BYKdb

Dataset for cluster tadcd of phylum cyanobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

506 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


K9SLA9          ---------------------------------------------------------MNK
A0A168TT23      --------------------MSNYGIHDGRHLKPIEDQNTALAQYDPYQSKANEDDDAID
A0A0M1JWX9      ---------------------MQTAPNSQPSSFDQNGKQPQIVPLSYLAEVPDADEEELD
A0A844MWN9      ------------------------------------------------------------
A0A2T1M1V6      ------------------------------------------------------------
A0A2G7GCS2      ------------------------------------------------------------
K9XBH8          ------------------------------------------------------------
A0A1Z4LJ30      ------------------------------------------------------------
Q7NF11          ------------------------------------------------------------
K9RI76          ------------------------------------------------------------
A0A433VN22      ------------------------------------------------------------
A0A139WSU3      ------------------------------------------------------------
A0A844MJB7      ------------------------------------------------------------
A0A352AE27      -----------------------------------------------------------M
A0A3B8JH60      ------------------------------------------------------------
A0A3C0N766      ------------------------------------------------------------
K9W9J7          ------------------------------------------------------------
Q7NJN6          ------------------------------------------------------------
U5QCC3          ------------------------------------------------------------
A0A1Z4JCS8      ------------------------------------------------------------
A0A846GVZ3      ------------------------------------------------------------
A0A6P0PI80      ------------------------------------------------------------
A0A6P0WGT6      ------------------------------------------------------------
F4XTX2          ------------------------------------------------------------
A0A3S0Y9N9      ---------------------------------------------------------MEE
A0A6P0ZKB8      ---------------------------------------------------------MEE
A0A846EDH6      ---------------------------------------------------------MEE
A0A433UNK7      ---------------------------------------------------------MEE
B8HNB0          -----------------------------------MVQFNAERWLQNQQLLNELYFSASD
A0A318BJ18      ----------------------------MSFISSNLGSPGAIGSAQSAIASPTIADGPSV
A0A3B8Y8H9      -----------------------MTDLPNNSLAVNSPQPQVNQTIQSQLREQNEEDISLS
A0A2W1JVB9      -----------------------------------------------MPAEYQLEEEVID
A0A6H1U102      -----------------------------------------MPDRFAGLDRMTLPDDNND
A0A7C3ZEJ3      -----------------------------------------------------MPERGTD
A0A2P8W9H0      ------------------------------------MASELQLSSKGALHPEGDQEGGLR
A0A6I5P386      -------------------------------------MIAKRLPTVGIPLDERDREGGLR
A0A3M1SVZ4      --------------------------------------------------MESGGESTIQ
A0A318BG22      ---------------------MIRSLTNDTRPGPIDDLQSRRGAMRPAAEVEQWDGGSIS
A0A2T1E9V8      ----------------------------------------------------MEAPENIQ
A0A1Z4LN32      -------------------------------------------------MENQNLSEEID
A0A2I8A9F5      -------------------------------------------------METQNSAEDID
A0A218Q6R8      -------------------------------------------------METKNYPDEID
A0A218QGE0      -------------------------------------------------MDTKNYPEEID
A0A846HDH5      -------------------------------------------------METKNYPEEID
A0A3M2GQQ6      ------------------------------------------MQNAIAINPIQDYKNDTD
A0A6H1U2X0      ------------------------------------------MQNAIAINPIQDYKNDTD
K9TLQ0          -------------------MDIDGNSPPFFQQLNGPFPSGQTPLPSTILPPLNDDADALN
K9QF04          -----------------------------------MTQNVENLTLFKPQALPKPQSDPWE
K9W1T3          ---------------------------------------------------------MDE
K9SGJ5          --------------------------------------------MPEYSLNPGQPEESID
A0A6N2JS94      -----------------------------------------MTEYPKATYVGKYVDDSFK
A0A6C2DSN4      -----------------------------------------MTAYPKATYVGKYVDDSFK
L8MYT6          -----------------------------------------MTAYPKATYVGKYVDDSFK
A0A352JGJ6      -----------------------------------------MTEYPKATYAGKYVDDSFK
A0A1J5GLS2      -----------------------------------------MTEYPKANYVGKYVDDSFK
A0A2W4W6M5      -----------------------------------------MSEYPKAISTGKYVDDSFK
A0A2W7AN33      -----------------------------------------MPAYPKATYVGKYVDNSFK
A0A256BLV2      -----------------------------------------MTEYPKATYVGKYVDDSFK
A0A2W6ZXF3      -----------------------------------------MTEYPKANYVGRYVDDSFK
A0A2Z5WX66      -----------------------------------------MTEYPKANYAGKYIDDSFK
Q7NEU3          -----MTKQPFADPV--------------------------------DKPAQVVEESSFD
A0A3C0N2P0      -----MGPDGDYQPLLPNGNGKQLSQLSTL----------------NAAEFSVLNEDKFD
A0A6P0JR04      -----MVSNLNSQPPFSGGSGHSPLAKSGV------------SESLPPPNLAKSEEDTLN
A0A6B3M6M6      -----MGSDANFQPLLPNSNTQVLLPTSAL-----------------SGGISGIDEDQLD
A0A6P0KD09      -----MGSDANFQPLLPNSNTQVLLPTSVL-----------------SGGISAIDEDKLD
A0A6B3NIJ0      -----MGSDANFQPLLPNSNTQVLLPTSVL-----------------SGGISAIDEDKLD
A0A6M0F053      -----MGSDANFQPLLPNSNTQVLLPTSVL-----------------SGGISAIDEDKLD
A0A6P2ATU9      ----------------MVSNLNPQPHLPPRPPGPIPPSSQNTGDPFVTLQ-GNSDEDSFN
A0A845XAM4      -----MGFACSYNCSLFVSNSNPPFSRSPR-NGTNPSPKLNLGDRMSAFPIPGSDEESIN
A0A352XE00      -----MNLNGDGKVLSINGNAQQSLEVPGI----------------NSKNVADIPNHQVD
A0A6P0QC14      -----MGPDGDYQPMPPYGNGNQAPHLYSP----------------YTTGLSEFDEDKFD
B4VS56          -----MGSNGEYQPLPPNRNGHLPSELSSL----------------SLYELVETEDDKLD
A0A352AAQ3      -----MALTGDYQPLLPTSNGKQLSELMPI----------------YTNGFSEIQEDKLD
A0A350Y472      -----MGPKVDYQPLLVNANDKPSSVSPPI----------------YPSGFSLVEEEKLD
A0A355DVB4      -----MGPKVDYQPLLVNANDKPSSVSPPI----------------YPSGFSLVEEEKLD
A0A1Z4RMB9      ------------------------------MLSNNSNEQNTNSAYPSIAPKRDSLD--VN
A0A318B4H2      --------------------MNTNLTYEEAPFDPSAASVVTPVAVDKPAGQRLDERAVSA
A0A2K3BR24      ------------------------------------------------MPTTTDQEDYID
K9YXY1          ----------------------------------MDHQEQLPASSVNPIPTTTDQEDYID
A0A1Q4RTR1      ------------------------------------------------MSALNTENDSIN
A0A1Z4SQV2      -------------------------------------------------MQVNAENDSIN
A0A2H2XGN1      -------------------------------------------------MQVNAENDSIN
A0A433UXH8      -------------------------------------------------MAVNTENDSIN
A0A1U7HGH0      ------------------------------------------------MEVTE-----LD
K9XJD3          ------------------------------------------------MEVTE-----LD
K9SX01          -------------------------------------------------MNQSPAEDKNP
A0A4P7ZT55      --------------------------------------------------MPAVPDGEIN
A0A1E5QIR9      -------------------------------------------------MTHLEDSDAID
A0A6P1A9A0      ---------------------MISNRNSQSISPNWNGKQLPPQLPPTISGLAKEEEESFN
A0A1Z4IBC7      ----------------------------------------------MTMESLRSIEE-VD
A0A5Q0GKD1      ----------------------------------------------MTMDSLQGFEE-VD
Q3MDC6          ----------------------------------------------MTMDSLQGFEE-VD
A0A1Z4KM73      ----------------------------------------------MTMDSLQGFEE-VD
Q8YNX7          ----------------------------------------------MTMDSLQGFEE-VD
A0A367R4K6      ----------------------------------------------MTMESLPNVEE-VN
A0A1E2WSV8      ----------------------------------------------MTMESLPNFEE-VN
A0A7D7L9Y1      ----------------------------------------------MTMESLPNFEE-VN
A0A2R5FRT9      ----------------------------------------------MTMESLPHVEE-VN
A0A2K8T1B6      ----------------------------------------------MTMESLPQFEE-VN
A0A235I9I0      ----------------------------------------------MTMESLPNFEE-VN
A0A2D0HQT8      ----------------------------------------------MTMESLPNFEE-VN
A0A2L2NU95      ----------------------------------------------MTMESLPSFEE-VN
A0A367S084      ----------------------------------------------MTMESLPNFEE-VN
A0A1Z4SMD6      -------------------------------------------------MNQGFI-EEID
A0A2H2Y096      -------------------------------------------------MNQGFI-EEID
K9S8M8          ------------------------------------------------MEFQHYP-EEID
A0A1Z4NFV0      ------------------------------------------------MENPSYL-EEID
A0A3M9ZEU1      ------------------------------------------------MHPKDHL-EEVD
A0A1Z4JK72      -------------------------------------------MTSMKMETKQYS-EDFD
A0A0N7Z489      -------------------------------------------MTSMNIETKRYS-EDFD
A0A0S3TXS2      -------------------------------------------MTSMNIETKRYS-EDFD
A0A2A2TPF8      ------------------------------------------------MEKQSNS-DDLD
A0A1Z4R0P8      ------------------------------------------------MEKQSYP-DELD
A0A0T7BUI3      ------------------------------------------------MEKQKAL-EELD
A0A1Z4LP32      ------------------------------------------------MQNKKNN-QEVD
K9REP9          ------------------------------------------------MKNKNNA-QEID
A0A1Z4SIJ3      ------------------------------------------------MENEGYPLQEAE
A0A2H2XPG4      ------------------------------------------------MENEGYPLQEAE
A0A2A2TC28      ------------------------------------------------METKGYL-EEID
K9V3C7          ---------------------------------------MLINQEKPDMKPQHYT-EEID
A0A1Z4T6Y7      -----------------------------------------------MEQQNNRS-EDID
A0A2H2Y561      -----------------------------------------------MEQQNNRS-EDID
A0A1Q4S362      -----------------------------------------------MEQQHNRS-EDID
A0A3S1CIN8      -----------------------------------------------MEQQHNRS-EDID
A0A0C1NCB0      -----------------------------------------------MEETKGHQ-EEID
A0A844MLU2      -----------------------------------------------METKGYQQ-EEID
A0A2N6K7Q9      ------------------------------------------------METNSYT-QEAE
A0A2N6MXH6      ------------------------------------------------METNSYT-QATE
A0A2N6M5A8      ------------------------------------------------MENNSYT-QATE
A0A2N6LL61      ------------------------------------------------METNSYT-QATE
A0A0S3TP66      ------------------------------------------------METNSYT-QATE
G6FP91          ------------------------------------------------MENNSYT-QATE
A0A1U7GYR5      ------------------------------------------------METNSYT-QATE
A0A2N6KY52      ------------------------------------------------METNSYT-QATE
A0A2N6KMP5      ------------------------------------------------METNSYT-QATE
A0A2N6MA45      ------------------------------------------------METNSYT-QATE
A0A4Q9J9V9      ------------------------------------------------METNSYT-QETE
A0A328IGA1      ------------------------------------------------METNSYT-QETE
A0A4D9CE41      ------------------------------------------------METNSYT-QETE
A0A0M0SFT2      ------------------------------------------------METNNYT-QETE
A0A1Z4TLC8      ------------------------------------------------METNSYT-QETE
A0A1Z4IYV4      ------------------------------------------------METKGYQ-EEVD
A0A1Z4Q0T6      ------------------------------------------------METKGYQ-EEID
A0A0C2PT44      ------------------------------------------------METKGYQ-EEID
A0A1D2P6J4      ------------------------------------------------METKGYQ-EEVD
A0A0C2LFH0      ------------------------------------------------METRGYQ-EEVE
A0A856M734      ------------------------------------------------METRGYQ-EEVE
B4WP72          ------------------------------------------------MRDKEYTEE-ID
A0A2T1CIL7      ---------------------------------------------MIPTIVPSTHEEQID
A0A433V7A0      ---------------------------------------MKYPKHTTTIDSREPEE--ID
A0A2T1FTR8      ---------------------------------------------------------MDE
K9UA41          ---------------------------------------------------------MDE
A0A563VS48      ---------------------------------------------MNTIEQNVHIDEYLD
A0A7Y0NUK1      ---------------------------------------------MNTVESNLHLEEYLD
A0A0C2LBE2      ---------------------------------------------MSAMEPVPNSEE-ID
A0A433NN38      ---------------------------------------------MDSIKHTHSLEE-ID
A0A2N6K0T2      -----------------------------------------------MKESEFHVEE-ID
A0A2N6ML72      -----------------------------------------------MKESEFHVEE-ID
G6FQZ6          -----------------------------------------------MKESEFHVEE-ID
A0A2N6MQX9      -----------------------------------------------MKESEFHVEE-ID
A0A2N6KXT6      -----------------------------------------------MKESEFHVEE-ID
A0A2N6KGB9      -----------------------------------------------MKESEFHVEE-ID
A0A2N6L3Y5      -----------------------------------------------MKESEFHVEE-ID
A0A0S3TIS7      -----------------------------------------------MKESEFHVEE-ID
A0A1U7GW28      -----------------------------------------------MKESEFHVEE-ID
A0A2N6LW63      -----------------------------------------------MKESEFHVEE-ID
A0A328IH74      -----------------------------------------------MKESEFKVEE-ID
A0A4D9CIB0      -----------------------------------------------MKESEFKVEE-ID
A0A1Z4TQ63      -----------------------------------------------MKESEYQLEE-ID
A0A4Q9J8G2      -----------------------------------------------MKESEYQLEE-ID
A0A350Y0P6      ------------------------------------------------MESKQYVED-ID
A0A352X940      ------------------------------------------------MESKQYVED-ID
B8HTN4          ------------------------------------------------MQALEDDR--ID
A0A6P1AFJ5      -----------------------MVASGNPAPLIPNFSNYQPLPQYQPLTWQGNTEESFD
B0CAX4          -----------------------------------------------MPMSNEYSHESID
A0A1Z4RN12      ------------------------------------------------MDSNLHLEEYID
A0A2T1CMF9      ------------------------------------------------MDSNLPIGEHID
Q7NDC5          ----------------------------------------------------------MG
U5QGK3          ----------------------------------------------------------MG
A0A2W4UY24      -------------------------------------------------MPQKELE--ID
A0A838VM23      ------------------------------------------------------------
A0A0D8ZUV2      ---------------------------------------------------MEFID--AD
A0A433VDI0      -----------------------------------------MEPTKPIVEYSESIN--ID
A0A3D1PG43      ------------------------------------------------MESREAID--IN
A0A2P8QQ72      --------------------------------------------MESRVESREAVD--IN
K9TZQ7          --------------------------------------------MESRVESREAVD--IN
A0A6N8G584      ------------------------------------------------MESNETID--ID
A0A2G7GPR0      ------------------------------------------------MESNETID--ID
K9XH68          ------------------------------------------------MESNETID--ID
A0A1U7HW70      ------------------------------------------------MQSNDTID--ID
A0A2S6VEJ8      ------------------------------------------------MESNETID--ID
A0A140KBA0      ------------------------------------------------MESNLYIDEYLD
K9XSG1          ------------------------------------------------MESNLYTDEYLN
A0A2T1GMT4      ------------------------------------------------MESQESID--LN
K9UI51          ------------------------------------------------MESQESID--LN
A0A1Z4QL41      ------------------------------------------------MESREAVD--LD
K9TYI2          ------------------------------------------------MESRESID--LN
A0A252D4T4      ------------------------------------------------MESRESID--FD
A0A252DJH5      ------------------------------------------------MESRESID--FD
A0A252EB80      ------------------------------------------------MESRESID--FD
A0A6G9SKZ9      ------------------------------------------------MESRESID--FD
A0A1Z4HPW5      ------------------------------------------------MESRESID--FD
A0A1Z4MSN1      ------------------------------------------------MESRESID--FD
A0A1Z4U1C2      ------------------------------------------------MESRESID--FD
A0A0D6KV51      ------------------------------------------------------------
A0A1Z4MKF8      ------------------------------------------------MESRESID--FD
A0A2C6WC43      ------------------------------------------------MESRETLD--LD
A0A841WRE0      ------------------------------------------------MESRETLD--LD
A0A1Z4L5A1      ------------------------------------------------MESRETID--LD
A0A367QD86      ------------------------------------------------MESRETID--LD
A0A2K8SM78      ------------------------------------------------------------
A0A2R5FPC0      ------------------------------------------------MESRESID--LD
A0A5P8W5T6      ------------------------------------------------MESRESID--LD
A0A7D7LDT7      ------------------------------------------------MESRESID--LD
A0A235IZ96      ------------------------------------------------MESRESID--LD
A0A2L2NGP0      ------------------------------------------------MESRESID--LD
K9QM62          -------------------------------------MKAKTLEVDSTIKSREAID--LD
A0A1Z4FWI3      ------------------------------------------------MESRESID--LD
A0A1Z4JYE7      ------------------------------------------------MESRESID--LD
A0A0F5YE28      ------------------------------------------------MEDRESID--LD
U7QEH7          ------------------------------------------------MEDRESID--LD
A0A3S1ATK5      -------------------------------------------MSKTPMESREDID--LD
A0A2Z6CPH0      -------------------------------------------MAKNIMESRESLD--LD
A0A1Z4GT50      ------------------------------------------------MESRESID--LD
A0A1Z4GIX0      -------------------------------------------MSKNSMESRETID--LD
A0A2H6LC24      -------------------------------------------MSKNSMESRETID--LD
B2J6N5          -------------------------------------------MSAKSTESRESID--LD
A0A367RMI4      -------------------------------------------MSEKSMESRESID--LD
A0A235HUM0      -------------------------------------------MSEKSMESRESID--LD
A0A2L2NW47      -------------------------------------------MSEKSMESRESID--LD
A0A1E2WUR1      -------------------------------------------MSEKSMESRESID--LD
A0A235IKU3      -------------------------------------------MSEKSMESRESID--LD
A0A1U7MYU6      ------------------------------------------------MESRSSID--LD
A0A1D8TNX9      ------------------------------------------------MESRSSID--LD
A0A6P0L6C2      ------------------------------------------------MESRSSID--LD
A0A6P0MVH0      ------------------------------------------------MESRSSID--LD
A0A6P0KJV0      ------------------------------------------------MESRSSID--LD
A0A6L9ZJG4      ------------------------------------------------MESRSSID--ID
A0A846GI17      --------------------MAGLVANSHQYQKLFYCAIYLGGAPEELMESRSSID--LD
F4XKF3          --------------------MAGLVANSHQYQKLFYCAIYLGGAPEELMESRSSID--LD
A0A1D9FX10      ------------------------------------------------MESRSSID--LD
A0A6P0Q0T0      ------------------------------------------------MESRSSID--LD
A0A6P0W5I0      ------------------------------------------------MESRSSID--LD
A0A845XJ02      ------------------------------------------------MESRSSID--LD
A0A846D190      ------------------------------------------------MESRSSID--LD
A0A3C0NJ41      ------------------------------------------------MESRESLD--LD
A0A352AG88      ------------------------------------------------MDSAESLD--LD
A0A350Y374      ------------------------------------------------MQSTDSPD--LD
A0A355DPX0      ------------------------------------------------MQSTDSPD--LD
A0A0S3TYD7      -----------------------------------------MKQPQNPSQTPASDAIELD
A0A2T1DNG3      -------------------------------------------MTAAQPKLNLSAATDPG
A0A140K3H3      -------------------------------------MNNQLVNPNSLYLPTPETESAFS
K9XUB8          -------------------------------------MNNQLVNSNTLYLPTPETESTFS
A0A563VLD6      -------------------------------------MNNPINNPE--FVQLPSQETGFS
A0A7Y0NVW6      -------------------------------------MNHPIVNSD--FVQLPPQETSFS
U5QL42          --------------------------------------------MVNPQASLGPPSDNFN
A0A6H2NHD5      -----------MVFPKTSSPSPAQPSANGNGH------HHNGYLPAPPAPVVVEADDDFD
A0A2P8W4F7      -------------MPFPPSSTPRETNGHSNGHGNGHGSGRPEFVPMMAPPSLVEKGDDVD
A0A5Q4E0Z4      -------------MPFSSTPTSEETNGNGNGH------AKHSFVPVSAPSAIVDDSDDFD
A0A2P8VVX1      --------------------------------------------MVSTSTLPTSTDQEFG
A0A2P8WHY0      --------------------------------------------MTHAAYQPIPDEPEFG
A0A563VQJ3      -----------------------------MTNNGFNYYPPKELESNYYNLPKSRENLDLD
A0A7Y0IRJ7      -----------------------------MTNNGFNSYPKLESDTNPYNLSPSRERLDLD
A0A2T1CMT9      ---------------------------------------------MDQNNWETETQGDLG
A0A7G8J1V5      -----------------MSNLISNQGEKPLHSNPPSNQSSPTDNGTE--------ESGIK
A0A354B169      -------------------------------------------------MGAMGVAEEID
Q0IDT5          -----------------MSNLIARPGQSPDLVPQTIQDVQVRDLGLNLSNLKAEASDEID
A0A7G8FZD9      -----------------MTNLSAQP------NPQAVEGLLQVD-----------GSDEID
G4FMX5          -----------------MSNLSAQP------NPQAVDGLLQVD-----------GSDEID
A3ZA21          -----------------MSNLIPRAGHSPNLAVQGIQTVQVRDLGTSVAAGPAAADDEID
A0A076HBF2      -----------------MSNLVAAPGQSPDFDARNVQTVRVHEVGTN-EP-IG-TEDEID
A0A7G8FP50      -----------------MSNLVAAPGQSPDFEPRTIEAVRVRDLGSA-TV-DNLSDDDID
A0A7G8E8K7      -----------------MSNLVAAPGQSPDFDPRNVQTVHVREVGTN-EA-MG-ADDEID
A0A7G8GNR2      -----------------MSNLVAAPGQSPDFDPRKDQTVRVRNHGAT-EI-VK-TDDEID
A0A7G8ICD3      -----------------MSNLVAAPGQSPDFDPRNVQTVRVREIDTN-QP-IG-ADDEID
A0A2D6FCW3      -----------------MSNLIVNPXQTPDFNRHQAQTVNVQDLGRX-VVQAADNNDEID
A0A7G7KJ95      -----------------MSKLVASPGQSPDFNPQGIQTVQVRDLGQV-PPGMGSSDDEID
A0A7G8EAN3      -----------------MSNLVASPGQSPDFNPQGIQTVQVRDLGQV-PPGVSSGDDEIN
A0A1D8TX52      ---------------------------------------------MKELDLNAAAETDAG
A0A1D9G4T2      ---------------------------------------------MKELDLNAAGETDAG
A0A6P0PR27      ---------------------------------------------MKELDLNAAGETDAG
A0A6P0WER7      ---------------------------------------------MKELDLNAAGETDAG
A0A845XM36      ---------------------------------------------MKELDLNAAGETDAG
A0A846DAT1      ---------------------------------------------MKELDLNAAGETDAG
A0A846GZK8      ---------------------------------------------MKELDLNAAGETDAG
F4XP71          ---------------------------------------------MKELDLNAAGETDAG
A0A6P0KZ31      ---------------------------------------------MKELDLNAAGETDAG
A0A6P0LPB8      ---------------------------------------------MKELDLNAAGETDAG
A0A6L9YR57      ---------------------------------------------MKELDLNAAAETDAG
A0A845WMG9      ---------------------------------------------MKELDLNAAAETDAG
A0A6P0SEV1      ---------------------------------------------MKELDLNGAAETDAG
A0A6B3N2I8      ---------------------------------------------MKELDLNGAAETDAG
A0A6M0B891      ---------------------------------------------MKELDLNGAAETDAG
A0A6P0IJQ1      ---------------------------------------------MKELDLNGAAETDAG
A0A6P0J8J8      ---------------------------------------------MKELDLNGAAETDAG
A0A6P0ZSH6      ---------------------------------------------MKELDLNGAAETDAG
A0A845VS63      ---------------------------------------------MKELDLNGAAETDAG
A0A1U7N5X9      ---------------------------------------------MKELDLNAAAETDAG
A0A6L9Z1V0      ---------------------------------------------MKELDLNGAAETDAG
A0A6P0LC12      ---------------------------------------------MKELDLNAAAETDAG
A0A6P0MVJ3      ---------------------------------------------MKELDLNAAAETDAG
A0A2W6ZAV2      -------------MPDPLPSPDELLPPGTLVTLGASSGQVVLIPQEAETQPAPGGSEELK
K9W742          ---------------------------------------------MTQSNLNTVPDTDPG
A0A3D1PBA3      -----------------------------------------MARVNEHNLPI-NTETDGG
K9XPB0          -----------------------------------------MKQIEWE-----ENSSDLG
A0A350Y7Z1      --------------------------------------------MIQSNLP--GDETNLG
A0A352X2A7      --------------------------------------------MTQSNLP--ETESDFG
A0A0D8ZYV0      -----------------------------------------MVRGIENN-PNVANETEPG
A0A433VMS2      -----------------------------------------MVRVNESNMPMTVEESDGG
K9TYA7          -----------------------------------------MVRVNESNMPMTVEESDGG
A0A2P8QUE1      -----------------------------------------MVRVNESNMPMTVEESDGG
K9SA61          ----------------------------MALVPHTPGNFAPHRSPVTDPRWTDSGDSDGG
A0A2G7GMH8      ---------------------------------------------MNKDNFAMATEQEAG
A0A6N8FU92      ---------------------------------------------MNKENLAMNGEQETG
A0A2T1DWE8      ------------------------------------------MVVVTVGNLANTVETDPG
A0A832H7C4      ---------------------------------------------MGVGYQPQTIETEPG
A0A1U7I8L3      ---------------------------------------MVNVNTNNLNPAA---ETEAG
A0A2T1DJL8      -MPSVASQKASFSSRSIASFRRFVWHRSDELSFAKGVPIVAESHLNLIAAA----DPDPG
A0A1Z4J9W0      ---------------------------------------MAQSNITLFNASPHAQEPDPG
A0A0N7Z5K9      ---------------------------------------MAQGNITLFNPSPPAQEPDPG
A0A0S3TXC5      -------------------------------------MIVAQGNITLFNPSSPMQEPDPG
A0A846FBD3      ---------------------------------M----------------ASGTYPEDID
K1XF69          ---------------------------MVMDFSN----------------IEHRESIDLD
B5W297          -----------------------------MDFSN----------------IEHRESIDLD
H1W7M8          ---------------------------MVMDFSN----------------IEHRESIDLD
A0A5Q4H6A5      ---------------------------MVMDFSN----------------IEHRESIDLD
D5A466          -----------------------------MDFSN----------------IEHRESIDLD
B4WQE3          -------------------------------------MSSANPPVLRDIIQEPDQEGGLR
U5QJM6          ------------------------------------------------------------
A0A0V7ZFJ4      ------------------------MTHNSFDFNQ----------------EDDDF---ID
A0A235IXQ2      -----------------------------MLSDQ----------------NNQDL---IN
A0A367RIS1      -----------------------------MPSHQ----------------DDQDL---IN
A0A841V8H9      -----------------------------MPSHQ----------------DDQDL---IN
A0A5Q0GJJ5      -----------------------------MPSHQ----------------DDQDL---IN
Q3MEB7          -----------------------------MPSHQ----------------DDQDL---IN
A0A1Z4KHN9      -----------------------------MPSQQ----------------DDQDL---IN
Q8YT70          -----------------------------MPSQQ----------------DDQDL---IN
A0A7U3NLX2      -----------------------------MPYYQ----------------EDQDE---IN
A0A166IWU6      -----------------------------MPSYQ----------------EDQDE---ID
A0A2S0Q8C0      -----------------------------MPSYQ----------------EDQDE---ID
W6FSX4          -----------------------------MPSYQ----------------EDQDE---ID
A0A218Q4C1      -----------------------------MPSYQ----------------EDQDE---IN
A0A6P1ZT04      -----------------------------MPSYQ----------------EEQDE---IN
A0A0V7ZNJ9      ----------------------------MTSSPQ----------------VEREDTDYID
A0A5P8VSD1      -----------------------------MPSHQ----------------DEQDL---IN
A0A1S1ZVW2      -----------------------------MPINQ----------------ETTD-V--ID
A0A0R0M9H9      -----------------------------MAINQ----------------EETD-V--ID
A0A7H0F4U6      -----------------------------MPINQ----------------EETD-V--ID
A0A7W2A1T7      -----------------------------MPINK----------------KETD-V--ID
A0A838WI98      -----------------------------MPINK----------------KETD-V--ID
A0A853MJX6      -----------------------------MPINK----------------KETD-V--ID
A0A1B7WX82      -----------------------------MSINQ----------------EDQDSS--ID
A0A1B7WTD1      -----------------------------MSINQ----------------EDQD-S--ID
A0A480ABC0      -----------------------------MSINQ----------------EDQD-S--ID
A0A1Z4LRU5      -------------------------MTNEMQVNQ----------------EEQD-Y--ID
A0A1Z4JVB4      -----------------------------MPTKQ----------------EDRD-S--ID
K9PIA4          -----------------------------MPTKQ----------------EDRD-T--ID
A0A1Z4HVE1      -----------------------------MPTKQ----------------EERE-V--ID
A0A252ECZ1      -----------------------------MPTKR----------------DDRD-L--ID
A0A1Z4G5Y1      -----------------------------MPTKR----------------DDRD-L--ID
A0A252DNA2      -----------------------------MPTKR----------------DDRD-L--ID
A0A252E1Q4      -----------------------------MPTKR----------------DDRD-L--ID
A0A6G9SK36      -----------------------------MPTKQ----------------EERD-V--ID
A0A1Z4M597      -----------------------------MPTKQ----------------EERE-V--ID
A0A1Z4MWT1      -----------------------------MPTKQ----------------EERE-V--ID
A0A1Z4TX53      -----------------------------MPTKQ----------------EERE-V--ID
A0A2A2TNQ5      -----------------------------MPSHE----------------EDTDY---IN
A0A3S1C4K5      -----------------------------MPSNQ----------------EDQNE---VD
A0A1X4G3D5      -----------------------------MPINQ----------------VNQEESDVID
D4TNI2          -----------------------------MPINQ----------------VNQEESDVID
A0A1Z4H6Z8      MNVIGAIILFVGTEGSDSPNYIWYFGTLFMPTKQ----------------DDRDL---ID
A0A3F3KPR9      ------------MLIFCVMVEPVIATGVYMPINK----------------KETDV---ID
A0A1Z4NPM1      -----------------------------MASEY----------------EEQDY---ID
A0A1Z4UZW9      -----------------------------MSINQ----------------EDQDSS--ID
A0A1B7VSH4      -----------------------------MSINQ----------------ETQDSS--VD
A0A1B7W126      -----------------------------MSINQ----------------ETQDSS--VD
A0A3D4C6Q6      -----------------------------MSINQ----------------ETQDSS--VD
A0A0K2M5H0      -----------------------------MSINQ----------------EDQDSP--ID
A0A844I4P0      -----------------------------MSINQ----------------EDQDSP--ID
A0A1B7UVJ4      -----------------------------MSINQ----------------EDQDSS--ID
A0A1B7UTR1      -----------------------------MSINQ----------------EDQDSS--LD
K7W0A4          -----------------------------MSINQ----------------EDQDSS--FD
A0A5C0DRW9      -----------------------------MSINQ----------------EDQDSS--FD
A0A6H2C088      -----------------------------MSINQ----------------EDQDSS--LD
A0A1Z4RPC6      -----------------------MTNLQTTNSLS----------------SNHREELDIN
A0A2T1CMZ0      -----------------------MTNLQRNNVYN----------------PNRRAEFDIN
L8M4F7          -----------------------MFKIPNNNSAYSSQTEGEANAS-----INSRDSIDLD
A0A140K2P2      ------------------------------MTNNYPANNSNNYNYPSETLSASREAIDVN
K9XWX4          ------------------------------MTNNYPANNSNNYNYPSEVSSASREAIDVN
A0A140KB14      -----------------------MSNFTGMSNGQTPENLSLNNSY-----TASRESIDVN
K9XX88          -----------------------MSNFTGMSNGQTPENLSLNNSY-----TASRENIDVN
L8LZE9          ---------------------------MYPVNNSSSNGSYTQGNY-----PESKEKFEVE
A0A563VSV6      -----------------------MVNSLTNNGGSQPDNSYPNYGL-----EESRESTDIE
A0A7Y0IQB0      -----------------------MTNFKTSNSGSSQDNLYNNSNF-----GEVAESTDIE
A0A433NM31      ---------------------------------M----------------QSNKQEEYID
A0A1Z4NDS1      ------------------------------MDSV----------------TSTTNVEEID
U9VXM0          ------------------------------MASQ----------------ENSVKEVEID
A0A6M0RI13      ------------------------------MASQ----------------DNSVKEIEID
A0A6M0S1N5      ------------------------------MASQ----------------DNSVKEIEID
K9F4D9          ------------------------------MASQ----------------DNSVKEIEID
A0A6I5QPI5      -----------------------MVAQQANGETR----------------TYTEYIEELD
A0A1Z3HMQ0      ------------------------------MDGK----------------TYQDYVEEID
A0A433W533      ----------------------------MQERLI----------------ETSENL-DLD
A0A2P8QWJ3      ----------------------------MQERLI----------------ETSENL-DLD
K9U6L7          ----------------------------MQEQLI----------------ETSENL-DLD
U5DPF5          ----------------------------MEAIDR----------------NLRQDDDFLD
A0A1E5QP61      ---------------------------------M----------------DSTDYTEGID
A0A846DWC7      ---------------------------------M----------------DSTDYTEGID
A0A845Y5J4      ---------------------------------M----------------ESQQQVEDID
A0A6P0X488      ---------------------------------M----------------ESQQHIEDID
A0A6P0VDM0      ---------------------------------M----------------ESQQHIQDID
A0A6P0UVD5      ---------------------------------M----------------ESQQHIQDID
A0A846BFF2      ---------------------------------M----------------ESQQHIQDID
A0A6M0G142      ---------------------------------M----------------ESQQHVEDID
A0A6P0MR53      ---------------------------------M----------------ESQQHVEDID
A0A3M2GIL5      ---------------------------------M----------------ENQIYTEDID
A0A6H1TSJ9      ---------------------------------M----------------ENQIYTEDID
A0A3M1PML8      -------------------------------MSL----------------VSQDYSEEID
A0A6M8BE85      -------------------------------MSL----------------ASQDYYEEID
A0A0T7BPZ0      ---------------------------------M----------------SNPEHIEEID
A0A352X442      ---------------------------------M----------------ESTEYIEEID
A0A6B3NF44      ---------------------------------M----------------EALEYSEEID
A0A6M0EPL4      ---------------------------------M----------------EALEYSEEID
A0A6P0K6L6      ---------------------------------M----------------EALEYSEEID
A0A6P0MRR9      ---------------------------------M----------------ESVGFSEELD
A0A6P0X1X4      ---------------------------------M----------------ESVGFSEELD
A0A6P0UX57      ---------------------------------M----------------ESVGFSEELD
A0A846B9S8      ---------------------------------M----------------ESVGFSEELD
A0A0M0SHU3      -------------------------------MKE----------------SEFKEVEEID
A0A1D2PBN3      ---------------------------------M----------------ESKPNFEEID
A0A0C2LVR7      ---------------------------------M----------------ESKPNFEEID
A0A1Z4PQB9      ---------------------------------M----------------ESKPNFEEID
A0A1Z4SFN6      ---------------------------------M----------------ESKQNLEEVD
K9PGI8          ---------------------------------M----------------ESIPKFEEID
A0A654SFI6      --------------------------------MQPSIADRGNYPDTPADYREDGLHIDLA
K9SSQ0          ----------------------------------------------MKVYSSKVFSPLLS
A0A2W1JIN9      --------------------------------------------------MDQSLSRLPL
A0A318AJV1      -----------------------------MLKQTSDHRVSHLAPPQDQARLGDAVAAAKR
A0A845WDS5      --------------------------------------------------METSLSSLVS
A0A6P0IC70      --------------------------------------------------METSLSSLVS
A0A845VVD9      --------------------------------------------------METSLSSLVS
A0A6B3MUB5      --------------------------------------------------METSLSSLVS
A0A6M0B7N4      --------------------------------------------------METSLSSLVS
A0A6P0J9W3      --------------------------------------------------METSLSSLVS
A0A6P0ZWE1      --------------------------------------------------METSLSSLVS
A0A1U7N2U4      --------------------------------------------------METSLSSLPL
A0A6L9YZL1      --------------------------------------------------MDTSLSSLPL
A0A6P0KYM4      --------------------------------------------------MDTSLSSLPL
A0A6P0LSD6      --------------------------------------------------MDTSLSSLPL
A0A6P0PNZ7      --------------------------------------------------MDTSLSSLPL
F4XV38          --------------------------------------------------MDTSLSSLPL
A0A6P0W137      --------------------------------------------------MDTSLSSLPL
A0A845XHF7      --------------------------------------------------MDTSLSSLPL
A0A845ZEG9      --------------------------------------------------MDTSLSSLPL
A0A1D9G1F2      --------------------------------------------------MDTSLSSLPL
A0A846CJ58      --------------------------------------------------MDTSLSSLPL
A0A6L9Y9E2      --------------------------------------------------MDTSLSSLPL
A0A6P0SGR0      --------------------------------------------------MDTSLSSLPL
A0A6M0BK48      --------------------------------------------------MDTSLSSLPL
A0A845WG36      --------------------------------------------------MDTSLSSLPL
A0A6P0X384      --------------------------------------------------MEKSFSSLPS
A0A2P8QIL5      --------------------------------------------------MEQKYALLPT
A0A433W447      --------------------------------------------------MEQKYALLPT
K9U1K8          --------------------------------------------------MEQKYALLPT
A0A1Q4RZJ6      --------------------------------------------------MEKGFWSVLS
A0A1Z4SNV3      --------------------------------------------------MEKGFWSVLA
A0A2H2XJQ1      --------------------------------------------------MEKGFWSVLA
A0A3S5K358      --------------------------------------------------MEKGFWSVLS
A0A0T7BPJ4      --------------------------------------------------MAKGISSLVA
A0A0C1QS61      --------------------------------------------------MEKSVSSVLG
A0A139X3R8      --------------------------------------------------MEKSVSSVLS
A0A844MZP8      --------------------------------------------------MEKSVSSLLG
A0A1Z4I7C5      --------------------------------------------------MGKGISTLLA
A0A844MST0      --------------------------------------------------MEKNLTYLIA
A0A0C2MDK7      --------------------------------------------------MEKGISSVLA
A0A856MDH8      --------------------------------------------------MEKGISSVLA
A0A1Y0RCK1      --------------------------------------------------MEKRISNVLA
A0A1Z4PWZ0      --------------------------------------------------MEKGISSVIG
A0A0C2QLT0      --------------------------------------------------MEKGISSVIG
A0A1Z4J2K1      --------------------------------------------------MEKGISSVIA
A0A3S0ZSX0      --------------------------------------------------MEKGFSSLLL
A0A2N6K4T3      --------------------------------------------------MEKGLSSLPS
A0A370CKT2      --------------------------------------------------MEKGLSSLPS
A0A0S3TL97      --------------------------------------------------MEKGLSSLPS
A0A2N6M8A0      --------------------------------------------------MEKGLSSLPS
A0A2N6M9E1      --------------------------------------------------MEKGLSSLPS
A0A2N6KJI4      --------------------------------------------------MEKGLSSLPS
A0A2N6MZ77      --------------------------------------------------MEKGLSSLPS
A0A2N6KT20      --------------------------------------------------MEKGLSSLPS
G6FSN3          --------------------------------------------------MEKGLSSLPS
A0A4D9CI02      --------------------------------------------------MEKGLSSLPF
A0A328I8B9      ------------------------------------------------------------
A0A4Q9J4Z7      --------------------------------------------------MEKGLSSLPF
A0A0M0SU69      --------------------------------------------------MEKGLSSLPF
A0A1Z4TIZ8      --------------------------------------------------MEKGLSSLLF
K9UYB2          --------------------------------------------------MEKSISSVFT
A0A1Q4S1H4      --------------------------------------------------MEKGVSSLWT
A0A433VBU6      --------------------------------------------------MEKGVSSLWA
A0A218QN17      --------------------------------------------------MEKGISSLLA
A0A846HD20      --------------------------------------------------MEKGISSLLA
K9RKN2          --------------------------------------------------MEKGISSLLT
A0A2I8ADV2      --------------------------------------------------MGRGISTLFA
A0A5Q0GMF5      --------------------------------------------------MGKGISTLLG
Q3MEW0          --------------------------------------------------MGKGISTLLG
A0A1Z4KIC7      --------------------------------------------------MGKGISTLLG
Q8YSM5          --------------------------------------------------MGKGISTLLG
                                                                            

K9SLA9          LNRGWVALRQH---KFPALVAFGIIFGGAALVT----V--RIQ---PIYEAKGQVLIEST
