPSGMNLVFGNR---Q----T------VS------TGKL---
K9S8M8          KQAALQSLVQERVGQVLNGT---------P---A----S------DI------NPSY---
A0A1Z4NFV0      EIAQVQGLIQQRVNASS-GA---------N---F----N------TT------PERL---
B0CAX4          KRIALKGVLGEQTSQII------------E---T----K------QPQ----PLRNL---
A0A350Y0P6      KEAARQRLLNQRVEQVI-GL---------K---Q----S------IP------LNNL---
A0A352X940      REDAQKSLLQERISKVL-GT---------G---E----I------LP------TENL---
B8HTN4          QLTELNTILRERVRDVAQAS---------R---K----G----GSLP------TSNL---
A0A2A2TPF8      EEKALTNLLQQRVSQSV-PS--------KN---V----K------ID------PNSL---
A0A1Z4R0P8      QEKALASLLQQRASQSV-GA---------N---V----K------IS------PNSL---
A0A0T7BUI3      QEKTLKSLLNRRTQEIT-GN---------Q---L----E------VS------LSNL---
A0A1Z4LP32      QESALNALLQQRKSEAS-GR---------Q---Q----N------IS------NSRL---
K9REP9          QATLLQSLLQQRKQEAS-GR---------Q---Q----N------IP------NNRL---
A0A1Z4SIJ3      QQAALKSILNERAGKAL-GT---------T---D----N------IS------TNKL---
A0A2H2XPG4      QQAALKSILNERAGKAL-GT---------T---D----N------IS------TNKL---
K9V3C7          QQATLKQLLQERVADSS-GS---------S---Q----Q------IT------PGNL---
A0A1Z4T6Y7      KEAALNNLLQQRASQSL-GT---------N---V----K------VS------PNKL---
A0A2H2Y561      KEAALNNLLQQRASQSL-GT---------N---V----K------VS------PNKL---
A0A1Q4S362      KEASLNKLLQQRASQSL-GT---------N---V----K------VS------PDKL---
A0A3S1CIN8      KEASLSQLLQQRASQSL-GT---------N---V----K------VS------PDKL---
A0A2A2TC28      QELALNSLVKQRVEQSL-GS----GKIGST---K----N------IS------PTNL---
A0A0C1NCB0      EEVTLKALLKQRVGETA-GS---------Q---R----E------IS------TDKL---
A0A2N6K7Q9      QQATLNSLLQQRTQEYS-GI-------------P----I------VS------PGKL---
A0A2N6MXH6      QQATLNSLLQQRTQEYS-GI-------------P----I------VS------PGKL---
A0A2N6M5A8      QQATLNSLLQQRTQEYS-GI-------------P----I------VS------PDKL---
A0A2N6LL61      QQATLNSLLQQRTQEYS-GI-------------P----I------VS------PGKL---
A0A0S3TP66      QQATLNSLLQQRTQEYS-GI-------------P----I------VS------PGKL---
G6FP91          QQATLNSLLQQRTQEYS-GI-------------P----I------VS------PGKL---
A0A1U7GYR5      QQATLNSLLQQRTQEYS-GI-------------P----I------VS------PGKL---
A0A2N6KY52      QQATLNSLLQQRTQEYS-GI-------------P----I------VS------PGKL---
A0A2N6KMP5      QQATLNSLLQQRTQEYS-GI-------------P----I------VS------PGKL---
A0A2N6MA45      QQATLNSLLQQRTQEYS-GI-------------P----I------VS------PGKL---
A0A4Q9J9V9      QQSTLNSLLQQRTQQYS-GI-------------P----L------VS------PSKL---
A0A328IGA1      QQSTLNSLLQQRTQQYS-GI-------------P----L------VS------PSKL---
A0A4D9CE41      QQATLNSLLQQRTQQYS-GI-------------P----L------VS------PSKL---
A0A0M0SFT2      QQATLNALLQQRTQQYS-GI-------------P----L------VS------PSKL---
A0A1Z4TLC8      QQATLNSLLQQRTQQYS-GI-------------P----L------VS------PGKL---
A0A0C2LFH0      KEITLNALLQQRVEQVL-GPSGVKQVLGTQ---Q----N------VA------PGKL---
A0A1Z4IYV4      QEVTLNALLQQRIEQVL-GTKGIKQVLGTQ---K----N------VP------PGKL---
A0A1Z4Q0T6      QEVTLNALLQQRIEQVL-GTKGIKQVLGTQ---Q----N------VP------PGKL---
A0A0C2PT44      QEVTLNALLQQRIEQVL-GAKGIKQVLGTQ---Q----N------VP------PGKL---
A0A1D2P6J4      QEVTLNALLQQRIEQVL-GTKGIEQVLGTQ---K----N------VP------PGKL---
A0A3M9ZEU1      QADQLRTLLQERVQQAI-GM---------Q---I----P------IS------EGGL---
A0A1Z4JK72      QEQDLNALLQSRVSEAV-GA---------S---V----Q------VA------PGAL---
A0A0N7Z489      QRDDLNALLQARVSEAV-GS---------S---V----Q------VS------PNRL---
A0A0S3TXS2      QRDDLNALLQTRVSDAV-GA---------N---V----S------VA------PGAL---
A0A1Z4RN12      EEADLTSLLEQQIASTL-GP---------G---Q----Q-----GLVN----SVNIA---
A0A2T1CMF9      EQADLEDLLRQEVAGTL-GP---------Q---Q----Q-----GLAG----QINIL---
Q7NDC5          RRGALRALLASEADRLL-GR---------R---G----L--------------PDSLLDA
U5QGK3          QRNALRALLKTEAGRLL-GQ---------P---G----L--------------PDSLVDA
A0A2W4UY24      QEVALLTLLQTRVGLALGSD---------Q---I----A------LP------DDDL---
A0A2T1GMT4      KQSKLKTLLSQQIRNTI-GS---------Q---A----Q------IP------QGLL---
K9UI51          KQSKLKALLEQQIRSTI-GS---------Q---A----Q------IP------QGLL---
K9QM62          RKSNLKTLLQQQINQTL-GK---------R---T----T------VS------PKLL---
A0A1Z4FWI3      KKANLKALLQQEIGQAG-GN---------P---S----N------IQ------PRTL---
A0A1Z4JYE7      KKDNLNNLLQLQIAKTV-GL---------G---Q----K------LQF----SPTLL---
A0A2T1FXY4      KKSNLEALLKKQIKQTV-GS---------Q---T----K------VA------AGLL---
K9TYI2          KKYNLEALLQKQIKQTV-GS---------Q---T----K------VA------AGLL---
A0A1Z4QL41      KRFNLKNLLQKQIEQTI-GS---------Q---T----Q------FT------QGFL---
A0A252D4T4      RRANLQALLKQEVGQNG-GT---------S---A----N------IQ------PKTL---
A0A252DJH5      RRANLQALLKQEVGQNG-GT---------S---A----N------IQ------PKTL---
A0A252EB80      KKANLQALLKQEVGQNG-GT---------Q---V----N------IQ------PQSL---
A0A6G9SKZ9      RKANLQALLNKELKQTG-AV---------Q---P----N------SQ------PKTL---
A0A1Z4HPW5      RKANLQALLKKEIGQTD-AG---------P---V----N------YQ------PKTL---
A0A1Z4MSN1      RKANLQALLKKEIGQTG-AG---------P---V----N------YQ------PKTL---
A0A1Z4U1C2      RKANLQALLKKEIGQTG-AG---------P---V----N------YQ------PKTL---
A0A0D6KV51      RKTNLQALLKQEIGQTG-AG---------P---V----N------YP------PKTL---
A0A1Z4MKF8      RKTNLQALLKQEIGQTG-AG---------P---V----N------YP------PKTL---
A0A2C6WC43      KKANLRALLQQQISQTV-GS---------N---A----Q------VP------QNLL---
A0A1Z4L5A1      KKANLRALLQQQISQTV-GS---------N---A----Q------VP------QNLL---
A0A367QD86      KKANLRALLQQQISQTI-GN---------N---A----Q------VP------QNLL---
A0A235IZ96      KKANLKSLLQQQIGQTI-GN---------Q---T----Q------VP------QSLL---
A0A2L2NGP0      KKANLKSLLQQQIGQTI-GN---------Q---T----Q------VP------QSLL---
A0A2K8SM78      KKASLKSLLQQQIGQTV-GN---------Q---T----Q------IP------QSLL---
A0A2R5FPC0      KKASLQSLLQQQIGQTV-GN---------Q---T----Q------IP------QRLL---
A0A5P8W5T6      KKASLKSLLQQQIGQTV-GN---------Q---T----Q------IP------QNLL---
A0A140KBA0      QEAELTALLEQQIRQTL-GS---------Q---S----A---SSVAQ------LNIL---
K9XSG1          QEAELTALLEQQIQQTL-GS---------Q---S----A---SSVAQ------LNIL---
A0A0F5YE28      KRDSLNAALQEQVEQVL-GS---------Q---A----V------VP------EGLL---
U7QEH7          KRDSLNAALQEQVEQTL-GS---------Q---A----V------VP------EGLL---
A0A3S1ATK5      KKANLNNLLQTQIKATI-GS---------S---A----K------IP------EEQLQKT
A0A2Z6CPH0      RKANLTNLLQQQITQTL-GQ---------Q---S----Q------FA------PRLL---
A0A1Z4GT50      KKTTLQTLLQKQIEQIV-GN---------Q---V----K------IP------QGQL---
A0A1Z4GIX0      RKANLTALLQQQVGQTL-GT---------Q---A----Q------VP------QRLL---
A0A2H6LC24      RKANLTALLQQQVGQTL-GT---------Q---A----Q------VP------QRLL---
B2J6N5          KKASLKSLLQQQIGQTV-GN---------K---T----E------VS------QNLL---
A0A367RMI4      KKANLKSLLQQQVGQTV-GN---------Q---T----Q------VP------QNLL---
A0A235HUM0      KKTNLKSLLQQQVGQTV-GN---------Q---T----Q------VP------TSLL---
A0A2L2NW47      KKANLKSLLQQQVGQTI-GN---------Q---T----Q------VP------QSLL---
A0A1E2WUR1      RKASLNSLLQQQIGQTI-GN---------Q---A----P------VP------QSLL---
A0A235IKU3      KKANLKSLLQQQIGQTI-GN---------Q---T----Q------IP------QSLL---
F4XKF3          QQRSLRGHLQQQINQIL-GS---------Q---S----LAGTQIQIT------QGLL---
A0A1D9FX10      QQRSLRGHLQQQIDQIL-GS---------Q---S----LAGTQIQIT------EGLL---
A0A1D8TNX9      QQRSLTGHLQQQINQIL-GS---------Q---S----LASTQIQIT------QGLL---
A0A1U7MYU6      QQSSLRGHLQQQIDQIL-GS---------Q---S----LAGTQIQIT------QGLL---
A0A3C0NJ41      KEASLKSLLQDRVSQTV-GS---------Q---Q----Q------VP------TGNL---
A0A352AG88      REAALRNLLQERVVQTI-GV---------V---R----P------VS------ASSL---
A0A350Y374      KEAALKSLLEERVGQTI-GY---------D---Q----F------VA------TQNL---
A0A355DPX0      KEAALKSLLEERVGQTI-GY---------D---Q----F------VA------TQNL---
A0A0D8ZUV2      RQAALKALLDKRV------A---------N---T----N----SPVQ------GANL---
A0A433VDI0      KKNAFKAQLQGLVK----DA---------G---V----R----RQVT------SQQL---
A0A3D1PG43      KKAALKALLQQRITQTL-GE------------------P----KQVP------IKDL---
A0A2P8QQ72      KRNALKQLLEGRIGQML-GN------------------S----KQVS------NRNL---
K9TZQ7          KRNALKQLLEGRIGQML-GN------------------S----KQVS------NRNL---
A0A2G7GPR0      RRDALRALLEERVQGAI-GN---------A---A----A----TEVS------PSNL---
K9XH68          RRDALRALLEERVQGAI-GN---------A---A----A----TEVS------PGNL---
A0A1U7HW70      RRDALRALLEERVQGAIGGN---------A---A----A----TEVS------PGNL---
A0A2S6VEJ8      RRDALRALLEERVQGAI-GN---------A---A----A----TEVS------PGNL---
                                                                            

K9SLA9          ---------------------------------------------A--------------
A0A168TT23      ---------------------------G--------------------------------
A0A0M1JWX9      -------------------------------VR------------V--------------
A0A2T1M1V6      ---------------------------SSQ-VDVTL-GDSSTDSRT--------------
A0A2G7GCS2      ---------------------------ANQ-IDPTLGGNGTRDSRI--------------
K9XBH8          ---------------------------SNQ-VDPTLSGSGTRDSRI--------------
A0A1Z4LJ30      -------------------------------VDTSVGQNT-----A--------------
K9RI76          ---------------------------G---VNPAIGENT-----A--------------
A0A352AE27      ---------------------------S---IDTTMTGER--QGRA--------------
A0A3B8JH60      ---------------------------R---VDTTVSTNN--EGRA--------------
A0A3C0N766      ---------------------------R---VDTTVSTNN--EGRA--------------
K9W9J7          ---------------------------Q---VDTTVSTNS--DGRA--------------
A0A139WSU3      ---------------------------K---VDTTVATDS--QGRA--------------
A0A433VN22      ---------------------------P---VDPTIATDS--QGRA--------------
Q7NF11          ---------------------------TERALDDSLAGGGNRDSRI--------------
A0A1Z4JCS8      ---------------------------R---ISANTDFTTGAEGRN--------------
F4XTX2          ---------------------------L---VDPTLTDSA--QGRA--------------
Q7NJN6          ---------------------------K---VNVSLGGNSYRDSRI--------------
U5QCC3          ---------------------------K---VDTTLGGNTYRDSRI--------------
A0A3S0Y9N9      ---------------------------KPQGLQ------------Q--------------
A0A433UNK7      ---------------------------RGQGLQ------------Q--------------
A0A3M1SVZ4      ---------------------------EFSQME------------Q--------------
A0A654SFI6      ------------------------------------------------------------
K9SSQ0          ---------------------------GQSSIK------------Q--------------
A0A2W1JIN9      ---------------------------ESARVG------------Q--------------
A0A318AJV1      ------------------------------------------------------------
A0A6B3MUB5      ---------------------------ASDQLS------------Q--------------
A0A1U7N2U4      ---------------------------ASDQLS------------Q--------------
A0A1D9G1F2      ---------------------------ASDQLS------------Q--------------
F4XV38          ---------------------------ASDQLS------------Q--------------
A0A2P8QIL5      ---------------------------ATDKLS------------Q--------------
A0A2T1FLY5      ---------------------------ATDKLS------------Q--------------
A0A433W447      ---------------------------ATDKLS------------Q--------------
K9U1K8          ---------------------------ATDKLS------------Q--------------
K9UYB2          ---------------------------ADDQIS------------Q--------------
A0A218QN17      ---------------------------AGDQIS------------Q--------------
K9RKN2          ---------------------------ASDEIS------------Q--------------
A0A2I8ADV2      ---------------------------ASDQIS------------Q--------------
A0A1W5CKM3      ---------------------------SNDQIS------------Q--------------
A0A5Q0GMF5      ---------------------------SNDQIS------------Q--------------
Q3MEW0          ---------------------------SNDQIS------------Q--------------
A0A1Z4KIC7      ---------------------------ANDQIS------------Q--------------
Q8YSM5          ---------------------------ANDQIS------------Q--------------
A0A1Q4S1H4      ---------------------------SNDTLS------------Q--------------
A0A433VBU6      ---------------------------SNDNLS------------Q--------------
A0A1Q4RZJ6      ---------------------------AGDPIS------------Q--------------
A0A1Z4SNV3      ---------------------------AGDAIS------------Q--------------
A0A2H2XJQ1      ---------------------------AGDAIS------------Q--------------
A0A3S5K358      ---------------------------AGDPIS------------Q--------------
A0A0T7BPJ4      ---------------------------ASDDLT------------K--------------
A0A0C1QS61      ---------------------------AADQVS------------Q--------------
A0A139X3R8      ---------------------------AADQVS------------Q--------------
A0A1Z4I7C5      ---------------------------ANDQIS------------Q--------------
A0A0C2MDK7      ---------------------------AGDQLS------------Q--------------
A0A1Y0RCK1      ---------------------------AGDQLS------------Q--------------
A0A1Z4PWZ0      ---------------------------AGDQLS------------Q--------------
A0A0C2QLT0      ---------------------------AGDQLS------------Q--------------
A0A1Z4J2K1      ---------------------------AGDQLS------------Q--------------
A0A3S0ZSX0      ---------------------------ASDRIS------------Q--------------
A0A2N6K4T3      ---------------------------AGDQIS------------Q--------------
A0A370CKT2      ---------------------------AGDQIS------------Q--------------
A0A0S3TL97      ---------------------------AGDQIS------------Q--------------
A0A2N6M8A0      ---------------------------AGDQIS------------Q--------------
A0A2N6M9E1      ---------------------------AGDQIS------------Q--------------
A0A2N6KJI4      ---------------------------AGDQIS------------Q--------------
A0A2N6MZ77      ---------------------------AGDQIS------------Q--------------
A0A2N6KT20      ---------------------------AGDQIS------------Q--------------
G6FSN3          ---------------------------AGDQIS------------Q--------------
A0A4D9CI02      ---------------------------AGDKIS------------Q--------------
A0A328I8B9      ---------------------------AGDKIS------------Q--------------
A0A4Q9J4Z7      ---------------------------AGDKIS------------Q--------------
A0A0M0SU69      ---------------------------AGDQIS------------Q--------------
A0A1Z4TIZ8      ---------------------------AGDKIS------------Q--------------
A0A0S3TYD7      -----------------QM--------G-Q-FR------------Q--------------
A0A3C0N2P0      -----------------------LASPS-S-IR------------K--------------
K9TLQ0          -----------------------LSTPN-S-LR------------S--------------
A0A6B3M6M6      -----------------------LAAPS-S-VR------------L--------------
A0A6B3NIJ0      -----------------------LAAPS-S-VR------------L--------------
A0A352XE00      -----------------------LASPS-S-VR------------L--------------
B4VS56          -----------------------LASPS-S-LR------------L--------------
A0A352AAQ3      -----------------------LASPS-S-LR------------L--------------
A0A350Y472      -----------------------LASPS-S-IR------------L--------------
A0A355DVB4      -----------------------LASPS-S-IR------------L--------------
U5QL42          -----------------PTPATVASKGE-P-AP------------PAAPTSKAPAALPEA
K9QF04          ------------------------------------------------------------
A0A076HBF2      ------------------------------------------------------------
A0A354B169      ------------------------------------------------------------
G4FMX5          ------------------------------------------------------------
Q0IDT5          ------------------------------------------------------------
A0A2D6FCW3      ------------------------------------------------------------
A3ZA21          ------------------------------------------------------------
A0A140K3H3      -----------------------VMGIN-G-AD------------TQAQALNPGQPVDSQ
K9XUB8          -----------------------IMGIN-T-AN------------TQVSAANTNQAVESQ
Q7NEU3          -----------------GSPKGITDRLG-D-LQ------------V--------------
A0A6H2NHD5      -----------------------LGHQG-A-VS------------R--------------
A0A2P8W4F7      -----------------------LGYKG-S-VS------------Q--------------
A0A5Q4E0Z4      -----------------------LGYQG-S-VS------------R--------------
A0A2P8VVX1      -----------------------YLQLG-G-ID------------F--------------
A0A2P8WHY0      -----------------------LLQLG-G-VD------------L--------------
A0A2T1CMT9      -----------------------KQGLV-G-SD------------T--------------
A0A563VQJ3      -----------------------AGD---N-NK------------E--------------
A0A1D8TX52      -----------------------EGQLG-G-VD------------I--------------
A0A1D9G4T2      -----------------------EGQLG-G-VD------------I--------------
F4XP71          -----------------------EGQLG-G-VD------------L--------------
A0A1U7N5X9      -----------------------EGQLG-G-VD------------I--------------
A0A6B3N2I8      -----------------------EGQLG-G-VD------------I--------------
A0A2W6ZAV2      ------------------------------------------------------------
A0A2G7GMH8      -----------------------AGQQG-Q-LD------------I--------------
K9W742          -----------------------EGQLG-E-TD------------V--------------
A0A2T1DWE8      -----------------------VGQLS-A-TD------------L--------------
A0A1U7I8L3      -----------------------KGQLG-K-LD------------V--------------
A0A2T1DJL8      -----------------------IGQLG-E-ND------------L--------------
A0A1Z4J9W0      -----------------------TGQLG-E-ND------------L--------------
A0A0N7Z5K9      -----------------------TGQLG-E-ND------------L--------------
A0A0S3TXC5      -----------------------TGQLG-E-ND------------L--------------
K9SA61          -----------------------EGQMG-E-LD------------L--------------
A0A3D1PBA3      -----------------------QGQLG-G-ID------------L--------------
K9XPB0          -----------------------QGELV-N-SK------------T--------------
A0A350Y7Z1      -----------------------EGQLG-N-ND------------L--------------
A0A352X2A7      -----------------------EGQLG-E-ND------------L--------------
A0A0D8ZYV0      -----------------------QGQRG-G-LD------------L--------------
A0A2T1FP73      -----------------------QGQLG-A-LD------------L--------------
A0A433VMS2      -----------------------QGQLG-A-LD------------L--------------
K9TYA7          -----------------------QGQLG-A-LD------------L--------------
A0A2P8QUE1      -----------------------QGQLG-A-LD------------L--------------
A0A2T1DNG3      ---------------------------G-G-FD------------Q--------------
B8HNB0          -----------------SD--------G-S-VV------------Q--------------
A0A1Z4LN32      -----------------QI--------G-R-VK------------Q--------------
A0A2I8A9F5      -----------------QI--------G-E-IK------------R--------------
A0A218Q6R8      -----------------QM--------G-E-IR------------Q--------------
A0A218QGE0      -----------------QM--------G-E-IK------------Q--------------
A0A563VS48      -----------------AL--------G-E-SE------------E--------------
A0A318BJ18      -------------------------------IQ---------------------------
A0A3B8Y8H9      -----------------TS--------P-NTIR------------E--------------
A0A2W1JVB9      -----------------QV--------G-E-LQ------------Q--------------
A0A6H1U102      -----------------QVDLSDVAGYG-A-IQ------------Q--------------
A0A563VLD6      ITNATESESTTENSEVNSQ--------G-N-IL------------A--------------
A0A2P8W9H0      -----------------EL--------A-SYIR---------------------------
A0A6I5P386      -----------------QI--------A-NRIR---------------------------
A0A318BG22      -----------------EL--------A---LN---------------------------
A0A1Z3HMQ0      -----------------QM--------S-E-LS------------R--------------
K1XF69          -----------------RV--------M-D-VK------------N--------------
B5W297          -----------------RV--------M-D-VK------------N--------------
A0A6H2AL05      -----------------RV--------M-D-VK------------N--------------
H1W7M8          -----------------RV--------M-D-VK------------N--------------
A0A5Q4H6A5      -----------------RV--------M-D-VK------------N--------------
D5A466          -----------------RV--------M-D-VK------------N--------------
U5QJM6          -----------------RTSSSTADRYG-E-LR------------V--------------
A0A1Z4RPC6      -----------------QA--------G-N-VR------------E--------------
A0A2T1CMZ0      -----------------QS--------D-N-LK------------D--------------
L8M4F7          -----------------KN--------N-Q-YA------------P--------------
A0A140K2P2      -----------------NN--------D-G-LK------------E--------------
K9XWX4          -----------------NN--------D-G-LK------------E--------------
A0A140KB14      -----------------RS--------D-G-NK------------E--------------
K9XX88          -----------------RS--------D-G-NK------------E--------------
A0A563VSV6      -----------------QD--------N-R-FQ------------E--------------
L8LZE9          -----------------QS--------DLG-QK------------E--------------
A0A433NM31      -----------------QI--------G-E-LQ------------Q--------------
A0A1Z4NDS1      -----------------QL--------G-D-LR------------Q--------------
K9F4D9          -----------------QS--------G-Q-LE------------Q--------------
U9VXM0          -----------------QS--------G-D-LE------------Q--------------
A0A6I5QPI5      -----------------QL--------G-E-LR------------Q--------------
A0A433W533      -----------------QI--------G-E-SK------------Q--------------
A0A2P8QWJ3      -----------------QI--------G-E-SK------------Q--------------
A0A2T1FKP8      -----------------QI--------G-E-SK------------Q--------------
K9U6L7          -----------------QI--------G-E-SK------------Q--------------
A0A1E5QP61      -----------------QI--------G-E-LQ------------Q--------------
U5DPF5          -----------------QL--------S-E-VE------------I--------------
A0A3M1PML8      -----------------QA--------G-A-LQ------------Q--------------
A0A3M2GIL5      -----------------EI--------G-L-VQ------------Q--------------
A0A6H1TSJ9      -----------------EI--------G-L-VQ------------Q--------------
A0A0T7BPZ0      -----------------QI--------G-D-VR------------Y--------------
A0A352X442      -----------------QI--------G-Q-TK------------Q--------------
A0A6B3NF44      -----------------QI--------G-E-LK------------E--------------
A0A0M0SHU3      -----------------QM--------G-E-VR------------Q--------------
A0A1D2PBN3      -----------------QT--------G-E-LR------------Q--------------
A0A0C2LVR7      -----------------QT--------G-E-LR------------Q--------------
A0A1Z4PQB9      -----------------QT--------G-E-LR------------Q--------------
A0A1Z4SFN6      -----------------QI--------G-E-LR------------Q--------------
K9PGI8          -----------------QI--------G-E-LR------------Q--------------
A0A2T1E9V8      -----------------QV--------G-S-IQ------------Q--------------
A0A3M2GQQ6      -----------------GS--------G-A-IK------------E--------------
A0A6H1U2X0      -----------------GS--------G-A-IK------------E--------------
K9SGJ5          -------------------------------IQ------------Q--------------
A0A6C2DSN4      -------------------------------IQ------------Q--------------
L8MYT6          -------------------------------IQ------------Q--------------
A0A352JGJ6      -------------------------------IQ------------Q--------------
A0A1J5GLS2      -------------------------------IQ------------Q--------------
A0A2W4W6M5      -------------------------------IQ------------Q--------------
A0A2W7AN33      -------------------------------IQ------------Q--------------
A0A256BLV2      -------------------------------IQ------------Q--------------
A0A2W6ZXF3      -------------------------------IQ------------Q--------------
A0A2Z5WX66      -------------------------------IQ------------Q--------------
K9W1T3          -----------------PL--------A-DGVQ------------Q--------------
A0A1Q4RTR1      -----------------NL--------D-S-LK------------Q--------------
A0A1Z4SQV2      -----------------QI--------D-P-LK------------Q--------------
A0A2H2XGN1      -----------------QI--------D-P-LK------------Q--------------
A0A433UXH8      -----------------QI--------D-P-LK------------Q--------------
A0A1Z4RMB9      -----------------EG--------Q-DGTK------------E--------------
B4WP72          -----------------QL--------G-E-LQ------------Q--------------
A0A318B4H2      -----------------EG--------G-R-SR------------S--------------
B4WQE3          -----------------RE--------G-VRVQ------------E--------------
A0A2K3BR24      -----------------QL--------S-S-LK------------I--------------
K9YXY1          -----------------QL--------S-S-LK------------I--------------
A0A1U7HGH0      -----------------QV--------G-Q-IQ------------Q--------------
K9XJD3          -----------------QV--------G-E-IQ------------Q--------------
K9SX01          -----------------QI--------G-G-AQ------------L--------------
A0A4P7ZT55      ---------------------------------------------D--------------
A0A1E5QIR9      -----------------QM--------G-Q-LQ------------L--------------
A0A1Z4IBC7      -----------------QV--------G-Q-LR------------Q--------------
A0A1W5CPC7      -----------------QV--------G-Q-LK------------Q--------------
A0A5Q0GKD1      -----------------QV--------G-Q-LK------------Q--------------
Q3MDC6          -----------------QV--------G-Q-LK------------Q--------------
A0A1Z4KM73      -----------------QV--------G-Q-LK------------Q--------------
Q8YNX7          -----------------QV--------G-Q-LK------------Q--------------
A0A367R4K6      -----------------QV--------G-Q-LR------------Q--------------
A0A1E2WSV8      -----------------QV--------G-Q-LR------------Q--------------
A0A2R5FRT9      -----------------QV--------G-Q-LR------------Q--------------
A0A2K8T1B6      -----------------QV--------G-Q-LR------------Q--------------
A0A235I9I0      -----------------QV--------G-Q-LR------------Q--------------
A0A2D0HQT8      -----------------QV--------G-Q-LR------------Q--------------
A0A2L2NU95      -----------------QV--------G-Q-LR------------Q--------------
A0A367S084      -----------------QV--------G-Q-LR------------Q--------------
A0A0V7ZFJ4      -----------------QI--------G-E-IK------------Q--------------
A0A367RIS1      -----------------QI--------G-E-LK------------Q--------------
A0A235IXQ2      -----------------QI--------G-E-LK------------Q--------------
A0A1W5CNX3      -----------------QI--------G-E-LK------------Q--------------
A0A5Q0GJJ5      -----------------QI--------G-E-LK------------Q--------------
Q3MEB7          -----------------QI--------G-E-LK------------Q--------------
A0A1Z4KHN9      -----------------QI--------G-E-LK------------Q--------------
Q8YT70          -----------------QI--------G-E-LK------------Q--------------
A0A218Q4C1      -----------------QI--------G-E-LK------------Q--------------
A0A166IWU6      -----------------QI--------G-E-LK------------Q--------------
A0A2S0Q8C0      -----------------QI--------G-E-LK------------Q--------------
W6FSX4          -----------------QI--------G-E-LK------------Q--------------
A0A0V7ZNJ9      -----------------QV--------G-E-IK------------Q--------------
A0A0R0M9H9      -----------------QI--------G-E-LK------------Q--------------
A0A1S1ZVW2      -----------------QI--------G-E-LK------------Q--------------
A0A1B7WX82      -----------------QI--------G-E-LK------------Q--------------
A0A1B7WTD1      -----------------QI--------G-E-LK------------Q--------------
A0A480ABC0      -----------------QI--------G-E-LK------------Q--------------
A0A1Z4LRU5      -----------------QI--------G-E-LK------------Q--------------
A0A1Z4JVB4      -----------------QI--------G-D-LK------------Q--------------
K9PIA4          -----------------QM--------G-K-LK------------Q--------------
A0A1Z4HVE1      -----------------QI--------G-Q-LK------------Q--------------
A0A252ECZ1      -----------------QI--------G-K-LK------------Q--------------
A0A1Z4G5Y1      -----------------QI--------G-V-LK------------Q--------------
A0A252DNA2      -----------------QI--------G-K-LK------------Q--------------
A0A252E1Q4      -----------------QI--------G-K-LK------------Q--------------
A0A6G9SK36      -----------------QI--------G-K-LK------------Q--------------
A0A1Z4M597      -----------------QI--------G-N-LK------------Q--------------
A0A1Z4MWT1      -----------------QI--------G-N-LK------------Q--------------
A0A1Z4TX53      -----------------QI--------G-N-LK------------Q--------------
A0A5P8VSD1      -----------------QI--------G-E-LK------------Q--------------
A0A2A2TNQ5      -----------------QI--------G-E-LK------------Q--------------
A0A3S1C4K5      -----------------QI--------G-Q-LK------------Q--------------
A0A1X4G3D5      -----------------YM--------P-S-LK------------Q--------------
D4TNI2          -----------------YM--------P-D-LK------------Q--------------
A0A1Z4H6Z8      -----------------QI--------G-E-LK------------Q--------------
A0A1Z4NPM1      -----------------QI--------G-Q-LK------------Q--------------
A0A3F3KPR9      -----------------QI--------G-E-LK------------Q--------------
D4TGN7          -----------------QI--------G-E-LK------------Q--------------
A0A1Z4UZW9      -----------------HI--------G-E-LK------------Q--------------
A0A0K2M5H0      -----------------QI--------G-E-LK------------Q--------------
A0A1B7VSH4      -----------------QI--------G-E-LK------------Q--------------
A0A1B7W126      -----------------QI--------G-E-LK------------Q--------------
A0A3D4C6Q6      -----------------QI--------G-E-LK------------Q--------------
A0A1B7UVJ4      -----------------QI--------G-E-LK------------Q--------------
A0A1B7UTR1      -----------------QV--------G-E-LK------------Q--------------
K7W0A4          -----------------QV--------G-E-LK------------Q--------------
A0A5C0DRW9      -----------------QV--------G-E-LK------------Q--------------
A0A6H2C088      -----------------QV--------G-E-LK------------Q--------------
A0A2T1CIL7      -----------------QL--------G-S-LKSKLLSISDGASEQ--------------
A0A433V7A0      -----------------QF--------G-E-TH------------Q--------------
A0A2T1FTR8      -----------------QP--------S-G-IQ------------G--------------
K9UA41          -----------------QP--------S-G-IQ------------G--------------
A0A0C2LBE2      -----------------QN--------G-S-LR------------Q--------------
A0A433NN38      -----------------QI--------G-G-VR------------Q--------------
A0A2N6K0T2      -----------------QM--------G-E-VR------------Q--------------
A0A2N6ML72      -----------------QM--------G-E-VR------------Q--------------
G6FQZ6          -----------------QM--------G-E-VR------------Q--------------
A0A2N6MQX9      -----------------QM--------G-E-VR------------Q--------------
A0A2N6KXT6      -----------------QM--------G-E-VR------------Q--------------
A0A2N6KGB9      -----------------QM--------G-E-VR------------Q--------------
A0A2N6L3Y5      -----------------QM--------G-E-VR------------Q--------------
A0A0S3TIS7      -----------------QM--------G-E-VR------------Q--------------
A0A1U7GW28      -----------------QM--------G-E-VR------------Q--------------
A0A2N6LW63      -----------------QM--------G-E-VR------------Q--------------
A0A328IH74      -----------------QM--------G-E-VR------------Q--------------
A0A4D9CIB0      -----------------QM--------G-E-VR------------Q--------------
A0A1Z4TQ63      -----------------QM--------G-E-VR------------Q--------------
A0A4Q9J8G2      -----------------QM--------G-E-VR------------Q--------------
A0A1Z4SMD6      -----------------QI--------G-Q-IK------------Q--------------
A0A2H2Y096      -----------------QI--------G-Q-IK------------Q--------------
K9S8M8          -----------------QS--------G-E-LH------------R--------------
A0A1Z4NFV0      -----------------EV--------Q-G-LR------------E--------------
B0CAX4          -----------------QA--------G-E-SR------------Q--------------
A0A350Y0P6      -----------------QS--------N-E-FQ------------Q--------------
A0A352X940      -----------------QI--------G-D-LK------------E--------------
B8HTN4          -----------------QT--------G-A-SE------------Q--------------
A0A2A2TPF8      -----------------QL--------G-A-LK------------E--------------
A0A1Z4R0P8      -----------------QL--------G-G-LK------------E--------------
A0A0T7BUI3      -----------------QV--------G-K-IR------------E--------------
A0A1Z4LP32      -----------------QI--------G-D-IK------------Q--------------
K9REP9          -----------------QI--------G-E-IK------------Q--------------
A0A1Z4SIJ3      -----------------QV--------G-K-IK------------Q--------------
A0A2H2XPG4      -----------------QV--------G-K-IK------------Q--------------
K9V3C7          -----------------QI--------G-D-IK------------Q--------------
A0A1Z4T6Y7      -----------------QL--------G-Q-LK------------E--------------
A0A2H2Y561      -----------------QL--------G-Q-LK------------E--------------
A0A1Q4S362      -----------------QL--------G-Q-LK------------E--------------
A0A3S1CIN8      -----------------QL--------G-Q-LK------------E--------------
A0A2A2TC28      -----------------QI--------G-K-IK------------E--------------
A0A0C1NCB0      -----------------QL--------G-K-IK------------Q--------------
A0A2N6K7Q9      -----------------QI--------G-K-IR------------E--------------
A0A2N6MXH6      -----------------QI--------G-K-IR------------E--------------
A0A2N6M5A8      -----------------QI--------G-K-IR------------E--------------
A0A2N6LL61      -----------------QI--------G-K-IR------------E--------------
A0A0S3TP66      -----------------QI--------G-K-IR------------E--------------
G6FP91          -----------------QI--------G-K-IR------------E--------------
A0A1U7GYR5      -----------------QI--------G-K-IR------------E--------------
A0A2N6KY52      -----------------QI--------G-K-IR------------E--------------
A0A2N6KMP5      -----------------QI--------G-K-IR------------E--------------
A0A2N6MA45      -----------------QI--------G-K-IR------------E--------------
A0A4Q9J9V9      -----------------QI--------G-K-IR------------E--------------
A0A328IGA1      -----------------QI--------G-K-IR------------E--------------
A0A4D9CE41      -----------------QI--------G-K-IR------------E--------------
A0A0M0SFT2      -----------------QI--------G-K-IR------------E--------------
A0A1Z4TLC8      -----------------QI--------G-K-IR------------E--------------
A0A0C2LFH0      -----------------QI--------G-K-IK------------E--------------
A0A1Z4IYV4      -----------------QV--------G-K-IK------------E--------------
A0A1Z4Q0T6      -----------------QV--------G-K-IK------------E--------------
A0A0C2PT44      -----------------QV--------A-K-IK------------E--------------