A0A168TT23      LLEIWRTILKRKWVVVSILAVFIATAALSSWLT----I--------PVYRATAVVQINHE
A0A0M1JWX9      LGQLFAVIRRR---AFVILGVAIAVTGAVWVWT----D--NQT---PQYEGKFQLLVEPV
A0A844MWN9      MNRVLAITGRH---WKPLLFLNALLLASAVAYV----H--YSE---KVWTATTQLILPDP
A0A2T1M1V6      MNHALSVVRRH---WPPLLALNLLLIAATVYVITNIEK--FVS---PTWKANAQLNIPIK
A0A2G7GCS2      MNHIVNIIRRH---WMPLLLLNGVILAGTLYAVIYTKT--NVA---PVWKASAKLNLPQP
K9XBH8          MNHIVNIIRRH---WMPLLLLNGVVLAATLYAVIYSKT--SVP---PVWKANAELNLPQS
A0A1Z4LJ30      MNRIAKIAIRH---WKLLLAWNILILGITAINI----K--VAP---RVWSSQAQLILPNV
Q7NF11          -MHVIQVLKRH---WRPLLVLNGLVLAATIGVA----C--YYP---RTWTATTRIILPST
K9RI76          MSRIATIAIRH---WKLLLAWNILLIGITAINI----K--LTP---RVWEGKAQLILPNV
A0A433VN22      ----MTIAARH---WKSLLVLNALVVSATIAAY----S--TSK---PVWTTTAQLILPKT
A0A139WSU3      MNKLVTISTKH---WKSLIAFNVLVVLATAVAV----S--NAK---PVWIAKTQLILPKT
A0A844MJB7      MNKLFTISTKH---WKSLIAFNFLVVLGTAAAV----S--TAK---PVWTSRTQLILPKT
A0A352AE27      LARIATITARH---WKFLLALNVLVLAAAASNY----V--TSP---KVWTAKAQLILPDT
A0A3B8JH60      MGKIAAIASRH---WKSLLVLNLLVLAATAGKL----A--TSP---KVWTANAQLILPNT
A0A3C0N766      MGKIAAIASRH---WKSLLVLNLLVLAATAGKL----A--TSP---KVWTANAQLILPNT
K9W9J7          MGKVAAIATRH---WKSLFILNLLVIAATAGKL----A--TSP---KVWTATAQLILPQK
Q7NJN6          MSSIVAIGRRH---WRPLLALNTVLLAATVGIA----V--FYP---RTWTASAQLILPNA
U5QCC3          -MSTLAIARRH---LRPLLILNGAILTTAIGIA----L--FFP---KSWTATTQLILPDT
A0A1Z4JCS8      MKKIALIASRH---WKALLGLNAVVIFGTLGAM----L--TTP---KVWTAQAQLILPSS
A0A846GVZ3      MKKVVAILNRH---WILLLVFNSLVLAASFGAF----S--LLK---PFWIAKAQLILPET
A0A6P0PI80      MKKVVAILNRH---WILLLVFNSLVLAASFGAF----S--LLK---PFWIAKAQLILPET
A0A6P0WGT6      MKKVVAILNRH---WILLLVFNSLVLAASFGAF----S--LLK---PFWIAKAQLILPET
F4XTX2          MKKVVAILNRH---WILLLVFNSLVLAASFGAF----S--LLK---PFWIAKAQLILPET
A0A3S0Y9N9      YLQYWLIFKRR---WLPVSIVFFTVVALSIVKT----L--LET---PIYQATAQLVLKKN
A0A6P0ZKB8      YLRYLSIIKRR---WLPTSIVFLTLVGLSIVKT----Y--LET---PIYQAGGQLVLKKN
A0A846EDH6      YLRYLSIIKRR---WLPTSIVFLTLVGLSIVKT----Y--LET---PIYQAGGQLVLKKN
A0A433UNK7      YLRYWSILKRR---WLPTSIVFLSLLALSIVKT----V--LET---PIYQAGGQLVLKKN
B8HNB0          KVELLRTLKKR---WIPALATAVTVFAGCYIYS----A--LQT---PLYRSEALILTGKE
A0A318BJ18      LRHYLRIAMRW---RWVILGVTIACVLLGLVVT----L--LMT---PTYTATATVEIARE
A0A3B8Y8H9      VSQIVPWLRRR---FWLIGSISLAVSLSAVSYA----F--TRA---PVYEESFQILVDTP
A0A2W1JVB9      LGKYWLILKRR---WLPATIIFLLMFSTATLAA----F--LKA---PIYQSQGTLRIKES
A0A6H1U102      LSEVLRILRKR---AGSAAAIATAVFAGVGLST----A--TKT---PEYQSETLILLDNE
A0A7C3ZEJ3      LSDVGRTLRKR---WPSAAAVATAVFAGVSFST----V--TQT---PDYQSETLILLDKK
A0A2P8W9H0      LDRFVAALRRH---LLLIAGITTLTASAAVLKA----I--TDA---PTYQSSFDILTPSS
A0A6I5P386      IDYLLSSLKRH---FLLITGVTVLTTALAVTKA----V--TDE---PVYQAEFELLTPSV
A0A3M1SVZ4      LDRAFPIVKRR---WLPASVVFAAIFTVFYIAA----Q--KDR---PVYIAEGEILIEKV
A0A318BG22      LQRYVATLTKH---RLLILGTTIAAALLALIVT----M--LTE---PRYVARTTFEVQRE
A0A2T1E9V8      FYNYWCIFKRH---WLPALAIFSTITGGSYLYT----S--AKT---PIYSAQGQILFKQD
A0A1Z4LN32      VQKYLLVLKRR---WLIASVVFAGFASFGVLHW----V--SQK---PAYQATGKLLFRTD
A0A2I8A9F5      IQKYLLVLKRR---WLVIAGVFVLFATLGGTLA----L--KQP---KSYEATGKLLFQMN
A0A218Q6R8      IQKYWLVLKRR---WLIIAAVSTACAALGGVNF----F--IQP---TTYQASGKLLFQLN
A0A218QGE0      VQKYLLVLKRR---WLIASGVFAVFATLGGINF----V--IQP---PVYEASGKLLFQSN
A0A846HDH5      VQKYLLVLKRR---WLIASGVFAVFATLGGINF----V--MQP---PVYEGSGKLLFQSN
A0A3M2GQQ6      FVELGRTLVKR---WSIIAIVMTSVFATVAVST----L--RTT---PQYRSETLILVDDR
A0A6H1U2X0      FVELGRTLVKR---WSIIAIVMTSVFATVAVST----L--RTT---PQYRSETLILVDDR
K9TLQ0          LRHLLSVARRR---IFVFAGVSIAVACGVLVKV----L--TQT---PIYEGNFRLLVEPI
K9QF04          LHQLGAIARRR---LVVFIAVSGVIIAGVICKQ----W--LQK---PIYKQQFQLMLDSA
K9W1T3          FTQYWFIFKRR---WLPASLVFTLVLGVTALVT----F--QQK---PIYQAQGQILIKKN
K9SGJ5          LSRFLRTLRKR---WLVVASISATLFATVAAYT----Y--IKE---PVYQSETSLLIDDA
A0A6N2JS94      LAKFFRVLRKR---WIVIVAVSVTVFAGNTYYT----F--TRT---PQYRSSASLLV-NS
A0A6C2DSN4      LAKFLRVLRKR---WIVIVAVSVTVFAGNTYYT----I--TRI---PQYRSSASLLINNS
L8MYT6          LAKFLRVLRKR---WIVIVAVSVTVFAGNTYYT----I--TRI---PQYRSSASLLINNS
A0A352JGJ6      LAKFFRVLRKR---WIVIVAVSASVFVGNAYYT----F--TRT---PQYRSSASLLINNS
A0A1J5GLS2      LAKFFRILRKR---WIVIVAVSASVFAGTTYYT----F--TRV---PQYKAGAALLINNS
A0A2W4W6M5      LAKFFRVLRKR---WIVVAAVSVTVFAGNAYYT----F--SRT---PQYRSNASLLINNS
A0A2W7AN33      FAKVLRVFRDR---WTVIATVSVTMLAGSALYT----F--TRT---PQYRSIASLLI-NS
A0A256BLV2      LAKFFRVLRKR---WIVIVAVSVSVFAGNTYYT----F--TRT---PQYRSSASLLV-NS
A0A2W6ZXF3      LAKFFRVLRKR---WIVIVAVSASVFAGTTYYT----F--TRT---PQYKAGAALLINNS
A0A2Z5WX66      LAKFFRVLRKR---WMVIVAVSVTVFAGNTYYT----F--TRT---PQYRSNASLLINNS
Q7NEU3          WQTYARTIWRR---RYAFIGVFVATFSLAAAYT----F--LSN---PVYEGEMLLLLE--
A0A3C0N2P0      LRRLLAVARRR---IILVAGVAIAVTSGVAAKV----L--RQV---PIYEGSFQLLVGPV
A0A6P0JR04      LRQALSALRRR---WLLMLLVSVAVTAGVSFRV----F--NEV---PVYRSQFRLLVEPI
A0A6B3M6M6      LSRIISLVRRR---VLVIAGVAIAISSGIIAKT----L--GKT---PQYQGKFQLLVEPV
A0A6P0KD09      LSQILSLVRRR---MVVIAGVAIAISSGIIAKT----L--GKT---PQYQGKFQLLVEPV
A0A6B3NIJ0      LSQILSLVRRR---MVVIAGVAIAISSGIIAKT----L--GKT---PQYQGKFQLLVEPV
A0A6M0F053      LSQILSLVRRR---MVVIAGVAIAISSGIIAKT----L--GKT---PQYQGKFQLLVEPV
A0A6P2ATU9      FRLALSMLRRR---WWILLLVGTAVTSVMGMRV----L--QED---PLYRSQFRLLVEPI
A0A845XAM4      LQLVLSVLQRR---WWILLLVSSVISTVMGIRV----F--QED---PLYRSSFRLLVEPI
A0A352XE00      MRQIIAIARRR---FILTAGVAVAVTSGVATRV----L--QQV---PKYEGKFQLLIGPV
A0A6P0QC14      LRKILAVARRR---LIIIAGVAIAVSSGIASKV----L--KQV---PNYEGKFQLLVGPV
B4VS56          LRQILAVARRR---ALVVAGMAIAVTSGIVTKV----L--QQT---PNYEGKFQLLVGSV
A0A352AAQ3      LGQILGVVRRR---FIVIAGVAIAVTSGIVARV----L--KQT---PNYEGKFQLLVGSV
A0A350Y472      LRQILAVAQRR---AIIIAGVAIAVSGGIVSQV----L--KQE---PNYEGKFQLLVGSP
A0A355DVB4      LRQILAVAQRR---AIIIAGVAIAVSGGIVSQV----L--KQE---PNYEGKFQLLVGSP
A0A1Z4RMB9      FNEYLLKVKRR---WKPALGVFLLTLGVTGALS----L--LQT---KTYQAEGKILFKQT
A0A318B4H2      LERYWRAMLNR---RLLILAVLLASMTVGVIVY----L--MAT---PQYLATARIEIQRS
A0A2K3BR24      LQQYWMALKRR---SLSAIIVFASTIGIAAAYS----F--QQE---PIYQAKAKLLFQGE
K9YXY1          LQQYWMALKRR---SLSAIIVFASTIGITAAYS----F--QQE---PIYQAKAKLLFQGE
A0A1Q4RTR1      FRQAWRILKRR---WLAVTIVISSAIGVTGAIT----F--SQT---PIYEAEGKLTFNKA
A0A1Z4SQV2      FRQAWRIMKRR---WLAVTVVLSSVVGITGAVT----F--SQT---PIYEAEGKLLFNRA
A0A2H2XGN1      FRQAWRIMKRR---WLAVTVVLSSVVGITGAVT----F--SQT---PIYEAEGKLLFNRA
A0A433UXH8      FRQAWRIMKRR---WLAVTIVLSSVVGITGAVT----F--SQT---PIYEAEGKLLFNKA
A0A1U7HGH0      LHKYWYILKRR---WLPAVAAFGTVMGITYLHT----L--SRV---PIYQAQGELLFRQD
K9XJD3          LHKYWCILKRR---WLPAVAAFGTVMGITYLHT----L--SRV---PIYQAQGELLFRQD
K9SX01          LFELLSIVRRY---WFLEISIFSLVFGVSAFLT----F--QEK---PIYQATGSLLFKSQ
A0A4P7ZT55      LKEIWMALRRRRRWFLAGFGVTLAITGVLTLGQ----R--LFR---PTYEGSFTLLVSDP
A0A1E5QIR9      LKQYGLVFKRR---FFPAAIVFCAAIGATAAIT----F--LQK---PTYQAQGELLFKKN
A0A6P1A9A0      PSKIFGVLRRR---WWLIGIVTISVSAVVGVRV----F--QEE---PIYQSRFQVLVGQL
A0A1Z4IBC7      IHKYIEVLQRR---WLAVVGVFGLSLALGCLYA----F--SLK---PSYKADGSLMIMTN
A0A5Q0GKD1      IHKYVEVLQRR---WLAVVGIFGLSLTLGCVYA----F--SQK---PSYKAEGSVMIKTN
Q3MDC6          IHKYVEVLQRR---WLAVVGIFGLSLTLGCVYA----F--SQK---PSYKAEGSVMIKTN
A0A1Z4KM73      IHKYVEVLQRR---WLAVVGIFGLSLTLGCVYA----F--SQK---PSYKAEGSVMIKTN
Q8YNX7          IHKYVEVLQRR---WLAVVGIFGLSLTLGCVYA----F--SQK---PSYKAEGSVMIKTN
A0A367R4K6      IQKYLEVLQRR---WLTVIGIFSIAVTLGCLYA----F--SLK---PSYKAEGSLMIKTN
A0A1E2WSV8      IQKYLEVIQRR---WLPLVGIFSIAVTLGCLYA----F--SLK---PSYKAEGSLMIKTN
A0A7D7L9Y1      IQKYLEVIQRR---WLPLVGIFSIAVTFGCLYA----F--SLK---PSYKAEGSLMIKTN
A0A2R5FRT9      IQKYLEVIQRR---WLPLVGIFGITVTLGCLYA----F--SLK---PSYKAEGSLMIKTN
A0A2K8T1B6      IQKYLEVIQRR---WLPLVGIFGISVTLGCLYA----F--SLK---PSYKAEGSLMIKTN
A0A235I9I0      IQKYLEVFQRR---WLPLVGIFAISVSLGCLYA----F--SLK---PSYKAEGSLMIKTN
A0A2D0HQT8      IQKYLEVFQRR---WLPLVGIFAISVSLGCLYA----F--SLK---PSYKAEGSLMIKTN
A0A2L2NU95      IQKYLEVIQRR---WLPLVGIFAISVTLGCLYA----F--SLK---PSYKAEGSLMIKTN
A0A367S084      IQKYLEVFQRR---WLPLVGIFAISVSLGCLYA----F--SLK---PSYKAEGSLMIKTN
A0A1Z4SMD6      VQNYWLVLKRR---WLIAAGVLLTFVGLSGVAI----Y--MQK---PEYEASGMLLFQSN
A0A2H2Y096      VQNYWLVLKRR---WLIAAGVLLTFVGLSGVAI----Y--MQK---PEYEASGMLLFQSN
K9S8M8          FQKYWLILKRH---WLPATGAFLLAVCGAAAMA----F--TAE---PIYEAQGKLLLKKK
A0A1Z4NFV0      VHRYWLVLKRR---WLVVVGILAASTALSGFVL----S--TQR---PQFEAIGQLLFQSN
A0A3M9ZEU1      LQKYWLVLKRR---WLPATGVFGTVVALSTLAA----V--MQK---PTYTATASLLVKAD
A0A1Z4JK72      LQNYWLILKRR---WLTAATVLAATVGLVGLAT----S--MQR---PSFEANGRLLVQSN
A0A0N7Z489      LQSYWLVLKRR---WLVAAGVFAATVGVAGLAT----S--LQR---PNYEANGRALVQSN
A0A0S3TXS2      LQSYWLVLKRR---WLVAAGVFAATVGLAGLAT----S--LQR---PNYEATGRVLVQSN
A0A2A2TPF8      LQNYWLVLKRR---WLIASGIFLTSVALSGFVI----S--LQR---ANYEAKGKLLFQAN
A0A1Z4R0P8      LQNYWLVLKRR---WPIALGIFLTSVALSGFAI----S--LQK---ANYEAEGKILFQAN
A0A0T7BUI3      IQQYFLVLQRR---WKILLALIITSVGFSGFAI----L--RQK---PQYQATGMLLFKSD
A0A1Z4LP32      IQQYWLIIKRR---WLFIVAAMLGSIGLSWFVI----L--QQK---PQYQANGLLLFKSD
K9REP9          IQQYWLIVKRR---WLFLVAAMLGSIGLSWLLI----L--RQK---PEYQATGLLLFKSD
A0A1Z4SIJ3      IQKYWLVLKRR---WLFVAVTVAASVGVAGIFI----V--RQH---PEYRANGMLLFKSD
A0A2H2XPG4      IQKYWLVLKRR---WLFVAVTVAASVGVAGIFI----V--RQH---PEYRANGMLLFKSD
A0A2A2TC28      IQQYWLVLKRR---WLIAATVFCASVGLSGLVV----L--RQK---PQYEASGMLLFKSD
K9V3C7          LKNYWLVLKRR---WLIAAGIFLTSVAMSGFVI----S--LQK---ATYEASGKLLFQTN
A0A1Z4T6Y7      IRNYWLALKRR---WLVASGIFITTVALSGFAI----S--LQR---PTYQASGKLLFQTN
A0A2H2Y561      IRNYWLALKRR---WLVASGIFITTVALSGFAI----S--LQR---PTYQASGKLLFQTN
A0A1Q4S362      IRSYWLVLKRR---WLVASGILFTSIALSGFAI----S--LQR---PTYQASGKLLFQAN
A0A3S1CIN8      IRSYWLVLKRR---WLIASGILFTSIALSGFAI----S--LQR---PTYQASGKLLFQAN
A0A0C1NCB0      IQKYLLVIQRR---WHIVAGVMLVSMVLSGLGI----Y--LQK---PKYQATGILLIQSD
A0A844MLU2      IQKYLLVLKRR---WHIIAGVSLVSVCLAGMAA----T--LQK---PKYQATGILLIQSD
A0A2N6K7Q9      IQQYLLILKRR---WRLIAAIILASIGLSGSAL----F--MQK---PEYQADGILLFKSD
A0A2N6MXH6      IQQYLLILKRR---WRLITAIILASIGLSGSAL----F--MQK---PEYQADGILLFKSD
A0A2N6M5A8      IQQYLLILKRR---WRLITAIILASIGLSGSAL----F--MQK---PEYQADGILLFKSD
A0A2N6LL61      IQQYLLILQRR---WRLITTIILASIGLSGSAL----F--MQK---PEYQADGILLFKSD
A0A0S3TP66      IQQYLLILKRR---WRLITAIILASIGLSGSAL----F--MQK---PEYQADGILLFKSD
G6FP91          IQQYLLILKRR---WRLITTIILASIGLSGSAL----F--MQK---PEYQADGILLFKSD
A0A1U7GYR5      IQQYLLILKRR---WRLITAIILASIGLSGSAL----F--MQK---PEYQADGILLFKSD
A0A2N6KY52      IQQYLLILKRR---WRLITAIILASIGLSGSAL----F--MQK---PEYQADGILLFKSD
A0A2N6KMP5      IQQYLLILKRR---WQLITTIIVASIGLSGSVL----F--MQK---PEYQADGILLFKSD
A0A2N6MA45      IQQYLLILQRR---WRLITTIIVASIGLSGSAL----F--MQK---PEYQADGILLFKSD
A0A4Q9J9V9      IQQYILVLKRR---WQLIASIIIASIGLSGLAL----F--MQK---PEYQADGILLFKSD
A0A328IGA1      IQQYILVLKRR---WQLIASIILASIGLSGLAL----F--MQK---PEYQADGILLFKSD
A0A4D9CE41      IQQYILVLKRR---WQLIASIILASIGLSGLAL----F--MQK---PEYQADGILLFKSD
A0A0M0SFT2      IQQYILVLKRR---WRLIASIVLAAIGLSGLAL----F--MQK---PEYQADGILLFKSD
A0A1Z4TLC8      IQQYILVLKRR---WRLIASIIIASIGLSGLAL----F--MQK---PEYQADGILLFKSD
A0A1Z4IYV4      IQKYWLVLKRR---WPIVAGVVLASVGLSSFAV----F--LQK---PKYQASGMLLFQSD
A0A1Z4Q0T6      IQKYWLVLKRR---WPIVAGVVLASIGLTTFAV----F--LQK---PEYQATGMLLFKSD
A0A0C2PT44      IQKYWLVLKRR---WPIVAGSVLTSIGLTTFAV----F--LQK---PEYQATGMLLFKSD
A0A1D2P6J4      IQKYWLVLKRR---WPIVAGVVLASVGLSSFAV----F--LQK---PEYQATGMLLFKSD
A0A0C2LFH0      IQKYWLVLKRR---WPIVVGVLLASIGFSSFLI----F--LQK---PEYQASGMLLFKSD
A0A856M734      IQKYWLVLKRR---WPIVVGVLLASIGFSSFLI----F--LQK---PEYQASGMLLFKSD
B4WP72          LQKYWCVLRRR---WRLATFVFSSSICLTVLAL----A--SQE---AEYEATGKLLIKGG
A0A2T1CIL7      FQKYWLVLKRR---WLPATMIFTGVTGIFVLSA----L--SKP---PTYMAEAQLLIRID
A0A433V7A0      FQKGWLTIKRH---WKPALGIFGVVFIITGIGV----L--MKS---PSYTAYGKLLFRVD
A0A2T1FTR8      IAQYWLVLKRR---WMPAALVFALTTAVATVWT----F--KQQ---EIFQAKGQVILKKT
K9UA41          IAQYWLVLKRR---WMPAALVFALTTAVATVWT----F--KQQ---EIFQAKGQVILKKT
A0A563VS48      FQKYWLVLKRR---WLPATLTLCGVLGISLGYA----L--SQE---QIYEAEAKVLIKSN
A0A7Y0NUK1      FQKYWLVIKRR---WLPATATLVGVLTLSLIYA----F--SVK---PIYQGEAKLLIQTD
A0A0C2LBE2      FQKYWLILQRR---WLPAVGVCGVVVSLASLLA----F--SSK---PTFKAEGSLLIKTN
A0A433NN38      FQKYWLVLQRR---WLPAVGIFGTVLTLASVYA----F--SLK---PYYQAQASLLIKTN
A0A2N6K0T2      FQKYLLVLQRR---WMTAVGVFGVIVSLALLYA----L--STK---PTYTAQASLLIKTN
A0A2N6ML72      FQKYLLVLQRR---WMTAVGVFGVIVTLALLHA----L--STK---PTYTAQASLLIKTS
G6FQZ6          FQKYLLVLQRR---WMTAVGVFGVVFTLALLYA----L--SIK---PTYTAQASLLIKTS
A0A2N6MQX9      FQKYLLVLQRR---WMTAVGVFGVVFTLALLHA----L--STK---PTYTAQASLLIKTS
A0A2N6KXT6      FQKYLLVLQRR---WMTAVGVFGVVFTLALLYA----L--STK---PTYTAQASLLIKTS
A0A2N6KGB9      FQKYLLVLQRR---WMTAVGVFGVVFTLALLYA----L--STK---PTYTAQASLLIKTS
A0A2N6L3Y5      FQKYLLVLQRR---WMTAVGVFGVVFTLALLYA----L--STK---PTYTAQASLLIKTS
A0A0S3TIS7      FQKYLLVLQRR---WMTAVGVFGVVFTLALLYA----L--STK---PTYTAQASLLIKTS
A0A1U7GW28      FQKYLLVLQRR---WMTAVGVFGVVFTLALLYA----L--STK---PTYTAQASLLIKTS
A0A2N6LW63      FQKYLLVLQRR---WMTAVGVFGVVFTLALLYA----L--STK---PTYTAQASLLIKTS
A0A328IH74      FQKYLLVLQRR---WLTAVGICGVVLSLALLYA----F--SLK---PTYTAQASLLIKTN
A0A4D9CIB0      FQKYLLVLQRR---WMTAVGICGVVLSLALLYA----F--SLK---PTYTAQASLLIKTN
A0A1Z4TQ63      VQKYLLVLQRR---WMTAVGVFGAVVTLALLYA----F--SLK---PTYTAQASLLIKTN
A0A4Q9J8G2      VQKYLLVLQRR---WMTAVGVFGVVLTLALLYA----L--SSK---PTYTAQASLLIKTN
A0A350Y0P6      FQKYWLILRRR---WLPSTVVFGFIFTLATTVA----F--VKK---PSYSAYGKLLLQKR
A0A352X940      FQKYWLILKRR---WLPATMVFLLSIGVAVGVA----Y--TRQ---PIYEAGGKLLLQKK
B8HTN4          LGKYLTILKRR---WLGGAIAFGSILSLVIAYT----L--LQK---PVYQAQGLLLLKDS
A0A6P1AFJ5      LRQLLTVARRR---RWLILGTSLLVGSGVAVRN----L--DRE---QVYAGKFRLLVEPV
B0CAX4          VRNYFRILRRR---WIPATAVFGSVFVLTALAT----F--LQK---PVYEAEGKLLLKKQ
A0A1Z4RN12      FNKYWQVLKRR---WLPATATFTGVVLLSLIAA----L--SSQ---KVYEAEAQLLIKPD
A0A2T1CMF9      FSRYWQVVRRH---WIPASATFAGVLALSLIAA----L--ASK---NIYQAEARLLIEPE
Q7NDC5          LREYLRILNRH---WPYAAGTALAVVTVVTVWT----F--ALP---PVWEAQGRLLFKQK
U5QGK3          LRDYLRVLNRH---RLYAGGVFVLVVAGVAVWT----F--TSP---SVWEAKGRLLFKQK
A0A2W4UY24      FQKYWLVLKRH---WLLALAVCGLTTAAAAFLG----S--TQA---LLYKAEGKLLFESS
A0A838VM23      ---------------LSAALILSSTVVVALGLT----T--LLK---PAYEAQGKLLIKKS
A0A0D8ZUV2      IHKLWLILKRR---WLPAAGVFSCVVGLSVVAA----M--MPK---SSYQAEGKLLLKRV
A0A433VDI0      FQKYWSILKRR---WLPAVIVFSGVVGLSVVVV----L--LQK---PVYQAEGKLMLKKV
A0A3D1PG43      LQNLWLSIKRR---WLPAAGIFGCVLGCSALAA----S--LQQ---PMYQAQGKILLKKI
A0A2P8QQ72      LQNLQLAIKRR---WLAAAGVFGFVLGLSTIVT----L--LQA---PLYQAEGKLLLKKP
K9TZQ7          LQNLQLAIKRR---WLAAAGVFGFVLGLSTIVT----L--LQA---PLYQAEGKLLLKKP
A0A6N8G584      LKRVWLILKRR---WLPAAGVFGVVVAVATVLA----S--MQR---PVYEAQGKLLFKRA
A0A2G7GPR0      LKRVWLILKRR---WLPAAGVFGVVVAAAAALA----S--MQR---PVYEAQGKLLFKRA
K9XH68          PKRVWLILKRR---WLPAAGVFGVVVAAATAFA----S--MQR---PVYEAQGKLLFRKA
A0A1U7HW70      LKRVWLILKRR---WLPAAGVFGVVVAAATAFA----S--MQR---PVYEAQGKLLFRKA
A0A2S6VEJ8      LKRVWLILKRR---WLPAAGVFGVVVAAATALA----S--MQR---PVYEAQGKLLFRKA
A0A140KBA0      FKKYWLVLKRR---IVPASITCLGVMTLSLVTA----L--SLE---QVYQAEGQVMIKTN
K9XSG1          FQKYWLVVKRR---IVPASVTCLGVITLSLVTA----L--SLE---QIYEAEGQVMIKTN
A0A2T1GMT4      LSHYLFAVKRH---WIPAVSIFAATVALSIAAT----S--LLK---PSYQAEGRLLFKNS
K9UI51          LSHYLFAVKRH---WIPAVSIFAATVALSIAAA----S--LLK---PSYQAEGRLLFKNS
A0A1Z4QL41      FGRYLSSVKRH---WIPATCIFATTVILSALAS----T--RLK---PSYESEGKLLFKVP
K9TYI2          LSQYLLSLKRR---WLPAVSIFATTVTLSVVAA----A--FMK---PSYEGEGKLLFKTP
A0A252D4T4      LGRYLSIVKRQ---WLPAVTIFASTVALSAVAT----T--FLK---PTYEAEGKLLFKTP
A0A252DJH5      LGRYLSIVKRQ---WLPAVTIFASTVALSAVAT----T--FLK---PTYEAEGKLLFKTP
A0A252EB80      LGRYLSIVKRQ---WIPAVTIFASTVALSAVAT----T--FLK---PTYQAEGKLLFKTP
A0A6G9SKZ9      FGRYLSIVKRQ---WIPAASIFASTVALSVVAT----T--FLK---PSYEAEGKLLFKTP
A0A1Z4HPW5      FGRYLSIVKRQ---WIPAASIFASTVALSVVAT----T--LLK---PSYEAEGKLLFKTP
A0A1Z4MSN1      LSRYLSMVKRQ---WIPAASIFASTVALSVVAT----T--LLK---PSYEAEGKLLFKTP
A0A1Z4U1C2      LSRYLSMVKRQ---WIPAASIFASTVALSVVAT----T--LLK---PSYEAEGKLLFKTP
A0A0D6KV51      ------MVKRQ---WIPAASIFASTVALSVVAT----T--LLK---PSYEAEGKLLFKTP
A0A1Z4MKF8      LSRYLSMVKRQ---WIPAASIFASTVALSVVAT----T--LLK---PSYEAEGKLLFKTP
A0A2C6WC43      LNRYLLMLKRW---WVPAATIFIATVMLSAVAT----R--FIK---PSYEAEGKLLFRIP
A0A841WRE0      LNRYLLMLKRW---WVPAATIFIATVMLSAVAT----R--FIK---PSYEAEGKLLFRIP
A0A1Z4L5A1      LNRYLLMLKRW---WIPAATIFLATVMLSAVAT----R--FMK---PSYEAEGKLLFRIP
A0A367QD86      LNRYLLMLKRW---WIPAATIFIATVMLSAVAT----R--FMK---PSYEAEGKLLFRIP
A0A2K8SM78      -----------------------------------------MK---PSYEAEGKLLFRIP
A0A2R5FPC0      LSRYLLILKRW---WLPGTAIFAATVMLSAVAT----Q--FMK---PSYEAEGKLLFRIP
A0A5P8W5T6      LGRYLLILKRW---WLPATAIFAATVMLSAIAT----Q--FMK---PSYEAEGKLLFRIP
A0A7D7LDT7      LNRYLLILKRW---WLPAVSIFVATVILSAIST----R--FMK---PDYEAEGKLLFRLP
A0A235IZ96      LNRYLLILKRW---WIPAVGIFVGTVMLSAIST----T--FMK---PSYEAEGKLLFRVP
A0A2L2NGP0      LNRYLLILKRW---WIPAVGIFVGTVMLSAIST----T--FMK---PSYEAEGKLLFRVP
K9QM62          FHRYLLMLKRR---WILTVGIFFATAGFGVFAT----T--LMK---PSYEAAGKLLFRIP
A0A1Z4FWI3      FGRYLSVLKRQ---WIPATTIFASTVAVSVMAT----T--FMK---PSYESEGKLLFKSP
A0A1Z4JYE7      LKIYLYLLRRR---WISVTSIFLGTVSLSILAT----T--LLK---PAYESSGKLWFRIP
A0A0F5YE28      IGKYLQTVKRY---WLIVISVFLLCVGLSVYGT----K--YLK---PTYAASGKLLFKVD
U7QEH7          IGKYFKTVQRY---WLVVIGVFALCVGLSVYGT----K--YLE---PTYAASGKLLFKVD
A0A3S1ATK5      LSRYLLMIKRQ---WIPAASIFVATIALSALAT----T--RLQ---PSYEAEGKLLFKLP
A0A2Z6CPH0      FSHYLMILKRR---WLCVTSIVIGTIALSALAA----T--LIK---PSYEAEGKLLFRMP
A0A1Z4GT50      LSRYLLMLKRQ---WLPANSIFAATVAMSALAT----T--YMK---PSYEAQGKLLFKTP
A0A1Z4GIX0      INRYLLVLRRR---WILILSILAASVGLSVAAT----T--LLK---ASYEAEAKLLFRMP
A0A2H6LC24      INRYLLVLRRR---WILILSILAASVGLSVAAT----T--LLK---ASYEAEAKLLFRMP
B2J6N5          LSRYLLILKRW---WLPATVIFTATVILSAIAT----Q--FMK---PSYEAEGKLLFRIP
A0A367RMI4      LNRYLLILKRW---WLPAFSVFVATVILSAIST----Q--FLK---PDYEAEGKLLFRVP
A0A235HUM0      LNRYLLILKRW---WVPAFSIFVATVILSAIST----K--FLK---PDYEAEGKLLFRVP
A0A2L2NW47      LSRYLLILKRW---WLPAFSIFVATVILSAIST----Q--FLK---PDYEAEGKLLFRVP
A0A1E2WUR1      LNRYLLILKRW---WLPAVSIFVATVILSAVST----R--FMK---PDYEAEGKLLFRLP
A0A235IKU3      LNRYLLILKRW---WIPAVGIFVGTVMLSAIST----T--FMR---PSYEAEGKLLFRVP
A0A1U7MYU6      ISQYLLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
A0A1D8TNX9      ISQYLLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
A0A6P0L6C2      LSQYLLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
A0A6P0MVH0      ISQYLLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
A0A6P0KJV0      LSQYLLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
A0A6L9ZJG4      ISQYLLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
A0A846GI17      LSQYKLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
F4XKF3          LSQYKLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
A0A1D9FX10      LSQYLLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
A0A6P0Q0T0      LSQYKLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
A0A6P0W5I0      LSQYKLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
A0A845XJ02      LSQYKLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
A0A846D190      LSQYKLLLKRR---WLPAVAIFLFTVISAAWST----L--FLK---PSYEAEGKLLFKID
A0A3C0NJ41      FQKLWLALKRR---WLPGVAVFAVVVGLTVPLA----LSKKQK---TDYEAKGKLLFKVN
A0A352AG88      LQKLGLVIKRR---WLIGAVVFLGMVGLTIPMA----LLQSQQ---TSYEAKGKLLFKVS
A0A350Y374      FYKLWLVIKRR---WLVGGGVFVLMVGLTIPVA----LTQMQK---GDYEAQGKLLFKVN
A0A355DPX0      FYKLWLVIKRR---WLVGGGVFVLMVGLTIPVA----LAQMQK---GDYEAQGKLLFKVN
A0A0S3TYD7      LRKTFMMLTRY---WLPATLAFSLVTVPAAVFL----M--TRK---SSYQATGAVLV---
A0A2T1DNG3      YGQLFAILKRH---YLWVLAAGTVSVAIAFAYT----L--KQE---STYISGMQFLVEPN
A0A140K3H3      LTELKQTLSRQ---WKPALLVASTVCAGIFLST----V--LQN---PKYQSQTLILLENQ
K9XUB8          LTELKQTLSRQ---WKPALLVASTVCIGMFLST----V--LQT---PKYRSQTLLLLENN
A0A563VLD6      LSELKQIIFRR---WKPALIVGTTVFAGIFIPT----M--LQT---PKYQSETFILLENP
A0A7Y0NVW6      LSDIKQIVFRR---WKPALAVGTAVFAGIFIPT----M--LQT---PLYKSETFILLDNP
U5QL42          LLSIWRTLRKR---KLLSLSVAVAVFGGVAAFT----Y--TRP---YIYESETLILVDNR
A0A6H2NHD5      LGHLVGVLKRR---AITFLGVTLLSLGGLTLWH----L--TRP---AVYSGGFDLLVEPV
A0A2P8W4F7      LKRLLGVFKRR---AGVFLGVAALSFGGLTLWH----L--SQP---PAYSGSVNLLVEPV
A0A5Q4E0Z4      LGHLIGVLKRR---VGVFVGVAALSFGGLTLWH----L--SRP---PVYSGTANLLVEPV
A0A2P8VVX1      YGQLFQILLRR---WPWIIASLGVATAGAVFVS----L--RQE---PIYRSNMQLLVEPN
A0A2P8WHY0      YGQLLGILLRR---WPWIAGTLVLSVAGAVLVF----L--RED---PTYRSSMQLIVEPN
A0A563VQJ3      LGQYLLKLKRR---WKPAILVFLATLGGSVFLS----L--FLQ---NSYQAAGKLLFRQN
A0A7Y0IRJ7      LGQYLLKLKRR---WKPATVVFLATLGSSILLS----L--FLS---ENYQSTGKLLFKQN
A0A2T1CMT9      YGELFSKLWHR---RLWFIGAFTGVLAIAVPLA----L--LKP---AVYQSYMQILAESN
A0A7G8J1V5      LRNIYVSLLRR---RKLVLTTAGIVLTLATVNL----A--SERIFRPVYQGNFKLLISDP
A0A354B169      LRELWLALRRR---RKLVTVTASTVLALTVMVT----A--YQRIFTPVYLGSFSLLITDP
Q0IDT5          LRELWRALKRR---KKIVGFTAAAVLVLSGVVT----T--YQRLFMPVYEGSFALLITDP
A0A7G8FZD9      LRELWRALKRR---KKLIGVTAAGVIALTCVIT----A--YQRIFRPVYQGSFALLITDP
G4FMX5          LRDLWRALKRR---KKLVGVTAAGVISLTCVST----A--YQRIFRPVYQGSFALLITDP
A3ZA21          LRELWRALKRR---KKLVGVTAAAVVALAGMVT----A--YQRIFRPVYQGSFALLITDP
A0A076HBF2      LRELWRALQRR---KKLVGVTAGSIIVLAALFT----T--YQRLFRPVYEGSFSLLITDP
A0A7G8FP50      WRELWRALLRR---KKLVTVVAGGVIVLAAVNT----A--FQRITSPVYQGSFRLLITDP
A0A7G8E8K7      LRELWRALQRR---KKLVAVTAGSVIVLAVLFT----T--YQRLFRPVYQGSFSLLITDP
A0A7G8GNR2      LRELWRALQRR---KKLVAVTAGSVIVLAALFT----T--YQRLFRPVYQGSFSLLITDP
A0A7G8ICD3      LRELWRALQRR---KKLVTVTAGSVIVLAALFT----T--YQRLFRPVYQGSFSLLITDP
A0A2D6FCW3      XRELWRALRRR---KNLVGVTAAGVLALSGLNT----A--YQRIFRPVYQGSFALLITDP
A0A7G7KJ95      LREVWRALRRR---KKLVGVTAAAVIGLAGLVT----V--YQRVFRPVYQGSFVLLITDP
A0A7G8EAN3      LRELLRALRRR---KKLVGVTALVVFSISALIT----I--RERVINPTYVGSFALLITDP
A0A1D8TX52      YGQLLAVLWRR---RLWIISVLLTSLPIAFYLT----I--KKE---PNYISSLQLLVEPN
A0A1D9G4T2      YGQLLAVLWRR---RLWIISVLLTSLPIAFYIT----L--KKE---PNYISSLQLLVEPN
A0A6P0PR27      YGQLLAVLWRR---RLWIISVLLTSLPIAFYIT----L--KKE---PNYISSLQLLVEPN
A0A6P0WER7      YGQLLAVLWRR---RLWIISVLLTSLPIAFYIT----L--KKE---PNYISSLQLLVEPN
A0A845XM36      YGQLLAVLWRR---RLWIISVLLTSLPIAFYIT----L--KKE---PNYISSLQLLVEPN
A0A846DAT1      YGQLLAVLWRR---RLWIISVLLTSLPIAFYIT----L--KKE---PNYISSLQLLVEPN
A0A846GZK8      YGQLLAVLWRR---RLWIISVLLTSLPIAFYIT----L--KKE---PNYISSLQLLVEPN
F4XP71          YGQLLAVLWRR---RLWIISVLLTSLPIAFYIT----L--KKE---PNYISSLQLLVEPN
A0A6P0KZ31      YGQLLAVLWRR---RLWILSVLLTSLPIAFYIT----L--NKE---PTYISSLQLLVEPN
A0A6P0LPB8      YGQLLAVLWRR---RLWILSVLLTSLPIAFYIT----L--NKE---PTYISSLQLLVEPN
A0A6L9YR57      YGQLLAVLWRR---RLWIISVLLTSLPIAFYLT----I--KKE---PTYISSLQLLVEPN
A0A845WMG9      YGQLLAVLWRR---RLWIISVLLTSLPIAFYLT----L--KKE---PTYISSLQLLVEPN
A0A6P0SEV1      YGQLLAVLWRR---RLWIISVLLTSLPIAFYLT----L--KKE---PTYISSLQLLVEPN
A0A6B3N2I8      YGQLLAVLWRR---RLWIISVLLTSLPIAFYLT----L--KKE---PTYISSLQLLVEPN
A0A6M0B891      YGQLLAVLWRR---RLWIISVLLTSLPIAFYLT----L--KKE---PTYISSLQLLVEPN
A0A6P0IJQ1      YGQLLAVLWRR---RLWIISVLLTSLPIAFYLT----L--KKE---PTYISSLQLLVEPN
A0A6P0J8J8      YGQLLAVLWRR---RLWIISVLLTSLPIAFYLT----L--KKE---PTYISSLQLLVEPN
A0A6P0ZSH6      YGQLLAVLWRR---RLWIISVLLTSLPIAFYLT----L--KKE---PTYISSLQLLVEPN
A0A845VS63      YGQLLAVLWRR---RLWIISVLLTSLPIAFYLT----L--KKE---PTYISSLQLLVEPN
A0A1U7N5X9      YGQLLAVLWRR---RLWIISVLLTSLPIAFYLT----L--KKE---PNYISSLQLLVEPN
A0A6L9Z1V0      YGQLLAVLWRR---RLWIISVLLTSLPIAFYLT----L--KKE---PTYISSLQLLVEPN
A0A6P0LC12      YGQLLAVLWRR---RLWILSILLTSLPIAFYVT----I--KKE---PTYISSLQLLVEPN
A0A6P0MVJ3      YGQLLAVLWRR---RLWILSVLLTSLPIAFYIT----I--KKE---PTYISSLQLLVEPN
A0A2W6ZAV2      LGNLLPILRRR---QRLLVAVFAATVAIGAAAT----L--FQRVVSPVYQGDFRLLVSDP
K9W742          YGQLFAILIRR---RLWLLGILCLALGIATFKA----F--TTK---STYVSSLQLLVEPN
A0A3D1PBA3      YGQLFSVLMRR---RFWLLGVLGSVLTIATVFT----L--ISK---PTYQSTMQLLIEPN
K9XPB0          YGQLLGILWRR---RFWIGGVFLGVLAVAIPLA----L--MKQ---PLYMSQMQLLIESN
A0A350Y7Z1      YGQLFSILLRR---RFWMLGVFCGVLAIAIPIA----L--NKE---PTYQSSMQLLIEPY
A0A352X2A7      YGQLFAILLRR---KFWLLGVFCSVLAIAIPIA----L--KKE---PTYQSSIQLLIEPL
A0A0D8ZYV0      YGQLFAVLSRR---RYWLLGVLGGVLTIATALT----L--TAE---PTFQSTMQILIEAN
A0A433VMS2      YGQLLAVLMRR---RYWLLGVMGAVLTIATVFT----L--ISK---PTYQSEMQLLIEPN
K9TYA7          YGQLLAVLMRR---RYWLLGVMGAVLTIATVFT----L--ISK---PTYQSEMQLLIEPN
A0A2P8QUE1      YGQLLAVLMRR---RYWLLGVMGAVLTIATVFT----L--ISK---PTYQSEMQLLIEPN
K9SA61          YGQIFAVLARR---RLWLLGVFGSVVAAAAGLT----F--LTT---PVYQSSLQLLVESN
A0A2G7GMH8      YGQLLSVLMRR---RFLLLSVFFGILSMATVLT----I--ITK---PTYKSSMQLLVEPN
A0A6N8FU92      YGQLLLVLMRR---RFLLLSVFLSVLSAATILT----L--MTK---PTYKSSMQLLVEPN
A0A2T1DWE8      YGQLVAALFRR---KLWLLGIFLTVLSAVTIYT----L--LKK---PIYQSSMQLLVEPN
A0A832H7C4      YGQLFSVLLRR---KRWLIGTFISVLSASAIAT----L--MMK---PAYQSYMQLLVEPN
A0A1U7I8L3      YGQLLAILLRR---RYWLLGIFSVVLAITAIVT----I--TTK---PTYKSSMQLLVEPN
A0A2T1DJL8      YGQLLSVLMRR---RLWLIGGLGLSLIGAALFT----L--FSK---PTFRSSMQLLSESN
A0A1Z4J9W0      YGQLFGVLLRR---KLWFLGALAGTLALAAGVT----A--VLP---PTYRSTMQLMVESN
A0A0N7Z5K9      YGQLFGVLMRR---KIWFLGAVAGTIALAAAVT----A--FMP---PTYRSTMQMLVESN
A0A0S3TXC5      YGQLFGVLMRR---KIWFLGALAGTIALAAGVT----A--FMP---PTYRSTMQMLIESN
A0A846FBD3      LQKYWLVLKRR---WFPAAGVFSLVVGLTAVLT----A--LQE---PIFEAKGKLLF---
K1XF69          LGRYLQTLKRR---WFWLLGVFVLSVSGAVYAT----Q--FLT---PTYENSGKILF---
B5W297          LGRYLQTLKRR---WFWLLGVFVLSVSGAVYAT----Q--FLT---PTYENSGKILF---
H1W7M8          LGRYLQTLKRR---WFWLLGVFVLSVSGAVYAT----Q--FLT---PTYENSGKILF---
A0A5Q4H6A5      LGRYLQTLKRR---WFWLLGVFVLTVSGAVYAT----Q--FLS---PTYQNSGKILF---
D5A466          LGRYLQTLKRR---WFWLLGVFVLTVSGAVYAT----Q--FLS---PTYQNSGKILF---
B4WQE3          LGRVVDVLKRH---VFLITGITALATSAVVARA----L--TET---PLYRADFELLT--P
U5QJM6          ------------------MMTMAATFTLAVAYT----F--LSQ---PVYKSEMLMLL--E
A0A0V7ZFJ4      LQQYWLTLKRR---WLPALIVSSSVFGMAAFNT----L--KQE---PIYSAEGKLRF---
A0A235IXQ2      FQQYWLTVKRR---WFLILIIIGSVFGVTGVVT----F--SEK---PIYEAEGKLLF--N
A0A367RIS1      FQQYWRILKRR---WFLIAIIMGSVFGVTGLVA----F--SKK---PIYESEGKLLF--N
A0A841V8H9      FHQYWLTVKRR---WFVIVIIMGSVFGATGFLT----F--SQK---PIYEAEGKLLF--N
A0A5Q0GJJ5      FQQYWLIAKRR---WLLIATIMGSVFGVTGLLT----F--SQK---PIYEAEGKLLF--N
Q3MEB7          FQQYWLIAKRR---WLLIATIMGSVFGVTGLLT----F--SQK---PIYEAEGKLLF--N
A0A1Z4KHN9      FQQYWLIVKRR---WLLIAAIIGSVFGVTGLVT----F--SQK---PIYEADGKLLF--N
Q8YT70          FQQYWLIVKRR---WLLIAAIIGSVFGVTGLVT----F--SQK---PIYEADGKLLF--N
A0A7U3NLX2      LQKYWLTVKRR---WLLIATIIGSVFGLTAFVT----F--SQK---PIYQAEGQLIF--D
A0A166IWU6      LRQYWLAVKRR---WLLIVIIIGSVFGITSFVT----F--NQK---QIYEAEGKLIF--D
A0A2S0Q8C0      LRQYWLAVKRR---WFLIVIIIGSVFGITSFVT----F--NQK---PIYEAEGKLIF--D
W6FSX4          LRQYWLAVKRR---WFLIVIIIGSVFGITSFVT----F--NQK---PIYEAEGKLIF--D
A0A218Q4C1      LQQYWLTVKRR---WLLIATIITSVFGFTAFVT----F--SQK---PIYQAEGKLIF--D
A0A6P1ZT04      LQQYWLTVKRR---WLLIATIIGSVFGITAFIT----F--SQK---PIYQAEGKLIF--D
A0A0V7ZNJ9      LEQYWLILKRR---WVPASVVAGSVVGLAALVT----F--MQK---PIYEAKAELLF--N
A0A5P8VSD1      FQQYWLTLKRR---WLLIITIMGSVFGVTGLVT----F--IQK---PIYEAESKLLF---
A0A1S1ZVW2      LQVYWLILKRR---WLVILLVMASVLGAAISYT----Y--SQK---PVYQAKGKLLF--E
A0A0R0M9H9      LQVYWLILKRR---WLVILLVMASVLGAAISYT----Y--SQK---PVYQAKGKLLF--E
A0A7H0F4U6      LQIYWLILKRR---WLVILLVIASVLGAAISYT----Y--SQK---PVYQAKGKLLF--E
A0A7W2A1T7      LQIYWLILKRR---WLVILLVIASVLGAAISYT----Y--SQK---PVYQAKGKLLF--E
A0A838WI98      LQIYWLILKRR---WLVILLVIASVLGAAISYT----Y--SQK---PVYQAKGKLLF--E
A0A853MJX6      LQIYWLILKRR---WLVILLVIASVLGAAISYT----Y--SQK---PVYQAKGKLLF--E
A0A1B7WX82      IQQYWLIFKRR---WLVSSIVFASVFGITAFVT----Y--TTK---PVYESEGKLVF--T
A0A1B7WTD1      IQQYWLILKRR---WFVASVVMASVISATAFMT----Y--TQK---PVYESQGKLVF--T
A0A480ABC0      IQQYWLILKRR---WFVASVVMASVISATAFMT----Y--TQK---PVYESQGKLVF--T
A0A1Z4LRU5      LGQYWLILKRR---WLPALLVTSSIFGLAAFVT----F--RQK---PVYQAEGKLRF--D
A0A1Z4JVB4      FQQYWLILKRR---WLLTSFVTGSVFGLAALLT----F--LQK---PAYESPAKLIF--N
K9PIA4          LQHYWTVLKRR---WLVTSIVISTVFGLTALVT----F--LKT---PVYESKAKLLF--N
A0A1Z4HVE1      VQQYWTVLKRR---WPVTTVVIGSVFGLTCLFT----F--LQK---PVYESQAKLLF--N
A0A252ECZ1      FHQYWPILKRR---WPVTTVVIGSVFGLTALVT----F--LQK---PVYESQAKLLF--N
A0A1Z4G5Y1      FQEYWPILKRR---WPVTAVVIGSVFGLTALVT----F--VQK---PVYESQAKLLF--N
A0A252DNA2      FQEYWPILKRR---WPVTTVVIGSVFGLTALVT----F--LQK---PVYESQAKLLF--N
A0A252E1Q4      FQEYWPILKRR---WPVTTVVIGSVFGLTALVT----F--LQK---PVYESQAKLLF--N
A0A6G9SK36      VQQYWTIIKRR---WPVTTVVIGSVFGLTALVT----F--LQK---PVYESQAKLLF--D
A0A1Z4M597      VQQYWTVLKRR---WPVTTVVIGSVFGLTALVT----F--LQK---PVYESQAKLLF--N
A0A1Z4MWT1      VQQYWTVLKRR---WPVTTVVIGSVFGLTALVT----F--LQK---PVYESQAKLLF--N
A0A1Z4TX53      VQQYWTVLKRR---WPVTTVVIGSVFGLTALVT----F--LQK---PVYESQAKLLF--N
A0A2A2TNQ5      LQEYLLVLKRR---WLAAAIVMGSVFGITAFVT----Y--SQK---PIYEASGKLLL---
A0A3S1C4K5      FQQYLRILKRR---WLVTAGVMGSVFGLTALVT----F--SQK---PVYESQGKLLI---
A0A1X4G3D5      LQLYWMILRRR---WLVVLLVMASVLGGAISYT----L--FQK---PVYQAKGKLLFEGD
D4TNI2          LQLYWMILRRR---WLVVLLVMASVLGGAISYT----L--FQK---PVYQAKGKLLFEGD
A0A1Z4H6Z8      FQEYWPILKRR---WPVTAVVIGSVFGMTALVT----F--LQK---PVYESQAKLLF--N
A0A3F3KPR9      LQIYWLILKRR---WLVILLVIASVLGAAISYT----Y--SQK---PVYQAKGKLLF--E
A0A1Z4NPM1      IQQYWLILRRR---WLVILLVLGSVFGLAAFYT----F--TLK---PVYEAGGKLML---
A0A1Z4UZW9      IQQYWLIFKGR---WPMASIVFAVVFGVTALVT----Y--STK---PVYESEGKLVF--T
A0A1B7VSH4      IQQYWLIFKRR---WLVASIVFASVFGATALVT----Y--LTK---PVYESEGKLVF--T
A0A1B7W126      IQQYWLIFKRR---WLVASIVFASVFGATALVT----Y--LTK---PVYESEGKLVF--T
A0A3D4C6Q6      IQQYWLIFKRR---WLVASIVFASVFGATALVT----Y--LTK---PVYESEGKLVF--T
A0A0K2M5H0      IQQYWLIFKRR---WPVASVVFAFVFGVTALVT----Y--STK---PVYESEGKLVF--T
A0A844I4P0      IQQYWLIFKRR---WPVASVVFAFVFGVTALVT----Y--STK---PVYESEGKLVF--T
A0A1B7UVJ4      IQQYWLTFKRH---WLVTSIVFASVLGVTALLT----Y--SAK---PVYESEGKLVF--T
A0A1B7UTR1      IQQYWLTFKRH---WLVTSIVFASVLGVTALLT----Y--SAK---PVYESEGKLVF--T
K7W0A4          IQQYWLTFKRH---WLVTSIVFASVLGVTALLT----Y--SAK---PIYESEGKLVF--T
A0A5C0DRW9      IQQYWLTFKRH---WLVTSIVFASVLGVTALLT----Y--SAK---PVYESEGKLVF--T
A0A6H2C088      IQQYWLTFKRH---WLVTSIVFASVLGVTALFT----Y--SAK---PVYESEGKLVF--T
A0A1Z4RPC6      IGNYLQKLKRR---WIPALAVFIVTVGTTAFLS----G--FLE---KNYKSEGKILF--K
A0A2T1CMZ0      IEEYLLKLKRR---WLPALSVFVVTVGTTLFLT----S--FLE---KTYKSEGKILF--K
L8M4F7          IGEYLLKLKRR---WKIASALFLLTVGAAGLLS----T--KLS---TKYEAEGKLLF--K
A0A140K2P2      ISQYLIKLRRR---WKLALAVFLLTAGITTALS----L--LLQ---KTYQAQGKLLF--K
K9XWX4          ISGYLIKLRRR---WKLALAVFLLTAGVTTALS----L--LLQ---KTYQAQGKLLF--K
A0A140KB14      LYNYLQKLSRR---WKPALAVFLLTVGSMAALS----T--LLK---KSYQAEGKLLF--K
K9XX88          LYNYLQKLRRR---WKPALAVFLLTVGSVAALS----T--LLK---KSYQAEGKLLF--K
L8LZE9          ILSYLQKIQRR---WKPALAVFLLTAGSIGLAS----V--FLT---TKYQAGGKILF--E
A0A563VSV6      IASYFQKLKRR---WKPALAVFLLTVVSTFAAT----S--LLE---EKYQAEGKILF--K
A0A7Y0IQB0      IASYFQKLKRR---WKPALAVFLLTVGSTFAAT----T--LLQ---EKYQAEGKILF--K
A0A433NM31      LRQYWLILKRR---WLPASAVFGFVLLLTALVT----F--LQK---PVYQAQGKLLL--K
A0A1Z4NDS1      LQKYVQVLQRR---WLPGLAIFGTCVTLATIYA----F--SLQ---PSYKAEGNLLI--K
U9VXM0          LQKYWRVLKRR---WLIALTIFGLTTTAAVGVG----I--TQK---PEYEAEAKLLF--E
A0A6M0RI13      LQKYWRVLKRR---WLIALTVFGLTTTAAVGVG----I--TQK---PEYQAESKLLF--E
A0A6M0S1N5      LQKYWRVLKRR---WLIALTVFGLTTTAAVGVG----I--TQK---PEYQAESKLLF--E
K9F4D9          LQKYWRVLKRR---WLIALTVFGLTTTAAVGVG----I--TQK---PEYQAESKLLF--E
A0A6I5QPI5      FQKYWLVLKRR---WIPAFAVFSTTVALSVFAA----L--SEE---SVYKAEGRVLF--R
A0A1Z3HMQ0      LQRYWLVLKRR---WLPASLVFAACVVAAALVG----L--SQK---DTYQASGKLLF--Q
A0A433W533      FSKLWIILKRR---WLPGTGVFTAILGLAIIAV----C--LQK---PVYEATGKLIV--K
A0A2P8QWJ3      FSKLWIILKRR---WLPGTGVFTAILGLAIIAV----C--LQK---PVYEATGKLIV--K
K9U6L7          FSKLWIILKRR---WLPGTGVFTAILGLAIIAV----C--LQK---PVYEATGKLIV--K
U5DPF5          LQKYWSILKRR---WLPASLVTISTIGLTGIYS----A--RQT---PIYEARARLLL--Q
A0A1E5QP61      FQKYWLVLKRH---WLPASSVFALIVTLATYKA----A--TAD---PVYEAQGKLLF--K
A0A846DWC7      FQKYWLVLKRH---WLPASSVFALIVTLATYKA----A--TAD---PVYEAQGKLLF--K
A0A845Y5J4      FQKYWLILRRR---WLPSALVLVLTVILATTAA----L--LKK---PTYEAQGKLLL--K
A0A6P0X488      FQNYWLILKRR---WLPGTLVLLLTVILATTAA----L--LKQ---PTYAAQGKLLL--K
A0A6P0VDM0      FQSYWLILRRR---WLPGTLVLLLTVILATTAA----L--LKQ---PTYAAQGKLLL--K
A0A6P0UVD5      FQSYWLILRRR---WLPGTLVLLLTVILATTAA----L--LKQ---PTYAAQGKLLL--K
A0A846BFF2      FQSYWLILRRR---WLPGTLVLLLTVILATTAA----L--LKQ---PTYAAQGKLLL--K
A0A6M0G142      FQKYWLILRRR---WLPGTLVLLLTVMLATTAA----L--LKK---PSYTAQGKLLL--K
A0A6P0MR53      FQKYWLILKRR---WLPGTMVFLLTVMLATTAA----F--LKK---PSYTAQGKLLL--K
A0A3M2GIL5      FQKYWLVLKRH---WLPSSCVFLLIFALAFAFA----Y--TRK---PTYEASGKLLI--K
A0A6H1TSJ9      FQKYWLVLKRH---WLPSSCVFLLIFALAFAFA----Y--TRK---PTYEASGKLLI--K
A0A3M1PML8      FQKYWNVLKRR---WLPATSVFLTLTLLSAAVA----I--RQK---SSYQAETLLQV--R
A0A6M8BE85      FQKYWNVLKRR---WLPATTVFLTLTALSTAIA----L--RQK---PSYEAETLLQV--R
A0A0T7BPZ0      LTKYWLILQRR---WLPTLGIVGIALTMAFGYV----L--SIK---PTYKAQGSILI--R
A0A352X442      FQKYWLVLKRR---WLPAVGVFGGIVAVAGLAV----I--RQV---PSYQAQGTILI--Q
A0A6B3NF44      FQKYWLVLKRR---WLPATGVVAMTVALSALAV----S--RQK---DSYKAEGKLLF--K
A0A6M0EPL4      FQKYWLVLKRR---WLPATGVVAMTVALSALAV----S--RQK---DSYKAEGKLLF--K
A0A6P0K6L6      FQKYWLVLKRR---WLPATGVVAMTVALSALAV----S--RQK---DSYKAEGKLLF--K
A0A6P0MRR9      FKKYWLVLRRR---WLPGVVVSAIVVTLAVLST----S--KEE---TVYKAGGQLLL--K
A0A6P0X1X4      FKKYWLVLRRR---WLPGVAVSAMVVTLAVLST----S--REE---IVYKAGGQLLL--K
A0A6P0UX57      FKKYWLVLRRR---WLPGVAVSAMVVTLAVLST----S--REE---TVYKAGGQLLL--K
A0A846B9S8      FKKYWLVLRRR---WLPGVAVSAMVVTLAVLST----S--REE---TVYKAGGQLLL--K
A0A0M0SHU3      FQKYLLVLQRR---WMTAVGIFGAVVTLALLYA----F--SLK---PTYTAQASLLI--K
A0A1D2PBN3      FQKYLLVLQRR---WVSAVGVFGVVVTVASLYA----F--SLK---PTYNAEGSLLI--K
A0A0C2LVR7      FQKYLLVLQRR---WVPAVGVFGAVVTLVSLYA----F--SLK---PTYNAEGSLLI--K
A0A1Z4PQB9      FQKYLLVLQRR---WVPAVGVFGVAVTLVSLYA----F--SLK---PTYKAEGSLLI--K
A0A1Z4SFN6      FQSYLLVVQRR---WLAAVSVFGVVVALASLQA----F--SSK---PSYEAQGSLLV--K
K9PGI8          FQKYLLILQRR---WIPAAGVFGVVVTLAFLYA----V--SLK---PAYKAEGSLLI--K
A0A654SFI6      RYWIEARALRF---WIAAIIALALIAGLVVTLL--------ST---PLYRAGAR------
K9SSQ0          TFLVRRLVRKH---LVTVISTTALTLGGAAIYT----F--NQP---FLYESKGSLLI---
A0A2W1JIN9      ------VFSRH---RWSALAAFSAVMCGLCLYV----V--FAP---RLYTSKVRLIL---
A0A318AJV1      ------MLRRR---WATMLGVSSVVFVVALSVV----A--CLP---PRYVAVARIRI---
A0A845WDS5      ------VLKRR---FWPALATFASVIGASIAYL----V--YTS---PVYEVKARLIV---
A0A6P0IC70      ------VLKRR---FWPALATFASVIGASIAYL----V--YTS---PVYEVKARLML---
A0A845VVD9      ------VLKRR---FWPALATFASVIGASIAYL----V--YTS---PVYEVKARLML---
A0A6B3MUB5      ------VLKRR---FWPALATFASVIGASIAYL----V--YTS---PVYEVKARLML---
A0A6M0B7N4      ------VLKRR---FWPALATFASVIGASIAYL----V--YTS---PVYEVKARLML---
A0A6P0J9W3      ------VLKRR---FWPALATFASVIGASIAYL----V--YTS---PVYEVKARLML---
A0A6P0ZWE1      ------VLKRR---FWPALATFASVIGASIAYL----V--YTS---PVYEVKARLML---
A0A1U7N2U4      ------ALRRR---LLAALATFTSVIGGGMAYL----V--VTP---PVYQVKARLML---
A0A6L9YZL1      ------ALKRR---LLPALVTFTSVIGGAIAYL----V--VTP---PVYQVKARLML---
A0A6P0KYM4      ------ALKRR---LLPALVTLTSVIGGAIAYL----V--VTP---PVYQVKARLML---
A0A6P0LSD6      ------ALKRR---LLPALVTLTSVIGGAIAYL----V--VTP---PVYQVKARLML---
A0A6P0PNZ7      ------ALKRR---LLPALVTFTSVIGGAIAYL----V--VTP---PVYQVKARLML---
F4XV38          ------ALKRR---LLPALVTFTSVIGGAIAYL----V--VTP---PVYQVKARLML---
A0A6P0W137      ------ALKRR---LLPALVTFTSVIGGAIAYL----V--VTP---PVYQVKARLML---
A0A845XHF7      ------ALKRR---LLPALVTFTSVIGGAIAYL----V--VTP---PVYQVKARLML---
A0A845ZEG9      ------ALKRR---LLPALVTFTSVIGGAIAYL----V--VTP---PVYQVKARLML---
A0A1D9G1F2      ------ALKRR---LLPALVTFTSVIGGAIAYL----V--VTP---PVYQVKARLML---
A0A846CJ58      ------ALKRR---LLPALVTFTSVIGGAIAYL----V--VTP---PVYQVKARLML---
A0A6L9Y9E2      ------ALRRR---LLPALATFTSVIGGAIAYL----V--VTP---PVYQMKARLML---
A0A6P0SGR0      ------ALKRR---LLPALATFTSVIGGAIAYL----V--VTP---PVYQVKARLML---
A0A6M0BK48      ------ALKRR---LLPALVTFTSVIGGAIAYL----V--VTP---PVYQVKARLML---
A0A845WG36      ------ALRRR---LLPALATFTSVIGGAIAYL----V--VTA---PVYQVKARLML---
A0A6P0X384      ------VLKRR---FLPALATFVSVIGASIVYV----V--SSS---PVYQVTGRLML---
A0A2P8QIL5      ------IFYRR---RLPALATFISVMLGALVYL----I--FAP---RTYEAEARLML---
A0A433W447      ------IFYRR---RLPALATFISVMLGALVYL----I--FAP---RTYEAEARLML---
K9U1K8          ------IFYRR---RLPALATFISVMLGALVYL----I--FAP---RTYEAEARLML---
A0A1Q4RZJ6      ------VLKRR---GLPALITFTAVIGGAVAYL----K--VTP---RLYESSSRLIF---
A0A1Z4SNV3      ------VIKRR---GLPALITFTAVISGAVAYL----K--VTP---RLYETSARLIF---
A0A2H2XJQ1      ------VIKRR---GLPALITFTAVISGAVAYL----K--VTP---RLYETSARLIF---
A0A3S5K358      ------VLKRR---GLPALITFTAVIGGAVAYL----K--VTP---RLYESSSRLIF---
A0A0T7BPJ4      ------VLKRR---GLPAAAAFVAVMGAAGAYL----L--LSP---KLYEASARMML---
A0A0C1QS61      ------VLKRR---SLPAVAAFVATIGGAIAYL----A--VTP---SQYEASARLML---
A0A139X3R8      ------VLKRR---SLPAVAAFVAAIGGAIAYL----A--VTP---SQYEASARLML---
A0A844MZP8      ------VLKRR---SLPAVAAFVATIGGAIAYL----A--VTP---SQYEASARLML---
A0A1Z4I7C5      ------VLGRR---GFPAITVFAAVIGTSFAYL----Q--VTP---RLYESSARLML---
A0A844MST0      ------VLKRQ---SLPAVATFAAVICGAFAYL----S--VTP---RLYETSARLML---
A0A0C2MDK7      ------VLRRR---SLPAVAAFVAVMGGAIAYL----A--VTP---SKYEAYARLML---
A0A856MDH8      ------VLTRR---SIPAVAAFVAVIGGAIAYL----S--VTP---SKYEAYARLML---
A0A1Y0RCK1      ------VLKRR---SAPAIAAFAAVIGGAIAYL----A--VTP---SKYEAYARLML---
A0A1Z4PWZ0      ------VLRRR---SLPAIAAFVAVIGGAMAYL----T--VTP---SKYAASARVML---
A0A0C2QLT0      ------VLRRR---SLPAIAAFVAVIGGAIAYL----A--VTP---SKYEAYARLMQ---
A0A1Z4J2K1      ------VLRRR---SLPAIAAFVAVIGGAIAYL----A--VTP---SKYEASARLMQ---
A0A3S0ZSX0      ------IFKRR---AFPALATFAAVIGGAIAYL----Q--VTP---HRYQTSARLML---
A0A2N6K4T3      ------ILKRR---ALPALVTFAAVIGGAIAYL----Q--MTP---RQYQTSTRLML---
A0A370CKT2      ------ILKRR---ALPALVTFAAVISGAIAYL----Q--ITP---RQYQTSTRLML---
A0A0S3TL97      ------ILKRR---ALPALVTFAAVIGGAIAYL----Q--ITP---HQYQTSTRLML---
A0A2N6M8A0      ------ILKRR---ALPALVTFAAVIGGAIAYL----Q--ITP---HQYQTSTRLML---
A0A2N6M9E1      ------ILKRR---ALPALVTFAAVIGGAIAYL----Q--ITP---RQYQTSTRLML---
A0A2N6KJI4      ------ILKRR---ALPALVTFAAVIGGAIAYL----Q--ITP---RQYQTSTRLML---
A0A2N6MZ77      ------ILKRR---ALPALVTFAAVIGGAIAYL----Q--ITP---RQYQTSTRLML---
A0A2N6KT20      ------ILKRR---ALPALVTFAAVISGAIAYL----Q--ITP---RQYQTSTRLML---
G6FSN3          ------ILKRR---ALPALVTFAAVISGAIAYL----Q--ITP---RQYQTSTRLML---
A0A4D9CI02      ------ILKRR---ALPALVTFAAVIGGAIAYL----L--ITP---RLYEISTRLIL---
A0A328I8B9      ---------------LPALVTFAAVIGGAIAYL----I--ITP---RLYEISTRLIL---
A0A4Q9J4Z7      ------ILKRR---ALPALVTFAAVIGGAIAYL----I--ITP---RLYEISTRLIL---
A0A0M0SU69      ------ILKRR---ALPALATFIAVIGGAIIYL----Q--ITP---RLYETSTRLIL---
A0A1Z4TIZ8      ------ILKRR---TLPALATFAAVIGGAIAYL----Q--ITP---RLYETSTRLIL---
K9UYB2          ------ILKRR---SFPALLMFAAVLGGAYAYI----S--TAP---KMYESAIRLMV---
A0A1Q4S1H4      ------VAKRR---SLPAFLTLSAVIAGAVTYL----A--VAP---RMYETSSRLMV---
A0A433VBU6      ------VVRRR---SLPAFLTLSAVMAGAVTYL----A--VAP---RMYETSSRLML---
A0A218QN17      ------ILKRR---ALPALVTFTAVIGGAVAYL----T--VTP---RLYEASARLMQ---
A0A846HD20      ------VLKRR---AFPALVTFTAVIGGAFAYL----T--VTP---RLYEASARLMQ---
K9RKN2          ------IVMRR---SLPALATFVAVMGGAFAYL----S--ITP---RVYETSARLML---
A0A2I8ADV2      ------VLRRR---GLPAVSTLAAVIGASVAYL----A--ITP---RFYATSAKMMV---
A0A5Q0GMF5      ------VLGRR---GFPAVTVFASVIGASFAYL----A--VTP---RLYETSARLML---
Q3MEW0          ------VLGRR---GFPAVTVFASVIGASFAYL----A--VTP---RLYETSARLML---
A0A1Z4KIC7      ------VLGRR---GFPAVTVFAAVIGASFAYL----A--VTP---RLYETSARLML---
Q8YSM5          ------VLGRR---GFPAVTVFAAVIGASFAYL----A--VTP---RLYETSARLML---
                                                                :           

K9SLA9          IESTTGS----VAAPTTTASIPNPNQDNIASSEGLP--PLPTDTAISTI-----PPGDRL
A0A168TT23      TANIL----------------------------RIE--DFEAAPR-SWQ-----GVEQFY
A0A0M1JWX9      TGEGANSLSSRLGALAGGL--------------GMGIPGSSGSGV---------D----Y
A0A844MWN9      T-SNLDANLGTLG--------------------SLK--NREPGFSDQVN-----P----L
A0A2T1M1V6      G-DKLNANLGTLG--------------------NLS--DGGSDFTREVN-----P----L
A0A2G7GCS2      T-TRLDTNLGTLG--------------------QLQ--NSALGFTRELN-----P----L
K9XBH8          T-NSINASLGTLG--------------------QLQ--NSGLGFSRELN-----P----L
A0A1Z4LJ30      T-NDSDADLGKLG--------------------SVR--DGGVVFSQQIN-----P----L
Q7NF11          N-KNAEISLGALG--------------------EVR--ETGTSFSSEVN-----A----L
K9RI76          T-NQSDADLGKLG--------------------NVR--DEGIVFSQQLN-----P----L
A0A433VN22      T-SNLDASLGTLG--------------------TFK--NGNLDFSPELN-----P----L
A0A139WSU3      T-SNLDANLGTLG--------------------SLR--NGDSAFSSEVN-----P----L
A0A844MJB7      T-SNLDANLGTLG--------------------SLR--NGDPGFSSEVN-----P----L
A0A352AE27      T-SSLDANLGTLG--------------------SLT--NDEPVFSNQLN-----P----L
A0A3B8JH60      T-GDLDANLGTLG--------------------SLR--NGGSGFSTEVN-----P----L
A0A3C0N766      T-GDLDANLGTLG--------------------SLR--NGGSGFSTEVN-----P----L
K9W9J7          S-GNLDANLGTLG--------------------SLR--NGDPGFSSEVN-----P----L
Q7NJN6          S-SNLSANLGPLG--------------------NIQ--QQGLPFSNELN-----P----T
U5QCC3          S-SNLSASLGPLG--------------------NLQ--QQGLTFSTELS-----P----T
A0A1Z4JCS8      NGGNLDANLGTLG--------------------SYR--NSDPSFSPQVN-----P----L
A0A846GVZ3      --GKLQASLGTLG--------------------SLT--KGDSELSAKSH-----P----L
A0A6P0PI80      --GKLQASLGTLG--------------------SLT--KGDSELSAKSH-----P----L
A0A6P0WGT6      --GKLQASLGTLG--------------------SLT--KGDSELSAKSH-----P----L
F4XTX2          --GKLQASLGTLG--------------------SLT--KGDSELSAKSH-----P----L
A0A3S0Y9N9      ATSS--L--------TGVG------------S-QLG--QLENSV--SGK-----P----M
A0A6P0ZKB8      STSS--L--------TGVG------------S-QLG--QLESSV--SGR-----P----L
A0A846EDH6      STSS--L--------TGVG------------S-QLG--QLESSV--SGR-----P----L
A0A433UNK7      STSS--L--------TGVG------------N-QLG--QLESSV--SGR-----P----L
B8HNB0          QSTP--L------------------------GEEIN--STSSYSN-WSN-----P----L
A0A318BJ18      ASQV---------------------------T------NFQGVER-QSSLVDQEF----Y
A0A3B8Y8H9      GDSNRGLPGG-INS-------------------SLG--NFLGVSTNSDN-----Y----F
A0A2W1JVB9      QSGLTEL--------------------------DLG--GISPLSG-DSS-----P----L
A0A6H1U102      ASTP-----------------------------LVP--GAP--EIATRK-----D----R
A0A7C3ZEJ3      TGVS-----------------------------IEP--TVPLQDGYTAK-----D----L
A0A2P8W9H0      TLET---------------------------Q-IISTLNPNALSN-QTEFGNSTI----D
A0A6I5P386      TPES---------------------------K-VVSNLTSEGLGD-AINSADIAV----D
A0A3M1SVZ4      SSTP---------SVTGVG------------S-EVG--LLDPLTK-ENS-----P----L
A0A318BG22      APRV--L--------------------------DVNSAESDSRPS-DSM-----F----M
A0A2T1E9V8      KTSS--L--------IGLD------------S------DAQAMDSQSNS-----S----L
A0A1Z4LN32      RTSS--L--------TGAG------------E-EIG--HLESIKR-EAN-----P----L
A0A2I8A9F5      RTSS--L--------TGIG------------G-KIG--DLESI---GSN-----P----L
A0A218Q6R8      RTSS--L--------TGVG------------G-RIG--DLESI---GAN-----P----L
A0A218QGE0      QTSS--L--------TGVG------------E-KIG--HLESIKP-EAN-----P----L
A0A846HDH5      QTSS--L--------TGVG------------E-KIG--HLESIKR-EAN-----P----L
A0A3M2GQQ6      SSVP-----------------------------VVP--GLESPYPGPQK-----D----L
A0A6H1U2X0      SSVP-----------------------------VVP--GLESPYPGPQK-----D----L
K9TLQ0          KGQD-----------------------------NLE--QLNQALTRNSGKGEILD----Y
K9QF04          TSDS---------DSNPLA--------------DSP--RRSAVVPLQFR-----D----F
K9W1T3          NSTSLLL--------------------------NLD--KIDGSAG-AGN-----Q----I
K9SGJ5          TISVSNLPVN-D----GLD--------------KYS----------KEP-----S----L
A0A6N2JS94      TIAVSDIQLP------GLP--------------S-S----------STV-----N----L
A0A6C2DSN4      TIPVSDIQVP-NAPSSGLP--------------A-S----------PVI-----N----L
L8MYT6          TIPVSDIQVP-NAPSSGLP--------------A-S----------PVI-----N----L
A0A352JGJ6      TIAISDIQVP------GLP--------------G-S----------SLI-----N----L
A0A1J5GLS2      TIAVSDIQIP------GLP--------------G-T----------SSI-----N----L
A0A2W4W6M5      TIAVSDIQVP------GLP--------------S-A----------SLI-----N----L
A0A2W7AN33      TISAPNIQPT------GAS--------------T-S----------SMV-----D----L
A0A256BLV2      TIAVSDIQLP------GLS--------------T-S----------SLV-----N----L
A0A2W6ZXF3      TIAVSDIQVP------GLP--------------G-A----------SSI-----N----L
A0A2Z5WX66      TIAVSDIQVP------GLP--------------G-T----------SLI-----N----L
Q7NEU3          -DRNSQP--------KVLA------------D-EAS--PMSYFAS-NSA-----D----I
A0A3C0N2P0      SSSEDKL--------GKLA------------Q-SLN--EGGGSSS-NTP-----D----Y
A0A6P0JR04      -AGEASF--------DQFS------------Q-RLI--GQLGFEL---------D----Y
A0A6B3M6M6      -TGEQKL--------DQLN------------Q-SLK--TTAGIQT-DGL-----D----Y
A0A6P0KD09      -TGEQKL--------DQLN------------Q-SLK--TTAGIKA-DGL-----D----Y
A0A6B3NIJ0      -TGEQKL--------DQLN------------Q-SLK--TTAGIKA-DGL-----D----Y
A0A6M0F053      -TGEQKL--------DQLN------------Q-SLK--TTAGIKA-DGL-----D----Y
A0A6P2ATU9      -ASEQQF--------DQFS------------Q-RLI--GQLGLDF---------D----Y
A0A845XAM4      -ASDQRF--------DQFS------------Q-SLV--NQLGLEF---------D----Y
A0A352XE00      -SGGDRL--------DELS------------Q-SLA--QNTGSQG-NAP-----D----Y
A0A6P0QC14      -SGEDQV--------DKLT------------Q-SLG--QNVGIEV-EGP-----D----Y
B4VS56          -SGEDQL--------EQIS------------E-SLN--QSAGVQT-NSI-----D----Y
A0A352AAQ3      -SGEDRV--------EQLT------------E-ALS--KTANIQV-EGP-----D----Y
A0A350Y472      -SGEDQA--------EQLT------------E-ALS--KTGTVQV-QGP-----D----Y
A0A355DVB4      -SGEDQA--------EQLT------------E-ALS--KTGTVQV-QGP-----D----Y
A0A1Z4RMB9      SAAS--Y--------TGIG------------E-EAG--TLKPILN-DQT-----P----L
A0A318B4H2      QAKV--V--------------------------NVGGLEMEDRSR-DLQ-----F----Y
A0A2K3BR24      SQAL-----------------------------ALP--TLEQQG--NAG-----P----L
K9YXY1          SQAL-----------------------------ALP--TLEQQG--NAG-----P----L
A0A1Q4RTR1      N-----LYSS-LTGITGGQ--------------ELE--MLGRGAN-AGN-----P----L
A0A1Z4SQV2      N-----LYSS-LTGITESQ--------------NID--V--PGIN-STN-----P----L
A0A2H2XGN1      N-----LYSS-LTGITESQ--------------NID--V--PGIN-STN-----P----L
A0A433UXH8      N-----LYSS-LTGITEGQ--------------NID--V--PGIN-SNN-----P----L
A0A1U7HGH0      RSSS--L--------IGLQ--------------SAT--QANPTTQ-NDT-----S----L
K9XJD3          RSSS--L--------IGLQ--------------SAT--QANPTTQ-NDT-----S----L
K9SX01          RQSN-----------TLTG------------VNSVA--QISDTVA--GD-----P----R
A0A4P7ZT55      LSEDRQL--------GGPS------------N-QLS--DLALVNP-GTV-----D----L
A0A1E5QIR9      NVTT---------NVTVVG------------K-EVP--EIHSP---PTN-----P----L
A0A6P1A9A0      TNEQ--I------------------------N-PLA--EQAGVST-KSV-----D----Y
A0A1Z4IBC7      RTFS--L--------TGLP------------Q-DIG--KLEPLNV-NDN-----P----L
A0A5Q0GKD1      RTSS--L--------TGLP------------Q-DIG--RLEPLNV-NDN-----P----L
Q3MDC6          RTSS--L--------TGLP------------Q-DIG--RLEPLNV-NDN-----P----L
A0A1Z4KM73      RTSS--L--------TGLP------------Q-DIG--RLEPLNV-NDN-----P----L
Q8YNX7          RTSS--L--------TGLP------------Q-DIG--RLEPLNV-NDN-----P----L
A0A367R4K6      RTSS--L--------TGLP------------E-DIG--RLEALNV-NDN-----P----L
A0A1E2WSV8      RSSS--L--------TGLP------------Q-DIG--RLEALNV-NDN-----P----L
A0A7D7L9Y1      RSSS--L--------TGLP------------Q-DIG--RLEALNV-NDN-----P----L
A0A2R5FRT9      RSSS--L--------TGLS------------E-DIG--RLEALNV-NDN-----P----L
A0A2K8T1B6      RSSS--L--------TGLS------------Q-DIG--RLEALNV-NDN-----P----L
A0A235I9I0      RSSS--L--------TGLP------------D-DIG--RLEALNV-NDN-----P----L
A0A2D0HQT8      RSSS--L--------TGLP------------D-DIG--RLEALNV-NDN-----P----L
A0A2L2NU95      RSSS--L--------TGLP------------D-DIG--RLEALNV-NDN-----P----L
A0A367S084      RSSS--L--------TGLP------------D-DIG--RLEALNV-NDN-----P----L
A0A1Z4SMD6      RTSS--L--------TKVG------------E-KIG--DLESVMR-EGN-----P----L
A0A2H2Y096      RTSS--L--------TKVG------------E-KIG--DLESVMR-EGN-----P----L
K9S8M8          NTTSALV--------TDAS------------A-KVG--ELDTLSD-KDT-----P----L
A0A1Z4NFV0      RTSA--Y--------TKIG------------E-NTG--SLESLRH-ESN-----P----L
A0A3M9ZEU1      RSSS--L--------VGLT------------KVETG--ELQALTT-ANS-----P----V
A0A1Z4JK72      RTTS--L--------TGVG------------E-KVG--TLESLKR-EGN-----P----L
A0A0N7Z489      RTTS--L--------TGVG------------E-RVG--TLEALRR-EGN-----P----L
A0A0S3TXS2      RTTS--L--------TGVG------------E-RVG--TLEALRR-EGN-----P----L
A0A2A2TPF8      RTNS--L--------TGVD------------G-KFR--DLESIRR-EAN-----P----L
A0A1Z4R0P8      RTNS--L--------TGVD------------G-KFR--DLESIRR-EAN-----P----L
A0A0T7BUI3      RISS--L--------TKAG------------E-KIG--DLESLIR-ENN-----P----L
A0A1Z4LP32      RISS--L--------TKAG------------E-KIG--DLESLMR-EGN-----P----L
K9REP9          RISS--L--------TKAG------------E-KIG--DLESLMR-EGN-----P----L
A0A1Z4SIJ3      RISS--L--------TKAG------------E-KIG--DLESLMR-QGN-----P----L
A0A2H2XPG4      RISS--L--------TKAG------------E-KIG--DLESLMR-QGN-----P----L
A0A2A2TC28      RTSS--L--------TKVG------------E-KIG--DLESLMR-EGN-----P----L
K9V3C7          RTSS--L--------TGVG------------E-KIG--SLESFRN-EAN-----P----L
A0A1Z4T6Y7      RASF--L--------TGVG------------E-KIG--DLETVRR-EAN-----P----L
A0A2H2Y561      RASF--L--------TGVG------------E-KIG--DLETVRR-EAN-----P----L
A0A1Q4S362      RASL--L--------TGVG------------E-KVG--DLESVRR-EAN-----P----L
A0A3S1CIN8      RASL--L--------TGVG------------E-KVG--DLESVRR-EAN-----P----L
A0A0C1NCB0      RTSS--L--------TKAG------------E-KIG--HLESLMR-EGN-----P----S
A0A844MLU2      RTSS--L--------TKAG------------E-KIG--HLESLMR-EGN-----P----S
A0A2N6K7Q9      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A2N6MXH6      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A2N6M5A8      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A2N6LL61      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A0S3TP66      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
G6FP91          RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A1U7GYR5      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A2N6KY52      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A2N6KMP5      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A2N6MA45      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A4Q9J9V9      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A328IGA1      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A4D9CE41      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A0M0SFT2      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A1Z4TLC8      RTSS--L--------TKVG------------E-KIG--DLEALMR-EGN-----P----L
A0A1Z4IYV4      RTSS--L--------TKVG------------E-KIG--DLESLMR-EGN-----P----L
A0A1Z4Q0T6      RTSS--L--------TKVG------------E-KIG--DLESLMR-EGN-----P----L
A0A0C2PT44      RTSS--L--------TKVG------------E-KIG--DLESLMR-EGN-----P----L
A0A1D2P6J4      RTSS--L--------TKVG------------E-KIG--DLESLMR-EGN-----P----L
A0A0C2LFH0      RTSS--L--------TKVG------------E-KIG--DLESLMR-EGN-----P----L
A0A856M734      RTSS--L--------TKVG------------E-KIG--DLESLMR-EGN-----P----L
B4WP72          RTSS--L--------TGLN------------V-DIG--ELEALDSLQKD-----P----L
A0A2T1CIL7      KSSQ--L--------VGLE------------E-ERG--QIEVIGK-DSN-----P----V
A0A433V7A0      TTPF--LIGI-KTKD----------------E-NVS--PLVPLTF-EGN-----P----L
A0A2T1FTR8      NKTS--ALLS-SATNAASG------------G-AIG--ELEGLTG--ST-----P----V
K9UA41          NKTS--ALLS-SATNAASG------------G-AIG--ELEGLTG--ST-----P----V
A0A563VS48      KTDT--L--------SGFE------------N-ETG--NIEVISE-ESD-----P----L
A0A7Y0NUK1      RSAT--F--------TGLE------------N-DTG--KIDVTSQ-NSD-----P----L
A0A0C2LBE2      RTSS--L--------TGLG------------E-AIG--RLDTLTM-ESN-----P----S
A0A433NN38      RTSS--L--------TGLG------------E-DLG--RLEALVS-QSS-----P----V
A0A2N6K0T2      RTSS--L--------TGLG------------E-DLG--RLESLVQ-DNS-----P----V
A0A2N6ML72      RTSS--L--------TGLG------------E-DLG--RLESLVQ-DNS-----P----V
G6FQZ6          RTSS--L--------TGLG------------E-DLG--RLESLVQ-NNS-----P----V
A0A2N6MQX9      RTSS--L--------TGLG------------E-DLG--RLESLVQ-DNS-----P----V
A0A2N6KXT6      RTSS--L--------TGLG------------E-DLG--RLESLVQ-NNS-----P----V
A0A2N6KGB9      RTSS--L--------TGLG------------E-DLG--RLESLVQ-DNS-----P----V
A0A2N6L3Y5      RTSS--L--------TGLG------------E-DLG--RLESLVQ-DNS-----P----V
A0A0S3TIS7      RTSS--L--------TGLG------------E-DLG--RLESLVQ-DNS-----P----V
A0A1U7GW28      RTSS--L--------TGLG------------E-DLG--RLESLVQ-DNS-----P----V
A0A2N6LW63      RTSS--L--------TGLG------------E-DLG--RLESLVQ-DNS-----P----V
A0A328IH74      RTSS--L--------TGLG------------E-DIG--RLESLVR-ENS-----P----V
A0A4D9CIB0      RTSS--L--------TGLG------------E-DIG--RLESLVR-ENS-----P----V
A0A1Z4TQ63      RASS--L--------TGLG------------E-DIG--RLESLAE-NNT-----P----L
A0A4Q9J8G2      RASS--L--------TGLG------------E-DLG--RLESLAE-KDS-----P----L
A0A350Y0P6      SATS--ALVT-EAG-----------------E-KIG--QLEALNNFINT-----P----L
A0A352X940      NKTS--ALVT-KAG-----------------E-KIG--ELDSLNAFINT-----P----L
B8HTN4          ENPL--ASMG-A-------------------T-SVG--NLVALGG-KSS-----P----I
A0A6P1AFJ5      TTDP--TT-----------------------N-IVA--ENQPLSA-SRL-----D----Y
B0CAX4          GGAT--IADL-EI------------------G-GLG--GLEALSS-KSS-----P----V
A0A1Z4RN12      RTSK--L--------IGID------------T-NPE--EIKGLTQ-DKD-----P----I
A0A2T1CMF9      QTSR--R--------IGIE------------D-GNP--EVKKTVL-EKD-----P----I
Q7NDC5          DTAI--DNPT--AVGLR--------------G-ALG--QMGS-VA-YGN-----P----L
U5QGK3          DTAV--GSEN-PARSLR--------------G-SLG--QLDS-VA-FGN-----P----L
A0A2W4UY24      KPVT--AIVG-LD------------------T-GEG--NLTPLTS-QSN-----P----L
A0A838VM23      SQTT--ALTG-LGG-----------------E-KLG--QLEGLDM-KSS-----P----I
A0A0D8ZUV2      NETS--AATG-LGS-------------------QIG--ELDTLAQ-QTN-----P----L
A0A433VDI0      DWAS--AATG-VGE-------------------QIG--ELDTLAQ-QSN-----P----L
A0A3D1PG43      DNAS--SVTE-LSQ-----------------T-DNS--ELEPLSQ-LGN-----P----S
A0A2P8QQ72      SETS--SLN---PE-----------------K-YEP--RLEPLSA-ESN-----P----V
K9TZQ7          SETS--SLN---PE-----------------K-YEP--RLEPLSA-ESN-----P----V
A0A6N8G584      DRTT--AISG-LKD-----------------I-NVG--ELEAIAA-KAN-----P----L
A0A2G7GPR0      DRTT--AISG-LKD-----------------I-NVG--ELEAIAT-KAN-----P----L
K9XH68          DRTT--AISG-LKD-----------------I-NVG--ELEALAT-KAN-----P----L
A0A1U7HW70      DRTT--AISG-LKD-----------------I-NVG--ELEAIAT-KAN-----P----L
A0A2S6VEJ8      DRTA--AISG-LKD-----------------I-NVG--ELEALAA-KAN-----P----L
A0A140KBA0      KSAK--L--------TGLE------------N-DIG--KIEVLTN-ESD-----P----L
K9XSG1          KSAK--L--------TGLE------------N-DIG--KIEVLTN-ESD-----P----L
A0A2T1GMT4      TFRV--IGPN-LIPNSMEG------------S-ESG--DLKSLVS-TQN-----P----I
K9UI51          TFRV--IGPN-LIPSNMEG------------S-ESG--DLKSLVS-NQN-----P----I
A0A1Z4QL41      SFQI--LGTN-LLPNSSEG------------G-GIG--DLKPLVS-TQN-----P----I
K9TYI2          SFNV--VGSN-LLPSISEG------------Q-ETG--DLRALVS-TQN-----P----V
A0A252D4T4      SFNV--VGTN-LLPSDSEG------------G-TSG--DLKPLVS-TQN-----P----I
A0A252DJH5      SFNV--VGTN-LLPSDSEG------------G-TSG--DLKPLVS-TQN-----P----I
A0A252EB80      SFNV--VGTN-LLPSDSEG------------G-GSG--DLKPLVS-TQN-----P----I
A0A6G9SKZ9      SFSV--VGAD-LLPSESE---------------ARG--DLRPLVS-TQN-----P----I
A0A1Z4HPW5      SFNV--VGTE-LLPTETQ---------------ARG--DLRPLVS-TQN-----P----I
A0A1Z4MSN1      SFNV--VGSE-LLPSESQ---------------ARG--DLRPLVS-TQN-----P----I
A0A1Z4U1C2      SFNV--VGSE-LLPSESQ---------------ARG--DLRPLVS-TQN-----P----I
A0A0D6KV51      TFNV--VGSE-LLPSESQ---------------ARG--DLRPLVS-TQN-----P----I
A0A1Z4MKF8      TFNV--VGSE-LLPSESQ---------------ARG--DLRPLVS-TQN-----P----I
A0A2C6WC43      SFKV--VGSN-LLPTTTEG------------G-STG--DLKSLIA-SQN-----P----I
A0A841WRE0      SFKV--VGSN-LLPTTTEG------------G-STG--DLKSLIA-SQN-----P----I
A0A1Z4L5A1      SFKV--VGSN-LLPTTTEG------------G-STG--DLKSLIA-SQN-----P----I
A0A367QD86      SFKV--VGSN-LLPTTTEG------------G-STG--DLKSLIA-SQN-----P----I
A0A2K8SM78      SFKV--VGSN-LFPTNAEG------------G-DPG--DLKSLLA-TQN-----P----I
A0A2R5FPC0      SFKV--VGSN-LFPTNAEG------------G-DPG--DLKSLLA-TQN-----P----I
A0A5P8W5T6      SFKV--VGSN-LLPTNTEG------------G-DAG--DLKSLLA-TQN-----P----I
A0A7D7LDT7      SFKV--AGTN-LSPGSSEG------------G-DSG--DLKPLVA-TQN-----P----I
A0A235IZ96      SFKV--AGSN-LSPGSSEG------------G-DSG--DLKALVA-TQN-----P----V
A0A2L2NGP0      SFKV--AGSN-LSPGSSEG------------G-DSG--DLKALVA-TQN-----P----V
K9QM62          AFNI--VGSN-LLPNSSEG------------E-FRG---LRALVS-TQN-----P----I
A0A1Z4FWI3      SFNV--VGTN-LLPNGSEG------------Q-ATG--DLKSLVS-NQN-----P----I
A0A1Z4JYE7      SFKT--IGTN-LLPNNNEG------------D-AAG--DLKSLVS-TQN-----P----I
A0A0F5YE28      RTSS--L--------AGIG------------E-GLG--ELKALLA-DQT-----P----L
U7QEH7          RTSS--L--------AGIG------------E-GLG--ELKALLA-DQT-----P----L
A0A3S1ATK5      SFQV--LGNN-LLRSNSEG------------E---G--DLKSLVS-TQN-----P----I
A0A2Z6CPH0      SFKT--VGTN-LLPNNNEG------------D-QAG--DLKSLVS-TQN-----P----I
A0A1Z4GT50      SFKV--IGSN-LLPNNSEG------------E-EA---DLKPLVS-TQN-----P----I
A0A1Z4GIX0      SFNV--VGTN-LLPSNNEG------------E-ETG--DLRSLVS-TQN-----P----I
A0A2H6LC24      SFNV--VGTN-LLPSNNEG------------E-ETG--DLRSLVS-TQN-----P----I
B2J6N5          SFKV--VGSN-LLPTNTEG------------G-DAG--DLKSLLA-TQN-----P----I
A0A367RMI4      SFKV--AGNN-LYPDTSEG------------G-DAG--DLKPLVA-TQN-----P----I
A0A235HUM0      SFKV--AGNN-LSPGTSEG------------G-DSG--DLKPLVA-TQN-----P----I
A0A2L2NW47      SFKV--GGNN-LSPGTAEG------------G-DSG--DLKPLVA-TQN-----P----I
A0A1E2WUR1      SFKV--AGTN-LSPGSSEG------------G-DSG--DLKPLVA-TQN-----P----I
A0A235IKU3      SFKV--AGSN-LSPGSSEG------------G-DSG--DLKALVA-TQN-----P----V
A0A1U7MYU6      RTAF--L--------TGLG------------E-EIE--QLRPLVD-AQN-----P----L
A0A1D8TNX9      RTAF--L--------TGLG------------E-EID--QLRPLVD-AQN-----P----L
A0A6P0L6C2      RTAF--L--------TGLG------------E-EID--QLRPLVD-AQN-----P----L
A0A6P0MVH0      RTAF--L--------TGLG------------E-EID--QLRPLVD-AQN-----P----L
A0A6P0KJV0      RTAF--L--------TGLG------------E-EIE--QLRPLVD-AQN-----P----L
A0A6L9ZJG4      RTPF--L--------TGLG------------E-EIE--QLRPLVD-AQN-----P----L
A0A846GI17      RTAF--L--------TGLG------------E-EID--QLRPLVD-AQN-----P----L
F4XKF3          RTAF--L--------TGLG------------E-EID--QLRPLVD-AQN-----P----L
A0A1D9FX10      RTAF--L--------TGLG------------E-EID--QLRPLVD-AQN-----P----L
A0A6P0Q0T0      RTAF--L--------TGLG------------E-EID--QLRPLVD-AQN-----P----L
A0A6P0W5I0      RTAF--L--------TGLG------------E-EID--QLRPLVD-AQN-----P----L
A0A845XJ02      RTAF--L--------TGLG------------E-EID--QLRPLVD-AQN-----P----L
A0A846D190      RTAF--L--------TGLG------------E-EID--QLRPLVD-AQN-----P----L
A0A3C0NJ41      RTAS--L--------TGVGQVERLEGGQTAQQ-PVG--GLGALTQ-TGN-----P----V
A0A352AG88      RTAD--L--------TGVG------------Q-QVG--ELAPLTT-NSN-----P----I
A0A350Y374      RTTS--L--------TGLG------------K-EVG--NFAPLTT-DSN-----P----I
A0A355DPX0      RTTS--L--------TGLG------------K-EVG--NFAPLTT-DSN-----P----I
A0A0S3TYD7      --KKQASTTSVLGLQVDVG--------------EIE--SL----D-KSG-----P----L
A0A2T1DNG3      YQGKNSGADPFTD------------------------------AT-VEV-----D----Y
A0A140K3H3      KTQQSASVSP-----EQQS--------------LAT--GY----Y-NLK-----D----L
K9XUB8          KTQQSALVSP-----GQQS--------------LNT--GY----S-NLK-----D----L
A0A563VLD6      QTKESARIVP-----GNMT--------------RGS--AF----S-SLR-----D----L
A0A7Y0NVW6      KTQEAAPVAP-----TDFA--------------GAN--AF----S-NLK-----D----L
U5QL42          QQI---------------P--------------VVQ--TTESALP-SAA-----N----L
A0A6H2NHD5      TSANSL---------EGDL--------------LNL--SQGTRSG---L-----D----Y
A0A2P8W4F7      TNAPPV---------GLEE--------------VVG--AQGNRGA---L-----D----Y
A0A5Q4E0Z4      TAVNPL---------GLEA--------------MVG--VAGARNT-SGL-----D----Y
A0A2P8VVX1      YQQELN-----------SS--------------DLS--SFADQDP-RDA-----D----Y
A0A2P8WHY0      YEDDVT-----------AR--------------ELD--GLANASD-QSI-----D----Y
A0A563VQJ3      TAASLT---------GIGE--------------DIS--SLDSIGV-NET-----P----L
A0A7Y0IRJ7      TEATLT---------GIGE--------------EAS--QLTTIGV-NET-----P----L
A0A2T1CMT9      YQAKDL-----QD--NQRD--------------SEE--QFADANV-EL------D----Y
A0A7G8J1V5      FSNQRG--NRGGG--STGS--------------SAF--EELARNT-TNN-----D----I
A0A354B169      ISSENSNGNSNAT--ALSG--------------TMF--EQLARNT-TSN-----D----L
Q0IDT5          ISNEGGNNSAASS--AASG--------------TVF--EQLARNT-TQN-----D----I
A0A7G8FZD9      ISSDSGNNSGSSS--GLNG--------------TVF--EELARNT-TSN-----D----L
G4FMX5          ISNDSGNNSASAG--GLNG--------------SMF--EELARNT-TSN-----D----L
A3ZA21          ISNEGGNGRNAAF--AASG--------------TMF--EQLARNT-TQN-----D----I
A0A076HBF2      ISNEGG-GRSGMA--NVEG--------------TMF--EQLARNT-TSN-----D----I
A0A7G8FP50      FNSKNG-G----S--GVGG--------------TVF--ERLAINT-TSN-----D----T
A0A7G8E8K7      ISNE-N-GRSSMA--NVEG--------------TMF--EQLALNT-TSN-----D----I
A0A7G8GNR2      ISNEGG-GRAGMA--NVEG--------------TMF--EQLARNT-TSN-----D----I
A0A7G8ICD3      ISNEGG-GRSGMA--NVEG--------------TMF--EQLARNT-TSN-----D----I
A0A2D6FCW3      LNNESG-NRAAAA--ALDG--------------GMF--EELARNT-TSN-----D----I
A0A7G7KJ95      ISTEGG-GSHAAA--GFNN--------------TMF--EQLARNT-TSN-----D----I
A0A7G8EAN3      ISEEGR-GRLPA-----NN--------------DMF--EQLARNT-TSN-----D----I
A0A1D8TX52      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A1D9G4T2      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6P0PR27      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6P0WER7      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A845XM36      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A846DAT1      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A846GZK8      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
F4XP71          YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6P0KZ31      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6P0LPB8      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6L9YR57      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A845WMG9      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6P0SEV1      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6B3N2I8      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6M0B891      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6P0IJQ1      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6P0J8J8      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6P0ZSH6      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A845VS63      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A1U7N5X9      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6L9Z1V0      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6P0LC12      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A6P0MVJ3      YIDKTR------------G--------------IES--QFTESTV-DI------D----Y
A0A2W6ZAV2      IDASST-----EG--AADS--------------SLR--ALALQPQ-DRA-----N----T
K9W742          YQSKRQ-----DG--Q-EG--------------AEK--QIVDPNI-QV------D----S
A0A3D1PBA3      YQGKRDT----DA--Q--R--------------PSQ--QYAESGV-KID-----D----Y
K9XPB0          YQTKDSTRGNDNN--Q--Y--------------LEE--EFADSSI-EI------D----Y
A0A350Y7Z1      VQQKQE-----GK--P--Q--------------TEE--QFTDSNV-EV------D----Y
A0A352X2A7      VQEKQQ-----RR--S--E---------------EN--QFTESNI-EV------D----Y
A0A0D8ZYV0      YQGRKD-----IQ--P--G--------------ADS--EFTDANV-EI------D----Y
A0A433VMS2      YQGKKDG----TT--P--R--------------QGE--QYADSGV-TID-----D----Y
K9TYA7          YQGKKDG----TT--P--R--------------QGE--QYADSGV-TID-----D----Y
A0A2P8QUE1      YQGKKDG----TT--P--R--------------QGE--QYADSGV-TID-----D----Y
K9SA61          YQGRDQ-----NG--D-RA--------------SEG--QFTDSNV-KL------D----Y
A0A2G7GMH8      YQGKTD-----QG--QGKT--------------TES--EFADSNV-EV------D----I
A0A6N8FU92      YQGKSE-----QG--QRKT--------------TES--DFTDSNV-EV------D----I
A0A2T1DWE8      YQSKKD-----SG--A--G--------------SEN--QFADSNV-EI------D----Y
A0A832H7C4      YQGKRG-----Q---T--Q--------------NDL--SFADSNV-EV------D----Y
A0A1U7I8L3      YQGKQE-----GS--K--N--------------AEN--DFADSNV-EI------D----Y
A0A2T1DJL8      YRSRKT-----DN--P--A--------------TPS---FADSNV-EI------D----N
A0A1Z4J9W0      YRERRS-----PN--D--T--------------RPS---FADPNV-ET------D----A
A0A0N7Z5K9      YRERRA-----PG--D--N--------------SPS---FADPNV-ES------D----T
A0A0S3TXC5      YRERRT-----PG--D--N--------------SVS---FADPNV-ET------D----T
A0A846FBD3      KTDRTSSLAG-LR--NKIG--------------EFD--TL---AK-NSD-----P----L
K1XF69          KVDRTSSLAG-IG--EGLG--------------ELK--AL---LA-DQT-----P----L
B5W297          KVDRTSSLAG-IG--EGLG--------------ELK--AL---LA-DQT-----P----L
H1W7M8          KVDRTSSLAG-IG--EGLG--------------ELK--AL---LA-DQT-----P----L
A0A5Q4H6A5      KVDRTSSLAG-IG--EGLG--------------ELK--AL---LA-DQT-----P----L
D5A466          KVDRTSSLAG-IG--EGLG--------------ELK--AL---LA-DQT-----P----L
B4WQE3          LVTLETQIISTISPDALSN--------------QSE--SV----G-VGL-----L----D
U5QJM6          DKSSQTQVLE-DA--AQQI--------------QLG--GG---AD-FTT-----Q----I
A0A0V7ZFJ4      NSDRVSALTA-LN--SQMG--------------EVA--AI---TG-KGN-----P----L
A0A235IXQ2      KQSGVSSLTG-VN--EQLG--------------QLS--GV---TN-VSN-----P----L
A0A367RIS1      KESGLSSLTG-VN--EQLG--------------QLS--GV---TN-LSN-----P----L
A0A841V8H9      KESGVSSLTG-VS--EQLG--------------QLS--GV---TN-LSN-----P----L
A0A5Q0GJJ5      KQSGVSSLTG-VS--EQLG--------------QLS--GV---TN-LSN-----P----L
Q3MEB7          KQSGVSSLTG-VS--EQLG--------------QLS--GV---TN-LSN-----P----L
A0A1Z4KHN9      KQSGVSSLTG-VS--EQLG--------------QLS--GV---TN-LSN-----P----L
Q8YT70          KQSGVSSLTG-VS--EQLG--------------QLS--GV---TN-LSN-----P----L
A0A7U3NLX2      KQNSISSLTG-VS--ESLG--------------ELS--GV---GV-GSN-----P----L
A0A166IWU6      KQNSVSSLTG-VS--EGVG--------------ELS--GL---TS-SSN-----P----L
A0A2S0Q8C0      KQNSVSSLTG-VS--EGVG--------------ELS--GL---TN-SSN-----P----L
W6FSX4          KQNSVSSLTG-VS--EGVG--------------ELS--GL---TS-SSN-----P----L
A0A218Q4C1      KQSSVSSLTG-VS--ERVG--------------ELS--RL---TN-LSN-----P----L
A0A6P1ZT04      KQSSVSSLTG-VS--ERVG--------------ELS--GL---TN-LSN-----P----L
A0A0V7ZNJ9      KQSNVSSLTG-LS--GAVG--------------ELS--GI---TN-LSN-----P----L
A0A5P8VSD1      NNQSPSSLTA-VS--QQLG--------------QLT--GL---TT-NSN-----L----L
A0A1S1ZVW2      KKDGVSSLTS-LA--TSVG--------------ELG--GV---GN-NSN-----P----I
A0A0R0M9H9      KKDGVSSLTS-LA--TSVG--------------ELG--GI---GN-NSN-----P----I
A0A7H0F4U6      KKDGVSSLTS-LA--TSVG--------------ELG--GL---GN-NSN-----P----I
A0A7W2A1T7      KKDGVSSLTS-LA--TSVG--------------ELG--GL---GN-NSN-----P----I
A0A838WI98      KKDGVSSLTS-LA--TSVG--------------ELG--GL---GN-NSN-----P----I
A0A853MJX6      KKDGVSSLTS-LA--TSVG--------------ELG--GL---GN-NSN-----P----I
A0A1B7WX82      KKGVASSLTTNIS--QQMG--------------ELG--GL---TN-LSN-----P----V
A0A1B7WTD1      KKDAASSLSS-LS--DKMG--------------ELG--GL---TN-LSN-----P----V
A0A480ABC0      KKDAASSLSS-LS--DKMG--------------ELG--GL---TN-LSN-----P----V
A0A1Z4LRU5      KNNNVSSLSG-LG--GQIG--------------ELS--GI---TN-LSN-----P----L
A0A1Z4JVB4      KQNGISSFSD-IA--AKAG--------------ELR--GL---TS-FSN-----P----V
K9PIA4          KQNGVSSLTG-FS--SKMG--------------ELG--GL---TN-LSN-----P----V
A0A1Z4HVE1      KQNGVSSLTG-LS--SQVG--------------ELS--GL---TN-LSN-----P----V
A0A252ECZ1      KQSGVSSLSG-LS--SQVG--------------ELS--GL---TN-LSN-----P----V
A0A1Z4G5Y1      KQSGVSSLTG-LS--SQVG--------------ELS--GL---TN-LSN-----P----V
A0A252DNA2      KQSGVSSLTG-LS--SQVG--------------ELS--GL---TN-LSN-----P----V
A0A252E1Q4      KQSGVSSLTG-LS--SQVG--------------ELS--GL---TN-LSN-----P----V
A0A6G9SK36      KQNGVSSLTG-IS--AQVG--------------ELS--GL---TN-LSN-----P----V
A0A1Z4M597      KQNGVSSLTG-LS--SQVG--------------ELS--GL---TN-LSN-----P----V
A0A1Z4MWT1      KQNGVSSLTG-LS--SQVG--------------ELS--GL---TN-LSN-----P----V
A0A1Z4TX53      KQNGVSSLTG-LS--SQVG--------------ELS--GL---TN-LSN-----P----V
A0A2A2TNQ5      KQNEASNLTG-LN--QKLG--------------ELS--GL---TN-TSN-----P----L
A0A3S1C4K5      KNNGASSLTG-LS--EKVG--------------ALS--AL---TN-TSS-----P----L
A0A1X4G3D5      RVSSLTRLGG-LA--ELAQ--------------LTG--AT---GS-GGS-----G----L
D4TNI2          RVSSLTRLGG-LA--ELAQ--------------LTG--AT---SS-GGS-----G----L
A0A1Z4H6Z8      KQSGASSLSG-LS--SQVG--------------ELS--GL---TN-LSN-----P----V
A0A3F3KPR9      KKDGVSSLTS-LA--TSVG--------------ELG--GL---GN-NSN-----P----I
A0A1Z4NPM1      KQNSSSSLIG-LS--DKLG--------------ELS--GL---TN-TSN-----P----L
A0A1Z4UZW9      KKSGASSLTS-LS--QQMG--------------ELG--AL---TN-LSN-----P----V
A0A1B7VSH4      KKSGASSLSG-LS--QQMG--------------ELG--AL---TN-LSN-----P----V
A0A1B7W126      KKSGASSLSG-LS--QQMG--------------ELG--AL---TN-LSN-----P----V
A0A3D4C6Q6      KKSGASSLSG-LS--QQMG--------------ELG--AL---TN-LSN-----P----V
A0A0K2M5H0      KKSGASSLSS-LS--QQMG--------------ELG--AL---TN-LSN-----P----V
A0A844I4P0      KKSGASSLSS-LS--QQMG--------------ELG--AL---TN-LSN-----P----V
A0A1B7UVJ4      KRSGASSLAD-IS--QSMG--------------ELG--GL---TN-LSN-----P----V
A0A1B7UTR1      KRSGASSLAD-IS--QSMG--------------ELG--GL---TN-LSN-----P----V
K7W0A4          KKSGASSLAG-LS--QSLG--------------ELG--GL---TN-LSN-----P----V
A0A5C0DRW9      KKSGASSLAG-LS--QSLG--------------ELG--GL---TN-LSN-----P----V
A0A6H2C088      KKSGASSLAG-LS--QSLG--------------ELG--GL---TN-LSN-----P----V
A0A1Z4RPC6      KNSVD-SFLD-LQ--SKPE--------------QLN--SI---LP-DQT-----P----L
A0A2T1CMZ0      KNTPN-ELLN-LS--ENTN--------------EFN--SL---LN-TQT-----P----L
L8M4F7          SSSLA-SLTG-VA--KNSS--------------ALE--TLNYSLG-QQS-----P----L
A0A140K2P2      QNSTA-SLTG-VG--KNVG--------------ELK--PL---LV-NQS-----P----L
K9XWX4          QNSTA-SLTG-VG--ENVG--------------ELK--PL---LV-NQS-----P----L
A0A140KB14      QNNTA-SLTK-VG--QGVG--------------ELK--PL---LN-DQS-----P----L
K9XX88          QNNTA-SLTK-VG--QGIG--------------ELK--PL---LN-DQS-----P----L
L8LZE9          PQD---NLTD-LG--NPSN--------------DLQ--SL---TV-GAT-----P----L
A0A563VSV6      QKN---NLLP-VG--EGVG--------------ELT--TF---LN-NQT-----P----L
A0A7Y0IQB0      QKN---DLLP-VG--EGVG--------------ELK--TF---LN-NQT-----P----L
A0A433NM31      RTGSTSTVTG-LG--KELG--------------QLD--SLVDSPE-SNY-----P----V
A0A1Z4NDS1      TNNTP-SLTG-LG--EAIG--------------KLE--SL--TR--DSN-----P----S
U9VXM0          LSNQTSSLVG-FE--GGTR--------------ELR--AL--TN--LDN-----P----L
A0A6M0RI13      LSNQASALVG-LE--GGNR--------------ELR--AL--TN--LDN-----P----L
A0A6M0S1N5      LSNQASALVG-LE--GGNR--------------ELR--AL--TN--LDN-----P----L
K9F4D9          LSNQASALVG-LE--GGNR--------------ELR--AL--TN--LDN-----P----L
A0A6I5QPI5      SDRTT-SLTG-LG--DDRG--------------RVE--IL------AAD-----P----L
A0A1Z3HMQ0      VDRST-SLTG-VG--DEIG--------------DLE--AV--NPV-NSD-----P----L
A0A433W533      KNDQTAALTG-LG--QGIG--------------DLE--GL--NL--QSN-----P----V
A0A2P8QWJ3      KNDQTAALTG-LG--QGIG--------------DLE--GL--NL--QSN-----P----V
K9U6L7          KNDQTAALTG-LG--QGIG--------------DLE--GL--NL--QSN-----P----V
U5DPF5          TADGAIPFAG-FSGGSST----------------------------SNT-----L----L
A0A1E5QP61      KQNTTSALVT-DAG-AKIG--------------QLD--TL--TQ--FNN-----P----L
A0A846DWC7      KQNTTSALVT-DAG-AKIG--------------QLD--TL--TQ--FNN-----P----L
A0A845Y5J4      KRILSSLGTE-AG--EQIG--------------ELE--AL--NNF-INT-----P----L
A0A6P0X488      KRILSSLGTE-AG--EQIG--------------ELE--AL--NNF-INT-----P----L
A0A6P0VDM0      KRILSSLGTE-AG--EQIG--------------ELE--AL--NNF-INT-----P----L
A0A6P0UVD5      KRILSSLGTE-AG--EQIG--------------ELE--AL--NNF-INT-----P----L
A0A846BFF2      KRILSSLGTE-AG--EQIG--------------ELE--AL--NNF-INT-----P----L
A0A6M0G142      KRIVSSIGTE-AG--EQIG--------------ELE--AL--NNF-INT-----P----L
A0A6P0MR53      KRILSSLGTE-AG--EQIG--------------ELE--AL--NNF-INT-----P----L
A0A3M2GIL5      KRNTTSALVT-EAG-AKLG--------------ELD--SV--YQ--LNS-----P----L
A0A6H1TSJ9      KRNTTSALVT-EAG-AKLG--------------ELD--SV--YQ--LNS-----P----L
A0A3M1PML8      SSGAA-KLTG-VG--EGLG--------------ELE--KL--TL--QSN-----P----V
A0A6M8BE85      SSAAS-RLTG-VG--EGLG--------------ELE--RL--TL--QSN-----P----V
A0A0T7BPZ0      TNRTS-SLTG-LG--GDIG--------------RLE--SL--TQ--TNN-----P----V
A0A352X442      KDRSA-SLTG-LD--EALS--------------QFD--KL--AQ--KSD-----P----I
A0A6B3NF44      EDNSS-SLTG-LE--NEIG--------------ELK--GL--TN--TSD-----P----L
A0A6M0EPL4      EDNSS-SLTG-LE--NEIG--------------ELK--GL--TN--TSD-----P----L
A0A6P0K6L6      EDNSS-SLTG-LE--NEIG--------------ELK--GL--TN--TSD-----P----L
A0A6P0MRR9      EDRSAGALTG-LEGLDEAG--------------RLK--GL--TS--NSE-----P----L
A0A6P0X1X4      EDRSAGALTG-LEGLDETG--------------RLK--GL--TT--KSE-----P----L
A0A6P0UX57      EDRSAGALTG-LEGLDETG--------------RLK--GL--TT--NSE-----P----L
A0A846B9S8      EDRSAGALTG-LEGLDETG--------------RLK--GL--TT--NSE-----P----L
A0A0M0SHU3      TNRTS-SLTG-LG--EDIG--------------RIE--SL--VR--ENS-----P----V
A0A1D2PBN3      TNRTS-SLTG-LG--EALG--------------RLE--SL--GV--NNN-----P----S
A0A0C2LVR7      TNRTS-SLTG-LG--EALG--------------RLE--SL--GV--NNN-----P----S
A0A1Z4PQB9      TNRTS-SLTG-LG--EALG--------------RLE--SL--GV--NNN-----P----S
A0A1Z4SFN6      TNRST-SLTG-LG--ESIG--------------RIE--SL--TN--TNN-----P----L
K9PGI8          TNRSA-SLTG-LG--EGIG--------------QVD--SL--VN--TNS-----P----S
A0A654SFI6      -----IEISQ-IS--ANVT--------------SLD--PL--ENE-SRV-----SELQYL
K9SSQ0          EN----------------------------------------APT-DGN-----S----L
A0A2W1JIN9      DGTPSTSVSD-FG--STIA--------------QQP----------GNG-----A----L
A0A318AJV1      DPSL-----------NPMS--------------QDQ--GQ--GVI-GAE-----T----M
A0A845WDS5      DNKQ-VSVSP-LG--RDLS--------------QLP--NR--GPG-GAN-----P----I
A0A6P0IC70      DNKQ-VSVSP-LG--RDLS--------------QLP--NR--GPG-GAN-----P----I
A0A845VVD9      DNKQ-VSVSP-LG--RDLS--------------QLP--NR--GPG-GAN-----P----I
A0A6B3MUB5      DNKQ-VSVSP-LG--RDLS--------------QLP--NR--GPG-GAN-----P----I
A0A6M0B7N4      DNKQ-VSVSP-LG--RDLS--------------QLP--NR--GPG-GAN-----P----I
A0A6P0J9W3      DNKQ-VSVSP-LG--RDLS--------------QLP--NR--GPG-GAN-----P----I
A0A6P0ZWE1      DNKQ-VSVSP-LG--RDLS--------------QLP--NR--GPG-GAN-----P----I
A0A1U7N2U4      ENKK-VSVSE-LG--RNLS--------------QVP--AN--TPG-EAS-----P----I
A0A6L9YZL1      DNKK-VSVSE-LG--DNLS--------------QVP--AN--TPG-GAD-----P----I
A0A6P0KYM4      DNKK-VSVSE-LG--DNLS--------------QVP--AN--IPG-GAD-----P----I
A0A6P0LSD6      DNKK-VSVSE-LG--DNLS--------------QVP--AN--IPG-GAD-----P----I
A0A6P0PNZ7      DNKK-VSVSE-LG--DNLS--------------QVP--AN--TPG-GAD-----P----I
F4XV38          DNKK-VSVSE-LG--DNLS--------------QVP--AN--TPG-GAD-----P----I
A0A6P0W137      DNKK-VSVSE-LG--DNLS--------------QVP--AN--TPG-GAD-----P----I
A0A845XHF7      DNKK-VSVSE-LG--DNLS--------------QVP--AN--TPG-GAD-----P----I
A0A845ZEG9      DNKK-VSVSE-LG--DNLS--------------QVP--AN--TPG-GAD-----P----I
A0A1D9G1F2      DNKK-VSVSE-LG--DNLS--------------QVP--AN--TPG-GAD-----P----I
A0A846CJ58      DNKK-VSVSE-LG--DNLS--------------QVP--AN--TPG-GAD-----P----I
A0A6L9Y9E2      DNKK-VSVSE-LG--RNLS--------------QVP--AN--TPG-GAN-----P----I
A0A6P0SGR0      DNKK-VSVSE-LG--DNLS--------------QVP--AN--TPG-GAN-----P----I
A0A6M0BK48      DNKK-VSVSE-LG--DNLS--------------QVP--AN--TPG-GAD-----P----I
A0A845WG36      DNKK-VSVSE-LG--RNLS--------------QVP--AN--TPG-GAN-----P----I
A0A6P0X384      DEKK-VSVSE-LG--REIS--------------QLE--GE--IPG-QES-----P----L
A0A2P8QIL5      DGKQLSLAGE-TG--RDLT--------------QES--AR--LD---SN-----P----V
A0A433W447      DGKQLSLAGE-TG--RDLT--------------QES--AR--LD---SN-----P----V
K9U1K8          DGKQLSLAGE-TG--RDLT--------------QES--AR--LD---SN-----P----V
A0A1Q4RZJ6      DDRR-TSVSE-LG--RDLS--------------QTS--IT--SAG--NS-----P----L
A0A1Z4SNV3      DDKR-VSVSE-LG--RDLS--------------QTS--VS--GSG--NS-----A----L
A0A2H2XJQ1      DDKR-VSVSE-LG--RDLS--------------QTS--VS--GSG--NS-----A----L
A0A3S5K358      DDRR-TSVSE-LG--RDLS--------------QTS--VT--SPG--NS-----P----L
A0A0T7BPJ4      DDKR-VSVSD-LG--RDLT--------------QVT--ST--TPG-GPS-----P----L
A0A0C1QS61      DSKQ-TSVSE-LG--RNLS--------------QVS--SN--TPG-GPS-----P----L
A0A139X3R8      DNKQ-TSISE-LG--RDLS--------------QVS--SN--TPG-GPS-----P----L
A0A844MZP8      DTTQ-TSISE-LG--RNIS--------------QVS--SN--TPG-GPS-----P----L
A0A1Z4I7C5      EDKK-ASVSE-LG--RDLT--------------QIN--SS--SVG--RN-----P----L
A0A844MST0      DSKS-VSVSE-LG--RDLI--------------QMS--SA--TPG-GAN-----P----L
A0A0C2MDK7      DDKR-VSVSE-LG--RDLT--------------QVS--AN--APG--IS-----P----L
A0A856MDH8      DDKR-VSVSE-LG--RDLT--------------QVS--AN--APG--IS-----P----L
A0A1Y0RCK1      DDKR-VSVSE-LG--RDLT--------------QVS--SN--SPG--NS-----P----L
A0A1Z4PWZ0      DDKR-VSVSE-LG--RDLT--------------QVS--SN--APG--IS-----P----L
A0A0C2QLT0      DDKR-VSVSE-LG--RDLT--------------QVS--SN--APG--IS-----P----L
A0A1Z4J2K1      DDKR-VSVSE-LG--RDLT--------------QVS--SS--GPG--IS-----P----L
A0A3S0ZSX0      DDKR-VSVSE-LG--RDLT--------------QMP--TN--IPG-GPS-----P----L
A0A2N6K4T3      DQKR-VSVSE-LG--RDLT--------------QLS--SD--TPG-GSN-----P----L
A0A370CKT2      DQKR-VSVSE-LG--RDLT--------------QLN--SG--TPG-GSN-----P----L
A0A0S3TL97      DQKR-VSVSE-LG--RDLT--------------QLN--SG--TPG-GSN-----P----L
A0A2N6M8A0      DQKR-VSVSE-LG--RDLT--------------QLN--SG--TPG-GSN-----P----L
A0A2N6M9E1      DQKR-VSVSE-LG--RDLT--------------QLN--SG--TPG-GSN-----P----L
A0A2N6KJI4      DQRR-VSVSE-LG--RDLT--------------QLN--SG--TPG-GSN-----P----L
A0A2N6MZ77      DQKR-VSVSE-LG--RDLT--------------QLN--SG--TPG-GSN-----P----L
A0A2N6KT20      DQKR-VSVSE-LG--RDLT--------------QLN--SG--TPG-GSN-----P----L
G6FSN3          DQKR-VSVSE-LG--RDLT--------------QLN--SG--TPG-GSN-----P----L
A0A4D9CI02      DQKR-VSVSE-LG--RDLT--------------QLS--PG--TSG-NSN-----P----L
A0A328I8B9      DQKR-VSVSE-LG--RDLT--------------QLS--PG--TSG-NSN-----P----L
A0A4Q9J4Z7      DQKR-VSVSE-LG--RDLT--------------QLS--PG--TSG-NSN-----P----L
A0A0M0SU69      DQKR-VSVSE-LG--RDLT--------------QLS--SA--TPG-GSN-----P----L
A0A1Z4TIZ8      DQKR-VSVSE-LG--RDLT--------------QLS--PG--TPG-GSN-----P----L
K9UYB2          DEKRGTSVSE-LG--RNLT--------------QV----S--NSP-GNS-----P----L
A0A1Q4S1H4      DDKG-VSVSD-FG--RSIT--------------QLN--AG--TPG-GAS-----A----L
A0A433VBU6      DSKS-VSVSA-LG--RDIT--------------QLD--AG--TPG-GAS-----P----L
A0A218QN17      DDRR-VSVSE-LG--RDLT--------------QVS--SG--APG-GPS-----P----L
A0A846HD20      DDRR-VSVSE-LG--RDLT--------------SVS--SG--APG-GPS-----P----L
K9RKN2          DEKQ-ISVSE-LG--RDLT--------------QVA--NS--TPG-GPS-----P----L
A0A2I8ADV2      DAKG-VSVSE-LG--RDLT--------------QP---SV--VGR-SSN-----P----L
A0A5Q0GMF5      DDKK-ASVSE-LG--RDLT--------------QI---NS--TAI-GRN-----P----L
Q3MEW0          DDKK-ASVSE-LG--RDLT--------------QI---NS--TAI-GRN-----P----L
A0A1Z4KIC7      DDKK-ASVSE-LG--RDLT--------------QI---TP--TGV-GRN-----P----L
Q8YSM5          DDKK-ASVSE-LG--RDLT--------------QI---TP--TGV-GRN-----P----L
                                                                            

K9SLA9          ANEAAVIKSNAIAKEVVGVL----------NQTAT-------------------------
A0A168TT23      QTQYEILRGRQLAENVVEKLEVWDHPELSGEISQRNLYRELRALPGRLVQLIRSDPPSAQ
A0A0M1JWX9      QSQIALLRSPKLMEPIIQQL-------------------------------------KPK
A0A844MWN9      KVQASILTSDAILEQVLAT-----------------------------------------
A0A2T1M1V6      YTQSAILMSDSVLGRVLTV-----------------------------------------
A0A2G7GCS2      QIQMTILTSDTVMERALAV-----------------------------------------
K9XBH8          QTQLSILTSDTVMQRVLSV-----------------------------------------
A0A1Z4LJ30      NILSSVAMSDRVIQEVWQN-----------------------------------------
Q7NF11          KVQSAILTSSEVLSKAWQA-----------------------------------------
K9RI76          NILSSIATSDHVVEEVWQN-----------------------------------------
A0A433VN22      KVQTSILMSDALLEKVLDS-----------------------------------------