A0A1D2P6J4      -----------------QI--------G-K-IK------------E--------------
A0A3M9ZEU1      -----------------QL--------G-T-LR------------E--------------
A0A1Z4JK72      -----------------QV--------G-D-IK------------R--------------
A0A0N7Z489      -----------------QV--------G-D-IK------------R--------------
A0A0S3TXS2      -----------------QV--------G-D-IK------------R--------------
A0A1Z4RN12      -----------------SL--------G-E-LK------------Q--------------
A0A2T1CMF9      -----------------RL--------G-E-LK------------Q--------------
Q7NDC5          NLGTGRTEPAAVPDDLPRL--------D-A-VR------------Q--------------
U5QGK3          SVAAEAQAPAT-KDNLPRL--------D-L-VR------------Q--------------
A0A2W4UY24      -----------------QA--------G-E-LE------------Q--------------
A0A2T1GMT4      -----------------KI--------G-D-LK------------Q--------------
K9UI51          -----------------KI--------G-D-LK------------Q--------------
K9QM62          -----------------QI--------G-E-LQ------------Q--------------
A0A1Z4FWI3      -----------------QI--------G-E-TK------------Q--------------
A0A1Z4JYE7      -----------------QI--------G-E-VR------------Q--------------
A0A2T1FXY4      -----------------QI--------G-E-LR------------Q--------------
K9TYI2          -----------------QI--------G-E-LR------------Q--------------
A0A1Z4QL41      -----------------QI--------G-E-LR------------Q--------------
A0A252D4T4      -----------------QI--------G-P-TK------------Q--------------
A0A252DJH5      -----------------QI--------G-P-TK------------Q--------------
A0A252EB80      -----------------QI--------G-E-TK------------Q--------------
A0A6G9SKZ9      -----------------QI--------G-E-TK------------Q--------------
A0A1Z4HPW5      -----------------QI--------G-E-TK------------Q--------------
A0A1Z4MSN1      -----------------QI--------G-E-TK------------Q--------------
A0A1Z4U1C2      -----------------QI--------G-E-TK------------Q--------------
A0A0D6KV51      -----------------QI--------G-E-TK------------Q--------------
A0A1Z4MKF8      -----------------QI--------G-E-TK------------Q--------------
A0A2C6WC43      -----------------QI--------G-E-LR------------Q--------------
A0A1Z4L5A1      -----------------QI--------G-E-LR------------Q--------------
A0A367QD86      -----------------QI--------G-E-LR------------Q--------------
A0A235IZ96      -----------------QI--------G-E-LR------------Q--------------
A0A2L2NGP0      -----------------QI--------G-E-LR------------Q--------------
A0A2K8SM78      -----------------QI--------G-E-LR------------Q--------------
A0A2R5FPC0      -----------------QI--------G-D-LR------------Q--------------
A0A5P8W5T6      -----------------QI--------G-E-LR------------Q--------------
A0A140KBA0      -----------------GL--------G-R-LK------------Q--------------
K9XSG1          -----------------GL--------G-K-LK------------Q--------------
A0A0F5YE28      -----------------QV--------P-QGQK------------N--------------
U7QEH7          -----------------QV--------P-QGQK------------N--------------
A0A3S1ATK5      IASIGSGTQFP----QGQA--------G-E-IR------------Q--------------
A0A2Z6CPH0      -----------------QI--------G-E-LR------------Q--------------
A0A1Z4GT50      -----------------QI--------G-E-LK------------Q--------------
A0A1Z4GIX0      -----------------QI--------G-E-LR------------Q--------------
A0A2H6LC24      -----------------QI--------G-E-LR------------Q--------------
B2J6N5          -----------------QI--------G-G-LK------------Q--------------
A0A367RMI4      -----------------QI--------G-E-LR------------Q--------------
A0A235HUM0      -----------------QI--------G-E-LR------------Q--------------
A0A2L2NW47      -----------------QI--------G-E-LR------------Q--------------
A0A1E2WUR1      -----------------QI--------G-E-LR------------Q--------------
A0A235IKU3      -----------------QI--------G-E-LR------------Q--------------
F4XKF3          -----------------EV--------D-Q-LK------------Q--------------
A0A1D9FX10      -----------------EV--------D-E-LK------------Q--------------
A0A1D8TNX9      -----------------EV--------D-Q-LK------------Q--------------
A0A1U7MYU6      -----------------EV--------D-Q-LK------------Q--------------
A0A3C0NJ41      -----------------QI--------G-Q-FK------------E--------------
A0A352AG88      -----------------QM--------G-D-FR------------Q--------------
A0A350Y374      -----------------QI--------G-E-FK------------N--------------
A0A355DPX0      -----------------QI--------G-E-FK------------N--------------
A0A0D8ZUV2      -----------------QI--------G-E-SK------------Q--------------
A0A433VDI0      -----------------QI--------G-E-SQ------------Q--------------
A0A3D1PG43      -----------------QM--------G-A-LK------------Q--------------
A0A2P8QQ72      -----------------EA--------G-E-LQ------------Q--------------
K9TZQ7          -----------------EA--------G-E-LQ------------Q--------------
A0A2G7GPR0      -----------------QM--------G-E-IR------------Q--------------
K9XH68          -----------------QM--------G-E-IR------------Q--------------
A0A1U7HW70      -----------------QM--------G-E-IR------------Q--------------
A0A2S6VEJ8      -----------------QM--------G-Q-IR------------Q--------------
                                                                            

K9SLA9          --------------QLISNLANLETSKYGLRSRLEALSKLHQDYQKRIDSLPKIEQQQSQ
A0A168TT23      --------------NVLAEYSNLEAEVAALEDEIAA-------NEERILALNQQGVQYNI
A0A0M1JWX9      --------------GLIQQMVAAASQIEVLKMRNQVLAQAAGMLSEYREQFPIVIRQYTD
A0A2T1M1V6      --------------AIVADLIRSQSTAQGLKQQASLLEKELDKLNNEVKFIAKNQGILIE
A0A2G7GCS2      --------------EMIAELIRSQNNAAGLQQQANQIASEINRVNAELNSITQNRSQLIN
K9XBH8          --------------DMIAELIRAQNTASGLQQQANQISSEINRVSTELNNITKNRAQLLD
A0A1Z4LJ30      --------------ALAEQMILAESQAFGMLKKAEQLQPTIDNLIKTLNGLPQKQATLLE
K9RI76          --------------SLAEQVILAESQVIGMQKKAEKLQPQIDKLSASLNSLPQKQAKLLE
A0A352AE27      --------------TLIQQLILAESTASAQQRQATQLQSQAEQLNATLKLIPGHQAKLLE
A0A3B8JH60      --------------TLIQQLATAESEASAQQRQADQLKSEIEKLNASLKALPGNQARVLE
A0A3C0N766      --------------TLIQQLATAESEASAQQRQADQLKSEIEKLNASLKALPGNQARVLE
K9W9J7          --------------TLIQQLVLAESEASGQRRQAEQLQNEIQKLSTTLRTFPANQSRLLE
A0A139WSU3      --------------ALIQQQVLAESEATAQRRQAQQLNNQITQLQTTLKSFPVNQARLVE
A0A433VN22      --------------VLIQQQLLSESEAEAQFQQARQLEKQITELQRYLNSLPAKQAQLLE
Q7NF11          --------------DLILSLLEAERAAEARSRQSAQLGRTIEQATERLSAISTRQATLLD
A0A1Z4JCS8      --------------TLIEQLVLAETNANGQQRQAEQLQQQIDQRQKILNQLPANQAKLNA
F4XTX2          --------------MLIQQLILAESAASGQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLE
Q7NJN6          --------------DLILQLVQSQAENGALTNQAARIGEKAASLEERLRTLAPQQSRLKE
U5QCC3          --------------DLILQLIQARSEGLAQNSQANQITEKIDSIDSQLRTMAPQQSKLLE
A0A3S0Y9N9      --------------GLLTNYASAEAERLSLQVRLKALAEMIQSYRQRADTIPQLELQQRQ
A0A433UNK7      --------------GLLGNYANVEAERLSLQVRLKSLAGVIESYRQRANTLPQLELQQRQ
A0A3M1SVZ4      --------------ELTQELVSLESERQGLNSQISALAQLQAGYQERLNVLPQLEQEERR
A0A654SFI6      ----------------------------AASTREREIRKKLEEAKNKFLGQQTLTIQYGI
K9SSQ0          --------------NLATQLFDTQTRLATQTAELGSLKIAQTQVEQVFAQIPQLQQTYIE
A0A2W1JIN9      --------------DLSVQLIQGKIERLSLQERLEAARGSMKQLESRRQQFPILEQWFTQ
A0A318AJV1      ---------------------SLQAQARAGDAQVASLRSTMAGLEAARARNTRNSADAER
A0A6B3MUB5      --------------ELTSRYIISNTEQLALAEKLKVLQRERAILQNHLEQLPIKQQRLTA
A0A1U7N2U4      --------------DFTSRFILAETERSALEQKLYLVQTERIKLQNRLGQIPVLQQPFGT
A0A1D9G1F2      --------------DFTSRFILAETERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFAS
F4XV38          --------------DFTSRFILAQTERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFAS
A0A2P8QIL5      --------------DLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAA
A0A2T1FLY5      --------------DLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAA
A0A433W447      --------------DLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAA
K9U1K8          --------------DLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAA
K9UYB2          --------------QLVSSLITSNIERAAIENKLTLVNASVSELRSRLNQLPAQQRPLTA
A0A218QN17      --------------ELTSKLLANETERSAIENKLTTVKAQRTQLQVQIAKLPIQQKPLIA
K9RKN2          --------------ELTSKLITNEIERLAVERKLAVVRAQTADLKARVAQLPIKQQPLTA
A0A2I8ADV2      --------------NLTTQLINNEVERVAVENKLQTVQSLRKNLQAQLAVLPLRQQPLTM
A0A1W5CKM3      --------------TLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTV
A0A5Q0GMF5      --------------TLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTV
Q3MEW0          --------------TLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTV
A0A1Z4KIC7      --------------TLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTV
Q8YSM5          --------------TLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTV
A0A1Q4S1H4      --------------TLNSQLVTNTVEGTAVANKLRTLQAERVRLQNRLAQLPIKQEPLTA
A0A433VBU6      --------------TLNSQLVTNTVEGTAIANKLRTLQAERVKLQTRLAQLPIKQEPLTA
A0A1Q4RZJ6      --------------DLTSQLITNEIERAAVAEKLQLTQNNIAQLRNRLTQLPLQQQPLTA
A0A1Z4SNV3      --------------DLTSKLITNEIERAAITDKLRVTQNNIAQLRNRLTQLPLQQQPLTA
A0A2H2XJQ1      --------------DLTSKLITNEIERAAITDKLRVTQNNIAQLRNRLTQLPLQQQPLTA
A0A3S5K358      --------------DLTSQLITNEIERAAVAQKLQLTQNNIAQLRNRLTQLPLQQQPLTA
A0A0T7BPJ4      --------------DLTAQLITNQTESLAVQKKLRVIQAERANLQARLGKLPLQQQSVAA
A0A0C1QS61      --------------NFSAQLIANDIERTAVENKLKSVQTQRANLQLRLAQLPIQQQNLTP
A0A139X3R8      --------------NFSAQLIANDIERTAVENKLKSVQAQRANLQTRFEQLPFKQQQLTP
A0A1Z4I7C5      --------------NLISELITNDITRLAVENRLNAIRQMRADIQRRLALIPIRQQPLTV
A0A0C2MDK7      --------------ELNSKFILNRIEESAVKERLTLLQKKEADLQNRLAQLPIKQQQLTI
A0A1Y0RCK1      --------------DLNSKFIVNRIEESAVNDRLKLLQTKKVNLQARLAQLPIKQQTLTV
A0A1Z4PWZ0      --------------ELNSKFILNRIEESAVNDRLKLLQTTKTDLQKRLAQLPINQQTLML
A0A0C2QLT0      --------------ELNSKFILNSIEESAVNNRLKLLQVKKANLQARLAQLPITQQTLTV
A0A1Z4J2K1      --------------ELNSKFILNSIEESAVNNRLKLLQVKKANLQARLSQLPITQQTLTV
A0A3S0ZSX0      --------------DLTSQLLVNDVERTAVENKLRVVQANRANLQTRLAELPIRQQKLTP
A0A2N6K4T3      --------------DLTSQLIINDVERLAVENKLKVVQTNRANLQARLAQLPIQQQQLTP
A0A370CKT2      --------------DLTSQLIINDVERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTP
A0A0S3TL97      --------------DLTSQLIINDVERLAQENKLKVVQTNRANLQTRLAQLPIQQQQLTP
A0A2N6M8A0      --------------DLTSQLIINDVERLALENKLKLVQTNRANLQTRLAQLPIQQQQLTP
A0A2N6M9E1      --------------DLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTP
A0A2N6KJI4      --------------DLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTP
A0A2N6MZ77      --------------DLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTP
A0A2N6KT20      --------------DLTSQLIINDVERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTP
G6FSN3          --------------DLTSQLIINDVERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTP
A0A4D9CI02      --------------DLTSELIINDVERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTP
A0A328I8B9      --------------DLTSELIVNDVERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTP
A0A4Q9J4Z7      --------------DLTSELIVNDVERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTP
A0A0M0SU69      --------------DLTSQLIVNDVERLAVEKRFRSVQAHRANLQARLAQLPIKQQQLTP
A0A1Z4TIZ8      --------------DLTSQLIVNDVERLAIENKFRSVQANRANLQTRLAQLPIKQQQLTP
A0A0S3TYD7      --------------QLVTELVMAEIEQMSLEGQVESLSGALSAQQQRASTLPRLSTRQAE
A0A3C0N2P0      --------------DLAQKLVDTQNQIQVLEVRRNKIAKAESVVGQQLTALPDIARRYTD
K9TLQ0          --------------DLTGKLIETVNLMEMTRARQWAIAQAETIVQQQMQEQATLMRQYTD
A0A6B3M6M6      --------------NLIENLVNASNQMRVLEARQTAIAKAESEMKNNLENLAVISRQYTD
A0A6B3NIJ0      --------------NLIENLVNASNQMRVLEARQTSIAKAEGEMKKNLENLAVISRQYTD
A0A352XE00      --------------EITKKLIDTKNEIQSLSVREAALERTENLMESQIKQLPIIARQYTD
B4VS56          --------------ALTQQLVETTNQINMLEVRSGAIAKAERLMSQQLKNLAVVARQYTD
A0A352AAQ3      --------------DLTQKLVETENQIQVLQVRQTEIADAESRVSQQIKELPIIARRYTD
A0A350Y472      --------------NLTQKLVETKNQIQVLEVRRNEIADAEIRLSQQLKTLPVIARRYGD
A0A355DVB4      --------------NLTQKLVETKNQIQVLEVRRNEIADAEIRLSQQLKTLPVIARRYGD
U5QL42          RSLAAAPVRQTIQQSLASQLLSTQVTLSVQKAQLASLTKAQNDIVARFKKIPQLQQQYTE
K9QF04          -------------TEIIEKLIAASNQFQALLARQKALAIAENQARRNLQQFAGIARQYAD
A0A076HBF2      -----------------NQLEAADAALSLNAGRLATARMQQATLNQQFLQQPGLIKQYEA
A0A354B169      -----------------SQLEAVDGALKLNAGRLAMARSQQQALTFQFLRQPALIKQFTD
G4FMX5          -----------------NQLEAVDAALNLNNGRLQTAQQQVAQLNAQFLKQPALIKQYEA
Q0IDT5          -----------------NQLEAVDAALGLNANRLATARAQERTLQDNFLKQPALIKQYET
A0A2D6FCW3      -----------------NQLEAVDAALNLNAGRLETAKAQETSLNNQFLKQPALIKQYEA
A3ZA21          -----------------NQLEAVDAALSLNAGRLATAQAQERQLNVQFLRQPALIKQYEA
A0A140K3H3      GASTQVSGTISTIQSLASMRSQVETEQAALQSQIAGIQQAKTKVEKTFKQIPQLQQYYAE
K9XUB8          GGSTQVSGTISTIQNLASMRLQVETEQASLQTQIAGIQRAKTQVENTFNSIPQLQQYYAE
Q7NEU3          --------------NLAAELIKAENAYRVQTARVAGLENVKNRMIGQFKVVPSLAKRYQE
A0A6H2NHD5      --------------DLMQQLVNTANQVEVLRTQDQATSQVTQQLQGEIQRLADLSRSYQQ
A0A2P8W4F7      --------------GLMQQLVNTANQMQVLQTQDQAIGQVVQQLQAEIQRLADLSRSFQQ
A0A5Q4E0Z4      --------------GLMQQLVDTANQMQVLETQDQAIGQAVQQLRAEIQRLADLSRSYQQ
A0A2P8VVX1      --------------GLVSQILEADVTLESLEARMETLASLESILRDEVNRYPSLMAEYDR
A0A2P8WHY0      --------------SLVTDLLEADVAIAGISARWESLATQEQSLRQELNRYPSWIAEYDR
A0A2T1CMT9      --------------GIANTVNDSQARLTGIRQRDLSLAQTEAALKQRLVGFPELISQYRN
A0A563VQJ3      --------------TILENFINLKIEELSLQQQLSSVSQSQQEYLKRADELPRLEKKEQE
A0A1D8TX52      --------------NLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNR
A0A1D9G4T2      --------------NLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNR
F4XP71          --------------NLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNR
A0A1U7N5X9      --------------NLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNR
A0A6B3N2I8      --------------NLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNR
A0A2W6ZAV2      ------------------KLDSIKATLAENRSEQAEVNRQALQLSRQFATNPNLVKQYEA
A0A2G7GMH8      --------------NLAGELVEAQTNLVSLQANAQSLANAEQQLSAEIQRFPTLLAQYNR
K9W742          --------------NLTNKLLELESSIRGLMAREQTLAEKEQQLRVELERFPSVLADYNR
A0A2T1DWE8      --------------TLANALVDAQVNLVALQGRAQSLNEAERSLQQQLRRFPSLLAEYGR
A0A1U7I8L3      --------------NLSSKLLEEQTNVQGWQARVQSLTQKAQQIQAELQRFPGMLSQYNR
A0A2T1DJL8      --------------KFASALVESQVNLVAAQARDRSLTNNELQLRGELKRFPSLLAEYNR
A0A1Z4J9W0      --------------KFASDLTDAQVEFFGARARDQELARTEQQLRGQLQRFPSLLAEYNR
A0A0N7Z5K9      --------------KFASDLTQAQVDFFAARARDQTLAAEAQRLQSQLQRFPTLLAEYNR
A0A0S3TXC5      --------------KFASDLTQAQVDFFAARARDQSLVAEAQRLQAQLQRFPTLLAEYNR
K9SA61          --------------NLAGQLVETQTRLQALQARGRSLSQTEQQLTGELQRFPQLLAEYGR
A0A3D1PBA3      --------------NLTNQLVDVQTNLNALRARDVSLEQTQKQLRTDLNRFPVLLAEYNR
K9XPB0          --------------NFIETITQSQADLKGLEERDRSLAQTESELREKLTQFPALIARYDS
A0A350Y7Z1      --------------TLSSQLAEAQTTLQALQARDRSLAITQQQLRAKLNRLPELMAEYER
A0A352X2A7      --------------DLSQKLAEAQSSIQGLQARDRSLAQTEQKLRTKINTLPQLMARYER
A0A0D8ZYV0      --------------NITAQLAEVQTSLSALQAQDVSLAKTEQGLRSQLNRFPKLLEEYNR
A0A2T1FP73      --------------NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNR
A0A433VMS2      --------------NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNR
K9TYA7          --------------NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNR
A0A2P8QUE1      --------------NLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNR
A0A2T1DNG3      --------------TLIGQFVETQGSLSTAQARYLSLLSSEQKVRAELQRFPQLLAQYER
B8HNB0          --------------GLTDKALEAQISLATQTAQLNGIRQAQQQVAERFQALPQLQQQYAE
A0A1Z4LN32      --------------ELISRFVNLRSQRLGLTQKIDSLSDLKNRYKQRADVIPDLEKRQKE
A0A2I8A9F5      --------------DLSLELGKLQSQRLGLEKRITSLSNLKSAYEQRLGAIPDLEKTHGE
A0A218Q6R8      --------------EIVSEFVKLKSQRLGLAEKIQSISNFRNSYSQRVSNLPSLEKRQGE
A0A218QGE0      --------------NLTSDFVRLQSQRLGLEKKVEALSAVIASYKRRAQVMPNLEKQEGD
A0A563VS48      --------------GQINEFANLGLERKGLQKRLAAFNKIYSSNQERSSILPQLEEEQKE
A0A318BJ18      -----------------AEYREAVQRENALQARVNQLKASYLDNRRR-------SIQYNI
A0A3B8Y8H9      --------------DILSSLLKAETQLEELRARQKELIGLENDIRQEIAQLARLTSEYVD
A0A2W1JVB9      --------------RATSELVRFETERLAAEQVAAALATSQTDFQQRTEAIPALEKQLRQ
A0A6H1U102      --------------GLATQLLQLETELEAQRSQLQEIRNAQGKVAVQFEQIPQLQQRYAD
A0A563VLD6      --------------SLGNQLLAAKHEIAILESQIGGTDKAKAKVENSFQDVPQLQEAYAE
A0A2P8W9H0      ----------------------------ELENRDRALSETIVTLNQTTNRLSTVTRQYNA
A0A6I5P386      ----------------------------ELSERERALSETIEALNVETKSLSTVARQYND
A0A318BG22      -------------------------QERALQVQLDQLKGSVSDLQTR-------SIQYMI
A0A1Z3HMQ0      --------------QLTSQLTEAEVNRLSLASQVQALLDSRQAYIEWSQAFPALEKRQLE
K1XF69          --------------NKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQE
B5W297          --------------NKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQE
A0A6H2AL05      --------------NKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQE
H1W7M8          --------------NKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQE
A0A5Q4H6A5      --------------NQIEEFVNAEIRRMDLTKQLDSLYEARDGLERRASILPQLEQQQQE
D5A466          --------------NKIEEFVNAEIRRMDLTKQLDSLYEARDGLERRASILPQLEQQQQE
U5QJM6          --------------SLAGDLVKAENLYLVQSARVTGLEAAKERLLGKFQLVPGLAKRYQE
A0A1Z4RPC6      --------------NQLERFISLKIDELSLQTELASLYKYQQVYLDRAKEVPRLEKEEQA
A0A2T1CMZ0      --------------NQIEKFINLKIEELSLQTELSSLYQYQQVYLNRAKQIPSLEQQEQS
L8M4F7          --------------GQLEKFIELKIQELSLRRQNLALAQAQQIASKRAQAIPKLDSKEQE
A0A140K2P2      --------------NQLEKFITLEIDKINQQRQLSSLYQTQESYLERAQKLPSLEQKEKD
K9XWX4          --------------NQLEKFITLEIDKINQQRQLSSLYQTQQSYLERAQKLPSLEQKEKD
A0A140KB14      --------------NQLEKYISLEIDRISQQRQLASLYQSQQAYLQRARQLPQIEQQQQD
K9XX88          --------------NPLEKYISLEIDRISQQRQLASLSQSQQAYLQRAKQLPQIEQQQQD
A0A563VSV6      --------------NPLEKFINLKIEELSLQQQLSSTYDYQQAYLKRAEQLPKLEQRERE
L8LZE9          --------------NPLERFISLKIDELSLQQQFASMNDYQQAYLQRAKELPRLEKEEQE
A0A433NM31      --------------KLTEDYVKTEVERIVFNNQLSALSKVYSNYKQRAGIIPQLQQKQRE
A0A1Z4NDS1      --------------KLMEDYARAEAERSGLARQLVSLQKQWLTYKQRANILPRLEQKQRE
K9F4D9          --------------DLIAEYLRLDGATSGLQQQVEELTTARLGQQSRARVIPVLEKQERA
U9VXM0          --------------ELIAEYLRLDGEQSGLQQQVEQLANARLSQQSRARVIPVLEKQERG
A0A6I5QPI5      --------------NLIAELTSLEIERIGLSNRMSQLMEARANYLERANDLPELEKQQRE
A0A433W533      --------------KLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRE
A0A2P8QWJ3      --------------KLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRE
A0A2T1FKP8      --------------KLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRE
K9U6L7          --------------KLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRE
A0A1E5QP61      --------------QLTADLVNAEVQRLGLGSNVSALVRAQGSYRDRANALPRLEQQQRD
U5DPF5          --------------QLTGDLVRAEVDRLGTSSRLSSLQREREAYQSRASVLPRLEQGQRE
A0A3M1PML8      --------------DLIGELVRLEVQRQGIVLRLNTLSEASNAYRQRASALPRLEQQQRE
A0A3M2GIL5      --------------QLLLDLVDSEVQRLGLVSQVRALEEARYSQQQRANVLPRLQEGLRE
A0A6H1TSJ9      --------------QLLLDLVDSEVQRLGLVSQVRALEEARYSQQQRANVLPRLQEGLRE
A0A0T7BPZ0      --------------ELIADIVKTERERVVLERKLAKQKSTWAKYRERANALPKLAQTQRE
A0A352X442      --------------DLAAKLVAAEVEQSGLSRQLAVLTTARIAYKERSNSLPRLQEKEKE
A0A6B3NF44      --------------ELAAALVDSQVERSGLGDHLKELQKTRTAYKTRSNALPRLEQKQRE
A0A0M0SHU3      --------------KLIEDLANTDKERAGLEKRIAELKQTWSLYKQRANILPQLEQTQRE
A0A1D2PBN3      --------------KLLEDYARSEAERVGLERQITTLSNKRSAYKQRANVLPKLEQTQRE
A0A0C2LVR7      --------------KLLEDYARSEAERVGLERQIITLSSKRSAYKQRANVLPKLEQNQRQ
A0A1Z4PQB9      --------------KLLEDYARSEAERVGLEKKIITLSSKRSAYKQRANVLPKLEQNQRQ
A0A1Z4SFN6      --------------NLIQNFATTEAERVGLSQQIATLSSKLSSYKQRVNVLPRLEQIQRQ
K9PGI8          --------------GLIADFARSEVERAGLEGEITTLSNKLSVYKKRANGLPKFEQTQRQ
A0A2T1E9V8      --------------DLITTLTKLEIDRLGLITQKTTLLKQQAFYQKKAATLPELQQQQGE
A0A3M2GQQ6      --------------SLATQLLQVETEMSAGLSQLARIRQAQQDVAIQFENIPQLQQRYAE
A0A6H1U2X0      --------------SLATQLLQVETEMSAGLSQLARIRQAQQDVAIQFENIPQLQQRYAE
K9SGJ5          --------------NLAGALFETQTTMAVQAAQMGSVKLAQERVSAIFAQIPQLQQRYTE
A0A6C2DSN4      --------------NLASQLFDAQTNLAVSQAQLESIRNAQSEVAAVFSKIPQIQQRYVE
L8MYT6          --------------NLASQLFDAQTNLAVSQAQLESIRNAQSEVAAVFSKIPQIQQRYVE
A0A352JGJ6      --------------TLATQLFEAQTSLAVNQAQLESIRGAQSEVAKAFSQIPQIQQRYIE
A0A1J5GLS2      --------------TLATQLFETQTNLAVSEAQLASIRSAQSEVSRAFSGIPQIQQRYVE
A0A2W4W6M5      --------------NLATQLFEAQTTLAVSQAQLESIRNAQAEVSSAFSKIPQIQQRYVE
A0A2W7AN33      --------------NLASQLFDAQTTLAVSQAQLQSIRNAQSEVSKAFSQIPQIQQKYVE
A0A256BLV2      --------------NLASQLFDAQTTLAVSQAQLESIRNAQSEVATAFSKIPQIQQRYVE
A0A2W6ZXF3      --------------GLATQLFETQTTLAVSEAQLESIRSAQSEVSRAFSGIPQIQQRYVE
A0A2Z5WX66      --------------TLATQLFETQTSLAVSQAQLESIRSAQAEVAKAFSQIPQIQQKYIE
K9W1T3          --------------SLITDFARASAERASLEKQIYALANVEAAYRERINTLPKLEQQQRE
A0A1Q4RTR1      --------------NLIAELVKLEVERTGLSNRISTLSNALTLYKQRATSLPRLEQNQSQ
A0A1Z4SQV2      --------------NLIAELVKLEVERTGLSNRVSTLGNAFTLYKQRAGILPRLEQNQRQ
A0A2H2XGN1      --------------NLIAELVKLEVERTGLSNRVSTLGNAFTLYKQRAGILPRLEQNQRQ
A0A433UXH8      --------------NLTAELVKLEVERTGLSNRVATLGNAFNLYKQRAKILPSLEQNQRQ
A0A1Z4RMB9      --------------NQLERFITLKIDELSRQRQVESLYQSQQEYLKRAKELPSLEKRDRE
B4WP72          --------------SLIELYLQLEVDRVGLSQRVSELSDLQGVYRRRASTLPALEKTQRE
A0A318B4H2      --------------DAEAALRAAQSKEAQFREQVANLTKNFNTQRTNL-------IEYQI
B4WQE3          --------------QLASRIRELNARDQALRESIATL-------DEQIRNLSTVTRSYNS
A0A2K3BR24      --------------DLVGDLVKAQINYLAQKSRIKGLKAEKADYQARAKILPKLEQRQRE
K9YXY1          --------------GLVGDLVKAQINYLAQKSRIKGLKAEKADYQARAKILPKLEQRQRE
A0A1U7HGH0      --------------DLISDLIAAEIERQGLISQQATLTQQQKAYLQKATNLPRLEQQQRE
K9XJD3          --------------ELISDLIAAEVERQGLISQQATLTQQQEAYLQKATHLPKLEQQQRE
K9SX01          --------------ELITQLVTKEIERVGLEKQIATINDSFIEYQKRLVNIPKLEQQLLV
A0A4P7ZT55      --------------AVASALQENAAQQAEVQRQLAQLEKAFRV------VGPELVKQYDA
A0A1E5QIR9      --------------DLMQQLVNSEVDRLVVNSQLNELLNEYAIHKQRANALPRLQESQRD
A0A1Z4IBC7      --------------SLIADITRAEAQRVGLERQITTLIQQRDAYIKRANYLPKLEQNQRE
A0A1W5CPC7      --------------SIIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRE
A0A5Q0GKD1      --------------SIIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRE
Q3MDC6          --------------SIIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRE
A0A1Z4KM73      --------------SLIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRE
Q8YNX7          --------------SLIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRE
A0A367R4K6      --------------SLIADITRAEAQGVGLERQINTLLQQRYAYARRANYLPKLEQTQRE
A0A1E2WSV8      --------------SLIADITRAQAERVGLERQIGTLLRQQDAYIKRANNLPRLEQSQRE
A0A2R5FRT9      --------------SLIADITRAQAERVGLERQIATLVRQQEAYIKRANNLPKLEQTQRE
A0A2K8T1B6      --------------SLIADITRAQAERVGLERQIATLLRQQDAYIKRANNLPKLEQSQRE
A0A235I9I0      --------------SLIADITRAQAERVGLERQIATLKEQQNAYIKRANNLPRLEQSQRE
A0A2D0HQT8      --------------SLIADITRAQAERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRE
A0A2L2NU95      --------------SLIADITRAQAERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRE
A0A367S084      --------------SLIADITRAQAERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRE
A0A0V7ZFJ4      --------------NLTAELVKSEVERLAAANRVGILRKNFITQQGRLRSLPKLEQTQRQ
A0A367RIS1      --------------TLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRTLPKLEQLQLQ
A0A235IXQ2      --------------TLTANLVQVEVEKLGLKNQVSVLMKAFLLYQARLRSLPKLEQEQLE
A0A1W5CNX3      --------------TLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQ
A0A5Q0GJJ5      --------------TLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQ
Q3MEB7          --------------TLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQ
A0A1Z4KHN9      --------------ALTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQ
Q8YT70          --------------ALTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQ
A0A218Q4C1      --------------ALTANLVQVEVERLGLENQVDVLTQAFTFDQVRLRSLPRLEQQQLQ
A0A166IWU6      --------------ALTANLVQVEVERLGLENQVGVLTNAFKQDRARLRILPKLQQQELQ
A0A2S0Q8C0      --------------ALTANLVQVEVERLGLENQVGVLTNAFKQDRARLKILPKLEQQQLQ
W6FSX4          --------------ALTANLVQVEVERLGLENQVGVLTNAFKQDRARLKILPKLEQQQLQ
A0A0V7ZNJ9      --------------TLTSELLKSEVERLAVAKQVGVLRKAFALQQARLTVLPKLEQQQRQ
A0A0R0M9H9      --------------GLTQDLVRSEVERLALANQVKALQSVFIINRRRLDSLPRLEQQQLQ
A0A1S1ZVW2      --------------ALTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQ
A0A1B7WX82      --------------SLTEALVKSEVERLALTNKIGELQRVFIVNRRRLDSLPRLEQQQLQ
A0A1B7WTD1      --------------ALTQDLVKSEVERLALTNQVGELRKVFMVNKSRLDSLPRLEQQQLQ
A0A480ABC0      --------------ALTQDLVKSEVERLALTNQVGELRKVFIVNKSRLDSLPRLEQQQLQ
A0A1Z4LRU5      --------------SLTAELIKSEVERLAATNRVGLLRKAFVSNQARLSVLPKLEQQQRQ
A0A1Z4JVB4      --------------NLSQDLVKAEVERLALANRVMELQRAYLLNKRRLDILPALEQQQLQ
K9PIA4          --------------TLTTDLVKSEVERLALARQLADLQQTFILSQKRLNSLPRLEQQQLQ
A0A1Z4HVE1      --------------ILSQDLVKAEVERLALAKRVAELRQAYLINQRRLDILPRLEQQQLQ
A0A252ECZ1      --------------NLTEELVKSEVNRLAITNRLAELRQVYIVNQRRLDILPRLEQQQLQ
A0A1Z4G5Y1      --------------NLTEALVKSEVDRLAFTNRVATLRQVYLTNQRRLDILPRLEQQQLQ
A0A252DNA2      --------------NLTEELVKSEVDRLAVANRLAELRQVYVVNQRRLDILPRLEQQQLQ
A0A252E1Q4      --------------NLTEELVKSEVDRLAVANRLAELRQVYVVNQRRLDILPRLEQQQLQ
A0A6G9SK36      --------------TLTEELVKSEVERLALANQVGELQQTFIVNKERLDSLPRLEQQQLQ
A0A1Z4M597      --------------TLTENLVKSEVERLALTNQVAELKQVLLVNKNRLDSLPRLEQQQLQ
A0A1Z4MWT1      --------------TLTENLVKSEVERLALTNQVAELQQVLIVNKNRLDSLPRLEQQQLQ
A0A1Z4TX53      --------------TLTENLVKSEVERLALTNQVAELQQVLIVNKNRLDSLPRLEQQQLQ
A0A5P8VSD1      --------------TLTANLVQLEVQRLGLENQVGVLRKDFVLYQARIRSLPKLEQLQLQ
A0A2A2TNQ5      --------------SLTGELVKSEVERLAALQRVQVLRNAYITYETRMRQLPKLEQRQRG
A0A3S1C4K5      --------------TLTLDLVKSEVDRLAVNNQVQVLQTAYLNYQGRLTAIPRLEQQQRA
A0A1X4G3D5      --------------GLTEELVKSEIEKLTLSSNINALQNVLSIYKRRLTSLPRLGQQEAR
D4TNI2          --------------GLTEELVKSEIEKLTLSSNINALQNVLSIYKRRLTSLPRLGQQEAR
A0A1Z4H6Z8      --------------TLSEDLVKSEVEGLALQNRVAELRKAFIINKSRLDILPRLEQQQLQ
A0A1Z4NPM1      --------------SLTADLVRAEADRLAAEQQVQVLSRALTDYQNRLAALPKLQQRQRA
A0A3F3KPR9      --------------GLTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQ
D4TGN7          --------------GLTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQ
A0A1Z4UZW9      --------------SLTQDLVKSEVERLALTKQVEELQRVFIVNRRRLDSLPRLEQQQLQ
A0A0K2M5H0      --------------ALTQDLVKSEVERLALTKQIEELQRVFIVNRRRLDSLPRLEQQQQQ
A0A1B7VSH4      --------------TLTQDLVKSEVERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQ
A0A1B7W126      --------------TLTQDLVKSEVERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQ
A0A3D4C6Q6      --------------TLTQDLVKSEVERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQ
A0A1B7UVJ4      --------------SLTQELVKSEVERLALTNKIGELQRVFIVKRRRLDSLPRLEQQQLQ
A0A1B7UTR1      --------------ALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQ
K7W0A4          --------------ALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQ
A0A5C0DRW9      --------------ALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQ
A0A6H2C088      --------------ALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQ
A0A2T1CIL7      --------------KMVAEYANLGVERSGLLGKLAELESNLQVRQQNLEKLPLLEKQQRE
A0A433V7A0      --------------KLLEELVKTQAKNLSLSSRLTSLENAKVRSQRRVSNIPKLEKDQRE
A0A2T1FTR8      --------------NLIADYAKSEAQRTSLQKQIAALVYVVDAYKQRMNALPKLEQQQNA
K9UA41          --------------NLIADYAKSEAQRTSLQKQIAALVYVVDAYKQRMNALPKLEQQQNA
A0A0C2LBE2      --------------KLLEDYAGTEAQRVGLVKQIATLSNQRTVYKERANILPKLEQTQRE
A0A433NN38      --------------NLIQDLANTEKVRLGLEKQIADLNNTLFEYKQRANILPKLEETQRE
A0A2N6K0T2      --------------RLIEDLANTEKERVGLERRIAELTNTWSVYKQRANVLPKLEQTQRE
A0A2N6ML72      --------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRE
G6FQZ6          --------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRE
A0A2N6MQX9      --------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRE
A0A2N6KXT6      --------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRE
A0A2N6KGB9      --------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRE
A0A2N6L3Y5      --------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRE
A0A0S3TIS7      --------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRE
A0A1U7GW28      --------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRE
A0A2N6LW63      --------------KLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRE
A0A328IH74      --------------KLIEDLANTDKERAGLEKRIADLRNTWSLYKQRANTLPRLEQTQRE
A0A4D9CIB0      --------------KLIEDLANTDKERAGLEQRIADLRNTWSLYKQRANVLPRLEQTQRE
A0A1Z4TQ63      --------------KLIEDLANTDKERAGLEKRLADLRNTWSLYKQRANIMPRLEQTQRE
A0A4Q9J8G2      --------------KLIEDLASTDKERAGLEKRIADLRNTWSLYKQRANTLPRLEQTQRE
A0A1Z4SMD6      --------------NLASQLSQLQTQRQGLEKKILALSNIRDSYKQRLSILPNLEKKQGD
A0A2H2Y096      --------------NLASQLSQLQTQRQGLEKKILALSNIRDSYKQRLSILPNLEKKQGD
K9S8M8          --------------TLTNNLVETENQRRGLREQVTALRESQVQYQQRANVLPQLEQRQRD
A0A1Z4NFV0      --------------KLLNEYVQLQAQQAGLASRVQELSNLHRIYRQRTTIIPNLEKRQGD
B0CAX4          --------------SLTDALVEAEVERLGLEKQVLSLAQTQAENKRRQGIIPKLEQQLIA
A0A350Y0P6      --------------QMMATLVNAEAERLSLAQRVASLEQTKLTYKRRANILPKLQEGLRD
A0A352X940      --------------SMTKDLVKAEVERLGFVRQAAYLERAKLAYQQRANLLPRLQEGLRD
B8HTN4          --------------QLVDNFINAEVERLALSSQVTSLSRTEQTYQQRMNALPKLEQWLGE
A0A2A2TPF8      --------------QLLGESVRLQAQRLGFENKVQTLTNLHQEYKKRANILPNLEKKQGD
A0A1Z4R0P8      --------------QLVGESVRLQAQRLGLANKVQTLTNLHQIYKRRANVLPNLEKKQGD
A0A0T7BUI3      --------------DLANQYVQLKTKRQGLQKKIAALQGVQQIYQKRLNAIPNLEKKQSD
A0A1Z4LP32      --------------NLVNQLVQLQTQKDGLQNKLATLNNIKNDYQRKLAILPNLEKRQQD
K9REP9          --------------SLVNQLVQVQTQKDGLQTKLQTLTNIRDNYQQKLAILPNLEKQQTE
A0A1Z4SIJ3      --------------DLAVQYLQFQGQRQGLEKKIRAMEAVQANYQQRLNVIPNLEKNLGD
A0A2H2XPG4      --------------DLAVQYLQFQGQRQGLEKKIRAMEAVQANYQQRLNVIPNLEKNLGD
K9V3C7          --------------DLANQYVSLQSQRAGLEEKVQTLSSLHEAYKRRANIFPNLEKQQGE
A0A1Z4T6Y7      --------------QLVGESVRLQAQRLGLENKVQTLSGLHEQFKQRAEVLPNLEKKQGD
A0A2H2Y561      --------------QLVGESVRLQAQRLGLENKVQTLSGLHEQFKQRAEVLPNLEKKQGD
A0A1Q4S362      --------------QLVGESVRLQAQRLGLESKVQTLSGIYEQFKQRAQVLPNLEKKQGD
A0A3S1CIN8      --------------QLVGESVRLQAQRLGLESKVQTLSGLHQQFRQRAQVLPNLEKKQGD
A0A2A2TC28      --------------DLASQYVQLLAQRQGLEKKVQTLLNIREGYQRKLSILPNLDKLQTD
A0A0C1NCB0      --------------DMTVEYANLEKKRQGLEEKIKSLSDIRNGYKQRLTVMPNLEKKHGD
A0A2N6K7Q9      --------------ELTDKYVELKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQA
A0A2N6MXH6      --------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQA
A0A2N6M5A8      --------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQA
A0A2N6LL61      --------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQA
A0A0S3TP66      --------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQA
G6FP91          --------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQA
A0A1U7GYR5      --------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMVPSLEKKQQA
A0A2N6KY52      --------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQA
A0A2N6KMP5      --------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQA
A0A2N6MA45      --------------ELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQA
A0A4Q9J9V9      --------------SLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQS
A0A328IGA1      --------------SLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQS
A0A4D9CE41      --------------SLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQS
A0A0M0SFT2      --------------NLVDNYVQLKAERQGLEKKFRTLSNIRANYQQQLAVMPSLEKQQQG
A0A1Z4TLC8      --------------EMVGNYVQLKAERQGLEKKFRTLSNIRANYQQQLAVMPSLEKQQQG
A0A0C2LFH0      --------------NLTTQYALIQAQRQGLENKIQALSNIRGTYKQRLSALPNLEKKQGD
A0A1Z4IYV4      --------------NLTSEFAKIQAQRQGLESKIQALSNIQASYKQRLAMMPNLEKKQGD
A0A1Z4Q0T6      --------------NLTSEFARIQAQRQGLESKIQALSNIQASYKQRLAMMPNLEKKQGD
A0A0C2PT44      --------------NLTSEFAKIQAQRQGLESKIQALSKIQASYKERLAMMPNLEKKQGD
A0A1D2P6J4      --------------NLTSEFAKVQAQRQGLESKIEALSNIQASYKQRLAMMPNLEKKQGD
A0A3M9ZEU1      --------------TLTANLIDAEVERISLLGQTQTLRNTLSAYRQRASTLPKLAQTQGE
A0A1Z4JK72      --------------KLAESLATLQSQKLGLEGRVGTLAGLQSSFRSRMAATPTLVKQQSE
A0A0N7Z489      --------------NLAAALSTLQSQRAGLEGRITTLSGLLINYSSRAARTPALIQQESE
A0A0S3TXS2      --------------NLAAALSTLQSQRIGLEGRISTLAGLLANYRSRAAQTPALIQQEGE
A0A1Z4RN12      --------------SQLAEFAELGLQKEGLDKRLASLRSNYNNYQQRSDNLPQLQEQQRE
A0A2T1CMF9      --------------GQLTEFADLGLRKEGLEQRLASLKNSYNNYQKRSNLSPQLEEQQRQ
Q7NDC5          --------------QLLKDLIAARVEELAARTRTEALARVSAEYDARVAALPRLEESQRR
U5QGK3          --------------KLLKDLVDARVEELAARTRTDALNSVSERYSSQVAAMPRLEETQRQ
A0A2W4UY24      --------------SLILSFLQLDAERAGLQQRLNQLTSAQAAQQSRAQLLPGLEKRNRE
A0A2T1GMT4      --------------NLITELLRSQVQQTGLVNKLNSLQSSRAAYEKRVSVIPKLVQTQRQ
K9UI51          --------------NLITELLRSQVQQTGLVNKLNSLQSSRAAYEKRVSVIPKLVQTQRQ
K9QM62          --------------GLITDFLRSEVQRLGLAQRLTSLSNSRATYEQRMQKMPQLEQTLRE
A0A1Z4FWI3      --------------NLINTFLQAEVQRQGLAQKLTSLYNSRGAYEKRVKVIPQLEQQQRE
A0A1Z4JYE7      --------------NLINNFLQLELQSTGLNQKLNSLLNTRSAHEKRMQILPKLAQQQRQ
A0A2T1FXY4      --------------DLIENLLQSDVQRRSLAQKLASLSNSRSTYEQRKNIIPQLVQNQHE
K9TYI2          --------------DLIENLLQSDVQRRSLAQKLASLSNSRSTYEQRKNIIPQLVQNQQE
A0A1Z4QL41      --------------KLIQDFLQSEVQRIGLAKRLASLYNSRSAYEQRTKIIPRLAQTQSE
A0A252D4T4      --------------DLIKEFLQSEVQRQGLAQKLNSLYNSRSIYEQRVKIIPQLEQQQRE
A0A252DJH5      --------------DLIKEFLQSEVQRQGLAQKLNSLYNSRSIYEQRVKIIPQLEQQQRE
A0A252EB80      --------------NLIRDFLQSEVQRQGLAQKLSSLYNSRSTYEQRVKIIPQLEQQQRE
A0A6G9SKZ9      --------------NLIRDFLQSEVQRRGFEQKLTSLYNSRSVYEQRVKIIPQLEQQQRD
A0A1Z4HPW5      --------------NLIREFLQSDVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRD
A0A1Z4MSN1      --------------NLIRDFLQSDVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRD
A0A1Z4U1C2      --------------NLIRDFLQSDVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRD
A0A0D6KV51      --------------NLIRDFLQSEVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRD
A0A1Z4MKF8      --------------NLIRDFLQSEVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRD
A0A2C6WC43      --------------TLIQDFLQSEVQRFGLSQRLASLYNSRTNYQKRVQVIPQLIQNQRE
A0A1Z4L5A1      --------------NLIRDFLQSEVQRFGLSQRLASLYNSRSNYQKRVQVIPQLIQNQRE
A0A367QD86      --------------NLIQDFLQSEVQRYGLSQRLASLYNSRSNYQKRVQVIPQLIQNQRE
A0A235IZ96      --------------GLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRE
A0A2L2NGP0      --------------GLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRE
A0A2K8SM78      --------------NLIQNFLQSEIQRFGLAKRLSSLSNSRSTYEQRVKIIPQLAQNQRE
A0A2R5FPC0      --------------NLIQSFLQSEIQRFGLAKRLSSLSNSRFTYEQRVKIIPQLAQNQRE
A0A5P8W5T6      --------------NLIQSFLQSEVQRFGLAKRLSSLSNSRLAYEQRVKIIPQLAQNQRE
A0A140KBA0      --------------EQISEFASLGLKKTGLEQKLANLKQTKTDYQQRLSVLPNLEKRQKE
K9XSG1          --------------EQISEFANLGLQKTGLEQKLANLKQTKTNYQQRLAVLPNLEKRQKE
A0A0F5YE28      --------------NQLERFIANEIQRVELTRQLDSLYASRINYEQRSQNLPQLEQEQQE
U7QEH7          --------------NQLERFIANEIQRVELTRQLESLYTSRRNYEQRSQNLPQLEQEQQE
A0A3S1ATK5      --------------KFIQDFLQVEVQRIGLSKRLASLYNSRSGYQRRVKIIPMLVQNQRD
A0A2Z6CPH0      --------------NLIQNFLQLEVQSFGFKQRLASLYNSRSVYERRMRFIPQLIQTQHE
A0A1Z4GT50      --------------NLIKDFLQSEVQRNGLTKKLASLYNSRSAYEQRLKIIPLLVQNQRE
A0A1Z4GIX0      --------------TLIQNFLQLEVQRFGLTNRLASLYNSRSAYERRMKVIPQLAQTQRE
A0A2H6LC24      --------------TLIQNFLQLEVQRFGLTNRLASLYNSRSAYGRRMKIIPQLAQTQRE
B2J6N5          --------------NLIQNFLQSEIQRIGLAKRLSSLYNSRSIYEKRVKLIPQLAQNQRE
A0A367RMI4      --------------SLIQNFLQSEIQRFGLTQRLSSLYNSRVSYEQRVKLIPQLAQNQRE
A0A235HUM0      --------------SLIQNFLQSEIQRFGLTQRLSSLYNSRVSYEQRVKLIPQLAQNQRE
A0A2L2NW47      --------------SLIQNFLQSEIQRFGLTQRLSSLYNSRVKYEQRVKLIPQLAQNQRE
A0A1E2WUR1      --------------NLIQNFLQSEIQRFGLTQRLSSLYNSRSTYEQRVKLIPQLAQNQRE
A0A235IKU3      --------------GLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRE
F4XKF3          --------------KLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQ
A0A1D9FX10      --------------KLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQ
A0A1D8TNX9      --------------KLINDFIESEVKRQSLAEGLATLAKARIGYEQRVNVLPRLEQTQQQ
A0A1U7MYU6      --------------KLISDFIESEVKRRSLAEGLATLAKARIAYEQRVNVLPRLEQTQQQ
A0A3C0NJ41      --------------QLTSDFVKAEVERLGLANRLTQLSNTRSAYKQRLSILPKLEKEQRE
A0A352AG88      --------------ELTLNLVNAEVERLGLASQLNELENVRLAYQQRLTILPKLEKDQRE
A0A350Y374      --------------QLIKDFVNSEVNRLGLKSKLDQLTNSRLIYKQRLNTLPKLEKEQRE
A0A355DPX0      --------------QLIKDFVNSEVNRLGLKSKLDQLTNARLIYKQRLNTLPKLEKEQRE
A0A0D8ZUV2      --------------KLNEELVQSEAERLGLAKQLALLSSTQDTYKQRANVFPKLEQNQRE
A0A433VDI0      --------------KLNEALVKLEEERSGLTSQLAELSNAQATYKQRVSILPKLEQEQRE
A0A3D1PG43      --------------KLTEDFATSEVERLSLSSRLAYLSKNLSAYKQRANVIPKLEQQQQE
A0A2P8QQ72      --------------KLAEDLVRAEVERLSLSNRLKFLAQARTNYRQRATVLPQLEQQQRE
K9TZQ7          --------------KLAEDLVRAEVERLSLSNRLKFLAQARTNYRQRATVLPQLEQQQRE
A0A2G7GPR0      --------------ELTQNYVNSEIQRLGLTSRLSSLNNTYSAYRQRINVLPRLEQTQRE
K9XH68          --------------ELTQNYVNSEIQRLGLTSRLNSLNNTYNAYRQRVNVLPRLEQTQRE
A0A1U7HW70      --------------ELTQNYVNSEIQRLGLTSRLNSLNNTYNAYRQRVNVLPRLEQTQRE
A0A2S6VEJ8      --------------ELTQNYVNSEIQRLGLVSRLNSLNNTYNAYRQRANVLPRLEQTQRE
                                                                            

K9SLA9          LERDLTLARVNYDHLLQQQTSLRSQLRQISAGARIVSPATIP--T--N--AIAPNIPL--
A0A168TT23      LRREFETNRELYDGMLQRLKEIGVAAGAQENNIAVIDSALRP--G--Y--PVLPDISR--
A0A0M1JWX9      LMRELEVASQTLNQLLAQREQLRLEAAQSETPWEIIALPEIPRNEDGELIPFSPNLLR--
A0A2T1M1V6      LQRKYEIAEGVYKGIIAQLSQNKINAFDAYPNVQLIDGPSLN--P--K--PLTASRKL--
A0A2G7GCS2      LQRQYEIAEGVYKSILGQVEQTKTNPFSVYPNVQTLDAPVID--P--K--PEEPSKRA--
K9XBH8          LQRRYEIAEGVYKSIIAQVEQAKTNPFNVYPNVQTLDAPTID--P--K--PEEPSRRV--
A0A1Z4LJ30      LQRQYDIAEGVYNGVVAQAEQAKLGSFSAYPSVQVLDQPIMD--T--K--PVGPKLRL--
K9RI76          LQRQYDIAEGVYNGVVAQIEQAKLGAFSAYPSVQVLDKPMVD--N--K--PSGPKLKL--
A0A352AE27      LKRQYEVAEGVYKGLVAQIQKVNIDAFNAYPNVQVLDPPTVS--S--N--PTDPKKTL--
A0A3B8JH60      LQRQVDVAEGVYKGLVAQVQKNNIDAFNTYPNVQVLDSPTVD--P--K--PSSPKKLL--
A0A3C0N766      LQRQVDVAEGVYKGLVAQVQKNNIDAFNTYPNVQVLDSPTVD--P--K--PSSPKKLL--
K9W9J7          LQRQVDVAEGIYKGLVAQVQQNNIDAFDTYPNVQVLDPAKVD--S--K--PSGPKRSI--
A0A139WSU3      LQRQVDVTEGVYKGLIAQIQQSNIDAFDAYPNIQVLDAPQVD--P--K--PVSPKFLL--
A0A433VN22      LQRQLDVAEGIYKGLVAQVQQKSVDAFDAYPNVQVLDPPRVN--S--K--PISPKLFL--
Q7NF11          LQRRYELAEAAYKAIVAQMQQARLSAFNAFPDIEVLDKAYSN--P--K--EANPRTLL--
A0A1Z4JCS8      LQRQADVAEGVYKGLVAQTQQSNIDAFNAYPNIQELNAPFVD--A--K--PSSPKKSL--
F4XTX2          LTRQYDVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVD--E--K--PAGPKKLL--
Q7NJN6          LQRRYEIAEGIYRGLVAQVQQAKVNAFDAYPNVQILDAPSVD--S--K--PS-PSGLL--
U5QCC3          LNRRYGIAEGVYKAMLAQVQQAKINAFDTYPNVQVLDPPAVD--P--K--PS-PRLFL--
A0A3S0Y9N9      LEREISATESSYQTLLARYQELQVAENLQVSNARVITPALIP--T--V--PIKSRQYI--
A0A433UNK7      LEREIAATDLSYQNLLARYQELQVAENLQVSNARIVTPALIP--G--V--PIRSRQYI--
A0A3M1SVZ4      LERQLELAQATYSQLQQKLQEVRLAESQSLGNASLVSPALVP--D--K--P-ISKKSL--
A0A654SFI6      LKREVETNRQIYDALLQRYKELGAAGAGQ-NNIKLIDKADAP--L--F--PYAPSLLQ--
K9SSQ0          LQRQLKQASTRLSTLSQKLEEAKSQEVQEATAWQILQSPSLP--S--Y--PSSPNVIL--
A0A2W1JIN9      MDRRREALFNSIQLLERKLDEVRVAEAQLLSNFRILDLSEPS--G--K--PSDPNIPV--
A0A318AJV1      LERDAASARAQFDKMSAMSLESTQAAHAAIAQAQIIDRADPP--V--S--PAPPGKVL--
A0A6B3MUB5      LVRQREEATESLKFLQNKLEEARIAEAQLVSNIRIIAEAQVP--S--L--PSEPNKKV--
A0A1U7N2U4      LVRRQDEAIASLKLLQNKLEEARIAETQLVNNIQIIERAKLP--S--S--PKEPNPKV--
A0A1D9G1F2      LVRRQEEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--S--S--PKEPNPKV--
F4XV38          LVRRQEEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--S--S--PQEPNPKV--
A0A2P8QIL5      LVRQRQEAVTSLEFLQRKLEEARIAEAQKVSNLRPVDLAEPP--R--L--PTWPNPAI--
A0A2T1FLY5      LVRQRQEAVTSLEFLQRKLEEARIAEAQKVSNLRPVDLAEPP--R--L--PTWPNPAI--
A0A433W447      LVRQRQEAVTSLEFLQRKLEEARIAEAQKVSNLRPVDLAEPP--R--L--PTWPNPAI--
K9U1K8          LVRQRQEAVTSLEFLQRKLEEARIAEAQKVSNLRPVDLAEPP--R--L--PTWPNPAI--
K9UYB2          LTRKREETATSLKFLQDKLEEARIAEAQKVSNILIIDPAKPA--T--I--PASPKIAV--
A0A218QN17      LTREREDATASLKSLQSKLEEARITEAQKVSNLRLIEAAKPP--T--I--ASSPKRSA--
K9RKN2          LVRQREESASTLKFLQGKLEEARLAQAQKVSNIRIIESATVP--E--S--PSSPKKPV--
A0A2I8ADV2      LTRQREEAAESLKLLQSKLEEARIAEAQKVSNLRIIELALVP--T--D--YAYPKRSV--
A0A1W5CKM3      LTRQREEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--E--L--PTSPKRTV--
A0A5Q0GMF5      LTRQREEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--E--L--PTSPKRTV--
Q3MEW0          LTRQREEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--E--L--PTSPKRTV--
A0A1Z4KIC7      LTRQREEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--E--L--PTSPKRTV--
Q8YSM5          LTRQREEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--E--L--PTSPKRTV--
A0A1Q4S1H4      LTRAREEAAESFKGLQRKLEEARIAEAQKVSNIRIIEVANVP--T--L--PSEPQPAI--
A0A433VBU6      LTRTREQAAESFKALERKLEEARIAEAQKVSNIRVIEVATVP--T--V--PSTPKSTI--
A0A1Q4RZJ6      LIRKREEAAASLKFLQAKFEEARIAEAQKVSTLQVIQAAKAA--S--I--ASSPKPNV--
A0A1Z4SNV3      LVRKREEAAASLKFLQAKFEEARIAEAQKVSNLQVIQVAQPP--T--E--ASSPKPKV--
A0A2H2XJQ1      LVRKREEAAASLKFLQAKFEEARIAEAQKVSNLQVIQVAQPP--T--E--ASSPKPKV--
A0A3S5K358      LIRKREEAAASLKFLQAKFEEARIAEAQKVSTLQVIQAAKAA--S--F--ASSPKPNV--
A0A0T7BPJ4      LTRKREEAAESLKTLQRKLEEARIAEAQKVSNLSIIEFAKPG--T--S--PSSPKIPV--
A0A0C1QS61      LTRQREEAAETLKLLQGKYEEARIAEAQQVGNLRIIEEAQPP--T--S--ATSPKKPA--
A0A139X3R8      LTRQREEAAETLKLLQSKYEEARIAEAQQVGNIRIIEEALPP--T--V--ATSPRRSS--
A0A1Z4I7C5      LTRQREEAAESLKFLQSKLEEAQIAEAQKVSNIRILETAVVP--E--L--PSSPKRNV--
A0A0C2MDK7      LTRKREEAAASLKFLQGKLEEARLTEAQKVSNIRAIENAVAP--S--S--PSQPKQKV--
A0A1Y0RCK1      LTRKREEAAASLKFLQSKLEEARLTEAQKVSNIRVIENAVAP--S--S--PSEPKQKV--
A0A1Z4PWZ0      LTRKREEAAVSLKFLQSKLEEARLTEAQKVSNIRVIENAVPA--S--S--PSDPKPNV--
A0A0C2QLT0      LTRKREEAAASLKFLQSKLEEARLTEAQKVSNIRVIENAVAP--S--S--PSEPKPKV--
A0A1Z4J2K1      LTRKREEAAASLKFLQSKLEEARLTEAQKVSNIRVIENAVAP--S--S--PSEPKPKV--
A0A3S0ZSX0      LIRQREESAASLKLLQSKLEEARIAEAQLVGNIQIIEAAQIP--L--K--PTSPHKKA--
A0A2N6K4T3      LTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--T--K--PSLPNKRS--
A0A370CKT2      LTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--T--Q--PSLPNKRT--
A0A0S3TL97      LTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--T--K--PSLPNKRT--
A0A2N6M8A0      LTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--K--K--PSLPNKRS--
A0A2N6M9E1      LTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--T--Q--PSLPNKRT--
A0A2N6KJI4      LTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--T--K--PSLPNKRT--
A0A2N6MZ77      LTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--T--K--PSLPNKRT--
A0A2N6KT20      LTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--T--Q--PSLPNKRT--
G6FSN3          LTRQREESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--T--Q--PSLPNKRT--
A0A4D9CI02      LTRKREEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--K--K--PSLPNKKA--
A0A328I8B9      LTRKREEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--K--K--PSLPNKKA--
A0A4Q9J4Z7      LTRKREEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--K--K--PSLPNKKA--
A0A0M0SU69      LTRKREEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--K--E--PSLPNKKA--
A0A1Z4TIZ8      LTRKREEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--K--E--PSLPNKKA--
A0A0S3TYD7      LERRLRASQSTYESLLSKLQEIQVAEQQQLGNARITSKALIP--E--K--PTLLTSALGR
A0A3C0N2P0      LQQQLKVATESLGRFLTVQETLQVEKARTSTSWKKISGPQKP--Q--A--PISPNVPR--
K9TLQ0          LQRELELGTESLNRFLAVRENLQIESAQKAMPWQLISQPEVG--T--V--PISPNLSR--
A0A6B3M6M6      LQRQLKVSTESLNRFLAVRETLEIESAQKTLPWQVIRKPQQP--Q--E--PISPNVPR--
A0A6B3NIJ0      LQRQLKVSTESLNRFLAVRETLEIESAQKTLPWQVIRKPQQP--Q--E--PISPNVPR--
A0A352XE00      LQRELKVATESLNRFLAVRETLQIESAQKTLPWQLIAPPQTP--I--K--PISPNVPR--
B4VS56          LQRELKVATESLNRFLAVRETLQIEAAQKTLPWQLIAEPQQP--Q--A--PISPNIPH--
A0A352AAQ3      LNRRLNVATESLSRFLAVREKLQIEESQKTPPWQKLSDPQKP--Q--T--PISPNVPR--
A0A350Y472      LQRRLTVATESLNRFLAVQEKLQIDESQKTPPWQQLSQPQKP--Q--Q--PISPNIPR--
A0A355DVB4      LQRRLTVATESLNRFLAVQEKLQIDESQKTPPWQQLSQPQKP--Q--Q--PISPNIPR--
U5QL42          LQRDYNVNSQIVNGLLTKLEELRITEAQETSPWRVLEPPDLP--D--T--PVSPKIDQ--
K9QF04          LSRDLEIANQSLNRFLVAKENLQIETARKVPPWQVISRIEAP--N--K--PISPNPVR--
A0A076HBF2      LQQRLEIAKQNLAGLVSAREKFQLEIAQRSVPWRVIAEPTIN--P--K--PIKPSVPR--
A0A354B169      IMQDLKIAEENLAGLVSARENFQLEMAQRSVPWRVIAPPQIN--P--R--PIEPSISR--
G4FMX5          LQTRLTIANQNLAGLVSARENFQLEIAQRSVPWRVIDPPEIN--P--N--PIKPSIPR--
Q0IDT5          LQTKLTLAQENLSGLVSARETFRLESAQSSVPWRVIDPPEID--P--N--PIKPSIPR--
A0A2D6FCW3      LQTRLKIAQENLTGLVTARENFQLEIAQRSVPWRVIDPPEIN--P--N--PIKPSIPR--
A3ZA21          LQTRLKIAQDNLAGLVSARENFQLEIAQRSVPWRVIDPPKIN--P--D--PIQPSVPR--
A0A140K3H3      VKRQFDIKSKAVDYLMQRRQELYIEQAQENAPWQILEAPPLP--S--I--PISPNLER--
K9XUB8          LTRQFEVKSGAVNYLMQRRQELDINKAQENAPWQILEAPRLP--N--V--PISPNLQR--
Q7NEU3          LVRDSNLASNSLNRLLERLQELRIQAAQELSPWRVIEPAAIP--E--K--PIWPKPLL--
A0A6H2NHD5      IARELAVTEDSLNQLLASRQDLRFKMAQQTSPWQLVSPLDQA--S--V--VPVTNLPR--
A0A2P8W4F7      IDRELTVAESSLNQLLASRQELRLQMARQASPWEIISPLSES--S--I--TQTTNLPR--
A0A5Q4E0Z4      ITRELTVAESSLDQLLTSRQDMRLQMARQTAPWELISPLDES--S--I--TEMTNLPR--
A0A2P8VVX1      LQPAVDTERSTLQELLIQREQISAELSRGGFSWEVVEPPLPG--Q--R--IG-PDPVR--
A0A2P8WHY0      LQPRVEIERATLQDLLLQREQISAELARGGFDWQIVEPPDVG--D--Q--IG-PDPLR--
A0A2T1CMT9      LTQESEIKRQAVQRLLEAKQKLEIELSRGGNNWQVIEPPQAG--L--Q--IA-PNLAK--
A0A563VQJ3      LMRKADTANKTYTALLESLQQARLAENQQTGNVDIIEEAIAP--E--T--GS-SGRMA--
A0A1D8TX52      LQPQVAIKQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--F--K--TG-PNMTQ--
A0A1D9G4T2      LQPQVAIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--F--K--TG-PNMTQ--
F4XP71          LQPQVAIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--S--K--TG-PNMTQ--
A0A1U7N5X9      LQPQVAIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--L--K--TG-PNMTQ--
A0A6B3N2I8      LQPQVAIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--S--K--TG-PNMTQ--
A0A2W6ZAV2      IEQRLEIARANLSTYIKTREDFRLEVAQRTRPWRIISPPEFE--D--T--PDKPNLRN--
A0A2G7GMH8      LLPEVSVNRETLQQLMTARQELGLQLARGGFDWQVVEQPGIG--E--Q--IS-PSIKR--
K9W742          LQPEIKLKRETLDQLEKARQELSLEIARGGFDWQVVEQPLLG--E--K--TG-PKKAQ--
A0A2T1DWE8      LQPNVQIGRNTLQQLLKARQDIALEIARGGFDWQVVEEPKLG--K--Q--IG-PNVKQ--
A0A1U7I8L3      LEPEVKLNRDTLEQLLKARQELSLEIARGGFDWQMVEEPQLG--L--Q--IG-PSMKR--
A0A2T1DJL8      LQPNVQVNRDTLQQLLKARQDLGLEIARGGFDWQVVEQPKVG--Q--Q--IG-PNWLR--
A0A1Z4J9W0      LQPLVTLNRDTLDELQKARQDLSLEIARGGFDWQMVEQPKLG--R--Q--VG-PSWMR--
A0A0N7Z5K9      LLPTVKLQRDTLDQLEKARQGLGLEIARGGFDWQIVEQAKVG--R--Q--VG-PNWLR--
A0A0S3TXC5      LLPTVKLQRDTLDQLEKARQELGLEIARGGFDWQVVEQSKVG--R--Q--VG-PNWMR--
K9SA61          LEPQLQLRRETLQELLKARQELGLEIARGGFDWQVVEEPRTG--N--Q--IA-PNLQR--
A0A3D1PBA3      LQPLLQINRNKLQQLLQAQQELSLEIARGGFDWQALEEPKQG--Q--Q--IG-PNLKL--
K9XPB0          LTQEANLKKNALQRLLAAKQELEIALSRGAYNWQVIESPQLG--V--Q--IA-PNTTK--
A0A350Y7Z1      LQPEVQIRRDTLQKLLEARQELGIEIARGGFKWQVVEPPKPG--K--Q--MG-PDTRR--
A0A352X2A7      MQPEVQLKRDTLQKLMQARQDLGIEIARGGFKWQVVEAPLPG--E--Q--IG-PNTKQ--
A0A0D8ZYV0      LLPIVQINREKLQQLLRAQQELSLEIARGGFEWQALEQPVLG--L--Q--VG-PNIKQ--
A0A2T1FP73      LVPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLG--L--K--VG-PNLKL--
A0A433VMS2      LVPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLG--L--K--VG-PNLKL--
K9TYA7          LVPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLG--L--K--VG-PNLKL--
A0A2P8QUE1      LVPFVQINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLG--L--K--VG-PNLKL--
A0A2T1DNG3      LKPDIELNRDTLKQLLKAQQDLGLEIARGGFAWQVVEQAQIG-----A--KTGPNLQK--
B8HNB0          LQRQLKVNEDVVGRFMERLQELRIAEAQRTTSWRVLEPAYLP--T--A--PISPNMSR--
A0A1Z4LN32      LEQKLSIAQKNYENLETRLQEIKVAESQTVGNASIVESAKVS--P--S--PQVQKQKF--
A0A2I8A9F5      LEQKMLIAQKNYENLLTKYQEIKIVESQTIGNARILEYAEVD--S--S--PKASKKKG--
A0A218Q6R8      LERKLSRAEKNYENLLTRFQDIKIVESQTIGNARVLQYAEIG--S--N--SSANKKKI--
A0A218QGE0      LERRLSIAQKSYENLLTRQLEIEVAKNQTVGNAKVVEYAKVA--F--S--PSVKKKKL--
A0A563VS48      LVRRVEASQTTYETLLNKLQEIQIAEEQDIGKARVVSEAVVP--E--F--PIGPQKKM--
A0A318BJ18      YQQEVDTNRALYDGLLQRYKEVGVAGGVGVNNISVVDTADAP--R--H--PSSPKLLI--
A0A3B8Y8H9      LQRKIEIANQSLTSYLVFQQELELERAKTIYPWRLVSEIRTP--E--E--PVSGPLKL--
A0A2W1JVB9      LLRDVEISQEIYANLVRKLQEIQVLEQQNLGNARILSPALIP--E--E--PIAPRKLL--
A0A6H1U102      LQREFQVKSQAVNRFLEKLQELQIAEAQETAPWRILEPPYQP--Q--N--PISPNIRR--
A0A563VLD6      LERQLVVKSESLDYLLKRRQELQISLAQETAPWKVLDKPYLP--H--K--PISPNIQR--
A0A2P8W9H0      LQRELEIATTNLNQFLTKREALRIDAAQRQTPWEVLTPPSQP-----R--ASAASAKR--
A0A6I5P386      IQRELDIATANLNQFLTKREALRIDAAQRQTPWELLTPAETP-----R--ESSASVKQ--
A0A318BG22      LQREVDTNRALYDALLQRFKEIGVAGGSGANNVSVIDTARAP--G--A--PASPILWL--
A0A1Z3HMQ0      LEQRLLAAKTNYETLLVRLQEAQLAENQTVGSAQILEPAAPP--R--F--PVGTSTKK--
K1XF69          LERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--D--E--GKTAKVPL--
B5W297          LERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--D--E--GKTAKVPL--
A0A6H2AL05      LERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--D--E--GKTAKVPL--
H1W7M8          LERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--D--E--GKTAKVPL--
A0A5Q4H6A5      LERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--D--E--GRTAKIQL--
D5A466          LERKAEVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--D--E--GRTAKIQL--
U5QJM6          LNRNAVIASDSLNRLLQRLQELEIKAAQELSPWRVIEPAVLP--DKEK--PVWPKPLV--
A0A1Z4RPC6      LLREVESTRSTYNTLLDNKQEIDILVNQQTGNAEVIELGKVP--D--K--GSTGRVFL--
A0A2T1CMZ0      LLREVDSARSTYKTLLENKSDLDVLVNQQTGNAQIIESGIVP--E--E--GSTGRLPL--
L8M4F7          LLLELKIADANYKNLLDSLEQVELELLQETSNVEIVEPALVP--I--K--GTSSKMKL--
A0A140K2P2      LIRKVKAAQNTYETLLTSLQEVQLAENQQNGNAQIIELAKLP--E--K--GSSGRMAF--
K9XWX4          LIRKVKAAQTTYETLLTSLQEVQLAENQQNGNAQIIELAKLP--E--K--GSSGRIAF--
A0A140KB14      LVRQVEAAEKVYQNLLDSQQELQLLQNQKSGNAQIIELAQLP--E--E--GSSGRLAL--
K9XX88          LLRQVEAAEKVYQNLLDSQQELKLLQNQTTGNAQIIELAQLP--E--K--GSSGRLAL--
A0A563VSV6      INQKVETARSTYENLLSTQQELQILRNKQTGNAEIIEQAIAP--E--N--GSTGRMAL--
L8LZE9          AIRKVENIRTTYENLLNTQVELDILQNKQTANARIIEPAIAP--E--K--GSSGQLAL--
A0A433NM31      LEREVDAAQSTYATLLKKLEEVRIAENQNVGNAQIVDVGRVA--E--E--PVAPKKLL--
A0A1Z4NDS1      LERKLKAAQTTYENLLNREQEIRIAENQNIGNARIVSYALVP--D--T--PAGPKKIL--
K9F4D9          LDRQLAAAQTTYETLLQNLQQAQVLENQNIGNARIVSPALIP--N--E--PLGPSLKL--
U9VXM0          LERQLDAAQTTYETLLQNLQQAQVLENQNVGNARIVSPALSP--T--E--PIGPSLKL--
A0A6I5QPI5      LDRQLEAAQTTYETLLSQLQETRVIENQTVGNVRVVSLAQIP--N--S--PAGPDRRM--
A0A433W533      LERQLKAAQSTYEILLQKLQEVRVAENQNMGNARIIESALAP--E--K--ALSLKPMI--
A0A2P8QWJ3      LERQLKAAQSTYEILLQKLQEVRVAENQNMGNARIIESALAP--E--K--ALLFKPMI--
A0A2T1FKP8      LERQLKAAQSTYEILLQKLQEVRVAENQNMGNARIIESALAP--E--K--ALLFKPMI--
K9U6L7          LERQLKAAQSTYEILLQKLQEVRVAENQNMGNARIIESALAP--E--K--ALLFKPMI--
A0A1E5QP61      LQRQLDAAQSAYQILLRNLQEVRIAENQNVGNARVISYATLP--V--N--PVAPNKKL--
U5DPF5          LERQLNAAQSTYEALLQRLQEVRVTENQNLGNARVVENALVP--I--N--PIWPRMQL--
A0A3M1PML8      LERRLNAAQTTYEALLLRLQEIQVAENQNIGNVRVVSPAIVP--D--D--PLPSQKKL--
A0A3M2GIL5      LERKVNAAQSTYEILLKNLQEVQIVENQNVGNARVIASASPP--E--F--PVGSGKKL--
A0A6H1TSJ9      LERKVNAAQSTYEILLKNLQEVQIVENQNVGNARVIASASPP--E--F--PVGSGKKL--
A0A0T7BPZ0      LERRLKASQTTYETLLTRLQEIHVAENQNMGNARIISTALVP--D--K--PGNSRKLL--
A0A352X442      LERRVEATQLTYSQLLQKLDETRLIENQNVGNARIVEAAAVP--E--K--PTSSKKKL--
A0A6B3NF44      LERKLEAAQSTYGILLSKLQETRVAENQTVGNASIISTAIVP--E--N--PTGSKKKL--
A0A0M0SHU3      LERKLKAAQTTYETLLTRLQEINVAENQNIGNARIISPALVP--D--E--PSGARKAL--
A0A1D2PBN3      LERKLKAAQTTYETLLTRLQEIQVAENQNVGNARIISPALIP--D--K--PAGSRKIL--
A0A0C2LVR7      LERKLKAAQTTYETLLTRLQEIQVAENQNVGNARIISPALIP--D--K--PAGSQKIL--
A0A1Z4PQB9      LERKIKAAQTTYETLLTRLQEIQVAENQNVGNARIISPALIP--D--K--PAGSRKIL--
A0A1Z4SFN6      LERKLKASQTTYEALLTRLQEVQVAENQNIGNARIISPALVP--D--E--PTGPRKAL--
K9PGI8          LERKLKAAQTTYEALLTKLQEVQVAENQNIGNARIISPALIP--D--A--PAASQKNL--
A0A2T1E9V8      LERQLLASQSTYETLLKSLQEIKVKENRTVGNVQIVEYAEIP--V--V--ATNASNKS--
A0A3M2GQQ6      LQREFKVKSEAFNRFLEKLQELQIAEAQETAPWRVLEPPYEP--Q--L--PISPNVRR--
A0A6H1U2X0      LQREFKVKSEAFNRFLEKLQELQIAEAQETAPWRVLEPPYEP--Q--L--PISPNVRR--
K9SGJ5          LQRQLELDSAVFTSLSEKLEELRIAEAQEISSWRVLDAALLP--L--Q--PIEPNVLR--
A0A6C2DSN4      IQRQLDLDTSTYNKLTEKLEELRISEAQEISSWKILEPPLLP--V--R--PSSPDIER--
L8MYT6          IQRQLDLDTSTYNKLTEKLEELRISEAQEISSWKILEPPLLP--V--R--PSSPDIER--
A0A352JGJ6      IQRKLALDTSTYQKLTEKLEELRISEAQEISSWRILEPPLIP--T--R--PSSPDIEK--
A0A1J5GLS2      IQRQLALDTSTYNKLTEKLEELRISEAQEISSWRVLEPPLIP--T--R--PSSPDIER--
A0A2W4W6M5      IQRQLALDTSTYNKLTEKLEELRISEAQEISSWKVLEPPLIP--T--R--PSSPDIEK--
A0A2W7AN33      IQRQLAIDSSTYNKLSEKLEELKVSEAQEISPWKILEPPLIP--T--R--PSSPDILM--
A0A256BLV2      IQRQLALDTSTYNKLSEKLEELRISEAQEISSWKILEPPLTP--I--K--PSSPDIER--
A0A2W6ZXF3      IQRQLALDTSTYNKLTEKLEELRISEAQEISSWRILEPPLIP--T--R--PSSPDIER--
A0A2Z5WX66      IQRQLALDTSTYNKLTEKLEELRISEAQEISSWRVLEPPLIP--I--R--PSSPDIEK--
K9W1T3          LERRLKTAQSTYEILSPKLQEIRVQENQTVGNARIVTPASIP--E--R--AIAPKKAQ--
A0A1Q4RTR1      LERDLQVARQTYEQLLRRFQEVQVIENKTVGNARVVSQALVT--D--N--PVSPKIAL--
A0A1Z4SQV2      LERNLQVARQTYEQLLRRYQEVQVIENKTVGNARIVSEAQVT--N--R--PVSPKLYL--
A0A2H2XGN1      LERNLQVARQTYEQLLRRYQEVQVIENKTVGNARIVSEAQVT--N--R--PVSPKLYL--
A0A433UXH8      LERNLQVARQTYEQLLRRLQEVQVIENKTIGNARIVSEAQVT--N--R--PVSPKLYL--
A0A1Z4RMB9      LVRSAEAASKTYQTLLDSLQKAQIAENQQSGNTDIVEYATVP-----D--KGSAGRVM--
B4WP72          LERRLQASQTTYEALLTKLQEVQVAENQNVGNARVVEAAIAP--E--S--PVDSRREL--
A0A318B4H2      LQREVDTNRTLYDGLLQRYKEIGVA-GVGSNNVAIVDAAEVP--G--G--PSEPNLNK--
B4WQE3          IQRDLEIAATNLNEFLTKRETLRIEAAQQQTPWEILTPPSAP-----Q--AFSQTGKS--
A0A2K3BR24      LERQLNASQSTYQALLKRLQEVRVAENQNLGNARIIESASIP--T--S--PISPRIKL--
K9YXY1          LERQLNASQSTYQALLKRLQEVRVAENQNLGNARIIESASMP--T--S--PISPRIKL--
A0A1U7HGH0      LERELSAAQSTYEALLRSLQEIKVIENRTVGNVQIIEYAQVP--S--G--AINASNTS--
K9XJD3          LERELSAAQSTYEALLRSLQEIKVIENRTVGNVRIIEYAQVP--S--G--AINASNTS--
K9SX01          LQRAVEISRTAYEGLLVKQQDIQLTEEQNIGNARILSPAVPS--G--V--PISPKISN--
A0A4P7ZT55      LNQRLEIASENLSSYLKARESFRLEVAQKTLPWQVISPPEVD--E--T--PVKPNLSR--
A0A1E5QIR9      LERQVEVAQSTYQTLLTRLQEVRIAEEQNIGNVRVIQAAVFP--E--R--PIAPQKKI--
A0A1Z4IBC7      LERRLQAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALVP--D--F--PEGPRKIL--
A0A1W5CPC7      LERRLQAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--D--F--PEGPRKIL--
A0A5Q0GKD1      LERRLQAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--D--F--PEGPRKIL--
Q3MDC6          LERRLQAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--D--F--PEGPRKIL--
A0A1Z4KM73      LERKLQAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--D--F--PEGPRKIL--
Q8YNX7          LERKLQAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--D--F--PEGPRKIL--
A0A367R4K6      LERRLKAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--D--K--PEGPRKLL--
A0A1E2WSV8      LERKLQAAQTTYETLLKKRQEIDVAQNQKIPNARVISYALIP--D--K--AEGPRKIL--
A0A2R5FRT9      LERKLQAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--D--K--AEGPRKIL--
A0A2K8T1B6      LERKLQAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--D--K--AEGPRKIL--
A0A235I9I0      LERKLQAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--D--K--AEGPRKML--
A0A2D0HQT8      LERKLQAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALTP--D--K--AEGPRKML--
A0A2L2NU95      LERKLQAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--D--K--AEGPRKML--
A0A367S084      LERKLQAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALTP--D--K--AEGPRKML--
A0A0V7ZFJ4      LQRKLEVAQLTYTELLKKLQEVQVVENRSVGNATIISEALVP--E--H--PISPNITR--
A0A367RIS1      RQRQLQVAQTTYEQMLKRLQEVQVLENQNVGNARIVSEALLP--K--K--PISPRILL--
A0A235IXQ2      VKRQLEVAQTTYEQMLKRLQEVQVLENQNVGNATIVSNALVP--K--K--RISPRISL--
A0A1W5CNX3      LQRQLQIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--K--T--PVSPRIVL--
A0A5Q0GJJ5      LQRQLQIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--K--T--PVSPRIVL--
Q3MEB7          LQRQLQIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--K--T--PVSPRIVL--
A0A1Z4KHN9      LQRQLQIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--K--T--PVSPRILL--
Q8YT70          LQRQLQIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--K--T--PVSPRILL--
A0A218Q4C1      LQRQLQVARNTYEQLLGRLQEVQLVENQNVGNARIISEALLP--D--K--SISPRIKL--
A0A166IWU6      LQRQLQVARITYEQMLRRLQEVQVAENQNVGNARIVSQALLP--E--K--SVSPRINL--
A0A2S0Q8C0      LQRQLQVARTTYEQMLRRLQEVQVAENQNVGNARIVSQALLP--E--K--SVSPRINL--
W6FSX4          LQRQLQVARTTYEQMLRRLQEVQVAENQNVGNARIVSQALLP--E--K--SVSPRINL--
A0A0V7ZNJ9      VERKLQIAQLTYQNLLKKLQEVQVIENQNIGNARIISEALVP--D--K--KISPRIAL--
A0A0R0M9H9      LQRQLQVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVP--E--I--PISPRTAL--
A0A1S1ZVW2      LQRQLQVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALIP--E--I--PISPRTAL--
A0A1B7WX82      LQRQLSVAQLTYQEFLKQFQLVAVLENQNVGNSRIISQALVP--E--R--PVSPKKPL--
A0A1B7WTD1      LQRQLMVAQTTYQELLRQFQLVQVMENQNVGNARIISEALVP--E--I--AVSPKKPL--
A0A480ABC0      LQRQLMVAQTTYQELLRQFQLVQVMENQNVGNARVISEALVP--E--I--AVSPKKPL--
A0A1Z4LRU5      LQRKLQVAQSTYQQLLKQLQEVQVVEKQNVGNAKVIASALVP--N--K--PISPKIAL--
A0A1Z4JVB4      LERQLKVARITYEQVSKQLQESEIIENQKVGNARVLSEALVP--D--K--PISPIIAI--
K9PIA4          LQRQLQVARVTYEQFLRQLQEIQVLENQNIGNARVISQALVP--N--R--PVSPVIHL--
A0A1Z4HVE1      LQRQLQVARVTYEQLLKQLQEVEVIENQNIGNARVISQALVP--D--K--AISPIIPL--
A0A252ECZ1      LQRQLQVARLTYEQLSKQLQEVEVIENQNIGNARVISEALVP--E--R--PVSPVIPL--
A0A1Z4G5Y1      LQRQLQVAKITYEQLMKQLQEVEVIENQNIGNSRVISDALVP--E--K--PVSPIVPL--
A0A252DNA2      LQRQLQVARVTYEQLLKQLQEVEVLENQNIGNSRVISEALVP--D--K--PVSPIVPL--
A0A252E1Q4      LQRQLQVARVTYEQLLKQLQEVEVLENQNIGNSRVISEALVP--D--K--PVSPIVPL--
A0A6G9SK36      LQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNARIISEALVP--D--K--SVFPVIPL--
A0A1Z4M597      LQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVA--D--K--SVSPIIPL--
A0A1Z4MWT1      LQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVP--D--K--SVSPIIPL--
A0A1Z4TX53      LQRQLKVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVP--D--K--SVSPIIPL--
A0A5P8VSD1      LQLELEIAQTTYGQMMKRLQETQILENQNVGNARILSEALLP--K--K--PVSPIILL--
A0A2A2TNQ5      LERRLEVAQTTYQQVQKQLQEVEVVEQQKVGNARIVSEALVP--E--K--PVAPKIPL--
A0A3S1C4K5      LERKLQVAQSTYQQVLKQLQEVEVVEQQKVGNARVVSAAEVP--E--I--PVSPKIPL--
A0A1X4G3D5      LRLRLEIVVTTYKQLQKQLQELEILQGETTGTARVLSSALVP--K--R--PVSPRIPL--
D4TNI2          LRLRLEIVVTTYKQLQKQLQELEILQGETTGTARVLSSALVP--K--R--PVSPRIPL--
A0A1Z4H6Z8      LQRQLQVARVTYEQLVKQLQEVEMIENQNVGNARVISDALVP--D--K--AVSPIIPL--
A0A1Z4NPM1      LERKLQVAQSTYQQVLKQLQEVEVAEQQKVGNARIVSPALVP--D--K--PVSPKIML--
A0A3F3KPR9      LQRQLQVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVP--E--I--PISPRTAL--
D4TGN7          LQRQLQVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVP--E--I--PISPRTAL--
A0A1Z4UZW9      LQRQLTVAQLTYQELLKQFQFIEVLENQNVGNSRIISEALVP--E--R--PVSPKIPL--
A0A0K2M5H0      LQRQLTVAQITYQEFLKQFQLVQVLENQNVGNSRIISGALVP--E--R--PISPKIPL--
A0A1B7VSH4      LQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVP--E--L--PVSPKIPL--
A0A1B7W126      LQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVP--E--L--PVFPKIPL--
A0A3D4C6Q6      LQRQLTVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVP--E--L--PVFPKIPL--
A0A1B7UVJ4      LQRQLSVAQLTYQEFLKQFQLVAVLENQNVGNSRIISQALVP--E--R--PVSPKKPL--
A0A1B7UTR1      LQRQLSVAQITYQEFLKQFQLVQVLENQNVGNSRIISEALVP--E--R--PVSPKIPL--
K7W0A4          LQRQLSVAQITYQEFLKQSQLVQVLENQNVGNSRIISEALVP--E--R--PVSPKIPL--
A0A5C0DRW9      LQRQLSVAQITYQEFLKQFQLVQVLENQNVGNSRIISEALVP--E--R--PVSPKIPL--
A0A6H2C088      LQRQLSVAQITYQEFLKQFQLVQVLENQNVGNSRIISEALVP--D--R--PVSPKIPL--
A0A2T1CIL7      LERRVEATQSTYQTLLGQLQDTQVAENQNVGNVRIIADAIVP--E--K--PTSSTQKK--
A0A433V7A0      LQRKLDAAQSTYQLLLQRLQEVRVAENQNIGNARIIESASIP-RH--A--SDFTIKII--
A0A2T1FTR8      LGRKLETTRTNYKTLLSKLQEIEIAENQTLGNSRILTHAELP--Q--E--ALSPKKGQ--
K9UA41          LGRKLETTRTNYKTLLSKLQEIEIAENQTLGNSRILTHAELP--Q--E--ALSPKKGQ--
A0A0C2LBE2      LERKLKAAQTTYETLLTRLQEVQVAENQNIGNARVISPALVP--D--K--STGSGKIL--
A0A433NN38      LERKVKAAQTTYENLLTRMQEVDVAENQNVGNATIISPALIP--D--K--PSGPRKTL--
A0A2N6K0T2      LERKLKAAQTTYETLLTRLQEINVAENQNVGNARIISPALVP--D--E--PSGVRKAL--
A0A2N6ML72      LERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--D--E--PSGTRKAL--
G6FQZ6          LERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--D--E--PSGTRKAL--
A0A2N6MQX9      LERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--D--E--PSGTRKAL--
A0A2N6KXT6      LERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--D--E--PSGTRKAL--
A0A2N6KGB9      LERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--D--E--PSGTRKAL--
A0A2N6L3Y5      LERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--D--E--PSGTRKAL--
A0A0S3TIS7      LERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--D--E--PSGTRKAL--
A0A1U7GW28      LERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--D--E--PSGTRKAL--
A0A2N6LW63      LERKLKAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--D--E--PSGTRKAL--
A0A328IH74      LERKLKAAQTTYETLLTRLQEINVAENQSIGNARIISPALVP--D--E--PSGMRKAL--
A0A4D9CIB0      LERKLKAAQTTYETLLTRLQEINVAENQSIGNARIISPALVP--D--E--PSGMRKAL--
A0A1Z4TQ63      LERKLKAAQTTYETLLTRLQEINVAENQNIGNARIISPALVP--D--E--PSGTRKAL--
A0A4Q9J8G2      LERKLKAAQTTYETLLTRLQEINVAENQNIGNARIISPALVP--D--E--PSGMRKAL--
A0A1Z4SMD6      LERTLSVAQKNYESLVNRSQEIQVAERQTVGNARVIQHARVP--N--K--PTLSKSTL--
A0A2H2Y096      LERTLSVAQKNYESLVNRSQEIQVAERQTVGNARVIQHARVP--N--K--PTLSKSTL--
K9S8M8          LERQLATYQSTYDILSRNLQQVQIIENQNVGNARIVSSASFP--S--K--PVGPNKKV--
A0A1Z4NFV0      LERRLGVAQKTYEHLLSRLQEIRVAENQTVGNARIIQAAAPP--P--L--PAKSKMSL--
B0CAX4          LERDRIVAQTTYEELLKALQQITISENQNIGNVRVIAAALEP--K--E--PVSPRKAF--
A0A350Y0P6      LERQLEASQATYDILLKNYQQIRIAENQNVGNARVITYASIP--E--A--PVSPKKKL--
A0A352X940      FERQLGAAQSTYEILLRNYQDVRIAENQNVGNADILARALVP--E--D--PVSPKKKL--
B8HTN4          LERRRVVAQTIYEGLLKTLQSLQISEQQNAGNVRLIQAATLS--D--E--PVSPKLLL--
A0A2A2TPF8      LERRLTVAQESYKQLLTRLQEVRVAENQNVGSARIVQDAAVS--N--Q--PVRSKLTM--
A0A1Z4R0P8      LERRLEVAQESYKNLLTRLQEVRVAENQNVGSARIVQEAVVP--N--Q--PVSSKLTL--
A0A0T7BUI3      LERKLSVAKLNHENLNARLQEIQVAEKQTIGNAKIIQPAQIP--E--T--PMLSKKSL--
A0A1Z4LP32      LERRLSVAQTDYENLITRQQEIELAEKQTIGNSRIIQSARIP--N--K--TVLSKMTI--
K9REP9          LERRLSVAQTDYENLITRLQEIELAEKQTIGNSSIIQKARVP--K--K--PSLSKMTL--
A0A1Z4SIJ3      LERRQTLAQTNFQNLQDRLQEIEIAEKQTIGNARIIQPARLP--N--K--PVLSRLTL--
A0A2H2XPG4      LERRQTLAQTNFQNLQDRLQEIEIAEKQTIGNARIIQPARLP--N--K--PVLSRLTL--
K9V3C7          LERSLTIAQKTYEELLTRQQAIRLAENQAMGNARVIQNAIAP--N--S--PISSKLTL--
A0A1Z4T6Y7      LERRLMVAQKSYETLLGRLQEIRVAENQTVGNARVIQNAVVS--P--N--PARLRMMF--
A0A2H2Y561      LERRLMVAQKSYETLLGRLQEIRVAENQTVGNARVIQNAVVS--P--N--PARLRMMF--
A0A1Q4S362      LERRLIVAQKTYETLLGRLQEIRVAENQTIGSARIVQNAVVS--P--N--PARMRMML--
A0A3S1CIN8      LERRVMVAQKTYETLLGRLQEIRVAENQTIGSARIVQNAVVS--P--N--PARMRMML--
A0A2A2TC28      LERKFNIAQTDYQNLVARLQEIEIVEKQTIGNARVVQPALVP--K--I--AAMSKMTL--
A0A0C1NCB0      LERRLDLAQKNYENLTLRLQEIQVAEKQTVGNARIIQPAQLP--Q--K--PALSKLTL--
A0A2N6K7Q9      LERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
A0A2N6MXH6      LERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
A0A2N6M5A8      LERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
A0A2N6LL61      LERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
A0A0S3TP66      LERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
G6FP91          LERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
A0A1U7GYR5      LERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
A0A2N6KY52      LERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
A0A2N6KMP5      LERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
A0A2N6MA45      LERRLEAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
A0A4Q9J9V9      LERKLESAKNGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
A0A328IGA1      LERKLESAKNGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
A0A4D9CE41      LERKLESAKNGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--K--K--PVISKTKI--
A0A0M0SFT2      LERKLESAKNGYENLVSRLQEIQVAEKQTIGNARIVQPAQTP--K--K--PVISKTKI--
A0A1Z4TLC8      LERKLESAKNGYENLVSRLQEIQVAEKQTIGNARIVQPAQIP--K--K--SVISKTKI--
A0A0C2LFH0      LERRLSIAQKNYENLVTRLQDIEVAEKQTVGNAKEIQLAQVP--K--R--PSVSKITF--
A0A1Z4IYV4      LERKLSISKKNYENLVSTLQEIEVAEKQTVGNAKEIQAAKVP--K--K--PVLSKVVL--
A0A1Z4Q0T6      FERKLSISKKNYENLVTRLQEIEVAEKQTVGNAKEIQPAKVP--K--K--PVLSKLVL--
A0A0C2PT44      YERKLSISKKNYENLVTRLQEIEVAEKQTVGNAREIQPAKVP--K--K--PVLSKVVL--
A0A1D2P6J4      FERKLSISKKNYENLVSRLQEIEVAEKQTVGNAKEIQPAQVP--K--K--PVISKVVL--
A0A3M9ZEU1      LARRLQAAQSTYETLLTRLQEVQVAENQNVGNARVISSAIVP--E--E--PSGLSKKV--
A0A1Z4JK72      LERKQDLAQKAYENLTSRLQEIQVARNQQVGNARVLQNALVP--T--Q--PTGRMRLI--
A0A0N7Z489      LERRQEIALTAYQNLNARKQEIEVAKNQQVGNARVLQSAMVP--T--R--PAGRMRLI--
A0A0S3TXS2      LQRRQEIALTAYQNLNARKQEIEVAKNQQVGNARVLQSAMVP--T--R--PAGRMRLI--
A0A1Z4RN12      LQRRVDATQSTYKTLLAKLQEAEIIEQRNTGKVRVTAPAAIA--E--D--PVNPDKKV--
A0A2T1CMF9      LERKLKSVTENYQTLLSKANEISIRQDYKVDKVRVISVAALA--E--D--PVNPDAKV--
Q7NDC5          LARQVEADQEAYRLLQKKFYEYRILEAQNIGNATLIEPAEVP--E--I--PAWPKPLL--
U5QGK3          LERQVEADSAAYKLLQTKFHEYRILEAQNIGNAELIEPAVAP--E--L--PAWPSPLL--
A0A2W4UY24      LERELDAAQTTYETLLASRQQAQVLEKQDVGNARTISLADLP--E--E--SISPALKL--
A0A2T1GMT4      LERKLEVSQSTYQSLLKKLQELQVARNKSTSNARIISSAAVP--E--K--PDPGPKLI--
K9UI51          LERQLEVSQATYQSLLKKVQELQVARNKSTSNARIISSAAIP--E--K--PEPGPKLI--
K9QM62          LQRTLEVAQSTYQNLLRKTQELQVAEHKNTANARIISQALVP--E--E--PVLKKKII--
A0A1Z4FWI3      LERRLEVAQSTYQTLLKKIQELQVAENDNTPNARIIARGLVP--T--K--PGLGLKPI--
A0A1Z4JYE7      LERKVEVAESTYQTLLKKVQELQVAENANTANARIIARGSVP--E--E--PLAAKKML--
A0A2T1FXY4      LERRLVVAQSTYQTLLKKVQELQVAENKTTAHARIIAQALVP--N--K--PVLEQKLI--
K9TYI2          LERRLVVAQSTYQTLLKKVQELQVAENKTTAHARIIAQALVP--E--K--PVLEQKLI--
A0A1Z4QL41      LERTIEVAQSTYGTLLKKIQALQVAENQNTASARIITEAIIP--K--K--SSGGKKLI--
A0A252D4T4      LQRRLDVAQSTYQTLLKKVQELQVAENNNTPNARIIAKGLVP--N--K--AALGLKPF--
A0A252DJH5      LQRRLDVAQSTYQTLLKKVQELQVAENNNTPNARIIAKGLVP--N--K--AALGLKPF--
A0A252EB80      LQRRLEVAQSTYQTLLKKVQELQVAENNNTPNARIIAKGLVP--T--K--PALGLKPF--
A0A6G9SKZ9      LERRLEVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGLVP--K--K--PTLGLKPF--
A0A1Z4HPW5      LERRLEVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSAP--K--K--PTLGLKPF--
A0A1Z4MSN1      LERRLEVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSVP--N--K--PTLGLKPF--
A0A1Z4U1C2      LERRLEVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSVP--N--K--PTLGLKPF--
A0A0D6KV51      LERRLEVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSVP--I--K--PTLGLKPF--
A0A1Z4MKF8      LERRLEVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSVP--I--K--PTLGLKPF--
A0A2C6WC43      LERKLEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--T--D--PVAGKKFL--
A0A1Z4L5A1      LERKLEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--A--D--PVAGKKLI--
A0A367QD86      LERKLEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALMP--T--D--PVAGKKFL--
A0A235IZ96      LERKVEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--K--D--PIVVKKII--
A0A2L2NGP0      LERKVEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--K--D--PIVVKKII--
A0A2K8SM78      LERKVEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--K--D--PVVGKKII--
A0A2R5FPC0      LERKVEVAESTYQTLLKKVQELQLVENTNTPSSRIIAPAVVP--N--K--PVIGKKII--
A0A5P8W5T6      LERKVEVAESTYQTLLKKVQELQLVENTNTASSRIIVPALVP--N--K--PVTGKKII--
A0A140KBA0      LERKTKAAQATYQTLLGKLQETQVAEKQNIGTVRVLANAIPP--D--E--PTGPSKKL--
K9XSG1          LERKTKAAQATYQTLLGKLQETQVAEKQNIGTVRVLANAIPP--D--E--PSGPSKKL--
A0A0F5YE28      LQRKVQVAQVTYETLLKNLEEVQVAENKSTNNARVIEEAIVP-----E--EGSTAKTK--
U7QEH7          LQRKVQIAQVTYETLLKNLEEVQVAENKSTNNTRIIEEAMVP-----E--EGSTAKIQ--
A0A3S1ATK5      LERKVEVAQSTYETILKKAQELQVAQNKNTANARIITQAKIP--E--K--PASGKKPI--
A0A2Z6CPH0      LERKVEVDQSTYQNLLKKVQELQLAENRNTANARIIAQALVP--E--K--PTSGKKLI--
A0A1Z4GT50      LEQKLEVAQSTYQTLLKKVQELQVAANKNTANARIIAQASVP--E--E--AVLGKKPI--
A0A1Z4GIX0      LERKVDVAESTYQTVLKKVQELQVAENKTTPNARVVAQATVP--E--K--PESGKKLI--
A0A2H6LC24      LERKVDVAESTYQTVLKKVQELQVAENKTTPNARVVAQATVP--E--K--PESGKKLI--
B2J6N5          LERKAEVAESTYQTLLKKVQELQLVENTNTASSRIIAQAIVP--D--K--PVESKKII--