A0A139WSU3      NVQASILTSDTLLEKVLAS-----------------------------------------
A0A844MJB7      NVQSSILTSDTLLEKVLAA-----------------------------------------
A0A352AE27      KVQAYILTSDALMQRLWAS-----------------------------------------
A0A3B8JH60      KVQASILTSDELLQKARAI-----------------------------------------
A0A3C0N766      KVQASILTSDELLQKARAI-----------------------------------------
K9W9J7          KVQASILTSDALLEQVLVS-----------------------------------------
Q7NJN6          SIQSNILLSSDVLRPVWQK-----------------------------------------
U5QCC3          TIQSNILLSDSVLRRVWLK-----------------------------------------
A0A1Z4JCS8      KIQEAILTSDAILEKAWAA-----------------------------------------
A0A846GVZ3      NMQASILKSDALMRRLLES-----------------------------------------
A0A6P0PI80      NMQASILKSDALMRRLLES-----------------------------------------
A0A6P0WGT6      NMQASILKSDALMRRLLES-----------------------------------------
F4XTX2          NMQASILKSDALMRRLLES-----------------------------------------
A0A3S0Y9N9      GTEVAVLRSLPIAERTINAL----------SLNLN-------------------------
A0A6P0ZKB8      GTEVAVLRSIPLAERTINTL----------GFNLN-------------------------
A0A846EDH6      GTEVAVLRSIPLAERTINTL----------GFNLN-------------------------
A0A433UNK7      GTEVAVLRSLPLAEQTINAI----------RLNIN-------------------------
B8HNB0          INEIQVLQSSSLVTKAQQQL----------KPPHN----------------------KT-
A0A318BJ18      ETQYGLLRSRALSERVATQL----------RLVDDPKFYEMYKFNS-----------DDP
A0A3B8Y8H9      LTQIQILYSYKIIAPVLEKL----------NKVFP----------------------P--
A0A2W1JVB9      DTEIETILSVPVLQEALKQL----------KLTDD----------------------E--
A0A6H1U102      STEIQILQSHSLVAKAISRL----------EDSTS----------------------Q--
A0A7C3ZEJ3      STEIQILQSRSLVSKAVAQL----------ENSFS----------------------N--
A0A2P8W9H0      ETRLRILTSPRVIEPILKEL----------QKSQP----------------------S--
A0A6I5P386      ETTLKILESPRVMKPILEEL----------QKIYP----------------------E--
A0A3M1SVZ4      DTEAEIISSVPIVEQTIAAL----------QLKNS----------------------E--
A0A318BG22      ETQLAFIRSRAMAEGIVKRL----------HLDQNDAFVDDAATGGG----------D--
A0A2T1E9V8      NTESRLILSENILRKILDIV----------NENSS----------------------Q--
A0A1Z4LN32      DTQAIILQSEPIIKDVVKSL----------ELKGN----------------------N--
A0A2I8A9F5      DTQALLVRSKPILEEVVNTL----------NLKDK----------------------K--
A0A218Q6R8      DTQALLVRSTPIIEDVINTL----------ELKDQ----------------------E--
A0A218QGE0      DTQAIVMQSEPVMQDAIETL----------KLKDK----------------------K--
A0A846HDH5      DTQAIVMQSEPVILDVIKTL----------NLKDK----------------------K--
A0A3M2GQQ6      STEIQILRSHALVAKAIAAL----------GDTDN-------------------------
A0A6H1U2X0      STEIQILRSHALVAKAIAAL----------GDTDN-------------------------
K9TLQ0          ETQMEVLLSSPIINPIFTNI----------QQNYP----------------------E--
K9QF04          KTEIEVLASYKVISPLLPTI----------QSRYP----------------------D--
K9W1T3          NTQAELINSIPVAQETIATL----------NLS------------------------Q--
K9SGJ5          DTEIAILKSRSLIEPAVAQL----------DNIDP----------------------TM-
A0A6N2JS94      GTEIAILKSRPLIEIAVSKM----------HQSPS----------------------AA-
A0A6C2DSN4      GTEIGILKSRPLIESAIAKM----------RQSSD----------------------GS-
L8MYT6          GTEIGILKSRPLIESAIAKM----------RQSSD----------------------GS-
A0A352JGJ6      GTEIGILRSRPLIEVAVTKI----------KQSSA----------------------SSK
A0A1J5GLS2      GTEIGILRSRPLIEVAVAKM----------KQSPT----------------------ASA
A0A2W4W6M5      GTEIGILRSRPLIEVAVSKM----------RQSPS----------------------ANT
A0A2W7AN33      GTEIAILKSRPLIETAVCKM----------QQSPT----------------------AIP
A0A256BLV2      GTEVAILKSRPLIEIAVSKM----------QQSPS----------------------ALS
A0A2W6ZXF3      GTEIGILRSRPLIEIAVAKM----------RQSPT----------------------ASS
A0A2Z5WX66      GTEIGILRSRPLIEVAVAKL----------QQSAS----------------------SNA
Q7NEU3          NTQIEVLLRRPLIEKALRVL----------RPKFP----------------------E--
A0A3C0N2P0      DTQIQVLWSPQVLSKIVKEI----------QTRYP----------------------D--
A0A6P0JR04      ETQVEVLRSPTVMRPIVEKI----------QEKYP----------------------K--
A0A6B3M6M6      ESQIEVLKSPQVMSPIVESI----------QARYP----------------------E--
A0A6P0KD09      ESQIEVLRSPQVMLPIVESI----------QARYP----------------------E--
A0A6B3NIJ0      ESQIEVLRSPQVMLPIVESI----------QARYP----------------------E--
A0A6M0F053      ESQIEVLRSPQVMLPIVESI----------QARYP----------------------E--
A0A6P2ATU9      ETQIEVLRSPAVLAPIIEQI----------QTQYP----------------------E--
A0A845XAM4      DTQIQVLQSPTVLQPIVKQI----------QAKY-----------------------E--
A0A352XE00      ETQIQVLWSSQIMIPIVKKI----------QAQYP----------------------E--
A0A6P0QC14      ETQIQVLWSPQVISPILKNI----------QAQYP----------------------E--
B4VS56          ETQIQVLWSPQVMTPIVEQI----------QSRYP----------------------E--
A0A352AAQ3      ETQIQVLWSPQVMAPIVKKI----------QARYP----------------------T--
A0A350Y472      ETQIQVLWSPQVMAPIVAQI----------QSRYP----------------------E--
A0A355DVB4      ETQIQVLWSPQVMTPIVKQI----------QSRYP----------------------E--
A0A1Z4RMB9      TTQIQVLRSEPVVQQVIDQL----------KLTDN----------------------E--
A0A318B4H2      ETQYNLLKARSLAERVARVL----------GLQNDDKFFAMYGGEEPSAAAPRTRSAQEQ
A0A2K3BR24      TNQSQIMQSAPMLQEVIDRL----------GLKND----------------------E--
K9YXY1          TNQSQIMQSAPMLQEVVDRL----------GLKND----------------------E--
A0A1Q4RTR1      ETQAEIIRSQPVIQKTIDIL----------ELKNK----------------------K--
A0A1Z4SQV2      ETQAEIIRSQPLVQKTIDTL----------ELRNN----------------------N--
A0A2H2XGN1      ETQAEIIRSQPLVQKTIDTL----------ELRNN----------------------N--
A0A433UXH8      ETQAELIRSQPLVQKTIDAL----------ELKNS----------------------K--
A0A1U7HGH0      ATEAKVIRSIPILQQALEQI----------NEASQ----------------------N--
K9XJD3          ATEAKVIRSVPILQQALEQI----------NEASQ----------------------N--
K9SX01          YTQLQVIRSTPVVAQTIKAL----------------------------------------
A0A4P7ZT55      PNLIEVLTSPMLLQPLANAQ----------GL----------------------------
A0A1E5QIR9      DTEVAIVRSVATSEGVMQAL----------DLRDE----------------------E--
A0A6P1A9A0      ETQIQVLSSPKVLSPILEKI----------KAEYP----------------------N--
A0A1Z4IBC7      ETQVRIIGSNPVLERTINTL----------NLKEA----------------------N--
A0A5Q0GKD1      ETQVRIIGSNPVLEQTIKAL----------NLKDK----------------------N--
Q3MDC6          ETQVRIIGSNPVLEQTIKAL----------NLKDK----------------------N--
A0A1Z4KM73      ETQVRIIGSNPVLQQTIKAL----------NLKDQ----------------------N--
Q8YNX7          ETQVRIIGSNPVLQQTIKAL----------NLKDQ----------------------N--
A0A367R4K6      ETQVKIVGSNPVLEQTIKEL----------NLTDN----------------------H--
A0A1E2WSV8      ETQVRVIGSNPVIEKTINSL----------KLKDS----------------------Q--
A0A7D7L9Y1      ETQVRVIGSNPVIEKTINSL----------KLKDS----------------------Q--
A0A2R5FRT9      ETQVRVIGSNPVIEKTINSL----------NLKDS----------------------K--
A0A2K8T1B6      ETQVRVIGSNPVIEETINSL----------NLKDS----------------------K--
A0A235I9I0      ETQVRVIGSNPVIEKTINSL----------NLKDG----------------------Q--
A0A2D0HQT8      ETQVRVIGSNPVIEKTINSL----------NLKDS----------------------Q--
A0A2L2NU95      ETQVRVIGSNPVIEKTINSL----------NLKDS----------------------Q--
A0A367S084      ETQVRVIGSNPVIEKTINSL----------NLKDS----------------------Q--
A0A1Z4SMD6      ETQAVILNSEPIIQKVINTL----------KLKDK----------------------K--
A0A2H2Y096      ETQAVILNSEPIIQKVINTL----------KLKDK----------------------K--
K9S8M8          DTEAEVIRSTPIAEEVITSM----------GLRSS----------------------S--
A0A1Z4NFV0      STQAVVLQSRPILEQVIAKL----------NLRDR----------------------N--
A0A3M9ZEU1      ETQAEIVRSAAIARATIEAL----------DLRDD----------------------N--
A0A1Z4JK72      DTQAVVVTSYPILQRVIDTL----------QLKNS----------------------K--
A0A0N7Z489      DTQAAVVTSYPILQRVIDTL----------QLKNA----------------------Q--
A0A0S3TXS2      DTQAAVVTSYPILQRVIDTL----------QLKNS----------------------Q--
A0A2A2TPF8      STQAVILQSRPILQAVVEKL----------NLRDK----------------------T--
A0A1Z4R0P8      STQAVILQSRPILQAVIERL----------NLRDD----------------------T--
A0A0T7BUI3      NTQAVIVNSQPVIKEVIKTL----------NLKDN----------------------Q--
A0A1Z4LP32      ETQAVVIQSEPILQEVIDTL----------NLKDD----------------------D--
K9REP9          ETQAVIVQSEPILQKVIDTL----------NLKDD----------------------D--
A0A1Z4SIJ3      ETQAVIVDSEPVLEEVIRTL----------DLKDK----------------------K--
A0A2H2XPG4      ETQAVIVDSEPVLEEVIRTL----------DLKDK----------------------K--
A0A2A2TC28      QTQAVIVNSQPILQEVINNL----------NLKDK----------------------D--
K9V3C7          STQAAILESRPIVQEVIQAL----------DLKDN----------------------K--
A0A1Z4T6Y7      STQAEILQSRPILEAVIKKL----------DLRDK----------------------N--
A0A2H2Y561      STQAEILQSRPILEAVIKKL----------DLRDK----------------------N--
A0A1Q4S362      STQAEILQSRPILEEVIKKL----------DLRDK----------------------N--
A0A3S1CIN8      STQAEILQSRPIIEEVIKKL----------DLRDK----------------------N--
A0A0C1NCB0      DTQAVVVTSAPILQQVIDKL----------ALKNN----------------------D--
A0A844MLU2      DTQAVVVSSAPILQQVIDKL----------GLKNG----------------------D--
A0A2N6K7Q9      ETQAVIVNSHPMLQEVITSL----------QLKDE----------------------Q--
A0A2N6MXH6      ETQAVIVNSHPMLQEVITAL----------QLKDD----------------------Q--
A0A2N6M5A8      ETQAVIVNSHPMLQEVITAL----------QLKDD----------------------Q--
A0A2N6LL61      ETQAVIVNSHPMLQEVITAL----------QLKDD----------------------Q--
A0A0S3TP66      ETQAVIVNSHPMLQEVITAL----------QLKDD----------------------Q--
G6FP91          ETQAVIVNSHPMLQEVITAL----------QLKDD----------------------Q--
A0A1U7GYR5      ETQAVIVNSHPMLQEVITAL----------QLKDD----------------------Q--
A0A2N6KY52      ETQAVIVNSHPMLQEVITAL----------QLKDD----------------------Q--
A0A2N6KMP5      ETQAVIVNSHPMLQEVITAL----------QLKDD----------------------Q--
A0A2N6MA45      ETQAVIVNSHPMLQEVITAL----------QLKDD----------------------Q--
A0A4Q9J9V9      ETQAVIVNSHPMLQEVITAL----------DLKDE----------------------Q--
A0A328IGA1      ETQAVIVNSHPMLQEVITAL----------DLKDE----------------------Q--
A0A4D9CE41      ETQAVIVNSHPMLQEVITAL----------DLKDE----------------------Q--
A0A0M0SFT2      ETQAVIVNSHPMLQEVITAL----------DLKDE----------------------Q--
A0A1Z4TLC8      ETQAVIVNSHPMLQEVITAL----------DLKNE----------------------Q--
A0A1Z4IYV4      ETQSVILTSQPILEEVIKTL----------ELKDK----------------------K--
A0A1Z4Q0T6      ETQAVILQSQPILEEVINTL----------RLKDK----------------------K--
A0A0C2PT44      ETQAVILKSEPILEEVIKTL----------ELKDK----------------------K--
A0A1D2P6J4      ETQAVILKSEPILEEVINTL----------GLKDK----------------------K--
A0A0C2LFH0      ETQAVILKSEPILKEVIDTL----------GLKDK----------------------K--
A0A856M734      ETQAVILKSEPILKQVIDTL----------GLKDK----------------------K--
B4WP72          RTQAEIIQSLPTLEKAIATA----------EAAVI----------------------E--
A0A2T1CIL7      VTEAEILRSRPILEKAIKQL----------NLKND----------------------Q--
A0A433V7A0      STEAEILLSEPLIRETISAL----------NLKDE----------------------Q--
A0A2T1FTR8      NTQAEILKSLTTIKGAL--I----------ELRDG----------------------KYA
K9UA41          NTQAEILKSLTTIKGAL--V----------ELRDG----------------------KYA
A0A563VS48      ATEAEILRSRPILEKLIKEL----------DLRDE----------------------G--
A0A7Y0NUK1      ATEAEILLSRPVVEKLIQQL----------DLKND----------------------E--
A0A0C2LBE2      ETQAKIVASVPVIQETIAEL----------DLKDD----------------------K--
A0A433NN38      DTQVKIVTSVPVLQETIKAL----------DLRDS----------------------L--
A0A2N6K0T2      DTQAKIVTSVPVIQETITSL----------SLKND----------------------D--
A0A2N6ML72      DTQAKIVTSVPVLQETITSL----------SLKND----------------------E--
G6FQZ6          DTQAKIVTSVPVLQATITSL----------SLKND----------------------E--
A0A2N6MQX9      DTQAKIVTSVPVLQETITSL----------SLKDD----------------------E--
A0A2N6KXT6      DTQAKIVTSVPVLQETITSL----------SLKND----------------------E--
A0A2N6KGB9      DTQAKIVTSVPVLQETITSL----------SLKND----------------------E--
A0A2N6L3Y5      DTQAKIVTSVPVLQATITSL----------SLKND----------------------E--
A0A0S3TIS7      DTQAKIVTSVPVLQATITSL----------SLKND----------------------E--
A0A1U7GW28      DTQAKIVTSVPVLQATITSL----------SLKND----------------------E--
A0A2N6LW63      DTQAKIVTSVPVLQATITSL----------SLKND----------------------E--
A0A328IH74      DTQAKIVISVPVIQETITSL----------SLKNN----------------------E--
A0A4D9CIB0      DTQAKIVISVPVIQETITSL----------SLKNN----------------------E--
A0A1Z4TQ63      DTQAKIVTSVPVIQETITSL----------SLKND----------------------E--
A0A4Q9J8G2      DTQAKIVTSVPVIQETITTL----------SLKDD----------------------E--
A0A350Y0P6      DTEAQIITAQPILEKTIAKL----------NLKTA----------------------E--
A0A352X940      DTEAQVITSLPLIQKTIERL----------NLKTE----------------------N--
B8HTN4          DTEAQIIRSTPIIQELITTL----------QLKDP----------------------Q--
A0A6P1AFJ5      ATQIQVLWSNQVLSPISEAI----------KQKYP----------------------E--
B0CAX4          QTEAEIIRSEPILRQTITAL----------KLVDD----------------------E--
A0A1Z4RN12      ETEAKILQSRPIVERLIKEL----------ELKND----------------------D--
A0A2T1CMF9      ETEAEILGSRTIVEKVIQEL----------DLKSE----------------------K--
Q7NDC5          DTQAEILQSRPVAAGVIRDL----------QLGDP----------------------RRP
U5QGK3          DTQAEIIQSRPLVEKVIRTL----------QLKDP----------------------QRR
A0A2W4UY24      DTQVEIFLSKPIAEKVINQL----------KIEDS----------------------E--
A0A838VM23      STEMEVIHSVPLLQKTIALL----------NLRDP----------------------R--
A0A0D8ZUV2      KTEAAVLSSIPLAQQTITAL----------NLKDN----------------------D--
A0A433VDI0      KTETEVLRSIPLVQRTIAEL----------NLKDE----------------------A--
A0A3D1PG43      QTEIEIMSSRPLAKETIAAL----------NLKDK----------------------K--
A0A2P8QQ72      STESEIVSSIPLAQKTIAAL----------TLKDE----------------------E--
K9TZQ7          STESEIVSSIPLAQKTIAAL----------TLKDE----------------------E--
A0A6N8G584      NTEIEIIRSVPFIEKTITAL----------NLRND----------------------S--
A0A2G7GPR0      NTEIEIIRSVPFVEKTISAL----------NLRNS----------------------G--
K9XH68          NTEIEIIRSVPFLEKTITAL----------NLRND----------------------G--
A0A1U7HW70      NTEIEIIRSVPFLEKTIASL----------NLRND----------------------S--
A0A2S6VEJ8      NTEIEIIRSVPFLEKTITAL----------NLRND----------------------N--
A0A140KBA0      TTEVEVVSSRPIIDRVIKEL----------DLRNK----------------------Q--
K9XSG1          TTEVEVVSSRPIIDRVIKEL----------DLRNK----------------------Q--
A0A2T1GMT4      TTQMEVIASRPLLQKTADRL----------KLKND----------------------R--
K9UI51          TTQMEVIASRPLLQRTADRL----------KLKND----------------------R--
A0A1Z4QL41      STQIEVISSPPVLQKTIDKL----------KLKNQ----------------------K--
K9TYI2          SSQIEVISSPTLLQQAIDEL----------QLKNN----------------------R--
A0A252D4T4      STQIEVISSPILLQRTIDEL----------QLKNA----------------------I--
A0A252DJH5      STQIEVISSPILLQRTIDEL----------QLKNA----------------------I--
A0A252EB80      STQIEVISSPILLQRTIDEL----------QLKNA----------------------I--
A0A6G9SKZ9      TTQIEVITSPLLLQKTIDEL----------QLKNN----------------------E--
A0A1Z4HPW5      TTQIEVITSPLLLQKTIDEL----------QLKNN----------------------Q--
A0A1Z4MSN1      TTQIEVITSPLLLQKTIDEL----------QLKNK----------------------E--
A0A1Z4U1C2      TTQIEVITSPLLLQKTIDEL----------QLKNK----------------------E--
A0A0D6KV51      TTQIEVITSPLLLQKTIDEL----------QLKNK----------------------E--
A0A1Z4MKF8      TTQIEVITSPLLLQKTIDEL----------QLKNK----------------------E--
A0A2C6WC43      NTQIEVISSPALLQKTIDKL----------QLKDQ----------------------E--
A0A841WRE0      NTQIEVISSPALLQKTIDKL----------QLKDQ----------------------E--
A0A1Z4L5A1      NTQIEVISSPALLQKTIDKL----------QLKDK----------------------E--
A0A367QD86      NTQIEVISSPPLLQKTIDKL----------QLKDK----------------------E--
A0A2K8SM78      NTQIEVISSPNLLQRTIDKL----------QLKDE----------------------E--
A0A2R5FPC0      NTQIEVISSPNLLQRTIDKL----------GLKDE----------------------E--
A0A5P8W5T6      NTQIEVISSPTLLQRTIDKL----------GLKDD----------------------E--
A0A7D7LDT7      SSQIEVITSPKLLQRTIDKL----------QLKDN----------------------E--
A0A235IZ96      STQIEVITSPSLLQRAIDKL----------KLKDK----------------------E--
A0A2L2NGP0      STQIEVITSPSLLQRAIDKL----------KLKDK----------------------E--
K9QM62          STEVEVITSYPLLQRTIDAL----------KLKNN----------------------Q--
A0A1Z4FWI3      SSQIEVISSPTLLQRTIDEL----------QLKND----------------------K--
A0A1Z4JYE7      STQVEVISSPPLLEKVINKL----------ELTNE----------------------K--
A0A0F5YE28      STQIEIISSNRLLNQVIEQL----------NLVDD----------------------E--
U7QEH7          STQIEIIYSNRLLNQVINQL----------NLVDS----------------------E--
A0A3S1ATK5      STEIEVISSRPLLQQTIDKL----------GLKNK----------------------K--
A0A2Z6CPH0      STQIEVISSPLLLEQIIDKI----------QLKDE----------------------N--
A0A1Z4GT50      STQIEVITSPPLLQRTIDQL----------HLKNN----------------------N--
A0A1Z4GIX0      NTQIEVISSPPLLQRTIDKL----------QLKND----------------------K--
A0A2H6LC24      NTQIEVISSPPLLQRTIDKL----------QLKND----------------------K--
B2J6N5          NTQIEVISSPTLLQRTIDKL----------QLKDQ----------------------E--
A0A367RMI4      SSQIEVISSPALLQRTIDKL----------QLKDN----------------------D--
A0A235HUM0      SSQIEVISSPALLQRTIDKL----------QLKDK----------------------E--
A0A2L2NW47      SSQIEVISSPALLQRTIDKL----------QLKDN----------------------E--
A0A1E2WUR1      SSQIEVITSPKLLQRTIDKL----------QLKDN----------------------E--
A0A235IKU3      STQIEVITSPNLLQRAIDKL----------KLKDK----------------------E--
A0A1U7MYU6      STEVEVIYSHPLLQQIIDQL----------NLTDN----------------------E--
A0A1D8TNX9      STEVEVIYSHPLLQQIIDQL----------NLTDN----------------------E--
A0A6P0L6C2      STEVEVIYSHPLLQQIIDQL----------NLTNN----------------------E--
A0A6P0MVH0      STEVEVIYSHPLLQQIIDQL----------NLTDN----------------------E--
A0A6P0KJV0      STEVEVIYSHPLLQQIIDQL----------NLTDN----------------------E--
A0A6L9ZJG4      STEVEVIYSHPLLQQIIDQL----------NLTDN----------------------E--
A0A846GI17      STEVEVIYSHPLLQQIIDQL----------NLTDN----------------------E--
F4XKF3          STEVEVIYSHPLLQQIIDQL----------NLTDN----------------------E--
A0A1D9FX10      STEVEVIYSHPLLQQIIDQL----------NLTDN----------------------E--
A0A6P0Q0T0      STEVEVIYSHPLLQQIIDQL----------NLTDN----------------------E--
A0A6P0W5I0      STEVEVIYSHPLLQQIIDQL----------NLTDN----------------------E--
A0A845XJ02      STEVEVIYSHPLLQQIIDQL----------NLTDN----------------------E--
A0A846D190      STEVEVIYSHPLLQQIIDQL----------NLTDN----------------------E--
A0A3C0NJ41      STEMEILHSIPLAQKTIAAF----------NLKDN----------------------K--
A0A352AG88      TTEIEILRSVPLAKETIAAL----------NLKSE----------------------D--
A0A350Y374      STEIEILSSLPLLDKTLNTL----------NLKDD----------------------Q--
A0A355DPX0      STEIEILSSVPLLDKTLNTL----------NLKDD----------------------Q--
A0A0S3TYD7      TTQAELIKSLPIVQRTIEDL----------NLQDD------------------DNA----
A0A2T1DNG3      ATQISLMQSSNLLKKAMTLLQ---TEYPELDPDN--------------------------
A0A140K3H3      STEVLVLRSYPLIAKAVKQVQ---QKYG--------------------------------
K9XUB8          STEILVLRSYPLIAKAVEKVQ---QEYS--------------------------------
A0A563VLD6      STEILVLRSNSLISQAIAQYP---NTFK--------------------------------
A0A7Y0NVW6      STEILVLKSKSLVSQAMAEYP---ETFK--------------------------------
U5QL42          ETEIQILKSRSLIGRAIHRLA---PP----------------------------------
A0A6H2NHD5      TSQIRVLRSPGVINPILESIQ---QR----------------------------------
A0A2P8W4F7      DSQIRVLRGPAVIEPILADIQ---RR----------------------------------
A0A5Q4E0Z4      TSQIRVLRGPDVINPILANIQ---RQ----------------------------------
A0A2P8VVX1      ATQLALMRSGQFLQEAVDVLR---TD----------------------------------
A0A2P8WHY0      NTQLTLMRSEQFLREAVASLE---AE----------------------------------
A0A563VQJ3      KNEIEKITASPVLQETIDQLE---LTDGE-------------------------------
A0A7Y0IRJ7      NNEIEKILASPILQETIDQLE---LKDQE-------------------------------
A0A2T1CMT9      TTQIKVLTSHEILQRVVNQLK---LKDQRSEQASS------------------SYGGVIS
A0A7G8J1V5      PTLIELLRSPLLLKPVADQL----------------------------------------
A0A354B169      PTLIEVLRSPMLLNPIAQHF----------------------------------------
Q0IDT5          PTLIEVLESPLLLAPIAKRF----------------------------------------
A0A7G8FZD9      PTLIELLQSPLLLSPIAERF----------------------------------------
G4FMX5          PTLIELLQSPLLLSPIAERF----------------------------------------
A3ZA21          PTLIEVLQSPLLLAPIAKRF----------------------------------------
A0A076HBF2      PTLIEVLQSPVLLQPVADKF----------------------------------------
A0A7G8FP50      PTLIEVLRSPLLLRPLADQF----------------------------------------
A0A7G8E8K7      PTLIEVLQSSVLLKPVADQF----------------------------------------
A0A7G8GNR2      PTLIEVLKSPVLLQPVADKF----------------------------------------
A0A7G8ICD3      PTLIEVLQSPVLLQPVAEKY----------------------------------------
A0A2D6FCW3      PTLIELLQSPLLLSPIAQRY----------------------------------------
A0A7G7KJ95      PTLIEVLQSPLLLGPIARRF----------------------------------------
A0A7G8EAN3      ATLIEVLRSPLLLSPIAKRF----------------------------------------
A0A1D8TX52      ATQLQLMGSSELIQRAVDLLR---DD----------------------------------
A0A1D9G4T2      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A6P0PR27      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A6P0WER7      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A845XM36      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A846DAT1      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A846GZK8      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
F4XP71          ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A6P0KZ31      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A6P0LPB8      ATQLQLMRSSELIQRAVELLR---DD----------------------------------
A0A6L9YR57      ATQLQLMGSSELIQRAVDLLR---DD----------------------------------
A0A845WMG9      ATQLQLMGSSELMKRAVELLR---DD----------------------------------
A0A6P0SEV1      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A6B3N2I8      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A6M0B891      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A6P0IJQ1      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A6P0J8J8      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A6P0ZSH6      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A845VS63      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A1U7N5X9      ATQLQLMRSSELMKRAVELLR---DD----------------------------------
A0A6L9Z1V0      ATQLQLMRSSELIQRAVELLR---DD----------------------------------
A0A6P0LC12      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A6P0MVJ3      ATQLQLMRSSELIQRAVDLLR---DD----------------------------------
A0A2W6ZAV2      PVLIEVLTSPLLLEPIAQRL----------------------------------------
K9W742          ATQLNLMQGSQLLQKALDLLR---PD----------------------------------
A0A3D1PBA3      ATQINVMRSSLLLQRAADILR---PE----------------------------------
K9XPB0          PTQLKLMRSSYLLKKVVKKLG---VE----------------------------------
A0A350Y7Z1      ATQLNLMRSSQLIQKAVDRLH---PK----------------------------------
A0A352X2A7      TTQINLMRSSQLIQRAVNLLQ---DK----------------------------------
A0A0D8ZYV0      ATQINVMRSTLLLQRAVDLLK---PE----------------------------------
A0A433VMS2      ATQINVMRSSLLIQRAVDILR---SE----------------------------------
K9TYA7          ATQINVMRSSLLIQRAVDILR---SE----------------------------------
A0A2P8QUE1      ATQINVMRSSLLIQRAVDILR---SE----------------------------------
K9SA61          STQLQLMKSSQLLQRAVDQLK---PT----------------------------------
A0A2G7GMH8      ATQINLMSSSILLQRAVSLLQ---PE----------------------------------
A0A6N8FU92      ATQINLMSSSILLQKAVYLLQ---PK----------------------------------
A0A2T1DWE8      STQLTQMRSSQLLQKAVVLLQ---AE----------------------------------
A0A832H7C4      STQLTLMRSSQLLDKAINSLK---DE----------------------------------
A0A1U7I8L3      ATQLNLMRSSQLIQKAVDLLR---PQ----------------------------------
A0A2T1DJL8      ATQLNLMRSSQLLQRAVDQLK---LN----------------------------------
A0A1Z4J9W0      ATQVNLMRSGQLLQRAVDQLK---PR----------------------------------
A0A0N7Z5K9      ATQVNLMRSTQLLQRAVDELQ---PR----------------------------------
A0A0S3TXC5      ATQVNLMRSTPLLQRAVDELK---PR----------------------------------
A0A846FBD3      GTEAEIIRSLPIAEATVAAL----------ELENE------------------Q-GK---
K1XF69          STQIELMYSNPLLETVIERL----------NLTNE------------------D-GE---
B5W297          STQIELMYSNPLLETVIERL----------NLTNE------------------D-GE---
H1W7M8          STQIELMYSNPLLETVIERL----------NLTNE------------------D-GE---
A0A5Q4H6A5      STQIELMHSNPLLETVIERL----------NLTNE------------------D-GD---
D5A466          STQIELMHSNPLLETVIERL----------NLTNE------------------D-GD---
B4WQE3          DTKLKILTSPRVLVSAVEEL----------EKTYP------------------D------
U5QJM6          NTQLQVLLSRPLVNKAVVRL----------SKKYP------------------K-LK---
A0A0V7ZFJ4      ATEAQIIRSRPIIQKTISKL----------NLRDS------------------K-GK---
A0A235IXQ2      ETEAEIIRSYPLTKKTIAEL----------QLKDK------------------L-GQ---
A0A367RIS1      ETEAEIIRSNPLTQKTIAEL----------HLKDK------------------L-GQ---
A0A841V8H9      ETEAEIIRSNPLTQKTITEL----------QLKDK------------------L-GQ---
A0A5Q0GJJ5      ETEAEIIRSNPIIQKTIAES----------QLKDE------------------Q-GQ---
Q3MEB7          ETEAEIIRSNPIIQKTIAES----------QLKDE------------------Q-GQ---
A0A1Z4KHN9      ETEAEIIRSNPIIQKTIAES----------QLKDE------------------Q-GQ---
Q8YT70          ETEAEIIRSNPIIQKTIAES----------QLKDE------------------Q-GQ---
A0A7U3NLX2      DTQAEIIRSHPLIQKTISEL----------QLNNQ------------------D-GE---
A0A166IWU6      ETQAEIIRSHPLIQKTIVDL----------QLKDQ------------------E-GE---
A0A2S0Q8C0      ETQAEIIRSHPLIQKTIVDL----------QLKDQ------------------E-GE---
W6FSX4          ETQAEIIRSHPLIEKTIVDL----------QLKDQ------------------E-GE---
A0A218Q4C1      DTQAEIIRSHPLIQQTIDNL----------QLKNQ------------------E-GE---
A0A6P1ZT04      ETQAEIIRSHPLIQKIIDEL----------QLKDQ------------------E-GE---
A0A0V7ZNJ9      ETEAKVIRSNPIIQKTIDKF----------NLRDD------------------D-NE---
A0A5P8VSD1      ETEAEIIRSHPLTQKIIDEL----------HIKDN------------------L-GQ---
A0A1S1ZVW2      DTEAEVIRSHPLITKTINQL----------GTKNT------------------K-GE---
A0A0R0M9H9      DTEAEVIRSHPLITKTINQL----------GIKNT------------------K-GE---
A0A7H0F4U6      DTEAEVIRSHPLITKTINQL----------GIKNT------------------K-GE---
A0A7W2A1T7      DTEAEVIRSHPLITKTINQL----------GIKNT------------------K-GE---
A0A838WI98      DTEAEVIRSHPLITKTINQL----------GIKNT------------------K-GE---
A0A853MJX6      DTEAEVIRSHPLITKTINQL----------GIKNT------------------K-GE---
A0A1B7WX82      DTESEIIRSYPIIIKTITTL----------KLTDD------------------K-GG---
A0A1B7WTD1      DTEAEVIRSNPIISKTINDL----------KLKGK------------------K-GA---
A0A480ABC0      DTEAEVIRSNPIVTKTITEL----------KLKGR------------------K-GA---
A0A1Z4LRU5      DTEAEVIQSHPLIKETITKL----------NLINE------------------E-GE---
A0A1Z4JVB4      DTEAEVIRSYPIIQKTITTL----------KLKDK------------------K-GQ---
K9PIA4          DTEAEVIRSYPIINKTITTL----------NLKDE------------------T-GE---
A0A1Z4HVE1      DTEAEVIRSNPIVLKTITSL----------NLKDK------------------S-GK---
A0A252ECZ1      DTEAEVIRSNPIVQKTITSL----------NLKDK------------------S-GK---
A0A1Z4G5Y1      DTEAEVIRSNPIVQKTIASL----------NLKDK------------------S-GK---
A0A252DNA2      DTEAEVIRSNSIVQKTITSL----------KLKDK------------------S-GK---
A0A252E1Q4      DTEAEVIRSNSIVQKTITSL----------KLKDK------------------S-GK---
A0A6G9SK36      DTEAEVVRSNPIVQKTIISL----------NLKDR------------------W-GK---
A0A1Z4M597      DTEAEVIRSNPIVLKTITSL----------DLKDK------------------S-GK---
A0A1Z4MWT1      DTEAEVIRSNPIVLKTITSL----------NLKDK------------------S-GK---
A0A1Z4TX53      DTEAEVIRSNPIVLKTITSL----------NLKDK------------------S-GK---
A0A2A2TNQ5      ETEAEIIRSNPLVKKIVNEL----------EMQDK------------------K-GK---
A0A3S1C4K5      DTEAEVIRSNPLVKKTISEL----------ELKDK------------------K-GK---
A0A1X4G3D5      ENEAEVIRSRPMLEQLVETL----------ELQDD------------------E-GK---
D4TNI2          ENEAEVIRSRPMLEQLVETL----------ELQDD------------------E-GK---
A0A1Z4H6Z8      DTEAEVIRSNPIIQKTITSL----------NLKDK------------------S-GK---
A0A3F3KPR9      DTEAEVIRSHPLITKTINQL----------GIKNT------------------K-GE---
A0A1Z4NPM1      DTEAEVIRSTPSVQKTIEKF----------QLRTP------------------K-GK---
A0A1Z4UZW9      DTESEIIRSYPIVNKTITTL----------KLTDD------------------Q-GK---
A0A1B7VSH4      DTESEIIRSYPIVIKTITTL----------NLTDD------------------Q-GK---
A0A1B7W126      DTESEIIRSYPIVIKTITTL----------NLTDD------------------Q-GK---
A0A3D4C6Q6      DTESEIIRSYPIVIKTITTL----------NLTDD------------------Q-GK---
A0A0K2M5H0      DTESEIIRSYPIVIKTITTL----------KLTDN------------------Q-GK---
A0A844I4P0      DTESEIIRSYPIVIKTITTL----------KLTDN------------------Q-GK---
A0A1B7UVJ4      DTESEIIRSYPIVIKTITTL----------NLTND------------------Q-GK---
A0A1B7UTR1      DTESEIIRSYPIVIKTITTL----------NLTND------------------Q-GK---
K7W0A4          DTESEIIRSYPIVIKTITTL----------NLTND------------------Q-GK---
A0A5C0DRW9      DTESEIIRSYPIVIKTITTL----------NLTND------------------Q-GK---
A0A6H2C088      DTESEIIRSYPIVIKTITTL----------NLTND------------------Q-GK---
A0A1Z4RPC6      STEKLRITSEPVLQQTIDQL----------KLVDA------------------A-GK---
A0A2T1CMZ0      STEKLRMISEPVLQQTIDQL----------KLENS------------------L-GE---
L8M4F7          HNQREQIFTSAVLQQTVENL----------DLKNE------------------N-GE---
A0A140K2P2      STQIEVITSDPVLQQTIDQL----------KLVDD------------------Q-GK---
K9XWX4          STQIEVITSTPVIQQTIDKL----------KLQDD------------------Q-GK---
A0A140KB14      KTEIERMKAEPILVQTIEKL----------KLKDE------------------E-GK---
K9XX88          KTEIERMKTEPILVQTIEKL----------KLKDE------------------E-GK---
L8LZE9          VSQKEILTSSPILQKTIDQL----------SLTDA------------------E-GE---
A0A563VSV6      LTQQEVISSAPVLQQTIEIL----------KLTNE------------------E-GE---
A0A7Y0IQB0      LTQQEVIYSAPVLQQTIETL----------KLTNK------------------D-GD---
A0A433NM31      NTQAEIINSVAFAQRTINEL----------DLKNE------------------Q-GE---
A0A1Z4NDS1      DTQVKIITSNQVIQETIQRL----------GLKDS------------------E-GN---
U9VXM0          DTQIEVFGSIPLVQQVIEQL----------KLQND------------------E-GE---
A0A6M0RI13      DTQIEVFRSIPLVQKVIETL----------KLQDD------------------E-GE---
A0A6M0S1N5      DTQIEVFRSIPLVQKVIETL----------KLQDD------------------E-GE---
K9F4D9          DTQIEVFRSIPLVQKVIETL----------KLQDD------------------E-GE---
A0A6I5QPI5      DTQAELIRSLPLMQATVDAL----------GLTTS------------------S-GR---
A0A1Z3HMQ0      STQAAILSSLPVLQEAVNAL----------DLQDA------------------K-GN---
A0A433W533      NTEIEVVRSIPLLQKTIAAL----------NLKDD------------------RTSE---
A0A2P8QWJ3      NTEIEVVRSIPLLQKTIAAL----------NLKDD------------------RTSE---
K9U6L7          NTEIEVVRSIPLLQKTIAAL----------NLKDD------------------RTSE---
U5DPF5          ANEAAIIRSLPIGQQVIERL----------DIRNA------------------D-GT---
A0A1E5QP61      DTEAEVISSMPIVKETVEAL----------NFRDD------------------Q-GK---
A0A846DWC7      DTEAEVISSMPIVKETVEAL----------NFRDD------------------E-GM---
A0A845Y5J4      DTEAQVITSRPLIEKTIEQL----------DLKNK------------------A-GE---
A0A6P0X488      DTEAQVITSRPLVEKTIEQL----------DLKNK------------------A-GE---
A0A6P0VDM0      DTEAQVITSRPLIEKTIEQL----------DLKNK------------------A-GE---
A0A6P0UVD5      DTEAQVITSRPLIEKTIEQL----------DLKNK------------------A-GE---
A0A846BFF2      DTEAQVITSRPLIEKTIEQL----------DLKNK------------------A-GE---
A0A6M0G142      DTEAQVITSRPLIEKTIEQL----------DLKNQ------------------E-GE---
A0A6P0MR53      DTEAQVITSRPLIEETIKQL----------ELRNQ------------------A-GE---
A0A3M2GIL5      DTEAEIISSTPIIEQTIAEL----------QLKGP------------------E-GN---
A0A6H1TSJ9      DTEAEIISSTPIIEQTIAEL----------QLKGP------------------E-GN---
A0A3M1PML8      DSQAQIIQSAPIVSEVIRSL----------DLRDE------------------K-GE---
A0A6M8BE85      DSQAQIIQSAPIVSEVIQSL----------DLRDE------------------N-GD---
A0A0T7BPZ0      ETQAKIVASVPVIQKTIRSL----------DLKDN------------------Q-GK---
A0A352X442      ATAAAIVKSRPIAEKTVAEL----------NLRDE------------------T-GN---
A0A6B3NF44      ATQAEIIRSRPIAQKTIEIL----------QLKDE------------------E-GN---
A0A6M0EPL4      ATQAEIIRSRPIAQKTIEIL----------QLKDE------------------E-GN---
A0A6P0K6L6      ATQAEIIRSRPIAQKTIEIL----------QLKDE------------------E-GN---
A0A6P0MRR9      ATQAQVVLSRPIAENTVKDL----------NLQDE------------------E-GN---
A0A6P0X1X4      ATQAQVVLSRPIAEKTVKKL----------DLRNE------------------E-GE---
A0A6P0UX57      ATQAQVVLSRPIAEKTVKKL----------DLRDE------------------E-GE---
A0A846B9S8      ATQAQVVLSRPIAEKTVKKL----------DLRDE------------------E-GE---
A0A0M0SHU3      DTQAKIVISVPVIQETITSL----------SLKND------------------E-GE---
A0A1D2PBN3      DTQAKIVASVPVIQETITEL----------DLRDN------------------K-GK---
A0A0C2LVR7      DTQAKIVASVPVIQETITEL----------DLRDK------------------R-GK---
A0A1Z4PQB9      DTQAKIVVSVPVIQETITEL----------DLRDD------------------K-GK---
A0A1Z4SFN6      ETQAKIVESVPVIQETIRTL----------NLKDD------------------E-GQ---
K9PGI8          DTQAKIVVSVPVIQETIRVL----------KLKNE------------------R-GK---
A0A654SFI6      NTQYELLESRFMATRVADAAS---LETD--PAFIE------------------AFDLDE-
K9SSQ0          STQAAILASRPLIETALPKIP---A-----NLSTN------------------LSKQ---
A0A2W1JIN9      ANQEEIVSSKRLLERAL-------------QSYRQ------------------QWDDPV-
A0A318AJV1      ETEAGLMASRGLAVAVVRKLH---LDR---DPEFA------------------SPSRLT-
A0A845WDS5      ANQAELVKSQRILQQAIDQVF---S-----QDVSN------------------LVTT---
A0A6P0IC70      ANQAELVKSQRILQQAIDQVF---S-----QYVSN------------------LVTK---
A0A845VVD9      ANQAELVKSQRILQQAIDQVF---S-----QYVSN------------------LVTK---
A0A6B3MUB5      ANQAELVKSQRILQQAIDQVF---S-----QYVSN------------------LVTK---
A0A6M0B7N4      ANQAELVKSQRILQQAIDQVF---S-----QYVSN------------------LVTK---
A0A6P0J9W3      ANQAELVKSQRILQQAIDQVF---S-----QYVSN------------------LVTK---
A0A6P0ZWE1      ANQAELVKSQRILQQAIDQVF---S-----QYVSN------------------LVTK---
A0A1U7N2U4      ATQAELVGSQRVLQGALYQI----------GILGS------------------SPEG---
A0A6L9YZL1      ATQAELVGSERVLQGALDEI----------ALLGS------------------SPEG---
A0A6P0KYM4      ATQAELVGSERVLQGALYQI----------ALLSS------------------SPEG---
A0A6P0LSD6      ATQAELVGSERVLQGALYQI----------ALLSS------------------SPEG---
A0A6P0PNZ7      ATQAELVGSERLLQGALDEI----------ALLGS------------------SQEG---
F4XV38          ATQAELVGSERLLQGALDEI----------ALLGS------------------SQEG---
A0A6P0W137      ATQAELVGSERLLQGALDEI----------ALLGS------------------SQEG---
A0A845XHF7      ATQAELVGSERLLQGALDEI----------ALLGS------------------SQEG---
A0A845ZEG9      ATQAELVGSERLLQGALDEI----------ALLGS------------------SQEG---
A0A1D9G1F2      ATQAELVGSERLLQGALDEI----------ALLGS------------------SQEG---
A0A846CJ58      ATQAELVGSERLLQGALDEI----------ALLGS------------------SQEG---
A0A6L9Y9E2      ATQAELVGSERVLQRALDEI----------ALLGT------------------SDEG---
A0A6P0SGR0      ATQAELVGSERVLEGALYQI----------GILGS------------------SQEG---
A0A6M0BK48      ATQAELVGSERVLQGALDEI----------ALLGS------------------SPEG---
A0A845WG36      ATQAELVGSERVLERALDEI----------AILGS------------------SQEG---
A0A6P0X384      ATQVELIKSQPVLLRTINQLF---P----------------------------NEEA---
A0A2P8QIL5      ATQAELALSQKVLRQAIYEAY---T-----ANNRN------------------SNAE---
A0A433W447      ATQAELALSQKVLRQAIYEAY---T-----ANNRN------------------SNAE---
K9U1K8          ATQAELALSQKVLRQAIYEAY---T-----ANNRN------------------SNAE---
A0A1Q4RZJ6      ANQAELIKSERILTQALAIAG---N-----SDGGQ------------------NGST---
A0A1Z4SNV3      ANQAELIKSERILNQALAI-----------AETSE------------------AGRS---
A0A2H2XJQ1      ANQAELIKSERILNQALAI-----------AETSE------------------AGRS---
A0A3S5K358      ANQAELIKSERILTQALAIVG---NSDVENSEDGQ------------------NGST---
A0A0T7BPJ4      ADQAELVKSEKVLEKAIAATY---P-----PG----------------------VKD---
A0A0C1QS61      ADQAELVKSQRVLNRALQIFK---S-----SYK---------------------STT---
A0A139X3R8      ADQAELAKSQRVLNRALQIFQ---S-----SHK---------------------TNT---
A0A844MZP8      ADTAELVKSQRVLNRAVQIFQ---N-----NHK---------------------STT---
A0A1Z4I7C5      ADQAEFLKSQPVLQLAISKLN---R-----QQG-N------------------STQK---
A0A844MST0      ADQAELVMSQRVLERAIALAT---S-----NSQRN------------------SSQP---
A0A0C2MDK7      ADQAELIKSQRVLERAIAIAF---P-----QTKGN------------------LSLS---
A0A856MDH8      ADQAELIKSQRVLERAIAIAF---P-----KTYGD------------------LSKS---
A0A1Y0RCK1      ADQAELIKSQRVLERAIAIAF---P-----QIKGN------------------LSQS---
A0A1Z4PWZ0      ADQAELVKSQRVLERAIAIAF---P-----EIKGN------------------LSLS---
A0A0C2QLT0      ADQAELIKSQRVLERAIAIAF---P-----EIKGN------------------LQRS---
A0A1Z4J2K1      ADQAELIKSQRVLEQAVAIAF---P-----EIKGN------------------LQRS---
A0A3S0ZSX0      ADQAELIKSQRVLRRAIARVI---P-----QLNSS------------------SLST---
A0A2N6K4T3      ADQAELIKSQRVLQRALTEVT---A-----ESGFR------------------SPEN---
A0A370CKT2      ADQAELIKSQRVLQRALTEVT---A-----ESGFR------------------SPEN---
A0A0S3TL97      ADQAELIKSQRVLQRALTEVT---A-----ESGFR------------------SPEN---
A0A2N6M8A0      ADQAELIKSQRVLQRALTEVT---A-----ESGFR------------------SPEN---
A0A2N6M9E1      ADQAELIKSQRVLQRALTEVT---A-----ESGFR------------------SPEN---
A0A2N6KJI4      ADQAELIKSQRVLQRALTEVT---A-----ESGFR------------------SPEN---
A0A2N6MZ77      ADQAELIKSQRVLQRALTEVT---A-----ESGFR------------------SPEN---
A0A2N6KT20      ADQAELIKSQRVLQRALTEVT---A-----ESGFR------------------SPEN---
G6FSN3          ADQAELIKSQRVLQRALTEVT---A-----ESGFR------------------SPEN---
A0A4D9CI02      ADQAELIKSQRVLQKALAKVA---A-----ESGFS------------------SPEN---
A0A328I8B9      ADQAELIKSQRVLQKALAKVA---A-----ESGFS------------------SLEN---
A0A4Q9J4Z7      ADQAELIKSQRVLQKALAKVA---A-----ESGFS------------------SVEN---
A0A0M0SU69      ADQAELIKSQRILQKALTKVA---A-----ESGFS------------------LPEN---
A0A1Z4TIZ8      ADQAELIKSQRVLQKALAKVS---A-----ESGFS------------------PPGN---
K9UYB2          ANQAEVVKSERVLQKALEIAS---A-----KTSPE------------------TLNS---
A0A1Q4S1H4      GDQAELIKSQQVLEKALTALK---A-----NSQTA------------------SQAE---
A0A433VBU6      ADQAELIKSQQVLEKALTALK---A-----NPQTA------------------SSSE---
A0A218QN17      ANEAELVKSQRVLERAIALAS---L-----KSYNG------------------SPPS---
A0A846HD20      ANQAELVKSERVLERAIALAS---L-----KSYNG------------------SPGS---
K9RKN2          ADQAELVKSQRVLEKAIKIFS---S-----QYKIK------------------NDQNFG-
A0A2I8ADV2      ADQAELVKSQAVLDQAIKTLA------------SK------------------HPQI---
A0A5Q0GMF5      ADQAELLKSQTVLQLAISKLN---P-----PIKDS------------------STQK---
Q3MEW0          ADQAELLKSQTVLQLAISKLN---P-----PIKDS------------------STQK---
A0A1Z4KIC7      ADQAELLKSQTVLQLAISKLN---P-----PIKDS------------------STQK---
Q8YSM5          ADQAELLKSQTVLQLAISKLN---P-----PIKDS------------------STQK---
                                                                            

K9SLA9          ENEL---------EAEQ---------SIESFLANLQVTNLP-----------DSEILEIS
A0A168TT23      PAAV---------QSPEAARAAAIRSAGGRLRARISVSPRE-----------NSRLVYVS
A0A0M1JWX9      YPEV---------EYKT---------LVTGEKPPLIIEQKKE----------ATKIIEVR
A0A844MWN9      -------------DPEKSK-FDRLFKY----KKLFDVTPQE-----------KSTIILMS
A0A2T1M1V6      -------------DPEKSE-FSNLEDY----KKLFTIEPQT-----------QTTVIDLE
A0A2G7GCS2      -------------DPEKSL-YPRLSDY----KLAFSATPQE-----------QSTIINLQ
K9XBH8          -------------DPEKSS-YLRLSDY----KSLFTVSPQE-----------QTTIIALE
A0A1Z4LJ30      -------------DPEKAD-FSRLNNF----KKLFEVSPEK-----------ESTVISVS
Q7NF11          -------------DPQREK-YPQLGSY----EKLFKAVPQS-----------QTTILAVE
K9RI76          -------------DPEKSE-YSRLSQF----KKLFEVTPEK-----------ESTVISLE
A0A433VN22      -------------DPEKNK-FKNLEQY----KALFQVSPQE-----------QSTVLSLT
A0A139WSU3      -------------DPERGK-FNSISRY----RQLFKVTPQE-----------QSTIMLLT
A0A844MJB7      -------------DPEKSK-FNTISRY----KQLFKVTPQE-----------QSTIMLLT
A0A352AE27      -------------DTENSQ-FG-LRSY----KKLFEISPQE-----------QSTTISLT
A0A3B8JH60      -------------DPEKNK-APKPSQY----KKLFKVSPQE-----------QSTIISLA
A0A3C0N766      -------------DPEKNK-APKPSQY----KKLFKVSPQE-----------QSTIISLA
K9W9J7          -------------DPQKTK-FSRLAKY----KRLFQVKPQE-----------QSTIISLA
Q7NJN6          -------------DPERTEKFTRLDTY----GKLFKGKPGD-----------QSTIVQLE
U5QCC3          -------------DPEKQEKFPRLEDY----TKLFKSKIED-----------QSTIVQVQ
A0A1Z4JCS8      -------------DPERDA-ANKPRNY----GQFFEVTSLE-----------QTSVMLLS
A0A846GVZ3      -------------DPEKTD-FQRLVQY----KQLFAVSPHQ-----------ESTTIWLN
A0A6P0PI80      -------------DPEKTD-FQRLVQY----KQLFAVSPHQ-----------ESTTIWLN
A0A6P0WGT6      -------------DPEKTD-FQRLVQY----KQLFAVSPHQ-----------ESTTIWLN
F4XTX2          -------------DPEKTD-FQRLVQY----KQLFAVSPHQ-----------ESTTIWLN
A0A3S0Y9N9      -PLV----------------------F----LKELQVKNIE-----------QTDILEIS
A0A6P0ZKB8      -PLV----------------------F----LKDLEVKNIE-----------NTDILEVY
A0A846EDH6      -PLV----------------------F----LKDLEVKNIE-----------NTDILEVY
A0A433UNK7      -PLV----------------------F----LKDLEVKNIE-----------NTDILEVY
B8HNB0          -------------SVGS---------I----AGGLSITQVG-----------DSDVLKVT
A0A318BJ18      AFQLVNGRYTSTGRAERVR-IAGEI-L----RDNLTIGSTR-----------LSRLVDIT
A0A3B8Y8H9      -------------ETEEEK-VEYQAFI----ENQLSINRPK-----------DTNIIIVS
A0A2W1JVB9      GEPL---------KIFD---------F----EEQLSIKKAR-----------AGDVIELA
A0A6H1U102      ---L---------SVSQ---------V----VRHLSIRQAG-----------EADVLIVS
A0A7C3ZEJ3      ---L---------SVED---------V----VRNLSIRQAG-----------DADVLIVS
A0A2P8W9H0      ---V---------SYGQ---------L----ITNLKIVPNQ-----------DGEILTVT
A0A6I5P386      ---M---------TYRQ---------L----IFSLGIKKSN-----------E-DVLVVS
A0A3M1SVZ4      GKLV---------EYSD---------V----LKNLKLSKVQ-----------SSDILTIS
A0A318BG22      GKAPAVRQRRIDAATAV---------V----MRNIEAAPLV-----------GSSVIELR
A0A2T1E9V8      KTPL---------SVGD---------L----QAGLEVINIE-----------GTDILQVT
A0A1Z4LN32      GKPL---------DPNS---------I------SIGTGSIV-----------GTDILRVS
A0A2I8A9F5      GERL---------KIES---------V------DIQVEAIP-----------GTDGLKVG
A0A218Q6R8      NNLL---------RPES---------I------NINIERIM-----------GTDGLQVS
A0A218QGE0      GNPL---------SPDA---------I------SIKTEAVV-----------GTDVLKVS
A0A846HDH5      GNPL---------SPDA---------I------SIKTEAVV-----------GTDVLKVS
A0A3M2GQQ6      --PI---------GVKQ---------V----ASNLSIHKAG-----------EADVLIVS
A0A6H1U2X0      --PI---------GVKQ---------V----ASNLSIHKAG-----------EADVLIVS
K9TLQ0          ---L---------KFEE---------L----IKNLSVRRLK-----------STKILDIR
K9QF04          ---I---------DYRQ---------L----VKQLKIKHKE-----------NTAIVEVS
K9W1T3          -------------KPES---------F----LKPLKVTNIR-----------STDILQVS
K9SGJ5          TQDQ---------MVSY---------V----LENLYIRQEK-----------GASVLWLI
A0A6N2JS94      YKDI---------DALT---------I----MSGLDIRPEK-----------DTMVLRLT
A0A6C2DSN4      SKPI---------DASS---------V----INGLDIRPEK-----------DALILRLT
L8MYT6          SKPI---------DASS---------V----INGLDIRPEK-----------DALILRLT
A0A352JGJ6      IKDI---------DAVT---------I----MSGLEIRPEK-----------DALILRLN
A0A1J5GLS2      YREI---------DAGT---------I----MGGLEIRPEK-----------DALILRLI
A0A2W4W6M5      YKEI---------DAGT---------I----MGGLEIRPEK-----------DALILRLT
A0A2W7AN33      YKDI---------DTLA---------I----MDGLDIQPEK-----------NAMVLRLI
A0A256BLV2      FKDL---------DPLT---------I----MNGLDIRPEK-----------DTMVLRLT
A0A2W6ZXF3      YKEI---------DAGT---------I----MNGLEIRPER-----------DALILRLI
A0A2Z5WX66      SKDI---------DAVT---------I----MNGLEIRPEK-----------DALILRLT
Q7NEU3          LLDQ---------DAED---------I----TKRLEIIREE-----------RTQVAVVS
A0A3C0N2P0      I------------DANT---------L----RSQLQISRLG-----------ETKILEVR
A0A6P0JR04      M------------DYNG---------V----IGNLSISRVE-----------TTKILEVS
A0A6B3M6M6      F------------DYNT---------L----QEQLTVSQLR-----------ETKILEAR
A0A6P0KD09      F------------DYDS---------F----QDKLTVTQLR-----------ETKILETR
A0A6B3NIJ0      F------------DYDS---------F----QDKLTVTQLR-----------ETKILETR
A0A6M0F053      F------------DYDS---------F----QDKLTVTQLR-----------ETKILETR
A0A6P2ATU9      V------------DYGA---------L----VGAFNVSQIV-----------GTKIMEVS
A0A845XAM4      L------------DYHG---------L----VGSMTINQLE-----------GTKILEVG
A0A352XE00      I------------DYNL---------L----RTKLTISRLQ-----------QTKILEIR
A0A6P0QC14      I------------DYDT---------L----RGKLGISRLA-----------ETKILEVR
B4VS56          I------------DYNT---------L----RSQLAINQLQ-----------ETKILEVR
A0A352AAQ3      V------------DYDT---------L----RTKLIISRLQ-----------QTKILEVR
A0A350Y472      V------------DYSA---------L----RTKLTISRLQ-----------ETKILEVR
A0A355DVB4      V------------DYSA---------L----RTKLTISRLQ-----------ETKILEVR
A0A1Z4RMB9      DKPL---------KPED---------F----RKKLVTEVVG-----------GTDVVDVK
A0A318B4H2      GKRLDQ-------AASI---------L----LDNITVEPIG-----------ASALVDIT
A0A2K3BR24      GEPL---------TPGG---------M----RKNLNVTRLS-----------DTEILEIA
K9YXY1          GEPL---------TPGG---------V----RKNLNVTRLS-----------DTEILEIA
A0A1Q4RTR1      GQPL---------AFEE---------F----SKNLKVSGVK-----------GTDILQIS
A0A1Z4SQV2      GQPL---------TVEE---------F----SQKLKVAGVK-----------GTDVLEVS
A0A2H2XGN1      GQPL---------TVEE---------F----SQKLKVAGVK-----------GTDVLEVS
A0A433UXH8      GQPL---------TIEE---------F----SQKLKVTGVK-----------GTEVLQIS
A0A1U7HGH0      -TTL---------SLES---------L----RQGLDIVAVE-----------GTEILQVV
K9XJD3          -TAL---------SLES---------L----RQGLDIVDVE-----------GTEILQVV
K9SX01          ALPL---------DNDV---------F----LKPLSLDVIK-----------YTDVIQVS
A0A4P7ZT55      -------------EPDA---------L----VGRVTARSVQRD---------ADGVLKVS
A0A1E5QIR9      GQPL---------KRKD---------F----LRRLSISTLK-----------DTDVLQIS
A0A6P1A9A0      ---Y---------DYSS---------L----SNNLKINRLG-----------QTQILEVR
A0A1Z4IBC7      GKKL---------SIRI---------F----AQQLKIEGIK-----------GTDVVQIS
A0A5Q0GKD1      GKPL---------SIRI---------F----AKQLKIEGIK-----------GTDVVQLS
Q3MDC6          GKPL---------SIRI---------F----AKQLKIEGIK-----------GTDVVQLS
A0A1Z4KM73      GKPL---------SIRI---------F----AKQLKIEGIK-----------GTDVVQLS
Q8YNX7          GKPL---------SIRI---------F----AKQLKIEGIK-----------GTDVVQLS
A0A367R4K6      GKLL---------SIRD---------L----AQQLKVEGIK-----------GTDVVQLS
A0A1E2WSV8      GKPL---------SIPD---------L----AKQLKIEGIK-----------GTDVVQLS
A0A7D7L9Y1      GKPL---------SIPV---------L----AEQLKIEGIK-----------GTDVVQLS
A0A2R5FRT9      GKLL---------SIPD---------L----AKQLKIEGIK-----------GTDVVQIS
A0A2K8T1B6      GKRL---------SIPD---------L----AKKLKIEGIK-----------GTDVVQLS
A0A235I9I0      GKLL---------SIPD---------L----AKQLKIEGIK-----------GTDVVQLS
A0A2D0HQT8      GKLL---------SIPD---------L----AKQLKIEGIK-----------GTDVVQLS
A0A2L2NU95      GKLL---------SIPD---------L----AKQLKIEGIK-----------GTDVVQLS
A0A367S084      GKLL---------SIPN---------L----AKQLKIEGIK-----------GTDVVQLS
A0A1Z4SMD6      GKLL---------NPEL---------V------KVKVETIT-----------GTDVLKIS
A0A2H2Y096      GKLL---------NPEL---------V------KVKVETIT-----------GTDVLKIS
K9S8M8          GKPM---------KPES---------F----LRGLEVKTIR-----------GTDVLLIT
A0A1Z4NFV0      GKLL---------DPDL---------L------KIKVEPVM-----------GTDVLKVS
A0A3M9ZEU1      GKRL---------QPQD---------I----SKQLKVKNIP-----------STDVLHLA
A0A1Z4JK72      GRPM---------DPEE---------L----SKQLKVEAVP-----------TTDILNLK
A0A0N7Z489      GRPL---------EPDE---------L----SRQIKVEPVP-----------TTDILDVK
A0A0S3TXS2      GRPM---------EPEE---------L----SRQVKVEAVP-----------TTDILELK
A0A2A2TPF8      GKLI---------EPES---------L------IIKVEPIA-----------GTDVLDVV
A0A1Z4R0P8      GKLV---------DPKS---------L------IIKVEPVA-----------GTDVLNVS
A0A0T7BUI3      GKFR---------NPET---------L------LIKVEPIV-----------GTDVLKVS
A0A1Z4LP32      GKPL---------EPES---------L------PMEVEALV-----------GTDVINVS
K9REP9          GKPL---------EPEA---------L------DLEIEPLV-----------GTDVINVS
A0A1Z4SIJ3      GHPL---------DPDQ---------L------KIKIEAIP-----------GTDVLKVS
A0A2H2XPG4      GHPL---------DPDQ---------L------KIKIEAIP-----------GTDVLKVS
A0A2A2TC28      GKPV---------DVEL---------F------KVLVEPVV-----------GTDVIKVS
K9V3C7          GRSL---------VPEA---------F------KIKVEAVP-----------GTDILNVS
A0A1Z4T6Y7      GNLV---------KPES---------L------NIKVEPII-----------GADVLNVS
A0A2H2Y561      GNLV---------KPES---------L------NIKVEPII-----------GADVLNVS
A0A1Q4S362      GELL---------EPES---------I------NIKIEPIP-----------GTDVLNVA
A0A3S1CIN8      GELL---------KPES---------I------NIKIDPIP-----------GTDVLKVA
A0A0C1NCB0      GTPL---------QPED---------L------EIKVDPVV-----------GTDVLKVS
A0A844MLU2      GTPL---------DTEG---------L------DIKVEPVV-----------GTDVLKVS
A0A2N6K7Q9      GKLI---------APEL---------L------KVNVKPIV-----------GTDVLRVS
A0A2N6MXH6      GKLI---------EPEL---------L------KVNVKPIV-----------GTDVLRVS
A0A2N6M5A8      GKLI---------DPEL---------L------KVNVKPIV-----------GTDVLRVS
A0A2N6LL61      GKLI---------DPEL---------L------KVNVKPIV-----------GTDVLRVS
A0A0S3TP66      GKLI---------DPEL---------L------KVNVKPIV-----------GTDVLRVS
G6FP91          GKLI---------DPEL---------L------KVNVKPIV-----------GTDVLRVS
A0A1U7GYR5      GKLI---------DPEL---------L------KVNVKPIV-----------GTDVLRVS
A0A2N6KY52      GKLI---------DPEL---------L------KVNVKPIV-----------GTDVLRVS
A0A2N6KMP5      GKLI---------DPEL---------L------KVNVKPIV-----------GTDVLRVS
A0A2N6MA45      GKLI---------DPEL---------L------KVNVKPIV-----------GTDVLRVS
A0A4Q9J9V9      GKII---------DPEL---------L------KINVKPIV-----------GTDVLKVS
A0A328IGA1      GKII---------DPEL---------L------KINVKPIV-----------GTDVLKVS
A0A4D9CE41      GKII---------DPEL---------L------KINVKPIV-----------GTDVLKVS
A0A0M0SFT2      GKLI---------DPEL---------L------KINVKPIV-----------GTDVLKVS
A0A1Z4TLC8      GKLI---------DPEL---------L------KINVKPIV-----------GTDVLKVS
A0A1Z4IYV4      GNTL---------DPES---------L------KIKVEPIV-----------GTDVLQVS
A0A1Z4Q0T6      GNTL---------EPES---------L------KIKVEPIV-----------GTDVLKVS
A0A0C2PT44      GETL---------DSES---------L------KIKVEPIV-----------GTDVLKVS
A0A1D2P6J4      GATL---------EPES---------L------KIKVEPIV-----------GTDVLKVS
A0A0C2LFH0      GNAL---------DPES---------L------KIKVEPIV-----------GTDVLKVS
A0A856M734      GNPL---------GPES---------L------QIKVEPIV-----------GTDVLKVS
B4WP72          -EAL---------TPTS---------L----KEGLEVKAIP-----------GTDILEIS
A0A2T1CIL7      GNFL---------KYQE---------I----LANLEVKPIV-----------GTDVLQVF
A0A433V7A0      DNAR---------LETN---------L----KKQFQVKNIA-----------GADVMQIS
A0A2T1FTR8      NRPERKRLDKFINKNES---------F----VQQLKVSSIK-----------NTDLLEVT
K9UA41          NRPERKRLDKFINKNES---------F----VQQLKVSSIK-----------NTDLLEVT
A0A563VS48      GELI---------RYQS---------F----RESFQVRPIT-----------GTDILNIR
A0A7Y0NUK1      GEPT---------KYEE---------I----IESLEVKTIT-----------GTDILEVT
A0A0C2LBE2      GKAI---------TIEE---------L----TNTLKISSLK-----------GTEILQVS
A0A433NN38      GNPL---------RIED---------L----AAALSVVSVK-----------GTDLLEIY
A0A2N6K0T2      GEPL---------RVED---------V----QKNLKVEGVK-----------GTDVLEVS
A0A2N6ML72      GEPL---------KVED---------L----QKKLKVEGVK-----------GTDVLEVS
G6FQZ6          GEPL---------KVED---------L----QKKLKVEGVK-----------GTDVLEVS
A0A2N6MQX9      GEPL---------KVED---------L----QKKLKVEGVK-----------GTDVLEVS
A0A2N6KXT6      GEPL---------KVED---------L----QKKLKVEGVK-----------GTDVLEVS
A0A2N6KGB9      GEPL---------KVED---------L----QKKLKVEGVK-----------GTDVLEVS
A0A2N6L3Y5      GEPL---------KVED---------L----QKKLKVEGVK-----------GTDVLEVS
A0A0S3TIS7      GEPL---------KVED---------L----QKKLKVEGVK-----------GTDVLEVS
A0A1U7GW28      GEPL---------KVED---------L----QKKLKVEGVK-----------GTDVLEVS
A0A2N6LW63      GEPL---------KVED---------L----QKKLKVEGVK-----------GTDVLEVS
A0A328IH74      GEPL---------TVEE---------L----LENLKVEGVK-----------GTDVLEIS
A0A4D9CIB0      GEPL---------TVEE---------L----LENLKVEGVK-----------GTDVLEIS
A0A1Z4TQ63      GEPL---------KIED---------L----LKNLKVEGLK-----------GTDVLEIS
A0A4Q9J8G2      GEPL---------KIKD---------L----LKNLKVEGLK-----------GTDVLEIS
A0A350Y0P6      GTPV---------QPSS---------I----GAGLKVEGIK-----------GTDVMEVS
A0A352X940      GSPI---------KPEN---------L----LGRLTVKGLK-----------GTDVMTVS
B8HTN4          GQLL---------KPEA---------F----LESLSVNNIR-----------GTDLLQVS
A0A6P1AFJ5      ---I---------NYNS---------L----AQNLKISQVN-----------NTKILEIS
B0CAX4          DQPL---------ETKD---------F----IEALTVFNVR-----------DTDVLKVT
A0A1Z4RN12      GEPL---------TYKS---------V----STALSVEPII-----------GTDLLKIT
A0A2T1CMF9      GEPL---------TYKT---------V----KKALKVEPVI-----------GTDLLQIS
Q7NDC5          GELL---------ATTD---------F----LRALKVEALR-----------RTDLLVIK
U5QGK3          GQLL---------RPEK---------F----LKALKVETLR-----------RTDLLVIR
A0A2W4UY24      GAPL---------EANA---------L----LQDMSVRAIP-----------GTDVLAVS
A0A838VM23      GVPI---------TPEI---------F----AKRLKFKNTP-----------TTDVLQVS
A0A0D8ZUV2      GEVL---------LPEG---------F----LKKQNIKQLA-----------ATDVLEVT
A0A433VDI0      GVPL---------EPED---------F----IKELKVKQLS-----------ATDILQLA
A0A3D1PG43      GATV---------QPTE---------L----LGKLKLKNVP-----------ATDVVQVA
A0A2P8QQ72      GKPL---------KPTA---------L----ISQLTLKNIP-----------ATDVLQVA
K9TZQ7          GKPL---------KPTA---------L----ISQLTLKNIP-----------ATDVLQVA
A0A6N8G584      GALI---------KPQV---------L----ANRINARNVP-----------LTDVLQIS
A0A2G7GPR0      GSLM---------KPQT---------L----ATRINAKNVP-----------LTDVLQIS
K9XH68          GSLI---------KPQA---------L----AGKMSAKNIP-----------LTDVLQIS
A0A1U7HW70      GSLI---------KPQA---------L----AGKMSARNIP-----------LTDVLQIS
A0A2S6VEJ8      GSLL---------KPQV---------L----ASRVNARNIP-----------LTDVLQIS
A0A140KBA0      DELY---------RYKD---------L----INKLEIKPVT-----------GGNVIKIS
K9XSG1          DELY---------RYKD---------L----INNLEIKALT-----------GSNVIKIA
A0A2T1GMT4      GKLI---------AASD---------L----HSGLTTKIVG-----------GADILQVS
K9UI51          GKLL---------TASD---------I----HTGLTTKIIG-----------GSDILQIG
A0A1Z4QL41      GEPL---------EVED---------L----VKDLTLKIIG-----------GTDVLKIT
K9TYI2          GEPQ---------EIEA---------F----KKAVKLKIVG-----------GTDVLQIT
A0A252D4T4      GEPL---------TVEA---------L----KKAINLKIIG-----------GTDVLLVS
A0A252DJH5      GEPL---------TVEA---------L----KKAINLKIIG-----------GTDVLLVS
A0A252EB80      GEPL---------TVES---------L----KKAINLKIIG-----------GTDVLLVS
A0A6G9SKZ9      GKPL---------TAEA---------L----KKALNLKIIG-----------GTDVLQVS
A0A1Z4HPW5      GQLL---------TPEA---------L----KKALNLKIIG-----------GADVLQIS
A0A1Z4MSN1      GKPL---------TTEA---------L----KKALSIKIIG-----------GTDVLLVS
A0A1Z4U1C2      GKPL---------TTEA---------L----KKALSIKIIG-----------GTDVLLVS
A0A0D6KV51      GKPL---------TPEV---------L----KKALNIKIIG-----------GTDVLLVS
A0A1Z4MKF8      GKPL---------TPEV---------L----KKALNIKIIG-----------GTDVLLVS
A0A2C6WC43      GQPL---------TVKA---------L----QKSLILKIIG-----------GTDVLRVT
A0A841WRE0      GQPL---------TVKA---------L----QKSLILKIIG-----------GTDVLRVT
A0A1Z4L5A1      GQPL---------TVKA---------L----QKSLVLKIIG-----------GTDVLRIT
A0A367QD86      GQPL---------TVKA---------L----QKSLVLKIIG-----------GTDVLRIT
A0A2K8SM78      GKPL---------EVEK---------L----RNSLTLKIVN-----------GTDVLRIS
A0A2R5FPC0      GKPI---------EVEK---------L----RKAVILKIIN-----------GTDVLRIS
A0A5P8W5T6      GKPI---------EVEK---------L----RKAVIMKIVN-----------GTDVLRIS
A0A7D7LDT7      GIPL---------EVQA---------L----KKALNLKIIG-----------GTDVLLIS
A0A235IZ96      DKPL---------EVQA---------L----QKSLTLKIVG-----------GTDVLKIT
A0A2L2NGP0      DKPL---------EVKA---------L----QKSLTLKIVG-----------GTDVLRIT
K9QM62          GKPL---------TVKA---------L----AKNLDLKIVG-----------GTDVLQIT
A0A1Z4FWI3      GEPL---------TVEA---------L----KQRLTLKIVG-----------GTDVLLVS
A0A1Z4JYE7      GEPL---------TVEE---------L----QEKLTLKIIG-----------GTDVLEIT
A0A0F5YE28      GKLI---------DPES---------I----RKSLEVKIIG-----------GTDIVSLS
U7QEH7          GKLR---------EAES---------I----RKSLEVKIIG-----------GTDIVSLS
A0A3S1ATK5      GEVL---------EVED---------L----QKSLTLKIVG-----------GTDVLKLT
A0A2Z6CPH0      GESL---------KVEE---------L----QKKLKLKIIG-----------GTDVLRVS
A0A1Z4GT50      GEVL---------AVEE---------L----AEALELKIVG-----------GTDVLQLN
A0A1Z4GIX0      GEPL---------KVEE---------L----QKNLTLKIVG-----------GTDVLRIA
A0A2H6LC24      GEPL---------KVEE---------L----QKNLTLKIVG-----------GTDVLRIA
B2J6N5          GKPL---------EVEK---------L----RKSLTLKIVS-----------ATDVLRIS
A0A367RMI4      GEPL---------EVKK---------L----LKLLNLKVIG-----------GTDVLRIS
A0A235HUM0      GEPL---------EVKA---------L----QKALNLKIVG-----------GTDVLRIS
A0A2L2NW47      GEPL---------EVKE---------L----LKVLNLKIVG-----------GTDVLRIA
A0A1E2WUR1      GIPL---------EVQA---------L----KKALNLKIIG-----------GTDVLLIS
A0A235IKU3      DKPL---------EVQA---------L----QKSLTLKIVG-----------GTDVLKIT
A0A1U7MYU6      GLPL---------EPEA---------L----KRRLTIKIVG-----------GTDVVRLS
A0A1D8TNX9      GLPL---------EPEA---------L----KRRLTIKIVG-----------GTDVVRLS
A0A6P0L6C2      GLPL---------EPEA---------L----KRSLTVKIVG-----------GTDVVRLS
A0A6P0MVH0      GLPL---------EPEA---------L----KRSLTVKIVG-----------GTDVVRLS
A0A6P0KJV0      GLPL---------EPEA---------L----KKKLTVKIVG-----------GTDVVRLS
A0A6L9ZJG4      GLPL---------EPEA---------L----KRRLTIKIVG-----------GTDVVRLS
A0A846GI17      GLPL---------QPEA---------L----KRKLTVKIVG-----------GTDVVRLS
F4XKF3          GLPL---------QPEA---------L----KRKLTVKIVG-----------GTDVVRLS
A0A1D9FX10      GLPL---------EPEA---------L----KKKLTVKIVG-----------GTDVVRLS
A0A6P0Q0T0      GLPL---------QPEA---------L----KRKLTVKIVG-----------GTDVVRLS
A0A6P0W5I0      GLPL---------QPEA---------L----KRKLTVKIVG-----------GTDVVRLS
A0A845XJ02      GLPL---------QPEA---------L----KRKLTVKIVG-----------GTDVVRLS
A0A846D190      GLPL---------QPEA---------L----KRKLTVKIVG-----------GTDVVRLS
A0A3C0NJ41      GKSL---------TPED---------F----QKKLKAKIVG-----------GTDVVELS
A0A352AG88      GTPL---------SPEA---------L----HEKLTIENLA-----------ETDVLELA
A0A350Y374      GEPI---------SPES---------L----QKKLKIKTIG-----------ATDVIEII
A0A355DPX0      GEPI---------SPES---------L----QKKLKIKTIG-----------ATDVIEIT
A0A0S3TYD7      --PL---------KVED---------F----LKRLKVTPVN-----------RSDILRVE
A0A2T1DNG3      --PG---------SVGG---------F----RGALTIVQVGTKKV-------DTKIFSIT
A0A140K3H3      --DL---------TVTD---------V----MENLSITQAAVNEM-------PTDVLVVS
K9XUB8          --DL---------TVGN---------V----IGNLSIIQANVNEI-------PTDVLVVS
A0A563VLD6      --GL---------SVGE---------V----ISKLSINTQEVNEI-------PTDVLTVS
A0A7Y0NVW6      --GL---------SANS---------V----VGMLSINPQVINDI-------PTDVLTVS
U5QL42          FNIL---------NSTT---------A----ADNISISQIG-----------DAGVLRVA
A0A6H2NHD5      YPDI---------TYGT---------L----LNNLTITRDG-----------ESKVLRVN
A0A2P8W4F7      YPNI---------TYNA---------L----LSRLSIVQEG-----------ESKVLRVT
A0A5Q4E0Z4      YPEI---------TYTT---------L----LNDLVISQEG-----------ESKVLRIT
A0A2P8VVX1      YPEI---------TVDE---------L----RAGFTLARLS--EGRT-----GTRIFQAS
A0A2P8WHY0      YPDL---------DVDQ---------V----VNTFSLQRVGGEERDK-----ATRVFQAT
A0A563VQJ3      GEPL---------KPKN---------F----AQNLTVELVG-----------GSDVIEVG
A0A7Y0IRJ7      GEPL---------KPQD---------F----AKKLTVELVG-----------GSDVIEIS
A0A2T1CMT9      DSEA---------TTAA---------IIAALRESIGVYQVLDESTDSNKDS-ATKIIQVS
A0A7G8J1V5      --NI---------SARG---------L----AGRISIQQGGDSR----RRFASTETLQVS
A0A354B169      --DL---------TYLN---------L----SSRLKISIGGEKS----QE--AEGVLNVS
Q0IDT5          --DV---------SENE---------L----AERINITTGGAKR----KE--AEGVLKVS
A0A7G8FZD9      --DL---------SENA---------L----AGRITITTGGAKR----SQ--AEGILKVS
G4FMX5          --DL---------SENG---------L----ASRITITTGGEKR----TE--AEGILRVS
A3ZA21          --DL---------AENA---------L----ASRIEISTGGAKR----KE--ADGVLNVS
A0A076HBF2      --EL---------TTDA---------L----RSRVDISTGGAKR----KE--AEGVLNVR
A0A7G8FP50      --DL---------SADD---------L----SRRISIKT---RS----KE--SKGVLIVN
A0A7G8E8K7      --DL---------EIDD---------L----RERINIQTGGEKR----KE--AEGILNVS
A0A7G8GNR2      --EL---------STGA---------L----RSRVNISTGGAKR----KE--AEGVLNVS
A0A7G8ICD3      --GL---------STGG---------L----IGRIEINSGGAKR----KE--AKGVLNVS
A0A2D6FCW3      --DL---------NANA---------L----AKRITITTGGEKR----KE--AEGILNVS
A0A7G7KJ95      --DL---------DENS---------L----ANRITISSGGEKR----KE--AEGVLNVS
A0A7G8EAN3      --GL---------STNG---------L----AGKITI-IGGNNP----RE--AEGILKVR
A0A1D8TX52      YPDI---------TIRD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A1D9G4T2      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6P0PR27      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6P0WER7      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A845XM36      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A846DAT1      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A846GZK8      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
F4XP71          YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6P0KZ31      YPDI---------TIRD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6P0LPB8      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6L9YR57      YPNI---------TIRD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A845WMG9      YPNI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6P0SEV1      YPDI---------TIRD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6B3N2I8      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6M0B891      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6P0IJQ1      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6P0J8J8      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6P0ZSH6      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A845VS63      YPDI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A1U7N5X9      YPNI---------TVGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6L9Z1V0      YPDI---------KVGD---------I----RDSLRLAQVLQG-----KT--ETKVFQAV
A0A6P0LC12      YPDI---------TIRD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A6P0MVJ3      YPDI---------TIGD---------I----RGSLRLAQVLQG-----KT--ETKVFQAV
A0A2W6ZAV2      --NV---------SPDK---------I----ASGLKIVSGGDA----------SGVMDVS
K9W742          YPDL---------TLKE---------L----RKSLSVFQVEGSQDDS-----KTKIFAAN
A0A3D1PBA3      YPTI---------TAKE---------I----KANLKLRQVLEEK-----V--NTKIVEAT
K9XPB0          GSDA---------EIAE---------IVEQLKSSLSVYQVIDESEDNKGT--ETKIIEVA
A0A350Y7Z1      YPEI---------QVTD---------I----KESFSLTGVQEEDTDIKDT--QTKIVKVV
A0A352X2A7      YPTI---------KVEE---------I----REFLTITRIIEDETE-------TKIVKID
A0A0D8ZYV0      YPDM---------TVKE---------L----KQTLVLTPLVEENSNTKY----TKIVEAN
A0A433VMS2      YPTL---------TVAE---------V----KKNLVLKQVVEEKAN-------TKIVEAT
K9TYA7          YPTL---------TVAE---------V----KKNLVLKQVVEEKAN-------TKIVEAT
A0A2P8QUE1      YPTL---------TVAE---------V----KKNLVLKQVVEEKAN-------TKIVEAT
K9SA61          YPDI---------TVGH---------L----KEALIVTQVEDD-----KT--KTKIFEAI
A0A2G7GMH8      YPDI---------DIKS---------L----RKSLTLSPVQGQDGTGKKV--RTKIVEVL
A0A6N8FU92      YPDI---------DIQE---------I----KKSLVLIPVQGQEGTGKKV--RTKIVEVL
A0A2T1DWE8      YPKL---------EAAE---------L----QKALVLTQVEE----D-KV--KTKIFQAV
A0A832H7C4      YPDL---------KVAE---------V----QKNLLLLQVED----A-KV--KTKVFQVV
A0A1U7I8L3      YPKI---------KVKD---------I----KEALVVNQLQE----D-KV--NTKIFEVT
A0A2T1DJL8      GSNL---------DVGD---------L----QKGLTVSQVIEQRGND-KI--NTSIFEMV
A0A1Z4J9W0      YSDI---------DVDR---------L----RKRLNIAQVQELRGNE-RV--TTNLVEVT
A0A0N7Z5K9      YSDI---------DVDR---------L----RNRLNIAQVQELRGSE-RV--NTSIVEMS
A0A0S3TXC5      YSDI---------DVDR---------L----TRRLNIVQVQELRGNE-RV--NTNIVEMS
A0A846FBD3      --PA---------NPSV---------I----ASGLKVKPVS-----------GTDIIQIS
K1XF69          --PV---------APED---------I----RRNLDMRIIG-----------GTDIVLLT
B5W297          --PV---------APED---------I----RRNLDMRIIG-----------GTDIVLLT
H1W7M8          --PV---------APED---------I----RRNLDMRIIG-----------GTDIVLLT
A0A5Q4H6A5      --PI---------YPED---------I----RRNLDIRIIG-----------GTDIVLLT
D5A466          --PI---------YPED---------I----RRNLDIRIIG-----------GTDIVLLT
B4WQE3          ---I---------SYDS---------L----KNNLTITPND-----------NGKTLTVQ
U5QJM6          --DD---------DIDD---------V----IKRLEIEQVT-----------RTQVVSVA
A0A0V7ZFJ4      --LL---------KPSV---------L----ISKLRVNAVG-----------DTDILNLS
A0A235IXQ2      --PL---------EIDD---------F----LHNLKIKSVR-----------GTDILQLS
A0A367RIS1      --PL---------EIDT---------F----LSNLKIKSIR-----------GTDILQLS
A0A841V8H9      --PL---------EIND---------F----LLNLKIKSIR-----------GTDILQLS
A0A5Q0GJJ5      --PL---------EIDD---------F----LRSLKIKSVR-----------GTDILQLT
Q3MEB7          --PL---------EIDD---------F----LRSLKIKSVR-----------GTDILQLT
A0A1Z4KHN9      --PL---------EIDD---------F----LRNLKIKSVR-----------GTDILQLS
Q8YT70          --PL---------EIDD---------F----LRNLKIKSVR-----------GTDILQLS
A0A7U3NLX2      --PL---------GINS---------F----RSNLKVESIR-----------GTDVLQIS
A0A166IWU6      --PL---------RIDN---------F----LGSLKVNAVR-----------GTDVLQLS
A0A2S0Q8C0      --PL---------KIDH---------V----LGSLKVQAIR-----------GTDLLQLS
W6FSX4          --PL---------KIDH---------V----LGSLKVQAIR-----------GTDLLQLS
A0A218Q4C1      --PL---------GVGS---------F----LGKLKVTTIR-----------GTDVLQLS
A0A6P1ZT04      --PL---------AIDD---------F----LKKLKVQSIR-----------GTDVLQLS
A0A0V7ZNJ9      --PI---------SIED---------F----LKQLKVKSAK-----------GTDVLEIS
A0A5P8VSD1      --PL---------ELRD---------F----LRNLKIKNIR-----------GTNILQLS
A0A1S1ZVW2      --PI---------EIDV---------F----LKQLKLQIIR-----------GTDVMELS
A0A0R0M9H9      --PI---------EIDR---------F----LKQLKLQTIR-----------GTDVMELS
A0A7H0F4U6      --PI---------DIDR---------F----LKQLKLQTIR-----------GTDVMELS
A0A7W2A1T7      --PI---------EIDR---------F----LKQLKLQTIR-----------GTDVMELS
A0A838WI98      --PI---------EIDR---------F----LKQLKLQTIR-----------GTDVMELS
A0A853MJX6      --PI---------EIDR---------F----LKQLKLQTIR-----------GTDVMELS
A0A1B7WX82      --QI---------SLEN---------F----LKKLKLKSIR-----------GTDVLQVS
A0A1B7WTD1      --PM---------TTDA---------F----LKTLKLKTIR-----------GTDVMELS
A0A480ABC0      --PM---------TTGD---------F----LKILKLKTIR-----------GTDVMELS
A0A1Z4LRU5      --TL---------SHEA---------F----LKLLQVKSIR-----------GTDVLQLS
A0A1Z4JVB4      --PL---------SIED---------F----LKNLKLKTIR-----------GTDVMQIS
K9PIA4          --YL---------PIET---------F----LKILQLKTIR-----------GTDVMQLS
A0A1Z4HVE1      --PL---------TIEK---------F----LKLLKLKTIR-----------GTDVMQLS
A0A252ECZ1      --LV---------SIER---------F----LKVLKLKTIR-----------GTDVMQLS
A0A1Z4G5Y1      --PL---------SIEK---------F----LKKLKLKTIR-----------GTDVMQLS
A0A252DNA2      --PL---------SIEK---------F----LKLLKLKTIR-----------GTDVMQLS
A0A252E1Q4      --PL---------SIEK---------F----LKLLKLKTIR-----------GTDVMQLS
A0A6G9SK36      --PL---------TIEK---------F----LKILKLKTIR-----------GTDVMQLS
A0A1Z4M597      --PL---------TIEK---------F----LKLLKLKTIR-----------GTDVMQLS
A0A1Z4MWT1      --PL---------SIEK---------F----LKLLKLKTIR-----------GTDVMQLS
A0A1Z4TX53      --PL---------SIEK---------F----LKLLKLKTIR-----------GTDVMQLS
A0A2A2TNQ5      --PL---------EIDD---------F----LKNLKVKSVK-----------GTDVMELT
A0A3S1C4K5      --PL---------KVEP---------F----LKLLKVKSVK-----------GTDVLEMT
A0A1X4G3D5      --PL---------DPDV---------I----LGNLKLQTVR-----------GTNVMEFT
D4TNI2          --PL---------DPDV---------I----LGNLKLQTVR-----------GTNVMEFT
A0A1Z4H6Z8      --PL---------TIEK---------F----LKLLKLKTIR-----------GTDVMQLS
A0A3F3KPR9      --PI---------EIDR---------F----LKQLKLQTIR-----------STDVMELS
A0A1Z4NPM1      --PL---------SVED---------F----LKNLKVKSVR-----------GTDVMELS
A0A1Z4UZW9      --QL---------SLEV---------F----LKKLKLKTIR-----------GTDVMQLS
A0A1B7VSH4      --QL---------SLEV---------F----LKKLKLKTVR-----------GTDVMQLS
A0A1B7W126      --QL---------SLEV---------F----LKKLKLKTVR-----------GTDVMQLS
A0A3D4C6Q6      --QL---------SLEV---------F----LKKLKLKTVR-----------GTDVMQLS
A0A0K2M5H0      --QL---------SLEV---------F----LKKLKLKTVR-----------GTDVMQLS
A0A844I4P0      --QL---------SLEV---------F----LKKLKLKTVR-----------GTDVMQLS
A0A1B7UVJ4      --QI---------SLEN---------F----LTKLKLKTIR-----------GTDVLQVS
A0A1B7UTR1      --QI---------SLEN---------F----LTKLKLKTIR-----------GTDVIQLS
K7W0A4          --QI---------SLEN---------F----LKKLKLKTIR-----------GTDVIQLS
A0A5C0DRW9      --QI---------SLEN---------F----LKKLKLKTIR-----------GTDVIQLS
A0A6H2C088      --QI---------SLEN---------F----LKKLKLKTIR-----------GTDVIQLS
A0A1Z4RPC6      --PL---------KTED---------F----KKKLTVEIVG-----------GTDVIQIA
A0A2T1CMZ0      --PL---------KVKE---------F----KEKLAIEIVG-----------GSDVISIE
L8M4F7          --FI---------DPNG---------L----RPQLKVKLLP-----------GTDLIQIL
A0A140K2P2      --PI---------KPKD---------F----EKKLSIELVG-----------GSDVIEIT
K9XWX4          --PI---------KPKD---------F----EKKLNIELVG-----------GSDVVEIT
A0A140KB14      --AL---------KPEV---------L----NNKLKIEIIG-----------GTDVISVR
K9XX88          --AL---------KPEA---------L----NKKLKIEIVS-----------GTDVISLR
L8LZE9          --PL---------TPEK---------M----TKKLKADLVG-----------ASDVIEIT
A0A563VSV6      --TL---------TAKD---------L----RRKLQVGLVG-----------GSDVIEII
A0A7Y0IQB0      --PL---------TPKE---------L----REKLEVGLVG-----------GSDVIQIS
A0A433NM31      --PL---------KIKE---------F----QQRLEVKNIK-----------GTDTLLIS
A0A1Z4NDS1      --PL---------QIKA---------F----RSKLKVDSAK-----------GTDIIQVS
U9VXM0          --LL---------QPDE---------L----LRDLTITGIP-----------GTDVLKVT
A0A6M0RI13      --LL---------QPED---------L----LKSLTVTGVP-----------GTDVLKVT
A0A6M0S1N5      --LL---------QPED---------L----LKSLTVTGVP-----------GTDVLKVT
K9F4D9          --LL---------QPED---------L----LKGLTVTGVP-----------GTDVLKVT
A0A6I5QPI5      --PL---------NPRA---------L----LGKVSAQPVG-----------GTDVLRIS
A0A1Z3HMQ0      --SI---------PPDV---------L----RRGLTIAPLE-----------GTDVLRVA
A0A433W533      --PL---------KPAD---------I----IGKLKLKNIG-----------GTDVMQVT
A0A2P8QWJ3      --PL---------KPAD---------I----IGKLKLKNIG-----------GTDVMQVT
K9U6L7          --PL---------KPAD---------I----IGKLKLKNIG-----------GTDVMQVT
U5DPF5          --PM---------APQN---------I----VGNLKVYEVP-----------NTHILELT
A0A1E5QP61      --FI---------PPGD---------F----LSQLNVKKIE-----------GTDVLMIA
A0A846DWC7      --LL---------PPGD---------F----LSQLNVKKIE-----------GTDVLMIA
A0A845Y5J4      --SV---------KPGY---------V----LGGLTVEGIK-----------GTDVLKVS
A0A6P0X488      --SV---------KPGY---------I----LGGLTVEGIK-----------GTDVLKVS
A0A6P0VDM0      --SV---------KPSY---------V----LGGLTVEGIK-----------GTDVLKVS
A0A6P0UVD5      --SV---------KPSY---------V----LGGLTVEGIK-----------GTDVLKVS
A0A846BFF2      --SV---------KPSY---------V----LGGLTVEGIK-----------GTDVLKVS
A0A6M0G142      --AV---------KPGY---------I----LGGLTVEGIK-----------GTDVLKLS
A0A6P0MR53      --SV---------KPGY---------I----LGGLTVEGIK-----------GTDVLELS
A0A3M2GIL5      --LI---------PPGG---------L----LSGLGVKGIK-----------GTDVLLIT
A0A6H1TSJ9      --LI---------PPGG---------L----LSGLGVKGIK-----------GTDVLLIT
A0A3M1PML8      --PV---------LVKD---------F----LSKLKANSIP-----------ATDLLRVT
A0A6M8BE85      --PM---------LVKD---------V----VSKLTARSIP-----------ATDLLRVT
A0A0T7BPZ0      --PL---------TIED---------L----TKNIKVEVVK-----------GSEVMQIS
A0A352X442      --PI---------KPEV---------V----LQGLQVKPVA-----------GTDVMTLT
A0A6B3NF44      --PL---------DPKT---------L----WAGLEVKPVT-----------GTDVMGIS
A0A6M0EPL4      --PL---------DPKT---------L----WAGLEVKPVT-----------GTDVMGIS
A0A6P0K6L6      --PL---------DPKT---------L----WAGLEVKPVT-----------GTDVMGIS
A0A6P0MRR9      --PL---------DPET---------L----LKHLSAEPVA-----------GTDVLNVT
A0A6P0X1X4      --PI---------APEK---------L----LKGLTAEPVA-----------GTDVLDVT
A0A6P0UX57      --PM---------AAEQ---------L----LKALTAEPVA-----------GTDVLDVT
A0A846B9S8      --PM---------AAEQ---------L----LKALTAEPVA-----------GTDVLDVT
A0A0M0SHU3      --PL---------TVEE---------L----LEDLKVESVK-----------GTDVLEIS
A0A1D2PBN3      --PL---------TIQE---------L----SKKLKIKGDK-----------GTEVLEVS
A0A0C2LVR7      --PL---------TIQE---------L----SKKLKIKGDK-----------GTEVLEVS
A0A1Z4PQB9      --PL---------TIQE---------L----SKELKIKGDK-----------GTEVLEVS
A0A1Z4SFN6      --LL---------TIPN---------F----TAKLKTKNYK-----------GTEVLDIY
K9PGI8          --FI---------QTQD---------L----SHKLKVESSK-----------GTDILQIS
A0A654SFI6      ETPV---------TRRD---------VEQVLLDNIKVTPIS-----------QSSLVDIE
K9SSQ0          --DL---------IT----------------QISDHLTITP-----------DAKVLNIS
A0A2W1JIN9      DIPL---------SVGE---------L----KQSLQTGIVP-----------GTDIFQLQ
A0A318AJV1      HRPA---------TPDQ---------IVTRVTKSVGVSRDQ-----------LSYIISLG
A0A845WDS5      ---I---------TPKE---------L----NKDLTVKNIP-----------ATNILEIS
A0A6P0IC70      ---I---------TPKE---------L----KKDLTVKNIP-----------ATNILEIS
A0A845VVD9      ---I---------TPKE---------L----KKDLTVKNIP-----------ATNILEIS
A0A6B3MUB5      ---I---------TPKE---------L----KKDLTVKNIP-----------ATNILEIS
A0A6M0B7N4      ---I---------TPKE---------L----KKDLTVKNIP-----------ATNILEIS
A0A6P0J9W3      ---I---------TPKE---------L----KKDLTVKNIP-----------ATNILEIS
A0A6P0ZWE1      ---I---------TPKE---------L----KKDLTVKNIP-----------ATNILEIS
A0A1U7N2U4      ---L---------TINT---------L----RRDLKVKIVP-----------ATNILELS
A0A6L9YZL1      ---L---------TIYK---------L----REDLKVKIVP-----------ATNILELS
A0A6P0KYM4      ---L---------TIDK---------L----RQDLKVKIVP-----------ATNILELS
A0A6P0LSD6      ---L---------TIDK---------L----RKDLKVKIVP-----------ATNILELS
A0A6P0PNZ7      ---L---------TIDT---------L----REDLKVKIVP-----------ATNILELS
F4XV38          ---L---------TIDT---------L----REDLKVKIVP-----------ATNILELS
A0A6P0W137      ---L---------TIDT---------L----REDLKVKIVP-----------ATNILELS
A0A845XHF7      ---L---------TIDT---------L----REDLKVKIVP-----------ATNILELS
A0A845ZEG9      ---L---------TIDT---------L----REDLKVKIVP-----------ATNILELS
A0A1D9G1F2      ---L---------TIDT---------L----REDLKVKIVP-----------ATNILELS
A0A846CJ58      ---L---------TIDT---------L----REDLKVKIVP-----------ATNILELS
A0A6L9Y9E2      ---L---------TIDK---------L----REDLKVKIVP-----------ATNILELS
A0A6P0SGR0      ---L---------TIDT---------L----REDLKVKIVP-----------ATNILELS
A0A6M0BK48      ---L---------TIDK---------L----REDLKVKIVP-----------ATNILELS
A0A845WG36      ---L---------TIDT---------L----REDLKVKIVP-----------ATNILELS
A0A6P0X384      --LI---------STDD---------L----KEGLNTKIVP-----------ATNILELS
A0A2P8QIL5      --PP---------TVEE---------L----RKQLKVKTVP-----------ATSILEIK
A0A433W447      --PP---------TVEE---------L----RKQLKVKTVP-----------ATSILEIK
K9U1K8          --PP---------TVEE---------L----RKQLKVKTVP-----------ATSILEIK
A0A1Q4RZJ6      --KL---------TVDE---------F----SQGIRVKTIP-----------ATNILEIS
A0A1Z4SNV3      --TI---------TTAE---------L----SRGIRIKTIP-----------ATSILEIS
A0A2H2XJQ1      --TI---------TTAE---------L----SRGIRIKTIP-----------ATSILEIS
A0A3S5K358      --KL---------TVDE---------L----SQGIRVKTIP-----------ATNILEIS
A0A0T7BPJ4      --SI---------TPEK---------L----RKKLKVKIVP-----------ATNILEFK
A0A0C1QS61      --QV---------KIQD---------L----NKGLGVKIVP-----------ATNILQLS
A0A139X3R8      --QV---------KTPD---------L----SKGLGVKIVP-----------ATNILQLS
A0A844MZP8      --QV---------TTQD---------L----SKGLGVKIVP-----------ATNILQLS
A0A1Z4I7C5      --KL---------SPSD---------I----KSNLKVVIVP-----------ATNILELR
A0A844MST0      --KP---------TAGA---------L----RKKLKVKIVP-----------ATNILELI
A0A0C2MDK7      --PV---------STAE---------L----SHNLKVKIVP-----------ATNILELS
A0A856MDH8      --PV---------STTE---------L----ARNLKVKIVP-----------ATNILELS
A0A1Y0RCK1      --PV---------STAE---------L----SHNLKVKIVP-----------ATNILELN
A0A1Z4PWZ0      --PV---------TTGE---------L----SHNLKVTIVP-----------ATNILELS
A0A0C2QLT0      --PV---------TTTE---------L----SRNLKVKIVP-----------ATNILELS
A0A1Z4J2K1      --PV---------STAE---------L----SHNLKVKIVP-----------ATNILELS
A0A3S0ZSX0      --PL---------TPEK---------V----RQGLKVKIVP-----------ATNILEVS
A0A2N6K4T3      --EL---------TVDQ---------L----TQGLKVKIVP-----------ATNILEVS
A0A370CKT2      --EL---------TVDQ---------L----SQGLKIKIVP-----------ATNILEVS
A0A0S3TL97      --EL---------TVDQ---------L----SQGLKIKIVP-----------ATNILEVS
A0A2N6M8A0      --EL---------TVDQ---------L----SQGLKIKIVP-----------ATNILEVS
A0A2N6M9E1      --EL---------TVDQ---------L----SQGLKVKIVP-----------ATNILEVS
A0A2N6KJI4      --EL---------TVDQ---------L----SQGLKIKIVP-----------ATNILEVS
A0A2N6MZ77      --EL---------TVDQ---------L----SQGLKIKIVP-----------ATNILEVS
A0A2N6KT20      --EL---------TVDQ---------L----SQGLKIKIVP-----------ATNILEVS
G6FSN3          --EL---------TVDQ---------L----SQGLKIKIVP-----------ATNILEVS
A0A4D9CI02      --EL---------TVGQ---------L----SRNLKVKIVP-----------ATNILEVS
A0A328I8B9      --EL---------TVGQ---------L----SRNLKVKIVP-----------ATNILEVS
A0A4Q9J4Z7      --EL---------TVGQ---------L----SRNLKVKIVP-----------ATNILEVS
A0A0M0SU69      --EL---------TVGQ---------L----SQNLKVKIVP-----------ATNILEVS
A0A1Z4TIZ8      --EL---------TVEQ---------L----SQNLKVKIVP-----------ATNILEVS
K9UYB2          ---I---------TTKQ---------L----RRGLRVKVVP-----------ATNIIDLS
A0A1Q4S1H4      --KT---------TLKK---------L----SRDLKVKIIP-----------ATNILELS
A0A433VBU6      --KL---------SFKQ---------L----SRDLKVKIIP-----------ATNILELR
A0A218QN17      --QI---------TSGD---------L----SKGLGVKIVP-----------ATNILELS
A0A846HD20      --QI---------TSGE---------L----NQGLDVKIVP-----------ATNILELS
K9RKN2          KDGL---------TSEY---------L----RKNLSVKIVP-----------ATNILQIS
A0A2I8ADV2      --QL---------TPTD---------I----SSALKVSILP-----------ATNILQLN
A0A5Q0GMF5      --PL---------TASD---------I----RSNLKVIIVP-----------ATNILDLR
Q3MEW0          --PL---------TASD---------I----RSNLKVIIVP-----------ATNILDLR
A0A1Z4KIC7      --PL---------TPSD---------I----RSNLKVIIVP-----------ATNILDLR
Q8YSM5          --PL---------TPSD---------I----RSNLKVIIVP-----------ATNILDLR
                                                                            

K9SLA9          YHDPDPKRAASIVNTVSKIYIASDLETKSLEAKSLLQFVERQ-LPTSKSALESAEIKLRQ
A0A168TT23      VNSFDPAFAAQLANAVVEEYVRSTMQRRYDAGQEAREFLEGQ-LADMRIALERADQNLID
A0A0M1JWX9      YQDEDPEKIDFILKKLAENYLRYSFEDRQTNTRKGIQFIEEQ-LPQLRQRVDTLQGQLQK
A0A844MWN9      VNGSSPALARSRTNNLIKAYQNRLNELRQANSQARLQFSQKE-LDQAKYRLVQAQIELSN
A0A2T1M1V6      VEATSPELAYQRVKTLMNSYQKRLNELRQQDVKSQDQFAENA-LKKAQNNLILAQNKLTQ
A0A2G7GCS2      VKASSPEIAQKRLSNLINVYQLRLNELRHQDTNVRKQFSQTD-LEDAQAQLAKAQAELAN
K9XBH8          VKASSPEIAQQRLNNLINIYQLRLNELRYQDTSVREEFSRGD-IEKARQQLEQAQAALAS
A0A1Z4LJ30      VEGSSPELAQQRANGLIKAFRDRLQELRKDEAQQRSQFMQDE-VKQAYQKLFKTQKNLSE
Q7NF11          AKGNAPEVAEARADLVVRSYVARLEELRNAYAASRDTLSQKE-LDRARRELTRAEAALAR
K9RI76          VQGSSPELAKNRAAALIAAFSNRLQELRLDEAKQRSQFMQGE-VKLANTKLLKAQKALSE
A0A433VN22      VSGSQPDLATLRTQNLIKAYQARLDELREGNSKERQKFNVKE-LEQAKAKLSNAQTKIAR
A0A139WSU3      VSGSSPKLANQRAIAITEAYQNRLNELRQANSRTRQKFSQIE-LEQAKLKLAQAQSKLTI
A0A844MJB7      VSGSSPKLAKERAIAITEAYQTRLNELRQANSRTRQKFSQVE-LEQAKLRLAQAQSKLTI
A0A352AE27      VKGSSPELAHQRAIALIEAYQQRLNELRQTDGVARAQFSQKQ-LEQAQQRLNQAQMELAQ
A0A3B8JH60      VNGSTPEVARQRAIALLKVYQARLNELRQADGMSRKQFSQKE-LEQAKERLAQAQMALAQ
A0A3C0N766      VNGSTPEVARQRAIALLKVYQARLNELRQADGMSRKQFSQKE-LEQAKERLAQAQMALAQ
K9W9J7          VSGSTPELAKGRANNLLQVYQQRLNQLRQADSASRKQFSQKE-LNQAKARLDQAQRAVAQ
Q7NJN6          AKGSSPELAQQRAEWVLQSYQTRLNALRLDDARRRDEFSRVE-TAKAQNNLQTAQVELYG
U5QCC3          VKGSSPEIAKNRANALLQSYQRRLNELRLDDARRRDQFSHEE-LERAKRTLQQTQSELAS
A0A1Z4JCS8      VTGSSPDIAKQRAEAILNAYRQRLSELRQANNNTRDGFSQKQ-LEQAQRRLTEAQTALAQ