A0A367RMI4      LERKVEVAESTYQTLLKKVQELQLVENTNAPSSRIIAQALVP--K--D--PTLTKTII--
A0A235HUM0      LERKVEVAESTYQTLLKKVQELQLVENTNTPSSRIIAQALVP--K--D--PTLGKKII--
A0A2L2NW47      LDRKVEVAESTYQTLLKKVQELQLVENTNTPSSRIIAQALVP--E--D--PTLTKTII--
A0A1E2WUR1      LERKVEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--K--D--PVAGKKII--
A0A235IKU3      LERKVEVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--K--D--PILVKKII--
F4XKF3          LEQRVQAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--K--K--PLGDKKIK--
A0A1D9FX10      LEQRLQAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--K--K--PLGDKKIK--
A0A1D8TNX9      LEQRVQAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--K--K--PLGDKKLK--
A0A1U7MYU6      LEQRLQAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--K--K--PLGDKKIK--
A0A3C0NJ41      LQRRVEAAQSTYQALLKKQEELKLAENQSIGNARIIEPALVP--E--T--RSPINAII--
A0A352AG88      LQRRLDASQSTYEILLKKLQEVRVAENQNIGNARIIEPAEVPLLP--S--SQMVQTVL--
A0A350Y374      LQRRLDAAQLTYQTLLQKLQELRLAENQNIGNARIVEPAQIP--D--S--RSSGKSVL--
A0A355DPX0      LQRRLDAAQLTYQTLLQKLQELRLAENQNIGNARIVEPAQIP--D--S--RSSGKSVL--
A0A0D8ZUV2      LERQLQASQSTYQSLLQKLQELKVAENQNTGNASIVEPALVP--D--K--ASIKLRVM--
A0A433VDI0      LERRLAAAQSTYETLLKKIQEVRVAANQRIGNAQIIEPAPIP--K--K--PSLLKPAI--
A0A3D1PG43      LERQVKASQATYEILLRKQQEVKVEENRNIGNASIIETALVP--E--Q--PTGGKKLI--
A0A2P8QQ72      LERQVRAAQATYELMLKKLQELRVEQNRNIGNASIIETALVP--E--T--PLLGKRVM--
K9TZQ7          LERQVRAAQATYELMLKKLQELRVEQNRNIGNASIIETALVP--E--T--PLLGKRVM--
A0A2G7GPR0      LERRLEAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--E--N--SSVRKRAM--
K9XH68          LERRLEAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--E--N--ASVRKKAM--
A0A1U7HW70      LERRLEAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--E--N--ASVRKKAM--
A0A2S6VEJ8      LERRLEAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--E--N--ASVRKKAM--
                                                                            

K9SLA9          -NLSLGAIL-GLAFAGLVTFILAAIDKSIKTSEQASDISG-YSLLGIVPDFGYVAKHDQM
A0A168TT23      -NLSIALLL-GLVVGVGLALLLEFLDSTVHRTEDVEKLVG-RPVLGLIPIVKLSEQRKK-
A0A0M1JWX9      -NLVLGAML-GLMLGFGAALLVEQLDFVFHNPEDLKQATD-KPLLGLIPISDRAKQLASS
A0A2T1M1V6      --IALGGLL-ASLFGSLSVLLLLESRNPLFNSKDLQQAG--LPLVLRFPRLRSLSLEKGL
A0A2G7GCS2      --IALGGIL-AGLFGSISLIFFLEKRNPMLRPKDLEQVE--FPVLGRISRLKRTDMERNL
K9XBH8          --IALGGIL-AALFGSVSLILFLESRNPMLSPRDLRQVE--FPVLGRISRLKRPDMERAL
A0A1Z4LJ30      --MLLGALL-ACGFGSAAIILFSENRDPLLSPKDIVQTN--IPVLANIPYIKNIHGKLEQ
K9RI76          --MLLGALL-ASGFGSAAIILFMENRNPLLSPKDIQQAN--IPVLASIPYVRHINAKADR
A0A352AE27      --IALNAFV-ASVVGSIALLLLLEARNPLLSPKDLQTLK--FAIVVRIPRLKQSVVGLGL
A0A3B8JH60      --AALNALI-ASIVGSVALVLFLESRNPLLSPKDLQAIK--FPIVVRIPRFKQSDRALKL
A0A3C0N766      --AALNALI-ASIVGSVALVLFLESRNPLLSPKDLQAIK--FPIVVRIPRFKQSDRALKL
K9W9J7          --IVLSGLM-ASIIGSIALVLLLESRNPLLSPKDLQATK--FPIVVRIPRLRHSNLSWQV
A0A139WSU3      --MAVNALL-ASIIGSIALVLFLESRNPLLNLKDLQGQK--FAIVQSIPRIKHSDPKIEM
A0A433VN22      --MAINALL-ASVIGSIALVLFLESRNPLLSAKDLQEQK--FAIVERIPRIKHSGVISEL
Q7NF11          --IALGGLV-AAVFGSLGLILRKEAINPLLGPKDLQSVE--LPVLARLPRTKGL---LPS
A0A1Z4JCS8      --IAINALL-ASVIGSIALILLLEARNPLLTPKDLQALK--FSLVARIPKLKRLAIEPNS
F4XTX2          --IIANGFL-ASAVGSIALVLLLERRNPLLSPKDLQAIK--FPMVVNIPHLRHAGMGLEL
Q7NJN6          --VAVGGLV-AMLSGSIALALWLERRNPMLGVRELDSTG--LPVLGRIPKLKDA----AL
U5QCC3          --IVLGALL-AMIAGSVALALLLERRNPLLAKRDIEVTG--LPVLARLPKFKDN----EL
A0A3S0Y9N9      -NLLQGFIG-GILLGVATAFILEKMDKTIKTPESARELLG-YNLLGYIPPFTNNSPIPEV
A0A433UNK7      -NLLQGLIG-GIVLGVATAFVLERLDKTIKTSKSAKDILG-YNLLGYIPPFPNGNFIPEV
A0A3M1SVZ4      -YQAMGIFL-GGLAGVATALLLEVQDRSIKSVGEAKAQLQ-FALLGVIPQVRKSNRLLGH
A0A654SFI6      -NLLVALIT-GLIGAGALIYGRVVLSQTIKDPQDVTRELG-LSLLGTIPKSDAADVLKDL
K9SSQ0          -NLLLAGLA-GILVAAIIITVLENSDDRLQQVSQLQTLSD-LPLLGAVPYLATNAKLLSP
A0A2W1JIN9      -VLILGTLA-GAVLSIGTVILLEALNRKLYSADEIEELVE-LPVLSTLPRLSKNTLNLGE
A0A318AJV1      -LSGLAMLA-SLGCGLATVIVMEMLQGGLRTIGEVEARLG-LPVLASVPA--------EG
A0A6B3MUB5      -VLVLATAA-GITLAIGIILLLEVIDNKLYDVSDAEVLLK-LPRLGVLPEIPLSALSLKH
A0A1U7N2U4      -VLLIASAA-GIALAVGMVLLLEVMDNTLHDGSEAEALLK-LPRLGVLPTIPAQALSVEQ
A0A1D9G1F2      -VLVIATAA-GIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLPKIPAQALSLEQ
F4XV38          -VLVIATAA-GIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLPKIPAQALSLEQ
A0A2P8QIL5      -VLVLATVA-GGTLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVLPVISPEVRGKEY
A0A2T1FLY5      -VLVLATVA-GGTLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVLPVISPEVRGKEY
A0A433W447      -VLVLATVA-GGTLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVLPVISPEVRGKEY
K9U1K8          -VLVLATVA-GGTLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVLPVISPEVRGKEY
K9UYB2          -VLALAIAI-GIVSAIALIILLEMLDNKLHDQDETEELLQ-LPLLGVLPRLPAKATILQP
A0A218QN17      -VLALATVF-GTVLGTGVMLLLEVLDNTLKDASEAEELVS-LPLLGVLPRLPAKTLVLEP
K9RKN2          -VLALATIF-GGILATGVILLLELMDNTLRDARDAEQLLN-LPLLGVLPRLPGKTLVLEP
A0A2I8ADV2      -VLAIAIFF-GSILATGVVLLLELMDNRLYEVAEAEELLK-LPLLGILPRLPATKLTLEP
A0A1W5CKM3      -VLVIAGFF-GSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLPRLPATKLSLEP
A0A5Q0GMF5      -VLVIAGFF-GSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLPRLPATKLSLEP
Q3MEW0          -VLVIAGFF-GSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLPRLPATKLSLEP
A0A1Z4KIC7      -VLVIAGFF-GSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLPRLPATKLSLEP
Q8YSM5          -VLVIAGFF-GSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLPRLPATKLSLEP
A0A1Q4S1H4      -ILAIAGAF-GILLSTGMVLLLEMMDNRLHDVAEAE-LLN-IPLLGILPRLSKSNLALAE
A0A433VBU6      -ILAIAGAF-GILLSTGMVLLLEMMDNRLHDVAEAE-LLE-LPLLGVLPRLSKSNLALAE
A0A1Q4RZJ6      -VLALAGAF-GLLLATGVVILLEIMDNTLHDASEAEELLK-LPLLGVLPRLPAKTLALEP
A0A1Z4SNV3      -VLALAGAF-GLLLATGVVILLELMDNTLRDASEAEELLK-LPLLGVLPRLPDRTLVLNP
A0A2H2XJQ1      -VLALAGAF-GLLLATGVVILLELMDNTLRDASEAEELLK-LPLLGVLPRLPDRTLVLNP
A0A3S5K358      -VLALAGAF-GLLLATGVVILLEVMDNTLHDASEAEELLK-LPLLGVLPRLPAKTLALEP
A0A0T7BPJ4      -VLVVATVF-GTVLATGIILLLEAMDNTLRSGWEAQDLLK-LQLLGVLPRLPGSTLKLQS
A0A0C1QS61      -VLVLATVL-GTLLATSIVLLLEMMDNTLRDASEAEELLK-LSLLGVLPRLPSKTLVLEP
A0A139X3R8      -VLVLATAL-GTLLATSIVLLLEMMDNTLHDASEAEDLLK-LSLLGVLPRLPSKTLVLEP
A0A1Z4I7C5      -ILVMATFF-GSVLAVGLVLLLELMDNTLRDASEAEELLQ-LPLLGVVPRLPATKLSLEP
A0A0C2MDK7      -VLALAAAF-GTMLAVGVVLLLEVMDNTLRDATEAEELLQ-LPLLGILPRLPAKTLVLEP
A0A1Y0RCK1      -ILALASVF-GSVLAVGVVLLLELMDNTLRDATEAEELLQ-LPLLGVLPRLPAKTLVLKP
A0A1Z4PWZ0      -ILALASVF-GSMLAVGVVLLLEIMDNTLRDASEAEELLQ-LPLLGVLPRLSAKTLVLEP
A0A0C2QLT0      -ILALASVF-GTMLAVGIVLLLEVMDNTLRDASEAEELLQ-LPLLGVLPRLPGKTLVLKP
A0A1Z4J2K1      -ILALASVF-GSMLAVGVVLLLEMMDNTLRDASEAEELLQ-LPLLGVLPRLPAKTLVLEP
A0A3S0ZSX0      -VLAIAIVF-GSALATGIVLLLELMDNTLKDASEAEELLD-LPLLGVLPRLPAKTLMLEP
A0A2N6K4T3      -VLAIATLF-GTALATGIVLLLELMDHTLKDASEAEELLR-LPLLGVLPCLPSRAIALEP
A0A370CKT2      -VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLPGHAIALEP
A0A0S3TL97      -VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLPGHAIALEP
A0A2N6M8A0      -VLVIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLPGHAIALEP
A0A2N6M9E1      -VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLPGHAIALEP
A0A2N6KJI4      -VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLPGHAIALEP
A0A2N6MZ77      -VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLPGHAIALEP
A0A2N6KT20      -VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLPGHAIALEP
G6FSN3          -VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLPGHAIALEP
A0A4D9CI02      -VLAIAIVF-GTALATGIVLLLELMDHTLKDASEAEDLLK-LPLLAVLPSLPADAIALEP
A0A328I8B9      -VLAIAIVF-GTALATGIILLLELMDHTLKDASEAEDLLK-LPLLGVLPSLPAHAIALEP
A0A4Q9J4Z7      -VLAIAIVF-GTALATGIILLLELMDHTLKDASEAEDLLK-LPLLGVLPSLPAHAIALEP
A0A0M0SU69      -VLAIATVF-GIALATGIVLLLEFMDHTLKDASEAEELLK-LPLLGVLPRLPADAIALEP
A0A1Z4TIZ8      -ILAIATVF-GTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLPRLPTHAIALES
A0A0S3TYD7      SLLLAGSGGAGLLLAFAATVLAYLLDRRIRTVQDLKDVFD-YPVLGMIPSFTDSGLSQVM
A0A3C0N2P0      -GILLGIVT-GLMAGAGVAFLAEKLDKVFHSPDELKDSTG-LPILGTIPFTKKLKEDIGS
K9TLQ0          -SLLLGGIA-GLMAGIGAALLAEKLDTKFHSVEDIKDYMG-FPILGTIPFEKDLKESLTV
A0A6B3M6M6      -GMILGVVA-GMLAGCGAGLLAEKLDRVFHTPDEIKETTA-LPVLGTIPFRKELKKGFIS
A0A6B3NIJ0      -GIVLGVVA-GMLAGGGAGLLAEKFDRVFHTPDEIKEATG-LPVLGTIPFHKELKKGLSS
A0A352XE00      -GLVLATVA-GLIAGAGAGSLAEKLDKAFHSLDELKDSTG-LPILGTIPFDKVVKNSKKQ
B4VS56          -GIALGAVA-GLLAGAGAGFLAEKLDKVFHSAEEVKEKTG-LAVLGTIPFHKPLKKPSKS
A0A352AAQ3      -GIVLGTVA-GLLAGAGAGMLAEKLDKAFHSPDELKDSTG-LAVLGTIPFGKELKKGIAR
A0A350Y472      -GIALGAIA-GLLAGAGAGMLAEKLDKAFHSTDELKDTTG-LPLLGTIPFSKELKKNITR
A0A355DVB4      -GIALGAIA-GLLAGAGAGMLAEKLDKAFHSTDELKDSTG-LPLLGTIPFSKELKKTITR
U5QL42          -NLLYGFIA-SVFLGLGAAFVPDLIDERIKGVEEAKELTG-LPLLGAIPKTEN-------
K9QF04          -DLLLGGFA-GLLAGIGTAIAVEKFDNKYHSPEEIQDNTG-LTLLGTIP-----------
A0A076HBF2      -NLALGTVL-GLVAGAAAGLLRDRMDHVFHHAGEVKDDLG-LPLLGHIPHVEFFKGVRED
A0A354B169      -NLALGAIL-GLVAGAFAGLLRDRLDHVFHTAAEAKADLR-LPLLGHIPHVNFFQGVREG
G4FMX5          -NLALGTLL-GLVAGAGAGLLRDRKDHVFHSPGEVKAEIGDLPLLGHIPYVDFFKGVRED
Q0IDT5          -NLALGAML-GLVAGVAAGLIRDRFDHVFHLPAEVKDDLN-LPLLGHIPHVAFFKGVRED
A0A2D6FCW3      -NLALGAVL-GLVAGAAAGLLRDRMDHVFHHAGEVKMDLG-LPLLGHIPHVDLFKGVRED
A3ZA21          -NLALGAVL-GLVAGAGAGLLRDRLDHVFHHPGEVKDDLG-LPLLGHIPHVSFFQGVRED
A0A140K3H3      -GILLALVA-GSLMGVATAFLLQKLDQRVKQVEEVKQMVR-LPLLGTIP-----------
K9XUB8          -GIFLALMA-GGFMGVATAFLLQKLDQRVKQVEQVKQIAR-LPLLGTIP-----------
Q7NEU3          -TLGGGALL-GLVFGLGIASLLESVDDRVKSISQAKELLN-LPLLGAIP---FTEEEDLQ
A0A6H2NHD5      -NLLLSTVI-SLLLGGGAALLRDKFDQVFHDVDELAKVTR-LPNLALVP-----EASGLE
A0A2P8W4F7      -KLLLSTVI-GLMLGGVAALLRDRMDQAFHSTDELIKTTQ-LPNLTTIP-----NAPALQ
A0A5Q4E0Z4      -NLLLSTVV-GLLLGGGAALLRDRADTAFHSADELVKATQ-LPNLALVP-----NAPALQ
A0A2P8VVX1      -PLALGIVA-GLFVGGALAFGVESIDQRVRTSDELKKQVP-LPLLGMLP----RRPSSLP
A0A2P8WHY0      -PIALGVVA-GLFVGGGLAFARDSMDKVVRTSDDLKRQVP-LPLLGILPVQPIRKGFSLP
A0A2T1CMT9      -DLLLSLVV-ASFVGGFAAFVKDFTDETINTSKEIERRTS-LPILGTAP--------GLS
A0A563VQJ3      -LILLGFLS-GLFLSNLTAIALEWQDRTVKSIPELKKKLP-YKVLGVIP--------QMD
A0A1D8TX52      -DLLLGAVV-GLFLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMIP--------ELP
A0A1D9G4T2      -DLLLGAVV-GLFLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMIP--------ELP
F4XP71          -DLLLGAVV-GLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------QLP
A0A1U7N5X9      -DLLLGAVV-GLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------ELP
A0A6B3N2I8      -DLLLGAVV-GLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------ELP
A0A2W6ZAV2      -SLMLSILI-GGVAGVGAALLRDRLDHVFHQPQDVEDGLG-LPLLGRLP--------FLP
A0A2G7GMH8      -NLLLGIVV-GLTLGCFAAFIREAVDDAVHSSDELKKQVA-LPLLGLIP--------ELP
K9W742          -IILLGAVA-GVMLGGIAAFIRETMDDAVRSSDELKQQVA-LPVLGMTP--------VLP
A0A2T1DWE8      -NILLGAVA-GLMLGSVAAFIRDTMDDAVHNADDL-KQVA-VPLLGMVP--------ALQ
A0A1U7I8L3      -NLLLGAVV-GLMLGSIVAFIRDMIDDAVHTSDDLKKQVD-LPLLGIIP--------QLN
A0A2T1DJL8      -NLLLGAVG-GLMLGGVAAFLREAADDAVRTSEDFKQQVP-LPLLGMVP--------EVP
A0A1Z4J9W0      -NLLIGAAG-GLMLGCVAAFLRESADKSIRTSEDLTKEAS-IPLIGMVP--------ELP
A0A0N7Z5K9      -NLLIGGAA-GLMLGSVAAFLRESADKSIRTSEDLTKQAS-IPLIGMVP--------ELP
A0A0S3TXC5      -NLMVGAAG-GLLLGCVAAFLRESADKSIRTSEDLTKQAS-IPLIGMVP--------ELP
K9SA61          -NLLLGAVA-GLMLGAVAAFVREGVDDAVHTSDDLQKQVP-LPLLGMIP--------ELP
A0A3D1PBA3      -NLLLGLVA-GLMLGGVAAFLREAVDDSVHTSEELEKQVE-LPLLGMTP--------ELP
K9XPB0          -DILLSLVV-ASFLGGTTAFIKESLDEQLYNSRQIQEKIA-LPLLGSTP--------GLP
A0A350Y7Z1      -DLMLSVVV-GLFLGGLAAFGREALDDAVHSSEELKRQVA-LPLLGIIP--------ELP
A0A352X2A7      -DIMLAVVV-GLFLGGIAAFGREFIDDGVHTSDQLKRNLT-LPFLGIIP--------ELP
A0A0D8ZYV0      -NLLLGLVA-GLMLGGVAAFLREATDDAVHTSDELEKQVS-IPLLGMTP--------EMP
A0A2T1FP73      -NLLLGLVA-GLMLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMTP--------ELP
A0A433VMS2      -NLLLGLVA-GLMLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMTP--------ELP
K9TYA7          -NLLLGLVA-GLMLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMTP--------ELP
A0A2P8QUE1      -NLLLGLVA-GLMLGSLAAFLRDAVDDSVYSSEDLEKQFE-LPLLGMTP--------ELP
A0A2T1DNG3      -NLMLGLVV-GILLGGVAAVSREVLDDSVHSSDELKQQTA-VPLLGTIPELSLGAMSGKP
B8HNB0          -AILLGLFA-GVLAGIGLALLIERLDSRIHSVEEVKRASG-LPLLGTVPRSRSSEPHKDT
A0A1Z4LN32      -IVTFGSIFVGLVLSIGSAYFVDLIDRRLKTAKEAEKLFG-YTLLGLIPKFDTNNAKSNH
A0A2I8A9F5      -LTLMVSVFGGLLVGIAVAFLLDVIDRRLKTAKEAEELFG-YTLLGLIPKFSNNFNTT--
A0A218Q6R8      -IILLGGGFVGLLLGVAAAFFIDLIDRRVKTAKEAEELFG-YTLLGLIPVFETKNISN--
A0A218QGE0      -VITLGSGFVGLLLGVASAFFVDLIDRRLKTTKEAEALFG-YTLLGLIPKYE-KNTST--
A0A563VS48      -MMITGGAI-GTLLGIAVAFLIDIRDNTIKNTREAEQMLP-YPLRGVIPDCKGIT-----
A0A318BJ18      -NLLLSLLA-GLGIGALAAFVLEQMDEAIADPIEVTRRLG-LPLLGSVPK----------
A0A3B8Y8H9      -SVL-GTFM-GIVLGMGAGLLAEKLDDTFHNAEELKQETR-LPLLATIPQLPRKL-----
A0A2W1JVB9      -YIFSGFVL-GSLLAFGVALLLDSRDKSVKTLEDIKALFSDYTMLGVIPAIEGVQTKIKE
A0A6H1U102      -NLLLGLIA-GGLLGVAAVILLERTDQRLQRVDEAKELTG-LPSLGVVPKVKVPLVEGSR
A0A563VLD6      -GLALALAG-GGFIGILTAWLLHQLDTRVKLIDEVKQITQ-LPLLGAVPKVLEPRIVLSN
A0A2P8W9H0      -NLLLGTLL-GLLLGAGAAIVVDRFSGKIYTIDELKAAVR-LPVLGNIPISSLLNSGGSV
A0A6I5P386      -NLLLGSIL-GLLLGCGAAIAWDRIKSKINTVEELKDITE-LPVLGAIPHSRLLENGQNL
A0A318BG22      -NLLLAIGF-GVLAGVGIAFIIEFVDDSIKMPDDVEQKLH-LPLLGITPTVEGAEI----
A0A1Z3HMQ0      -YIAAGGAV-GLLLGVAMAFFLDLIDKSIKTVKDGEALLG-YTLLGLIPKFGLLGNDGPD
K1XF69          -LAL-GVMG-GLVASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGIIPSFAAPPFYRYL
B5W297          -LAL-GVMG-GLVASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGIIPSFAAPPFYRYL
A0A6H2AL05      -LAL-GVMG-GLVASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGIIPSFAAPPFYRYL
H1W7M8          -LAL-GVMG-GLVASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGIIPSFAAPPFYRYL
A0A5Q4H6A5      -LAL-GVMG-GLVASTTLLLLMEMGDKSLRTVAETRDLLG-YTLLGIIPSFAAPPFYRYF
D5A466          -LAL-GVMG-GLVASTTLLLLMEMGDKSLRTVAETRDLLG-YTLLGIIPSFADPPFYRYF
U5QJM6          -TLGVGSIL-SVVFGLLVAVLLETFDDRVKTVERAKELMQ-LPLLGAIPYNDELNTTAKS
A0A1Z4RPC6      -IAL-GVLM-GLFLSNLTVILLEMQDRTLKTIPEVKRKFG-YQVLGIVPFDSFQDS----
A0A2T1CMZ0      -IVL-GVLT-GLFLANLTAILLEMQDHSLKTISEIKQKFA-FQVLGIVPLDTLQNN----
L8M4F7          -LAL-GVMG-GLFFSNAAVLLLETRDRSLKTIGEIRKKLP-HTILGIIPIDDDARS----
A0A140K2P2      -MLV-GILL-GLLLSNLSVLLVEMQDRSLKTVAEIKNKFG-YKVLGLVPKHAAEEN----
K9XWX4          -MLV-GILL-GLLLSNLSVILVEMQDRSLKTVAEIKNKFG-YNVLGLVPKHEAEDN----
A0A140KB14      -MVL-GVIL-GLLLSNLSVLLLEMQDRSLKTMSEIKQRFP-YKVLGLIPQYSDDEP----
K9XX88          -MVL-GLIL-GLLLSNLSVLLLEMQDRSLKTIPEIKQRFP-YKVLGLIPQYTDDEP----
A0A563VSV6      -MLL-GILM-GLLLSNLTAIYLDMQDRTIKTIADIKKKLP-YKVLGIVPINELSDR----
L8LZE9          -MAL-GILS-GLLLSNLTAIILDKQDRSLKNISEVKKKLP-YKVLGIIPENKFAKR----
A0A433NM31      -NFALGGVA-GIILAVFIALARDAVDTSIKTLREAKEVLG-YTVLGVIPNFDKIDKLNSR
A0A1Z4NDS1      -IIAAGAIA-GFLCGVITAFALDLIDSSLKTVQEARELFR-YTLLGVIPQIPRNSKRKSE
K9F4D9          -FLMTGGFA-GLLLGLITAFMADLLDQSVKTVQEGQELYE-YPLLGIIPAWKRGNAKGSD
U9VXM0          -FLLAGGFV-GFLLGLIAAFFADIIDQSITTVQEGQELYE-YPLLGIIPAWKRNNAKGTD
A0A6I5QPI5      -YLVAGGFM-GVLLAIATAFLLDLLDSSVKTVKEVKELYG-YTVLGVIPLVKGAGRSEAE
A0A433W533      -ILAAGILL-SVVLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAIPSLTKKAAADGK
A0A2P8QWJ3      -ILAAGILL-SVVLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAIPSLTKKAAADGK
A0A2T1FKP8      -ILAAGILL-SVVLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAIPSLTKKAAADGK
K9U6L7          -ILAAGILL-SVVLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAIPSLTKKAAADGK
A0A1E5QP61      -LVAAGVVG-GSMLYVLTAFLLELMDPSIKTAKELRMLFR-YTLLGMIPA----TKKRFG
U5DPF5          -ILMAGGIV-GALIGTATAITLDVRDQSLKTVQEAKNRLG-YVMLGSIPLFGRFNRPVDG
A0A3M1PML8      -FLIAGSLA-GMLLGVATAFGLDLFDRSIKTVKEAKEALG-YTLLGVVPAFSRNAKSNVP
A0A3M2GIL5      -YLAAGIVA-GGMLYVVTAFLLELIDPSIKTAKEVREVFR-YTVLGMIPKYRKKG--FFF
A0A6H1TSJ9      -YLAAGIVA-GGMLYVVTAFLLELIDPSIKTAKEVREVFR-YTVLGMIPKYRKKG--FFF
A0A0T7BPZ0      -ILGGAGFF-GLLVGIIAALALDLLDQSVKNVKQAKEIFG-YTLLGVIPQMNRSSKSSSG
A0A352X442      -IAAGGVVV-GGLLGIAVAFLVDLIDHSVKNVKEAKELFG-YTLLGVVPAFGKLGNRGFS
A0A6B3NF44      -ILAAGGMV-GILLGVTTAFLLDLIDSSVKTVKEAKELFS-TTLLAVIPAYGKPGKANYL
A0A0M0SHU3      -VVLGGGVL-GALLGIIAALAADLIDRSIKTVKEAREVFQ-YTLLGVIPSVSRTGKSGYS
A0A1D2PBN3      -MITGGGVL-GILLGVIAAFTLDLIDRSVKTVKEARELFK-YTLLGVIPSINSNSKKSSF
A0A0C2LVR7      -VITGGGVL-GILLGVIAAFSLDLIDRSVKTVKEARELFK-YTMLGVIPSINSNSKKSSF
A0A1Z4PQB9      -MITGGGVL-GILLGVIAAFTLDLIDRSVKTVKEARELFK-YTLLGVIPSISSNSTKSSF
A0A1Z4SFN6      -IIAGGGVL-GILLGIMAAFTLDLIDRSLKTVKEARELFQ-YTLLGVIPLVGGNGKKSYY
K9PGI8          -IVLGGGIF-GAMLGLIAALTLDMIDRSVKTVKEARELLQ-YTLLGVIPLVGRNTKNSSL
A0A2T1E9V8      -SMIAASLA-GILVAGAVVYFLELTDKKIKTVKEARELFD-YRLLGTIPIFNKIA-----
A0A3M2GQQ6      -NLLLGLIA-GGLLGVAAAILVERSDQRVKHVDEAKELTG-LPSLGMIPKVSCP------
A0A6H1U2X0      -NLLLGLIA-GGLLGVAAAILVERSDQRVKHVDEAKELTG-LPSLGMIPKVSCP------
K9SGJ5          -NLVFGGFA-GILFGVAIAMYLERSDERIREVEEVRELTH-VPLLGSIPRTDMLELSP--
A0A6C2DSN4      -SLFISAIA-GLGLGVLIALLLDRLDQRIREVEEVREIID-VPLLASIPMTEVASLAP--
L8MYT6          -SLFISAIA-GLGLGVLIALLLDRLDQRIREVEEVREIID-VPLLASIPMTEVASLAP--
A0A352JGJ6      -SLIAGTFI-GLTLGILCALLFNRLDQRIREVEEVKEIID-IPLLASVPLTEVASLSA--
A0A1J5GLS2      -NLMTGAFV-GAVLGILSALALDRLDQRIREVEEVKEIID-VPLLASIPITEVTSLSA--
A0A2W4W6M5      -GLIAGAFF-GLVLGISSALILNRLDQRIREVEEVREIID-IPLLASIPMTEVASLSA--
A0A2W7AN33      -NLFVGGIS-GLALGVLLALLLNRLDQRIRDVGEVREIID-VPLLASIPFTDPVALIS--
A0A256BLV2      -SLITGAIS-GIALGILFALLLNRLDQRIREVEEVRELID-IPLLASIPMTEVSSLSA--
A0A2W6ZXF3      -SLITGAFV-GAVLGILSALALDRLDQRIREVEEVKEIID-IPLLASIPMTEVASLSA--
A0A2Z5WX66      -SLIIGALG-GLVLGVLFALLLNRLDQRIREVEEVKEIID-IPLLASIPMTEVASLGA--
K9W1T3          -NLAVGGLL-GILLGIAVALALETTDKSIKDPEDAKRILG-YPLLGTIPIIEHMDSSTTI
A0A1Q4RTR1      -NLALGGFL-GIILAVGAALTLEALDGTVKTIEEAQELLG-YALLGTIPRLSVSRHYRN-
A0A1Z4SQV2      -NLALGGFL-GIILAVGAALMSEALDGSVRTLSEAQELLG-YSLLGTIPRLSITRPHRN-
A0A2H2XGN1      -NLALGGFL-GIILAVGAALMSEALDGSVRTLSEAQELLG-YSLLGTIPRLSITRPHRN-
A0A433UXH8      -NLALGGFL-GIILAVGAALTLEALDGTVKTIEEAQELLG-YALLGTIPRLSVSRHYRN-
A0A1Z4RMB9      -LMGLGVIL-GAFLANLSIILLEMQDRSLQSLAEIKKKFA-YNVIGMTPLEP--------
B4WP72          -ILIAGILA-GSLVGISAAFAQDLLDRSIKTLNDCREQFG-YALLGAIPLFNETSNLHRS
A0A318B4H2      -TLLVSLLI-GLVLAVGLVVLAEEIDQSLRDPADVQRELG-LPLLGTIPKVEDKDV----
B4WQE3          -SLLVGPIL-GLLLGSGIALLVDRVKGKICTVRELKDLTN-VPLLATIPYNHLLEGSKAS
A0A2K3BR24      -NLALGGIL-GAMLGIATALALDARDRTVKTVQEVKDRLG-YTVLGSIPLVKTKM-----
K9YXY1          -NLALGGIL-GAMLGVATALALDARDRTVKTVQEVKDRLS-YTVLGSIPLVKTKM-----
A0A1U7HGH0      -ALAAGSLA-GLMIAGGIVYLLELTDKKIKTAKEAREIFE-YKLLGTIPLFHNESQTERE
K9XJD3          -ALAAGSLA-GLMIAGAIVYLLELTDKRIKTAKEAREIFE-YKLLGTIPLFHNDSQTERE
K9SX01          -NLTTGAVL-GIVAAISVALLLNSRDNLLRSGEDIKRLFG-YPLLGILPNFATRKLENLP
A0A4P7ZT55      -NLMLGLLL-GAMAGAGAALLRDRLDHVFHSPRDVEQGID-QPLLGSIPFLPLERFQ---
A0A1E5QIR9      -NFGLGGVV-GIFLAVVTALVLDAKDTRIKTVREAREYLG-YTLLGIIPNFEKIDKGLSY
A0A1Z4IBC7      -FVIGGGAV-GIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNS
A0A1W5CPC7      -FIIGGGVA-GIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNT
A0A5Q0GKD1      -FIIGGGVA-GIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNT
Q3MDC6          -FIIGGGVA-GIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNT
A0A1Z4KM73      -FIIGGGVA-GIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNG
Q8YNX7          -FIIGGGVA-GIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNG
A0A367R4K6      -FIVGGGAI-GFFLGIIAAFSLDLIDRSVKTVKEAKEVLR-YTVLGVIPTLG-----RNG
A0A1E2WSV8      -FIVGGGGI-GLFLGIIIAFGLDLIDRSVKTVKEAKEVLR-YSVLGVIPTQG-----RNG
A0A2R5FRT9      -FIVGGGGI-GLFLGIIVAFGLDLVDRSVKSVKEAKEVMK-YSVLGVIPTQS-----KNG
A0A2K8T1B6      -FIVGGGGV-GLFLGIIVAFGLDLIDRSLKTVKEAKEVLR-YSVLGVIPTQS-----RNG
A0A235I9I0      -FIIGGAGV-GFFLGIIVAFTLDLIDRSVKTVKEAKEVLR-YSVLGVIPTQG-----RNG
A0A2D0HQT8      -FIIGGAGV-GFFLGIIVAFTLDLIDRSVKTVKEAKEVLR-YSVLGVIPTQG-----RNG
A0A2L2NU95      -FIVGGAGV-GFFLGIIVAFTLDLIDRSVKTVKEAKDVLR-YSVLGVIPTQA-----RNG
A0A367S084      -FIIGGAGI-GFFLGIIVAFTLDLIDRSVKTVKEAKEVLR-YSVLGVIPAQG-----RNG
A0A0V7ZFJ4      -NLLLGGIG-GILLGVGTALLLERTDKSLKTVDKIKQLLD-YPLLGTIPKTPKTTKGST-
A0A367RIS1      -NLALGGFL-GFFLAIAAALLLEAGDTSVKTTEEAQELLD-YPLLGTIPVFEQKDKLAR-
A0A235IXQ2      -NLALGGFL-GFFFAIGVALLLEAGDKSVKTAEEAQHFLD-YPLLGKIPVFDQKARLAR-
A0A1W5CNX3      -NLALGGFL-GFFLAIGAALLLEAGDKSVRTQEEAQQLLD-YPLLGTIPAFDQKARLAR-
A0A5Q0GJJ5      -NLALGGFL-GFFLAIGAALLLEAGDKSVRTQEEAQQLLD-YPLLGTIPAFDQKARLAR-
Q3MEB7          -NLALGGFL-GFFLAIGAALLLEAGDKSVRTQEEAQQLLD-YPLLGTIPAFDQKARLAR-
A0A1Z4KHN9      -NLALGGFL-GFFLAIGAALLLEAGDKSVRTLEEAQQLLD-YPLLGTIPVFDQKVRLAR-
Q8YT70          -NLALGGFL-GFFLAIGAALLLEAGDKSVRTLEEAQQLLD-YPLLGTIPVFDQKVRLAR-
A0A218Q4C1      -NLALGGFL-GILLAFGSALLLDAVDKSVQTAEEAEKLFD-YPLLGKVP------KLLR-
A0A166IWU6      -NLALGGFL-GILLAVGSALFLDALDKSVQTAAEAEQLLD-YPLLGKIP------KMIR-
A0A2S0Q8C0      -NLALGGFL-GILLAVGSALLLDALDKSVQTAAEAEQLLD-YPLLGKIP------KMIR-
W6FSX4          -NLALGGFL-GILLAVGSALLLDALDKSVQTAAEAEQLLD-YPLLGKIP------KMIR-
A0A0V7ZNJ9      -NLLLGGFL-GILLGAGTALILETMDKSLKTVDQAKRLLN-YPVLGTIPQFEGKG-----
A0A0R0M9H9      -NIGIGALV-GLVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIPQYENTKRRKNQ
A0A1S1ZVW2      -NIGIGGIV-GLVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIPQYENTKRRKNQ
A0A1B7WX82      -NLAMGGFL-GILLGAGTALLLESMNQALKNVEEANRLLG-FPLLGMIPLYGGKNPKN--
A0A1B7WTD1      -NLALGGFL-ALLLGAGTALLLESMNQTLKNIEEANRLLG-FPLLGTIPLYGEKKTKN--
A0A480ABC0      -NLALGGFL-GLLLGAGTALLLESMNQTLKNIEEANRFLG-FPLLGTIPQYGEKKRKN--
A0A1Z4LRU5      -NLALGGFL-GILLGVGTALILEAMDKSLKTLDEAKKLLG-YPLLGTIPRVDE----K--
A0A1Z4JVB4      -NLALGGAL-GILLGIGVAILLEAMDSSLKTVEQAQDLLD-YPLLGIIPKVETAKGNH--
K9PIA4          -NLALGGFL-GILLGLGTALVLESMDNSLKNVEEVKRLLG-YPVLGTIPLAEKVKGSD--
A0A1Z4HVE1      -NLALGGFM-GIMLGLGTALILEAMDNSLKTIEEVKRLLG-YPLLGTIPLAEKVKDSD--
A0A252ECZ1      -NLALGGFL-GILLGVGTGLLLEAMDTSLKTIEEVKHLLD-YPLLGIIPLAEKAKGSD--
A0A1Z4G5Y1      -NLGLGGVL-AIALGVGAALMLEAADNSLKTIEEVKRLLD-YPLLGTIPLAEKPKGVD--
A0A252DNA2      -NLGLGGVL-GILLGVGVALMLEATDNSLKTIEEVKRLLD-YPLLGTIPLAEKPKGSD--
A0A252E1Q4      -NLGLGGVL-GILLGVGVALMLEATDNSLKTIEEVKRLLD-YPLLGTIPLAEKPKGSD--
A0A6G9SK36      -NLALGGLL-GIVLGAGTALVLESIDNSLKTVEEAKRILE-YPLLGAIPLSEKAKNIE--
A0A1Z4M597      -NLALGGIL-GIILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAIPQAEKAKGSE--
A0A1Z4MWT1      -NLALGGIL-GIILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAIPLAEKAKGSE--
A0A1Z4TX53      -NLALGGIL-GIILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAIPLAEKAKGSE--
A0A5P8VSD1      -NLALGGFL-GFFLGIGAALLLEAEDKSVKTAEEAQQLLD-YPLLGTIPLFDQKTRLAR-
A0A2A2TNQ5      -NLALGGFL-GVLLGAGTALLLEALDKSLKNVDEAKRLLG-YPLLGTVPNLAEK------
A0A3S1C4K5      -NLALGGVL-GIILGVGAALVLEAMDKSLKSVEEAKRLLG-YPLLGTIPQLGGS------
A0A1X4G3D5      -NIGIGAIL-GVILGVGTALVLESLDKSVKNIEEINRLLD-LPLLGSIPNFETKKRKNKG
D4TNI2          -NIGIGAIL-GVILGVGTALVLESLDKSVKNIEEINRLLD-LPLLGSIPNFETKKRKNKG
A0A1Z4H6Z8      -NVALGGFL-GILLGVGAALMLEATDNSLKTIEEVKRLLG-YPLLGTIPLAEKPKGSN--
A0A1Z4NPM1      -NLALGGFL-GVLLGAGSALLLEALDKTLRDIDEAKRLLG-LPVLGTIPQLMDKKGK---
A0A3F3KPR9      -NIGIGALV-GVVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIPQYENTKRQKNA
D4TGN7          -NIGIGALV-GVVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIPQYENTKRQKNA
A0A1Z4UZW9      -NLALGGFL-GIILGAGTALVLESMNQSLKNIEEANRLLG-FPLLGTIPLYIGKNPKNP-
A0A0K2M5H0      -NLALGGFL-GVILGAGTALVLESMNQSLKNIEEANRLLG-FPLLGTIPQYGEKNPKNR-
A0A1B7VSH4      -NLALGGFL-GVLLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTIPQHGEKNPKNP-
A0A1B7W126      -NLALGGFL-GVLLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTIPQHGEKNPKNR-
A0A3D4C6Q6      -NLALGGFL-GVLLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTIPQHGEKNPKNR-
A0A1B7UVJ4      -NLAMGGFL-GILLGAGTALLLESMNQALKNVEEANRLLG-FPLLGMIPLYGGKNPKNQ-
A0A1B7UTR1      -NLALGGFL-GILLGVGTALLLESMNQSLKNVEEANRLLG-FPLLGMIPLYGGKNPKNQ-
K7W0A4          -NLALGGFL-GILLGAGTALLLESMNQSLKNVEEANRLLG-FPLLGAIPQYGEKNPKHR-
A0A5C0DRW9      -NLALGGFL-GILLGAGTALLLESMNQSLKNVEEANRLLG-FPLLGTIPQYGEKNPKHR-
A0A6H2C088      -NLALGGFL-GILLGAGTALLLESMNQSLKNVEEANRLLG-FPLLGTIPQYGKKNPKNR-
A0A2T1CIL7      -LITLIGSAMGVLLATAFAFLLDFKDRSIKNSKEAEEIFG-YPLQGVIPDSGYSAETTVS
A0A433V7A0      -ILGLGGLV-GTLLATATIFVLELTDKSIKNIEEARKIFD-YTLLGVIPYYGSFEKHSSR
A0A2T1FTR8      -NIAIGGFL-GLFLGAATAFLLDGADKRIKTSEEAKSLLPGYPILGQIPVFEKSRQLPKL
K9UA41          -NIAIGGFL-GLFLGAATAFLLDGADKRIKTSEEAKNLLPGYPILGQIPVFEKSRQLPKL
A0A0C2LBE2      -IIGAGGIL-GVLFGAVAAFALDTIDPSLKTVKQAKELFK-YTLLGVIPLTG-----RNQ
A0A433NN38      -LIAAGGIL-GILLGVVAAFSLELVDQSVKTLKEAKELFQ-YTLLGVIPNLS-----RYG
A0A2N6K0T2      -IAAGGGVL-GILLGIIAALAADLIDRSIKTVREARELFQ-YTLLGVIPSVS-----KTS
A0A2N6ML72      -IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNN
G6FQZ6          -IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNN
A0A2N6MQX9      -IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNN
A0A2N6KXT6      -IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNN
A0A2N6KGB9      -IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNN
A0A2N6L3Y5      -IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNN
A0A0S3TIS7      -IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNT
A0A1U7GW28      -IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNT
A0A2N6LW63      -IAAGGGVL-GIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIPNVS-----RNT
A0A328IH74      -IVFGGGVL-GILLGIITALASDLIDRSIKTVKEARELFQ-YTLLGVIPSVS-----RSG
A0A4D9CIB0      -IVFGGGIL-GILLGIITALASDLIDRSIKTVKEARELFQ-YTLLGVIPSVS-----RSG
A0A1Z4TQ63      -IVLGGGVL-GILLGIIAALTSDLIDRSIKTVREARELFQ-YTLLGVIPSVS-----RSG
A0A4Q9J8G2      -IVFGGGIL-GILLGIIAALISDLIDRSIKTVKEARELFQ-YTLLGVIPSVS-----RSG
A0A1Z4SMD6      -ALAGGGVFGGLLFGVAVAFFIDLIDNSLKTVKEAEVLFD-LTLLGLIPKFEPSPSTVPS
A0A2H2Y096      -ALAGGGVFGGLLFGVAVAFFIDLIDNSLKTVKEAEVLFD-LTLLGLIPKFEPSPSTVPS
K9S8M8          -VLMGGMVV-GGMLYLIVAFVFELIDPTVKTAKEIRNLYQ-YTLLGMIPRSKKKRWWFGS
A0A1Z4NFV0      -LIGVGGVFAGLSLGIAAAFLIDLVDRSIKSVKEAESVFG-YTLLGLIPRFDSSV--SSN
B0CAX4          -NLAVGFFL-GGLLGLGTALLLEALDTSVKTVQEATGLFD-YTVLGNIPLLKDAEKMTRK
A0A350Y0P6      -ILVGGIVA-GSLLYIVTAFVLDLMDPSIKTAKEIRQLFK-YTWLGMIPESRKKGFFWRQ
A0A352X940      -ILGGGIIA-GSLLYIIVAFVLDLMDPSIKTAKEVRQLFR-YTWLGMIPNLRKKGLLSRR
B8HTN4          -NLILGTIL-GSLGAIVVIFILESKDKTLKSLEEIQQYFD-YVTLAMIPFDKAAA--TAN
A0A2A2TPF8      -YLAAGGVFVGLMFGIAAAFLIDIIDRSIKTIKEAETIFG-YTLLGLIPKFETN------
A0A1Z4R0P8      -YLAAGGIFVGLMLGIAAAFLIDIIDRSIKTTKEAQNIFG-YTLLGLIPKFSTN------
A0A0T7BUI3      -MLALGSLFAGSLLGIAGAFFVDLIDRSLKTVKEAENFFG-WTLLGLIPRFEAN------
A0A1Z4LP32      -MLAGGGVFVGLLLGIAAAFTVDLIDRSLKTIKEIEEFFG-YTLIGLIPKFEPN------
K9REP9          -LLAGGGVFVGLLFGIAAAFTVDLIDRSLKTVKEIEGFFN-YTLVGLIPKFEPD------
A0A1Z4SIJ3      -LLAAGSAFAGLLFGVSIAFFVDLIDNSLKTIKETEAFFE-YPLLGLIPKFESN------
A0A2H2XPG4      -LLAAGSAFAGLLFGVSIAFFVDLIDNSLKTIKETEAFFE-YPLLGLIPKFESN------
K9V3C7          -LLAVGGVFVGVFLGIAAAFLVDSIDKSIKTIKEAQTLFG-YTPLGLIPKFDAN------
A0A1Z4T6Y7      -LLGAGGIFIGALLGVAAAFLVDVIDKSIKTVKEAQDVFG-YTMLGLIPKFE-N------
A0A2H2Y561      -LLGAGGIFIGALLGVAAAFLVDVIDKSIKTVKEAQDVFG-YTMLGLIPKFE-N------
A0A1Q4S362      -LLGAGGIFIGALLGVAAAFVVDVIDKSIKTVKEAQDVFG-YTLLGLIPKFDTN------
A0A3S1CIN8      -LLGAGGIFIGTLLGVAAAFLVDVIDKSIKTVKEAQDVFG-YTLLGLIPKFDTN------
A0A2A2TC28      -LLLGGGVFVGLLVGIASAFFIDLIDRSLKTVKESEKFFG-YTMLGFIPKFEPN------
A0A0C1NCB0      -LLPVGGILGGLLLGVAAAFFVDLVDRSLKTAKEAEEFFK-YTVLGLIPTFESSTKSSSE
A0A2N6K7Q9      -LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKPN------
A0A2N6MXH6      -LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------
A0A2N6M5A8      -LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------
A0A2N6LL61      -LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------
A0A0S3TP66      -LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------
G6FP91          -LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------
A0A1U7GYR5      -LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------
A0A2N6KY52      -LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------
A0A2N6KMP5      -LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------
A0A2N6MA45      -LLAGGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKLN------
A0A4Q9J9V9      -LLASGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKPN------
A0A328IGA1      -LLASGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKPN------
A0A4D9CE41      -LLASGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YILLGLIPKYKPN------
A0A0M0SFT2      -LLASGSIFAGVLISIAAAFFVDLIDRSLKTIKETETFFG-YTLLGLIPKYKPN------
A0A1Z4TLC8      -LLATGSIFAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIPKYKPN------
A0A0C2LFH0      -LLAGGSVFVGLLLGTAAAFFVDLIDRTLKTVKEAETFFG-YTLLGLIPKFESK------
A0A1Z4IYV4      -LLAGGGVFVGLLLGIAAAFFVDLVDRSLKTVKEAETFFG-YTLLGLIPKFESN------
A0A1Z4Q0T6      -LLVGGGVFVGLLLGVAAAFFVDLVDRSLKTVKEAETFFG-YTMLGLIPKFESN------
A0A0C2PT44      -LLAGGGVFVGLLLGVAAAFFVDLVDRSLKTVKEAETFFG-YTMLGLIPKFESN------
A0A1D2P6J4      -LLAGGGVFVGLLVGVAAAFFVDLIDRSLKTVKEAETFFG-YTLLGLIPKFESN------
A0A3M9ZEU1      -YLLAGGIV-GALLAITTAFLLDLCDRSIKTVQEAKALFG-YTLLGLIPDYT-----KLG
A0A1Z4JK72      -LLAAGTMI-GLLLGVAAAFFRDMMDKSLKTVKEAEAQYG-YTMLGLVPKFE-----TSD
A0A0N7Z489      -LLAAGAMV-GLLLGIAAAFLVDTIDKSLKTVKDAEAQYG-YTLLGLVPRFE-----TSD
A0A0S3TXS2      -LLAAGAMV-GLLLGIAAAFLVDSIDKSLKTVKDAEAQYG-YTLLGLVPRFE-----TSD
A0A1Z4RN12      -IVAAGAMM-GALFGMALAFLLDLKDNTIKNTQEVENLFA-YPLHGVVPNLNLTG--ERK
A0A2T1CMF9      -IVAAGAMM-GLLFGTALAFLLDLKDNTIKNTQEVENMFA-YPLHGVVPDLSLGG--NNQ
Q7NDC5          -NLAAGGVL-ALILAALAAYTREFFDDSLRSVEEARGLLG-TSLLGSVPRWN--------
U5QGK3          -NLGAGALL-GAILAMLVAYGREFFDDSLQTVEEATSLLG-TPLLGTIPRWT--------
A0A2W4UY24      -YLLAGGVV-GALLGIAIAFLADLLETSVKTVTEGQKLYD-YPLLGVIPDWR-KR--TAR
A0A2T1GMT4      -IGILGGLV-GALFGTSAIAYLELRDGSLKTVKEIDKVFG-YTLLGMIPATQRKK--NRA
K9UI51          -LGILGGLV-GALLGTSAIAYLELRDSSLKTVKEIDKIFG-YTLLGMIPATQKKK--IRS
K9QM62          -VVVLSVMF-GAFLSTTTVLLLEMRDRSLKTLQEIRQVFE-YTLLGIIPTSP-VS--HKT
A0A1Z4FWI3      -VWLLGILL-GAFLSTTAVVFLETRDRSLKTLNEIREIFGRYTLLGIVPSST-KK--LRS
A0A1Z4JYE7      -VLVIGAMF-GLFLATSTILLLEIKDKSLKTLDKVKEAFNGYTLLGIIPLLP-QK--TIS
A0A2T1FXY4      -VLVLGTMF-GALLSTSTVLFLELRDRSLKTLEEIRQRFS-YTLLGVIPLVG-NK--VRS
K9TYI2          -ILALGIMI-GALLSTSTVLFLELRDRSLKTLEEIRQRFR-YTLLGVIPLVA-NK--VRS
A0A1Z4QL41      -VLLLGGTL-GVFLASSTIFILEMRDSSLKTVNEVREIFG-YTLLGMMPLLA-KK--VPF
A0A252D4T4      -VLVLGILL-GAFLATTAVIFLETRDRSLKTLKQIREIFG-YTLLGIVPSST-KK--LRS
A0A252DJH5      -VLVLGILL-GAFLATTAVIFLETRDRSLKTLKQIREIFG-YTLLGIVPSST-KK--LRS
A0A252EB80      -VLVLGILL-GAFLATTAVVFLETRDRSLKTLKQIREIFG-YTLLGIVPSST-KK--LRS
A0A6G9SKZ9      -VLVLGVLL-GAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVPSST-KK--IRS
A0A1Z4HPW5      -ILVLGVLL-GAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVPSST-KK--IRS
A0A1Z4MSN1      -ILVLGVLL-GAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVPSST-KK--IRS
A0A1Z4U1C2      -ILVLGVLL-GAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVPSST-KK--IRS
A0A0D6KV51      -ILVLGVLL-GAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVPSST-KK--IRS
A0A1Z4MKF8      -ILVLGVLL-GAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVPSST-KK--IRS
A0A2C6WC43      -VLLLGIML-GLFLATTTVLFLGMRDRSLKTLREVRDIFR-YTLLGIVPLSV-KK--VRS
A0A1Z4L5A1      -VLLLGVMF-GLFLATTTVLFLGMRDRSLKTLKEVRDVFG-YTLLGIVPLSV-KK--VRS
A0A367QD86      -VLLLGVMF-GLFLATTTVLLLGMRDRSLKTLKEVRDVFR-YTLLGIIPLSV-KK--VRS
A0A235IZ96      -VLVLGVMF-GLFFATTTVLFLAMRDKSLKTLREVRDVFG-YTLLGIVPLSV-KK--VRS
A0A2L2NGP0      -VLVLGVMF-GLFFATTTVLFLAMRDKSLKTLREVRDVFG-YTLLGIVPLSV-KK--VRS
A0A2K8SM78      -ILLLGVMF-GLFLATTTILFLSMRDRSLKTLKEVRDVFR-YTLLGIIPLSV-KK--VRS
A0A2R5FPC0      -ILLLGVMF-GLFLATTTVLFLSMRDRSLKTLKEVRDVFR-YTLLGIIPLSV-KK--VR-
A0A5P8W5T6      -VLLLGVMF-GLFLATTAVLFLSMRDRSLKTLKEVRDIFR-YTLLGIVPLSV-KK--VRS
A0A140KBA0      -IVAAGGLL-GGLLGIAVAFLLDLKDNSLKNSQEIEEIFG-YPLQGVIPDLA-KEGSPNL
K9XSG1          -IVAAGGLL-GGLLGIAVAFLLDLKDNSLKNSKEIEEIFG-YPLQGVIPDLE-KEGSPHL
A0A0F5YE28      -LIALGIML-GLVGATTSVLILAMGDQNIRTVEEAKKTFG-YTLLGIIPMFK-NK--RFS
U7QEH7          -LLALGIML-GLVAATTSVLLLEMGDKYIRSVEETKKIFG-YTLLGIIPMFK-NK--RLS
A0A3S1ATK5      -VVAIGVLL-GAFFGTTTILLLEMRDRSLKTLQEVRDIFG-YTLLGILPSLS-KK--SLF
A0A2Z6CPH0      -ILVMGVMF-GAFLSTTTVLFLEMRDKSLKTLKEIREVFE-YPLLGVIPLSA-HK--THS
A0A1Z4GT50      -VLSLGVLL-GLFLSTSAVAALETRDRSLKTLKEVKEIFG-YTLLGMLPLST-KK--GRS
A0A1Z4GIX0      -FIALGLTF-GAFLSTSAVLFLEMRDKSLKTLKEIREVFG-YTLLGGIPLST-NK--MRS
A0A2H6LC24      -FIALGLTF-GAFLSTSAVLFLEMRDKSLKTLKEIREVFG-YTLLGGIPLST-NK--MRS
B2J6N5          -VLVLGVMF-GLFLATTTVLVLGMRDRSLKTLQEIRDIFR-YTLLGIVPLSV-KK--IHS
A0A367RMI4      -VLVLGVMF-GLFFATTTVLFLAMRDRSLKTLKEIRDVFR-YTLLGIVPLSV-KK--LRS
A0A235HUM0      -VLVLGVMF-GLFFATTTILFLAMRDRSLKTLKEIRDVFG-YTLLGIVPLSV-KK--LRS
A0A2L2NW47      -VLVLGVMF-GLFFATTTVLFLAMRDRSLKTLKEIRDVFG-YTLLGIVPLSV-KK--LRS
A0A1E2WUR1      -VLVLGVMF-GLFFATTTILLLAMRDRSLKTLKEVRDIFG-YTLLGIVPLSV-KK--LRS
A0A235IKU3      -VLVLGVMF-GLFFATTTVLFLAMRDKSLKTLREVRDVFG-YTLLGIVPLSV-KK--VRS
F4XKF3          -VLALGVML-GVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIPVFK-HK--KLS
A0A1D9FX10      -VLALGVML-GVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIPVFK-HK--KLS
A0A1D8TNX9      -VLALGVML-GVTLATTAILLLEMRDRSIKTLKEVKQLLR-YPVLGVIPVFK-HK--KLS
A0A1U7MYU6      -VLALGVML-GVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIPVFK-HK--KLS
A0A3C0NJ41      -TLLFGGTA-GTLLGMATIILLEVRDVSLKTLKEVREQFG-YTLLATIPLLG-KK--PRR
A0A352AG88      -PVVGGGAL-GILLAIVTIITLEVRDTSIKTLREVRELFG-YTLLGVIPSLT-KK--GIS
A0A350Y374      -ILLLGAMA-GTLLAMATIIILEVRDNSIKTLKEVKDLFG-YTLLATIPTFG-KK--TVS
A0A355DPX0      -ILLLGAMA-GTLLAMATIIILEVRDNSIKTLKEIKDLFG-YTLLATIPTFG-KK--TVP
A0A0D8ZUV2      -ILGLGVIV-SALLAGATIIILEVRDTSVKTLKEAQELFG-YTFLGTIPMLG-KK--ANS
A0A433VDI0      -ILALGNML-GILLAAATIVILEVKDTSIKTLEEALELFG-YTLLGVIPALN-KK--AIP
A0A3D1PG43      -ILGLGSVL-ATLLATGTILILEISDRTIKTLREVRDAFG-YTVIACIPHV--GKKVGFR
A0A2P8QQ72      -TLGLGGIA-AILLAIATITLLELSDASIKTLREVKQLFG-YTLIGSIPQL--GKFIKLK
K9TZQ7          -TLGLGGIA-AILLAIATITLLELSDASIKTLREIKQLFG-YTLIGSIPQL--GKFIKLK
A0A2G7GPR0      -ILALGNVL-ALILAILTICILELSDRSVKTLREARERLD-YTLLGTIPYF--GK--RYA
K9XH68          -ILALGNIL-ALILAILTICILELSDRSVKTLREARERLD-YTLLGTIPYF--GK--RYA
A0A1U7HW70      -ILALGNIL-ALILAILTICILELSDRSVKTLREARERLD-YTLLGTIPYF--GK--RYA
A0A2S6VEJ8      -ILALGNVL-ALILAILTICILELSDRSVKTLREARERLD-YTLLGTIPYFG-GK--RFA
                          .                                     .           

K9SLA9          MRKSAK------------------------------------------------------
A0A168TT23      ------------------------------------------------------------
A0A0M1JWX9      SW----------------------------------------------------------
A0A2T1M1V6      DE----------------------------------------------------------
A0A2G7GCS2      SG----------------------------------------------------------
K9XBH8          SA----------------------------------------------------------
A0A1Z4LJ30      KL----------------------------------------------------------
K9RI76          KL----------------------------------------------------------
A0A352AE27      TT----------------------------------------------------------
A0A3B8JH60      GT----------------------------------------------------------
A0A3C0N766      GT----------------------------------------------------------
K9W9J7          GT----------------------------------------------------------
A0A139WSU3      TS----------------------------------------------------------
A0A433VN22      AI----------------------------------------------------------
Q7NF11          GD----------------------------------------------------------
A0A1Z4JCS8      SF----------------------------------------------------------
F4XTX2          GT----------------------------------------------------------
Q7NJN6          SA----------------------------------------------------------
U5QCC3          -I----------------------------------------------------------
A0A3S0Y9N9      VVKNKPDS----------------------------------------------------
A0A433UNK7      IVKNQPDS----------------------------------------------------
A0A3M1SVZ4      RRSIPQII----------------------------------------------------
A0A654SFI6      INSASD------------------------------------------------------
K9SSQ0          SLELISER----------------------------------------------------
A0A2W1JIN9      PASFYENS----------------------------------------------------
A0A318AJV1      GRRWFRSR----------------------------------------------------
A0A6B3MUB5      PEQFLDDL----------------------------------------------------
A0A1U7N2U4      PKGFLEDM----------------------------------------------------
A0A1D9G1F2      PNRFLEDM----------------------------------------------------
F4XV38          PNRFLEDM----------------------------------------------------
A0A2P8QIL5      ADALMQEP----------------------------------------------------
A0A2T1FLY5      ADALMQEP----------------------------------------------------
A0A433W447      ADALMQEP----------------------------------------------------
K9U1K8          ADALMQEP----------------------------------------------------
K9UYB2          ANFFFNEI----------------------------------------------------
A0A218QN17      AERFLDNI----------------------------------------------------
K9RKN2          SDRFLDQV----------------------------------------------------
A0A2I8ADV2      AEKFLDDV----------------------------------------------------
A0A1W5CKM3      AEQFLDDL----------------------------------------------------
A0A5Q0GMF5      AEQFLDDL----------------------------------------------------
Q3MEW0          AEQFLDDL----------------------------------------------------
A0A1Z4KIC7      AEQFLDDL----------------------------------------------------
Q8YSM5          AEQFLDDL----------------------------------------------------
A0A1Q4S1H4      ADLFLDDM----------------------------------------------------
A0A433VBU6      ADLFLDDM----------------------------------------------------
A0A1Q4RZJ6      ADGFLDNV----------------------------------------------------
A0A1Z4SNV3      ANRFLDNV----------------------------------------------------
A0A2H2XJQ1      ANRFLDNV----------------------------------------------------
A0A3S5K358      ADGFLDNV----------------------------------------------------
A0A0T7BPJ4      ADTFLDDI----------------------------------------------------
A0A0C1QS61      SQRFLDNM----------------------------------------------------
A0A139X3R8      SHRFLDNV----------------------------------------------------
A0A1Z4I7C5      AEQFLDDL----------------------------------------------------
A0A0C2MDK7      ANQFLDNM----------------------------------------------------
A0A1Y0RCK1      ANQFLDNI----------------------------------------------------
A0A1Z4PWZ0      ANRFLDNI----------------------------------------------------
A0A0C2QLT0      ANRFLDNI----------------------------------------------------
A0A1Z4J2K1      ANRFLDNI----------------------------------------------------
A0A3S0ZSX0      SERFLDNS----------------------------------------------------
A0A2N6K4T3      SVRFLDHV----------------------------------------------------
A0A370CKT2      SAQFLDHV----------------------------------------------------
A0A0S3TL97      SAQFLDHV----------------------------------------------------
A0A2N6M8A0      SAQFLDHV----------------------------------------------------
A0A2N6M9E1      SAQFLDHV----------------------------------------------------
A0A2N6KJI4      SAQFLDHV----------------------------------------------------
A0A2N6MZ77      SAQFLDHV----------------------------------------------------
A0A2N6KT20      SAQFLDHV----------------------------------------------------
G6FSN3          SAQFLDHV----------------------------------------------------
A0A4D9CI02      SGQFLDHL----------------------------------------------------
A0A328I8B9      SGQFLDHV----------------------------------------------------
A0A4Q9J4Z7      SGQFLDHL----------------------------------------------------
A0A0M0SU69      SGRFLDHV----------------------------------------------------
A0A1Z4TIZ8      SGRFLDHV----------------------------------------------------
A0A0S3TYD7      ESLTKNLQKLGNL-----------------------------------------------
A0A3C0N2P0      LSDGS------------------M------------------------------------
K9TLQ0          SDGEN------------------L------------------------------------
A0A6B3M6M6      PVGDL------------------I------------------------------------
A0A6B3NIJ0      PVGDL------------------V------------------------------------
A0A352XE00      IKTNS------------------KVYQN--------------------------------
B4VS56          AKTAG------------------K------------------------------------
A0A352AAQ3      PVPAA------------------T------------------------------------
A0A350Y472      SATPS------------------K------------------------------------
A0A355DVB4      PATPP------------------K------------------------------------
U5QL42          -----------------------LTETL--------------------------------
K9QF04          -----------------------FQKEL--------------------------------
A0A076HBF2      KRFLL------------------QELD---------------------------------
A0A354B169      KRFQL------------------QELD---------------------------------
G4FMX5          KRFPL------------------KELD---------------------------------
Q0IDT5          KRFLL------------------NELDQ--------------------------------
A0A2D6FCW3      KRFLL------------------QELD---------------------------------
A3ZA21          KRFLL------------------QELD---------------------------------
A0A140K3H3      ---KV------------------EKPLI--------------------------------
K9XUB8          ---KV------------------EEPVI--------------------------------
Q7NEU3          AS---------------------SQPQF--------------------------------
A0A6H2NHD5      HRSLL------------------MNPRL--------------------------------
A0A2P8W4F7      KQPLL------------------IEPNL--------------------------------
A0A5Q4E0Z4      KQPLL------------------MVPSL--------------------------------
A0A2P8VVX1      PL---------------------RRSEP--------------------------------
A0A2P8WHY0      GR---------------------QDGGP--------------------------------
A0A2T1CMT9      IS-SS------------------NNLLT--------------------------------
A0A563VQJ3      DV---------------------KEQGV--------------------------------
A0A1D8TX52      EG-KI------------------SKPVL--------------------------------
A0A1D9G4T2      EG-KI------------------SKPVL--------------------------------
F4XP71          EG-KI------------------SKPVL--------------------------------
A0A1U7N5X9      EG-KI------------------SKPVL--------------------------------
A0A6B3N2I8      EG-KI------------------SKPVL--------------------------------
A0A2W6ZAV2      VQDGL------------------SITEV--------------------------------
A0A2G7GMH8      P----------------------AKPNG--------------------------------
K9W742          KAKKSEPRMLLPFGKSQALEPVGNQPII--------------------------------
A0A2T1DWE8      YE-GG------------------LAALV--------------------------------
A0A1U7I8L3      PQ-TR------------------TEPII--------------------------------
A0A2T1DJL8      LG-EI------------------NPRSI--------------------------------
A0A1Z4J9W0      MS-EL------------------MPTTP--------------------------------
A0A0N7Z5K9      MS-EL------------------MPTT---------------------------------
A0A0S3TXC5      LS-EL------------------MPTT---------------------------------
K9SA61          RSVSV------------------AEPTI--------------------------------
A0A3D1PBA3      KN-KL------------------AKPQI--------------------------------
K9XPB0          LA-KH------------------DQFVV--------------------------------
A0A350Y7Z1      RT-GG------------------SGLLV--------------------------------
A0A352X2A7      KT-RS------------------SSIFV--------------------------------
A0A0D8ZYV0      QT-KA------------------SEPVV--------------------------------
A0A2T1FP73      RG-RV------------------AQPEV--------------------------------
A0A433VMS2      RG-RV------------------AQPEV--------------------------------
K9TYA7          RG-RV------------------AQPEV--------------------------------
A0A2P8QUE1      RG-RV------------------AQPEV--------------------------------
A0A2T1DNG3      SLRLS------------------GQ-----------------------------------
B8HNB0          DS----------------------------------------------------------
A0A1Z4LN32      NIPVG------------------KDKI---------------------------------
A0A2I8A9F5      QLEDS------------------A--L---------------------------------
A0A218Q6R8      TLDTE------------------EPIV---------------------------------
A0A218QGE0      FLDRS---------------------L---------------------------------
A0A563VS48      ------------------------------------------------------------
A0A318BJ18      ------------------------------------------------------------
A0A3B8Y8H9      ------------------------------------------------------------
A0A2W1JVB9      KGASV------------------A------------------------------------
A0A6H1U102      MDGDR------------------YRAHGS-------------------------------
A0A563VLD6      EAEIN------------------ISKGY--------------------------------
A0A2P8W9H0      LFAVR------------------EINSI--------------------------------
A0A6I5P386      ALAMT------------------QLGDL--------------------------------
A0A318BG22      ------------------------------------------------------------
A0A1Z3HMQ0      LELPA------------------GEGISP-------------------------------
K1XF69          TGGDR------------------SSV----------------------------------
B5W297          TGGDR------------------SSV----------------------------------
A0A6H2AL05      TGGDR------------------SSV----------------------------------
H1W7M8          TGGDR------------------SSV----------------------------------
A0A5Q4H6A5      TGGDR------------------SSV----------------------------------
D5A466          TGGDR------------------SSV----------------------------------
U5QJM6          EKQSK------------------EIAKISKK-----------------------------
A0A1Z4RPC6      ---------------------------HG-------------------------------
A0A2T1CMZ0      ---------------------------RG-------------------------------
L8M4F7          ---------------------------KR-------------------------------
A0A140K2P2      ---------------------------Q--------------------------------
K9XWX4          ---------------------------Q--------------------------------
A0A140KB14      ---------------------------N--------------------------------
K9XX88          ---------------------------N--------------------------------
A0A563VSV6      ---------------------------Q--------------------------------
L8LZE9          ---------------------------ED-------------------------------
A0A433NM31      NENPE------------------QT--LP-------------------------------
A0A1Z4NDS1      QPERN----------------------LP-------------------------------
K9F4D9          ---------------------------VP-------------------------------
U9VXM0          ---------------------------VP-------------------------------
A0A6I5QPI5      AAD-D------------------HP--YP-------------------------------
A0A433W533      NAEAT------------------TI-----------------------------------
A0A2P8QWJ3      SAEAT------------------TI-----------------------------------
A0A2T1FKP8      NAEAT------------------TI-----------------------------------
K9U6L7          NAEAT------------------TI-----------------------------------
A0A1E5QP61      FLGFS------------------SRREIP-------------------------------
U5DPF5          TRPVT------------------LP-----------------------------------
A0A3M1PML8      LGALD------------------YP--AP-------------------------------
A0A3M2GIL5      QNKID------------------QI--TP-------------------------------
A0A6H1TSJ9      QNKID------------------QI--TP-------------------------------
A0A0T7BPZ0      TTEID------------------RQ--IP-------------------------------
A0A352X442      FKKSE------------------AK--DV-------------------------------
A0A6B3NF44      LGESE------------------HR--AP-------------------------------
A0A0M0SHU3      VEGLD------------------RP--VP-------------------------------
A0A1D2PBN3      LPGVD------------------QP--IP-------------------------------
A0A0C2LVR7      LPGVD------------------QP--IP-------------------------------
A0A1Z4PQB9      LRGVD------------------QP--IP-------------------------------
A0A1Z4SFN6      LPGAD------------------QQ--IP-------------------------------
K9PGI8          LPGGE------------------QPFAIP-------------------------------
A0A2T1E9V8      ------------------------------------------------------------
A0A3M2GQQ6      ------------------------------------------------------------
A0A6H1U2X0      ------------------------------------------------------------
K9SGJ5          ------------------------------------------------------------
A0A6C2DSN4      ------------------------------------------------------------
L8MYT6          ------------------------------------------------------------
A0A352JGJ6      ------------------------------------------------------------
A0A1J5GLS2      ------------------------------------------------------------
A0A2W4W6M5      ------------------------------------------------------------
A0A2W7AN33      ------------------------------------------------------------
A0A256BLV2      ------------------------------------------------------------
A0A2W6ZXF3      ------------------------------------------------------------
A0A2Z5WX66      ------------------------------------------------------------
K9W1T3          RFGNQ------------------Q------------------------------------
A0A1Q4RTR1      ------------------------------------------------------------
A0A1Z4SQV2      ------------------------------------------------------------
A0A2H2XGN1      ------------------------------------------------------------
A0A433UXH8      ------------------------------------------------------------
A0A1Z4RMB9      ------------------------------------------------------------
B4WP72          KSHSK------------------QLASS--------------------------------
A0A318B4H2      ------------------------------------------------------------
B4WQE3          ILPRY------------------EATRQP-------------------------------
A0A2K3BR24      ------------------------------------------------------------
K9YXY1          ------------------------------------------------------------
A0A1U7HGH0      QWR---------------------------------------------------------
K9XJD3          EWQ---------------------------------------------------------
K9SX01          AFVLR------------------NPESVLSKLYLKIRKSKAYRSFASSLESFKISILNAV
A0A4P7ZT55      ------------------------------------------------------------
A0A1E5QIR9      GKDGE------------------RVKAK--------------------------------
A0A1Z4IBC7      KDESP------------------IPGLD--------------------------------
A0A1W5CPC7      KDDIP------------------IPGLD--------------------------------
A0A5Q0GKD1      KDDIP------------------IPGLD--------------------------------
Q3MDC6          KDDIP------------------IPGLD--------------------------------
A0A1Z4KM73      KDDTP------------------IPGLD--------------------------------
Q8YNX7          KDDTP------------------IPGLD--------------------------------
A0A367R4K6      KEHSS------------------IAGLD--------------------------------
A0A1E2WSV8      KESSS------------------IAGLD--------------------------------
A0A2R5FRT9      KDNPS------------------IAGLD--------------------------------
A0A2K8T1B6      RDHSS------------------IAGLD--------------------------------
A0A235I9I0      KDHSS------------------IPGLD--------------------------------
A0A2D0HQT8      KDHSS------------------IPGLD--------------------------------
A0A2L2NU95      KDHSS------------------IAGLD--------------------------------
A0A367S084      KDHSS------------------IPGLD--------------------------------
A0A0V7ZFJ4      ------------------------------------------------------------
A0A367RIS1      ------------------------------------------------------------
A0A235IXQ2      ------------------------------------------------------------
A0A1W5CNX3      ------------------------------------------------------------
A0A5Q0GJJ5      ------------------------------------------------------------
Q3MEB7          ------------------------------------------------------------
A0A1Z4KHN9      ------------------------------------------------------------
Q8YT70          ------------------------------------------------------------
A0A218Q4C1      ------------------------------------------------------------
A0A166IWU6      ------------------------------------------------------------
A0A2S0Q8C0      ------------------------------------------------------------
W6FSX4          ------------------------------------------------------------
A0A0V7ZNJ9      ------------------------------------------------------------
A0A0R0M9H9      EQ----------------------------------------------------------
A0A1S1ZVW2      EQ----------------------------------------------------------
A0A1B7WX82      Q-----------------------------------------------------------
A0A1B7WTD1      P-----------------------------------------------------------
A0A480ABC0      TV----------------------------------------------------------
A0A1Z4LRU5      ------------------------------------------------------------
A0A1Z4JVB4      ------------------------------------------------------------
K9PIA4          ------------------------------------------------------------
A0A1Z4HVE1      ------------------------------------------------------------
A0A252ECZ1      ------------------------------------------------------------
A0A1Z4G5Y1      ------------------------------------------------------------
A0A252DNA2      ------------------------------------------------------------
A0A252E1Q4      ------------------------------------------------------------
A0A6G9SK36      ------------------------------------------------------------
A0A1Z4M597      ------------------------------------------------------------
A0A1Z4MWT1      ------------------------------------------------------------
A0A1Z4TX53      ------------------------------------------------------------
A0A5P8VSD1      ------------------------------------------------------------
A0A2A2TNQ5      ------------------------------------------------------------
A0A3S1C4K5      ------------------------------------------------------------
A0A1X4G3D5      E-----------------------------------------------------------
D4TNI2          E-----------------------------------------------------------
A0A1Z4H6Z8      ------------------------------------------------------------
A0A1Z4NPM1      ------------------------------------------------------------
A0A3F3KPR9      GG----------------------------------------------------------
D4TGN7          GG----------------------------------------------------------
A0A1Z4UZW9      ------------------------------------------------------------
A0A0K2M5H0      ------------------------------------------------------------
A0A1B7VSH4      ------------------------------------------------------------
A0A1B7W126      ------------------------------------------------------------
A0A3D4C6Q6      ------------------------------------------------------------
A0A1B7UVJ4      ------------------------------------------------------------
A0A1B7UTR1      ------------------------------------------------------------
K7W0A4          ------------------------------------------------------------
A0A5C0DRW9      ------------------------------------------------------------
A0A6H2C088      ------------------------------------------------------------
A0A2T1CIL7      RG---------------------MQELS--------------------------------
A0A433V7A0      HKEIE------------------QTALN--------------------------------
A0A2T1FTR8      SKGAA------------------RAPGQ--------------------------------
K9UA41          SKGAA------------------RAPGQ--------------------------------
A0A0C2LBE2      KKSLR------------------VPEVD--------------------------------
A0A433NN38      KT--L------------------TGRLD--------------------------------
A0A2N6K0T2      KNNYS------------------VQGLD--------------------------------
A0A2N6ML72      KNSYS------------------VQGLD--------------------------------
G6FQZ6          KNSYS------------------VQGLD--------------------------------
A0A2N6MQX9      KNSYS------------------VQGLD--------------------------------
A0A2N6KXT6      KNSYS------------------VQGLD--------------------------------
A0A2N6KGB9      KNSYS------------------VQGLD--------------------------------
A0A2N6L3Y5      KNSYS------------------VQGLD--------------------------------
A0A0S3TIS7      KNSYS------------------VQGLD--------------------------------
A0A1U7GW28      KNSYS------------------VQGLD--------------------------------
A0A2N6LW63      KNSYS------------------VQGLD--------------------------------
A0A328IH74      KNSYS------------------VEGLD--------------------------------
A0A4D9CIB0      KSSYS------------------VEGLD--------------------------------
A0A1Z4TQ63      KSSYS------------------VEGLD--------------------------------
A0A4Q9J8G2      KNSYS------------------VEGLD--------------------------------
A0A1Z4SMD6      IK----------------------------------------------------------
A0A2H2Y096      IK----------------------------------------------------------
K9S8M8          GS-------------------------N--------------------------------
A0A1Z4NFV0      RS---------------------EELFA--------------------------------
B0CAX4          GL-------------------------D--------------------------------
A0A350Y0P6      KL-------------------------N--------------------------------
A0A352X940      KS-------------------------D--------------------------------
B8HTN4          KAFKP------------------TQGLE--------------------------------
A0A2A2TPF8      -----------------------NNAIAQTFIE---------------------------
A0A1Z4R0P8      -----------------------NAAIEQISIE---------------------------
A0A0T7BUI3      -----------------------HKSVAANITDD--------------------------
A0A1Z4LP32      -----------------------SKSLDSNFIDD--------------------------
K9REP9          -----------------------SKSTDSNPIVD--------------------------
A0A1Z4SIJ3      NQ---------------------DSSKETRLLGRINGLLAKYQQKNQIVSLPSTNFDSKL
A0A2H2XPG4      NQ---------------------DSSKETRLLGRINGLLAKYQQKNQIVSLPSTNFDSKL
K9V3C7          -----------------------STSLIEEMSGD--------------------------
A0A1Z4T6Y7      -----------------------APTIEQTI--E--------------------------
A0A2H2Y561      -----------------------APTIEQTI--E--------------------------
A0A1Q4S362      -----------------------SASIQQTM--E--------------------------
A0A3S1CIN8      -----------------------SASIEQTM--E--------------------------
A0A2A2TC28      NT---------------------HSSLHQ-IMGD--------------------------
A0A0C1NCB0      SS---------------------TKSSSDRLMGE--------------------------
A0A2N6K7Q9      NS---------------------VSGVQ--EIEA--------------------------
A0A2N6MXH6      NS---------------------VSGVQ--EIEA--------------------------
A0A2N6M5A8      NS---------------------VSGVQ--EIEA--------------------------
A0A2N6LL61      NS---------------------VSGVQ--EIEA--------------------------
A0A0S3TP66      NS---------------------VSGVQ--EIEA--------------------------
G6FP91          NS---------------------VSGVQ--EIET--------------------------
A0A1U7GYR5      NS---------------------VSGVQ--EIEA--------------------------
A0A2N6KY52      NS---------------------VSGVQ--EIET--------------------------
A0A2N6KMP5      NS---------------------VSGVQ--QIET--------------------------
A0A2N6MA45      NS---------------------VSGVQ--QIEA--------------------------
A0A4Q9J9V9      NF---------------------VSAVQ--DIED--------------------------
A0A328IGA1      NF---------------------VSAVQ--DIED--------------------------
A0A4D9CE41      NF---------------------VSAVQ--DIED--------------------------
A0A0M0SFT2      NF---------------------VNAVQ--DIED--------------------------
A0A1Z4TLC8      NF---------------------VNAVQDVDVED--------------------------
A0A0C2LFH0      KT---------------------SAPVN--LMSD--------------------------
A0A1Z4IYV4      TT---------------------STPDK--LMSE--------------------------
A0A1Z4Q0T6      ST---------------------SAPTK--LMSE--------------------------
A0A0C2PT44      ST---------------------SAATK--LMSE--------------------------
A0A1D2P6J4      ST---------------------SAPAE--LMSE--------------------------
A0A3M9ZEU1      ASG--------------------RKSAE--------------------------------
A0A1Z4JK72      TPTIV------------------SPSAD--------------------------------
A0A0N7Z489      TPTIL------------------SPGAD--------------------------------
A0A0S3TXS2      TPTIL------------------SPGAD--------------------------------
A0A1Z4RN12      QLQLP------------------GNS-T--------------------------------
A0A2T1CMF9      QFQLP------------------GSE-K--------------------------------
Q7NDC5          ---------------------------A--------------------------------
U5QGK3          ---------------------------G--------------------------------
A0A2W4UY24      NR-------------------------E--------------------------------
A0A2T1GMT4      RA---------------------TTP-E--------------------------------
K9UI51          RA---------------------TTP-E--------------------------------
K9QM62          MSFYL------------------QDT-E--------------------------------
A0A1Z4FWI3      RN---------------------REA-E--------------------------------
A0A1Z4JYE7      RK---------------------REG-E--------------------------------
A0A2T1FXY4      ND---------------------WDV-E--------------------------------
K9TYI2          ND---------------------GYV-E--------------------------------
A0A1Z4QL41      RH---------------------QKA-Q--------------------------------
A0A252D4T4      RN---------------------RET-D--------------------------------
A0A252DJH5      RN---------------------RET-D--------------------------------
A0A252EB80      RN---------------------RET-D--------------------------------
A0A6G9SKZ9      RY---------------------RET-E--------------------------------
A0A1Z4HPW5      RY---------------------RET-E--------------------------------
A0A1Z4MSN1      RY---------------------RET-E--------------------------------
A0A1Z4U1C2      RY---------------------RET-E--------------------------------
A0A0D6KV51      RY---------------------RET-E--------------------------------
A0A1Z4MKF8      RY---------------------RET-E--------------------------------
A0A2C6WC43      RF---------------------SSA-E--------------------------------
A0A1Z4L5A1      RF---------------------SSA-E--------------------------------
A0A367QD86      RF---------------------SSA-E--------------------------------
A0A235IZ96      RY---------------------SNL-E--------------------------------
A0A2L2NGP0      RY---------------------SNL-E--------------------------------
A0A2K8SM78      RY---------------------SNL-E--------------------------------
A0A2R5FPC0      RD---------------------SNV-E--------------------------------
A0A5P8W5T6      RH---------------------SNL-E--------------------------------
A0A140KBA0      LV---------------------GDV-V--------------------------------
K9XSG1          LV---------------------GDV-V--------------------------------
A0A0F5YE28      DY---------------------FQG-E--------------------------------
U7QEH7          SY---------------------FQG-E--------------------------------
A0A3S1ATK5      WH---------------------QNA-D--------------------------------
A0A2Z6CPH0      RK---------------------LDTKK--------------------------------
A0A1Z4GT50      RN---------------------RDA-E--------------------------------
A0A1Z4GIX0      RE---------------------SDG-E--------------------------------
A0A2H6LC24      RE---------------------SDG-E--------------------------------
B2J6N5          RY---------------------SNT-E--------------------------------
A0A367RMI4      RY---------------------SNA-E--------------------------------
A0A235HUM0      RD---------------------SNA-E--------------------------------
A0A2L2NW47      RY---------------------SNA-E--------------------------------
A0A1E2WUR1      RY---------------------SDT-E--------------------------------
A0A235IKU3      RY---------------------SNL-E--------------------------------
F4XKF3          RR---------------------RDD-L--------------------------------
A0A1D9FX10      RR---------------------RDD-L--------------------------------
A0A1D8TNX9      RR---------------------RDD-L--------------------------------
A0A1U7MYU6      RR---------------------RDD-L--------------------------------
A0A3C0NJ41      RT---------------------KHQ-E--------------------------------
A0A352AG88      RS---------------------RDL-E--------------------------------
A0A350Y374      RF---------------------TAQ-E--------------------------------
A0A355DPX0      RL---------------------KAQ-E--------------------------------
A0A0D8ZUV2      RG---------------------KDA-E--------------------------------
A0A433VDI0      RG---------------------RDK-E--------------------------------
A0A3D1PG43      NQ---------------------K-Q-E--------------------------------
A0A2P8QQ72      PG---------------------RQE-D--------------------------------
K9TZQ7          PE---------------------RQQ-D--------------------------------
A0A2G7GPR0      NR---------------------RNQ-E--------------------------------
K9XH68          NR---------------------RNQ-E--------------------------------
A0A1U7HW70      NR---------------------RNQ-E--------------------------------
A0A2S6VEJ8      NR---------------------RNQ-E--------------------------------
                                                                            

K9SLA9          --------LAKGSVLITRDMPQS-------TLAET-----------FRILHTNLK-----
A0A168TT23      --------SGTTTRAEDRAVSHYSELHPKSAVSEA-----------FRSLRTSLM-----
A0A0M1JWX9      --------------IADSNGRERLQDDRDFGFLEA-----------FRALNTNIR-----
A0A2T1M1V6      ------------------------------KSEVE-----------FQRLAAIVS-----
A0A2G7GCS2      ------------------------------EVAIE-----------LQRLASAV------
K9XBH8          ------------------------------EVPID-----------LQRLASAV------
A0A1Z4LJ30      ------------------------------GGEIE-----------FQRLASAVS-----
K9RI76          ------------------------------GGEIE-----------FQRLASAVS-----
A0A352AE27      ------------------------------ETEVE-----------FQRLASAIS-----
A0A3B8JH60      ------------------------------DTEVE-----------FQRLASAIS-----
A0A3C0N766      ------------------------------DTEVE-----------FQRLASAIS-----
K9W9J7          ------------------------------ETEVE-----------FQRLASAIS-----
A0A139WSU3      ------------------------------VSEVE-----------FQRLASAIS-----
A0A433VN22      ------------------------------ETEVE-----------FQRLASAIS-----
Q7NF11          ------------------------------PPRLE-----------SRQLASTVS-----
A0A1Z4JCS8      ------------------------------EGEIE-----------FQRVASAIS-----
F4XTX2          ------------------------------ETDVE-----------FQRLASVIS-----
Q7NJN6          ------------------------------AEAEE-----------FRQLASVVS-----
U5QCC3          ------------------------------ATAEE-----------FLQLASIVS-----
A0A3S0Y9N9      ------------------------------PVSEA-----------FRILQTNLR-----
A0A433UNK7      ------------------------------SVSEA-----------FRMLQTNLR-----
A0A3M1SVZ4      ------------------------------VRDNPRSLISEA----YRMLQTKLK-----
A0A654SFI6      -------------------------------LSEA-----------YQATRANLAF----
K9SSQ0          ------------------------------AFLPH-----SYNHSAFTEAVNSLALNIQN
A0A2W1JIN9      ------------------------------AILEA-----------YRALFKALE-----
A0A318AJV1      ------------------------------GRVSPADLIGVAGATVYSEAIRNLRASLIG
A0A6B3MUB5      ------------------------------SLVEP-----------YRLLLKKLE-----
A0A1U7N2U4      ------------------------------RLMEP-----------YRLLLTTME-----
A0A1D9G1F2      ------------------------------RLMEP-----------YRLLLTTME-----
F4XV38          ------------------------------RLMEP-----------YRLLLTTME-----
A0A2P8QIL5      ------------------------------AILES-----------YRSLLRSSE-----
A0A2T1FLY5      ------------------------------AILES-----------YRSLLRSSE-----
A0A433W447      ------------------------------AILES-----------YRSLLRSSE-----
K9U1K8          ------------------------------AILES-----------YRSLLRSSE-----