A0A846GVZ3      ATGASPELARDRVRALISAYQERLNELRQADGTTRVEFNKKA-LDRAKQKLDQSQEALAK
A0A6P0PI80      ATGASPELARDRVRALISAYQERLNELRQADGTTRVEFNKKA-LDRAKQKLDQSQEALAK
A0A6P0WGT6      ATGASPELARDRVRALISAYQERLNELRQADGTTRVEFNKKA-LDRAKQKLDQSQEALAK
F4XTX2          ATGASPELARDRVRALISAYQERLNELRQADGTTRVEFNKKA-LDRAKQKLDQSQEALAK
A0A3S0Y9N9      YADTNPRMAASIVNTLMKIYIENDIDINRAQTRSARSFIAQQ-LPLSKAALQAAEKKLQD
A0A6P0ZKB8      YTDEEPRTAASVVNTLMKIYIENDIEANRAQTKSARDFIAQQ-LPARKAALQAAERKLQL
A0A846EDH6      YTDEEPRTAASVVNTLMKIYIENDIEANRAQTKSARDFIAQQ-LPARKAALQAAERKLQL
A0A433UNK7      YTSTDPRTAASVVNTLMKVYIENDINANRAQTRSARDFIAQQ-LPLRKAALQTSERRLQF
B8HNB0          YTGTDPKTVQAILDALNKTYIDYSLEKRRSQVSSGVRFIEEQ-LPAAQAKLAQSAQAVRN
A0A318BJ18      FSSPDPDFSARIANAWAENFIQTNLERKIQATSYGRNLLQRQ-LALQKERLDDSQRQLVA
A0A3B8Y8H9      YQDIDPRKVTFILNELAKVYLDYSLNDPRMKKTQGLQFVEDQ-LPKLDQEVSSLQKELER
A0A2W1JVB9      YESEDPEEAALVINTLMKVYLADNLRINRLEASSARQYIDQE-LPKTREKIENLEEQLRR
A0A6H1U102      YTDTDPSRAKAILEALGSTYVDYSLERQLSQATNAIDFIEEQ-LPKAQAELNETAQAIQK
A0A7C3ZEJ3      YTDRDPERAKAVLEALGNTYVDYSLERQRSEATNAIGFIKEQ-LPEAQKELNQSASAIRE
A0A2P8W9H0      YSSEDPEQVTDVLEVVMAGYLRYSLEDRQNDIFRGLDFLDEQ-LPEVRERVSSLEAELED
A0A6I5P386      YKSTDSEKVTYVLDLLLSTYLRYSLEDRQNDINRGISFVDEQ-LPVVRQQVQDLETELEN
A0A3M1SVZ4      YQDENPKKAATFVNSLIEVYLEDDILRKRAELTATREFIEAK-LPDAEYTLSQAEQELRQ
A0A318BG22      YTSNDARLSAAIANAAVDQFIESTTQRQYAASSYARSFVGNR-LTQQRARLEESERQLVA
A0A2T1E9V8      YKSNNPEIASLVVNQLMNVYVNRNLLGNRAAAISAGNFITSQ-LPKVKANVYNADAAIRK
A0A1Z4LN32      YTSGKPELAIKVVDKVMEAYIKKNIYTNRSEAIAARSFIEKQ-LPSAKRGLSKVTEELRD
A0A2I8A9F5      YVSEDPYLAKAIVNQVMKSYIANNILTNRSEVMAAGDFIAKQ-LPGAKTELEEAQKALLQ
A0A218Q6R8      YVSEEPQLAKEVVNQVMKSYIANNILANRSEAIAAATFIQQQ-LPQAKKELEEITEALRQ
A0A218QGE0      YTSDNPESAKAIVDQVMKSYIANNILSNRTQAISAGAFIEKE-LPRAKAQLEKAAEALRK
A0A846HDH5      YTSDNPESAKAIVDQVMKSYIANNILSNRTQAISAGGFIEKE-LPRAKAQLEKAAEALRE
A0A3M2GQQ6      YTDTDPARAKAILDVLGKTYVDYSLERQVSQASNAIEFIEEQ-LPKAQQELSESALAIQS
A0A6H1U2X0      YTDTDPARAKAILDVLGKTYVDYSLERQVSQASNAIGFIEEQ-LPKAQQELSESALAIQS
K9TLQ0          YQDTDPQKIQIILKELATGYIHYSEMEQQTTLRQGLEFVETQ-LPRLQQRVDTLQEYLEK
K9QF04          YQDTDPEKIEFVLDKLAEGYTAYYLEKLQTSSKQALKLVEAL-SPQQRQRVDQLQVQLQR
K9W1T3          YTDTDPAKAAKIINTVMSIYIKSDVNAQRSEAKAAREFVEKQ-LPIIEVTVRQAEQDLRK
K9SGJ5          YRDPDPQRAKDVLDSLASAYSQYSLKDRRSRSSTAIQFIEDK-LPQVKKDLDESALTVTK
A0A6N2JS94      YTDSNPKRAQGVLNALAQTYVEYSLKDRRTKSSTAIKFIQDK-LPQVKQQLDKSALAVTQ
A0A6C2DSN4      YTDSDPKRAREVLGALSQTYVEYSLKDRRTKSSNAIKFIQDK-LPQVKQKLEKSALAVTQ
L8MYT6          YTDSDPKRAREVLGALSQTYVEYSLKDRRTKSSNAIKFIQDK-LPQVKQKLEKSALAVTQ
A0A352JGJ6      YIDSDPKRAREVLNALAQTYVEYSLKDRRTKSSTAIKFIQDK-LPQVKQQLDKSALAVTR
A0A1J5GLS2      YTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAIKFIQEK-LPQVKQQLEKSALAVTQ
A0A2W4W6M5      YTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAIKFIQDK-LPQVKQQLDKSALAVTQ
A0A2W7AN33      YTDSNPKRAQEVLNALSQTYVEYSLNNRRTNSSTAIKFIQDK-LPQVKQQLDKSALAVTQ
A0A256BLV2      YTDSDPKRAREVLTALTQTYVEYSLKDRRTKSSTAIKFIQDK-LPQVKQQLDKSALAVTQ
A0A2W6ZXF3      FTDSDPKRAREVLNALSQTYVEYSLSDRRTKSSTAIKFIQEK-LPQVKQQLDKSALAVTQ
A0A2Z5WX66      YTDSNPKRAREVLTALSETYVEYSLKDRRTKSSTAIKFIQGK-LPQVKQQLDKSALAVTQ
Q7NEU3          FEDTDPQVVKAILDELSRTYIDYSLEIQKSKLDGAIAFIENE-LPPVRKEVERAEEQLRT
A0A3C0N2P0      YQDSNPEKIQFVLERVAQGYVNYSAKEQQDSVTQGLGFVNEQ-TKNLQKRVNELQKSIQS
A0A6P0JR04      YQDSDPEKIKYILDQVAAGFVDYSQREQKTGRQKGLTFVEDQ-LPELQNRVDTLQADLQT
A0A6B3M6M6      YQDSDPEKIKFVLEQVVKGYIKYSEQEQQTTTRQGIQFVESQ-LPKLQERVNKFQEQLQR
A0A6P0KD09      YQDSDPEKIKFVLEQIVKGYIKYSEQEQQTTTRQGIQFVESQ-LPKLKERVNKLQEQLQR
A0A6B3NIJ0      YQDSDPEKIKFVLEQIVKGYIKYSEQEQQTTTRQGIQFVESQ-LPKLKERVNKLQEQLQR
A0A6M0F053      YQDSDPEKIKFVLEQIVKGYIKYSEQEQQTTTRQGIQFVESQ-LPKLKERVNKLQEQLQR
A0A6P2ATU9      YQDSDPHKIQFVLDKLAAGLIAYSQMEQQTGRQKGLGFVEEQ-LPILEERVNTLQNDLQA
A0A845XAM4      FQDSDPNKIRYILDALSIGFIDYSRVEQKTGREKGLDFVETQ-LTKQRKAVNQLQEQVEA
A0A352XE00      YQDSDPEKIKFILDQVANGYINYSRQEQQTTTQQGIQFVKDQ-LPKLQERVNQLQAQLQE
A0A6P0QC14      YQDSDPEKIQFILKELADGYVEYSKIEQRNSVEKGLEFVNGQ-TKELQKRVKDLQQKIQT
B4VS56          YQDSDPEKIQFILEQIATGYVNYSLSEQQTSTRQGIQFVEEQ-LPKLQGRVDSLQQKLQR
A0A352AAQ3      YQDSDPEKIRFILEQVADGYVKYSETEQRTAVTQGLAFVNKQ-AKELQGIVNDLQQKVQD
A0A350Y472      YQDSDPNKIQFILEQVANGYVQYSEAEQRTAVTQGLAFVNKQ-TQKLQELVNDLQQQIQN
A0A355DVB4      YQDSDPDKIQFILEQVANGYVKYSEAEQRTAVTQGLAFVNKQ-TQKLQELVNDLQQQIQN
A0A1Z4RMB9      YRHPNPKTASEVVNALMDVYVKEQIRGNQSQPAAAKDFITKE-LPSIESKVQQAESQISA
A0A318B4H2      FKSPSAELSSKVANSWAAEYIQSNLDRRFATTADARGFLEQR-LAQLRSRLEASERELVA
A0A2K3BR24      YEHPEPEKAATIVNELMNVYRENNVLNNRSEATAAREFIEEQ-LPKTEQSVQAAEEKFRE
K9YXY1          YEHPDPEKAATIVNELMNVYRENNVLNNRSEATAAREFIEEQ-LPKTEQSVQAAEEKFRE
A0A1Q4RTR1      YRSPDKKMAAAVVDSVIKNYLENDIRANRTEVVSAREFISKQ-LPEVEAKVRQAEVSLRL
A0A1Z4SQV2      YRSPDAKQAANIVNTLIKNYLENDIRTNRTEAVAAREFISKQ-LPEVETKVRSAEYGLRQ
A0A2H2XGN1      YRSPDAKQAANIVNTLIKNYLENDIRTNRTEAVAAREFISKQ-LPEVETKVRSAEYGLRQ
A0A433UXH8      YRSSNPKLAANVVNTLIKNYLENDIRTNRTEVVAAREFISKE-LPEVETKVRSAEYGLRQ
A0A1U7HGH0      YRGEEPEQAALIVNQLMNVYVSKNLLNNRAAAISAGNFITAQ-LPKVKANLQRADLAVRN
K9XJD3          YRGEDPAQAALVVNQLMNIYVNKNLLNNRAAAISAGNFITAQ-LPKVKANLQRADLAVRN
K9SX01          YLSSSPQDAAKIVNGLMKSYIDNDLLTNREDTASARKFIDEQ-LPKLQISLRQAEAALRR
A0A4P7ZT55      LQWRNPQQGEQLLKALSQSYLAYSLRQRQEKLSQGLKFLDEQ-APGLQERVSQIQQELAN
A0A1E5QIR9      FKSNDPQEAVDVVNRLMQFYQENDIQTNRAQAAAVRRFIEEQ-LPKSEFTVQEAEANLRV
A0A6P1A9A0      YQDSNPEKVKIVLDRVAAGYINYSLNEQQSGLQQGLEFTEDQ-LPQLQERVDKLQERLQI
A0A1Z4IBC7      YKSNNAEQAAKVVNTVIKSYIDLNIQANQDEAVTAKQVILRE-IPKAEESVKKAESELRI
A0A5Q0GKD1      YKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETSVKKAESELRI
Q3MDC6          YKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETSVKKAESELRI
A0A1Z4KM73      YKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETSVKKAESELRI
Q8YNX7          YKSNDPALAAKVVNKVIDNYIALNIKANQDEALTAKQVLIAE-IPKAETSVKKAESELRI
A0A367R4K6      YQSNNPELAAKIINQVIDNYIDLNIKANQNEAFAAKQVLVAE-LPKAEEIVSRAESQLRL
A0A1E2WSV8      YKGGDPELAAKIVNEVIDSYIDLNIKANQNEALTAKQVLVTE-VPKAEEIVRRAESKLRL
A0A7D7L9Y1      YKGGDPELAAKIVNEVIDSYIDLNIKANQNEALTAKQVLVTE-VPKAEEIVRRAESKLRL
A0A2R5FRT9      YKGGNPELAAKIVNEVIDSYIELNIKANQNEALIAKEVLVTE-VPKAEEIVRRTESKLRL
A0A2K8T1B6      YKGSDPELAAKIVNEVIDSYIDLNIKANQNEALTAKEVLVTE-VPKAEEIVRRAESKLRL
A0A235I9I0      YKGGDPKLAAKIVNEVIDSYIDLNIKANQNEARTAKQVLVTE-VPKAEEVVRRAESKLRV
A0A2D0HQT8      YKGGDPKLAAKIVNEVIDSYIDLNIKANQNEARTAKQVLVTE-VPKAEEVVRRAESKLRV
A0A2L2NU95      YKGGDPELAAKIINEVIDSYIDLNIKANQNEARTAKQVLVTE-VPKAEEVVRRAESKLRL
A0A367S084      YKGGDPELAAKIVNEVIDSYIDLNIKANQNEARTAKQVLVTE-VPKAEEVVRRAESKLRL
A0A1Z4SMD6      YSSKDPEVASSVVNQVMKTYVEKNIESNRSQVFAAGSFIKKQ-LPDSKAELEQAAEALRQ
A0A2H2Y096      YSSKDPEVASSVVNQVMKTYVEKNIESNRSQVFAAGSFIKKQ-LPDSKAELEQAAEALRQ
K9S8M8          YTSDDPQEAANVVNVLMEIYIKENIRANRAEATAARKFITEL-LPKTEASLRQAEAQLRD
A0A1Z4NFV0      HISDNPNLAAAVVNQVMESYVESNIQSNRAEAQSAGKFIEQQ-LPRARAELEKSAEELRK
A0A3M9ZEU1      YTDSDPERAAKVVNQVINVYIENNVAANRAEAAAAREFISRE-IPRVEAAVRQAERALRE
A0A1Z4JK72      YSDNDAEMAANVVNQIMKAYIDNNLKTNQEEANKAGRFIESQ-LPRAEAELQKASEELRL
A0A0N7Z489      YADDDPEMAANVVNQVLKAYIDNNLKTNQEEANKAGRFIDNQ-IPPAEEALNRASEDLKN
A0A0S3TXS2      YADDDPEMAANVINQIVKAYIDSNLKTNQEEANKAGRFIDSQ-IPPAEEALNKASEDLRN
A0A2A2TPF8      YISENGKEAAAIVNQLMRSYVENNIRNNRSEALAARKFIEAQ-LPRAKGELDKTAEESRR
A0A1Z4R0P8      FISDKPKEAAAIVNQLMRSYVDNNIKNNRSEALAARKFIEAQ-LPRAKGELDKTTEDLRR
A0A0T7BUI3      HASDNPKLAAKIVNQVMATYAENNVESNRTQVTAAGEFIKKQ-LPSSRKELESAAEALRQ
A0A1Z4LP32      YTSEKPRLAAAIVNQVMRTYVKNNIESNRAQVVAAGQFLKQQ-VPLSRLELENATEALLQ
K9REP9          YTSDKPRLAASIVNQVMESYVDNNIESNRAQVVAAGEFLKKQ-VPLSKIELEQATQALLQ
A0A1Z4SIJ3      YVSINPELAKKVVNQVMQTYVDKNIESNRTQVYAAGEFIKKQ-LPFSRAELESASEALRR
A0A2H2XPG4      YVSINPELAKKVVNQVMQTYVDKNIESNRTQVYAAGEFIKKQ-LPFSRAELESASEALRR
A0A2A2TC28      YQSNNPEMTAEVVNQVMNTYIKNNIQSNRTQVFAAGDFIRKR-LPSSRAELERATEALRR
K9V3C7          FTWDNPEIASAVVNKLMDVYVANNLANSRSEAVSAGKFIELQ-IPQAKIELDKTSEALRN
A0A1Z4T6Y7      HISSDSRLAADVINYVMRSYVENNIQTNRLEAVSARKFIENQ-LPRAEQELNKTTEELRS
A0A2H2Y561      HISSDSRLAADVINYVMRSYVENNIQTNRLEAVSARKFIENQ-LPRAEQELNKTTEELRS
A0A1Q4S362      HISGESKKAADVVNQIMRSYVNSNIQNNRQETIAARKFIEGQ-LPRAEGQLNRATEDLRS
A0A3S1CIN8      HISGESKKAADVVNQIMRSYVNSNIQNNRQETIAARKFIEGQ-LPRAEGELNRATEQLRS
A0A0C1NCB0      YTAKAPNLAANVVNLVMQAYVNNNIQSNQEQVLAAGEFIKKQ-LPYARADLERASEALRQ
A0A844MLU2      YTAKAPKLAADVVNHVMSAYVDNNIKSNQSQVLAAGEFIKKQ-LPYARTELERASEALRQ
A0A2N6K7Q9      YASNDPELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A2N6MXH6      YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A2N6M5A8      YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A2N6LL61      YASNDPKLAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A0S3TP66      YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
G6FP91          YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A1U7GYR5      YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A2N6KY52      YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A2N6KMP5      YTSNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A2N6MA45      YASNDRELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPASRQELERAAEALRQ
A0A4Q9J9V9      YASNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPNSRRELERAAEALRQ
A0A328IGA1      YASNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPNSRRELERAAEALRQ
A0A4D9CE41      YTSNDPELAAAIVNQLMKSYVENNIQTNRAQVSAAGDFIKEQ-LPNSRRELERAAEALRQ
A0A0M0SFT2      YTSNDPELAAAIVNQLMKSYVQNNIQNNRAQVSAAGEFIKEQ-LPNSRRELERAAEALRQ
A0A1Z4TLC8      YASNDPELAAAVVNQLMKSYVENNIQTNRAQVSAAGEFIKEQ-LPNSRRELERAAEALRQ
A0A1Z4IYV4      YTSENPELAASVVNQLMKSYVANNIQSNRSQVFAAGEFIKKQ-LPYARAELDRSAEALRQ
A0A1Z4Q0T6      YISENPELAASVVNQLMKSYVANNIQSNRVQVFAAGEFIKKQ-LPYARAELDRSAEALRQ
A0A0C2PT44      YTSENPELAASVVNQLMKSYVANNIQSNRAQVFAAGEYIKKQ-LRYARAELERSAEALRQ
A0A1D2P6J4      YTSENAELAASVVNQLMKSYVANNIQSNRAQVFAAGEFIKKQ-LPYARAELDRSAEALRQ
A0A0C2LFH0      YTSENPELTASVVNQVMKSYVAKNIQYNRTQVVAAGEFIKKQ-LPQARVELNQAAEALRE
A0A856M734      YTSGNPELTASVVNQVMKSYVAKNIEFNRTQVVAAGEFIKKQ-IPQARAELNQAAEALRE
B4WP72          YQSPDDQTAPVIVNALMEAYIENNVETNREEAIAARRFIAGQ-LPQTESAVSAAEANLRQ
A0A2T1CIL7      YQDSDPKRAASIVNEVIDLYVQEDTLSNRAAPASAREFIKAQ-LPKVELTVAKAEEDLRR
A0A433V7A0      YTSKDPQESASVVNQLMSIYIKNNISANRLQAVAARKFISSQ-LPTSEADVVRAEMALRK
A0A2T1FTR8      FQDPSRELSRDVVEKIMEIYIRDDRTNQRREAEAARKFVAQE-LPKIENEVKQAENDLRL
K9UA41          FQDPSRELARDVVEKIMEIYIRDDRTNQRREAEAARKFVAQE-LPKIETEVKQAENDLRL
A0A563VS48      YEGNDPEVVASVVNQALMLYKDQDRLSNRTEAVAARTFITEQ-LPQVKANVQEAESELRK
A0A7Y0NUK1      YKNSDPELAVSVVNEIIKVYQAQDTLSNRTEAATARKFIAEQ-LPQIEANVKQAENQLRE
A0A0C2LBE2      YIDKDPKLAAKVVNKVMQAYIKNNIEANRQEAVSARKFIQKQ-LPTTEVSVKQAESALRQ
A0A433NN38      YADSDPIMAAKVVNKLVEIYIKQNIQTNRAEAVSARKFMWEQ-VPKTEQAVKQAEANLRK
A0A2N6K0T2      YTHEDPQLAAKVINKVVDTYIKQNIQVNREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A2N6ML72      YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
G6FQZ6          YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A2N6MQX9      YTHEDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A2N6KXT6      YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A2N6KGB9      YTHEDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A2N6L3Y5      YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A0S3TIS7      YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A1U7GW28      YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A2N6LW63      YTHQDPQLAAKVINKIVEEYTKQNIQANREEAISAGKFMLQQ-LPKTEEAVQKAELALRR
A0A328IH74      YTDENPELAAKVINKIVDTYIQQNIQANREEATSAGRFILQQ-LPKTEEAVQKAELALRR
A0A4D9CIB0      YTDENPELAAKVINKIVDTYIQQNIQANREEATSAGRFILQQ-LPKTEEAVQKAELALRR
A0A1Z4TQ63      YTDENPQLAAKIINRVVDTYIKQNIQANREEATSAGRFILQQ-LPKTEEAVQKAELALRR
A0A4Q9J8G2      YTDENPQLAAKVINKVVDAYIKQNIQANREEATSAGKFILQQ-LPKTEEAVQKAELALRR
A0A350Y0P6      FTSDNPKKAAAVVNQLMNVYVENNILTNRAEAVAAGEFIAKQ-LPQIQNRVRQAESALRN
A0A352X940      VKSQKPKEAAAIVNKLMEVYLENNIQTNRSEAVAARKFIERQ-LPKTESTVRQAEAALRR
B8HTN4          YRSTDPKQAVAIVDLLIKIYKRNNILANRLETTNSREFIERK-LPDVTEQLRGLDRQIRS
A0A6P1AFJ5      YQNSDPEKIKFVLEQVAEGYIAYSWQKQQGSLQQGLEFVNVQ-LPKLQEEVNQLQAELQK
B0CAX4          YKSIDPKESADVVNRLMDDYLKNNIETNRAEAASARVFIEKQ-VPEVAAKLKNLDLSLRR
A0A1Z4RN12      FTDQDPEVALAFVNRAIELYSEDYASYNRSETASARDFIAKQ-LPKAEENVREAEANLRI
A0A2T1CMF9      YENSDPDVAVSFVNRAVELYSDGYALFNSEAALKDGDFIKQQ-LPKLETEVENAEANLRN
Q7NDC5          YRDRDPAVATRVVNTLARHYIDLNMQQNRAEAASTRGFVEAQ-LPAMEQRLRASERKLRS
U5QGK3          YREFNPELAAKVVNTLAQAYIVENVQQNRAEASSTRTFVESQ-LPKMEQRLRDSERRLRE
A0A2W4UY24      YESTSPALAQAVVNAMMAAFIQANVQANRTAAIAAQSFVASQ-LPASKAKVGKIESDLRA
A0A838VM23      YESKNPEEATAVVNKLMDLYLENNVFTNRAETIAAGEFIVKQ-LPQTEATVRQAELALRG
A0A0D8ZUV2      YKSNDPQEAAAVVNKLMSLYIENNVLSNRTAAVEASKFIANQ-LPKTEARVRQAEAALRQ
A0A433VDI0      YKSTNPEEATAVVNKLMNLYIENNILTNRDQAVEAVEFIAKQ-LPRTETTVRQAEAALRQ
A0A3D1PG43      YESKNPEEAAAVVNKLMSLYVQNNIQSNRAQTTAVGEFIAKQ-LPTVQGTLRQAEAKLRR
A0A2P8QQ72      YESKDPQEAAAVVNKLMSAYVDYNIQSNRAEASAAEDFIVKQ-LPQTESTVRAAEASLRR
K9TZQ7          YESKDPQEAAAVVNKLMSAYVDYNIQSNRAEASAAEDFIVKQ-LPQTESTVRAAEASLRR
A0A6N8G584      YQSEDPEEAAAIVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMEATVRQAEQALRQ
A0A2G7GPR0      YQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMEATVRQAELALRQ
K9XH68          YQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMETTVRQAELALRQ
A0A1U7HW70      YQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMETTVRQAELALRQ
A0A2S6VEJ8      YQSEDPEEAAAVVNKVMNLYIENNIITNRAEASAAGEFIAKQ-LPQMEATVRQAEQALRQ
A0A140KBA0      YEDSDAERAALVVNKIIELYQEKDTENNRSEAIAARQFISEE-LPEVEAKVAQAEADLRN
K9XSG1          YEDSDPERAALVVNKIIELYQEKDTENNRSEAIAAREFISQE-LPEVEAKVAQAEADLRN
A0A2T1GMT4      FKGRNPKDAANIVNTLMNVYLENDIQASQLEAETARQFIEQQ-MPKTLAAVNAAESAVRS
K9UI51          FKGRNSKDAANIVNTLMNVYLENDIQASRLEAENARQFIEQQ-MPKTLAAVNSAESAVRN
A0A1Z4QL41      YKSNKPEEAAEVVNTIMNFYIENDISTNRAEAEETRQFLDKQ-LPKTQTAVQTAEAALRR
K9TYI2          YKHHDPEKAAAVVNKIMELYLENDILTSRSEAEATRLFMAKQ-LPKSQAAVHQAEVKLRI
A0A252D4T4      YNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATRKFMAKQ-LPNTKNAVQEAEAALRI
A0A252DJH5      YNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATRKFMAKQ-LPNTKNAVQEAEAALRI
A0A252EB80      YNSPNPEEAAAVVNTIMNLYLENDILTNRGEAEATRKFMAKQ-LPNTKNAVQEAEAALRI
A0A6G9SKZ9      YKSRSPEEAAAVVNNIMNLYLENDILTNRAEAESTRKFMARQ-LPNNRSAVQEAEAALRI
A0A1Z4HPW5      YKSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSAVQDAEAALRI
A0A1Z4MSN1      YQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSAVQDAEAALRI
A0A1Z4U1C2      YQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSAVQDAEAALRI
A0A0D6KV51      YQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSAVQDAEAALRI
A0A1Z4MKF8      YQSPNPQEAAAVVNNVMNLYLENDILTNRAEAEATRKFMAKQ-LPNNRSAVQDAEAALRI
A0A2C6WC43      YASLNAEEAAAVVNTVMNVYLENDILTNRSEAASTRQFIARQ-LPKTQEAVDKAERELRI
A0A841WRE0      YASLNAEEAAAVVNTVMNVYVENDILTNRSEAASTRQFIARQ-LPKTQEAVDKAERELRI
A0A1Z4L5A1      YSSLDPEEAASVVNTVMNVYVESDILTSRSEAASTRQFIARQ-LPKTQEAVDKAERELRI
A0A367QD86      YSSLNPEEAAAVVNTVMNVYVENDILTNRSEAASTRQFIARQ-LPKTQEAVDKAERELRI
A0A2K8SM78      YTSRDPEQSAAVVNTIMSLYLENDILTNRSEAAATRQFMAKQ-LPKTQEAVNNAEVALRI
A0A2R5FPC0      YASRDPEQAAAVVNTIMNLYLENDILTNRSEAAATRQFMAKQ-LPKTQEAVNNAEVALRI
A0A5P8W5T6      YTSRDPKQSADVVNTIMNLYLENDILTNRSEAAATRQFIAKQ-LPKTQQAVNNAEVALRI
A0A7D7LDT7      YSSSNPEEAAAVVNTIMSFYLENDILTNRSEAAAARQFMAKQ-LPKTQAAVNNAEVALRI
A0A235IZ96      YSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATRQFMAKQ-LPKTQAAVNNAEVALRI
A0A2L2NGP0      YSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATRQFMAKQ-LPKTQAAVNNAEVALRI
K9QM62          YKSRNPEEAAAVVNSVMNVYLENDILTNRTEVEATRRFMARQ-LPQTQAAVSTAEVALRK
A0A1Z4FWI3      YKSPDPETAAAVVNTVMNIYLENDSNTNRAEAEATRRFMAKQ-LPNTRAAVQEAEGALRR
A0A1Z4JYE7      YQSNDPKQAAAVVNALMNVYVDNDISTNREEAEATRKFMERQ-LPQTQAAVNYAEAVLRK
A0A0F5YE28      YESPDPLEAANIVNTLMEVYIQTNVNMNQDEAREAREFISQQ-LPPVQQEVFRAEQALRS
U7QEH7          YESKDPKEAADIINTLMEVYMQTNVDMNQEDAIEAREFISQQ-LPKVQEEVFRAEQALRS
A0A3S1ATK5      YKSRDPKEAAVVVNTVMNFYLENDIETNRAEAETTYKFMARQ-LPKTQAAVYAAEVALRK
A0A2Z6CPH0      YQSNNPEEAAAVVNTLMNLYLENDILTSRAEAEATRKFMAKQ-LPISQASVNRAEVALRV
A0A1Z4GT50      YKSRNPEEAAAVVNTIMKMYVENDITTSRAEAEDTREFMSKQ-LPKMQAAVREAEVALRK
A0A1Z4GIX0      YKSTNPEEASAVVNTIIDAYLENDILTSRSEAEATRKFMAKQ-LPNTQAAVHKAEVALRI
A0A2H6LC24      YKSTNPEEAAAVVNTIIDAYLENDILTSRSEAEATRKFMAKQ-LPNTQAAVHKAEVALRI
B2J6N5          YTSPDPEQSAAVVNTIMSLYLDNDILTNRSEAAATRQFIAKQ-LPKTQEVVNNTEVALRI
A0A367RMI4      YKSHNPEEAAAVVNTIMRFYLENDILTNRSEAGAARQFMAKQ-LPTTQAAVNNAEVALRI
A0A235HUM0      YSSHDPEEAAAVVNTVMRFYLENDVLTNRSEAGATRQFMAKQ-LPTTQAAVNNAEVALRI
A0A2L2NW47      YRSHDPEEAAAVVNTIMRFYLENDILTNRSEAGATRQFMAKQ-LPTTQAAVDNAEVALRI
A0A1E2WUR1      YSSSDPEEAAAVVNTIMNFYLENDILTNRSEAAAARQFMAKQ-LPKTQAAVNNAEVALRI
A0A235IKU3      YSSHDPEEAAAVVNTVMNLYLENDILTNRSEAAATRQFMAKQ-LPKTQAAVNNAEVALRI
A0A1U7MYU6      YKGNNSDKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A1D8TNX9      YKGNNSDKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A6P0L6C2      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A6P0MVH0      YKGKNSEKGATVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A6P0KJV0      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A6L9ZJG4      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A846GI17      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
F4XKF3          YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A1D9FX10      YKGKNSEKGAAVINKLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A6P0Q0T0      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A6P0W5I0      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A845XJ02      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A846D190      YKGKNSEKGAAVINQLMRLYIENQILSKKSEAAKAREFITNQ-LPQSEANVRQAEAALRQ
A0A3C0NJ41      YKGANPQQIAAVVNKLMSLYIEDNLRTNRAELVAAQDFIAKQ-LPKAETNVGQAETSLRR
A0A352AG88      YESSNPQEAAAVVNYLMNLYIKNNVKANRAEVVAAVKFLNEQ-LPKAEANVNQAEMALRQ
A0A350Y374      YKNKDAKTAAAVVNQLMKLYIENNLRNNRTELVTAQEFITKQ-LPKAEANVNQAEAAVQE
A0A355DPX0      YKNKDAKTAAAVVNELMKLYIENNLRNNRTELVTAQEFITKQ-LPKAEANVNQAEAAVQE
A0A0S3TYD7      YRSNDPMEAAEVVNHLMQLYVQDNLTANRAEAKSAREFIQSQ-LPEVERNVRQVEGEIRA
A0A2T1DNG3      YTSNDPIKTQKVLQAVQKVYQDYNLQQQQDRLTRGLAFVDKQ-LPQVEGKVKDAEAALEQ
A0A140K3H3      YTDTNPERAKAVLDALGSTYVEYSLNRQRSQAGNAINFIDEQ-LPKAQAELNEVAKAIRN
K9XUB8          YIDSNPERAKAVLEALGSTYVEYSLNRQRSQAANAINFIDQQ-LPKAQAELDDVAKKIRN
A0A563VLD6      FIDSSPQRAKEVLDALGKVYVQYSLDKQRSQAANAIDFIDEQ-LPDSQLDLDKVAYDIRS
A0A7Y0NVW6      FVDSSPQRTKEVLDALGKVYVQYSLEKQRSQAANAIAFIDEQ-LPESRLELDKVSYELRQ
U5QL42          YRDTNPERAKAVLTALGATYVEYSLESKRGQADNAIKFIEAK-LPRAKKVLNQTAIAIRE
A0A6H2NHD5      YRDQDPEVVAFVLSEVAEGFVDYSVDDRQAELRRGLTFLDEQ-LQEKWQEVSDIEDNLSD
A0A2P8W4F7      YNGADPAVVSFVLNQVVEGFVDYSVQDRQGDLRRGLTFLDEQ-LQEKWQEVEAIESDLSE
A0A5Q4E0Z4      YKNSDPEVVTTVISEVVKGFVAYSVQDRQGELRRGLEFLDEQ-LQEKWQEVDTIESGLSD
A0A2P8VVX1      YTANDPTQPQRVLAALQDIYLNYNQEQQAQRLSRGLDNVNNR-LANTQQNLRDSQSALEQ
A0A2P8WHY0      YVDSDPIKTQRLLEALKEAYLEFNEAQQARRLERGLEHTNNR-LDNTQKNLQQAQAALEK
A0A563VQJ3      YNADRPEIAAEIVNTLMTIYVREQIRNNQAEPANAKEFINRQ-LPEIEVKVETAESELEQ
A0A7Y0IRJ7      YDSKEPELSAEVVNTLMNIYVREQIRSNQAEPANAREFINRQ-LPEIEAKVQSAESDLQK
A0A2T1CMT9      YVGSSPVETKKVLTAIQEVYLKYNLEQQEKRLRDALTFINQQ-IPQARKELTQTETNLTK
A0A7G8J1V5      LTGRNPAETEQLLKALSSTYLQAAQQQRQKRLEDGLNFLNKQ-APELEARSNALQDELAS
A0A354B169      LTGHDPVQDELVLKAISAAYLHAALEQRQKRLADGLTFLNKN-APTLQQKTSQLQSDLAK
Q0IDT5          LTGRNPKEDGQLLEAISAAYLQTALQQRQKRLTDGIAFLDLQ-APALQAKADAIQGELAE
A0A7G8FZD9      LVGRDKDEDQQLLTALSDTYLKVALQERQQRLADGLNFLNKQ-APALEAKTEQIQSEVAA
G4FMX5          LVGRDKDEDQQLLTALSDTYLKVALQERQQRLADGLNFLNKQ-APALEAKTEQIQSEVAA
A3ZA21          LTGRDPEQDEVLLQAISTAYLQAALQQRQQRLADGIDFLNKQ-APALQQKTEAIQNELAA
A0A076HBF2      LTGRNPIEDERLLNALSNTYLQAALQQRQQRLADGLAFLNKQ-APSLQTRLDQLQGELAD
A0A7G8FP50      LTGRNPSESQRLLKALSSTYLQAALEERRRRLSDGLAFLNKQ-APSLQSKVDQIQGELAD
A0A7G8E8K7      LKGSDPVEDERLLKALSSTYLQAALQQRQQRLADGLAFLNKQ-APSLQTRLDQLQGELAD
A0A7G8GNR2      LTGRDPVEDELLLKALSSTYLQAALQQRQQRLADGLAFLNKQ-APSLQTRLDQLQGELAG
A0A7G8ICD3      LTGRDPIEDERLLKALSNTYLQAALQQRQQRLADGLAFLNKQ-APSLQTRLDQLQGELAD
A0A2D6FCW3      VTGRDPVEDKQLLDDLSSTYLQAALQQRQQRLSDGLNFLNKQ-APALEAKTEEIQSEVSD
A0A7G7KJ95      LTGRDPEQDEAVLKALSTAYLQAALQQRQQRLADGLAFLNKQ-APALQAKTDQIQSEVAA
A0A7G8EAN3      LTGKDPVEDQRLLSALSETYLQAALQQRQQRLADGLAFLNKQ-APALQAKTDQIQSEVAA
A0A1D8TX52      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPKARKDLEQAEQQLEQ
A0A1D9G4T2      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0PR27      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0WER7      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A845XM36      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A846DAT1      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A846GZK8      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
F4XP71          YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0KZ31      YTSNDRIKTQKVLQAIQKVYQEYNLEQQEMRLNKGLAFINQQ-LPTARKNLEQAEQRLEQ
A0A6P0LPB8      YTSNDRIKTQKVLQAIQKVYQEYNLEQQEMRLNKGLAFINQQ-LPTARKNLEQAEQRLEQ
A0A6L9YR57      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPKARKDLEQAEQQLEQ
A0A845WMG9      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPKARKDLEQAEQQLEQ
A0A6P0SEV1      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6B3N2I8      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6M0B891      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0IJQ1      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0J8J8      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0ZSH6      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A845VS63      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A1U7N5X9      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPKARKDLEQAEQQLEQ
A0A6L9Z1V0      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARNNLEQAEQRLEQ
A0A6P0LC12      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINEQ-LPTARKNLEQAEQRLEQ
A0A6P0MVJ3      YTSNDRIKTQKVLQAIQKVYQDYNLEQQEMRLNKGLAFINQQ-LPTARKNLEQAEQRLEQ
A0A2W6ZAV2      LLWDDRREGQQILEAISAEYLAFSMRQRQERLAQGLEFLDTQ-APVLQQGVVELQQQLSS
K9W742          YTANDPVKTQKVLQAVQRVYLNYNREQQRLRLAKGLAFIDEQ-LPKARLSVTQSEAALEK
A0A3D1PBA3      YTANDPVKAEKVLEAVYKVYQIYNREQQQQRLQKGLKFINEQ-IPVVSKTVDQAENKLEQ
K9XPB0          YVSQDYNDSKKILEAIEQVYIEYNVEQQEKRLRDGLAFIAKQ-IPAAQQEVAAIEAKLTQ
A0A350Y7Z1      YTSNDPIQTQDVLAAIQTVYQDYNLQQQQVRLTEGLAFINDQ-LPTARDNVIQAEKALEQ
A0A352X2A7      YISKDPIQTQEVLKAIQKIYQNYNLEQQKQRLVDGLSFIDNQ-LVTAANNVNKAERSLEE
A0A0D8ZYV0      YVSNDPVKTQKVLQTIYQVYQSYNREQQEQRLKKGLKFINEQ-IPGVRNQVAQSEAQLEK
A0A433VMS2      YTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-IPAVTKTVDQAENKLED
K9TYA7          YTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-IPAVTKTVDQAENKLEE
A0A2P8QUE1      YTANDPIKAQKVLKAVHTVYQIYNREQQEQRLKKGLKFINEQ-IPAVTKTVDQAENKLEE
K9SA61          YTGDDPEKTQAVLQAVQKVYQDYNREQQELRLSRGLAFINDQ-LPKVQAEVREAEAALEA
A0A2G7GMH8      YTDNDPQRTQNVLNAMQQVYQDYNLEQQKLRLAKGLTFINEQ-LPVIKDRVNQAENALEL
A0A6N8FU92      YTDNDPVRTNDVLSAMQQVYQDYNLEQQKIRLAKGLTFINEQ-LPLVQDRVNQAENALEL
A0A2T1DWE8      YTSDDPEKTQKVLMAVQQVYKDYNREQQKLRLTRGLAFVDEQ-LPLVEKQVDRAEDAMER
A0A832H7C4      YRGDDSEKTQRVLQAIQKVYQDYNREQQKQRLSKGLAFVDEQ-LPQVQKQVAQSEANLER
A0A1U7I8L3      YIDNDPIKTQTVLETIKRVYQDYNREQQQLRLTKGLSFIDAQ-LPSLRESTVRTEAALEK
A0A2T1DJL8      YTGHDRQQTQAVLQAIQQVYQQYNLEQQKARLTKGLGFINEQ-IPQVEARVNQAEAALER
A0A1Z4J9W0      YIDHDRIKTREVLKALEKVYQDYNLEQQRNRLTKGLSFIDRQ-IPEVQAKVNQAESNLER
A0A0N7Z5K9      YIDYDRVKTREVLKSLQRVYQDYNLEQQRNRLAKGLSFIDRQ-IPQVQEKVNKAEADLER
A0A0S3TXC5      YIDHDRVKTREVLKALQRVYQDYNLEQQRNRLAKGLSFIDRQ-IPQVQAKVDKAEADLEQ
A0A846FBD3      YESPDPKLAAAVVNQVVAAYIANNVQANRAEAAAARKFIHEQ-LPQTEAQVEKAEAALQR
K1XF69          YQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-LPRVQQELFLAEKSIQD
B5W297          YQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-LPRVQKELFLAEKSIQD
H1W7M8          YQSRNPQEVADVINTVMEVYIEANVSSIRQDASGAKEFIQEQ-LPRVQKELFLAEKSIQD
A0A5Q4H6A5      YQSKNPQEVADVINTIMEVYIDANVSGIRQEASGAKEFIQEQ-LPRVQQELFLAEKSIQD
D5A466          YQSKNPQEVADVINTIMEVYIEANVSGIRQEASGAKEFIQEQ-LPRVQQELFLAEKSIQN
B4WQE3          YRSDDPYKVTTVLEVVLQTYLNYSLEDRQNDIYRGVDFVNDQ-LPAVRARVNELEAELEA
U5QJM6          FKDTDRQLVQDMLKELAKIYIDYSQDVQKSQVSGAITFINAE-LPRVRMNVEASEEALRD
A0A0V7ZFJ4      YESNDPQKAAAIVNSLMKDYQENNISTNTAEARSAREFLNKQ-LPEVEQRLIRAEAELRE
A0A235IXQ2      YRSTNPQEATAIINRLMSAYLANNVRINRSEARAAREFLNKQ-LPLVEAKVTEEEAALRR
A0A367RIS1      YRSANPQQATAIINKLMSAYLENNVRINRSQARAAREFLNKQ-LPLVEAKVAEGEAALRQ
A0A841V8H9      YRSTNPQEATDIINRLMSAYLANNVLVNRSEARAAREFLNKQ-LPLVESKVREGEAALRQ
A0A5Q0GJJ5      YRSANPEEATAIINRLMNTYLENNVRNNRSEATAAREFLSKQ-LPLVEAKVTEAEAALRR
Q3MEB7          YRSANPEEATAIINRLMNTYLENNVRNNRSEATAAREFLSKQ-LPLVEAKVTEAEAALRR
A0A1Z4KHN9      YRSADPKEATAIVNKLMSAYLENNVRNNRSEATAAREFLSKQ-LPLVEAKVTEAEAALRR
Q8YT70          YRSADPKEATAIVNKLMSAYLENNVRNNRSEATAAREFLSKQ-LPLVEAKVTEAEAALRR
A0A7U3NLX2      YRSVDPEEAKAVVNQLMSAYLENNVLTNRSQATAAREFLSKE-LPVVEAQVAEAELALRR
A0A166IWU6      YRSVDPELAKAIVNKLMNVYIDDNVMTNRSQATAAREFLNKQ-LPLVEKQVAESELALRQ
A0A2S0Q8C0      YRSVDPEVGKAVVNKLMNVYIDDNVMTNRSQATAAREFLNKQ-LPLVEKQVAESELALRQ
W6FSX4          YRSVDPEVGKAVVNKLMNVYIDDNVMTNRSQATAAREFLNKQ-LPLVEKQVAESELALRQ
A0A218Q4C1      YNSIDPQEAQSTVNQLMAAYLNNNVLNNRSQAAAAREFLTEQ-LPLVEAKVSEAELALRR
A0A6P1ZT04      YLNTDPQEAQATVNQLMAAYLEDNVLTNRSQAAAAREFLSKQ-LPQVEAQVSDAELALRR
A0A0V7ZNJ9      YKGTDPQQAAAIVNSLMQDYIDNNIRVNTAEARAAREFLNNQ-LPEVESRVVKAEAELRK
A0A5P8VSD1      YRSANPQEATAILNRLMSAYLENNIRINRSEATATREFLNKQ-LPLVQAKLAESQAALRR
A0A1S1ZVW2      YNSTNPQEAADTVNTLMKYYLDNNILINRSQATAARKFLSQE-LPRIEKQVTKAELELRR
A0A0R0M9H9      YNSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQVIKAELELRR
A0A7H0F4U6      YNSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQVIKAELELRR
A0A7W2A1T7      YSSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQVIKAELELRR
A0A838WI98      YSSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQVIKAELELRR
A0A853MJX6      YSSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQVIKAELELRR
A0A1B7WX82      YSSTNPQEAANVVNSLMKYYLESNILNNRTEARSAREFLAKQ-LPEVERQVTKAEMSLRR
A0A1B7WTD1      YKSTDKQEAANVVNSLMKHYLASNINTNRAEAIAAREFLSQE-LPKVERRVTEAEIALRR
A0A480ABC0      YKSTDKREAANVVNSLMKHYLASNVSTNRAEAIAAREFLSKE-LPKVERRVTEAEIALRR
A0A1Z4LRU5      YKSTDPKEAANVVNSLMGDYMENNVETNTAEVRAAREFLQKE-LPQVEGRVVQAEAALRQ
A0A1Z4JVB4      YRSKNPQESADVVNFLMKSYIESNISNNRTEARSLREFLSKQ-LPEVENRVLRAEMALRR
K9PIA4          YRSPNPKEAADVINTLMKYYLESNVRTNRSTAKSAREFLNKE-LPQVEKRVMKAEMSLRE
A0A1Z4HVE1      YRSTNPQEAASVINSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A252ECZ1      YRSTNPQEAASVINSLMNYYLESNVRTNSAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A1Z4G5Y1      YNSTNPEEAATVLNSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A252DNA2      YRSTNPQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMSLRR
A0A252E1Q4      YRSTNPQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMSLRR
A0A6G9SK36      YRSTNPQEAATVINSLMKYYLESNVRTNRAEARSAREFLTKQ-LPEVEQRVLRAEMALRR
A0A1Z4M597      YRSTNPQEAASVINSLMNYYLENNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A1Z4MWT1      YRSTNPQEAASVINSLMSYYLENNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A1Z4TX53      YRSTNPQEAASVINSLMSYYLENNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A2A2TNQ5      YRGTNPLETAKVINTLMNNYLENNIRSNRTEVTAARDFLRKQ-LPEIENKVVQAEATLRR
A0A3S1C4K5      YRDTDPKVAADVINTLVKYYIENNIRVNRLDATSAREFLSKQ-LPNIEGRVIAAEAGLRK
A0A1X4G3D5      YDSKIPDEAAKIVNGLMNEYLLSNIVINNSASSKARQVLAKK-LPRVERELAKAETDLRQ
D4TNI2          YDSKIPDEAAKVVNGLMNEYLLSNIVINNSASAKARQVLAKK-LPRVERELAKAETDLRQ
A0A1Z4H6Z8      YRSTNAQEAATVINSLMNYYLESNVRTNRAEARSAREFLNRQ-LPEVEKRVLKAEMALRR
A0A3F3KPR9      YNSTNPQEAADTVNTLMKYYLDNNILINRSEATAARKFLSQE-LPRIEKQVIKAELELRR
A0A1Z4NPM1      YRSTDPQEAANVINFLMKSYLEGNILNNRAEATAAKEFLSKQ-VPQLERRVVVAEADLRR
A0A1Z4UZW9      YRSTNPQEAAKVVNSIMKYYLESNVRTNRTEARSAREFLSKQ-LPEVEKRVTKAEMNLRR
A0A1B7VSH4      YKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAREFLSKQ-LPEVESRVTKAEMNLRR
A0A1B7W126      YKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAREFLSKQ-LPEVESRVTKAEMNLRR
A0A3D4C6Q6      YKSTNPQEAANVVNSLMKYYLESNVRTNRREATSAREFLSKQ-LPEVESRVTKAEMNLRR
A0A0K2M5H0      YRSTNPQEAADVVNSLMKYYLESNVRTNRTEARSAREFLSKE-LPEVEHRVTKAEMNLRR
A0A844I4P0      YKSTNPQEAADVVNSLMKYYLESNVRTNRTEARSAREFLSKQ-LPEVEHRVTKAEMNLRR
A0A1B7UVJ4      YSSTNPQEAANVVNSLMKYYLESNILNNRTEARSARQFLAKQ-LPEVERQVTKAEMSLRR
A0A1B7UTR1      YRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-LPEVEKRVTKAEMTLRR
K7W0A4          YRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-LPEVEKRVTKAEMTLRR
A0A5C0DRW9      YRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-LPEVEKRVIKAEMTLRR
A0A6H2C088      YRSTNPQEAADVVNSLMKYYLESNIRTNRTEARSAREFLDKQ-LPEVEKRVIKAEMTLRR
A0A1Z4RPC6      YKDPDPVIASKVINTLMDVYIKEQVNSNKKATASADSFVTST-IPKIEDKLQTLESRLQN
A0A2T1CMZ0      YKDPDPIIASKVVNTLMGVYIKEHVRSNKSATVSADSFISST-IPKIETKLNSLEANLQS
L8M4F7          YKDPNPKFAADIVNSLMNVYVEAQIRGNQSDPAVAKKFINQQ-IPTLKAKVESAESALAK
A0A140K2P2      YAHPNPKVAADVVNTLMNTYINEQIRTNQSEPASAREFINKQ-LPQIESQVSQAESELRN
K9XWX4          YAHPNPKVAADVVNTLMNTYINEQIRANQSEPASAREFINKQ-LPQIESQVSQAESELRN
A0A140KB14      YQDQDPYTAADVINTLMKLYLDEQVKSTQAETANADSFISNQ-LPQIEQKLSKAESDLRR
K9XX88          YQDQDPYTAADVINTLMKLYLDEQVKSTQAETANADGFISNQ-LPQIEQKLSQAESDLRR
L8LZE9          YEDKDPQIASNVVNTLMNIFLENKIANNQKDTESADFFVESQ-LPQVEKRLEEYESILQN
A0A563VSV6      YKDSDPIQASQVVNTLMDVYIKNQVRSNQAETENADSFVTTQ-IPQVEDKLKQNESILQE
A0A7Y0IQB0      YKDPDPIQASQVVNTLMDIYLEEQIRSTQAETANADSFVSNN-IPQVEEKLKQHESILQD
A0A433NM31      YKSTVPEQAQAVVNKLMDSYLRNNMMATRTEAIAARNFIESQ-LPKSKISVQKAEAQLRE
A0A1Z4NDS1      YQDNDPELAAKVVNKLMEVYVQNNIRENRAEASAAGTFLDDQ-RPNAARIVQAAELELRR
U9VXM0          YTSDDPELAANVVNTLTDIYIENDIQTNRAAAVAAQEFISAQ-LPESEAAVNEAEEALRQ
A0A6M0RI13      YTSEDPEIAATVVNTLADIYIENDIQTNRAAALAAQEFITAQ-LPESEEAVEEAEASLRR
A0A6M0S1N5      YTSEDPEIAATVVNTLADIYIENDIQTNRAAALAAQEFITAQ-LPESEEAVEEAEASLRR
K9F4D9          YTSEEPEIAATVVNTLADIYIENDIQTNRAAALAAQEFITAQ-LPESEEAVEEAEASLRR
A0A6I5QPI5      VESEDPEEAAAIVNQVIESYREQNIESNREEAAAARQFIEEQ-LPTTEAEVLRVEGALRE
A0A1Z3HMQ0      YQSPNGELSAAVVNQVMTSYIERNITMNRSEATAARQFVQEQ-LPKAEAEVEQAAEALRQ
A0A433W533      YKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-IPDVEARVRRAESALRR
A0A2P8QWJ3      YKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-IPDVEARVRRAESALRR
K9U6L7          YKSISPDEAAAVVNKLMNVYLENNIQTNRVTATAAGDFIAKQ-IPDVEARVRRAESALRR
U5DPF5          YQSTDPEEAARVVDSFMEVYRDNDVRINRSEAAAAREFIEEQ-LPLTERSVREAEEALRR
A0A1E5QP61      FKSQYPKEAADAVNKLMDVYINNNILVNRREATAAREFIMQQ-LPDTEETVRQAEAALRA
A0A846DWC7      FKSQYPKEAADAVNKLMDVYINNNILVNRREATAAREFIMQQ-LPDTEETVRQAEAALRA
A0A845Y5J4      FNGPDPQDAAEVVNQLMKVYLQNNVLTNRAEAVAAREFIAKQ-LPETEKILRQAESALRS
A0A6P0X488      FNGPDPKDAAEVVNQLMQVYLQNNVLTNREEAVAAREFIAKQ-LPATEKTLRQAESALRS
A0A6P0VDM0      FNGPNPEDAAEVVNQLMQVYLQNNVLTNREEAVAAREFIAKQ-LPATEKTLRKAESDLRS
A0A6P0UVD5      FNGPNPEDAAEVVNQLMQVYLQNNVLTNREEAVAAREFIAKQ-LPATEKTLRKAESDLRS
A0A846BFF2      FNGPNPEDAAEVVNQLMQVYLQNNVLTNREEAVAAREFIAKQ-LPATEKTLRKAESDLRS
A0A6M0G142      FSGPNPEDTAKVVNQLMNVYLQNNVLTNRAEAVAAREFIAQQ-LPQTQENLRQAESALRR
A0A6P0MR53      FESPNSEDAAAVVNQLMKVYLQNNVLTNRAEAVAAREFIAQQ-LPKTQETLRQAESALRR
A0A3M2GIL5      YQAGNPEEAATVVNKVMEVYIENNILVNRSEAAAAREFINKE-LPEIEARLSRAEAELRN
A0A6H1TSJ9      YQAGNPEEAATVVNKVMEVYIENNILVNRSEAAAAREFINKE-LPEIEARLSRAEAELRN
A0A3M1PML8      YASEDPEETAAVINRLVDIYTKNNVLVNRAEAAAARDFIAKE-LPKTEAAVKAADSDLRR
A0A6M8BE85      YASDDPEEAAAVLNRLVEVYTKNNVLVNRAEAAAAREFIAKE-LPKTEAAVRAADSDLRR
A0A0T7BPZ0      FTHENAQLAANVVNQVMDNYITENIRANRAEAESARKFIISQ-LPISESSVRAAESAFRQ
A0A352X442      YQSKKPDVAAAVVNKVMEVYIADDIQANRAKAAAAREFITEQ-LPRLKQNVSIADAELRN
A0A6B3NF44      YVSEDPEEAAKVANNIMEVYIKNDIQTNRQKAVAAREFIDQQ-LPQVEANVSKSEEALRR
A0A6M0EPL4      YVSEDPEEAAKVANNIMEVYIKNDIQTNRQKAVAAREFIDQQ-LPQVEANVSKSEEALRR
A0A6P0K6L6      YVSEDPEEAAKVANNIMEVYIKNDIQTNRQKAVAAREFIDQQ-LPQVEANVSKSEEALRR
A0A6P0MRR9      YESDNPELVAAVVNKTMEGYIENNIETNRAQAVAARKFLEGQ-VPRMKARVSRAEEDLRR
A0A6P0X1X4      YKSDDPELAAAIVNTTMDGYIENNIETNRAQAVAAREFLEKQ-VPKIEQRVRLAEENLRK
A0A6P0UX57      YKSDDPEVAVAVVNTTMDGYIENNIETNRAQAVAARKFLEKQ-VPKIEQRVKRAEEDLRK
A0A846B9S8      YKSDDPEVAVAVVNTTMDGYIENNIETNRAQAVAARKFLEKQ-VPKIEQRVKRAEEDLRK
A0A0M0SHU3      YTNENPQLAAKVINKVVDTYIKQNIQANREEATSAGRFILQQ-LPKTEEAVQKAELALRR
A0A1D2PBN3      YTDTNPTLAAKVVNKLMQAYIKNNIEANREEAVSARKFIQRQ-LPATETSVKRAEAELRR
A0A0C2LVR7      YTDTNPTLAAKVVNKLMQAYIKNNIRANREEAVSARKFIQKQ-LPATEISVKRAEAQLRR
A0A1Z4PQB9      YTDTNPTLAAKVVNKLMQAYIKNNIGANREEAVSVRKFIQKQ-LPATERSVKRAEAELRR
A0A1Z4SFN6      YKDEDPYLAAKVVNQMMEVYIKNNIEANRAEAVSARKFIMKE-LPATELSVRAAESTLRK
K9PGI8          YTDKDPTLAAKVVNKVMDAYIRNNIEANRAEAVSARKFISQQ-LPATEISVRGAELALRK
A0A654SFI6      FSSPSPEISSKISNLWADEFIRANYEKRFGANIDAREFLNKQ-IEELRERLSISERDLVE
K9SSQ0          YSDRNPKTAATILQGLLETYKAYGAN----KANQATQLIQAQ-IPDAKKQLDQNSTALTR
A0A2W1JIN9      YTSSDPELASRMLNSIAQTVVQENTETIQAEAKSAREFLEGQ-IPQRRQELLQVEARMSK
A0A318AJV1      FKSRDAAKSSRIANAFADTYLDMRVHGEASSSVQQAAFFRQR-LDELARQVNDADTRLAA
A0A845WDS5      YQNQDPELATVLLNAVANAMVYESTEAIRQEARVVREFLEKE-VPQQRALTEAAEVAESK
A0A6P0IC70      YQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRALTEAAEVAESK
A0A845VVD9      YQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRALTEAAEVAESK
A0A6B3MUB5      YQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRALTEAAEVAESK
A0A6M0B7N4      YQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRALTEAAEVAESK
A0A6P0J9W3      YQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRALTEAAEVAESK
A0A6P0ZWE1      YQNQNPELATVLLNAVANAMVYESTEAIRQEARAVREFLEKE-LPQQRALTEAAEVAESK
A0A1U7N2U4      YQSQNPELATTVLNAVANAMVSESAQGIRSEARAVREFLEKE-VPLRRLEVEATEAALNK
A0A6L9YZL1      YQGQNPELATTVLNAIANAMVTESAEGIRSEAKAVREFLEKE-VPLRRLEVAAAEAALNQ
A0A6P0KYM4      YQGQNPELATTVLNAVANAMVTESAEGIRSEAKAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6P0LSD6      YQGQNPELATTVLNAVANAMVTESAEGIRSEAKAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6P0PNZ7      YQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVAAAEAALNK
F4XV38          YQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6P0W137      YQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVAAAEAALNK
A0A845XHF7      YQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVAAAEAALNK
A0A845ZEG9      YQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVAAAEAALNK
A0A1D9G1F2      YQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVAAAEAALNK
A0A846CJ58      YQGQNPELVTTVLNAVANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6L9Y9E2      YQGQNPELATTVLNAIANAMVSESAEGIRSEAKAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6P0SGR0      YQGQNPELATTVLNAIANAMVTESAEGIRSEARAVREFLEKE-VPLRRLEVEAAEAALNQ
A0A6M0BK48      YQGQNPELATTVLNAVANAMVTESAEGIRSEAKAVREFLEKE-VPLRRLEVAAAEAALNK
A0A845WG36      YQGQNPELATTVLNAIANAMVSESAEGIRSEAKAVREFLEKE-VPLRRLEVAAAEAALNK
A0A6P0X384      YESENPELATRLLNTVLQVMVQESSEAIRSEARSLREFLEAE-LPKRRAAAEAAEAALSK
A0A2P8QIL5      YSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-VPKKRAQLAQVEATLSQ
A0A433W447      YSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-VPKKRAQLAQVEATLSQ
K9U1K8          YSNKDPLIAAKLLNALTEAMINEDTAVIRREAGSARQFLAVE-VPKKRAQLAQVEATLSQ
A0A1Q4RZJ6      YQSKNPDLAATYANAVAMATIRDNIKSISSEATKVRQFLQQQ-LPQARTQLQAAEVAENN
A0A1Z4SNV3      YQSKNPELAATYVNAVAMATIRDNTKSISTEATKVRQFLQQQ-LPQARAQLQAAEAAENK
A0A2H2XJQ1      YQSKNPELAATYVNAVAMATIRDNTKSISTEATKVRQFLQQQ-LPQARAQLQAAEAAENK
A0A3S5K358      YQSKNPDLAAAYANAVAMATIRDNIKSISSEATKVRQFLQQQ-LPQARTQLQAAEAAENN
A0A0T7BPJ4      YEARDAQLAAKLLNVIAQTMVEENTRTISSQATKVREFLEKKEVPAAQRNLTVAEANENR
A0A0C1QS61      YQSKNPKLAAQLLNSVARAMEEESANTIRQEAANVRKFLEME-VPKAREKLENAELTENR
A0A139X3R8      YQSKDPILAAQLLNAVSRAMEEESANTIRQEAANVRKFLATE-VPKARQNLEDAELKENK
A0A844MZP8      YEGKDPILAAQLLNAVARAMEEESANTIRQEAANVRKFLETE-VPKARKQLENAELKENK
A0A1Z4I7C5      YQSPNPEQTAQVLNAVSQAMVEENIKTINSEATKVREFLSQK-VPQARQRLQQAELAETR
A0A844MST0      YQDGDPEQAVNILNAVSQTMVENNIKAIRSEATKVREFLEQQ-VPLARTQLQQAETSENK
A0A0C2MDK7      YQSRDPQLAAKVLNAVSQAMVEDNVKSIGLEATKVKQFLEQKQVPEAEKKLLQAEDLENK
A0A856MDH8      YQSRDPQLAAKLLNAISQATVEDNTKSIGLEATKVKQFLERKQVPEAENKLLQAEAQENK
A0A1Y0RCK1      YQSKNPQLAAQLLNAISQAMVEDNTKSINSEATKVKEFLEEKQVPEADKQLRQAEAQENK
A0A1Z4PWZ0      YQSEYPKLAARLLNAVAQAMVEDNIKAISSEATKVKAFLEKKQVPSAEKQLLQAEEKENK
A0A0C2QLT0      YQSKDPRLAAKLLNAISQAMVEDNTKAISSEATKVKKFLEEKQVPEADKQLRLAEATENK
A0A1Z4J2K1      YQSKDPQLAAKLLNAISQAMVEDNTKAISSEATKVKKFLEEKQVPEADKQLRLAEATENK
A0A3S0ZSX0      YEHKDPALASKLVNAVSQAMVEDNTQIIRQEAANVRKFLQQQ-VPEARQRLEKAELIENK
A0A2N6K4T3      YLNKDPILATKVVNAVSKAMVEDNTQVIRQEAANVRKFLETK-VPDARKRLQEAEQKENR
A0A370CKT2      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A0S3TL97      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A2N6M8A0      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A2N6M9E1      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A2N6KJI4      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A2N6MZ77      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A2N6KT20      YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
G6FSN3          YLNEDPILATKVVNAVSRAMVEDNTQVIRQEAANVRKFLEKK-VPEARKQLQEAEQKENR
A0A4D9CI02      YLNKDPTLATKVVNAVSQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKRVEEAEQKENK
A0A328I8B9      YLNKDPTLATKVVNAISQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKRVEEAEQKENK
A0A4Q9J4Z7      YLNKDPTLATKVVNAISQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKRVEEAEQKENK
A0A0M0SU69      YLNKDPTLATRVVNAVSQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKRVEEAEQKENK
A0A1Z4TIZ8      YLNKNPTLATKVVNAISQAMVEDNTQVIRQEAANVRKFLEKK-VPDARKRVEEAEQKENK
K9UYB2          YQSEDSQLAANLVNSVAMAMIRDHVQAISSEATKIREFLETKELPKARQALMVAEMEESA
A0A1Q4S1H4      YKASDPVFAARLLNAVSNAMVEENIKTISSEATKVRQFLEKNEVPNAQQRLKVAEIKENK
A0A433VBU6      YKAADPVFATRLVNAVTDAMVEENIKTMSSEATKVREFLEKKEVPNAQQRLKAAEIKENK
A0A218QN17      YKSKDPELAAQLLNAVSQAMIEENTKTISSEATKVREFLENNEIPNARKRLATAEQNESN
A0A846HD20      YKSKDPELAAQLLNAVSQAMIEENTKTISSEATKVREFLETSEIPNAYKRLREAENKESQ
K9RKN2          YENQDPLLAARLLNAVSSAMVEYDIKAISSEATKVKDFLENKQLPIARKKLREAEATESQ
A0A2I8ADV2      YFHQDPQFAADVLNAVSQAMVEENIQAISSEATKVRKFLEKE-VPVARNRLQQAEVAESR
A0A5Q0GMF5      YQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQRLLQAELAETK
Q3MEW0          YQSPNPNQAAQILNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQRLLQAELAETK
A0A1Z4KIC7      YQSPEPNQAAQVLNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQRLLQAELAETK
Q8YSM5          YQSPEPNQAAQVLNAVSQAMVEENIKTISSEATKVREFLAEK-VPIARQRLLQAELAETK
                                                                            

K9SLA9          FKENYRLVDLEI----------EKVTTVKAIKEIEAQMLGLQAELAEVGA----RSKQLQ
A0A168TT23      FAQANGVADLEE----------RVDMSQSSVRTLNDRLSAARGDLVQLRA----FSQLID
A0A0M1JWX9      FRQDYNLIDPKI----------QGEQLAGQITKIDDQLLEAQTALIQQQQ----LYTTLR
A0A844MWN9      FRQSTGLANVEE----------QTKGLVNTLDTLTASYAQAQAQAEAYRN----RAVSLS
A0A2T1M1V6      FQQSTGLFESET----------QTQELMQSINKLRATQTEISSEAESHAT----QARVAA
A0A2G7GCS2      FQQSTGLTEVTE----------QTRSLINQQRELRTTYTNVLSQAQANQA----QAQAAS
K9XBH8          FQEATGISEAVE----------QTRSLIAQLRDLKTNYTTILAQAQGSQA----QAIEAS
A0A1Z4LJ30      FKQKTNLVSSEE----------QTKEIVSTINALETEQAQTIAQAQEFQS----RAKMLS
Q7NF11          FKRSTGLVNTDQ----------QTGGLVGVISSLTTSQAQAVAEGTADKA----RAQMLT
K9RI76          FKQKTNLVSSEE----------QTQQIVSAINTLNTQQAQAIAEAESAAA----RVRMLS
A0A433VN22      FKQATGIVNNDA----------QTQGIVTTINALVGSRAQALSLAQASAS----RSKVLS
A0A139WSU3      FKQSSGLINNED----------QAKGIVDSISTLTTVRAQVLATAEASEN----RAKALS
A0A844MJB7      FKQSTGLINNED----------QAKSIVNTISTLTTVRAQVLATAEASEN----RAKALS
A0A352AE27      FQKSSGLVNSEE----------QTRGLVQSISELTTAQAQAQAQALASIN----EVRTLS
A0A3B8JH60      FKQSSGLVNSEA----------QTEGIVTTINNLSTAQAQAQALAQAGQN----RVSVLS
A0A3C0N766      FKQSSGLVNSEA----------QTEGIVTTINNLSTAQAQAQALAQAGQN----RVSVLS