K9UYB2          ------------------------------SLVEP-----------YRMLFKNLE-----
A0A218QN17      ------------------------------SLVEP-----------YRMLLKTLE-----
K9RKN2          ------------------------------GLVEP-----------YRMLFKTLE-----
A0A2I8ADV2      ------------------------------GLVEP-----------YRMLLKNLE-----
A0A1W5CKM3      ------------------------------GLVEP-----------YRMLLKNLE-----
A0A5Q0GMF5      ------------------------------GLVEP-----------YRMLLKNLE-----
Q3MEW0          ------------------------------GLVEP-----------YRMLLKNLE-----
A0A1Z4KIC7      ------------------------------GLVEP-----------YRMLLKNLE-----
Q8YSM5          ------------------------------GLVEP-----------YRMLLKNLE-----
A0A1Q4S1H4      ------------------------------GLVEP-----------YRMLLKTLE-----
A0A433VBU6      ------------------------------GLVEP-----------YRMLLKTLE-----
A0A1Q4RZJ6      ------------------------------ALVEP-----------YRMLFKSLE-----
A0A1Z4SNV3      ------------------------------GLVEP-----------YRMLFKSLE-----
A0A2H2XJQ1      ------------------------------GLVEP-----------YRMLFKSLE-----
A0A3S5K358      ------------------------------ALVEP-----------YRMLFKSLE-----
A0A0T7BPJ4      ------------------------------GSVEP-----------YRMLLKNIE-----
A0A0C1QS61      ------------------------------SLVEP-----------YRMLFKTLE-----
A0A139X3R8      ------------------------------SLVEP-----------YRMLFKTLE-----
A0A1Z4I7C5      ------------------------------GLVEP-----------YRMLLKNLE-----
A0A0C2MDK7      ------------------------------ELIEP-----------YRTLFKTLE-----
A0A1Y0RCK1      ------------------------------SLVEP-----------YRTLFKTLE-----
A0A1Z4PWZ0      ------------------------------GLVEP-----------YRTLFKTLE-----
A0A0C2QLT0      ------------------------------GLVEP-----------YRTLFKTLE-----
A0A1Z4J2K1      ------------------------------GLVEP-----------YRTLFKTLE-----
A0A3S0ZSX0      ------------------------------ALIEP-----------FRMLFKNLE-----
A0A2N6K4T3      ------------------------------GLVEP-----------YRTLFKNLE-----
A0A370CKT2      ------------------------------GLVEP-----------YRTLFKNLE-----
A0A0S3TL97      ------------------------------GLVEP-----------YRTLFKNLE-----
A0A2N6M8A0      ------------------------------GLVEP-----------YRTLFKNLE-----
A0A2N6M9E1      ------------------------------GLVEP-----------YRTLFKNLE-----
A0A2N6KJI4      ------------------------------GLVEP-----------YRTLFKNLE-----
A0A2N6MZ77      ------------------------------GLVEP-----------YRTLFKNLE-----
A0A2N6KT20      ------------------------------GLVEP-----------YRTLFKNLE-----
G6FSN3          ------------------------------GLVEP-----------YRTLFKNLE-----
A0A4D9CI02      ------------------------------GLVEP-----------YRTLLKNLE-----
A0A328I8B9      ------------------------------GLVEP-----------YRTLLKNLE-----
A0A4Q9J4Z7      ------------------------------GLVEP-----------YRTLLKNLE-----
A0A0M0SU69      ------------------------------GLVEP-----------YRTLFKNLE-----
A0A1Z4TIZ8      ------------------------------GLIEP-----------YRTLFKNLE-----
A0A0S3TYD7      --------NVVDTELVVRDAPRS-------APAAA-----------YQMLQSNLK-----
A0A3C0N2P0      ----------IDPENLEFQLSAQSYGYNASPLLES-----------FRSLNTNLQ-----
K9TLQ0          --------------------VQASGGYLFSRFFEA-----------FRSLHADLY-----
A0A6B3M6M6      ----------SESEKVEF-----NHSYISSPFLEA-----------FRSLQVNLH-----
A0A6B3NIJ0      ----------SESEKVEF-----NNSYISSPFLEA-----------FRSLQVNLH-----
A0A352XE00      --------SQVNREVLELAFSGYS-RYRPSPFLEA-----------FRSLHTNLN-----
B4VS56          ----------LETPLLASPISQSTYRYHASPFLEA-----------FRSLQTNLQ-----
A0A352AAQ3      ----------PEGQQLESEFNQRSYRYTASPVLEA-----------FRSLHANLH-----
A0A350Y472      ----------SHSEPLELELRRRSSRYNASPLLEA-----------FRSLHANLH-----
A0A355DVB4      ----------SHSEPLELELRRRSSRYNASPLLEA-----------FRSLHANLH-----
U5QL42          --------VAPSRDGVVIGDRLVTRQYTRSPFKEA-----------LRSLALSLR-----
K9QF04          --------KAATNQLTHYG------NYTLSHYWEA-----------YISLQTNLD-----
A0A076HBF2      ---------RSVTGEDDPE-AAKQRRYQRFLYQEA-----------FRNLFTSIR-----
A0A354B169      ----------QLVANPASE-AFEKYRSQLFYCQEA-----------FRSLFTSLR-----
G4FMX5          ---------SETQADVGET-ERKAARYQRFFYQEA-----------FRNLFTSLR-----
Q0IDT5          --------SSNNNATNAPE-SRKQDRYQRFFYQEA-----------FRNLFTSLR-----
A0A2D6FCW3      ---------INNPSEEDQN-TKQKAKYQRFFYQEA-----------FRNLFTSIR-----
A3ZA21          ----------QSVSGGDAD-DRREQRYQRFFYQEA-----------FRNLFTSIR-----
A0A140K3H3      --------QVNGETNTKAH------YYNYSSFTEG-----------LRTLAMNLR-----
K9XUB8          --------QINGETHSRAH------YYNYSSFTEG-----------LRALAMNLR-----
Q7NEU3          --------SKERQKPDLPK-----SSLEKSMLREA-----------FRSLLTNLR-----
A0A6H2NHD5      --------VSTMEEVLVQH-QGDNSPYTSFSFTEA-----------FYSLDANLR-----
A0A2P8W4F7      --------AVTMADVLTQS-QSPEKLYTSFSFAEA-----------FYSLEANLR-----
A0A5Q4E0Z4      --------IATTADLLAQS-QSPGNLYSSFSFAEA-----------FYSLEANLR-----
A0A2P8VVX1      --------DARGLHPELAD-SDLMKTVMWPQFRDS-----------LDLIANNLQ-----
A0A2P8WHY0      --------PI--LHPELAD-SDLMQIVQWPTFREA-----------LDLVANNVQ-----
A0A2T1CMT9      --------RLPFRSISSDT-SSIQNVIQWQPFREA-----------IDLIYENLK-----
A0A563VQJ3      --------LVKEEPDSYVS--------------EL-----------YRMLQANLK-----
A0A1D8TX52      --------NLSLSQSERA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----
A0A1D9G4T2      --------NLSLSQSEKT--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----
F4XP71          --------NLGLSQSERT--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----
A0A1U7N5X9      --------NLSLSQSEKA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----
A0A6B3N2I8      --------NLSLSQSEKA--LPMMELLGWRPFQEA-----------LDMIYVNIQ-----
A0A2W6ZAV2      --------VEGMEPEARFG------------LRES-----------LRNLFSSFR-----
A0A2G7GMH8      --------LIKLNKQQ----TQVLPMLCLQSFRDA-----------LDLIYKNIR-----
K9W742          --------KLPFGKPKVLA-PWTVEVLHWSPSWQS-----------LDLIYKNIQ-----
A0A2T1DWE8      --------PF---REVGVPAPPIMQVIHWQPFRES-----------LDLIYKNIQ-----
A0A1U7I8L3      --------HLPFRQQPILT-SSTIELISWQPFRES-----------LDLIYQNIQ-----
A0A2T1DJL8      --------AMPFQKAENLA-PSMMQVIHWAPFRES-----------LDLIYKNIQ-----
A0A1Z4J9W0      --------NFAFSRNAFEENSSMLQVLHWAPFRES-----------LDLIYKNLQ-----
A0A0N7Z5K9      --------NFAFGRST--GDTSMLQVLHWAPFRES-----------LDLIYKNLQ-----
A0A0S3TXC5      --------NFAFGRSTNAGDTSMLQVLHWAPFRES-----------LDLIYKNLQ-----
K9SA61          --------KLPLRRSETFT-TASLEVIHWPPFRES-----------MDLIYQNIQ-----
A0A3D1PBA3      --------SLPFGKPHLLA-PWTVQVSNWPPTWES-----------LDLIYKNIQ-----
K9XPB0          --------KLPFLSPK--E-SSVQEIINWQPFRES-----------LDLIYENLQ-----
A0A350Y7Z1      --------HLPFRRTQVAA-ASTLPMVYWLPFRES-----------LDLIYKHIQ-----
A0A352X2A7      --------NLPFRKSSVTE-ISTSHLAYSSAFRES-----------LDLIYKNIQ-----
A0A0D8ZYV0      --------SLPFGKPNVLA-PWTVQVSNWPPSWES-----------LDLIYKNIQ-----
A0A2T1FP73      --------SLPFGKPLHLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----
A0A433VMS2      --------SLPFGKPLHLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----
K9TYA7          --------SLPFGKPLHLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----
A0A2P8QUE1      --------SLPFGKPLHLS-PWTVQVRNWPPSWES-----------LDLIYRNLQ-----
A0A2T1DNG3      --------TQALLPPITQLTKWR-------PFRES-----------LDLLYQNLQ-----
B8HNB0          ------------------------------PFVEA-----------VRSLGLNLR-----
A0A1Z4LN32      --------AGVSERVIVATSPRT-------VIHEA-----------YQMLQANLK-----
A0A2I8A9F5      --------AEPARRVIVETTPRS-------MIHES-----------FGMLQANLK-----
A0A218Q6R8      --------EQFSPRIVVETSPRS-------VIHES-----------YQMLQANLK-----
A0A218QGE0      --------EKVSERIIVATSPRT-------VIHEA-----------YQMLQANLK-----
A0A563VS48      --------QGKQQPVLAESSSAITDDGLILPVKEA-----------FQDIQINLQ-----
A0A318BJ18      --------------TAEGTTPREQLLDRKSNLVDA-----------YLAINTNLG-----
A0A3B8Y8H9      --------LQNKTDFPGSNPNFS-------LFLEA-----------FLGLQTNLV-----
A0A2W1JVB9      --------ADVKRDLYVRDTPNS-------PPSEA-----------VRMVQSNLK-----
A0A6H1U102      ------------------------------PFTEA-----------IRSLALNLR-----
A0A563VLD6      ------------------NYSYS-------SFTEA-----------FRAIAMNLG-----
A0A2P8W9H0      --------GLTSDFSLPPLSYELRTDQVAMPFLEA-----------FRILATNIR-----
A0A6I5P386      --------GFNMDLPLSSGPSNL------TPFLEA-----------FKRLSTNLR-----
A0A318BG22      --------------PALLANKRS-------SLSEA-----------YYSIQTALQ-----
A0A1Z3HMQ0      -------------RVIAFSQTQP-------MVTAA-----------YQMLQANLK-----
K1XF69          -------------QVPVVDTPGS-------LISEI-----------YRMIQANLK-----
B5W297          -------------QVPVVDTPGS-------LISEI-----------YRMIQANLK-----
A0A6H2AL05      -------------QVPVVDTPGS-------LISEI-----------YRMIQANLK-----
H1W7M8          -------------QVPVVDTPGS-------LISEI-----------YRMIQANLK-----
A0A5Q4H6A5      -------------QVPVVDTPGS-------LISEI-----------YRMIQANLK-----
D5A466          -------------QVPVVDTPGS-------LISEI-----------YRMIQANLK-----
U5QJM6          --------AKSNGRVQNPPYTRS-------AYEEA-----------FRSLLTNIR-----
A0A1Z4RPC6      -------------SIIVQREPDS-------FASEI-----------YRMIQTNLK-----
A0A2T1CMZ0      -------------GLVVQREPDS-------FASEI-----------YRMIQTNLK-----
L8M4F7          -------------RVVVEQSPDS-------YTSEI-----------YRMIRTNLT-----
A0A140K2P2      -------------GIIVQKQPDS-------FASEV-----------YRMIQANLK-----
K9XWX4          -------------GIIVHKQPDS-------FASEV-----------YRMIQANLK-----
A0A140KB14      -------------GIVVQREPDS-------FNSEL-----------YRMIQANLK-----
K9XX88          -------------GIVVQREPDS-------FNSEI-----------YRMIQANLK-----
A0A563VSV6      -------------GVLVQQEPDS-------YASET-----------YRMIQANLK-----
L8LZE9          -------------GIMVQQDPDS-------YTSEI-----------YRMIQANLK-----
A0A433NM31      -------------KIPVKCTPRS-------MISEI-----------YGMIYANLK-----
A0A1Z4NDS1      -------------QIVGRDTPQF-------PFSDA-----------YQMLQANLK-----
K9F4D9          -------------SILVKNSEYS-------SILDA-----------YQALQANLK-----
U9VXM0          -------------SILVRNTEYS-------SVLDA-----------YQSLQANLK-----
A0A6I5QPI5      -------------RLLVNQPAHV-------GVREA-----------YQMMQANLK-----
A0A433W533      -------------ALPVRDTPRA-------PIAEA-----------FRMLQANLK-----
A0A2P8QWJ3      -------------ALPVRDTPRA-------PIAEA-----------FRMLQANLK-----
A0A2T1FKP8      -------------ALPVRDTPRA-------PIAEA-----------FRMLQANLK-----
K9U6L7          -------------ALPVRDTPRA-------PIAEA-----------FRMLQANLK-----
A0A1E5QP61      -------------LLPTRDQPTT-------YTSEA-----------YRTLQANLK-----
U5DPF5          ----------------VRDYPRS-------SMSEA-----------FRMLQANLK-----
A0A3M1PML8      -------------RVVVRDMPQS-------PIAAS-----------YQMLQANLK-----
A0A3M2GIL5      -------------DLPVRDRPHW-------VVSET-----------YRMLQANLR-----
A0A6H1TSJ9      -------------DLPVRDRPHW-------VVSET-----------YRMLQANLR-----
A0A0T7BPZ0      -------------RVIGRDVPSF-------PMDEV-----------YQMLQANLK-----
A0A352X442      -------------RLVARDTPGS-------PIAQA-----------YQMLRANLK-----
A0A6B3NF44      -------------LVFARDLPRS-------PFNEA-----------YQMLQANLK-----
A0A0M0SHU3      -------------RVIGRDVPHF-------PVGDA-----------YQMLQANLK-----
A0A1D2PBN3      -------------RVIGTDIPQF-------PVGDA-----------YQMLQANLK-----
A0A0C2LVR7      -------------RVIGTDIPQF-------PVGDA-----------YQMLQANLM-----
A0A1Z4PQB9      -------------RVIGTDIPQF-------PVGDA-----------YQMLQANLK-----
A0A1Z4SFN6      -------------RVIGRDIPHF-------PVGDA-----------YQILQANLK-----
K9PGI8          -------------RLIGRDIPHY-------PIGNA-----------YQMLQANLK-----
A0A2T1E9V8      --------EIGSGAVPVIEDPRA-------FISES-----------YRMLQFNLE-----
A0A3M2GQQ6      --------LVSQRKGEGRSLPSYYTE----PFTEA-----------VRSLALNLR-----
A0A6H1U2X0      --------LVSQRKGEGRSLPSYYTE----PFTEA-----------VRSLALNLR-----
K9SGJ5          --------VVEKETALAPSMMHS-------AFREA-----------LRSLALNLR-----
A0A6C2DSN4      --------LLSQ--GILPTSSYY-------AFKEA-----------LSSLALNLR-----
L8MYT6          --------LLSQ--GILPTSSYY-------AFKEA-----------LSSLALNLR-----
A0A352JGJ6      --------MVSQ--GILPTSSYY-------AFKEA-----------LSSLALNLR-----
A0A1J5GLS2      --------MVGQ--SILPSSSYY-------AFKEA-----------LSSLALNLR-----
A0A2W4W6M5      --------MISH--GILPTSSYY-------AFKEA-----------LSSLALNLR-----
A0A2W7AN33      --------M-AK--GQFPNNNYH-------AFKEA-----------LGSLALNLR-----
A0A256BLV2      --------ATNQ--GILPSSSYY-------AFKEA-----------LGSLALNLR-----
A0A2W6ZXF3      --------MISQ--GILPSSSYY-------AFKEA-----------LSSLALNLR-----
A0A2Z5WX66      --------MLSQ--GILPTSSYY-------AFKEA-----------LSSLALNLR-----
K9W1T3          --------RIVPS-IVVTNTAGS-------PISEA-----------YRMIHTSLR-----
A0A1Q4RTR1      --------RHIST-LPIRDNPWS-------PASAA-----------FEKLQSTLE-----
A0A1Z4SQV2      --------RDIST-LPIRDNPWS-------PASAA-----------FEKLQSTLE-----
A0A2H2XGN1      --------RDIST-LPIRDNPWS-------PASAA-----------FEKLQSTLE-----
A0A433UXH8      --------RDIST-LPIRDNPWS-------PASAA-----------FEKLQSTLE-----
A0A1Z4RMB9      --------PSYQGRIITREEPDS-------FSSEI-----------YRMIQANLK-----
B4WP72          --------VFSNVRTRSRNVHAS-------VVTEA-----------YQMLWSNLK-----
A0A318B4H2      --------------AEELQNKKT-------QLYES-----------YLAVRTNLS-----
B4WQE3          --------IYFNEGVQHLDRTTG-------PFLEA-----------FKLLATNVC-----
A0A2K3BR24      --------DNTSSFLPLRDLPQS-------SASEA-----------FRMLQANLK-----
K9YXY1          --------DDTSSFLPLRDLPQS-------SASEA-----------FRMLQANLK-----
A0A1U7HGH0      --------------VPVLAEPRS-------FITES-----------YRMLLANLK-----
K9XJD3          --------------VPVLAEPRS-------FVTES-----------YRMLLANLK-----
K9SX01          SEPE----NTTALTVFVRDNPRA-------PASEA-----------YRMLQTSLR-----
A0A4P7ZT55      --------SVNGLWEQLDDQQRF-------GLRES-----------LRNLYRSLQ-----
A0A1E5QIR9      --------------LPVKDAPRS-------LISES-----------YRMLYANLK-----
A0A1Z4IBC7      --------RPVPK-IIGRDIPYF-------PLGDA-----------YQILQVNLK-----
A0A1W5CPC7      --------RAVPK-IIGRDIPYF-------PLGDA-----------YQILQVNLK-----
A0A5Q0GKD1      --------RAVPK-IIGRDIPYF-------PLGDA-----------YQILQVNLK-----
Q3MDC6          --------RAVPK-IIGRDIPYF-------PLGDA-----------YQILQVNLK-----
A0A1Z4KM73      --------RAVPK-IIGRDIPYF-------PLGDA-----------YQILQVNLK-----
Q8YNX7          --------RAVPK-IIGRDIPYF-------PLGDA-----------YQILQVNLK-----
A0A367R4K6      --------RPIPK-IIGRDIPYF-------PLGDA-----------YQILQVNLK-----
A0A1E2WSV8      --------RAIPK-IIGRDIPYF-------PVGNA-----------YQILQVNLK-----
A0A2R5FRT9      --------RAIPK-IIGRDIPYF-------PLGNA-----------YQVLQVNLK-----
A0A2K8T1B6      --------RPIPK-IIGRDIPYF-------PLGNA-----------YQILQVNLK-----
A0A235I9I0      --------RAIPK-IIGRDIPYF-------PVGNA-----------YQILQVNLK-----
A0A2D0HQT8      --------RPIPK-IIGRDIPYF-------PVGNA-----------YQILQVNLK-----
A0A2L2NU95      --------RPIPK-IIGRDIPYF-------PVGNA-----------YQILQVNLK-----
A0A367S084      --------RPIPK-IIGRDIPYF-------PVGNA-----------YQILQVNLK-----
A0A0V7ZFJ4      --------DNQEIELPVLDNPYS-------SVTSA-----------FEILQTNLA-----
A0A367RIS1      --------GESITELPVLNNPYS-------SVNAA-----------FEMLQINLG-----
A0A235IXQ2      --------GENITELPVLNNPYS-------SVNAA-----------FEMLQINLG-----
A0A1W5CNX3      --------GESITELPVLNNPYS-------SVNAA-----------FEMLQINLG-----
A0A5Q0GJJ5      --------GESITELPVLNNPYS-------SVNAA-----------FEMLQINLG-----
Q3MEB7          --------GESITELPVLNNPYS-------SVNAA-----------FEMLQINLG-----
A0A1Z4KHN9      --------GESITELPVLNNPYS-------SVNAA-----------FEMLQINLG-----
Q8YT70          --------GESITELPVLNNPYS-------SVNAA-----------FEMLQINLG-----
A0A218Q4C1      --------DEHTTELPLLDNPYS-------SVNTA-----------FEMLQINLG-----
A0A166IWU6      --------DDNTSELPLLNNPYS-------SVNTA-----------FEMLQINLG-----
A0A2S0Q8C0      --------DDNTSELPLLNNPYS-------SVNTA-----------FEMLQINLG-----
W6FSX4          --------DDNTSELPLLNNPYS-------SVNTA-----------FEMLQINLG-----
A0A0V7ZNJ9      --------FDGNPELPTLNNPYS-------VESSA-----------FEMLQTNLS-----
A0A0R0M9H9      --------EENQRELPVLDNPYS-------PVSTS-----------IEMLQTNLG-----
A0A1S1ZVW2      --------EENQRELPVLDNPYS-------PVSTS-----------IEMLQTNLG-----
A0A1B7WX82      --------EESRRELPLLDNIYS-------PVSTS-----------FEMLQTNLG-----
A0A1B7WTD1      --------VEGLLEVPLLDQPYS-------PVSTS-----------LEMLHTNLG-----
A0A480ABC0      --------VEGLLEVPLLDQPYS-------PVSTS-----------LEMLNTNLG-----
A0A1Z4LRU5      --------DKDRQELPVLNNPYS-------PASTA-----------FEILQTNLG-----
A0A1Z4JVB4      --------DERTAALPVLHNPYS-------PAAVA-----------FEMFQTNLG-----
K9PIA4          --------GEGGAELPVLNNPYS-------PESAA-----------FEMLQTNLG-----
A0A1Z4HVE1      --------GEEGAELPVLNNPYS-------AESAA-----------FEMLQANLG-----
A0A252ECZ1      --------GEGSTELPVLNNPYS-------PESSA-----------FEMLQANLS-----
A0A1Z4G5Y1      --------GEGSAELPVLHNPYS-------PESAA-----------FEMLQTNLG-----
A0A252DNA2      --------GEGSAELPTLHNPYS-------PESAA-----------FEMLQANLG-----
A0A252E1Q4      --------GEGSAELPTLHNPYS-------PESAA-----------FEMLQANLG-----
A0A6G9SK36      --------GEGEQELPVLNNPYS-------PVSSA-----------FEMLQTNLS-----
A0A1Z4M597      --------GVGEVELPVLNNPYS-------PVSSA-----------FEMLQTNLS-----
A0A1Z4MWT1      --------AASEQELPVLNNPYS-------PVSSA-----------FEMLQTNLS-----
A0A1Z4TX53      --------AASEQELPVLNNPYS-------PVSSA-----------FEMLQTNLS-----
A0A5P8VSD1      --------GESITELPVLNNPYS-------SVNAA-----------FEMLQINLG-----
A0A2A2TNQ5      --------GKMATEIPARDNPYS-------SGSMA-----------FEMLMTNLA-----
A0A3S1C4K5      --------KGNGDDLPVLKDPYS-------PATSA-----------FEMLVTNLS-----
A0A1X4G3D5      --------WEGEGDLPLFDQPYS-------PISRS-----------FQILQTNLG-----
D4TNI2          --------WEGEGDLPLFDQPYS-------PISRS-----------FQILQTNLG-----
A0A1Z4H6Z8      --------SEAGSELPVLNNPYS-------PESTA-----------FEMLQVNLG-----
A0A1Z4NPM1      --------KAGDEELPVLNNPYS-------PASVA-----------FEMLQTNLS-----
A0A3F3KPR9      --------EESQRELPILDNPYS-------PVSTS-----------IEMLQTNLG-----
D4TGN7          --------EESQRELPILDNPYS-------PVSTS-----------IEMLQTNLG-----
A0A1Z4UZW9      --------QEGRQELPVLNNPYS-------PVSTS-----------FEMLQTNLG-----
A0A0K2M5H0      --------QEGRQELPLLDDPYS-------PVSTS-----------FEMLQTNLG-----
A0A1B7VSH4      --------QEGRQELPLLDDPYS-------PVSTS-----------FEMLQTNLG-----
A0A1B7W126      --------QEGRQELPLLDDPYS-------PVSTS-----------FEMLQTNLG-----
A0A3D4C6Q6      --------QEGRQELPLLDDPYS-------PVSTS-----------FEMLQTNLG-----
A0A1B7UVJ4      --------EESRGELPLLDNIYS-------PVSTS-----------FEMLQTNLG-----
A0A1B7UTR1      --------EESRGELPLLDNIYS-------PVSTS-----------FEMLQTNLG-----
K7W0A4          --------QEGRQELPLLDNPYS-------PVSTS-----------FEMLQTNLG-----
A0A5C0DRW9      --------QEGRQELPLLDNPYS-------PVTTS-----------FEMLQTNLG-----
A0A6H2C088      --------QEGRQELPLLDNPYS-------PVTTS-----------FEMLQTNLG-----
A0A2T1CIL7      --------FATSR-DNNSSLSIPDLNLAAVRYNEA-----------YNMLQANLK-----
A0A433V7A0      --------------VHVRDNSRS-------FIYEL-----------YCMIQANLK-----
A0A2T1FTR8      --------------LVLTGMTTG-------IEGES-----------FRMLQTNLQ-----
K9UA41          --------------LVLTGMTTG-------IEGES-----------FRMLQTNLQ-----
A0A0C2LBE2      --------QSIPK-VIGRDIPHF-------PVGDA-----------YQMLQANLK-----
A0A433NN38      --------RPTPR-VIGRDIHLF-------AIRDA-----------YQMLQANLR-----
A0A2N6K0T2      --------RPIPR-VVGRDIPHF-------PVGDA-----------YQMLQANLK-----
A0A2N6ML72      --------RPIPR-VVGRDIPHF-------PVGDA-----------YQMLQANLK-----
G6FQZ6          --------RPIPR-VVGRDIPHF-------PVGDA-----------YQMLQANLK-----
A0A2N6MQX9      --------RPIPR-VVGRDIPHF-------PVGDA-----------YQMLQANLK-----
A0A2N6KXT6      --------RPIPR-VVGRDIPHF-------PVGDA-----------YQMLQANLK-----
A0A2N6KGB9      --------RPIPR-VVGRDIPHF-------PVGDA-----------YQMLQANLK-----
A0A2N6L3Y5      --------RPIPR-VVGRDIPHF-------PVGDA-----------YQMLQANLK-----
A0A0S3TIS7      --------RPIPR-VVGRDIPHF-------PVGDA-----------YQMLQANLK-----
A0A1U7GW28      --------RPIPR-VVGRDIPHF-------PVGDA-----------YQMLQANLK-----
A0A2N6LW63      --------RPIPR-VVGRDIPHF-------PVGDA-----------YQMLQANLK-----
A0A328IH74      --------RPVPR-VIGRDVPHF-------PVGDA-----------YQMLQANLK-----
A0A4D9CIB0      --------RPVPR-VVGRDVPYF-------PVGDA-----------YQMLQANLK-----
A0A1Z4TQ63      --------RPVPR-VVGRDIPHF-------PVGDA-----------YQMLQANLK-----
A0A4Q9J8G2      --------RPVPR-VVGRDVPHF-------PVGDA-----------YQMLQANLK-----
A0A1Z4SMD6      --------GISPR-IVIGTYPHT-------IVHDA-----------YQMLQANLK-----
A0A2H2Y096      --------GISPR-IVIGTYPHT-------IVHDA-----------YQMLQANLK-----
K9S8M8          --------TSVPK-VVVQEAPHS-------IISEN-----------YRMLQANLR-----
A0A1Z4NFV0      --------GVSPR-VIVATTPRS-------VIHEA-----------YQMLQANLK-----
B0CAX4          --------RPTPD-LVVRDSPRS-------SVSES-----------YRMLQANLK-----
A0A350Y0P6      --------GNVPQ-LVVRDVPHG-------ITSEA-----------YRMLEANLK-----
A0A352X940      --------GDIPQ-LPVRDAPHA-------IVSEA-----------YRMLEANLK-----
B8HTN4          --------RATPQ-LYLRDQPNS-------HLSEA-----------YRTLQANLK-----
A0A2A2TPF8      --------AASPR-IIVATLPRS-------VIHEA-----------YQMLQANLN-----
A0A1Z4R0P8      --------GASPR-VIVGTLPRS-------VIHEA-----------YQMLEANLN-----
A0A0T7BUI3      --------GISER-VIVNSSPRT-------IIHEA-----------YQMLQANLN-----
A0A1Z4LP32      --------NISPR-IIVASSPRT-------MIHEA-----------YQMLQANLK-----
K9REP9          --------TISPR-IIVASSPRT-------MIHEA-----------YQMLQANLK-----
A0A1Z4SIJ3      LPIRLVGLEVSNR-IIVASAPHT-------VIHDA-----------YQMLQANLK-----
A0A2H2XPG4      LPIRLVGLEVSNR-IIVASAPHT-------VIHDA-----------YQMLQANLK-----
K9V3C7          --------GVSPR-IIVATSPRT-------VIHEA-----------YQMLRANLK-----
A0A1Z4T6Y7      --------GASPR-IVVGTLPRS-------VIHEA-----------YQMLQANLK-----
A0A2H2Y561      --------GASPR-IVVGTLPRS-------VIHEA-----------YQMLQANLK-----
A0A1Q4S362      --------GASPR-VIVGTLPRS-------VIHEA-----------YQMLQANLK-----
A0A3S1CIN8      --------GASPR-VVVGTLPRS-------VIHEA-----------YQMLQANLK-----
A0A2A2TC28      --------NVSPR-VIVASSPRT-------VIHEA-----------YQMLQANLK-----
A0A0C1NCB0      --------ATSPR-VIVATSPRT-------VVHEA-----------YQMLQANLK-----
A0A2N6K7Q9      --------GVYPQ-VIATTSPRT-------VVHEA-----------YQMLQANLK-----
A0A2N6MXH6      --------GVYPQ-VITTTSPRT-------VVHEA-----------YQMLQANLK-----
A0A2N6M5A8      --------GVYPQ-VITTTSPRT-------VVHEA-----------YQMLQANLK-----
A0A2N6LL61      --------GVYPQ-VITTTSPRT-------VVHEA-----------YQMLQANLK-----
A0A0S3TP66      --------GVYPQ-VITTTSPRT-------VVHEA-----------YQMLQANLK-----
G6FP91          --------GVYPQ-VITTTSPRT-------VVHEA-----------YQMLQANLK-----
A0A1U7GYR5      --------GVYPQ-VITTTSPRT-------VVHEA-----------YQMLQANLK-----
A0A2N6KY52      --------GVYPQ-VITTTSPRT-------VVHEA-----------YQMLQANLK-----
A0A2N6KMP5      --------GVYPQ-VITTTSPRT-------VVHEA-----------YQMLQANLK-----
A0A2N6MA45      --------GVYPQ-VITTTSPRT-------VVHEA-----------YQMLQANLK-----
A0A4Q9J9V9      --------GVYPQ-VITTTSPRT-------LVHEA-----------YQMLQANLK-----
A0A328IGA1      --------GVYPQ-VITTTSPRT-------LVHEA-----------YQMLQANLK-----
A0A4D9CE41      --------GVYPQ-VITTTSPRT-------LVHEA-----------YQMLQANLK-----
A0A0M0SFT2      --------GVYPQ-VITTTSPRT-------LVHEA-----------YQMLQANLK-----
A0A1Z4TLC8      --------GVYPQ-VITTTSPRT-------LVHEA-----------YQMLQANLK-----
A0A0C2LFH0      --------KASAR-IIVATSPRS-------VVHEA-----------YQMLQANLK-----
A0A1Z4IYV4      --------GVSAR-VIVATSPRS-------VIHEA-----------YQMLQANLK-----
A0A1Z4Q0T6      --------GVSAR-VIVATSPRS-------VIHEA-----------YQMLQANLK-----
A0A0C2PT44      --------GVSAR-VIVATSPRS-------VIHEA-----------YQMLQANLK-----
A0A1D2P6J4      --------GVSGR-VIVATSPRS-------VVHEA-----------YQMLQANLK-----
A0A3M9ZEU1      --------PATLR-IFPRDLPRS-------PISEA-----------YHMLQANLK-----
A0A1Z4JK72      --------DISPR-VIAMTSPRS-------MIHEA-----------YQMLQANLK-----
A0A0N7Z489      --------DISPR-VIAMSTPRS-------MIHEA-----------YQMLQANLK-----
A0A0S3TXS2      --------DISPR-VIAMTSPRS-------MIHEA-----------YQMLQANLK-----
A0A1Z4RN12      --------ANLPE-QVTTDASML-------PLKEA-----------YQNIQVNLK-----
A0A2T1CMF9      --------ANLPE-QIVSEVSMM-------PLKEA-----------YQNIQVNLN-----
Q7NDC5          --------QSVRGPLMALRDPLS-------PVSEA-----------YRSIRTHLK-----
U5QGK3          --------AEGPG-LVAQSDPLS-------PMSEA-----------YRSVRTYLK-----
A0A2W4UY24      --------LDAPR-IIVKQRHRV-------PLVES-----------YQSLQANLK-----
A0A2T1GMT4      --------QTTLE-IAVRDTPQS-------ITSEM-----------SRTIQSNLR-----
K9UI51          --------QTTLE-IAVRDTPQS-------ITSEM-----------SRTIQSNLR-----
K9QM62          --------SITPS-IAVRDRPYS-------LTSEM-----------YRMLQANLK-----
A0A1Z4FWI3      --------LAPPE-IAVIDTPQS-------LTSEI-----------YRMIQANLR-----
A0A1Z4JYE7      --------YQIPR-IAVRDTPDS-------LTSEI-----------YRMIQANLK-----
A0A2T1FXY4      --------STNPE-IAVRDKPHS-------LTSEI-----------YRMIQANLK-----
K9TYI2          --------STIPE-ISVRDKPHS-------LTSEI-----------YRMIQANLK-----
A0A1Z4QL41      --------TNTQN-IVVRDQPYS-------LASEM-----------YRMIQANLR-----
A0A252D4T4      --------LINPE-IAVIDTPHS-------LTSEI-----------YRMIQANLR-----
A0A252DJH5      --------LINPE-IAVIDTPHS-------LTSEI-----------YRMIQANLR-----
A0A252EB80      --------LINPE-IAVIDTPHS-------LTSEI-----------YRMIQANLR-----
A0A6G9SKZ9      --------IATQE-IAVIDSPNS-------LTSEI-----------YRMIQANLR-----
A0A1Z4HPW5      --------IATQE-IAVIDSPSS-------LTSEI-----------YRMIQANLR-----
A0A1Z4MSN1      --------IATQE-IAVIDSPTS-------LTSEI-----------YRMIQANLR-----
A0A1Z4U1C2      --------IATQE-IAVIDSPTS-------LTSEI-----------YRMIQANLR-----
A0A0D6KV51      --------IATQE-IAVIDSPSS-------LTSEI-----------YRMIQANLR-----
A0A1Z4MKF8      --------IATQE-IAVIDSPSS-------LTSEI-----------YRMIQANLR-----
A0A2C6WC43      --------SITQK-VAVRDMPYS-------LTSEM-----------YRMIQANLK-----
A0A1Z4L5A1      --------SITQK-VAVRDMPHS-------LTSEM-----------YRMIQANLK-----
A0A367QD86      --------SITQK-VAVRDMPHS-------LTSEM-----------YRMIQANLK-----
A0A235IZ96      --------LPTQT-VAVRDTPYS-------LTSEM-----------YRMIQANLK-----
A0A2L2NGP0      --------LPTQT-VAVRDTPYS-------LTSEM-----------YRMIQANLK-----
A0A2K8SM78      --------SITQK-IAVRDTPYS-------LTSEM-----------YRMIQANLK-----
A0A2R5FPC0      --------P---K-IAVRDTPYS-------LTSEM-----------YRMIQANLK-----
A0A5P8W5T6      --------SITQK-IAVRDTPYS-------LTSEM-----------YRMIQANLK-----
A0A140KBA0      --------DTLPQ-LPAGQNDSSHHRHALLPIREA-----------YQILQANLK-----
K9XSG1          --------DTLPQ-LPASQNAHSNNRHVFLPIREA-----------YQILQANLK-----
A0A0F5YE28      --------RASQQ-IPVVEASDS-------FISEI-----------YRMLQANLK-----
U7QEH7          --------KATPD-IPVIEASDS-------FISEI-----------YRMLQANLK-----
A0A3S1ATK5      --------YITPE-IASKDAPQS-------LTSEM-----------YRVIQANLR-----
A0A2Z6CPH0      --------LTTPE-IAVRDMPHS-------LTSEI-----------YRMIQANLK-----
A0A1Z4GT50      --------SITPE-VPVRDTPNS-------LTSEI-----------YRMIQANLR-----
A0A1Z4GIX0      --------LASPE-IAVRDMPHS-------LTSEM-----------YRMIQANLK-----
A0A2H6LC24      --------LASPE-IAVRDMPHS-------LTSEM-----------YRMIQANLK-----
B2J6N5          --------SINQT-IAVRDTPYT-------LTSEM-----------YRMIQANLK-----
A0A367RMI4      --------SISQT-IAVRDTPHS-------LTSEM-----------YRMIQANLK-----
A0A235HUM0      --------FTSQT-VAVRDTPHS-------LTSEM-----------YRMIQANLK-----
A0A2L2NW47      --------SISQT-IAVRDTPHS-------LTSEM-----------YRMIQANLK-----
A0A1E2WUR1      --------STVQT-IAVRDTPHS-------LTSEM-----------YRMIQANLK-----
A0A235IKU3      --------LPTQT-VAVRDTPYS-------LTSEM-----------YRMIQANLK-----
F4XKF3          --------FFGGE-LPVTEQPHS-------MVSEV-----------YRMIQANLK-----
A0A1D9FX10      --------FFGGE-LPVTEQPHS-------MVSEV-----------YRMIQANLK-----
A0A1D8TNX9      --------FFGGE-LPVRDQPHS-------MVSEV-----------YRMIQANLK-----
A0A1U7MYU6      --------FFGGE-LPVTDQPHS-------MVSEV-----------YRMIQANLK-----
A0A3C0NJ41      --------RTVPE-LPVRDTPRS-------PISEA-----------YRMLQANLK-----
A0A352AG88      --------GTIPE-LPVRDTPRL-------PISEA-----------YRMLQANLK-----
A0A350Y374      --------RTIPE-LPVRDNPLA-------AISEV-----------YRMLQANLK-----
A0A355DPX0      --------RTIPE-LPVRDNPLA-------AISEV-----------YRMLQANLK-----
A0A0D8ZUV2      --------ATIPE-LPVRDMPRS-------PLSEA-----------YRMLQANLK-----
A0A433VDI0      --------WAVPE-LPVRDIPNS-------PISEA-----------YRMLQANLK-----
A0A3D1PG43      --------WAVPE-ISVLENSLS-------PIAEN-----------YRMLQANLK-----
A0A2P8QQ72      --------CPIPE-LAVRNSPRS-------LTAEA-----------YRMLQANLR-----
K9TZQ7          --------CPVPE-LAVRNSPRS-------LTAEA-----------YRMLQANLR-----
A0A2G7GPR0      --------WSIPE-LPVINLPRS-------PISEA-----------YRMLQANLK-----
K9XH68          --------WSIPE-LPVINLPRS-------PISEA-----------YRMLQANLK-----
A0A1U7HW70      --------WSIPE-LPVINLPRS-------PISEA-----------YRMLQANLK-----
A0A2S6VEJ8      --------WSIPE-LPVINLPRS-------PISEA-----------YRMLQANLK-----
                                                                            

K9SLA9          FL----EP-GKAPKVIAITSSIAKEGKSTFTANLAI-AAAQMGAKVLLIDADLRKPTQHQ
A0A168TT23      FS----TP-QGMPKTILMTSPGPGDGKTTNAINLAT-VLAQNGARVLLIDADLRKPRLHR
A0A0M1JWX9      FL----ST-DQPIRAIAVASAVAAEGKSTAAVNLAQ-AAATMGQRVLLVDGDLRRPQVHA
A0A2T1M1V6      SF-------ELENRRLMITSATRSEGKTTLTLGLAW-ALVQLGFRVLLVDADLRQA----
A0A2G7GCS2      -L-------MLEHQRLLVTSPTSGEGKTTVTLGLAL-ALVNFGFRVLIVDGDLRQA----
K9XBH8          -L-------MLEHQRILITSPTAGEGKTTMTLGLAL-ALVNCGFRVLMVDGDLRQA----
A0A1Z4LJ30      LM-------QLGSGRLMIASATTSEGKTTATLGLAN-ALINLGFKVLVVDGDFRKS----
K9RI76          LM-------QLNSGRLMIASANTEEGKTTTTIGLAN-ALLVLGFKVLLVDGDFRRG----
A0A352AE27      LQ-------PLKNRRLLVTSATMGEGKTTVTLGLAT-ALVDLGFRVLLVDGDFRKA----
A0A3B8JH60      LQ-------PLQDHRLLVTSAIMGEGKTTVTLGLAT-ALADLGFRVLLVDGDFRKA----
A0A3C0N766      LQ-------PLQDHRLLVTSAIMGEGKTTVTLGLAT-ALADLGFRVLLVDGDFRKA----
K9W9J7          LQ-------PLKDHRLLITSAIMGEGKTTVTLGLAR-ALADLGFRVLLVDGDFRKA----
A0A139WSU3      LQ-------PLNNRRLLVTSATQGEGKTTVAIGLAY-GLVDLGFRVLLVDGDFRSA----
A0A433VN22      LQ-------PLENRRLLVTSAIMGEGKTTVAIGLAN-ALVDLGFKVLLVDADFRQA----
Q7NF11          LM-------DLPNRRLMITSSTAGEGKTTLTLGLAN-ALAEMGFRVLLVDADFRQA----
A0A1Z4JCS8      LQ-------PLKGIRLLIASAITGEGKTTVALQLAH-ALTELGFRVLLVDGDFRKA----
F4XTX2          LR-------SGEDRRILITSAMVSEGKTTVTLGLAT-ALVDLGFRVLVVDGDFRQA----
Q7NJN6          LL-------PLPARRLMITSANTGEGKTTVTLGLAK-ALRELGFRVLVVDADFRQA----
U5QCC3          LM-------PLEGQRLMITSSTFGEGKTTVTLGLAR-ALRSLGFRVLVVDADFRQA----
A0A3S0Y9N9      FF----NS-KQHIKVIVVSSAVPQEGKSTIAANLAF-SISQIGRKVLLVDADFRRPSQDK
A0A433UNK7      FF----NS-EQSIKVIVVSSSVPKEGKSTIAANLAF-SISQLGRNILLVDADLRNPSQHK
A0A3M1SVZ4      FA----CA-EQSVKTIVVTSAIAKEGKSTIAANLAA-AISQVGRRVLLVDADLRRPLQHE
A0A654SFI6      LT----SD-GA-PKLLMLTSSVLAEGKSVSSLALAA-SFARLGKRTLLIDGDLRNSRLMA
K9SSQ0          LA----AQ-RT-FKTIAFTSSIPSEGKSTIIYNLSL-TLAELGYKVLLVDADMRKPTIHS
A0A2W1JIN9      FR----GL-EE-FHTLVVSSAISGEGKSVVTSYLAA-VAAMLSRRTLIIDADLRRPTIHK
A0A318AJV1      VR----QA-SG-MRVIGFTSALPGEGKSNTALAFAR-MLAVNGARVLLVDADLRNSKFPG
A0A6B3MUB5      FR----TQ-QK-LKLIVVSSTVSGEGKSIVASHLAA-VSAMLSRQTLIIDADLRKPKQHR
A0A1U7N2U4      LR----AQ-KR-LQLIVVSSAVSGEGKSVVVSHLAA-VSARFSRRTLIIDADWRHPMQHN
A0A1D9G1F2      LR----AQ-KR-LQLIVVSSAVSGEGKSVVASHLGA-VSVRFSRRTLIIDADWRHPMQQD
F4XV38          LR----AQ-KR-LQLIVVSSAVSGEGKSVVASHLGA-VSVRFSRRTLIIDADWRHPMQHN
A0A2P8QIL5      FA----AN-ED-IKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQHK
A0A2T1FLY5      FA----AN-ED-IKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQHK
A0A433W447      FA----AN-ED-IKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQHK
K9U1K8          FA----AN-ED-IKVIVVSSALSGEGKSLVSSYLAA-VAATLSRRTLLIDADLRCPTQHK
K9UYB2          FS----TA-EN-LHLFVVSSTISGEGKSIVTSHLGA-ISAMLSRRTLIIDADLRKPVQHK
A0A218QN17      FR----SN-DK-VQVIVVSSTLSGEGKSIVASHLAA-ISAMLSRRTLIIDADLRRPMQHT
K9RKN2          FR----SD-DE-LQKIVVSSTISGEGKSVVVSHLAA-VSAMLSRKTLVIDADLRRPVQHT
A0A2I8ADV2      FR----SH-EK-LQVVVVTSTISGEGKSVVVSHLAA-VAAMLFRRTLIIDADLRRPVQHT
A0A1W5CKM3      FR----NV-DN-LQVIVVSSPLAGEGKSVIVSHLAA-VSAMLSRRTLIIDADLRKPSQHT
A0A5Q0GMF5      FR----NV-DN-LQVIVVSSPLAGEGKSVIVSHLAA-VSAMLSRRTLIIDADLRKPSQHT
Q3MEW0          FR----NV-DN-LQVIVVSSPLAGEGKSVIVSHLAA-VSAMLSRRTLIIDADLRKPSQHT
A0A1Z4KIC7      FR----NV-DN-LQVIVVSSPLSGEGKSVIVSHLAA-VAAMLSRRTLIIDADLRKPSQHT
Q8YSM5          FR----NV-DN-LQVIVVSSPLSGEGKSVIVSHLAA-VAAMLSRRTLIIDADLRKPSQHT
A0A1Q4S1H4      CR----SP-GK-LHLVVVSSALSSEGKSVVVSHLAA-VAAMLSRRTLLIDADLRRPKLHR
A0A433VBU6      CR----SA-SK-LHSIVVSSALSGEGKSVVVSHLAA-VSAMLSRRTLLIDADLRRPKLHR
A0A1Q4RZJ6      FR----TS-E--LQLLVVSSTISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQHT
A0A1Z4SNV3      FR----TS-E--LQLLVVSSTISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQHT
A0A2H2XJQ1      FR----TS-E--LQLLVVSSTISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQHT
A0A3S5K358      FR----TS-E--LQLLVVSSTISGEGKSIVASHLAA-VSAMLSRRTLIIDADLRRPVQHT
A0A0T7BPJ4      FR----NL-ED-LNSIVISSTISGEGKSVVASHLGA-VSAMLSRKTLIIDADLRRPEQHR
A0A0C1QS61      FR----S--DR-MRVIVVSSSIAGEGKSIVASHLAA-IAGMLSWRTLIIDADLRRPEQHT
A0A139X3R8      FR----S--DQ-MRLIVVSSSIAGEGKSIVASHLAA-VAAMLSWRTLVIDADLRRPEQHT
A0A1Z4I7C5      FR----SI-DN-LQVIVVSSPLSGEGKSVIVSHLAA-VCAMLSRRTLIIDADLRKPSQHT
A0A0C2MDK7      FR----RS-EQ-LRAIVVSSTISGEGKSVVASHLAA-VVGMLSWRTLIIDADLRRPSQHT
A0A1Y0RCK1      FR----SR-EQ-LRLIVVSSTISGEGKSVVASHLAA-VAAMLSWRTLVIDADLRKPVQHT
A0A1Z4PWZ0      FR----SS-EQ-LRLIVVSSPISGEGKSVVASHLAA-VAAMLSWRTLIIDADLRRPVQHT
A0A0C2QLT0      FR----SP-EQ-VRLIVVSSPISGEGKSVVASHLAA-VAAMLSWRTLIIDADLRRPVQHT
A0A1Z4J2K1      FR----SP-EQ-VRLIVVSSPISGEGKSVVASHLAA-VAAMLSWRTLIIDADLRRPVQHT
A0A3S0ZSX0      FR----SS-EP-LRQIVVSSTISGEGKSVVASHLAA-VCAMLSRRTLLIDADLRRPAQHT
A0A2N6K4T3      FR----SR-ES-LRSIVVSSTITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPILHT
A0A370CKT2      FR----SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHT
A0A0S3TL97      FR----SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHT
A0A2N6M8A0      FR----SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHT
A0A2N6M9E1      FR----SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHT
A0A2N6KJI4      FR----SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHT
A0A2N6MZ77      FR----SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHT
A0A2N6KT20      FR----SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHT
G6FSN3          FR----SS-EP-LRSIVVSSTITGEGKSVVASHLAA-ISAMLSRRTLLIDADLRRPILHT
A0A4D9CI02      FR----NP-ES-LRSIVVSSTITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPMLHT
A0A328I8B9      FR----NP-ES-LGSIVVSSTITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPMLHT
A0A4Q9J4Z7      FR----NP-ES-LRSIVVSSTITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPMLHT
A0A0M0SU69      FR----ST-EP-LRSIVVSSTVTGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPVLHT
A0A1Z4TIZ8      FR----SN-EP-LRSIVVSSSITGEGKSVVASHLAV-ISAMLSRRTLLIDADLRRPVLHT
A0A0S3TYD7      YV----SS-DREARAIVVSSCIPSEGKSTVSANLAS-AFAQIGKRVLLIDADLRRPRQHH
A0A3C0N2P0      FV----S-PDEAVRSVVISSATPGDGKSTITTFLAQ-AAAAMGQRVLLVDADLRRPRIHE
K9TLQ0          FM----S-PDRPLKSIVISSTLPAEGKTTISMKLAE-AASAMGNRVLLVDADLRRPQIDQ
A0A6B3M6M6      FL----G-TDESIRSLVISSTVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVHL
A0A6B3NIJ0      FL----G-TDESIRSLVISSTVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVHE
A0A352XE00      FI----S-PDRPIRSLVMSSAVPADGKSTTSMFLAQ-AAAAMGEKVLLVDADLRRPQIHV
B4VS56          FI----S-PDQPIRSVVISSAVPADGKSTIATFMAQ-AAAAMGQRVLLVDADLRRPQLHV
A0A352AAQ3      FL----S-PDRPIRSLVMSSAVPADGKSTTSAFLAQ-AAAAMGERVLLVDADLRRPQVHV
A0A350Y472      FL----S-PDKSIRSLVVSSAVPADGKSTVAAFLSQ-AAAAMGERVLLVDADLRRPQVHV
A0A355DVB4      FL----S-PDKTIRSLVVSSAVPADGKSTVAAFLAQ-AAAAMGERVLLVDADLRRPQVHV
U5QL42          YL----G-SNNSVKTLLFTSSIPAEGKSIISYNLGL-VLSEFGKRVLVVDADMRKPNLHR
K9QF04          FL----D-PDKPLKSLVISSALPGEGKSTIAVYLAQ-VAASMGKRVLLIDADLRRPTIHT
A0A076HBF2      FL----N-SDQPLRSIALTSSLPAEGKSLVNVLLAK-TLSEMGQRILLIDADLRKPQMHV
A0A354B169      FL----N-SEKPLRLIAISSSLPREGKSLIIVLLAK-TLAEMGKKILVIDADMRRPQLHQ
G4FMX5          FL----N-SDRPLRSIALTSSLPAEGKSLVNTLLAK-TLAEMGQRVLLIDADLRKPQLHT
Q0IDT5          FL----N-TERPLKAVALTSSLPAEGKSLVNVLLAK-TLAEMGQRVLLVDADLRKPQLHI
A0A2D6FCW3      FL----N-SDQPLRSIAITSSLPAEGKSLVNVLLAK-TLSEMGQKVLLIDADLRKPQLHT
A3ZA21          FL----N-SDRPLRAIALTSSLPAEGKSLVNVLLAK-TLSEMGQRVLLIDADLRKPQMHT
A0A140K3H3      YT----LTEKGKINSLALTSATSAEGKTTVTYNLGI-VLAELGLNVLIIDADMRKPKIHK
K9XUB8          YT----ITETGKINSLALTSSTSAEGKTTVTYNLGL-VLAELGLRVLIVDADMRKPKIHK
Q7NEU3          FL----S-SDRKLKVFVVSSSMPGEGKSTVATNLAK-VVGGLNRKALLVDADLRRPTVSN
A0A6H2NHD5      LL----S-SDAPIQLVVFTSSVPGEGKSTICAHLAI-ASANMGRRVLLIDGDMRKPSQHL
A0A2P8W4F7      ML----S-SDVPVQVVALTSSVPGEGKSTICAHLAI-AAANMGRRVLLIDGDLRKPSQHL
A0A5Q4E0Z4      ML----S-SDTPVQVVALTSSVPGEGKSTMCAHLAI-AAANMGRRVLLIDGDLRKPSQHL
A0A2P8VVX1      LL----Q-NSHPSKAIAITSALPGEGKTTLTLGLAF-SLARMGQRVLVIDADLRRSGIQA
A0A2P8WHY0      LM----L-KGKGNQAIAVTSSLPSEGKTTVALGLAF-SLARMRQRVLVIDADLRRSGIAT
A0A2T1CMT9      LAYLNSSLVGSALKSIAITSAVAGEGKSTLTLGLAL-SIARDRQKVLVIDADLRSPSLHK
A0A563VQJ3      FM----N-SQRAPKVILVTSSVPGEGKSTITANLAA-AIAQLGRYVLLIDGDLRKPTQNT
A0A1D8TX52      LL----N-PGSEWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLHQ
A0A1D9G4T2      LL----N-SGSEWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLHQ
F4XP71          LL----N-SGSELKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLHQ
A0A1U7N5X9      LL----N-SGSEWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLHQ
A0A6B3N2I8      LL----N-SGSEWKSLMVTSALSGEGKSTLALGLAL-SAARLHRRVLLIDVDMRRPRLHQ
A0A2W6ZAV2      LL----R-ADKVVRLFSVTSTVELEGKSTASALFAQ-TMADLGQRVLLVDADLRRPSLHR
A0A2G7GMH8      LL----T--AFPVKSLAVTSALAGEGKTTLALGLAI-AAARLHQKVLLIDTDLRRPSLHK
K9W742          LL----S-SVSTLRSLMVTSAVAGEGKSTLALGLAI-SAARLHQRVLLIDADLRNPTLHE
A0A2T1DWE8      LL----P-SAAGLRSLVVTSALAGEGKSTIALGLAI-SAARLHQRVLLVDADLRRPSLHQ
A0A1U7I8L3      LV----N-STGSLKSLVITSALAGEGKSAIALGLAI-SAARLHQRVLLIDADLRRPSLHK
A0A2T1DJL8      LL----T-AANPLRSLVVTSALAGEGKSTIALGLAI-SAARLHQRVLIIDADLRRPGLHK
A0A1Z4J9W0      LM----T-DGDPLKSLVVTSALAGEGKSTVALGLAI-SAARLHQRVLLIDADLRRPGLHK
A0A0N7Z5K9      LM----T-DGDPMRSLVVTSALAGEGKSTVALGLAI-SAARLHQRVLLIDADLRRPGLHE
A0A0S3TXC5      LM----T-DGSPMRSLVVTSALAGEGKSTVALGLAI-SAARLHQRVLLIDADLRRPGLHH
K9SA61          LL----N-AASPLKSIVVTSALAGEGKSTLAMGLAM-SAARLHQRVLLIDADLRRPSLHK
A0A3D1PBA3      LM----N-ELASFKSLMVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDADLRRPNLHE
K9XPB0          RL----G-SGFAFKSLLLTSAVAGEGKSTLVLGLAF-SIARHQKRVLVIDADLRCPSLHE
A0A350Y7Z1      LL----N-SSATLRSIVVTSALPSEGKSTLVVGLAF-SAARLHQRVLLIDADLRRPSLHK
A0A352X2A7      LV----N-AGRLLKSLAVTSALSGEGKSTLVMGLAL-TAARLQQRVLLIDTDLRFPTLHR
A0A0D8ZYV0      LL----NTAVASLQSIMVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDADLRRPNLHQ
A0A2T1FP73      LM----N-EMAAFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLHQ
A0A433VMS2      LM----N-EMAAFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLHQ
K9TYA7          LM----N-EMAAFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLHQ
A0A2P8QUE1      LM----N-EMAAFKSLVVTSAVAGEGKSTLALGLAL-SAARLHQRVLLIDTDLRRPSLHQ
A0A2T1DNG3      LI----NA-TAELHSIVVTSTLAGEGKSTLSVGLAI-SAARLHQRVLLIDADLRRPNLHK
B8HNB0          YL----SP-DTELRTIAFTSTIPSEGKSTIVYNLGR-MLAELGQKVLIVDADTRNPTIHQ
A0A1Z4LN32      FI----SL-DRKIRSIAVTSSVAGEGKTEVAANLAA-VMAQVGRRVLLVDADMRQPSQHH
A0A2I8A9F5      FI----SL-DKKIRTIAVTSSIAGEGKSEIAANLAA-VIAQTGRRVLLIDADMRRPSQHH
A0A218Q6R8      FM----SL-DKKVRTIVVTSSVPGEGKSEVSANLAA-VMAQVGRKVLLVDADMRQPSQHH
A0A218QGE0      FI----SL-DRKVSAIVVTSSISGEGKTEVAANLAA-VMSLAGRRVLLVDADMRQPSQHH
A0A563VS48      LL----DP-KERIKTIAITSAVAQEGKSSVSANYAI-AQAQCGKRILLIDGDLRRSSQHD
A0A318BJ18      FT----TE-HGVPRSFLVTSTRPAEGKSTTALALAT-MLARAGKRTILVDGDMRSPSVHQ
A0A3B8Y8H9      LL----NP-KQTIKSLTISSAIPEEGKSTVAAHLAQ-AAAKMGQKVLLVDGDLRLPQLHH
A0A2W1JVB9      YL----NS-DKPLKVIVMTSGIPSEGKSTASANLAM-AMAELGQKVLLVDADLRRPVQHR
A0A6H1U102      YL----GA-KDEVKTLALTSSTPSEGKSTLTYNLAR-SLAELGQRVLIVDADMRKPTIHE
A0A563VLD6      YM----MAQSGKIKSLVLTSSTSSEGKSTTAYNLGL-ALTDLGSRVLIVDADMRKPKMHK
A0A2P8W9H0      LS----NP-EQPLKSITVSSAVPNSGKTTVSFHLAY-TMALLGYRTLVVDNDFRRPSLHT
A0A6I5P386      LN----NP-DTHLKSLAISSATPNSGKSTVSFHLAH-TNATLGQKTLLVDMDLRRPTLHK
A0A318BG22      LA----TP-GGLPRTLLVTSAAMAEGKSTTSAALAQ-GVADRGKRVLLVDADLRKPTLHH
A0A1Z3HMQ0      FI----SS-DTPRRALTLTSSVPQEGKSEVAANLAA-TIAQTGKQVLLVDADMRSPWQHH
K1XF69          FL----GS-DRKVRVIVVSSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQHH
B5W297          FL----GS-DRKVRVIVVSSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQHH
A0A6H2AL05      FL----GS-DRKVRVIVVSSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQHH
H1W7M8          FL----GS-DRKVRVIVVSSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQHH
A0A5Q4H6A5      FL----GS-DRKVRVIVVTSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQHH
D5A466          FL----GS-DRKVRVIVVTSSVPQEGKSTVSANLAA-AIAQLGHRVILIDGDMRQPIQHH
U5QJM6          FL----NS-DKKVNTFVISSSAPGEGKSTVSTNLAR-IAAELNRKVLIIDADLRRPTVAK
A0A1Z4RPC6      FL----AV-KRQPKVIVITSSVPGEGKSTIAANLAA-AMAQLGRKVLLIDGDLRKASQQD
A0A2T1CMZ0      FL----AV-KQQPKVILMTSSVPGEGKSLVAANLAA-AMAQLGRKVLLIDGDLRKASQHD
L8M4F7          AR----SS-QVLPKVILVTSSVPGEGKSTVTANLAA-AISQLGSRVLLVDGDLRRPSQHL
A0A140K2P2      FM----SL-ENSTQVILVTSSVPEEGKSTVSANLAA-AIAQLGKRVLLIDGDLRKPSQHR
K9XWX4          FM----SL-EHPPQVILVTSSVPEEGKSTVSANLAT-AIAQLGKRVLLIDGDLRKPSQHH
A0A140KB14      IL----NQ-DNPPQVILITSSVPGEGKSTVAANLAA-AIAQLGRRVLLIDGDLRRATQHH
K9XX88          IL----NQ-DNPPQVVLVTSSVPGEGKSTIAANLAT-AIAQLGRRVLLIDGDLRRANQHH
A0A563VSV6      FM----TT-QRPPKVILITSSAPGEGKSTVTANLAA-AIAQLGRRVLLIDGDLRKSSQHQ
L8LZE9          FM----TS-QRPPKVILVTSSIPGEGKSTVTANLAA-AISQLGRKVLLIDGDLRKASQHQ
A0A433NM31      FL----GS-DQELRVITITSAVPKEGKSTVSANLAL-AIAQLGFKVLLVDADMRSPSQHQ
A0A1Z4NDS1      FL----AS-DNELKTIVVSSSVSGEGKSEVSANLAV-TVAQLGRRVLLIDADMRCPIQHH
K9F4D9          FS----CV-DTHVKTVTVTSAVGGEGKSEVAANLAL-TLAHLGHTVLLVDADLRKPTQHH
U9VXM0          FS----CV-ESQVKTITITSAVGGEGKSEVAANLAL-TLAHLGHMVLVVDADMRKPTQHL
A0A6I5QPI5      FL----QS-DTELKTVMITSAVPGEGKSEIAANLAA-ALAQVGRRVLLIDADMRYPRQHH
A0A433W533      FS----SS-DK-LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQHH
A0A2P8QWJ3      FS----SS-DK-LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQHH
A0A2T1FKP8      FS----SS-DK-LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQHH
K9U6L7          FS----SS-DK-LKVILVTSSVPGEGKSTVSANLGA-AIAQLGNRVLIVDADMRRPRQHH
A0A1E5QP61      FI----SP-DREIRIIVVTSAVSQEGKSTVAANLAV-ATAQLGRRVLLIDGDMRHSTQHQ
U5DPF5          FS----TT-DRKLKVVAVTSSIPREGKSTVSANLGV-ALAELGNRVLVIDADMRRPSQHQ
A0A3M1PML8      FL----SS-DKAVRSFVITSSVAQEGKSEIAANLAA-TMAQLGRKVLLVDADLRRPAQHH
A0A3M2GIL5      FL----SP-DKELKTIVVTSSMAKEGKSAVAANLAL-AIAQLGRRVLLIDADLRHPIQHH
A0A6H1TSJ9      FL----SP-DKELKTIVVTSSMAKEGKSAVAANLAL-AIAQLGRRVLLIDADLRHPIQHH
A0A0T7BPZ0      FL-----S-DRRIKAIAVTSSIPKEGKSEVSANLAV-AMAQVGRKVLLIDADMRHPIQHH
A0A352X442      FL----SS-DKQIKAIVVTSSVPQEGKSEVSANLAA-AIAQVGRRVLLVDADMRHPSQHH
A0A6B3NF44      FL----SS-DKQIKSIVVTSSVPKEGKSEVCANLAA-AMAQIGRRVLLVDGDMRHPSQHH
A0A0M0SHU3      FL-----S-DKQLKAITVTSSIPKEGKSEVSANLAV-AMAEVERRVLLVDADMRHPIQHH
A0A1D2PBN3      FL----SS-DKQLKAIVVTSSVAKEGKSEVAVNLAV-AMAQVGRRVLLVDADMRHPVQHH
A0A0C2LVR7      FL----SS-DNQLKAIVVTSSVAKEGKSEVAVNLAV-AMAQVGRRVLLVDADMRHPVQHH
A0A1Z4PQB9      FL----SS-DNELKAIVVTSSVPKEGKSEVAANLAV-AMAQVGRRVLLVDADMRHPVQHH
A0A1Z4SFN6      FL----SS-DKKLKAIVVSSCVSKEGKSEVAANLAV-AMAQLGHRVLLVDADMRRPVQHH
K9PGI8          FL----GS-DEELKAIAVTSSVAKEGKSEVAANLAV-AIAQLGRRVLLVDADMRHPVQHH
A0A2T1E9V8      VA----S--SKALKVIAITSSVPNEGKSTTCANLAA-VMAQLEHKVLIIDADFRHPSQHL
A0A3M2GQQ6      YL----GA-EDEAKTLALTSATSGEGKSTLTYNLGR-VLSELGQRVLIVDADMRKPTVHE
A0A6H1U2X0      YL----GA-EDEAKTLALTSATSGEGKSTLTYNLGR-VLSELGQRVLIVDADMRKPTVHE
K9SGJ5          YL----GG-DLSIKSIAFTSAVPSEGKSTLVFNLAS-ILAELGHKVLVVDADMRKPNVHH
A0A6C2DSN4      YL----GT-DNMMKVIAFTSSVPSEGKSTLTYNLAM-ILSSLGYRILLVDADLRKPTVHK
L8MYT6          YL----GT-DNMMKVIAFTSSVPSEGKSTLTYNLAM-ILSSLGYRILLVDADLRKPTVHK
A0A352JGJ6      YL----GT-DNTMKVIAFTSSVPSEGKSTLTYNLAT-ILAALGYKVLLVDADMRKPTVHK
A0A1J5GLS2      YL----GT-DNMMKVIAFTSSVPSEGKSTLTYNLST-ILAVLGYRVLLVDADMRKPTIHK
A0A2W4W6M5      YL----GT-DNMMKVIAFTSSVPSEGKSTLTYNLAT-ILAALGYKVLLVDADMRKPTVHK
A0A2W7AN33      HL----GM-DNLMKVIAFTSSVPSEGKSTLTYNLAV-ILSSLGYRVLLVDADMRKPTIHK
A0A256BLV2      YL----GT-DNMMKVIAFTSSVPSEGKSTLTYNLAT-ILSALGYRVLLVDADMRKPSIHK
A0A2W6ZXF3      YL----GT-DNMMKVIAFTSSVPSEGKSTLTYNLST-ILAALGYRVLLVDADMRKPTVHK
A0A2Z5WX66      YL----GT-DNTMKVIAFTSSVPSEGKSTLTYNLST-ILAALGYKVLLVDADMRKPTVHK
K9W1T3          FM----SL-DNQLKVMVISSSVPKEGKSTTAANLAV-AISQLGQRVLLIDADMRKPSQHK
A0A1Q4RTR1      YT----LP-DQVLKSIVITSAIPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSSQHE
A0A1Z4SQV2      YT----LP-DQVLKSIVITSAVPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSRQHE
A0A2H2XGN1      YT----LP-DQVLKSIVITSAVPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSRQHE
A0A433UXH8      YT----LP-DQVLKTIVITSAIPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSNQHQ
A0A1Z4RMB9      FL----TS-DKPPKVMLITSSVPEEGKSTVVANLAA-AIAQLGRSVLLIDADLRRSSQHT
B4WP72          SV----TS-RQELKTIVITSAAAGEGKSEVSVNLAT-TIAQSGQRVLLIDADMRHPSLHK
A0A318B4H2      FL----TD-HGAPGVLMLTSSRPNEGKSLSAYALSR-LFAETGASVVLIDADMRNTRLDD
B4WQE3          QG----GS-QDIAKSFSVSSAVPNEGKSTISFYLAH-ASASLGKRTLLVDADLRHPTLHR
A0A2K3BR24      FS----SV-DQKMKVIVLTSSIPNEGKSTVSANLGM-ALAELGHRVLIIDADLRRPSQHQ
K9YXY1          FS----SV-DQKMKVIVLTSSIPSEGKSTISANLGM-ALAELGNKVLIIDGDLRRPSQHQ
A0A1U7HGH0      FP----PSLDRSSRVILVTSSIPKEGKSTTCANLAA-VMALLNYKVLIIDADLRHPSQHQ
K9XJD3          FP----PSLERSSRVILVTSSAPKEGKSTTCANLAA-VMALLNYKVLIIDADLRHPSQHQ
K9SX01          FL----NS-DRQIKAIVITSSVPGEGKSTVSANLAV-AIAQLGKRVLLVDVDMRRPSQHK
A0A4P7ZT55      LV----RA-GGNLRMLAVTSTASGEGKTTSVALLGQ-ALADLGLKVLLVDGDLRQMQLHQ
A0A1E5QIR9      FL----GS-DRQVRVIAVTSAIPKEGKSTVSANLAL-AIAQLGFRVLLVDADMRHPSQQA
A0A1Z4IBC7      FL----CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQHH
A0A1W5CPC7      FL----CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQHH
A0A5Q0GKD1      FL----CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQHH
Q3MDC6          FL----CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQHH
A0A1Z4KM73      FL----CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQHH
Q8YNX7          FL----CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQHH
A0A367R4K6      FL----CS-DKPLKSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDTDMRHPIQHH
A0A1E2WSV8      FL----CS-DKPLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQHH
A0A2R5FRT9      FL----CS-DKPLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRNPMQHH
A0A2K8T1B6      FL----CS-DKPLRSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRNPIQHH
A0A235I9I0      FL----CS-DKPLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQHH
A0A2D0HQT8      FL----CS-DKPLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQHH
A0A2L2NU95      FL----CS-DKPLKSIVITSSVAREGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQHH
A0A367S084      FL----CS-DKPLKSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQHH
A0A0V7ZFJ4      FT----VS-DKTLKVIVVSSSNPNEGKSFVSANLAV-TLSQLGRKVLLVDADMRRPRQHR
A0A367RIS1      FT----FS-DKELKVIVVSSSVMNEGKSFVAANLAV-ATAQMGKRVLLIDADMRRPRQHE
A0A235IXQ2      FS----FS-DKELKVIVVSSSVINEGKSFIAANLAV-ATAQMGRRVLLIDADMRHPHQHK
A0A1W5CNX3      FS----FS-DKKLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQHE
A0A5Q0GJJ5      FS----FS-DKKLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQHE
Q3MEB7          FS----FS-DKKLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQHE
A0A1Z4KHN9      FT----FS-DKKLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQHE
Q8YT70          FT----FS-DKKLKVIVVSSCVMNEGKSFIAANLAV-ATAQMGRRVLLIDADMRRPRQHE
A0A218Q4C1      FT----IS-DKKLKVIVVSSCLPGEGKSFITANLAV-ATAQMGQRVLLIDADMRRPSQQE
A0A166IWU6      FT----IS-DKELKVIVVSSCLPGEGKSFVAANLAV-ATAQMGRRVLLIDADMRRPRQQE
A0A2S0Q8C0      FT----IS-DKELKVIVVSSCLPGEGKSFVAANLAV-ATAQMGRRVLLIDADMRRPRQQE
W6FSX4          FT----IS-DKELKVIVVSSCLPGEGKSFVAANLSV-ATAQMGRRVLLIDADMRRPRQRE
A0A0V7ZNJ9      FT----SS-DKTLKVLMVTSSVPGEGKSLVSANLAV-TISQFGQRVLLIDGDMRRPRQHK
A0A0R0M9H9      FA-----T-DKELRVILLTSSSPSEGKSFVSANLAL-AASHLGKRVLIVDADLRRPRQHK
A0A1S1ZVW2      FA-----T-DKELQVILVTSSSPAEGKSFVSANLAL-AASHLGKRVLIVDADLRRPRQHK
A0A1B7WX82      FT----LS-DKELRVILVTSSTAGEGKSFVAANLAL-AAAHVGRRVLLVDADMRRPRQQR
A0A1B7WTD1      FT----IS-DKELQVILVTSSTSGEGKSFVAGNLAV-AASHVGKRVLLIDCDMRRPRQHR
A0A480ABC0      FT----IS-DKELQVILVTSTTSGEGKSFVAANLAV-AASHVGKRVLLIDCDMRRPRQHR
A0A1Z4LRU5      FT----MS-DKALKVIVVSSSIPGEGKSFVSSNLAV-AMAQLGRRVLLIDADMRRPTQQN
A0A1Z4JVB4      FS----IC-EQKLKVIVVSSAVPGEGKSFIAANLAT-ATAQLGKKVLLLDADMRRSRQHK
K9PIA4          FS----IS-DKKLKVIVVSSSIPGEGKSFVTANLAV-AIAQLGRRVLLIDADMRRPRQHK
A0A1Z4HVE1      FS----IS-DKTLKVIALSSSIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQHK
A0A252ECZ1      FS----IS-DKKLKVIVVSSSVPGEGKSFVAANLAV-AAAQIGHRVLLVDADMRRPRQHK
A0A1Z4G5Y1      FS----IS-DKTLKVIVLSSSIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQHK
A0A252DNA2      FS----IS-DKTLKVIVLSSSIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQHK
A0A252E1Q4      FS----IS-DKTLKVIVLSSSIPGEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQHK
A0A6G9SK36      FS----IS-DKMLKVIALSSSIPGEGKSFVAANLAV-AVAQLGRRVLLVDGDMRRPRQHK
A0A1Z4M597      FS----IS-DKMLKVIAISSSIPGEGKSFVAANLAV-AVAQLGRRVLLVDADMRRPRQHK
A0A1Z4MWT1      FS----IS-DKMLKVIAISSSIPGEGKSFVAANLAV-AVAQLGRRVLLVDADMRRPRQHK
A0A1Z4TX53      FS----IS-DKMLKVIAISSSIPGEGKSFVAANLAV-AVAQLGRRVLLVDADMRRPRQHK
A0A5P8VSD1      FT----FY-DKELKVVVVSSSVMNEGKSFIAANLAI-ATAQMGKRVLLIDADMRRPRQHE
A0A2A2TNQ5      FS----VS-DQELRVIVVTSSVPGEGKSLVAANLAV-AKAQMGKRVLLIDADMRRPRQHE
A0A3S1C4K5      FT----LS-DQALRVIAVTSSVPGEGKSFVAANLAV-AKVQMGYRVLLIDADMRRPRQHK
A0A1X4G3D5      FA-----R-DRELQVMLVTSSSQGEGKSFVSANLAA-ALSYLGKRVLIVDGDLRRPCQHR
D4TNI2          FA-----R-DRELQVMLVTSSSQGEGKSFVSANLAA-ALSYLGKRVLIVDGDLRRPCQHR
A0A1Z4H6Z8      FS----IS-DKTLKVIVVSSSIPSEGKSFVAANLAV-AAAQTGRRVLLVDADMRRPRQHK
A0A1Z4NPM1      FT----VS-DNELRVILVTSSVPGEGKSFVSANLAV-AMSQLGKRVLLIDADMRRPRQHK
A0A3F3KPR9      FA-----T-DKELRVILLTSSSPGEGKSFISANLAL-AASHLGKRVLIVDGDLRRPRQHK
D4TGN7          FA-----T-DKELRVILLTSSSPGEGKSFISANLAL-AASHLGKRVLIVDGDLRRPRQHK
A0A1Z4UZW9      FT----LS-DKELRVILLTSSIPGEGKSFVAANLALAAAAQPGRRVLLVDADMRRPRQQS
A0A0K2M5H0      FT----CS-DKELRVILVTSATPGEGKSFVAANLAL-AAAYVGRRVLLVDADMRLPRQHR
A0A1B7VSH4      FT----VS-DKKLRVILVTSATPGEGKSFVAANLAL-AGAYVGKRVLLVDADMRRPRQHR
A0A1B7W126      FT----VS-DKELRVILVTSATPGEGKSFVAANLAL-AGAYVGKRVLLVDADMRRPRQHR
A0A3D4C6Q6      FT----VS-DKELRVILVTSATPGEGKSFVAANLAL-AGAYVGKRVLLVDADMRRPRQHR
A0A1B7UVJ4      FT----LS-DKQLRVILVTSSTSGEGKSFMAANLSL-AAAHVGRRVLLVDADMRRPRQHR
A0A1B7UTR1      FT----LS-DKQLRVILVTSSTSGEGKSFMAANLSL-AAAHVGRRVLLVDADMRRPRQHR
K7W0A4          FT----LS-DKELRVILLTSSTPGEGKSFVAANLAL-AAAHVGRRVLLVDADMRRPRQHR
A0A5C0DRW9      FT----LS-DKKLRVVLLTSSTPEEGKSFVAANLAL-AAAHVGRRVLLVDADMRRPRQHR
A0A6H2C088      FT----LS-DKELRVILLTSSNPGEGKSFVAANLAL-AAAHVGRRVLLVDADMRRPRQHR
A0A2T1CIL7      FL----TT-NWDRKAIAVTSSVPQEGKSEVASNLAK-SMADLGRRVLLIDADLRRPTQHH
A0A433V7A0      FL----CS-DKALKVIVITSTVPSEGKSTVAANLAA-AIAQLGKQVLLVDADMRHPSQHT
A0A2T1FTR8      FL----NA-DDSLKVVVVSSSQSGEGKSTVAANLAL-AVAELGKRVLLVDADMRKPAQHL
K9UA41          FL----NA-DDSLKVVVVSSSQSGEGKSTVAANLAL-AVAELGKRVLLVDADMRKPAQHL
A0A0C2LBE2      FL----SS-DREPRVIVVTSSVSGEGKSEVAANLAM-AMTQVGHRVLLVDADMRHPVQHH
A0A433NN38      FL-----S-DKQLKAIAVTSSVAKEGKSEVSANLAV-VMAQVGRRVLLVDADMRRPCQHH
A0A2N6K0T2      FL-----S-DKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHH
A0A2N6ML72      FL-----S-YKQLKAITVTSSIPREGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHH
G6FQZ6          FL-----S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHH
A0A2N6MQX9      FL-----S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHH
A0A2N6KXT6      FL-----S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHH
A0A2N6KGB9      FL-----S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHH
A0A2N6L3Y5      FL-----S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHH
A0A0S3TIS7      FL-----S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHH
A0A1U7GW28      FL-----S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHH
A0A2N6LW63      FL-----S-YKQLKAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQHH
A0A328IH74      FL-----S-DKQLKAITVTSSIPKEGKSEVCANLAV-AMAEVERRVLLVDADMRHPIQHH
A0A4D9CIB0      FL-----S-DKQLKAITVTSSIPKEGKSEVCANLAV-AMAEVERRVLLVDADMRHPIQHH
A0A1Z4TQ63      FL-----S-DKQLKAITVTSSIPKEGKSEVSANLAV-AMAEVERRVLLVDADMRHPIQHH
A0A4Q9J8G2      FL-----S-DKQLKAITVTSSIPKEGKSEVSANLAV-AMVEVERRVLLVDADMRHPIQHH
A0A1Z4SMD6      FI----S--DKKVRTIAVASSVALEGKSEVSANLAA-ALANAGRRVLIVDTDMRQPRQHH
A0A2H2Y096      FI----S--DKKVRTIAVASSVALEGKSEVSANLAA-ALANAGRRVLIVDTDMRQPRQHH
K9S8M8          FL----SP-DRELKVIVVTSPVPQEGKSTVSANLAA-AMAQLGRRVLLVDADMRHPMQHH
A0A1Z4NFV0      FI----S--HKKVRTIVITSSVAGEGKSEVAANLAT-SIAQSGRRVLLVDADMRNPSQHH
B0CAX4          FL----SS-DHHVQVFVVTSSIPKEGKSTVVANLAL-ALGELGHRVLVIDADMRRPSQHQ
A0A350Y0P6      FL----SP-DHVLKRIVVTSSVAQEGKSTVSANLAI-AMAQVGRRVLLVDADMRHPMQHH
A0A352X940      FL----SP-DKMLKVIVVTSSVSREGKSTVSANLAA-AMAQLGRKVLLIDADMRHPIQHH
B8HTN4          FL----SSPDHPIRTIVITSTRPQEGKSTVSANLAL-AIAELGHKVLLIDADLRLPLQHQ
A0A2A2TPF8      FI----S--HKKVRTIVVTSSVAGEGKSEVSANLAA-VMAQAGKRVLIIDADMRNPSQHH
A0A1Z4R0P8      FI----S--HKRVRTLVVTSSVAGEGKSEVSANLAA-VIAQTGKRVLLIDADMRNPSQHH
A0A0T7BUI3      FI----S--HKKVRAIAITSCVPGEGKSEVSANLAA-ILAQAGRRVLLIDADMRKPSQHH
A0A1Z4LP32      FI----S--HKEVRTIVVTSSVVGEGKSEVSANLAA-ILAQSGKRVLLVDADMRQPNQHH
K9REP9          FI----S--HKEVRTIAVTSSVVGEGKSEVTANLGA-ILAQGGQRVLIVDADMRQPMQHH
A0A1Z4SIJ3      FI----S--HKKVCTLAITSSVAGEGKSEVAANLAA-ALAQSGRQVLLVDADMRQPAQHR
A0A2H2XPG4      FI----S--HKKVCTLAITSSVAGEGKSEVAANLAA-ALAQSGRQVLLVDADMRQPAQHR
K9V3C7          FI----S--HKQVRTIVVTSSVAGEGKSEVSANLAA-AIAQTGKRVLLVDADMRQPSQHH
A0A1Z4T6Y7      FI----S--HKKVRTIVITSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDGDMRNPAQHH
A0A2H2Y561      FI----S--HKKVRTIVITSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDGDMRNPAQHH
A0A1Q4S362      FI----S--HKTVRTIVVTSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDSDMRNPSQHH
A0A3S1CIN8      FI----S--HKTVRTIVVTSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDSDMRNPSQHH
A0A2A2TC28      FI----S--HKKVCTIVVTSSVAGEGKSEVTANLAA-IIAQSGRRVLLVDADMRQPSQHH
A0A0C1NCB0      FI----S--HKRLRTIVVTSSVPGEGKSEVSANLAA-VLAQSERKVLLIDADMRLPSQHH
A0A2N6K7Q9      FI----S--HRKVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A2N6MXH6      FI----S--HRKVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A2N6M5A8      FI----S--HRKVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A2N6LL61      FI----S--HRKVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A0S3TP66      FI----S--HRKVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
G6FP91          FI----S--HRKVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A1U7GYR5      FI----S--HRKVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A2N6KY52      FI----S--HRKVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A2N6KMP5      FI----S--HRKVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A2N6MA45      FI----S--HRKVRKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A4Q9J9V9      FI----S--HRKVRKIVVTSSVSAEGKSEVSANLAA-IIAQSGKRVLLVDADMRKPTQHH
A0A328IGA1      FI----S--HRKVRKIVVTSSVSAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A4D9CE41      FI----S--HRKVRKIVVTSSVSAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A0M0SFT2      FI----S--HRKVRKIVVTSSVSAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A1Z4TLC8      FI----S--HRKVRKIVVTSSVSAEGKSDVSANLAA-VIAQSGKRVLLVDADMRKPTQHH
A0A0C2LFH0      FI----S--HRKVRTIVVTSSVPGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPSQHH
A0A1Z4IYV4      FI----S--HKKVRTIVVTSSVPGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQHH
A0A1Z4Q0T6      FI----S--HKKVRTIVVTSSVAGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQHH
A0A0C2PT44      FI----S--HKKVRTIVVTSSVAGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQHH
A0A1D2P6J4      FI----S--HKRVRTIVVTSSVAEEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQHH
A0A3M9ZEU1      FL----SS-DQEIRVVVVTSAVAKEGKSTIAANLAA-AAAQVGRRVLLIDADLRYPQQHH
A0A1Z4JK72      FM----SL-DKKVKTIVISSAVPREGKSEVAANLAA-TMAQSGRKVLLVDADMRNPSQHH
A0A0N7Z489      FM----SL-DKPVKTIVISSAVPREGKSEVAANLAA-TMAQSGRRVLLVDADMRNPSQHH
A0A0S3TXS2      FM----SL-DKKVKTIVISSAVPREGKSEVAANLAA-TMAQSGRKVLLVDADMRNPSQHH
A0A1Z4RN12      LL----GA-NVETKTIAVTSSVPQEGKSSVSANLAV-ARAQCGQKVLLVDADMRRPTQHR
A0A2T1CMF9      LL----DA-DAKKKVIAITSSVPQEGKSSVSANLAV-ARSQCSQRILLIDADMRRPTQHH
Q7NDC5          FL----SS-ERGLRAFVLTSASPQEGKSTTAANLAA-VSAQAGARVLLVDGDLRKPRQHA
U5QGK3          FL----SA-ESPLTAVVFTSASPQEGKSTTVANLAI-VSAQSGARVLLIDADLRKPRQHK
A0A2W4UY24      FS----YF-DGSLKAITVTSAVGGEGKSEISANLAL-TLAQLGHSVLLIDADMRSPIQHH
A0A2T1GMT4      FL----GA-DKPLKTIAITSSVANEGKSKVAANLAA-AIAGMGQKVLLIDADMRVPYQHR
K9UI51          FL----SA-DKPLKIIAITSSVANEGKSKVAANLAA-AIAGMGQKVLLIDADMRVPYQHR
K9QM62          FL----SS-DKELKTIVVTSSVPKEGKSSVSANLAL-AISQMGRKVLLIDADMRVPSQHK
A0A1Z4FWI3      FL----SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVPSQHH
A0A1Z4JYE7      FL----SS-DKLLKTIVVTSAVAKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVSSQHY
A0A2T1FXY4      FL----SP-DRVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRDSSQHH
K9TYI2          FL----SP-DRALRTIVITSAVPKEGKSTVSANLAA-AIAQLGRKVLLVDADMRDSSQHH
A0A1Z4QL41      LV----SS-DQVLKSIVVTSAVSKEGKSTVSANLAA-VMAQLGRKVLLIDADLRLPSQHD
A0A252D4T4      FL----SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVPSQHH
A0A252DJH5      FL----SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVPSQHH
A0A252EB80      FL----SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVPSQHH
A0A6G9SKZ9      FL----SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPTQHH
A0A1Z4HPW5      FL----SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPTQHH
A0A1Z4MSN1      FL----SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPTQHH
A0A1Z4U1C2      FL----SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPTQHH
A0A0D6KV51      FL----SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPTQHH
A0A1Z4MKF8      FL----SS-DKVLKTIVVSSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPTQHH
A0A2C6WC43      FL----SS-DKVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHH
A0A1Z4L5A1      FL----SS-DKVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHH
A0A367QD86      FL----SS-DKVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHH
A0A235IZ96      FL----SS-DKALKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRQVLLIDADMRVPSQHH
A0A2L2NGP0      FL----SS-DKALKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRQVLLIDADMRVPSQHH
A0A2K8SM78      FL----SS-DKVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHH
A0A2R5FPC0      FL----SS-DKVLRTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRIPSQHH
A0A5P8W5T6      FL----SS-DKVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHH
A0A140KBA0      LL----SL-SQARKVIAVTSCVPQEGKSHVSANLAI-AQNQVGKRILLIDADMRRPSQHK
K9XSG1          LL----SL-SQERKVIAVTSCVPQEGKSHVSANLAI-AQNQVGKRILLIDADMRRPTQHK
A0A0F5YE28      FL----SS-DKRIKTIVVTSSVPKEGKSTVSANLAA-TLAQLGYRVMLIDADMRQPSQHH
U7QEH7          FL----SS-DKRIKTIVVTSSVPKEGKSTVSANLAA-TLAQLGYRVMLIDADMRQPSQHH
A0A3S1ATK5      LL----SS-DKVIKSIVVTSSISKEGKSTVAANLAT-VISQLGRKVLLIDADLRVPTQHH
A0A2Z6CPH0      FL----SS-DKVLKTIVVTSSVPKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVPSQHH
A0A1Z4GT50      FL----SS-DKVVKTIVITSAVPKEGKSTVSANLAA-AIAQLGRRVLLIDADMRVPSQHH
A0A1Z4GIX0      FL----SS-DKVLKTVVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHH
A0A2H6LC24      FL----SS-DKVLKTVVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHH
B2J6N5          FL----SS-DKVLKTIVVTSAVPKEGKSTVSANLAT-AIAQLGRQVLLIDADMRVPSQHH
A0A367RMI4      FL----SS-DNVLKTIVITSAVPKEGKSTVSANLAA-AIAQLGRQVLLIDADMRVPSQHH
A0A235HUM0      FL----SS-DNLLKTIVITSAIPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHH
A0A2L2NW47      FL----SS-DHLLKTIVITSAVPKEGKSTVSANLAA-AIAQLGRQVLLIDADMRVPSQHH
A0A1E2WUR1      FL----SS-DKVLKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRKVLLIDADMRVPSQHH
A0A235IKU3      FL----SS-EKALKTIVVTSAVPKEGKSTVSANLAA-AIAQLGRQVLLIDADMRVPSQHH
F4XKF3          FL----RS-DHPLKVIVVTSSVSKEGKSTVSANLAA-AMAQLGRRVLLIDSDMRHPCQHY
A0A1D9FX10      FL----RS-DHPLKVIVVTSSVSKEGKSTVSANLAA-AMAQLGRRVLLIDSDMRHPCQHY
A0A1D8TNX9      FL----KS-DHPPKVIVVTSSVSKEGKSTVSANLAA-AMAQLGRRVLLIDADMRHPCQHY
A0A1U7MYU6      FL----RS-DHPLKVIVVTSSVSKEGKSTVSANLAA-AMAQLGRRVLLIDSDMRHPCQHY
A0A3C0NJ41      FL----SS-DKPLKVIVVTSSVPKEGKSTVSANLAA-AMAQLGRRVLLVDADLRHPFQHH
A0A352AG88      FL----SS-DKTPRVIVVTSSVPKEGKSTVSANLAA-AIAQLGRRVLLIDADLRHPLQHH
A0A350Y374      FL----SS-DKPPKVILVTSSVPQEGKSTVSANLAL-AIAQLGRRVLLVDADLRYPVQHH
A0A355DPX0      FL----SS-DKPPQVILVTSSVPQEGKSTVSANLAL-AIAQLGRRVLLVDADLRYPVQHH
A0A0D8ZUV2      FL----SS-DKPLRVIVVTSSVPREGKSTVSANLAT-AMAQLGYRVLLVDADMRRPVQHH
A0A433VDI0      FL----GS-DKALKVIVVTSAVSKEGKSTVSANLAA-AIAQLERQVLLVDADMRRPVQHH
A0A3D1PG43      FL----SS-ERALKAVVVSSSVPKEGKSTVSANLAA-AIAQLGRRVLLVDADMRCPVQHH
A0A2P8QQ72      FL----NL-DRPLKAVVVTSSVPKEGKSTVCANLAV-AIAQLGRRVLLIDADLRSPIQHH
K9TZQ7          FL----NL-DRPLKAVVVTSSVPKEGKSTVCANLAV-AIAQLGRRVLLIDADLRSPIQHH
A0A2G7GPR0      FL----SS-DKPLKVIVVTSAVPKEGKSTVSANLAA-AMAQLGRKVLLIDADMRHPLQHH
K9XH68          FL----SS-DKPLKVIVVTSAVPKEGKSTVSANLAA-AMAQLGRKVLLVDADMRHPLQHH
A0A1U7HW70      FL----SS-DKPLKVIVVTSAVPKEGKSTVSANLAA-AMAQLGRKVLLVDADMRHPLQHH
A0A2S6VEJ8      FL----SS-DKPLKVIVVTSAVPKEGKSTVSANLAA-AMAQLGRKVLLVDADMRHPLQHH
                               . .:*    .**:      .           :::* * *      

K9SLA9          LW-Q--VP--NSQGLSN-------VLA-GS-ANFYTTTQQVEPR------LELLTAGTLP
A0A168TT23      DF-S--IQ--QAPGVTN-------RIA----DVGSQEVATSSIIPTTTEGLFVMPSGNQA
A0A0M1JWX9      KL-G--IL--NRQGLSN-------VLA----TDLQAKDAIQRSPIEEN--LFILTAGTLP
A0A2T1M1V6      ---E--MS--RKLGYPQ-------FRRGTGYPE------ILLPIHPG---FDLMLAPLIQ
A0A2G7GCS2      ---E--LS--RRLGQLQ-------KQPK-NGQQ------TPVSVCLG---LDLLPAPNLS
K9XBH8          ---E--LS--RRLGHSK-------TETTMNAKQ------SPVSVSLG---LDLIPAPAVR
A0A1Z4LJ30      ---E--LS--QSLGYQS-------QTILDSRF-------IHKKIRPN---LDLLSVNIAE
K9RI76          ---E--LS--ESLGYQP-------QAKSRF---------VHNQVRFN---LDLLSVNIAE
A0A352AE27      ---Q--LS--HRLGYAR-------ELLPPE---------KPVQLRPS---LDLVPTLPKQ
A0A3B8JH60      ---E--LS--RRLGYGR-------ELKGTEAPLFADVAQQPVQIQPS---LDLVPISPKK
A0A3C0N766      ---E--LS--RRLGYGR-------ELKGTEAPLFADVAQQPVQIQPS---LDLVPISPKK
K9W9J7          ---E--LS--RRLGYGR-------EVELADAPRFANEVQQPVSLEGG---LDLLPTSPKK
A0A139WSU3      ---E--LS--RSLGYAE-------DSTIEQ---------LQRSIQPN---LDLLPTLPKR
A0A433VN22      ---A--LS--RRLGYTQ-------TST-ED---------LSISIQPN---LDLLPTLPRQ
Q7NF11          ---S--LS--RLLGHGP-------QVEGTQA--------EPVSVIAD---LDLVPALAIE
A0A1Z4JCS8      ---Q--LS--HQLGYLS-------D-RSVGD--------QVISLQPN---LDFVPTMPQT
F4XTX2          ---T--LS--QRLGHHH-------D-PLKPG--------QPVKIQPS---LDLLPTSHKK
Q7NJN6          ---G--LG--RKLQVGP-------G-----S--------EPVALAPS---LSFLPAGRPD
U5QCC3          ---G--LG--RLLQVNQ-------G-----N--------EPVALAPS---LNFLPAGQPD
A0A3S0Y9N9      IW-N--IM--NHAGLTN-------VIK-SQL-DLDNAMTKV-TSN-----LQVITAGEQT
A0A433UNK7      IW-E--IP--NEVGLSN-------VLK-RQV-DLDQAVTEI-VPN-----LEVLTAGELN
A0A3M1SVZ4      IW-N--LG--NEMGLGN-------TIS-GQV-DFHLALQPT-MPN-----LDVLTAGTLA
A0A654SFI6      LL-GGEGA--DTAGLAA-------LLT-TNDASLESQVFSSDLFA-----IDVLPAGRTP
K9SSQ0          LA-G--VS--NKLGLSQ-------AIA-TKL-PWQQIIHTGDHSQFSAGYLHIITAGATP
A0A2W1JIN9      QF-Q--LP--NKSGLSD-------ILS-GDV-SLESAAQSTSIDN-----LSVVTAGSSC
A0A318AJV1      SM-A--IG--PGKGLIE-------ALR-GRA-PLVATVIPDRIGG-----LDILPVAQTL
A0A6B3MUB5      IL-G--VT--PLPGLTD-------VID-RDI-NLFETVQPTSIEN-----LSILTSGGLF
A0A1U7N2U4      LF-G--LP--PQPKVKD-------LMD-SNQ-TCLEAVQPTAIAN-----LSILTCSDQP
A0A1D9G1F2      LF-G--LS--PQPKVTD-------VID-SNQ-TWLSAVQPTAIPN-----LSILTCSDLP
F4XV38          LF-G--LP--PKPKVTD-------VID-SNQ-TWRSAVQPTAIAN-----LSILTCSDQP
A0A2P8QIL5      LF-K--LA--AKPGLAE-------VAQ-GKL-ALAEAVQTTGIDK-----LKVLCSGRPR
A0A2T1FLY5      LF-K--LA--AKPGLAE-------VAQ-GKL-ALAEAVQTTGIDK-----LKVLCSGRPR
A0A433W447      LF-K--LA--AKPGLAE-------VAQ-GKL-ALAEAVQTTGIDK-----LKVLCSGRPR
K9U1K8          LF-K--LA--AKPGLAE-------VAQ-GKL-ALAEAVQTTGIDK-----LKVLCSGRPR
K9UYB2          LF-N--LN--PQPGIAE-------VFD-GTK-TLTQAIQPTEIEN-----LWVLTCGDFY
A0A218QN17      LF-N--LA--PTPGITD-------VIE-KRR-SLNQAVQPTDVEN-----LDVLTGGEFH
K9RKN2          LF-N--LP--PKPGITE-------IIE-GRR-NFANAIQKTDVDN-----LDVLTCGELH
A0A2I8ADV2      LF-N--LP--PKPGISD-------VIN-GNR-TLLNAVQPTDIEN-----LSVLTCGELH
A0A1W5CKM3      LF-N--LP--PRPGITD-------VID-GTR-PLLSAVQSTTIEN-----LSVLTCGELR
A0A5Q0GMF5      LF-N--LP--PRPGITD-------VID-GTR-PLLSAVQSTTIEN-----LSVLTCGELR
Q3MEW0          LF-N--LP--PRPGITD-------VID-GTR-PLLSAVQSTTIEN-----LSVLTCGELR
A0A1Z4KIC7      LF-N--LP--PRPGITD-------VID-GTR-PLLSAVQSTTIEN-----LSVLTCGELR
Q8YSM5          LF-N--LP--PRPGITD-------VID-GTR-PLLSAVQSTTIEN-----LSVLTCGELR
A0A1Q4S1H4      AF-N--LQ--AAPGLSD-------AIS-QRSGRLADFVQPTGIEN-----LSVLTCGSMS
A0A433VBU6      VF-N--LQ--NAPGLSD-------AIT-ERR-RLADFVQPTAIEN-----LFVLTCGSMS
A0A1Q4RZJ6      IF-N--LP--GKPGITD-------IVE-GNI-SLKEAVQPTEIEN-----LSVLTCGGIY
A0A1Z4SNV3      IF-N--LP--AKPGITD-------IVE-GSI-SLKEAVQPTEIEN-----LSVLTCGELH
A0A2H2XJQ1      IF-N--LP--AKPGITD-------IVE-GSI-SLKEAVQPTEIEN-----LSVLTCGELH
A0A3S5K358      IF-N--LP--GKPGISD-------IVE-GNI-SLKEAVQPTEIEN-----LSVLTCGGIY
A0A0T7BPJ4      IF-H--LE--HKPGVAD-------VIA-GNL-SLMEAVQPSGTEN-----LSVLTCGEMH
A0A0C1QS61      LF-N--LA--GKPGVSD-------VLE-GDI-SLADAVQSTDIEN-----LDVLTCGELH
A0A139X3R8      LF-N--LS--GKPGVTD-------VLE-GDI-SLADAVQSTDIEN-----LDVLTCGELH
A0A1Z4I7C5      LF-N--LP--PKPGITD-------VID-GKR-PLLNAVQSTAVDN-----LSVLTCGELR
A0A0C2MDK7      LF-N--LA--PGPGITD-------VLE-GNI-SLLDAVQPTDIEN-----LDVLTCGELH
A0A1Y0RCK1      LF-H--LA--PKLGITD-------VLE-GNI-SLLDAVQPTDIEN-----LDVLTCGQLH
A0A1Z4PWZ0      LF-N--LT--PKPGITD-------VLE-GNV-SLLDAVQPTDIEN-----LDVLTCGELY
A0A0C2QLT0      LF-N--LT--GKPGITD-------VLE-GNV-SLLDAVQPTDIEN-----LDVLTCGELY
A0A1Z4J2K1      LF-N--LT--PKPGITN-------VLE-GNV-SLLDAVQPTDIEN-----LDVLTCGELY
A0A3S0ZSX0      LF-N--LA--PQPGITD-------LIY-GER-SLQQTVQPTRIEN-----LFVLTCGELY
A0A2N6K4T3      LF-N--LA--PQPGITD-------VID-SER-SLEETVQQTNIAN-----LCVLTCGELC
A0A370CKT2      LF-N--LA--PRPGITD-------VID-SER-SLEETVQRTNIPN-----LSVLTCGELH
A0A0S3TL97      LF-N--LA--PRPGITD-------VID-SER-SLEETVQRTNIPN-----LSVLTCGELH
A0A2N6M8A0      LF-N--LA--PRPGITD-------VID-SER-SLEETVQRTNIPN-----LSVLTCGELH
A0A2N6M9E1      LF-N--LA--PRPGITD-------VID-SER-SLEETVQRTNIPN-----LSVLTCGELY
A0A2N6KJI4      LF-N--LA--PRPGITD-------VID-SER-SLEETVQRTNIPN-----LSVLTCGELH
A0A2N6MZ77      LF-N--LA--PRPGITD-------VID-SER-SLEETVQRTNIPN-----LSVLTCGELH
A0A2N6KT20      LF-N--LA--PRPGITD-------VID-SER-SLEETVQRTNIPN-----LSVLTCGELY
G6FSN3          LF-N--LA--PRPGITD-------VID-SER-SLEETVQRTNIPN-----LSVLTCGELH
A0A4D9CI02      LF-N--LA--PQPGITD-------VID-SQR-SLEETVQRTHIAN-----LSVLTCGDLY
A0A328I8B9      LF-N--LA--PQPGITD-------VID-SQR-SLEETVQRTHIAN-----LSVLTCGDLY
A0A4Q9J4Z7      LF-N--LA--PQPGITD-------VID-SQR-SLEETVQRTHIAN-----LSVLTCGDLY
A0A0M0SU69      LF-N--LV--PQPGITD-------VID-SER-SLEETVQRTHIAN-----LCVLTCGDLY
A0A1Z4TIZ8      LF-N--LA--PQPGITD-------VID-SQR-SLEETVQRTHIAN-----LSVLTCGDLY
A0A0S3TYD7      VW-S--LG-TNDVGFSD-------VLV-GV-STLE--DALCPVM-EN---LWLLPAGKIP
A0A3C0N2P0      TT-D--LP--NVWGLSN-------VIS-SE-INFEDVIQRSPIEDN----LFVLTAGQIP
K9TLQ0          RM-D--LP--NVWGLSN-------LIS-TDSLNAQDSIQQSALNQN----LYVLTAGQMP
A0A6B3M6M6      RM-D--LP--NVWGLSN-------VIT-SE-MDVDDVIQQSPMEEN----LFVLTAGQIP
A0A6B3NIJ0      RM-D--LP--NVWGLSN-------VIT-SE-MDVDDVIQQSPMEKN----LFVLTAGQIP
A0A352XE00      RM-N--LL--NMWGLSN-------AIS-SD-INVDNLIQESPVDEN----LFVLTAGQLP
B4VS56          RT-D--LP--NVWGLSH-------VIS-SD-INVKDVIQPSPLEEN----LFVLTAGQIP
A0A352AAQ3      KT-D--LP--NVWGLSN-------VIS-SE-ISVDDVIQQSPWEEN----LFVLTAGQIP
A0A350Y472      KT-D--LP--NVWGLSN-------VIS-SE-INVSDVIQQSPLEDN----LFVLTAGQIP