K9W9J7          WKQSTGLVNSEA----------QTQGIVTTINNLTSVQAQALAQAQASEN----RIQVLS
Q7NJN6          YQRRTGLVNADD----------QTRGIVETLNSLRSTQTLTLAQAEAAAR----RATALE
U5QCC3          YQQTTGLVNVDE----------QTRGLVETLNTLRSSATLAQAQAKAAED----RSRSLE
A0A1Z4JCS8      FKQSTGLVNNEE----------QTKGLVGTINTLEAAQAQVQAESQATRD----RANTLA
A0A846GVZ3      FQESSGLVNSEA----------QTEGLVRAITDLSISQAQAQAEAQASQH----QLQILS
A0A6P0PI80      FQESSGLVNSEA----------QTEGLVRAITDLSISQAQAQAEAQASQH----QLQILS
A0A6P0WGT6      FQESSGLVNSEA----------QTEGLVRAITDLSISQAQAQAEAQASQH----QLQILS
F4XTX2          FQESSGLVNSEA----------QTEGLVRAITDLSISQAQAQAEAQASQH----QLQILS
A0A3S0Y9N9      FKQQYKVLDLKS----------EATSSVTILTDLEKQVAETISELASQTA----KMKSIK
A0A6P0ZKB8      FKQQNRVLDLKA----------EAASSVGILTALDKQVADTRSDLSSQTA----RMQSIK
A0A846EDH6      FKQQNRVLDLKA----------EAASSVGILTALDKQVADTRSDLSSQTA----RMQSIK
A0A433UNK7      FKQQNRVLDLKA----------EASASVAILTDLDKQVAATRSDLSSQTA----RMQSIQ
B8HNB0          FRKQYGLVTPDA----------YAEAVVSTRMELEKQGKDAEIAVKTTQR----QLEEVN
A0A318BJ18      YASAQQIINLPA------PGSGIGGTTTVERSIVADDLAALNASLAQATA------ERIQ
A0A3B8Y8H9      FRKKHNFIDPQS----------QSRILSSNLTNIIQKKQENQSLLQEQEI----RYRNLQ
A0A2W1JVB9      FKETNKIVAIDK----------EAEVAVEAVIRLAEKINEAQGRAISAQA----QSDSLR
A0A6H1U102      FRQDYGIVDPES----------YANQVLEQKQLLEKDGQQLEISLSRTQR----QYAELR
A0A7C3ZEJ3      FREKNGIVDPDT----------HATQVVSIKQSLEQQARDVEIALNRTQR----KYQELR
A0A2P8W9H0      LRQRSNLIDPLK----------QGEQLSTQTAKFTAEQFDLRLQLEQSQQ----LYQELQ
A0A6I5P386      LRKSYNLIDPLL----------QGEQLALQASKFRSERFDLWVEIQENQS----IYQDLQ
A0A3M1SVZ4      FKEENNFFALQE----------EAAAATQLMTGLQQRITDTQSQIASTNS----RYNALQ
A0A318BG22      YAEQNGIISVTD---------AKTAGTGSGAQSLDSASMAALNDRVAAAR----ANRILA
A0A2T1E9V8      FKEKYKLTDLAQ----------TQRSVAENIERIGSQVDSIEAQLSDLNS----RSKGIQ
A0A1Z4LN32      FKQKNKVIELKE----------ETTKAVQIIHEIDKELTEARSELADVGG----QEKEVS
A0A2I8A9F5      FKTQNKIVNLEE----------ESSGLVKNAITIDSEINNARAQLAETIT----REKQIL
A0A218Q6R8      FKTQNQIVDLQE----------EKNATVTIVLALDEELNNARALLADVSA----QEKQII
A0A218QGE0      FKLKNQILELAE----------ETKASVKNISDVEIELAKARSELADARA----QEIQIR
A0A846HDH5      FKLKNQILELAE----------ETRASVKNISDVENELAKARSELADASA----QEIQIR
A0A3M2GQQ6      FRQTYGIVDPES----------YANQVLDIKQSLEKDAQSLEITLTRSQR----LYAELR
A0A6H1U2X0      FRQTYGIVDPES----------YANQVLDIKQSLEKDAQSLEITLTRSQR----LYAELR
K9TLQ0          FRQHYNLIDPGQ----------SGQILSQQIGSLVNERQETESQLVQAQA----LYGKLR
K9QF04          FRRQNNLVDPEK----------QSQVLTERLSNIIQQRQETQALLGETQS----TIKDLQ
K9W1T3          FKEQNKVLDLAG----------EATSTTEVLNNLTQQISEAQSKYAAETS----RVQGLQ
K9SGJ5          FREKYKIVDPDT----------YAASVYTMKQDLDTQAQQLQIQMAQTQR----QFKELQ
A0A6N2JS94      FRKTYNIVDPDT----------YAASVYKMREALENQAQDLQIKIAQVQQ----QYEALS
A0A6C2DSN4      FRKTYNIVDPDT----------YAAAVFKMREALETQAQELQIKIAQSQQ----QYEALS
L8MYT6          FRKTYNIVDPDT----------YAAAVFKMREALETQAQELQIKIAQSQQ----QYEALS
A0A352JGJ6      FRKTYNIVDPET----------YAAAVFKMREVLEVQAQELQIKIAQTQQ----QYKSLS
A0A1J5GLS2      FRKSYNIVDPET----------YAASVYSMREALEKQAQELQIRIAQVEQ----QFEILS
A0A2W4W6M5      FRKTYNIVDPET----------YAASVYKMREALEVKAQELQIQIAQVQQ----QYKALS
A0A2W7AN33      FRKTYNIVDPDI----------YAASVYKMREALETQAQDLQIKIAQVQQ----QYEVLS
A0A256BLV2      FRKTYNIVDPDT----------YAASVYKMREALENQAQDLQIKMAQVQQ----QYEALS
A0A2W6ZXF3      FRKTYNIVDPET----------YAASVYSMREALEKQAQDLQIRIAQLQQ----QFEILS
A0A2Z5WX66      FRKTYNIVDPEV----------YAAAVFKMREALEAQAQDLQIKIAQFQQ----QYKSLS
Q7NEU3          FRRQYSILDPQV----------QGTELAATLNTLNRDYEQSKAELEASKE----HYWALS
A0A3C0N2P0      LRENYKIVDPES----------QGQQLSNRASEIVKQRQDTESQLSEAQK----LYTELQ
A0A6P0JR04      FRQENNLLDPEV----------QGQKVADRLNQIQQQRQETQAELKAKQA----LYDKLK
A0A6B3M6M6      FRQRYNLTDPET----------QGKLLTSRLSTIVGQRQETTTTFRETQE----LYSRLQ
A0A6P0KD09      FRQRYNLTDPET----------QGKLLTSRLSTIVEQRQTTDTTLQETQE----LYSRLQ
A0A6B3NIJ0      FRQRYNLTDPET----------QGKLLTSRLSTIVEQRQTTDTTLQETQE----LYSRLQ
A0A6M0F053      FRQRYNLTDPET----------QGKLLTSRLSTIVEQRQTTDTTLQETQE----LYSRLQ
A0A6P2ATU9      FRQRHNILDPDV----------QGQSVAERLNRLSEESRAARTTLNEVRS----LTQTLQ
A0A845XAM4      FRKRHNLLDPDV----------QGEAVANRLNTIVEERRGVASSLQETDK----LYAKLQ
A0A352XE00      FRQAYNLIDPDS----------QAQLLTQRATSIVQQRQDAQSQLAEAKA----LYNQLE
A0A6P0QC14      LREDYRIVDPET----------QGSLLTNRISDVVKQRQEAQTQLDESKQ----LYVELQ
B4VS56          FRQQYNLVNPDS----------QGQLLTSRVSTIVQERQNTQTQLDEART----LAVQLQ
A0A352AAQ3      LRQNYKIVDPET----------QGQLLTNRVSEIVKQRQETESQLVEAQR----LYTELQ
A0A350Y472      LRQTYQIVDPET----------QGQLLTNRVSDIVKQRQETQSQLIESQQ----LYAELQ
A0A355DVB4      LRQTYQIVDPET----------QGQLLTNRVSDIVKQRQETQSQLIESQQ----LYAELQ
A0A1Z4RMB9      FRTQNNIVDIEE----------EKRGVVESIGALNQQISTTGSELQGLKA----QTAALE
A0A318B4H2      YASGKGIVSFSSGSTEKGGGGGERTLVTDDLSSLNTALNAAVAERVAAES----------
A0A2K3BR24      FKEENNIIALSQ----------EASSTVDILASLDQQLIQAQASLDDAQT----RLEKLT
K9YXY1          FKEENDIIALSQ----------EASSTVSILASLDQQLIQAQASLDDAQT----RLEKLT
A0A1Q4RTR1      FKEKNRVVELQQ----------EAKTSIANQSDLADEIIKTEATLVDTSS----KIISLQ
A0A1Z4SQV2      FKEKNRVVELQE----------EAKTSIKNQSDLADQIIKSEAQLVDISS----QIQALQ
A0A2H2XGN1      FKEKNRVVELQE----------EAKTSIKNQSDLADQIIKSEAQLVDISS----QIQALQ
A0A433UXH8      FKEKNRIVELQE----------EAKTSIKNQSDLADEIIKSEAQLVNISS----QIQALQ
A0A1U7HGH0      FKEKNQLTNIEQ----------SQTALAANIERVGSQIDAVEAQLVDLNS----RTQSLQ
K9XJD3          FKEKNQLTNIEQ----------SQTALAANIERVGSQIDTVEAQLVDLNS----RAQSLQ
K9SX01          FKEVNKAYLPEA----------EAQSAVAAVTSLDTQITASKSDLAKVNS----EINDIR
A0A4P7ZT55      FRRANALLIPED----------RAKQIELERADLEARERQLQQGQAQLVG----LQASVR
A0A1E5QIR9      FKENNRIVALDQ----------EASATVTLLGGLEGEITQAKVALNSANT----RVAALR
A0A6P1A9A0      FRQQYDLIEPQS----------QGQQLSGKLSAIKQQQQETQAQLAEIQS----LSVRLS
A0A1Z4IBC7      FKEINKIVALEQ----------EATVAVDTVSKLSNQISQAQAQLNDVKG----RLEQLR
A0A5Q0GKD1      FKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVTG----RLEQLR
Q3MDC6          FKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVTG----RLEQLR
A0A1Z4KM73      FKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVKG----RLEQLR
Q8YNX7          FKEINKIIALEQ----------EATVAVDTVSKLSNRISEAQAQLNDVKG----RLEQLR
A0A367R4K6      FKEKNKVIVLDQ----------EASAAVDTISKLDNQIYQAQAQLDDVKG----RLEQLR
A0A1E2WSV8      FKETNKIVVLEQ----------EATAAVDTISKLGNQISQALAQLDDVKG----RLEQLR
A0A7D7L9Y1      FKETNKIVVLEQ----------EATAAVDTISKLGNQISQALAQLDDVKG----RLEQLR
A0A2R5FRT9      FKEKNKVVVLGQ----------EASAAVDTISKLGNQISQALAQLDDVKG----RLEQLS
A0A2K8T1B6      FKEKNKVVVLGQ----------EASAAVDTISKLGNQISQALAQLDDVKG----RLEQLR
A0A235I9I0      FKETNKVVVLDQ----------EAAAAVDTISKLGNQISQALAQLDDVKG----RLEQLS
A0A2D0HQT8      FKETNKVVVLEQ----------EAAAAVDTISKLGNQISQALAQLDDVKG----RLEQLS
A0A2L2NU95      FKETNKVVVLEQ----------EAAAAVDTISKLGNQISQALAQLDDVKG----RLEQLS
A0A367S084      FKETNKVVVLEQ----------EAAAAVDTISKLGNQISQALAQLDDVKG----RLEQLS
A0A1Z4SMD6      FKNQFQIIELKD----------ESTAAINNVAKIDEEMNQVKAAIAEAIA----QETQLR
A0A2H2Y096      FKNQFQIIELKD----------ESTAAINNVAKIDEEMNQVKAAIAEAIA----QETQLR
K9S8M8          FKERNGVISLNE----------EARTAVESIATLSTMIAQSEAMLQDATA----RSGQLQ
A0A1Z4NFV0      FRTQNQIANLPE----------EAKTTVESIAKLTDELNSTQAELAQVTS----QMGQLR
A0A3M9ZEU1      FKEANQIVALDT----------EATAAVNIIASIDQQIADTEAELAKMVA----RSSALR
A0A1Z4JK72      FRTQNQIVDLER----------ESAANINSLSLLQDQLNQARSQLADVAR----QEQVVR
A0A0N7Z489      FRARNGIVDLER----------ESAANINSAAVLQDQLSQARAQLADVGR----QERAVA
A0A0S3TXS2      FRAQNGIVDLER----------ESAANINSAAVLQDQLSQARAQLADVGR----QERAVA
A0A2A2TPF8      FKEQNQIINLEE----------ESNETVKTIGELDKQLNETRGQLAEATS----QQTELR
A0A1Z4R0P8      FKERNQIINLEE----------ESNETVKTIGELDKQLNEAQGQLAEVIS----QYQELR
A0A0T7BUI3      FKNKNKIVQLEQ----------ESSSAITSMAKLDEEINQATANLAETLA----QESQVG
A0A1Z4LP32      FKNQNQVIQLAE----------EATAAIQNISKLDDEINQARALLADVSA----QESRVA
K9REP9          FKNKNQVIQLPE----------EATAAIQNISTLDGEINQARASLAELTA----QESQLA
A0A1Z4SIJ3      FKTENKIIQLSQ----------ESTAGINNIAQLDEQINQSKASLADISA----QEALIA
A0A2H2XPG4      FKTENKIIQLSQ----------ESTAGINNIAQLDEQINQSKASLADISA----QEALIA
A0A2A2TC28      FKIQNNIVQLPQ----------EATAAITNISNLNEQVSQNQAALADIIA----QETELK
K9V3C7          FKARNQIISLKE----------ESDSTVKIIEELSNKLNEARGQLADVAS----QQAEVR
A0A1Z4T6Y7      FKTNNKVINLDK----------ETEETVKNIGELDKQLNEVKGQLAEVTS----QQAELR
A0A2H2Y561      FKTNNKVINLDK----------ETEETVKNIGELDKQLNEVKGQLAEVTS----QQAELR
A0A1Q4S362      FKAANQVINLEK----------ETEETVKNIGELDKQLNEVKGQLAEVTS----QQAELR
A0A3S1CIN8      FKAANQVINLEQ----------ETEETVKSIGELDKQLNEVKGQLAEVTS----QQAELR
A0A0C1NCB0      FKTSNKIVELKQ----------EATSAISNVAQLDDTINQAQAELAEVSA----EQAKVL
A0A844MLU2      FKTSNKIVELKQ----------EASSAISNVAQLDDTINQAQAELAEVSA----QQAKVL
A0A2N6K7Q9      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A2N6MXH6      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A2N6M5A8      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A2N6LL61      FKIQNKVIQLAE----------ESTAAIDIIAKLDQEINQVKAALADVSA----QEQQIA
A0A0S3TP66      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
G6FP91          FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A1U7GYR5      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A2N6KY52      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A2N6KMP5      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVST----QEQQIA
A0A2N6MA45      FKIQNKVIQLAE----------ESTAAIDIISKLDQEINQVKAALADVSA----QEQQIA
A0A4Q9J9V9      FKIQNRVIQLAE----------ESSAAIDIISKLDQEMNQIKAALADVTA----QEAQIA
A0A328IGA1      FKIQNRVIQLAE----------ESSAAIDIISKLDQEMNQIKAALADVTA----QEAQIA
A0A4D9CE41      FKIQNRVIQLAE----------ESSAAIDIISKLDQEMNQIKAALADVTA----QEAQIA
A0A0M0SFT2      FKIQNRVIQLAE----------ESTAAIEIISKLDQEMNQIKAALSDVSA----QEAQIA
A0A1Z4TLC8      FKIQNRVIQLAE----------ESTAAIDIISKLDQEMNQIKAALADVSA----QEAQIA
A0A1Z4IYV4      FKIQYKIIELPE----------EASAAVKNLGQIDQEINQARAALADVSA----QEAKMN
A0A1Z4Q0T6      FKIQYKIIQLPE----------EASAAVQNLGQIDQEINQARAALADVSA----QEAKMN
A0A0C2PT44      FKTRYKIIELPE----------EASAAVQNLGQIDQEINQARAALADVSA----QEAKIN
A0A1D2P6J4      FKTRYKIIELPE----------EASAAVKNLGEIDQEINQARAALADVSA----QEAKIN
A0A0C2LFH0      FKTRYKIIELPE----------EASAAVQNVASIDEEINQARAALADTSA----QEEKIR
A0A856M734      FKTRYKIIELSE----------EASAAVQNEASIDEQINQAKAALADTSA----QEEKIR
B4WP72          FKEENGVVDLEQ----------EAAQAVDSIGNLDTQIDQAKTELANVNA----RLLELR
A0A2T1CIL7      FKTKNKIANLAQ----------EASNNINATKSLESEIDAVRANLKDVNG----RFEQLR
A0A433V7A0      FKELNQVVDLNQ----------EATSTVKVIEDLEKAITQTQAELAEVNNYYQILQNQIQ
A0A2T1FTR8      FKEQYNVVDLPT----------ESVKAVETITSLNKEITSASAQLAAETS----RLEGLK
K9UA41          FKEQYNVVDLPT----------ESVKAVETITSLNKEITSASAQLAAETS----RLEGLK
A0A563VS48      FKNQYQIANLTE----------ETSATINSISNIRSQIDTIEAELEDVNA----RYSALN
A0A7Y0NUK1      FKNRNGIANLTE----------ETSATVSSLTGLENQLDELKAELEDVDA----RYNQLS
A0A0C2LBE2      FKENNKIITLQE----------EASAAVQAIAKLNEQISQAQAQLEDVTA----RSQKLQ
A0A433NN38      FKEANKVVVLQQ----------EAAEAVSTISKLEDNIATAQAQLVNVTA----QSQKLK
A0A2N6K0T2      FKERNKIIVLQE----------EATAAVNTISKLEDEIAQAQAQLVDVNA----RLEKLQ
A0A2N6ML72      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
G6FQZ6          FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A2N6MQX9      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A2N6KXT6      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A2N6KGB9      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A2N6L3Y5      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLQKLQ
A0A0S3TIS7      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A1U7GW28      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A2N6LW63      FKERNKIIVLQE----------EATAAVNTISRLEDEIAQAQAQLVDVNA----RLEKLQ
A0A328IH74      FKEKNKVIVLQE----------EATAAVNSISKLEDEIAEAQAQLVDANA----RLEKLQ
A0A4D9CIB0      FKEKNKVIVLQE----------EATAAVNSISKLEDEIAEAQAQLVDANA----RLEKLQ
A0A1Z4TQ63      FKEKNKVIVLQE----------EATAAVNTISKLEDEIAQAQAQLVDANA----RLEKLQ
A0A4Q9J8G2      FKEKNKVIVLQE----------EATAAVNTISKLEDEIAQAQAQLVDANA----RLEKLQ
A0A350Y0P6      FKEQHNIVSIDE----------EGTAAVEIMADLDKKISETKAQLQEKTT----TATELQ
A0A352X940      FKEENNIVAIEE----------EAKSAVQAMAELDSKLSQTKSNLEDATA----RSIAIQ
B8HTN4          FKETHGIVDLPT----------EQIESVKFKSLLARDLAQAKSLLATAQA----RATGLS
A0A6P1AFJ5      FRQENNFIEPSA----------QAQTLSSTLNNLAVAKEENQTQLAEMES----LATNLQ
B0CAX4          FKETNGIIALEE----------EAKVSVEVEGNFYQEAAKMQSLLINARA----KSRALR
A0A1Z4RN12      FKNRNRTINLDE----------ETASTIESISTIENQIDQVEAELSDINA----RYSRLQ
A0A2T1CMF9      FKNRNGISDLQG----------QITADIDSVAQVENQINQVSADLNDVNA----RYNRLQ
Q7NDC5          FKEQYGSVALAE----------EQQAAVRLLSEFRSQQAQADVALSEAGA----RVRAID
U5QGK3          FKERYGSVALPE----------EQQAVVKQLAEFKSEQAQAAVKLAEAQT----RAGAIA
A0A2W4UY24      FKEANGIVNLEE----------ESQNTVKTLSTVTDSITQLRSDLADKNA----QFAQIQ
A0A838VM23      FQEHNHLVSLTE----------ESKSAVAIVKELEGKITEVNAALADVNA----QYVSLQ
A0A0D8ZUV2      FKEQNQIVSLDE----------EVKSAVGIIKELESQINTTEAALANANA----RYATLQ
A0A433VDI0      FKEQNRVVNLDE----------EAKSAVEIIQELESQINQSQTALAGANA----RHTSLY
A0A3D1PG43      FKEQNQVVNLDE----------EGKSAVEVIKQLEDQVTATQAALVQAKT----RSANLQ
A0A2P8QQ72      FKERHQIVSLEH----------EAISAVEVLKELQDQITLAEAALVQTQG----RATKLQ
K9TZQ7          FKERHQIVSLEH----------EAISAVEVLKELQDQITLAEAALVQTQG----RATKLQ
A0A6N8G584      FKEQNQVVALDE----------EAKTAVAAIKQLENQITETQAQLADTTT----RSATLQ
A0A2G7GPR0      FKEQNQVVALDE----------EAKTAVAAVKQLENQITETQAQLADTTT----RSATLQ
K9XH68          FKEQNQVVALDE----------EAKTAVAAIKQLENQITETQAQLADTTT----RSATLQ
A0A1U7HW70      FKEQNQVVALDE----------EAKTAVAAIKQLENQITETQAQLADTTT----RSATLQ
A0A2S6VEJ8      FKEQNQVVALDE----------EAKTAVAAIKQLENQITETQAQLADTTT----RSATLQ
A0A140KBA0      FKNENQIANLSE----------ETTTLIETSKLVDTQIDQVAAELGDVNA----RYTSLS
K9XSG1          FKNENQIANLSE----------ETTTLIETSKLVDTQIDQVAAQLQDVNA----RYASLS
A0A2T1GMT4      FKQQNNIVDLSE----------EAKSAVSVIGNLDNNINAVRSELEQANA----QSQELY
K9UI51          FKQQNNIVDLSE----------EAKSAVGVIGNLENNINAVRSELEQANA----QSQELY
A0A1Z4QL41      FKQQNSVVDLSE----------ETKSAVTIIGNLDNEINTIRAQLADFNA----QTDALR
K9TYI2          FKQKNNIVDLSE----------EAKTAVANIGSLDNQIDNLKAELDQANT----QTNELR
A0A252D4T4      FKQKYNIVDLVE----------ETRSAVAIIGNLDNGINTAKADLDQATA----QTNELR
A0A252DJH5      FKQKYNIVDLVE----------ETRSAVAIIGNLDNGINTAKADLDQATA----QTNELR
A0A252EB80      FKQKYNIVDLVE----------ETRSAVAIIGNLDNGINTAKADLDQATA----QTRELR
A0A6G9SKZ9      FKQKYKIVDLAE----------ETRSAVAIIGNLDNNINTAKADLDQATA----QTNELR
A0A1Z4HPW5      FKQKYNIVDLAE----------ETRSAVAIIGNLDNNINGVRADLDQATA----QTNELR
A0A1Z4MSN1      FKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKADFDQATA----QTNELR
A0A1Z4U1C2      FKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKADFDQATA----QTNELR
A0A0D6KV51      FKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKADFDQATA----QTNELR
A0A1Z4MKF8      FKQKYNIVDLAE----------ETRSAVAIIGNLDSNINGVKADFDQATA----QTNELR
A0A2C6WC43      FKQKNRIADLTE----------ETKSAVGIIGNLNNEINTVQAQLDEVNA----QTNELR
A0A841WRE0      FKQKNRIADLTE----------ETKSAVGIIGNLNNEINTVQAQLDEVNA----QTNELR
A0A1Z4L5A1      FRQKNRIADLTE----------ETKSAVSIIGNLNTEINTVQAQLDEVNA----QTNELR
A0A367QD86      FKQKNRIADLTE----------ETKSAVGIIGNLNNEINTVQAQLDEVNA----QTNELR
A0A2K8SM78      FKQKHQIANLSE----------ETRSAVETIGNLDNEMNTVRAQLDEVNA----QTNELR
A0A2R5FPC0      FKQKHQIADLSE----------ETRSAVATIGNLDNEMNTVKAQLDEVNA----QTNELR
A0A5P8W5T6      FKQKHQIADLSE----------ETKSAVATIGNLDSEMNTVQAQLDEVNA----QTNELR
A0A7D7LDT7      FKQKHQIADLSE----------ETRSAVATIGNLDNEMNSVKAQLNEVNA----QTNQLR
A0A235IZ96      FKQKHQIADLSE----------ETKSAVATIGNLDNEMNTVKAQLDEINA----QTNELR
A0A2L2NGP0      FKQKHQIADLSE----------ETKSAVATIGNLDNEMNTVKAQLDEINA----QTNELR
K9QM62          FKQQNNIVDLTE----------EARSAVTIIGGLDTEINTVKASLNEITA----QSNELR
A0A1Z4FWI3      FKQSNNIVDLIE----------ETRSAVAIIGNLDNSINATRAELDQATA----QSNELR
A0A1Z4JYE7      FREQNNIVDLAE----------ETKTSVGVITGIDNEINAVKAQLADLVA----QRNQLS
A0A0F5YE28      FKEKNQVLDLEE----------EFRTAVLEQAELNRKITVLESELSGVNA----LAESLQ
U7QEH7          FKEKNQVLDLDA----------EFRTAVTELAELNRKITVLESELSGVNA----LAESLQ
A0A3S1ATK5      FKQENRIVDLPE----------ETKSAVGIIGNLENEINTVKAQLEDLNG----QTETLR
A0A2Z6CPH0      FRQKNNIADLSE----------ETKSSVGIIANLDNEINAIQAQLAEVNA----QSSELR
A0A1Z4GT50      FKEKHNIVDLSE----------EAKSGVAIIGNLNNEIHTIQAQLDEVNA----QSNELR
A0A1Z4GIX0      FRQKNNIADLTE----------ETRSGVGIIGNLDNEINTVNSQLAEVTA----QSNELR
A0A2H6LC24      FRQKNNIADLTE----------ETRSGVGIIGNLDNEINTVNSQLAEVTA----QSNELR
B2J6N5          FKQKYQIADLSE----------ETKSAVATIGNLDNEMNTVKAQLDEVNA----QTNELR
A0A367RMI4      FKQKHQIADLSE----------ETRSAVATIGNLDNEMNTVKAQLDEVNA----QTNELR
A0A235HUM0      FKQKHQIADLSE----------ETRSAVATIGNLDNEMNTVKAQLNEVNA----QTSELR
A0A2L2NW47      FKQKHQIADLAE----------ETRSAVATIGNLDNEMNTVKAQLDEVNA----QTNELR
A0A1E2WUR1      FKQKHQIADLSE----------ETRSAVATIGNLDNEMNSVKAQLNEVNA----QTNQLR
A0A235IKU3      FKQKHQIADLSE----------ETKSAVATIGNLDNEMNTVKAQLDEINA----QTNELR
A0A1U7MYU6      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A1D8TNX9      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A6P0L6C2      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A6P0MVH0      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A6P0KJV0      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A6L9ZJG4      FKERNQVVSLTE----------ESRSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A846GI17      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
F4XKF3          FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A1D9FX10      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A6P0Q0T0      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A6P0W5I0      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A845XJ02      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A846D190      FKERNQVVSLTE----------EARSLVAVMADLDSQITTVQAQLEEANA----QAAGLR
A0A3C0NJ41      FKQENQVIALDE----------EAKSAVGVMANLEQQITQVQAELQQANA----QTAALQ
A0A352AG88      FKEVNKVVSLEE----------ESRAAVDTLAKLDQQITEVKSQFKDANA----RSAELR
A0A350Y374      FKERNQVVALDT----------EATTAVEVIAKLDEQIAQVQSDLKNINS----QSAALR
A0A355DPX0      FKERNQVVALDA----------EATTAVEVIAKLDEQIAQVQADLKNINS----QSAALR
A0A0S3TYD7      FKENNQIVALDQ----------EQRNSVEITSDFNKRIEDTRAKLVGAIQ----KVNALK
A0A2T1DNG3      FRRDQSLIEPSA----------EAAAQTEMLNRLQADKQATLVQIRELQT----RYGDLQ
A0A140K3H3      FRQTYNIVDPDE----------YALRVIQFRDGLEQQEKQAEIALARTQR----QYQEIN
K9XUB8          FRQSYHIVDPNE----------YASRVIQFRDGLEQQEKQAEISLAAAQR----RYEEIN
A0A563VLD6      FRQENNLVDPNI----------YASDVSKFRQSLEQDSRSTEIALARAKS----KYQELY
A0A7Y0NVW6      FRQEHNIVDPNI----------YAEGVSEFRQSLEQDSKATEIALEQAKR----KYQEIS
U5QL42          FRKRYDIPDPDG----------YATSVAEVQQSLQQRIQDLQINLAQTQR----QYSELR
A0A6H2NHD5      FQKQYDLVDVNA----------ASESVTQRLNQMQANQEKLRVELASQIS----LYNALQ
A0A2P8W4F7      FQKRYDIVDVNA----------TSESVTQRLNQMLADQEQLRVDLTAMEP----LYDSLR
A0A5Q4E0Z4      FQKRYDLVNVTT----------TTESVTQRLNQMLADQEQLRVQLTALGP----LYENLR
A0A2P8VVX1      FRINQNLIDPNS----------QAISVVESLNQVQTQQQQLMVELSGLEQ----QYATLE
A0A2P8WHY0      FRQSQNLIDPTL----------QSQAVVTSLNEVQSEQRQLMSQLTELKS----RYQTLE
A0A563VQJ3      FRTENSIIDLQE----------EKRTIVQDAGAINRQIATLGASYQGKQA----QTKAMQ
A0A7Y0IRJ7      FRTENNIIDLQE----------EKKIVVQEIGSINRQIADVGASYQGKQA----QTKAIQ
A0A2T1CMT9      LTKENNLVSPEA----------EATSVKENIRQIAQEREALKAQVGEIAG----SSSALQ
A0A7G8J1V5      FRIRNNLLEPLE----------EGSALKEQEFTLNQQLLGLETE----RN----RLKSVR
A0A354B169      FRERHNLIEPTE----------EGGAIKGRLAQLESQLLGLEAE----RN----RLQRVR
Q0IDT5          FRRRHSLLEPAI----------EGTALKQREATLATQIFGFEAE----RS----RLKRVR
A0A7G8FZD9      FRIKHSLLEPTA----------EGGALRQQELALSNQVLALQAS----RN----RLSKVR
G4FMX5          FRIKHSLLEPTA----------EGGALRQQEAGLSSQVLALQAG----RN----RLSKVR
A3ZA21          FRRQHSLLEPTA----------EGGALKDRETAVATEILGLEAE----RS----RLQRVR
A0A076HBF2      FRTRYSLLEPTA----------EGGALKKRETAMAAQVLGLEAD----RN----RLLKVR
A0A7G8FP50      FRTRYSLLEPTA----------EAGALKSRETDKAAMVLELEAE----RS----RLIKVR
A0A7G8E8K7      FRTRYSLLEPTA----------EGGALKQRETAMAAQVLGLEAD----RN----RLLKVR
A0A7G8GNR2      FRTRYSLLEPTA----------EAGALKERETSMAAQVLGLEAD----RN----RLLKVR
A0A7G8ICD3      FRTRYSLLEPTA----------EGGALKQRETAMAAQVLGLEAD----RN----RLLKVR
A0A2D6FCW3      FRQRHSLLEPTT----------EGGALKQREAAIAAQVLDLEAG----RN----RLLRVR
A0A7G7KJ95      FRRQHSLLEPSA----------EGGALKEREAGMAAQVLDLQAG----RN----RLLKVR
A0A7G8EAN3      FRRQHSLLEPST----------EGGALKEREAGMAAQVLDLQAG----RN----RLLKVR
A0A1D8TX52      FRKSKNLIDPSQ----------QAVAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A1D9G4T2      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A6P0PR27      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0WER7      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A845XM36      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A846DAT1      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A846GZK8      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
F4XP71          FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0KZ31      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0LPB8      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6L9YR57      FRKSKNLIDPSQ----------QAVAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A845WMG9      FRKSKNLIDPSQ----------QAVAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A6P0SEV1      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6B3N2I8      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6M0B891      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0IJQ1      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0J8J8      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0ZSH6      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A845VS63      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A1U7N5X9      FRKSKNLIDPSQ----------QAVAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A6L9Z1V0      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYQAVQ
A0A6P0LC12      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A6P0MVJ3      FRKSKNLIDPSQ----------QALAVSQTLNGIEQERRAIRAQYMETQT----RYEAVQ
A0A2W6ZAV2      FRRQNSFLDPSS----------QGEAIQTQRQALNVRLDDLRQTEAKLLG----MASAVG
K9W742          FRKTQNLIEPDA----------QTTALTTALNAIQDERRRNQAQYRELQA----SYNTLQ
A0A3D1PBA3      FRKNYNLIDPEQ----------QATAVSQSLNAIAQERQVIRAQYKDLQA----RYNALQ
K9XPB0          LRSENNLVSPQG----------ESESIKAVLNNIQQERATLKAEQKQTQG----NYRQLQ
A0A350Y7Z1      FRETQNLIDPVQ----------QATTITDALSTVEQEQQAIRAQYQETQA----RYRVLQ
A0A352X2A7      FRENQNLIDPLQ----------EASNVGETLTKIEQERQAVRAQYQETLA----RYNSLQ
A0A0D8ZYV0      FRTNQNLIDPEQ----------QAAAINNSLNAVVQQRQVLRAQFQDTEA----RYRVLQ
A0A433VMS2      FRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRAQYNDLQA----RYGQLQ
K9TYA7          FRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRAQYNDLQA----RYGQLQ
A0A2P8QUE1      FRKNNNLIDPEQ----------QAATVNNSLNAIAQEREVIRAQYNDLQA----RYGQLQ
K9SA61          FRKNQNLIDPEA----------QSQTILEALSRTRQEQQTNQAELQATQA----QFASLQ
A0A2G7GMH8      FRESNNLIDPEL----------QAKALTDALNNVKQEQRTNRNQIQQTQS----RLHNLQ
A0A6N8FU92      FRESNNLIDPEL----------QAKALTDALNNVRLEQQTNRNQIQQTQS----RLNDLQ
A0A2T1DWE8      FRKSQNLVDPEV----------QSRALIDALSNLQKEQQTNQAQIREVQG----RYQTLQ
A0A832H7C4      FRKSQNLVDPEL----------QAKALIDALSQVRDEKRKNDAQTREAAA----RYAELQ
A0A1U7I8L3      FRKSQNLIQPEL----------QAKALIESLKDIQYELRTARAQYQEAQS----RFQTLQ
A0A2T1DJL8      FRKNQDLIDPEL----------QSKSMVDSLAAVQKDQRANRTELQDLQA----RYGALQ
A0A1Z4J9W0      FRSTSNLVDPEV----------QAKSLVDSLKELQQNQQENRGLLASSRA----KFIALQ
A0A0N7Z5K9      FRKSSNLVDPED----------QSRALIESLRELQKDQQSNRGELASAQA----RFLALQ
A0A0S3TXC5      FRKSSNLVDPED----------QSRALVESLRELQKDQQSNRGELASAQA----RFSALQ
A0A846FBD3      FKETYNVVVLQQ----------EASEAVSTIAGLDRDITQAEARLNEMTV----QSTHLR
K1XF69          FKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS----LVNSLG
B5W297          FKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS----LVNSLG
H1W7M8          FKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS----LVNSLG
A0A5Q4H6A5      FKERNYVVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS----LVNSLG
D5A466          FKERNEIVDLGT----------EFAISVQEMAQLNRNITTLEAELNAVQS----LVNSLG
B4WQE3          LRQNSNLIDPLA----------QGDQLSQQMAQFTSDHLNLQVEIAQTTE----LYNDLQ
U5QJM6          FRSKNNILDPEE----------QAKALSGVMSDLMEEAEKAKVELQTSRK----QYLALA
A0A0V7ZFJ4      FKEKNGIVALEQ----------EAQTGVEALKDLSEEIVKAQAYLGEVTT----RSEGLQ
A0A235IXQ2      FKEKYEVVSLEE----------EAKEGVKRLNELSSQITELRARLVDARS----RSGALQ
A0A367RIS1      FKEKYEVVSLEV----------EAQEGVRSLNELSNQITQLRARLVDARS----RSGALQ
A0A841V8H9      FKEKYEVVSLEV----------EAEEGVKSINELSNQITQLQARLVDARS----RSGALQ
A0A5Q0GJJ5      FKEKYEVVSLQE----------EAIQGVKRLNDLSGQVTQLRAQLVDART----RSGALQ
Q3MEB7          FKEKYEVVSLQE----------EAIQGVKRLNDLSGQVTQLRAQLVDART----RSGALQ
A0A1Z4KHN9      FKEKYEVVSLQE----------EAIQGVKRLNELSGQVTLLRAQLVDART----RSGALQ
Q8YT70          FKEKYEVVSLQE----------EAIQGVKRLNELSGQVTLLRAQLVDART----RSGALQ
A0A7U3NLX2      FKEKYQVVLLEE----------EAKQGVERLYEISNQITLLRARLVDANS----RSAALQ
A0A166IWU6      FKEKYEVVLLEE----------EAKQGVERLYQISNQLTLLRARLIDASS----RSDALQ
A0A2S0Q8C0      FKEKYEVVLLEE----------EAKQGVERLYQISNQITLLRARLIDASS----RSDALQ
W6FSX4          FKEKYEVVLLEE----------EAKQGVERLYQISNQITLLRARLIDASS----RSDALQ
A0A218Q4C1      FKERNEVVALEE----------EAKQGVERVYEISNQITLLRARLVDASS----RSSALQ
A0A6P1ZT04      FKERNEVVALEE----------EAKKGVERVYEISNQITLLRARLVDASS----RSGALQ
A0A0V7ZNJ9      FKEENKVVALKE----------EAQFGVEGLKDSLQELNQAEAKLAAANE----RSQALQ
A0A5P8VSD1      FKEKHEVVSLEA----------EAIEGVKRLNELSSQMTQLHAQLVDFRS----RSGALQ
A0A1S1ZVW2      FKEVNRVVALDA----------EAKVGIESLGRIDEVITQAQGQLAAAYT----RSLALQ
A0A0R0M9H9      FKEINRVVALDA----------EAKVGIETLGKIDEVITQAQGQLAAAST----RSLALQ
A0A7H0F4U6      FKEINRVVALDA----------EAKVGIETLGRIDEVITQAQGQLAAAST----RSLALQ
A0A7W2A1T7      FKEINRVVALDA----------EAKVGIETLGRINEVITQAQGQLAAAST----RSLALQ
A0A838WI98      FKEINRVVALDA----------EAKVGIETLGRINEVITQAQGQLAAAST----RSLALQ
A0A853MJX6      FKEINRVVALDA----------EAKVGIETLGRINEVITQAQGQLAAAST----RSLALQ
A0A1B7WX82      FKENNRVAVLDV----------EAKTGLESLAKLDQAIIESQGELVAAST----RSLALQ
A0A1B7WTD1      FKEKNRVVALDV----------EARVSLESLGRLTESITQSQGELAAAYT----RSVALQ
A0A480ABC0      FKEKNRVVALDV----------EARVSLESLGNLTEAITQSQGELAAAYT----RSVALQ
A0A1Z4LRU5      FKEQNNVVALEE----------EAKFGVESLKDLSENITQSQANLVEAMT----RSEALQ
A0A1Z4JVB4      FKEKNRVVALDE----------EAKVGVEGLNQLSQEIISTQGQLVAAKT----WSVGLQ
K9PIA4          FKEKNKVIALEI----------EAKAGVEGLKDLAAIITKVEAELVGANT----RSLALQ
A0A1Z4HVE1      FKEKNRVVALDV----------EAKVGVEGLKDLLEEITKAQANLVDANT----RTQALQ
A0A252ECZ1      FKEKNRVVALDI----------EAKAGVEGLKDLLEEITTAQAELADANT----RTRALQ
A0A1Z4G5Y1      FKEQNKVVALEV----------EAKTGVEGLKDLLGEITKAQAGLADATS----RTKALQ
A0A252DNA2      FKEQNRVVALDV----------EAKAGVEGLKDLLEEITKAQAELADAST----RTRALQ
A0A252E1Q4      FKEQNRVVALDV----------EAKAGVEGLKDLLEEITKAQAELADAST----RTRALQ
A0A6G9SK36      FKEKNKVIALDV----------EAKVGVEALKDLAEEITKTQGELIAAKT----RSQSLQ
A0A1Z4M597      FKEKNRVVALDV----------EAKVGVEGLKELAEEITRTQGELTAAKT----RSLALQ
A0A1Z4MWT1      FKEKNRVVALDV----------EAKVGVEGLKELAEEITRTQGQLTAAKT----RSLALQ
A0A1Z4TX53      FKEKNRVVALDV----------EAKVGVEGLKELAEEITRTQGQLTAAKT----RSLALQ
A0A2A2TNQ5      FKDDNKVVSLAE----------EAKVGVEGMRNIAEESTRALAVLEEAKS----RSGTLQ
A0A3S1C4K5      FKDENKVVSLPE----------EAKYGVEALKDLSGDITKAQALLSDASS----RSVALQ
A0A1X4G3D5      FKESNEIISLEA----------EAESGMKNVSTVDAAINQAQAELAVVYT----RSSALQ
D4TNI2          FKESNEIISLEA----------EAESGMKNVSTVDAAINQAQAELAVVYT----RSSALQ
A0A1Z4H6Z8      FKEKNRVVALEV----------EAKVGVEGLKDLAEEITTAQGELVAAKT----RSVALQ
A0A3F3KPR9      FKEINRVVALDA----------EAKVGIETLGRINEVITQAQGQLAAAYT----RSLALQ
A0A1Z4NPM1      FKDENRVVELTE----------EAKVGVEAMRNLSAELTRAQAALAEKNT----RVQTLQ
A0A1Z4UZW9      FKENNRVVALDV----------EAKTGLESLGKLDEAITKSQGELAAVLT----RSVALQ
A0A1B7VSH4      FKENNRVVALDV----------EAKTGLESLGRLNEAITQSQGQLAAALT----RSVALQ
A0A1B7W126      FKENNRVVALDV----------EAKTGLESLGRLNEAITQSQGQLAAALT----RSVALQ
A0A3D4C6Q6      FKENNRVVALDV----------EAKTGLESLGRLNEAITQSQGQLAAALT----RSVALQ
A0A0K2M5H0      FKENNRVVALDV----------EAKTGLESLGKLNEAITQSQGELAAALT----RSVALQ
A0A844I4P0      FKENNRVVALDV----------EAKTSLESLGKLNESITQSQGQLAAALT----RSVALQ
A0A1B7UVJ4      FKENNRVAVLDV----------EAKTGLESLAKLDQAIIESQGELVAAST----RSLALQ
A0A1B7UTR1      FKENNRVVALDV----------EARTGLESLGKLDEAITRSQGELAAAYT----RSVALQ
K7W0A4          FKENNRVVALDV----------EAKTGLESLGKLDEAITRSQGELAAAYT----RSVALQ
A0A5C0DRW9      FKENNRVVALDV----------EAKTGLESLGKLDEAITRSQGELAAAYT----RSVALQ
A0A6H2C088      FKENNRVVALDV----------EAKTGLESLGKLDEAITRSQGELAAAYT----RSVALQ
A0A1Z4RPC6      FYERNQVVDLQE----------EKRILVGEVGNLNRQIADTGAQLQGAKA----QTESLQ
A0A2T1CMZ0      FYEKNQVVDLQE----------EKKSLVDEIGTLNRAISGVGAQLQGKKA----QTDSLQ
L8M4F7          FRADNKIVDLQQ----------EKQTVIEETANLNRQIAFIGSQYRGTKA----QTDALQ
A0A140K2P2      FKESNQVVNLTK----------EAESTVMQMAEMNSEISKVAAQLQGTMA----QSEALQ
K9XWX4          FKESNQVVNLTR----------EAESTVVQMANLNSEIANVAAQLQGTMA----QSEALQ
A0A140KB14      FKEANRVVNLAK----------EKETLVLELGNLNQQIANVAAQYQGTQA----QTATLN
K9XX88          FKEANRVVNLAK----------EKETLVVELANLNQQIANVAAQFQGTQA----QTATLN
L8LZE9          IRERNNIVDLTQ----------EKRVLVQEIGTLNRQISAIGAQLQGAKA----QTGALS
A0A563VSV6      FRTKHKIVDLQE----------EKKVLVAELGTLNRQIATTGSQLKGTQA----QTASLQ
A0A7Y0IQB0      FRTKHNIVDLQE----------EKKILVSELGTLNRQIATTGSQLQGTQA----QTATLQ
A0A433NM31      FKERNNILDLEN----------EAKAAVTLVTDLENQIAQAQINLANANM----RSAALQ
A0A1Z4NDS1      FKEENKVINLQE----------EATASVNAIARLEDQITQVQAKLVDATA----RVKTLQ
U9VXM0          FREGNSIVDLEE----------ESRNLVESLFTLDNALIQLKSELADSTA----QASQLQ
A0A6M0RI13      FKEGNNIVDLEE----------ESRNLVESLFTLDNALIQLKSQLADSSA----QASQLQ
A0A6M0S1N5      FKEGNNIVDLEE----------ESRNLVESLFTLDNALIQLKSQLADSSA----QASQLQ
K9F4D9          FKEGNNIVDLEE----------ESRNLVESLFTLDNALIQLKSQLADSSA----QASQLQ
A0A6I5QPI5      FKETNDIISLDQ----------EASNAVSVLAGLDQDIGNIQAQLADISA----QLGQLR
A0A1Z3HMQ0      FKDQNQIIALES----------EANAAVSMINNLETQIGQAQAQLASAIT----RTGELR
A0A433W533      FKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRAELANANT----KLAKLR
A0A2P8QWJ3      FKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRAELANANT----KLAKLR
K9U6L7          FKEQNHLIALEV----------EAQGAVTVIQTLEGQIAQVRAELANANT----KLAKLR
U5DPF5          FKERNRIIVLNE----------EAQTTVRLLGSIDEELVKSQTSLNDTQA----RIQELS
A0A1E5QP61      FKEENSVVSLQD----------EATSAVISISNLDSEVIKAQAQYEDATA----RSQALQ
A0A846DWC7      FKEENSVVSLQD----------EATSAVISISNLDSEVIKAQAQYEDATA----RSQALQ
A0A845Y5J4      FKEQNNIVSLKE----------EASYAVANIAELDKKISQTRSDLEDSAA----RSTAIQ
A0A6P0X488      FKEQNNIVSLKE----------EATYAVANIANLDQKISQTRSELEDVAA----RSAALQ
A0A6P0VDM0      FKEQNNIVSLKE----------EATYAVANIAELDNKISQTRSELEDVAA----RSAALQ
A0A6P0UVD5      FKEQNNIVSLKE----------EATYAVANIAELDKKISQTRSDLEDVAA----RSAALQ
A0A846BFF2      FKEQNNIVSLKE----------EATYAVANIAELDKKISQTRSDLEDVAA----RSAALQ
A0A6M0G142      FKEQNNIVSLEE----------EASFAVENIAELDKKISQTQSELEDVAA----RSSALQ
A0A6P0MR53      FKEQNNIVSLEE----------EASFAVENIAELDRKISQTQSEMEDAAA----RSTALQ
A0A3M2GIL5      FKERNNIVELEE----------EARSAVFVMGEIETEKSKKEAALADATA----RSAALQ
A0A6H1TSJ9      FKERNNIVELEE----------EARSAVFVMGEIETEKSKKEAALADATA----RSAALQ
A0A3M1PML8      FKEANGVVLLES----------EAQEAVNIISKLEDQVTQARAELSDTSA----RLSQLQ
A0A6M8BE85      FKEENGVVLLES----------EAQEAVNIISKLEDQVTQARAELSDTSA----RLAQLQ
A0A0T7BPZ0      FQERNKIIILQE----------QESNAVKMISSLEDEIAQAEIKLTEVNA----QLDKLR
A0A352X442      FKEQNKIVDLVN----------EAKSSVETVADLDTQIAQTQAKLAEATA----QTETLR
A0A6B3NF44      FKEENRVVALQE----------EASASVSIISSLDNQIAQAQARLADVTA----RSTQLR
A0A6M0EPL4      FKEENRVVALQE----------EASASVSIISSLDNQIAQAQARLADVTA----RSTQLR
A0A6P0K6L6      FKEENRVVALQE----------EASASVSIISSLDNQIAQAQARLADVTA----RSTQLR
A0A6P0MRR9      FKEENKVVSLVA----------EATATVDNIARLDRTIAETQAELANISS----QVSELQ
A0A6P0X1X4      FKEENKVVSLVD----------EATQTIRTIAILDQQITQKEAELANVSS----QVAEVE
A0A6P0UX57      FKEENKVVSLVD----------EATQTVKSIALLDQQIAAKKAELANISS----QVAEVE
A0A846B9S8      FKEENKVVSLVD----------EATQTVKSIALLDQQIAAKKAELANISS----QVAEVE
A0A0M0SHU3      FKEKNKVIVLQE----------EATAAVNTISKLEDEIAEAQAQLVDANA----RLEKLQ
A0A1D2PBN3      FKEENKVIALQE----------EATAAVNEISKLEEQISQAQAQLADVSA----RSQKLQ
A0A0C2LVR7      FKEENKVIALQE----------EATAAVNEISKLEEQISQAEAQLADVTA----KSQKLQ
A0A1Z4PQB9      FKEENKVIALQE----------EATAAVNEISKLEEQISQAQAQLADVSA----RSQKLQ
A0A1Z4SFN6      FKEENKIINLES----------EAGLAVERISNLEQQLAQAQAEYANVTA----KSQKLQ
K9PGI8          FKEENKIIALQE----------EASTAVQVISRLEEQINQTQAKLVEVGA----RTKKLQ
A0A654SFI6      YANENEILVLET---GNREEGSGTASQTLIATDLAALNEALA-----------------Q
K9SSQ0          FRQQYNITDPDT----------YAASIFSTKQGLATQIQDLQIKMAQTQR----QLQELQ
A0A2W1JIN9      FKQEYGYVTLSA----EGNNNEANQLLVNSYAQLEGQIRDLTSQIQEVDA----RNLSLS
A0A318AJV1      YRAGTGLSADGA----------GSNVVDQQIATLSGQLANAEAEAAGARS----SASVAQ
A0A845WDS5      YRKSSGLVSFEQ----------QTESLVESLAKVEDQERLLYAQLQEVNA----RLKALG
A0A6P0IC70      YRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEVNA----RLKAIE
A0A845VVD9      YRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEVNA----RLKAIE
A0A6B3MUB5      YRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEINA----RLKAIE
A0A6M0B7N4      YRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEINA----RLKAIE
A0A6P0J9W3      YRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEINA----RLKAIE
A0A6P0ZWE1      YRKSSGLVSFNE----------QTESLVESLAKVEDQERLLYAQLEEINA----RLKAIE
A0A1U7N2U4      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6L9YZL1      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6P0KYM4      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6P0LSD6      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6P0PNZ7      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
F4XV38          FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6P0W137      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A845XHF7      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A845ZEG9      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A1D9G1F2      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A846CJ58      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6L9Y9E2      FKQTTGLVSPEE----------QTQLLVRSLASLEDQERAVSIQLQDAKT----RSQELQ
A0A6P0SGR0      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQEAKT----RSQELQ
A0A6M0BK48      FKQTTGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A845WG36      FKQTSGLVSPEE----------QTQLLVRSLATLEDQERAVSIQLQDAKT----RSQELQ
A0A6P0X384      YKQATGLVSVEE----------QTNNLITSLASLEQEKQLLAAQVQEANG----RVESLR
A0A2P8QIL5      YKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKA----RNSSLE
A0A433W447      YKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKA----RNSSLE
K9U1K8          YKQSQGIVSIAD---DQGRDNAQTTSIVESLAQIEEQERTTLAQLQEVKA----RNSSLE
A0A1Q4RZJ6      YRQQSSIVDFDE----------QTKSLVQSVASLEDQQRNLATQLQEANS----RLDSLR
A0A1Z4SNV3      YRQASIIVNYDE----------QTKSLVQSVASLEDQQRTLATQLQDANS----RGESLR
A0A2H2XJQ1      YRQASIIVNYDE----------QTKSLVQSVASLEDQQRTLATQLQDANS----RGESLR
A0A3S5K358      YRQQSSIVDFDE----------QTKSLVQSVASLEDQQRTLATQLQEANS----RLDSLR
A0A0T7BPJ4      QKQASGIVSFDE----------QSKSVVTSLASLEDQERTALAQLQELRS----RAASLE
A0A0C1QS61      YRRSSGIISFTK----------QSESLVDSLAALENQERTLSAQLRELRS----QDASLR
A0A139X3R8      YRQSSGIISFTK----------QSESLVDSLATLENQERTLSAQLQELRS----QDASLR
A0A844MZP8      YRQSSGIISFTK----------QSESLVDSLATLENQERTLSAQLRELRS----QDASLR
A0A1Z4I7C5      YRQQSGVVAADD----------QTKSLVGSLADLENQERTLAAQLQEARS----RDASLR
A0A844MST0      YRQISGLVSSEE----------QTKTIVESIAVLENQERALLAQRQEVRS----RKVSLQ
A0A0C2MDK7      YRKSSGIVSVEE----------QTKSLVQSIATLEHQERTLSAQLQEIKT----KDASLG
A0A856MDH8      YRKLSGIVSVEE----------QTKSLVESIATVEDQERTLSAQLQEIKA----RDASLQ
A0A1Y0RCK1      YRQLSGIVSLEE----------QTKSLVQSIATVEDQERTLSAQLQEIKA----RDVSLR
A0A1Z4PWZ0      YRKSSGIVSFEE----------QTKSLVQSIATVEDQERTLSAQLQEIKA----RDASLR
A0A0C2QLT0      YRKLSGIVSLEE----------QTKSLVQSIATVEDQERTLSTQLQEIKA----RDASLR
A0A1Z4J2K1      YRKLSGIVSLEE----------QTKSLVQSIATVEDQERTLSAQLQEIKA----RDASLR
A0A3S0ZSX0      YRQDSGIVSFDE----------QTKSLVNSLATLEEQEGTLSAQLQELRS----KEVSLR
A0A2N6K4T3      YRQSSGIVSFDE----------QTKSIVESLATLEEQENTLSAQLQELRS----KEASLQ
A0A370CKT2      YRQSSGIVSFDE----------QTKSLVESLANLEQQENTLSAQLQELRS----KEASLQ
A0A0S3TL97      YRQSSGIVSFDE----------QTKSLVESLATLEQQENTLSAQLQELRS----KEASLQ
A0A2N6M8A0      YRQSSGIVSFDE----------QTKSLVESLATLEQQENTLSAQLQELRS----KEASLQ
A0A2N6M9E1      YRQSSGIVSFDE----------QTKSLVESLATLEEQENTLSAQLQELRS----KEASLQ
A0A2N6KJI4      YRQSSGIVSFDE----------QTKSLVESLANLEEQENTLSAQLQELRS----KEASLQ
A0A2N6MZ77      YRQSSGIVSFDE----------QTKSLVESLANLEEQENTLSAQLQELRS----KEASLQ
A0A2N6KT20      YRQSSGIVSFDE----------QTKSLVESLANLEQQENTLSAQLQELRS----KEASLQ
G6FSN3          YRQSSGIVSFDE----------QTKSLVESLANLEQQENTLSAQLQELRS----KEASLQ
A0A4D9CI02      YRQSSGIVSFDE----------QTKSLVNSLATVEEQENTLVAQLQELRS----KEGSLR
A0A328I8B9      YRQSSGIVSFDE----------QTKSLVNSLATVEEQENTLVAQLQELRS----KEGSLR
A0A4Q9J4Z7      YRQSSGIVSFDE----------QTKSLVNSLATVEEQENTLVAQLQELRS----KEGSLR
A0A0M0SU69      YRQSSGIVSFDE----------QTKSLVNSLAIVEEQENTLVAQLQELRS----KEASLR
A0A1Z4TIZ8      YRQSSGIVSFDE----------QTKSLVNSLATLEEQENTLVAQLQELRS----KEASLR
K9UYB2          YRERTGIISFDE----------QTKSLVQSLAALEDQQRTLGTQLQEARS----RGESIR
A0A1Q4S1H4      YRQTSGIVSFDD----------QSKSLVTSLANLEDQERMLFAQLQEARS----RDSSLR
A0A433VBU6      YRQTSGVVSFDE----------QSKSLVTSLANLEDQERMLFAQLQEARS----RDASLR
A0A218QN17      YRHISGIISFEE----------QTKSAVESLATLEDQERALTAQLQEAKG----RDASLR
A0A846HD20      YRHISGIISFEE----------QTKSTVESLATLEDQERSLTAQLQEAKG----RDASLR
K9RKN2          YRQASGIVSFAE----------QTESLVENLSSLEEQERTLSALLEQVRS----QENSLR
A0A2I8ADV2      YRQKSGVVADTD----------QTKSLVQSLTNLEDQERTLIAQLQEARS----REASLR
A0A5Q0GMF5      YRQQSGVVATDD----------QTRSLVNSLAELENQERILAVQLQETRS----RDASLR
Q3MEW0          YRQQSGVVATDD----------QTRSLVNSLAELENQERILAVQLQETRS----RDASLR
A0A1Z4KIC7      YRQQSGVVATDD----------QTRSLVGSLAELENQERTLAVQLQETRS----RDASLR
Q8YSM5          YRQQSGVVATDD----------QTRSLVGSLAELENQERTLAVQLQETRS----RDASLR
                                                                            

K9SLA9          ---QSL-------GMDAGL-------------------S----VAWSSP-SAQ-------
A0A168TT23      ---QGR--------------GDSI--------------R----PVVNDG-QIA-------
A0A0M1JWX9      ---QQV-------GLDPDV-AIAS--------------S----VLSEAP-SYQ-------
A0A844MWN9      ---NRL-------NLTFNQ-AVKS--------------V----GLSENE-NYK-------
A0A2T1M1V6      ---AQL-------GMNPQH-ALNS--------------L----RLAENK-EYQ-------
A0A2G7GCS2      ---QRL-------GINAQQ-AMNS--------------L----RLGENR-EYQ-------
K9XBH8          ---GRL-------GMNAQQ-AMNS--------------L----RLAENK-EYQ-------
A0A1Z4LJ30      ---ARI-------EMSPST-AVNS--------------V----KLKENK-EYQ-------
Q7NF11          ---ARL-------GMDAPQ-AMRA--------------L----RLGESK-EYQ-------
K9RI76          ---NRI-------ALSPAA-AVNS--------------V----RLKEYK-EFQ-------
A0A433VN22      ---ERI-------NMAPAS-AVRS--------------L----SLSENQ-EFK-------
A0A139WSU3      ---IRL-------SLTPNE-AIRS--------------L----GLGENK-EYQ-------
A0A844MJB7      ---TRL-------SLTPDE-AVRS--------------L----SLGENK-EYQ-------
A0A352AE27      ---NRL-------GLTPDQ-AIRS--------------L----GLAENP-DYQ-------
A0A3B8JH60      ---APL-------SLTPDQ-AIKS--------------L----GLGENQ-NYQ-------
A0A3C0N766      ---ARL-------SLTPDQ-AIKS--------------L----GLGENQ-NYQ-------
K9W9J7          ---SRL-------SLTPNQ-AIRS--------------L----GLGENQ-NYQ-------
Q7NJN6          ---QAV-------GMDLRR-ATAA--------------L----NLGEDK-GLQ-------
U5QCC3          ---QAV-------GMDLRR-ATSA--------------L----RVGEDK-EYQ-------
A0A1Z4JCS8      ---TRL-------NLSPTD-AVQA--------------L----GLDQNE-DYK-------
A0A846GVZ3      ---TRL-------GLTPKQ-AIRS--------------L----GLAENR-DYQ-------
A0A6P0PI80      ---TRL-------GLTPKQ-AIRS--------------L----GLAENR-DYQ-------