A0A355DVB4      KT-D--LP--NVWGLSN-------VIS-SE-INVSDVIQQSPLEDN----LFVLTAGQIP
U5QL42          FL-E--LP--NSRGLST-------AIA-TE-TPW--QQLVQSGGNPN---LTLLTSGPIP
K9QF04          RVHS--LT--NVWGLSN-------LIS-GS-FPIENIIQISPENEN----LHILTAGKTP
A0A076HBF2      RL-G--LN--NLSGLSN-------VLT-ED-DQTWRDAVQTVPGYQN---WSVLTAGRRP
A0A354B169      RL-G--LN--NLVGLSN-------LLA-DD-CLHWRNCVQSLPGYEH---WDVITAGLPP
G4FMX5          RL-G--LN--NLRGLSN-------VLT-DD-SSHWRQALQPINGYEG---WSVMTAGRRP
Q0IDT5          RL-G--IN--NLQGLSN-------LIT-ED-ALHWRDLCKQVPGYEN---WSVMTAGLRP
A0A2D6FCW3      RL-G--LN--NLRGLTN-------VLT-DD-SNSWRSLLQPVEGYEN---WSVITAGRRP
A3ZA21          RL-G--LN--NLSGLSN-------LLA-DD-GFHWRDVVQTVPGYDQ---WSLITAGRRP
A0A140K3H3      LA-K--LP--NDEGLSE-------AIT-TE-RPWTDFVQIGVVEN-----LHLITSGSTS
K9XUB8          LA-K--LA--NDEGLSE-------AIA-NE-RPWTDYVRLGVLEN-----LHLITAGSTS
Q7NEU3          KL-E--LS--NGPGLST-------VLA-GE-MHWSNCVNQIDEN------VHVLTSGPLP
A0A6H2NHD5      MF-E--VP--NHLGLSD-------LIT-HP-QEPLPDFVKPIVGNPN---LHLLTAGTQP
A0A2P8W4F7      IF-G--QP--NRQGLSD-------LIT-QA-IDDPNDLVLQLPGNPN---LHLLTAGARP
A0A5Q4E0Z4      IF-G--RR--NGRGLSE-------LIT-QG-LEAANDLVLTMPDNPN---LHLLTAGALP
A0A2P8VVX1      GL-G--LV--AEQGLSG-------LLT-GE-PAQNRPHRLDFGSVF----VDVLPAGPIP
A0A2P8WHY0      EL-G--LS--TEGNLAN-------LLK-GV-TRPSRPHRLDFGPGH----IDVLPAGDPL
A0A2T1CMT9      SF-A--LT--NLSGLTN-------FLG-GE-ISLPLIHQVSLSGAR----IDLITSGTMT
A0A563VQJ3      LW-K--AP--KTVGLQD-------LIR-DR-KPLANAVHRPMPK------LDILFSTSRV
A0A1D8TX52      QL-G--LS--NYEGLSTLLEDDTALLE-DD-TATPNPVSISPLGST----IDVLTAGPTP
A0A1D9G4T2      QL-G--LS--NQEGLST-------LLE-DD-TATPSPVSISPLGST----IDVLTAGPTP
F4XP71          QL-G--LS--HQEGLST-------LLE-DD-TATPSPVSISPLGST----IDVLTAGPTP
A0A1U7N5X9      QL-G--LS--NQEGLST-------LLE-DD-IATPSPVSISPLGST----IDVLTAGPTP
A0A6B3N2I8      QL-G--LS--NQEGLST-------LLE-DD-TATPSPVSISPLGST----IDVLTAGPTP
A0A2W6ZAV2      LM-S--VA--NGEGLSN-------LLT--E-PTLQPERLIQPISER----LDLITAGPAP
A0A2G7GMH8      QL-E--LS--NEQGLST-------LLT-SD-RALPCRRRIQLFGAQ----IDVLTSGPTP
K9W742          KL-N--LP--NDYGLST-------LLS-SD-APLPIQTSLHASSAY----IDVITSGPIS
A0A2T1DWE8      QL-D--LP--NNYGLST-------LLT-RH-TPLRHHGDFQPSHRYTDIPLSILTSGPTP
A0A1U7I8L3      EL-N--LP--NDRGLST-------LLT-ND-VSLRDETNVQISRQHNN--ISILTAGPTP
A0A2T1DJL8      QL-E--LP--NEQGLST-------LLS-GD-RML-SQNAIQLAGTYSDLSISVLTAGPAP
A0A1Z4J9W0      QL-Q--LP--NDHGLST-------LLT-SD-RAI-TQGAIQPASTYSDLPISVLTAGSSP
A0A0N7Z5K9      QL-Q--LP--NEHGLST-------LLT-SD-RAL-TQAAIQPASTYSDLPISVLTAGPTP
A0A0S3TXC5      QL-Q--LP--NDHGLST-------LLT-SD-RAL-TQSAIQPASTYSDLPISVLTAGPTP
K9SA61          QL-N--LP--NDRGLSS-------LLS-GD-A-LFQHGDIQPSGHDSD--ISVLTAGPTP
A0A3D1PBA3      ML-S--LP--NEQGLST-------LLS-SD-ATLPGQGVIQSSG--AF--IDILTAGPLP
K9XPB0          KL-G--VE--NNSGLSD-------LLQ-GT-TASLNIQQVTLAG--EN--IDLVTCGSRI
A0A350Y7Z1      QL-N--LA--NEQGLAT-------LLV-ED-SSIPSPQRLSLSG--SE--IDVLTAGPIP
A0A352X2A7      QL-N--LP--NEEGLST-------LLA-DD-NSIPNPQHVSLLG--SN--IDVLTAGPIP
A0A0D8ZYV0      ML-N--LP--NEEGLST-------LLA-SD-ANVPSNAGIQSSG--SY--IDILTAGPMP
A0A2T1FP73      IL-N--LP--NDYGLST-------LLS-SD-ATLPIHNAIQSSG--SY--IDILTAGPQP
A0A433VMS2      IL-N--LP--NDYGLST-------LLS-SD-ATLPIHNAIQSSG--SY--IDILTAGPQP
K9TYA7          IL-N--LP--NDYGLST-------LLS-SD-ATLPIHNAIQSSG--SY--IDILTAGPQP
A0A2P8QUE1      IL-N--LP--NDYGLST-------LLS-SD-ATLPIHNAIQSSG--SY--IDILTAGPQP
A0A2T1DNG3      LL-N--LP--NEQGLST-------LLV-SQ-SPIP--QQIETQDANLRGNISVLTAGPTP
B8HNB0          II-E--QP--NLRGLTT-------AIA-SD-KSWQ--EMLIPGGVTN---LDILTAGFRP
A0A1Z4LN32      LW-G--LI--NSIGLSN-------VMV-GE-HDLE--DAVQKVT-EN---LSVLTSGVMP
A0A2I8A9F5      LW-N--LI--NSAGLSN-------VVV-EQ-NDFS--ATVQAVT-PS---LSVLTSGVTP
A0A218Q6R8      LW-G--LL--NSIGLSN-------VMV-GQ-EELS--DTIKQIT-PN---LSVLTTGVIP
A0A218QGE0      LW-G--LI--NSVGLSN-------VMV-GE-NDFS--KSVQRIT-SN---LSVLTAGVMP
A0A563VS48      LW-Q--IP--NQIGLTN-------VLN-QE-AEWY--EGVQNVR-PN---LDVLTAGTTP
A0A318BJ18      LG-G--VD--HDHGLSN-------FLS-GE-DDID--SLVFSMSDLG---FSAMTAGPIP
A0A3B8Y8H9      QP-G--LTSSNQYSLED-------ILN-QD-LAPDQAITISPLN-PN---LYVLVGTAKS
A0A2W1JVB9      TW-E--LL--NRVGLSD-------VLV-GE-ATLE--DAIQEGE-TN---LDVLTAGVLP
A0A6H1U102      FI-K--QT--NALGLSS-------AIA-TD-RPWR--NLIQSDRSGN---LHVLTSGPMP
A0A563VLD6      LT-K--QS--NEKGLTE-------AIV-SD-EHWS--EIVNPNIVDG---LDVMTAGSNV
A0A2P8W9H0      LC-H--LP--NEKGLSN-------YVI-GE-YDFEDIVVNLPLD-EK---LFIVTAGPIP
A0A6I5P386      FC-N--HA--NDKGLSN-------YVS-GE-FELDDILVDLSLD-EN---LYMVSSGPIP
A0A318BG22      RF-A--QT--NQVGFSN-------LLT-GE-LPLS--DVRIRLQDQG---FDIITSGPLP
A0A1Z3HMQ0      LW-N--VV--NQIGLSH-------VLV-GE-GHLN--QALRPVA-NN---LTLLSAGVTP
K1XF69          IW-G--LT--NAVGLSD-------VLV-EE-ATLS--EAVKPGI-DQ---LDILTAGVTP
B5W297          IW-G--LT--NAVGLSD-------VLV-EE-ATLS--EAVKPGI-DQ---LDILTAGVTP
A0A6H2AL05      IW-G--LT--NAVGLSD-------VLV-EE-ATLS--EAVKPGI-DQ---LDILTAGVTP
H1W7M8          IW-G--LT--NAVGLSD-------VLV-EE-ATLS--EAVKPGI-DQ---LDILTAGVTP
A0A5Q4H6A5      IW-G--LT--NAVGLSD-------VLV-EQ-ATLS--EAVNRGI-DQ---LDILTAGVTP
D5A466          IW-G--LT--NAVGLSD-------VLV-EE-ATLS--EAVKPGI-DQ---LDILTAGVTP
U5QJM6          RL-E--LT--NSRGLSS-------VLA-GN-LSWQ--EAVQKLG-EN---LFVLTSGPIP
A0A1Z4RPC6      LW-Q--VS--NLMGVKD-------VIT-HK-TPLD--QVVSQPM-KQ---LDLLTAGTIA
A0A2T1CMZ0      LW-Q--IS--NKVGVKD-------VVA-HK-TPLA--QVVTQPI-MQ---LNVLTSGTIA
L8M4F7          LW-N--RN--SHQGIKE-------VIQ-GE-AELA--DAVTQPM-LN---LKLLASGEVV
A0A140K2P2      LW-N--LE--NFVGLRD-------VIV-AQ-KPLS--LAVSKPL-EK---LDLLTAGELQ
K9XWX4          LW-N--LD--NFVGLKD-------VIS-AQ-KPLS--LAVSRPL-EQ---LDLLTAGEVQ
A0A140KB14      LW-S--MS--NHLGFKD-------VLT-HK-TSLQ--EVVARPL-DR---LDLLTVGVVP
K9XX88          LW-N--MS--NHLGLKD-------VLT-HK-TSLH--EVVARPI-ER---LDLLTVGVVP
A0A563VSV6      LW-G--VS--NQVGIKD-------LVT-NQ-ASVR--DVASKPM-AK---LDLLTSGMIP
L8LZE9          LW-G--VS--NQKGVKE-------LLT-EK-IALN--QITQQPM-PN---MDLLTSGEII
A0A433NM31      FW-E--LG--NNKGLSN-------LIV-EQ-IDLE--TVVTKVE-QN---LYVLTSGVLP
A0A1Z4NDS1      IW-G--LN--NTIGLSN-------VIV-NQ-VNLS--LAVEEVI-PN---LHLLPAGVVP
K9F4D9          IW-D--LP--NVQGLSN-------FAS-GQ-VPLK--DVIVSQE-PN---LHILTAGVIP
U9VXM0          IW-D--LP--NLQGLSN-------FAT-GQ-VSLK--DVIISQE-PN---LHILPAGVIP
A0A6I5QPI5      AL-K--VL--NRVGLSH-------VIT-GQ-ARVK--SAIQTVM-QN---LDVLTAGAVP
A0A433W533      IW-E--KA--NTEGLSD-------AIV-GQ-VDYQ--SAIKEVL-PK---LHILTAGATP
A0A2P8QWJ3      IW-E--KA--NTEGLSD-------AIV-GQ-VDYQ--SAIKEVL-PK---LHILTAGATP
A0A2T1FKP8      IW-E--KA--NTEGLSD-------AIV-GQ-VDYQ--SAIKEVL-PK---LHILTAGATP
K9U6L7          IW-E--KA--NTEGLSD-------AIV-GQ-VDYQ--SAIKEVL-PK---LHILTAGATP
A0A1E5QP61      IW-N--LT--NVAGLSD-------VIA-NQ-AKFN--IAVREVM-EN---LDVLPSGATP
U5DPF5          VW-E--LA--NTTGLSN-------VLV-EQ-LSVA--EIAHAEG-QDGNKLDVLTAGVIP
A0A3M1PML8      TW-N--LV--NAAGLTN-------LLI-DQ-VSSE--SVIQEVM-PG---LHVLPSGVVP
A0A3M2GIL5      IW-D--LT--NIAGLSD-------AIV-SQ-VELD--QATLDVS-DN---LDVLPSGVIP
A0A6H1TSJ9      IW-D--LT--NIAGLSD-------AIV-GQ-VELD--QATLDVS-DN---LDVLPSGVIP
A0A0T7BPZ0      IW-G--IT--NAKGLSN-------IIV-DQ-VPFN--TLMREVM-PN---LFVITSGVLP
A0A352X442      LW-N--LT--NAVGLSN-------LLV-GE-ADFS--TAVQEVM-PG---LEVLTSGVIP
A0A6B3NF44      IW-G--LT--NAVGLSN-------VLV-GE-AQFN--MVVQEVM-PG---LDVLPSGVIP
A0A0M0SHU3      IW-Q--LS--NKRGLSN-------IIV-DQ-VPIE--TVLHEVM-PN---LHVLTSGVMP
A0A1D2PBN3      VW-G--MT--NAVGLSN-------VIV-D--VPID--IAVQEAI-PN---LYVLSSGVVP
A0A0C2LVR7      VW-G--MT--NAVGLSN-------VIV-DE-LPID--IAVQEAI-PN---LYVLPSGVVP
A0A1Z4PQB9      VW-G--MT--NAVGLSN-------VIV-DE-LPID--IAVQEVI-PN---VYVLPSGVVP
A0A1Z4SFN6      IW-G--MT--NAVGLSN-------VIV-DQ-SPMR--VAIQEVM-PY---LYVLPSGVVP
K9PGI8          IW-G--MT--NAVGLSN-------VIV-DQ-VPLN--KAVQEFI-PN---LYVLTSGVIP
A0A2T1E9V8      IW-Q--IS--NEEGLMN-------VIA-EK-VSFS--DRVIQTVRKN---LDVITTGESD
A0A3M2GQQ6      FI-K--QP--NALGLSS-------AIA-TD-RNWS--DLIHRSESGR---LHILTSGPTP
A0A6H1U2X0      FI-K--QP--NALGLSS-------AIA-TD-RNWS--DLIHRSESGR---LHILTSGPTP
K9SGJ5          LA-K--LR--NNYGLST-------VIA-TN-RSWRQVVQSANVK-GC---LNVITSGPLP
A0A6C2DSN4      LA-R--LS--NKFGLST-------ALA-TP-SPWQELTQVVDEK-GN---LHILTSGSIP
L8MYT6          LA-R--LS--NKFGLST-------ALA-TP-SPWQELTQVVDEK-GN---LHILTSGSIP
A0A352JGJ6      LS-K--LS--NKFGLST-------ALA-TP-SPWQDLVQIADEK-DN---LHILASGSLP
A0A1J5GLS2      LS-K--LP--NKVGLST-------ALA-TP-TPWQDLIQSGDEK-GN---LDVLTSGSIP
A0A2W4W6M5      LT-K--LS--NKVGLST-------ALA-TP-SPWQDLIQVADDK-GN---LHVLTSGSIP
A0A2W7AN33      LA-G--LS--NKVGLSM-------ALA-TP-SPWQDLIQVGSDH-NN---LYILTSGSPP
A0A256BLV2      LA-G--LS--NKVGLST-------ALA-TP-SPWQDLIQAGDEQ-DN---LHILTSGSLP
A0A2W6ZXF3      LS-K--LP--NKVGLST-------ALA-TP-TPWQDLIQSGDEK-GN---LDVLTSGSIP
A0A2Z5WX66      LT-N--LS--NKSGLST-------ALA-TP-NPWQDLVQVADET-GN---LHVLTSGSLP
K9W1T3          IW-Q--LP--NETGLST-------VLT-GQ-SDFN--DAVVEVM-EN---LEVLTAGTPP
A0A1Q4RTR1      VW-K--VE--NSQGLNE-------ILE-NK-IDLQ--TAVKNIS-NN---VYLLTAGATP
A0A1Z4SQV2      IW-K--VE--NSQGLNE-------ILE-GT-IDLQ--TAERKVS-NN---VYLLTAGVTP
A0A2H2XGN1      IW-K--VE--NSQGLNE-------ILE-GT-IDLQ--TAERKVS-NN---VYLLTAGVTP
A0A433UXH8      IW-K--VE--NSQGLNE-------ILE-NK-IDLQ--TASRKVA-NN---VYLLTAGTTP
A0A1Z4RMB9      LW-G--VD--NNLGLKD-------ILTNDQ-SPL---SVIKRPM-PK---LSLLTSGIVN
B4WP72          TW-N--IS--NRVGLSS-------FLV-GQ-SSAQ--DTIQSVM-PR---LHVLPSGWIS
A0A318B4H2      LV-A--LD--ARPGLSN-------YLS-GA-NEIG--DVLQEPRGEG---FAMIPAGPTP
B4WQE3          LC-N--LP--NEKGLSD-------YIA-GD-ALLDESFVNLAVD-EN---LFFMSSGSIA
A0A2K3BR24      VW-E--EP--NAVGLSN-------VLV-ED-KEVN--SVVKELM-QN---LDVLTAGAPP
K9YXY1          VW-E--EP--NAVGLSN-------VLV-ED-KEIN--SVVRELM-PN---LDVLTAGAPP
A0A1U7HGH0      IW-E--IA--NHIGLMN-------TIT-KR-VGVNK-KAIQPVA-KN---IDVLTTGTSE
K9XJD3          IW-E--IA--NHIGLMN-------TIA-KR-IGVNK-KAIQPVA-KN---IDVLTTGTSE
K9SX01          IW-G--LG--NASGLSN-------ILV-GE-TQLE--TVLESVV-PN---LDILSSGVLP
A0A4P7ZT55      RF-A--AD--GARGWSE-------LFTEHP-PELE--ALLQWPE-AN---LALLPVGRRP
A0A1E5QIR9      FW-D--TP--KTVGLSN-------IIV-EQ-VDPH--EAIAEVM-PH---LFVLTAGSLP
A0A1Z4IBC7      IW-E--LS--NEIGLSN-------VLI-GQ-VTLE--DAVQEVM-PN---LEVLPCGILP
A0A1W5CPC7      IW-D--LS--NAIGLTN-------VLI-GQ-VTLD--EAVQEVM-PN---LEVLPCGILP
A0A5Q0GKD1      IW-D--LS--NAIGLTN-------VLI-GQ-VTLD--EAVQEVM-PN---LEVLPCGILP
Q3MDC6          IW-D--LS--NAIGLTN-------VLI-GQ-VTLD--EAVQEVM-PN---LEVLPCGILP
A0A1Z4KM73      IW-D--LS--NAIGLTN-------VLI-GQ-VTLD--EAVQEVM-PN---LEVLPCGILP
Q8YNX7          IW-D--LS--NAIGLTN-------VLI-GQ-VTLD--EAVQEVM-PN---LEVLPCGILP
A0A367R4K6      IW-E--LK--NTVGLSN-------VII-GQ-VSLD--EAVQEVM-PN---LEVLTCGTLP
A0A1E2WSV8      IW-G--LP--NAMGLSN-------VII-GQ-ASLD--TVVQEVM-PN---LEVLTSGVLP
A0A2R5FRT9      IW-G--LT--NVTGLSN-------AIA-GQ-VSLD--VAIQEVM-PN---LEVLTSGILP
A0A2K8T1B6      IW-G--LK--NTIGLSN-------VII-GE-ASLD--TVAQEVM-PN---LEVLTSGVLP
A0A235I9I0      IW-G--LT--NTSGLSN-------IIG-SQ-APLD--TVVQEVM-PN---LEVLTSGVLP
A0A2D0HQT8      IW-G--LT--NTMGLSN-------IIT-NQ-ASLD--TVVQEVM-PN---LEVLTSGVLP
A0A2L2NU95      IW-G--LT--NTMGLSN-------VIL-NQ-ASLD--TVVQEVM-PN---LEVLTSGVLP
A0A367S084      IW-G--LT--NTMGLSN-------ILI-NQ-ASLD--TVVQQVM-PN---LEVLTSGVLP
A0A0V7ZFJ4      IW-R--RP--NLIGLSN-------VLV-GQ-SKLQ--DTLQKAL-PA---LDVLLVGKIP
A0A367RIS1      IW-Q--KP--NLMGLSN-------VLV-GQ-ATLA--GAAKEVV-SN---LELLTAGTIP
A0A235IXQ2      MW-Q--QP--NLMGLSN-------VLV-GQ-TSLA--EAAKEVV-IN---LELLTSGTIP
A0A1W5CNX3      MW-Q--QP--NLMGLSN-------VLV-GQ-ATLA--EAAKEVV-IN---LELLTSGTIP
A0A5Q0GJJ5      MW-Q--QP--NLMGLSN-------VLV-GQ-ATLA--EAAKEVV-IN---LELLTSGTIP
Q3MEB7          MW-Q--QP--NLMGLSN-------VLV-GQ-ATLA--EAAKEVV-IN---LELLTSGTIP
A0A1Z4KHN9      MW-Q--QP--NLMGLSN-------VLV-GQ-ATLA--EAAKEVV-IN---LELLTSGTIP
Q8YT70          MW-Q--QP--NLMGLSN-------VLV-GQ-ATLA--EAAKEVV-IN---LELLTSGTIP
A0A218Q4C1      VW-Q--VR--NLIGLSN-------VLV-GQ-ATLA--QSCHEAL-VN---LHLLTAGTIP
A0A166IWU6      LW-Q--VR--NLMGLSN-------ILA-GQ-TDLT--QISQEAL-VN---LDLLTAGTIP
A0A2S0Q8C0      VW-Q--VR--NLMGLSN-------VLA-GQ-TNLT--QSSQEAL-VN---LDLLTAGTIP
W6FSX4          VW-Q--VR--NLMGLSN-------VLA-GQ-TNLT--QSSQEAL-VN---LDLLTAGTIP
A0A0V7ZNJ9      LW-K--IH--SFSGLSN-------LLV-GK-AELQ--NSIQKPL-AT---LDLLPAGKIP
A0A0R0M9H9      VW-G--LP--NFVGLSN-------VLV-AQ-TQLE--NCLQDV--SS---VNVLTAGKVP
A0A1S1ZVW2      VW-G--LP--NFVGLSN-------LLV-AQ-TQLE--NCLQDV--SS---VNVLTAGKVP
A0A1B7WX82      IW-E--TP--NLLGLSN-------ILA-GQ-AQLK--NTVQEVS-PL---VDLLPVGKIP
A0A1B7WTD1      IW-E--IP--NLLGMSN-------ILA-GQ-NEVK--PAIHKVF-LN---VDMLPAGKIP
A0A480ABC0      IW-E--IP--NLLGLSN-------ILA-GQ-NEVK--PAIHTVF-SN---VDMLPAGKIP
A0A1Z4LRU5      IW-D--LP--NMIGLSN-------VLV-GQ-AALN--GSTEEAL-VT---LDVLTSGKIP
A0A1Z4JVB4      IW-Q--QS--HLMGLSN-------ILV-GQ-ADLQ--STSKEVL-IN---LDLLTSGIIP
K9PIA4          IW-E--QS--NLIGLSN-------ILV-GQ-AELQ--SSTKEAL-MA---MDLLTAGTIP
A0A1Z4HVE1      IW-E--QS--NLIGLSN-------ILV-NQ-AELQ--TTTKEAL-MT---LDLITAGTIP
A0A252ECZ1      IW-E--QS--NLIGLSN-------ILV-GQ-AELP--TTTKEAL-MT---LDFVSSGTIP
A0A1Z4G5Y1      VW-E--QS--NLIGLSN-------ILV-NQ-AELA--TTTKEAL-MT---LDLVTAGTIP
A0A252DNA2      VW-E--QS--NLIGLSN-------ILV-NQ-AELP--TTTKEAL-MT---LDLVTAGTIP
A0A252E1Q4      VW-E--QS--NLIGLSN-------ILV-NQ-AELP--TTTKEAL-MT---LDLVTAGTIP
A0A6G9SK36      IW-E--QN--NLVGLSN-------ILV-GQ-AEWQ--TTAKEAL-MT---LDIITAGTIP
A0A1Z4M597      IW-E--QN--NLVGLSN-------ILV-GQ-TELQ--TTSKEAL-MT---LDIITAGTIP
A0A1Z4MWT1      IW-E--QN--NLVGLSN-------ILV-GQ-TELQ--TTTKEAL-MT---LDIITAGTIP
A0A1Z4TX53      IW-E--QN--NLVGLSN-------ILV-GQ-TELQ--TTTKEAL-MT---LDIITAGTIP
A0A5P8VSD1      MW-Q--QP--NLMGLSN-------VLV-GQ-ATLA--EAAKEVM-IN---LELLTSGTIP
A0A2A2TNQ5      IW-E--LQ--NFMGLSN-------ALV-GQ-GEWV--NLTKEVV-YG---LDVLTAGTIP
A0A3S1C4K5      VW-E--KA--NFMGLSE-------VLV-GQ-AEYV--AIAQEAI-HN---LDILTAGTIP
A0A1X4G3D5      VW-K--LP--NFVGLSE-------ILA-GR-TQLG--ASIQEVS-S----ISVLTAGNTP
D4TNI2          VW-K--LP--NFVGLSE-------ILA-GR-TQLG--ASIQEVS-S----ISVLTAGNTP
A0A1Z4H6Z8      IW-E--QS--NLIGLSN-------ILV-NQ-AELP--TTTKEAL-MT---LDLVTAGTIP
A0A1Z4NPM1      VW-Q--LA--NITGLSN-------LLV-GQ-AVLS--QVTHEAL-VT---LDLVTTGTTP
A0A3F3KPR9      VW-G--LP--NFVGLSN-------VLV-AQ-TQLE--NCLQDVS-S----VHVLTAGKVP
D4TGN7          VW-G--LP--NFVGLSN-------VLV-AQ-TQLE--NCLQDVS-S----VHVLTAGKVP
A0A1Z4UZW9      IW-E--IH--NLLGLSN-------VLA-GQ-VQLK--NAVQEVS-PQ---VHILPAGRTP
A0A0K2M5H0      VW-E--IH--NLLGLSN-------ILA-GQ-AQLE--NAVQEVS-PL---VNMLPAGKIP
A0A1B7VSH4      VW-E--IH--NLLGLSN-------ILA-GQ-TQLK--NAVQEVS-PL---VKMLPAGKIP
A0A1B7W126      VW-E--IH--NLLGLSN-------ILA-GQ-TQLK--NAVQEVS-PL---VKMLPAGKIP
A0A3D4C6Q6      VW-E--IH--NLLGLSN-------ILA-GQ-TQLK--NAVQEVS-PL---VKMLPAGKIP
A0A1B7UVJ4      IW-E--TP--NLLGLSN-------ILA-GQ-AQLK--NTVQEVS-PL---VDLLPVGKIP
A0A1B7UTR1      IW-E--TP--NLLGLSN-------ILA-GQ-AQLK--NTVQEVS-PL---VDLLPVGKIP
K7W0A4          VW-E--IP--NLLGLSN-------ILA-GQ-MQLK--NAVQEVS-PQ---VNMLPAGKIP
A0A5C0DRW9      VW-E--IP--NLLGLSN-------ILA-GQ-TQLK--NAVQEVS-PQ---VNMLPAGKIP
A0A6H2C088      VW-E--IP--NLLGLSN-------ILA-GQ-TQLK--NAVQEVS-PQ---VNMLPAGKIP
A0A2T1CIL7      IL-G--LS--NTAGLSN-------VLL-NE-TEWQ--EAVQRVM-PN---LDVLTAGVIP
A0A433V7A0      AW-N--LI--NEVGLSN-------AIV-SR-DNPR--VAVKEVM-SN---LDVLCSGVIP
A0A2T1FTR8      IW-R--QG--NYEGLSN-------VLS-GQ-CDRK--TATTEIQ-PN---LFLVTAGVVP
K9UA41          IW-R--QG--NYEGLSN-------VLS-GQ-CDRK--TATTEIQ-PN---LFLVTAGVVP
A0A0C2LBE2      VW-N--LT--NAVGLSH-------VIV-NP-DTLN--VALQEAM-PN---LDVIPSGVVP
A0A433NN38      IW-G--LT--NAQGLSN-------AIVDDQ-IPLN--TVVQEVM-PN---LYVLPSGVIP
A0A2N6K0T2      IW-Q--LR--NNQGLSN-------IIV-DQ-VPLE--TTVHEVM-PN---LHVLTSGVIP
A0A2N6ML72      IW-Q--LS--NNQGLSN-------IIV-DQ-VPLE--TIVHEVM-PN---LHVLTSGVMP
G6FQZ6          IW-Q--LS--NNQGLSN-------IIV-DQ-VPLE--TIVHEVM-PN---LHVLTSGVIP
A0A2N6MQX9      IW-Q--LS--NNQGLSN-------IIV-DQ-VPLE--TIVHEVM-PN---LHVLTSGVMP
A0A2N6KXT6      IW-Q--LS--NNQGLSN-------IIV-DQ-VPLE--TIVHEVM-PN---LHVLTSGVIP
A0A2N6KGB9      IW-Q--LS--NNQGLSN-------IIV-DQ-VPLE--TIVHEVM-PN---LHVLTSGVMP
A0A2N6L3Y5      IW-Q--LS--NNQGLSN-------IIV-DQ-VPLE--TIVHEVM-PN---LHVLTSGVMP
A0A0S3TIS7      IW-Q--LS--NNQGLSN-------IIV-DQ-VPLE--TIVHEVM-PN---LHVLTSGVMP
A0A1U7GW28      IW-Q--LS--NNQGLSN-------IIV-DQ-VPLE--TIVHEVM-PN---LHVLTSGVMP
A0A2N6LW63      IW-Q--LS--NNQGLSN-------IIV-DQ-VPLE--TIVHEVM-PN---LHVLTSGVMP
A0A328IH74      IW-Q--LS--NKKGLSN-------IIV-DK-VALE--TVVHEVM-PN---LHVLTSGVIP
A0A4D9CIB0      IW-Q--LS--NKKGLSN-------LIV-DK-VALE--TVVHEVM-PN---LHVLTSGVIP
A0A1Z4TQ63      IW-Q--LS--NKKGLSN-------IIV-DQ-VPLE--SVVHEVM-PN---LHVLTSGVIP
A0A4Q9J8G2      IW-Q--LS--NKKGLSN-------IIV-DQ-VPLE--TVVHEVM-PN---LHVLTSGVIP
A0A1Z4SMD6      LW-G--LI--NSTGLSN-------IIV-GQ-EEFS--SAVQSIT-TN---LSVLTAGVQP
A0A2H2Y096      LW-G--LI--NSTGLSN-------IIV-GQ-EEFS--SAVQSIT-TN---LSVLTAGVQP
K9S8M8          VW-H--LT--NLAGLSN-------VIM-KQ-TDLS--EAVNPVM-DN---LDVLTCGAIP
A0A1Z4NFV0      LW-G--RI--NPTGLSN-------ILV-GQ-DDMS--KAVQTVT-GN---LSVLTAGVIP
B0CAX4          VW-E--LP--NALGLSN-------VLV-EQ-KDWH--EAIRPED-DQ---LDILTAGVTP
A0A350Y0P6      IW-D--LA--NTVGLSE-------VIV-HQ-TQFE--FAVREVM-DN---LDVLPSGVIP
A0A352X940      IW-D--LA--NAMGLSE-------VIV-NH-AEFK--DAVREVT-DN---LDVLPSGAIP
B8HTN4          IW-E--LP--NATGLTH-------LLA-DN-HSST--KFIHQES-DN---LDVLTAGPRA
A0A2A2TPF8      LW-G--VM--NLTGLSN-------VIV-GQ-EQIR--RCIQSVT-RN---LSVLTAGVIP
A0A1Z4R0P8      LW-G--VM--NLTGLSN-------AIV-GQ-NQIR--RCIQSVT-RN---LSVLTAGVIP
A0A0T7BUI3      LW-G--LI--NSVGLSN-------VIV-GQ-NDFP--QAVQRIT-SN---LFVLTAGVQP
A0A1Z4LP32      LW-G--LI--NGGGLSN-------VIV-GQ-DEFS--RCYHQVN-KY---LSVLSAGVQP
K9REP9          LW-G--LI--NSGGLSN-------VIV-GQ-DELY--RCHHQVT-EN---LSVLTAGVQP
A0A1Z4SIJ3      LW-G--LI--NSVGLSN-------VIV-GQ-SDFL--LSKKVVN-EH---LSILTAGVRP
A0A2H2XPG4      LW-G--LI--NSVGLSN-------VIV-GQ-SDFL--LSKKVVN-EH---LSILTAGVRP
K9V3C7          LW-G--LM--NVKGLSN-------LLV-DR-VKLN--RVVQKVS-TN---LSLLTAGVIP
A0A1Z4T6Y7      LW-G--VM--NLTGLSN-------VIV-GQ-DRIR--SCIQSVT-RN---LSVLTAGVIP
A0A2H2Y561      LW-G--VM--NLTGLSN-------VIV-GQ-DRIR--SCIQSVT-RN---LSVLTAGVIP
A0A1Q4S362      LW-G--VM--NLTGLSN-------VIV-GQ-DRIR--NCIQTVT-RN---LSVLTAGVIP
A0A3S1CIN8      LW-G--VM--NLTGLSN-------VIV-GQ-DRIR--NCIQTVT-RN---LSVLTAGVIP
A0A2A2TC28      LW-G--LI--NSSGLSN-------IIV-GQ-DEFS--LAVKTVT-NH---LSILTAGVQP
A0A0C1NCB0      IW-G--LI--NSVGLSN-------VIV-AQ-DEFS--QAVQEVT-SH---LSVLTAGVQP
A0A2N6K7Q9      LW-G--LI--NSVGLSH-------LLV-GQ-GVLS--QAVQKVT-EF---LAVLTAGVIP
A0A2N6MXH6      LW-G--LI--NSVGLSH-------LLV-GQ-GVFS--QAVQKVT-EF---LAVLTAGVIP
A0A2N6M5A8      LW-G--LI--NSVGLSH-------LLV-DQ-GVFS--QAVQKVT-EF---LSVLTAGVIP
A0A2N6LL61      LW-G--LI--NSVGLSH-------LLV-GQ-GVFS--QAVQKVT-EF---LAVLTAGVIP
A0A0S3TP66      LW-G--LI--NSVGLSH-------LLV-GQ-GVFS--QAVQKVT-EC---MAVLTAGVIP
G6FP91          LW-G--LI--NSVGLSH-------LLV-DQ-GVFP--QAVQKVT-EF---LAVLTAGVIP
A0A1U7GYR5      LW-G--FI--NSVGLSH-------LLV-DQ-GVFS--QAVQKVT-EF---LAVLTAGVIP
A0A2N6KY52      LW-G--LI--NSVGLSH-------LLV-DQ-GVFS--QAVQKVT-EF---LAVLTAGVIP
A0A2N6KMP5      LW-G--LI--NSVGLSH-------LLV-GQ-GVFS--QAVQKVT-EF---LAVLTAGVIP
A0A2N6MA45      LW-G--LI--NSVGLSH-------LLV-GQ-GVFS--QAVQKVT-EF---LAVLTAGVIP
A0A4Q9J9V9      LW-S--LI--NSVGLSH-------LLV-GQ-AVFS--EAVHKVT-EF---LSVLTAGVIP
A0A328IGA1      LW-S--LI--NSVGLSH-------LLV-GQ-AVFS--EAVHKVT-EF---LSVLTAGVIP
A0A4D9CE41      LW-S--LI--NSVGLSH-------LLV-GQ-AVFS--EAVHKVT-EF---LSVLTAGVIP
A0A0M0SFT2      LW-S--LI--NSVGLSH-------LLV-GQ-AVFS--EAVHKVT-EF---LSVLTAGVIP
A0A1Z4TLC8      LW-S--LI--NSVGLSH-------LLV-GQ-GVFS--QAVHKVT-EY---LSVLTAGVIP
A0A0C2LFH0      LW-G--LV--NSVGLSN-------VIV-GQ-DQLP--QTVQTVT-KE---LSILTAGVQP
A0A1Z4IYV4      LW-G--VI--NSVGLSN-------MIV-CQ-AEFP--QGVQTVT-KH---LSVLTAGVVP
A0A1Z4Q0T6      LW-G--VI--NSVGLSN-------MIV-CQ-AEFP--QGVQTVT-QH---LSVLTAGVVP
A0A0C2PT44      FW-G--VI--NSVGLSN-------LIV-CQ-AEFP--QGVQTVT-KD---LSVLTAGVVP
A0A1D2P6J4      LW-G--VI--NSVGLSN-------MIV-CQ-AEFP--QGVKTVT-KH---LSVLTAGVVP
A0A3M9ZEU1      IW-D--LL--NTGGLSN-------VIV-GQ-QELS--TAIQPAM-PG---LDVLPAGVVP
A0A1Z4JK72      LW-G--IV--NSVGLSN-------VVV-DQ-SELR--QAVKPIT-NN---LSILTAGVMP
A0A0N7Z489      LW-G--LV--NSVGLSN-------VVV-DQ-SELR--QAVKPIT-SN---LSVLTAGVMP
A0A0S3TXS2      LW-G--LV--NSVGLSN-------VVV-DQ-SELR--QAVKPIT-SN---LSVLTAGVMP
A0A1Z4RN12      IW-E--IT--NEIGLSN-------VLK-HE-VQWA--DVVHKVM-PN---LDVLTSGIVP
A0A2T1CMF9      IW-E--IS--NQIGLSE-------VLS-GK-VSWS--ETVQNVM-PN---LDVLTSGSMP
Q7NDC5          LW-D--LD--NRQGLST-------LLV-GE-ADWQT-AVRPTPQ-PG---LVVLTAGPPP
U5QGK3          LW-E--VS--NQQGLST-------LLT-GE-GNWRDLLVQPPGL-ER---LSLLTAGPMP
A0A2W4UY24      IW-D--IS--NLKGLSN-------LVA-GQ-LPLK--QAIVRQE-PN---LHLLPAGSIP
A0A2T1GMT4      FW-K--LP--LKKGLSE-------LIE-RK-SKFQ--QISWTVM-EN---LDVLTAGGKP
K9UI51          FW-K--LP--LRKGLSE-------LIE-RK-SKLQ--QISWTVM-EN---LDVLTAGARP
K9QM62          IW-E--LS--HTSGLSD-------VLV-GQ-SQFN--ETVSQVT-HY---LDVLTAGVRP
A0A1Z4FWI3      LW-Q--IT--NSAGLSD-------VLV-GE-AEFK--TVACNVI-EN---LDVLTAGVRP
A0A1Z4JYE7      IW-G--IT--STAGLSE-------VLV-GH-LDVR--FAVKKVM-DN---LDILTAGVRP
A0A2T1FXY4      LW-Q--LT--NAAGLSE-------VLV-GQ-AQLS--IATSKVI-NN---LDVLTAGVTP
K9TYI2          LW-Q--LT--NAAGLSE-------VLV-GQ-AQLS--VATSKVM-NN---LDVLTAGVTP
A0A1Z4QL41      LW-Q--LN--NLAGLSE-------VLV-DE-AELN--VALCKVM-DN---LDVLTAGVRP
A0A252D4T4      LW-Q--IT--NTAGLSE-------VLV-GE-AEFK--TAACNVI-DN---LDVLTAGVRP
A0A252DJH5      LW-Q--IT--NTAGLSE-------VLV-GE-AEFK--TAACNVI-DN---LDVLTAGVRP
A0A252EB80      LW-Q--IT--NAAGLSE-------VLV-GE-AEFK--TAACNVI-DN---LDVLTAGVRP
A0A6G9SKZ9      IW-Q--IT--NTAGLSE-------VLV-GE-AEFK--TAASNVI-EN---LDVLTAGVRP
A0A1Z4HPW5      LW-Q--IT--NTAGLSE-------VLV-GE-ADFK--TAASNVI-EN---LDVLTAGVRP
A0A1Z4MSN1      LW-Q--IT--NTAGLSE-------VLV-GE-AEFK--TAASNVI-EN---LDVLTAGVRP
A0A1Z4U1C2      LW-Q--IT--NTAGLSE-------VLV-GE-AEFK--TAASNVI-EN---LDVLTAGVRP
A0A0D6KV51      LW-Q--IT--NTAGLSE-------VLV-GE-AEFK--TAASNVI-EN---LDVLTAGVRP
A0A1Z4MKF8      LW-Q--IT--NTAGLSE-------VLV-GE-AEFK--TAASNVI-EN---LDVLTAGVRP
A0A2C6WC43      LW-E--LT--NAVGLSE-------VLV-GQ-AEFN--TAVSKVM-DN---LDVLTAGVRP
A0A1Z4L5A1      LW-Q--LT--NAVGLSE-------VLV-GQ-AEFN--IAVSKVM-DN---LDVLTAGVRP
A0A367QD86      LW-Q--LT--NVVGLSE-------VLV-GQ-AEFN--TAVSKVM-DN---LDVLTAGVRP
A0A235IZ96      FW-Q--LS--NAVGLSE-------VLV-GQ-VEFN--MAISKVM-DN---LDVLTAGVRP
A0A2L2NGP0      FW-Q--LS--NAVGLSE-------VLV-GQ-VEFN--MAISKVM-DN---LDVLTAGVRP
A0A2K8SM78      LW-Q--LT--NAVGLSE-------VLV-GQ-AEFD--VTVSKVM-DN---LDVLTAGVRP
A0A2R5FPC0      LW-Q--LT--NAVGLSE-------VLI-GQ-AEFD--VTVSRVM-DN---LDVLTAGVRP
A0A5P8W5T6      LW-Q--LT--NAVGLSE-------VLV-GQ-AEFD--VSVSKVM-DN---LDVLTAGVRP
A0A140KBA0      IW-S--IP--NYLGLSN-------VLK-GE-AEWQ--EAIKTIK-PG---LDILTAGDLP
K9XSG1          IW-S--IP--NYLGLSN-------VLK-GE-VEWQ--EAIKTIK-PG---LDILTAGEPP
A0A0F5YE28      LW-G--LT--NAVGLSD-------ILV-GQ-AELS--SVIRQGI-ER---LDIIPSGVTP
U7QEH7          LW-G--LT--NAVGLSD-------ILV-GQ-AELQ--SGICQGI-ER---LDIIPSGVTP
A0A3S1ATK5      FW-Q--IS--NSPGLSE-------VLV-AQ-VEYS--NSIFRVM-DN---LDVLPAGVRP
A0A2Z6CPH0      LW-Q--LT--NVAGLSE-------VLV-GQ-SEVD--TAVNQVM-DN---LNVLTAGVRP
A0A1Z4GT50      IW-Q--LT--NAAGLSE-------VLV-AQ-AEFK--QAACKVM-DN---LDVLTAGVRP
A0A1Z4GIX0      LW-Q--LT--NAAGLSE-------VLV-GQ-AEFP--TAVSQVM-DN---LDVLTAGVRP
A0A2H6LC24      LW-Q--LT--NAAGLSE-------VLV-GQ-AEFP--SAVYQVM-DN---LDVLTAGVRP
B2J6N5          LW-E--VS--NADGLSE-------VLV-GQ-TEFD--VALSKVM-DN---LDVLTAGSRP
A0A367RMI4      LW-E--LT--NEVGLSE-------VLV-GQ-AEFD--IAVSKVM-DN---LDVLTAGVRP
A0A235HUM0      LW-Q--LT--NEVGLSE-------VLV-GQ-AEFE--IAVSQVM-DN---LDVLTAGVRP
A0A2L2NW47      LW-Q--LT--NEVGLSE-------VLV-GQ-AEFE--IAVSKVM-DN---LDVLTAGVRP
A0A1E2WUR1      LW-Q--LT--NAVGLSE-------VLV-GQ-AEFD--IAVSKVM-DS---LDVLTAGVRP
A0A235IKU3      FW-Q--LS--NAVGLSE-------VLV-GQ-VEFN--MAISKVM-DN---LDVLTAGVRP
F4XKF3          IW-Q--VM--NVAGLSQ-------VLI-GE-VPLE--LAICKAM-EN---LDVLTAGVMP
A0A1D9FX10      IW-Q--VM--NVAGLSQ-------VLI-GE-VPLE--LAICKAM-EN---LDVLTAGVMP
A0A1D8TNX9      IW-Q--VM--NVAGLSQ-------VLI-GE-VPLE--LVICQAM-EN---LDLLTAGVMP
A0A1U7MYU6      IW-Q--VM--NVAGLSQ-------VLI-GE-VPLE--LAICQAM-EN---LDVLTAGVMP
A0A3C0NJ41      MW-E--LT--NAGGLSD-------VLV-GQ-AEFK--AVVTEVM-DN---LDVLSCGVIP
A0A352AG88      IW-D--LT--NTAGLSD-------VLV-GQ-ADFA--ATVRTGM-DS---LDVLTAGVIP
A0A350Y374      IW-Q--LT--NAAGLSD-------VLV-VQ-AEFE--TAVNKVM-DN---LDVLTAGVIP
A0A355DPX0      IW-Q--LT--NAAGLSD-------VLV-VQ-AEFE--TAVNKVM-DN---LDVLTAGVIP
A0A0D8ZUV2      IW-K--LN--NITGLSD-------VIV-GQ-SEFK--TSVRTAI-KN---LDVLTAGVMP
A0A433VDI0      VW-E--LT--NAVGLSD-------VIV-GQ-AEFK--ASVTQVM-PN---LEVLTSGVIP
A0A3D1PG43      IW-N--IN--NVAGLSN-------VIV-SQ-TEFQ--TTVQQVM-TN---LDVLTAGVMP
A0A2P8QQ72      IW-Q--QT--NVEGLSH-------VLV-GG-TDFQ--AAVEQVM-PN---LHVLTAGVVP
K9TZQ7          IW-Q--QT--NVEGLSH-------VLV-GG-TDFQ--AAVEQVM-PN---LHVLTAGVVP
A0A2G7GPR0      IW-E--LT--NAAGLSD-------VIV-SQ-AEFE--SVVTEVI-PK---LDVLSAGVIP
K9XH68          IW-E--LT--NAAGLSD-------VIV-SQ-AEFE--SVVTEVI-PK---LDVLSAGVIP
A0A1U7HW70      IW-E--LT--NAAGLSD-------VIV-SQ-AEFE--SVVTEVI-PK---LDVLSAGVIP
A0A2S6VEJ8      IW-E--LT--NAAGLSD-------VIV-SQ-AEFE--SVVTEVI-PK---LDVLSAGVIP
                                                                     :      

K9SLA9          TN--PAALLDS-RPMNSLLSVAAR--NYDLVLLDTPPVTVAADTTVLGKKTDGVVLLVRP
A0A168TT23      PN--PAELLSS-DRMRKIINMSAR--AFDHVIIDSAPILGLADALVLSRCVDGVILVTSA
A0A0M1JWX9      PD--PIRLLSS-QKMQQLMQQWSR--EFDLVILDTPPLKNVVDGRVLAGYTDGVVLVVSM
A0A2T1M1V6      PN-KIGEFFLR-GEFEQRLNRAQASDNYDFILIDSPPVNLTSETSLMSRLIQNVMFLVRP
A0A2G7GCS2      KT-KIPEYFAR-GRFQQNLDQIQAEGGYDYVLVDSPPIGLASETNLMSSVVRNVLFVVRS
K9XBH8          RE-KIAEFFAR-GSFERNLNQIQSSGGYDFVLVDSPPVGLASETNLMSSVIQNVLFVVRA
A0A1Z4LJ30      DK--ISEFVAR-GEFEQHLNFVQTNDNYDYVLVDSSPVTLTPEAALLAKVIINVLFVVRS
K9RI76          DK--ISEFVAR-GEFEQYLNLIQAQGNYDYVLVDSSPVALTPEAALLARIISKVVFVVRS
A0A352AE27      GK--IVEMVTR-GRFEESLVAAQSANEYDYILVDSAPVSLTSETVLMAAITRNVLFVVRP
A0A3B8JH60      GK--IVELVRG-GRFEQSLEAIQSAGDYDYILIDSAPVTFTSETALMASIVPNVLFVVRP
A0A3C0N766      GK--IVELVRG-GRFEQSLEAIQSAGDYDYILIDSAPVTFTSETALMASIVPNVLFVVRP
K9W9J7          GK--IVELVRR-GRFEQSLAVAESANKYDYVLIDSAPVSLTSETALMANVVPNVLFVVRP
A0A139WSU3      GK--IVETIKR-GRFEQALTACEARGNYDYVIVDSAPVSLTSETALMATLISNVLFVVRP
A0A433VN22      GK--IVEIIRR-GNFEKTLATCEANNKYDYIIVDSAPVSFTSETPLIANIIRNVLFVVRP
Q7NF11          DT--STAFFVQ-GGFERYLDDVQTD-GYDYVLVDSPPISLTSEAALMIPAVRNVLFVVRP
A0A1Z4JCS8      GK--IVDLVKR-GRFERYLAVAESQKDYDYVLVDSAPVSSTSETALMAAIVPYVLFVVRP
F4XTX2          GK--IVELVTQ-GKFEQSLATAEESGDYDYVLIDSAPVSMTSETALMAAVIGNLLFVVRP
Q7NJN6          ERTSVGEYIAR-GHFSRYLSELESAGGYDYVLIDTAPEDLVAETKLIAAAIGNVLFVVRP
U5QCC3          GDASIGEHIVK-GNFTRHLDRLKQENGHDYILIDTAPEQLVAETKLIAAEIRNVLFVVRP
A0A3S0Y9N9      NN--PSALINS-TQMAVFIAQVAQ--KYDFVIIDSPPFTVAADATILGKLANGILLVVRP
A0A433UNK7      HN--PASLLDS-SQMAVFVAQVAQ--KYDFVIIDTSPLTVAADATILGKLVNGILFVVRP
A0A3M1SVZ4      PN--PIALLDS-QRMVSLMEEFAD--RYDFIILDAPPLNVAADASILGKMSDGILWVVRP
A0A654SFI6      PN--PVELLAS-PRIGHILTQARD--QYDQVVIDSAPMLSLADAVELSRFVDGVLYVVES
K9SSQ0          PN--PMILLES-NKFQKLLGEWDQ--TYDYVLIDTPPIVGITDAQSLAPRMDGVVLVTAI
A0A2W1JIN9      VL--PSRFFES-DGMKILLEEARS--SYDLVIVDTPPVTSCVDAMAVSSEGYPLLLIARP
A0A318AJV1      FI--SRDIFSP-STVQNLLENGRA--LYDFVVMDLPPVLGVADARLLAAMADANVFVVRW
A0A6B3MUB5      TN--PSRVLES-ASMKHLLAKAAT--HYDLVIIDTPPISSCADVHTLSRYSEGLVMITRP
A0A1U7N2U4      SG--PATFLQS-QVMKSILAAAGD--HYDLVIVDTPPVSSFADAHTLSRYSDGLVMVTRA
A0A1D9G1F2      SG--PATFLQS-QVIKSILAAAAD--HYDLVIVDTPPVSSFPDAHTLSRYSDGLVMVTRP
F4XV38          SG--SATFLQS-QMIKSILAAAAD--HYDLVIVDTPPVSSFADAHILSRYSDGLVIVTRP
A0A2P8QIL5      SH--PSELFES-RQIQQVIAAAAS--QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARP
A0A2T1FLY5      SH--PSELFES-RQIQQVIAAAAS--QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARP
A0A433W447      SH--PSELFES-RQIQQVIAAAAS--QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARP
K9U1K8          SH--PSELFES-RQIQQVIAAAAS--QYDLIVIDTPPVTSCVDAVSLCGNGEKLLLVARP
K9UYB2          GS--ASQMLES-AAMRHIITEASE--HFDLVIIDTPPLTICADAITLGRITEGLLLVTRP
A0A218QN17      GR--PSQLLES-PAMKSLVAEAAA--TYDMVIIDTAPISACADAATLARQSDGIMLVTRP
K9RKN2          GR--PSQLLES-VEMKLILEEAAK--EYDLVIIDTPPVSACADAATLGKQGDGVVLVTRP
A0A2I8ADV2      GR--PSQLLES-EAMKSLIAEAAH--HYDLVIIDTPPIGVCADASTLSQYSDGVIMTTRP
A0A1W5CKM3      GR--PSQILES-AAMKALVAEAAQ--RYDLVIIDTPPLSACADASTLSQMSDGVILTTRP
A0A5Q0GMF5      GR--PSQILES-AAMKALVAEAAQ--RYDLVIIDTPPLSACADASTLSQMSDGVILTTRP
Q3MEW0          GR--PSQILES-AAMKALVAEAAQ--RYDLVIIDTPPLSACADASTLSQMSDGVILTTRP
A0A1Z4KIC7      GR--PSQILES-AAMKSLVAEAAQ--RYDLVIIDTPPLSACADASTLSQMSDGVILTTRP
Q8YSM5          GR--PSQILES-AAMKSLVAEAAQ--RYDLVIIDTPPLSACADASTLSQMSDGVILTTRP
A0A1Q4S1H4      AR--PSQLLES-NQMKALLTEAAE--NYDLVILDTPPLSACADATTLSQLSDGVMLVTRP
A0A433VBU6      TR--PSQLLES-TYMKALMMEAAE--SYDLVILDTPPLSACADATTLGQLSDGIMLVTRP
A0A1Q4RZJ6      GR--PSQILES-AAMKKLIAEAAA--NYDFVIIDTPPLSACADTATLAKQCEGVLMVTRP
A0A1Z4SNV3      VR--PSQILES-PAMKRLISEAVA--NYDFVIIDTPPLSACADTATLAKQSEGVLMVTRP
A0A2H2XJQ1      VR--PSQILES-PAMKRLISEAVA--NYDFVIIDTPPLSACADTATLAKQSEGVLMVTRP
A0A3S5K358      GR--PSQILES-AAMKKLIAEAAA--NYDFVIIDTPPLSACADTATLAKQCEGVLMVTRP
A0A0T7BPJ4      NR--PSQLLES-PEMKALIAEATA--KFDLVIIDTPPLCACADASTLSRYSDGMVVVTRP
A0A0C1QS61      GR--PSQLLES-IAMKSLVAEASE--NYDLVILDTPPLSACADAATLAKQSDGVMLVTRP
A0A139X3R8      GR--PSQLLES-VAMKSLVAEAAE--NYDLVIIDTPPLSACADAATLAKQSDGVMLVTRP
A0A1Z4I7C5      GR--PSQILES-PAMKSLVAQAAE--YYDIVIIDTPPLSACADAASLSQMSDGVILATRP
A0A0C2MDK7      GR--PSQLLES-IAMKSLMAEAAE--NYDLVIIDTPPLTACADALTLAQEGNGLMLVTRP
A0A1Y0RCK1      GR--PSQLLES-IEMKSLIAEASE--NYDLVIIDTPPLSACADASTLAQQSDGVVLVTRP
A0A1Z4PWZ0      GR--PSQLLES-IAMKSLVAEAAE--NYDLVIIDTAPLCSCADASTLARQSDGVMLVTRP
A0A0C2QLT0      GR--PSQLLES-IAMKSLVAEAAE--NYDLVIIDTPPLSACADASTLAQQSDGVMLVTRP
A0A1Z4J2K1      GR--PSQLLES-IAMKSLVAEAAE--NYDLVIIDTPPLSACADASTLAQQSDGVMLVTRP
A0A3S0ZSX0      GR--PLQLLES-DAMKSLLAEAVQ--QYDCVILDTPPLSACADAHTLSRQSDGVLIVTRP
A0A2N6K4T3      GY--PSRLLES-NAISSLLAEATR--QYDCVIIDTPPLSACADAHTLGRQSNGILLVTRP
A0A370CKT2      GR--PSHLLESXXXMKSLLIEAVR--QYDFVVIDTPPLSACADAHTLGRQSDGILLVTRP
A0A0S3TL97      GR--PSHLLES-EAMKSLLIEAVR--QYEFVVLDTPPLSACADAHTLGRQSDAILLVTRP
A0A2N6M8A0      GR--PSHLLES-EAMKSLLIEAVR--QYEFVVLDTPPLSACADAHTLGRQSDAILLVTRP
A0A2N6M9E1      GR--PSHLLES-EAMKSLLIEAVR--QYEFVVIDTPPLSVCADAHTLGRQSDGSLLVTRP
A0A2N6KJI4      GR--PSHLLES-EAMKSLLIEAVR--QYDFVVIDTPPLSACADAHTLGRQSDGILLVTRP
A0A2N6MZ77      GR--PSHLLES-EAMKSLLIEAVR--QYDFVVIDTPPLSACADAHTLGRQSDGILLVTRP
A0A2N6KT20      GR--PSHLLES-EAMKSLLIEAVR--QYDFVVIDTPPLSACADAHTLGRQSDGSLLVTRP
G6FSN3          GR--PSHLLES-EAMKSLLIEAVR--QYDFVVIDTPPLSACADAHTLGRQSDGILLVTRP
A0A4D9CI02      GR--PSHLLES-EAMRSVIIEATR--LYDFVIIDTPPLGACADGQTLGRQSGGILLVTRP
A0A328I8B9      GR--PSHLLES-EAMRSVIIEATR--LYDFVIIDTPPLSACADGQTLGRQSSGILLVTRP
A0A4Q9J4Z7      GR--PSHLLES-EAMRSVIIEATR--LYDFVIIDTPPLGACADGQTLGRQSGGILLVTRP
A0A0M0SU69      GR--PSHLLES-EVMKSLMTEATQ--RFDCVIIDTSPLSACADAQTLGRQSDGILLVTRP
A0A1Z4TIZ8      GH--LSHLLES-EVMKSLITEAIL--QYDCVIIDTPPLSACADAQTLGRQSDGILLVTRP
A0A0S3TYD7      PN--PIALLDS-ERMSFLMQVFLE--RYDYVIFDTPPLSGIADATILGKRADGLVLVSRL
A0A3C0N2P0      PD--PTRLLSS-KKMKNLVERFQE--AYDLVIFDTPPLMGLADAKLLATHTDGIVMVVGL
K9TLQ0          PD--PARLLSS-QRMKQLIEEFKT--SFDLVIFDTPPLGAISDAKFLAPHTDGLVMVIGM
A0A6B3M6M6      PD--PTRLLSS-QKMQNLVKHFQE--SFDLVLFDTPPMLGLADARLLEAHTNGMVMVVGL
A0A6B3NIJ0      PD--PTRLLSS-QKMQNLVKHFQE--SFDLVLFDTPPMLGLADARLLEAHTSGMVMVVGL
A0A352XE00      PD--PTRLLNS-KKMQNLVEYFQS--KFDLVIFDMPPLLGLADARLLAAYTDGILMVVGL
B4VS56          PD--PTRLLCS-QKMQHLVESFEE--MFDLVIFDTPPMLGLADARLLAAHTDGIVMVVGL
A0A352AAQ3      PD--PIRLLCS-KKMQNLVAYLQK--SFDLVIFDTPPLLGLADARVLAAHTDGIVMIVGL
A0A350Y472      PD--PTRLLCS-KKMQNLVERFHG--AFDLVIFDTPPLLGLADARLLAAHTDGIIMVVGL
A0A355DVB4      PD--PTRLLCS-KKMQNLVDRFHG--AFDLVIFDTPPLLGLADARLLAAHTDGIIMVVGL
U5QL42          PN--PVALLNS-EKMTELLAQWRE--NFDYVIVDTPPVVGLPDAQSIVSRVDRVVLIVAI
K9QF04          PN--PAQLLSS-SKMRDLLVQFQK--SYDLVIVDTPPLHGFADAKFLASQTNGLIMVIGL
A0A076HBF2      PD--PTRLLSS-NRMRSLVNELEASGQFDLVLFDTPPVLGLADAALVAEHCDGLMLLVSL
A0A354B169      PD--STRLLSS-NRMRDLMVDLGHCGDYDLVLFDTPPLLGLTDAVLVAENCDGLVLLVSL
G4FMX5          PD--PTRLLSS-KRMHQLVEDLGKSEEFDLILFDTPPVLGLADAALVAEHCDGLMLLVSL
Q0IDT5          PD--PTRLLSS-QRMHDLVQEITQSNDFDLVLFDTPPVLGLADASLVAEHCDGLMLLVSL
A0A2D6FCW3      PD--PARLLSS-NRLHQLVEDLENSGEFDLILFDTAPVLGLADAALVAEHCDGLVLMVSL
A3ZA21          PD--PTRLLSS-QRMHSLVQELANGGEFDLVVFDTPPVLGLADAALVAEHCDGLMLLVSL
A0A140K3H3      PN--PIALLNS-DKMKQLLQQWQE--AYDYVLVDTPPIGVVADAKSLANQVDSVLFVVGI
K9XUB8          PN--PIALLNS-DKMKQLMQQWQE--AYDYVLIDTPPIGVMADAKSLANQVDSVLFVVGM
Q7NEU3          PD--PVALLDS-LRMKELVKQWGE--RYDLVIIDSPPMIGLADATILTKCADGLVFVIGL
A0A6H2NHD5      PA--PGRLLSS-RKMQHITEQYRR--HYDLIIFDTPPLAGMIDAKLIAAQADGLLLVSRL
A0A2P8W4F7      PA--PGRLLSS-RKMQQLTEQYRR--HYDLIIFDTPPLSGMIDAKLTAAHADGLLLVVRL
A0A5Q4E0Z4      PA--PGRLLSS-RKMQQITEQYRR--HYDLIIVDTPPLAGMIDAKLIAAHADGLLLVVRL
A0A2P8VVX1      DD--PISLLSS-PRFRQLLARGKE--RYDLILVDTTPLIGMADALKVGAVCDSTVLVTRL
A0A2P8WHY0      ND--PITLLSS-PRFQKLIHRCKS--IYDVVLVDTPPLTGMADALKIGAVCDNVLLVARL
A0A2T1CMT9      ED--PVKILNS-SRLGRFIEQQKE--NYDLILVDTPPAIGMVDAIKIASICDTSLIVSRL
A0A563VQJ3      SN--PLALLDS-PEMGELIARGRK--TYDLVLIDAPPLPVTADVLTLSKMVDGILFVSRL
A0A1D8TX52      ID--PVKLLGS-KRMKNLMAEFQE--TYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRL
A0A1D9G4T2      ID--PVKLLGS-KRMKNLMAEFQQ--TYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRL
F4XP71          ID--PVKLLGS-KRMKNLMAEFQQ--TYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRL
A0A1U7N5X9      ID--PVKLLGS-KRMKNLMAEFQQ--TYDLVLLDTPPVLGMVDALQAASLCQGVVMVGRL
A0A6B3N2I8      ID--PVKLLGS-KRMKNLMAEFQQ--TYDLVLLDTPPVLGMVDALQAASLCQGVLMVGRL
A0A2W6ZAV2      PD--ATKLLSS-ERCSALVEQIRSLPGYDVVLFDTPPSLALSDALLLSEHLDGTVFLVSL
A0A2G7GMH8      VD--PVQLLSS-SKMKEMMLAFEQ--EYDLVLLDTPPVLGRVDAIQTASFCSGAILVARI
K9W742          PD--PANLLSS-PRMGELMAEFEQ--SYDLVLVDAPPVLGLVDSILTASYCGGVLLVARM
A0A2T1DWE8      TD--PAQLLSA-ERMGDLVQALEQ--AYDLIIIDAPPVLGIVDALLTASFCSSMVLVGRI
A0A1U7I8L3      LD--PAQLLSS-QRMRELMANFEQ--SYDLVLLDAPPVLGIVDAILAASFCSGAVLVGRI
A0A2T1DJL8      SD--PVKLLSS-RRMKELMTVFEQ--SYDLVIVDVPPVLGIVDAMLAASFCDGTLLVGKV
A0A1Z4J9W0      SD--SVKLLSS-KRMRDLMTLFEQ--HYDLVILDAPPVLGIVDALLASSCSDGVLLVGRM
A0A0N7Z5K9      TD--SVKLLSS-KRMRDLMTVFEQ--HYDLVILDCPPVLGIVDALLAASFCDGTLLVGRM
A0A0S3TXC5      TD--SVKLLSS-KRMRDLMTVFEQ--HYDLVILDAP