A0A6P0WGT6      ---TRL-------GLTPKQ-AIRS--------------L----GLAENR-DYQ-------
F4XTX2          ---TRL-------GLTPKQ-AIRS--------------L----GLAENR-DYQ-------
A0A3S0Y9N9      ---QLF-------GVNSQE-AVVA--------------G----FASESP-STS-------
A0A6P0ZKB8      ---KIF-------GVTSQD-AVLS--------------G----FVGESP-STT-------
A0A846EDH6      ---KIF-------GVTSQD-AVLS--------------G----FVGESP-STT-------
A0A433UNK7      ---KLF-------GVASQD-AVVA--------------G----FVGESP-STV-------
B8HNB0          QQLADL-------KVNPSQ-AVPI--------------S----VLLQDS-NYQ-------
A0A318BJ18      ---AEA------RSQQGGRAGASA--------------E----ALRN-------------
A0A3B8Y8H9      ---QQL-------AMGEQE-AIDL--------------T----ALSESP-RYM-------
A0A2W1JVB9      ---KQL-------GIDKQK-SIAS--------------T----TLSQSP-GVQ-------
A0A6H1U102      RQMVAA-------GQNPDT-ALVN--------------S----MLAEDS-VYQ-------
A0A7C3ZEJ3      LQVSKA-------GQNPDA-ALPA--------------A----ILSQDT-VYQ-------
A0A2P8W9H0      QTLNND------GELAANS------------------------ALLNSN-RYQ-------
A0A6I5P386      QELARG------EELASTS------------------------ALLENE-RYQ-------
A0A3M1SVZ4      ---NQL-------GMNPKQ-AAQR--------------T----VISQST-TIQ-------
A0A318BG22      ---EQA------WNLARSPRADSL--------------P----EVRDNV-QIA-------
A0A2T1E9V8      ---QKL-------GMSPQE-AIVT--------------A----SVSQSS-AVQ-------
A0A1Z4LN32      ---SQL-------NLPLNK-AVDI--------------S----SLSQVK-GVQ-------
A0A2I8A9F5      ---NQI-------NLPADQ-AVDI--------------S----SLSQAA-GVQ-------
A0A218Q6R8      ---GQL-------NLPAEQ-ALAI--------------T----SLSQES-GVQ-------
A0A218QGE0      ---RQM-------NLRVDR-AVDI--------------T----SLSQVP-RVQ-------
A0A846HDH5      ---RQM-------NLPVDQ-AVDI--------------T----SLSQIP-AVQ-------
A0A3M2GQQ6      SQMVEA-------GQNPDT-ALVH--------------S----LLSQDS-VYQ-------
A0A6H1U2X0      SQMVEA-------GQNPDT-ALVH--------------S----LLSQDS-VYQ-------
K9TLQ0          ---GQL-------GLELEQ-AMLA--------------T----SLSDSP-RYQ-------
K9QF04          ---QQL-------GIDFKQ-AVAL--------------S----VLGEDP-NYL-------
K9W1T3          ---QLF-------GNDLNA-TVVA--------------A----SVGESP-TTQ-------
K9SGJ5          ---RQV-------GGSTDL-VLGK--------------A----ILAEDI-TYQ-------
A0A6N2JS94      ---RQV-------GKSPEA-AIGS--------------A----ILQQDA-PYQ-------
A0A6C2DSN4      ---RQV-------GKSAES-AIGG--------------A----ILQQDP-TYQ-------
L8MYT6          ---RQV-------GKSAES-AIGG--------------A----ILQQDP-TYQ-------
A0A352JGJ6      ---RQV-------GKSPDA-AISG--------------V----ILQQDT-PYQ-------
A0A1J5GLS2      ---RQV-------GKTPDA-AISG--------------A----ILQQDI-PYQ-------
A0A2W4W6M5      ---RQV-------GKSPDA-AIGG--------------A----ILQQDI-PYQ-------
A0A2W7AN33      ---RQV-------GKSPEA-AISS--------------A----ILQQDA-PYQ-------
A0A256BLV2      ---RQV-------GKSPEA-AIGS--------------A----ILQQDT-PYQ-------
A0A2W6ZXF3      ---RQV-------GKTPDA-AIGS--------------A----ILQQDV-PYQ-------
A0A2Z5WX66      ---SQV-------GKSPNA-AISS--------------A----ILQQDT-PYQ-------
Q7NEU3          ---ERL-------GISPGQ-ALAS--------------A----TLSKDG-PYQ-------
A0A3C0N2P0      TQLSQL-------GVTPNQ-AIAS--------------S----ALSEAP-RYQ-------
A0A6P0JR04      ---SQL-------EVDLDT-AMTA--------------T----ALSQAP-RYQ-------
A0A6B3M6M6      ---TQL-------GLSTEQ-ALAA--------------A----TLSEAP-RYQ-------
A0A6P0KD09      ---TQL-------GLSTEQ-ALTA--------------A----TLSEAP-RYQ-------
A0A6B3NIJ0      ---TQL-------GLSTEQ-ALTA--------------A----TLSEAP-RYQ-------
A0A6M0F053      ---TQL-------GLSTEQ-ALTA--------------A----TLSEAP-RYQ-------
A0A6P2ATU9      ---GQL-------DLDLNQ-AMVV--------------A----ALSEAP-RYQ-------
A0A845XAM4      ---EQL-------GLDLDT-ALVV--------------S----ALSEAP-RYQ-------
A0A352XE00      SQLAEL-------GVSPDR-AIAA--------------S----ALSEAP-RYQ-------
A0A6P0QC14      SQLGQL-------GVTPDQ-AIAA--------------T----ALSEGP-RYQ-------
B4VS56          SQLGEL-------GLSPKQ-AIAA--------------S----ALSEAP-RYQ-------
A0A352AAQ3      DQLGQL-------GVTPDQ-AIAA--------------A----ALSEAP-RYQ-------
A0A350Y472      TQLGQL-------GVTPDG-AIAA--------------S----ALSEAP-RYQ-------
A0A355DVB4      TQLGQL-------GVTPDG-AIAA--------------S----ALSEAP-RYQ-------
A0A1Z4RMB9      ---GQL-------GLNLNQ-AVAA--------------N----QLGASP-EVQ-------
A0A318B4H2      --------------------AVRA--------------A----SVSPNS-ASQ-------
A0A2K3BR24      ---EQL-------GLPPEQ-ALAA--------------G----ALSQSE-AVQ-------
K9YXY1          ---EQL-------GLPPEQ-ALAA--------------G----ALSQSE-AVQ-------
A0A1Q4RTR1      ---NQL-------GLNSQK-AIAL--------------N----ALSQSK-AVQ-------
A0A1Z4SQV2      ---NQL-------SLNSRQ-AVAL--------------N----TLSQST-AVQ-------
A0A2H2XGN1      ---NQL-------SLNSRQ-AVAL--------------N----TLSQST-AVQ-------
A0A433UXH8      ---NQL-------GFNSRT-AVAL--------------Y----SLSQST-AVQ-------
A0A1U7HGH0      ---RQL-------GMNPQQ-AMTI--------------A----TISQSS-AIQ-------
K9XJD3          ---RQL-------GMTPQQ-AMTI--------------A----KISQSS-AIQ-------
K9SX01          ---TRL-------GFTSEQ-AIIL--------------T----KLSASK-PVQ-------
A0A4P7ZT55      ---RGQ-------LFSPQFQGASG--------------VSGGGGLKPAT-GADLSGALAS
A0A1E5QIR9      ---SQT-------GIDSQQ-AIAL--------------S----ALSQSE-GVQ-------
A0A6P1A9A0      ---EQL-------GLEMNE-AITA--------------S----ALSAAP-RYQ-------
A0A1Z4IBC7      ---AQA-------QVNSQQ-GVIA--------------S----ELSQAP-GVQ-------
A0A5Q0GKD1      ---AQA-------QVDSQQ-GVIA--------------S----ELSQAP-GVQ-------
Q3MDC6          ---AQA-------QVDSQQ-GVIA--------------S----ELSQAP-GVQ-------
A0A1Z4KM73      ---TQA-------QVDSQQ-GVIA--------------S----ELSQAP-GVQ-------
Q8YNX7          ---TQA-------QVDSQQ-GVIA--------------S----ELSQAP-GVQ-------
A0A367R4K6      ---AQA-------QVNSQQ-GVIA--------------S----ELSQAP-GVQ-------
A0A1E2WSV8      ---SEA-------QVDSQQ-GVIA--------------S----DLSQAP-GVQ-------
A0A7D7L9Y1      ---SEA-------QVDSQQ-GVIA--------------S----DLSQAP-GVQ-------
A0A2R5FRT9      ---SEA-------KIDSKQ-GVIA--------------S----ELTQAP-GVQ-------
A0A2K8T1B6      ---SEA-------KIDSQQ-GVIA--------------S----ELTQAP-GVQ-------
A0A235I9I0      ---SEA-------QVDSRQ-GVIE--------------S----ELSQAP-GVQ-------
A0A2D0HQT8      ---SEA-------QVDSRQ-GVIE--------------S----ELSQAP-GVQ-------
A0A2L2NU95      ---SEA-------QVDSRQ-GVIE--------------S----ELSQAP-GVQ-------
A0A367S084      ---SEA-------QVDSRQ-GVIE--------------S----ELSQAP-GVQ-------
A0A1Z4SMD6      ---SQL-------NIAQNQPVVEI--------------A----SLNQIP-GVQ-------
A0A2H2Y096      ---SQL-------NIAQNQPVVEI--------------A----SLNQIP-GVQ-------
K9S8M8          ---RSL-------GMDARQ-AIAM--------------N----AVGESP-AVQ-------
A0A1Z4NFV0      ---SQM-------NISSEQ-AVDI--------------S--------TP-GVQ-------
A0A3M9ZEU1      ---NQL-------GMDSRQ-AALL--------------A----SLSQTP-GVQ-------
A0A1Z4JK72      ---DQL-------GLETGQ-AIDL--------------A----SLSQSP-GVQ-------
A0A0N7Z489      ---DQL-------GLELGQ-AIDL--------------A----SLSQSA-GVQ-------
A0A0S3TXS2      ---DQL-------GLELGQ-AIDL--------------A----SLSQSA-GVQ-------
A0A2A2TPF8      ---SQL-------KIKSDR-AVDV--------------A----SLSLIP-GVQ-------
A0A1Z4R0P8      ---SQV-------KIPSET-AVDV--------------A----SLSLIP-GVQ-------
A0A0T7BUI3      ---NQI-------KTVKNQ-AIEI--------------T----SLNQIP-GVQ-------
A0A1Z4LP32      ---SKL-------DFSTNE-AVEI--------------T----SLNQIS-GVQ-------
K9REP9          ---SKL-------DFSANQ-AVEI--------------T----SLNQIS-GVQ-------
A0A1Z4SIJ3      ---SQL-------NMQSKE-AVEV--------------A----SVSQMS-GVQ-------
A0A2H2XPG4      ---SQL-------NMQSKE-AVEV--------------A----SVSQMS-GVQ-------
A0A2A2TC28      ---KQL-------NLVGEE-AVNI--------------T----SLSQIP-GVQ-------
K9V3C7          ---LSA-------NIPRDR-TVTQ--------------TVNVSSLSVNP-GVQ-------
A0A1Z4T6Y7      ---AQI-------KIPSNE-AVDR--------------T----SLSLIP-GVQ-------
A0A2H2Y561      ---AQI-------KIPSNE-AVDR--------------T----SLSLIP-GVQ-------
A0A1Q4S362      ---SQI-------KIPSSE-AVDR--------------T----SLSLIP-GVQ-------
A0A3S1CIN8      ---SQI-------KIPSSE-AVDR--------------T----SLSLIP-GVQ-------
A0A0C1NCB0      ---NQL-------KLAGQD-AVEI--------------T----SLNQIP-GVQ-------
A0A844MLU2      ---NQL-------KLAGQD-AVEI--------------T----SLNQIP-GVQ-------
A0A2N6K7Q9      ---SQL-------NVSENQ-AVTV--------------T----SLSQIP-GVQ-------
A0A2N6MXH6      ---SQL-------NVSENQ-AVTV--------------T----SLSQIP-GVQ-------
A0A2N6M5A8      ---SQL-------NVSENQ-AVTV--------------T----SLSQIP-GVQ-------
A0A2N6LL61      ---SQL-------NVSENQ-AVTV--------------T----SLSQIP-GVQ-------
A0A0S3TP66      ---SQL-------NVSENQ-AVTV--------------T----SLSQIP-GVQ-------
G6FP91          ---SQL-------NVSENQ-AVTV--------------T----SLSQIP-GVQ-------
A0A1U7GYR5      ---SQL-------NVSENQ-AVTV--------------T----SLSQIP-GVQ-------
A0A2N6KY52      ---SQL-------NVSENQ-AVTV--------------T----SLSQIP-GVQ-------
A0A2N6KMP5      ---SQL-------NVSENQ-AVTV--------------T----SLSQIP-GVQ-------
A0A2N6MA45      ---SQL-------NVSENQ-AVTV--------------T----SLSQIP-GVQ-------
A0A4Q9J9V9      ---SQL-------NVSENQ-AVTV--------------A----SLSQIP-GVQ-------
A0A328IGA1      ---SQL-------NVSENQ-AVTV--------------A----SLSQIP-GVQ-------
A0A4D9CE41      ---SQL-------NVSENQ-AVTV--------------A----SLSQIP-GVQ-------
A0A0M0SFT2      ---SQL-------NVSENQ-AVTV--------------A----SLSQIP-GVQ-------
A0A1Z4TLC8      ---SQL-------NVSENQ-AVTV--------------A----SLSQIP-GVQ-------
A0A1Z4IYV4      ---SQL-------NLAGDQ-AVEV--------------T----SISQIP-GVQ-------
A0A1Z4Q0T6      ---SQL-------NLAGDQ-AVEV--------------T----SISQIP-GVQ-------
A0A0C2PT44      ---TQL-------NLAGDQ-AVEV--------------A----SISQIP-GVQ-------
A0A1D2P6J4      ---TQL-------NLAGDQ-AVEV--------------T----SISQIP-GVQ-------
A0A0C2LFH0      ---SQL-------NLAGSQ-AVEI--------------T----SISQIP-GVQ-------
A0A856M734      ---SQL-------NLAGSQ-AVEI--------------T----SISQIP-GVQ-------
B4WP72          ---RQL-------GMELET-AIEL--------------N----TLSQSP-GVQ-------
A0A2T1CIL7      ---SQL-------NISWEE-AVAI--------------S----SLSQS--AVP-------
A0A433V7A0      ---SQI-------GMSVQD-ALAR--------------S----TLSQSA-GVQ-------
A0A2T1FTR8      ---NLF------GGRDAQA-TIQS--------------G----LVSESP-GLQ-------
K9UA41          ---NLF------GGRDAQA-TIQS--------------G----LVSESP-GLQ-------
A0A563VS48      ---SQL-------GISWEK-ASAI--------------A----TLSQSL-AVQ-------
A0A7Y0NUK1      ---SQL-------GISWQQ-ASAI--------------A----TLSQSL-AIQ-------
A0A0C2LBE2      ---NQA-------KIDSQQ-TVTN--------------S----SLTQAS-GIQ-------
A0A433NN38      ---EQI-------EVESQK-AITY--------------A----ELSQIP-GTQ-------
A0A2N6K0T2      ---TQA-------RVNSQE-AVSA--------------V----NLSQVP-GTQ-------
A0A2N6ML72      ---TQA-------RVNSQE-AVSA--------------V----DLSQVP-GTQ-------
G6FQZ6          ---TQA-------RVNSQE-AVSA--------------V----DLSQVP-GTQ-------
A0A2N6MQX9      ---TQA-------RVNSQE-AVSA--------------V----DLSQVP-GTQ-------
A0A2N6KXT6      ---TQA-------RVNSQE-AVSA--------------V----DLSQVP-GTQ-------
A0A2N6KGB9      ---TQA-------RVNSQE-AVSA--------------V----DLSQVP-GTQ-------
A0A2N6L3Y5      ---TQA-------RVNSQE-AVSA--------------V----DLSQVP-GTQ-------
A0A0S3TIS7      ---TQA-------RVNSQE-AVSA--------------V----DLSQVP-GTQ-------
A0A1U7GW28      ---TQA-------RVNSQE-AVSA--------------V----DLSQVP-GTQ-------
A0A2N6LW63      ---TQA-------RVNSQE-AVSA--------------V----DLSQVP-GTQ-------
A0A328IH74      ---NQA-------RVSSQE-AVSA--------------V----DLSQVA-GTQ-------
A0A4D9CIB0      ---NQA-------RVSSQE-AVSA--------------V----DLSQVA-GTQ-------
A0A1Z4TQ63      ---NQA-------RVNSQE-AVSA--------------V----DLSQVA-GTQ-------
A0A4Q9J8G2      ---NQA-------RVNSQE-AVSA--------------V----DLSQVA-GTQ-------
A0A350Y0P6      ---DKL-------GLNSQQ-AIAL--------------N----KLNQSR-AVQ-------
A0A352X940      ---NQL-------NLNENE-AVAL--------------N----SLSQSR-AVQ-------
B8HTN4          ---QQV-------GMSIDL-ARFS--------------N----AVSQSK-GVQ-------
A0A6P1AFJ5      ---AQL-------ELDLDQ-AVTI--------------S----ALSAAP-RYQ-------
B0CAX4          ---NKL-------GLTPQQ-GEDI--------------N----ALSQST-VVQ-------
A0A1Z4RN12      ---SQL-------GMNWRE-ASAV--------------S----ALSQSP-GVQ-------
A0A2T1CMF9      ---SQL-------GVSWQE-ASAI--------------S----SLSQSI-SLQ-------
Q7NDC5          ---ARM------GGLSEPE-ALVA--------------G----ALSGSD-GMR-------
U5QGK3          ---SRM------GGLSEKE-ALVA--------------G----ALSSSD-GMS-------
A0A2W4UY24      ---QQL-------RLNPQE-AYAV--------------G----LVSESP-GVQ-------
A0A838VM23      ---SKV-------GMSSGS-AIAA--------------N----TLNQSP-GVQ-------
A0A0D8ZUV2      ---QQV-------GMSSAQ-AVAT--------------N----SLNQAG-GIQ-------
A0A433VDI0      ---KKV-------GMSSEQ-AIAT--------------N----SLNQSS-GVQ-------
A0A3D1PG43      ---KEI-------GINSSD-IIAV--------------N----SLNQPAGGAQ-------
A0A2P8QQ72      ---KEI-------ALTSQD-VVPI--------------N----SLKESP-GIQ-------
K9TZQ7          ---KEI-------ALTSQD-VVPI--------------N----SLKESP-GIQ-------
A0A6N8G584      ---QQV-------GMNPQE-GITL--------------T----SLNQSP-GIQ-------
A0A2G7GPR0      ---QQV-------GMNPQE-GITL--------------T----SLNQSP-GIQ-------
K9XH68          ---QQV-------GMNPQE-GITL--------------T----ALNQSP-GIQ-------
A0A1U7HW70      ---QQV-------GMNPQE-GITL--------------T----ALNQSP-GIQ-------
A0A2S6VEJ8      ---QQV-------GMNPQE-GITL--------------T----ALNQSP-GIQ-------
A0A140KBA0      ---SQL-------GMNVSE-AAAI--------------S----SLNQSV-AVQ-------
K9XSG1          ---SQL-------GMGVSE-AAAI--------------S----SLNQSV-AVQ-------
A0A2T1GMT4      ---KKV-------NLNSQD-ALAV--------------S----AISQSP-AIQ-------
K9UI51          ---KKV-------NLNSQD-ALAV--------------S----AISQSP-AIQ-------
A0A1Z4QL41      ---QKI-------GLNSQQ-AIVV--------------S----SLSNSP-AIQ-------
K9TYI2          ---QKV-------GLNPQQ-ASTV--------------S----ALSQSP-AVQ-------
A0A252D4T4      ---QKV-------ALSSQE-ALSA--------------S----TLSQSP-AVQ-------
A0A252DJH5      ---QKV-------ALSSQE-ALSA--------------S----TLSQSP-AVQ-------
A0A252EB80      ---QKV-------ALSSQE-ALSA--------------S----TLSQSP-GVQ-------
A0A6G9SKZ9      ---QKV-------NLNSQE-ALSA--------------S----AVSQSP-AVQ-------
A0A1Z4HPW5      ---QKV-------NLNSQE-ALSA--------------S----AVSQSP-AVQ-------
A0A1Z4MSN1      ---QKV-------NLNSQE-ALSA--------------S----AVSQSP-AVQ-------
A0A1Z4U1C2      ---QKV-------NLNSQE-ALSA--------------S----AVSQSP-AVQ-------
A0A0D6KV51      ---QKV-------NLNSQE-ALSA--------------S----AVSQSP-AVQ-------
A0A1Z4MKF8      ---QKV-------NLNSQE-ALSA--------------S----AVSQSP-AVQ-------
A0A2C6WC43      ---QKV-------NLSSQN-AIAV--------------S----ALSQSP-AVQ-------
A0A841WRE0      ---QKV-------NLSSQN-AIAV--------------S----ALSQSP-AVQ-------
A0A1Z4L5A1      ---QKV-------NLSSQN-AIAV--------------S----ALSQSP-AVQ-------
A0A367QD86      ---QKV-------NLSSQN-AIAV--------------S----ALSQSP-GVQ-------
A0A2K8SM78      ---QKV-------ELNSQE-AIAV--------------S----ALSQSP-AVQ-------
A0A2R5FPC0      ---QKV-------ELNSQE-AIAV--------------S----ALSQSP-AVQ-------
A0A5P8W5T6      ---QKV-------ELNSQE-AIAV--------------S----ALSQSP-AVQ-------
A0A7D7LDT7      ---QKV-------ELNSQE-AIAV--------------S----ALSQSP-AVQ-------
A0A235IZ96      ---QKV-------ELNSQQ-AIAV--------------S----ALSQSP-AVQ-------
A0A2L2NGP0      ---QKV-------ELNSQQ-AIAV--------------S----ALSQSP-AVQ-------
K9QM62          ---KKV-------GLDSPQ-AIAM--------------S----TLSQSP-AVQ-------
A0A1Z4FWI3      ---QKV-------ALNSQQ-ALSA--------------S----AVSQSP-AVQ-------
A0A1Z4JYE7      ---QQL-------GLTTQQ-AIAV--------------T----TLSQSP-AVQ-------
A0A0F5YE28      ---TQA-------GFDLEE-AIAI--------------N----TLSQSP-VLI-------
U7QEH7          ---TQA-------GFDLEE-AIAI--------------N----TLSQSP-VLI-------
A0A3S1ATK5      ---QKI-------ALNSQQ-AIAV--------------S----SLNNSP-AIR-------
A0A2Z6CPH0      ---QKL-------GLNSQN-ALAV--------------S----ALSQSP-AVQ-------
A0A1Z4GT50      ---QKV-------NLNSPE-AITV--------------M----AISQSP-AIQ-------
A0A1Z4GIX0      ---QKI-------NLNSQQ-AIAV--------------S----TLSQSP-AVQ-------
A0A2H6LC24      ---QKI-------NLNSQQ-AIAV--------------S----TLSQSP-AVQ-------
B2J6N5          ---QKV-------ELNSQE-AIAV--------------S----ALSQSP-AVQ-------
A0A367RMI4      ---QKV-------ELNSQE-AIAV--------------S----ALSQSP-AVQ-------
A0A235HUM0      ---KKV-------ELNSQE-AIAV--------------S----ALSQSP-AVQ-------
A0A2L2NW47      ---QKV-------ELNSQE-AIAV--------------S----ALSQSP-AVQ-------
A0A1E2WUR1      ---QKV-------ELNSQE-AIAV--------------S----ALSQSP-AVQ-------
A0A235IKU3      ---QKV-------ELNSQQ-AIAV--------------S----ALSQSP-AVQ-------
A0A1U7MYU6      ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
A0A1D8TNX9      ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
A0A6P0L6C2      ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
A0A6P0MVH0      ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
A0A6P0KJV0      ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
A0A6L9ZJG4      ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
A0A846GI17      ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
F4XKF3          ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
A0A1D9FX10      ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
A0A6P0Q0T0      ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
A0A6P0W5I0      ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
A0A845XJ02      ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
A0A846D190      ---NQV-------GLNPQQ-AIAI--------------S----ALSQST-SVQ-------
A0A3C0NJ41      ---NKV-------GMNSQE-AINT--------------T----ALSQSA-GVQ-------
A0A352AG88      ---DQV-------GMNSQE-AIVA--------------S----SLSQSP-GVQ-------
A0A350Y374      ---DKV-------GMDAQE-AIAI--------------T----SLNQSP-GVQ-------
A0A355DPX0      ---DKV-------GMDAQQ-AIAI--------------T----SLNQSP-GVQ-------
A0A0S3TYD7      ---NQV------GT-SNEI-GVAQ--------------V----ALSQST-GVQ-------
A0A2T1DNG3      ---QKV------NL-SPQQ-AVLT--------------A----RLNQSG-RYQ-------
A0A140K3H3      ---RQL---RDLGQ-NPET-IVAY--------------T----LLSQDQ-VYQ-------
K9XUB8          ---RQL---RELGQ-NPET-IVAY--------------T----LLSQDQ-VYQ-------
A0A563VLD6      ---FQL---QQLGQ-EPDT-ILAS--------------T----VLSQDG-VYR-------
A0A7Y0NVW6      ---LQL---KALNQ-NPET-ILAS--------------T----VLSEDG-IYQ-------
U5QL42          ---AQV------GE-DPDI-ALSM--------------T----ILSQDP-TYT-------
A0A6H2NHD5      ---DQV------GF-QPST-AIRV--------------A----NLSESP-TYQ-------
A0A2P8W4F7      ---DQV------GF-DPDT-AIRV--------------A----NLNESP-TYQ-------
A0A5Q4E0Z4      ---RQV------GF-EPTV-AIGV--------------A----NLNESP-TYQ-------
A0A2P8VVX1      ---QQL------NL-SPQS-GVIA--------------A----RLSQSP-RIQ-------
A0A2P8WHY0      ---QRT------QL-SPAN-ALLA--------------A----RLSQSQ-RVQ-------
A0A563VQJ3      ---SQL------GL-NLQQ-AIAA--------------N----QLGNTP-AVK-------
A0A7Y0IRJ7      ---NQL------GL-DLRQ-AISA--------------N----QLGNTP-MVK-------
A0A2T1CMT9      ---EQL------GV-SVEN-ALAL--------------S----RLSQSP-RYQ-------
A0A7G8J1V5      ---TEINNGTLSIR-GFQD-AIGPS----GASQSGGTGG----GLSISD-PDQ-------
A0A354B169      ---AEISSGRLSAR-GFQE-AISTG---SGGSSSDNSGK----GLSVGD-VDQ-------
Q0IDT5          ---QDIASGSLSAR-GFQE-AISTG--SGGVVTGNQQSQ----GLAVSD-ADQ-------
A0A7G8FZD9      ---QEIAYGTLTAR-GFQE-AIGGL---GNGLTAGGGVQ----GLTISD-VDQ-------
G4FMX5          ---EEIANGTLTAR-GFQE-AIGGM---GNGLTAGGGVQ----GLTISD-VDQ-------
A3ZA21          ---AEIAAGTLSAR-GFQE-AISTG-SGGGGQSAQ--------GLSVSD-ADQ-------
A0A076HBF2      ---GEIASGTLTAR-GFQE-AIGQN--NGGGQANS--------GLTVSD-VDQ-------
A0A7G8FP50      ---SEISRGTLTAR-GFQE-AIGSS---------G--------GLTVSD-VDQ-------
A0A7G8E8K7      ---DGIASGTLSAR-GFQE-AIGNNTDPGGGQANS--------GLTVSD-VDQ-------
A0A7G8GNR2      ---DEISGGTLTAR-GFQE-AIGNT---GGAQANS--------GLTVSD-VDQ-------
A0A7G8ICD3      ---GEIASGTLTAR-GFQE-AIGNT---GGGQANS--------GLTVSD-VDQ-------
A0A2D6FCW3      ---QEIANGTLTAR-GFQE-AIGGL---GNGTTAGGDVQ----GLTISD-VDQ-------
A0A7G7KJ95      ---QEIANGTLTAR-GFQE-AIGGM---GNGTTAGGGVQ----GLTISD-VDQ-------
A0A7G8EAN3      ---QEIANGTLTAR-GFQE-AIGGL---GNGTTASGSVQ----GLTISD-VDQ-------
A0A1D8TX52      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A1D9G4T2      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6P0PR27      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6P0WER7      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A845XM36      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A846DAT1      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A846GZK8      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
F4XP71          ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6P0KZ31      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6P0LPB8      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6L9YR57      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A845WMG9      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6P0SEV1      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6B3N2I8      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6M0B891      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6P0IJQ1      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6P0J8J8      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6P0ZSH6      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A845VS63      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A1U7N5X9      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6L9Z1V0      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6P0LC12      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A6P0MVJ3      ---QKL------AR-SPQN-ALTS--------------S----RLSQSG-RYQ-------
A0A2W6ZAV2      ---SGM------LT-GPQV-QGSAG---DPGSGSQDKPA----QGTMTT-TTS-------
K9W742          ---QQV------AR-SPQD-ALVS--------------S----RLSQST-RYQ-------
A0A3D1PBA3      ---QQL------AR-SPQQ-ALAA--------------S----RLSQSS-RYQ-------
K9XPB0          ---QEL------GL-SAEN-SVAM--------------T----RLNQSS-QYQ-------
A0A350Y7Z1      ---QQL------ER-SPQE-ALTS--------------S----RLSQSP-RYQ-------
A0A352X2A7      ---KQL------NR-STSE-ALTS--------------S----RLSQSP-RYQ-------
A0A0D8ZYV0      ---QQV------GS-TPQV-ALSS--------------S----RLSQSP-RYQ-------
A0A433VMS2      ---QQL------AR-SPQQ-ALVA--------------S----RLSQSS-RYQ-------
K9TYA7          ---QQL------AR-SPQQ-ALVA--------------S----RLSQSS-RYQ-------
A0A2P8QUE1      ---QQL------AR-SPQQ-ALVA--------------S----RLSQSS-RYQ-------
K9SA61          ---RQL------GR-SPQA-ALLA--------------S----RLSEST-RYQ-------
A0A2G7GMH8      ---QQL------AR-TPRN-ALVS--------------S----RLSQSQ-RYQ-------
A0A6N8FU92      ---QQI------AR-SPRN-ALVS--------------S----RLSQSQ-RYQ-------
A0A2T1DWE8      ---QEL------AL-SPQQ-ALIA--------------A----RLSQSS-RYQ-------
A0A832H7C4      ---QQL------AR-SPAN-ALTT--------------N----RLSQSA-RYQ-------
A0A1U7I8L3      ---QQV------KR-SPQD-AVVS--------------S----RLSEST-RYQ-------
A0A2T1DJL8      ---QQL------AR-SPQQ-ATIA--------------A----RLSQSP-RYQ-------
A0A1Z4J9W0      ---QQL------QR-SPGQ-ATVA--------------A----RLSQSK-QYQ-------
A0A0N7Z5K9      ---QQL------AR-SPEQ-ATIA--------------S----RLSQSN-QYQ-------
A0A0S3TXC5      ---QQL------AR-SPEQ-ATIA--------------S----RLSQSR-QYQ-------
A0A846FBD3      ---EQL------GM-SAEQ-SIDV--------------S----TLSQAP-GVQ-------
K1XF69          ---NQV------GL-NLEE-AIAV--------------N----TLSQSP-VVR-------
B5W297          ---NQV------GL-NLEE-AIAV--------------N----TLSQSP-VVR-------
H1W7M8          ---NQV------GL-NLEE-AIAV--------------N----TLSQSP-VVR-------
A0A5Q4H6A5      ---NQV------GL-NLEE-AIAI--------------N----TLSQSP-VVR-------
D5A466          ---NQV------GL-NLEE-AIAV--------------N----TLSQSP-VVR-------
B4WQE3          ---QEL------SR-IDNE-YAST--------------S----ALAQSA-RYQ-------
U5QJM6          ---SRL------GS-SPEQ-ALAA--------------A----TLSEDK-IYQ-------
A0A0V7ZFJ4      ---KQL------QL-ETQE-AVAI--------------S----TLNQSP-IVQ-------
A0A235IXQ2      ---NQL------AL-NTQQ-AMAL--------------S----SLSQSR-AVQ-------
A0A367RIS1      ---NQL------AL-NTKQ-AMAL--------------S----TLSQSR-AVQ-------
A0A841V8H9      ---NQL------AL-NTKQ-AMAL--------------S----SLSQSR-AVQ-------
A0A5Q0GJJ5      ---NQL------AL-NTKQ-AMAL--------------S----SLSQSN-AVQ-------
Q3MEB7          ---NQL------AL-NTKQ-AMAL--------------S----SLSQSN-AVQ-------
A0A1Z4KHN9      ---NQL------EL-NTKQ-AMAL--------------S----SLSQSN-AVQ-------
Q8YT70          ---NQL------EL-NTKQ-AMAL--------------S----SLSQSN-AVQ-------
A0A7U3NLX2      ---NQL------GL-NIQQ-ATAI--------------N----TLSQSA-AVQ-------
A0A166IWU6      ---NQL------AL-NTQK-ATAL--------------S----TLSQSR-AVQ-------
A0A2S0Q8C0      ---NQL------AL-NTQK-ATAL--------------S----TLSQSR-AVQ-------
W6FSX4          ---NQL------AL-NTQK-ATAL--------------S----TLSQSR-AVQ-------
A0A218Q4C1      ---NQL------QL-NTEQ-ATAL--------------S----TLSQSR-AVQ-------
A0A6P1ZT04      ---NQL------EL-NTEQ-ATAL--------------S----TLSQSR-AVQ-------
A0A0V7ZNJ9      ---REL------DI-EKQK-AVEL--------------S----ELSQSP-AVQ-------
A0A5P8VSD1      ---NQL------AL-STQQ-AMAL--------------T----SLSQSI-AVQ-------
A0A1S1ZVW2      ---NEL------QL-STQQ-AVAL--------------S----SLSQIP-GVQ-------
A0A0R0M9H9      ---NEL------QL-STQQ-AVAL--------------S----NISQIP-GVQ-------
A0A7H0F4U6      ---NEL------QL-TTQQ-AVAL--------------S----NISQIP-GVQ-------
A0A7W2A1T7      ---NEL------QL-TTQQ-AVAL--------------S----NISQIP-GVQ-------
A0A838WI98      ---NEL------QL-TTQQ-AVAL--------------S----NISQIP-GVQ-------
A0A853MJX6      ---NEL------QL-TTQQ-AVAL--------------S----NISQIP-GVQ-------
A0A1B7WX82      ---YEM------KL-DTRQ-AVDL--------------S----TLSQSP-GVQ-------
A0A1B7WTD1      ---NEM------KL-TTQQ-AVDL--------------S----SLSQSP-GVQ-------
A0A480ABC0      ---NEM------KL-TTQQ-AVDL--------------S----SLSQSP-GVQ-------
A0A1Z4LRU5      ---NQL------KL-QPQQ-AVAL--------------S----SLSQSP-AVQ-------
A0A1Z4JVB4      ---DQM------AL-STKQ-AVEL--------------T----TLSQSP-GIQ-------
K9PIA4          ---NQI------EL-NTNQ-AVAL--------------N----TLNESP-GIQ-------
A0A1Z4HVE1      ---NQI------AL-NTQQ-AVEL--------------S----TLSQSP-GVQ-------
A0A252ECZ1      ---SQM------AL-NTQQ-AVEL--------------S----TLSQSP-GIQ-------
A0A1Z4G5Y1      ---SQI------AL-NTQQ-AVEF--------------S----TLSQSP-GIQ-------
A0A252DNA2      ---SQI------AL-NTQQ-AVEL--------------S----TLSQSP-GIQ-------
A0A252E1Q4      ---SQI------AL-NTQQ-AVEL--------------S----TLSQSP-GIQ-------
A0A6G9SK36      ---NQM------QL-SSEK-AVEL--------------T----TLSQSP-AVQ-------
A0A1Z4M597      ---NQM------KL-NTDT-AVEL--------------T----TLSQSP-GVQ-------
A0A1Z4MWT1      ---NQM------KL-NTDT-AVEL--------------T----TLSQSP-GVQ-------
A0A1Z4TX53      ---NQM------KL-NTDT-AVEL--------------T----TLSQSP-GVQ-------
A0A2A2TNQ5      ---KQL------DL-TTQK-AVEL--------------S----TLSQTP-GIQ-------
A0A3S1C4K5      ---KEL------EL-TTQQ-AVEL--------------A----NLNQST-GVQ-------
A0A1X4G3D5      ---NEL------QL-NKQQ-AVLV--------------S----TLSQIP-GVQ-------
D4TNI2          ---NEL------QL-NKQQ-AVLV--------------S----TLSQIP-GVQ-------
A0A1Z4H6Z8      ---SQM------EL-NPHQ-AVEL--------------S----TLSQSP-GIQ-------
A0A3F3KPR9      ---NEL------QL-TTQQ-AVAL--------------S----NISQIP-GVQ-------
A0A1Z4NPM1      ---NQL------EL-NRQQ-AVEL--------------S----TLNQSQ-GVQ-------
A0A1Z4UZW9      ---NEM------KL-GTQQ-AVDL--------------S----SLSQSP-GVQ-------
A0A1B7VSH4      ---NEM------KL-DRQQ-AVDL--------------S----TLSQSR-GVQ-------
A0A1B7W126      ---NEM------KL-DRQQ-AVDL--------------S----TLSQSR-GVQ-------
A0A3D4C6Q6      ---NEM------KL-DRQQ-AVDL--------------S----TLSQSR-GVQ-------
A0A0K2M5H0      ---NEM------KL-GTQQ-AVDL--------------S----TLSQSP-GVQ-------
A0A844I4P0      ---NEM------KL-GTQQ-AVNL--------------S----TLSQSP-GVQ-------
A0A1B7UVJ4      ---YEM------KL-DTRQ-AVDL--------------S----TLSQSP-GVQ-------
A0A1B7UTR1      ---DKM------KA-TTQE-AVDL--------------S----ALSQSP-GVQ-------
K7W0A4          ---YEM------KS-TTQE-AVDL--------------S----ALSQSR-GVQ-------
A0A5C0DRW9      ---DKM------KS-TTQE-AVDL--------------S----ALSQSP-GVQ-------
A0A6H2C088      ---DKM------KS-TTQE-AVDL--------------S----ALSQSP-GVQ-------
A0A1Z4RPC6      ---NQL------GL-DLKQ-AIAA--------------N----QLGSTP-QVQ-------
A0A2T1CMZ0      ---NQL------GL-NLKQ-AIST--------------V----QLGNTP-QVQ-------
L8M4F7          ---AKI------GL-SLEQ-AIAA--------------D----QLGSTP-VVK-------
A0A140K2P2      ---SQL------NL-NLNQ-AIAA--------------N----QLGASP-VVD-------
K9XWX4          ---SQL------NL-NLNQ-AIAA--------------N----QLGASP-VVD-------
A0A140KB14      ---QQL------GL-NLNQ-ALAA--------------N----QLGGTP-VVE-------
K9XX88          ---QQL------GL-NLNQ-ALAA--------------N----QLGGTP-VVE-------
L8LZE9          ---QEL------GL-SLEQ-AISA--------------N----QLGRTP-IVQ-------
A0A563VSV6      ---KQL------GL-SLNQ-AIAV--------------S----QLGNSP-TVQ-------
A0A7Y0IQB0      ---KQL------GL-SLPQ-AIEV--------------N----QLGNSP-TVQ-------
A0A433NM31      ---REI------GI-NVEQ-AKVI--------------N----ALSQSA-GVQ-------
A0A1Z4NDS1      ---EQA------NI-NSQQ-AITS--------------S----SLSQIP-GIQ-------
U9VXM0          ---QKL------KL-SSQE-AYAV--------------G----LVSESP-GIQ-------
A0A6M0RI13      ---QKL------KL-SSDE-AYAV--------------G----LVSESP-GIQ-------
A0A6M0S1N5      ---QKL------KL-SSDE-AYAV--------------G----LVSESP-GIQ-------
K9F4D9          ---QKL------KL-SSDE-AYAV--------------G----LVSESP-GIQ-------
A0A6I5QPI5      ---GQL------GV-NVSE-GIAL--------------S----SLNQSE-GVQ-------
A0A1Z3HMQ0      ---RQL------GI-PLAQ-ARQV--------------D----SLSQSP-GVQ-------
A0A433W533      ---QQV------GM-DTDT-SLNL--------------N----ALNQAR-GVQ-------
A0A2P8QWJ3      ---QQV------GM-DTDT-SLNL--------------N----ALNQAR-GVQ-------
K9U6L7          ---QQV------GM-DTDT-SLNL--------------N----ALNQAR-GVQ-------
U5DPF5          ---AQL------GL-SSAE-ALAA--------------S----ALTQSR-AVR-------
A0A1E5QP61      ---SQM------GL-NPQQ-ALAI--------------N----TLSQSA-AIQ-------
A0A846DWC7      ---RQM------GL-NPQQ-ALAI--------------N----TLSQSA-AIQ-------
A0A845Y5J4      ---SKL------EL-NSQQ-ALAI--------------S----SLSQSR-AVQ-------
A0A6P0X488      ---AKL------GL-NSQQ-ALAI--------------S----SLSQSR-AVQ-------
A0A6P0VDM0      ---GKL------GL-NSQQ-ALAL--------------S----SLSQSR-GVQ-------
A0A6P0UVD5      ---GKL------GL-NSQQ-ALAL--------------S----SLSQSR-GVQ-------
A0A846BFF2      ---GKL------GL-NSQQ-ALAL--------------S----SLSQSR-GVQ-------
A0A6M0G142      ---AQL------GL-NAEQ-ALAL--------------N----SLSQSR-AVQ-------
A0A6P0MR53      ---GKL------GL-NAQQ-ALAI--------------S----SLSQSR-AVQ-------
A0A3M2GIL5      ---QQM------GL-NSAQ-AIAL--------------G----AIGESM-AVQ-------
A0A6H1TSJ9      ---QQM------GL-NSAQ-AIAL--------------G----AIGESM-AVQ-------
A0A3M1PML8      ---GRV------GA-DPRR-ATVI--------------A----ALSQSP-GVQ-------
A0A6M8BE85      ---GRV------GA-DPRR-ATVI--------------A----ALSQSA-GVQ-------
A0A0T7BPZ0      ---SQA------KI-DTWQ-AVTL--------------T----ELSKEP-RTQ-------
A0A352X442      ---SQV------GL-NSKT-AVAV--------------N----SLNQSA-GVN-------
A0A6B3NF44      ---NQL------QL-NSQQ-AVAL--------------S----SLSQSP-AVQ-------
A0A6M0EPL4      ---NQL------QL-NSQQ-AVAL--------------S----SLSQSP-AVQ-------
A0A6P0K6L6      ---NQL------QL-NSQQ-AVAL--------------S----SLSQSP-AVQ-------
A0A6P0MRR9      ---QQL------DL-TPEE-ALSA--------------S----FLSQST-EVK-------
A0A6P0X1X4      ---QQV------GL-SPEE-AVAA--------------S----TLSQST-VVQ-------
A0A6P0UX57      ---QQL------GL-SPEE-AVAA--------------S----TLSQST-PVK-------
A0A846B9S8      ---QQL------GL-SPEE-AVAA--------------S----TLSQST-PVK-------
A0A0M0SHU3      ---NQA------RV-NSQE-AISA--------------V----DLSQVA-GTQ-------
A0A1D2PBN3      ---NQA------KI-DSQQ-GVTF--------------T----SLSQTP-GIQ-------
A0A0C2LVR7      ---NQA------KI-DSQQ-GVTF--------------T----SLSQTP-GIQ-------
A0A1Z4PQB9      ---NQA------KI-DSQQ-GVTF--------------T----SLSQTP-GIQ-------
A0A1Z4SFN6      ---NQG------SI-DSPQ-SVTF--------------A----SLSQIP-GIQ-------
K9PGI8          ---KQA------NV-NSQQ-AVTL--------------A----SLSQIP-GVQ-------
A0A654SFI6      ---AVT------DRISAEA-SVLS--------------G----EFPAAD-ARN-------
K9SSQ0          ---RQV------G-RPADV-AISS--------------A----ILSQDA-NYQ-------
A0A2W1JIN9      ---TLT------NAGSINN-TYTS--------------V----RTGQDP-ELQ-------
A0A318AJV1      ---GQV------RSGNVD----AV--------------V----GVQGSN-VIR-------
A0A845WDS5      ---QLT------GFNTINN-AYVS--------------G----RVGQDQ-ELD-------
A0A6P0IC70      ---QLT------GFNTINN-AYVG--------------G----RVGQDE-QLD-------
A0A845VVD9      ---QLT------GFNTINN-AYVG--------------G----RVGQDE-QLD-------
A0A6B3MUB5      ---QLT------GFNTINN-AYVG--------------G----RVGQDE-QLD-------
A0A6M0B7N4      ---QLT------GFNTINN-AYVG--------------G----RVGQDE-QLD-------
A0A6P0J9W3      ---QLT------GFNTINN-AYVG--------------G----RVGQDE-QLD-------
A0A6P0ZWE1      ---QLT------GFNTINN-AYVG--------------G----RVGQDE-QLD-------
A0A1U7N2U4      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A6L9YZL1      ---TIT------SLNNAQN-AYIA--------------G----RIGQDE-ELQ-------
A0A6P0KYM4      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A6P0LSD6      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A6P0PNZ7      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
F4XV38          ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A6P0W137      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A845XHF7      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A845ZEG9      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A1D9G1F2      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A846CJ58      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A6L9Y9E2      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A6P0SGR0      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A6M0BK48      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A845WG36      ---TIT------SLNNTQN-AYIA--------------G----RIGQDQ-ELQ-------
A0A6P0X384      ---QTT------GL-NLED-AYVG--------------G----RIGQDE-ELV-------
A0A2P8QIL5      ---QVT------DSSTLKN-TYAT--------------V----RSGQNE-QLQ-------
A0A433W447      ---QVT------DSSTLKN-TYAT--------------V----RSGQNE-QLQ-------
K9U1K8          ---QVT------DSSTLKN-TYAT--------------V----RSGQNE-QLQ-------
A0A1Q4RZJ6      ---QVT------QSKGLDT-AYES--------------V----RGGQDQ-ELQ-------
A0A1Z4SNV3      ---QIT------QAKGLDR-AYES--------------V----RSGQDQ-ELQ-------
A0A2H2XJQ1      ---QIT------QAKGLDR-AYES--------------V----RSGQDQ-ELQ-------
A0A3S5K358      ---QVT------QAKGLDT-AYES--------------V----RGGQDQ-ELQ-------
A0A0T7BPJ4      ---KIT------KTTSLDK-AYSA--------------V----RTGQDE-EVK-------
A0A0C1QS61      ---QIT------NATALKS-AYAS--------------V----RGGQDE-QLK-------
A0A139X3R8      ---QIT------NSTAVKS-AYAS--------------V----RGGQDE-QLK-------
A0A844MZP8      ---QIT------NATAPES-AYAS--------------V----RGGQDE-QLK-------
A0A1Z4I7C5      ---QVT------DAKNITA-AYAS--------------V----REGQDE-QLK-------
A0A844MST0      ---QIT------QVRSVGK-AYAA--------------V----RGGQDE-ELK-------
A0A0C2MDK7      ---QIT------NAGNLNN-AYSS--------------V----RSGQDD-EIK-------
A0A856MDH8      ---QVT------KSTNLNN-AYSS--------------V----RSGQDE-EIK-------
A0A1Y0RCK1      ---QIT------NTENLNN-AYSS--------------V----RSGQDE-EIK-------
A0A1Z4PWZ0      ---QIT------DSATLNK-AYSS--------------V----RSGQDD-EIK-------
A0A0C2QLT0      ---QIT------NTENLNK-AYSS--------------V----RSGQDD-EIK-------
A0A1Z4J2K1      ---QIT------DAGNLNK-AYSS--------------V----RSGQDD-EIK-------
A0A3S0ZSX0      ---QVT------DAKALDQ-AYAS--------------V----RGGQNE-ELK-------
A0A2N6K4T3      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
A0A370CKT2      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
A0A0S3TL97      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
A0A2N6M8A0      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
A0A2N6M9E1      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
A0A2N6KJI4      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
A0A2N6MZ77      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
A0A2N6KT20      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
G6FSN3          ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
A0A4D9CI02      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
A0A328I8B9      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
A0A4Q9J4Z7      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
A0A0M0SU69      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
A0A1Z4TIZ8      ---QVT------DAKALNQ-AYAA--------------V----RGGQDE-ELK-------
K9UYB2          ---RIT------DTSTLNN-AYTT--------------V----RGGQDD-ELK-------
A0A1Q4S1H4      ---QVT------NSSNLGN-AYAS--------------V----RSGQDE-QIK-------
A0A433VBU6      ---QVT------NSSNLGS-AYAS--------------V----RSGQDE-QIK-------
A0A218QN17      ---QIT------SAKSLDK-AYAS--------------V----RGGQDE-QLK-------
A0A846HD20      ---QIT------DAKSLDK-AYAS--------------V----RGGQDE-QLK-------
K9RKN2          ---QIT------NADSLNS-AYSS--------------V----RSGSDE-ELV-------
A0A2I8ADV2      ---QLT------ATKNINN-AYTS--------------V----RSGQDE-QLR-------
A0A5Q0GMF5      ---QVT------DAKNINT-AYAS--------------V----REGQDE-QLK-------
Q3MEW0          ---QVT------DAKNINT-AYAS--------------V----REGQDE-QLK-------
A0A1Z4KIC7      ---QVT------DAKNINT-AYAS--------------V----REGQDE-QLK-------
Q8YSM5          ---QVT------DAKNINT-AYAS--------------V----REGQDE-QLK-------
                                                                            

K9SLA9          ----QLLE--ELQAIEQQIALES----TRYGAEHPSIIDLRAQREALQVVLQGRVGEDLL
A0A168TT23      ----ELRS--RKAELETEISGLL----QRFMEDYPVIVELRSQINEIDTQIRERADTII-
A0A0M1JWX9      ----SQLS--KLRELENQIAKEL----TRFTINSPQIQTMLEQRQQLEGMLSQEAQRALG
A0A844MWN9      ----YVRQ--KLAEVEAVLVQQR----TTLTEDHPQIQNLVNQRNQLQRQLQQYIASTA-
A0A2T1M1V6      ----SIRD--KLSATEIELSESR----GIYTDKMPQVKSLLLKRDELRREANRQMAQVL-
A0A2G7GCS2      ----AIRQ--KLSDAETALAEAR----SRYTDESPQVQSLLSQRDELMQIMNQQIAIAA-
K9XBH8          ----ATRQ--QLSEVETALAEAR----SRYTDESPQVQSLLARRQQLMQTMNQQLAVAL-
A0A1Z4LJ30      ----LFRD--KLSEVEVALVEAR----GKLTNSHPQIQELVYQQRVLRSQLRQYLANTS-
Q7NF11          ----AMRL--KLSSLDTALAEAR----GLYTEKHARVQSLLVQREELQRSLRELLAKVV-
K9RI76          ----LIRD--KLSQIEVALIEAQ----GKLTSNHPEVQNLLYQRSVLRQQLNQFIAASR-
A0A433VN22      ----AVRK--ELSEVEAKLVQKQ----AIFTINHPEVQTLLAQRSTLRRQIGAYITQVA-
A0A139WSU3      ----FVRQ--QLSEVEASLRQKQ----AIFTDVHPEVKTLLAQRESLQRKIQEHIRQTS-
A0A844MJB7      ----FVRQ--QLSEVEASLRQKQ----AIFTDIHPEVKTLLAQRESLQRRLQERIRQTA-
A0A352AE27      ----FIRQ--KLTEVEAKLVEAK----ATYTMENPRVEGLVIQRDELQRQLQQYITQAA-
A0A3B8JH60      ----FVRNXXKLAEVNANLIRTR----ATFTDNHPTVQKLISERDDLQRQLQGYIAQSA-
A0A3C0N766      ----FVRN--KLAEVNANLIRTR----ATFTDNHPTVQKLISERDDLQRQLQGYIAQSA-
K9W9J7          ----FVRN--KLAEVDANLVKLR----ATFTDNHPAVRKLISERDELQRQLQGYVAQAA-
Q7NJN6          ----ALRQ--RLADIESQLAQAR----GLYTGKNLRVKSLELQREELLGKIKQQVGSIV-
U5QCC3          ----SLRQ--KLTDIETQLAQAR----GIYTEKNQRIQSLLLQREELLSKIKLQLSKLV-
A0A1Z4JCS8      ----ELRS--KLTEVESTLGKLR----STFTDRSPQVQRAIVERDTLRNQLQQYVG-QA-
A0A846GVZ3      ----FVRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLLQREQLQQQIQQYIF-LA-
A0A6P0PI80      ----FVRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLLQREQLQQQIQQYIF-LA-
A0A6P0WGT6      ----FVRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLLQREQLQQQIQQYIF-LA-
F4XTX2          ----FVRQ--QLTELEATLVKAQ----ATYTYAHPEIQNLLLQREQLQQQIQQYIF-LA-
A0A3S0Y9N9      ----LVLG--QLKETQQKIEMAR----LRLTDNHPTVINLKEQETVLKQELKRHIEQSF-
A0A6P0ZKB8      ----EVLG--KLQNLQQRIAVTS----LRLTDDHPTMIDLKKEEIILREELEERIEQSF-
A0A846EDH6      ----EVLG--KLQNLQQRIAVTS----LRLTDDHPTMIDLKKEEIILREELEERIEQSF-
A0A433UNK7      ----AVLG--QLQDVQQKIQVIG----LRLTDTHPTIMDLKKEEVILRQELKKRIEQSF-
B8HNB0          ----KLTT--RLQEVELSLAQQS----LTLQNNHPTIENLRAERADLLKLMRQRANGLL-
A0A318BJ18      ----QAIN--NLRQRRAELSAEYQRLMVQFEPGYPAALAIQNQIDQLDRSIAREESRV--
A0A3B8Y8H9      ----NLLE--KLREVDTKLAEES----TRFTEDNPTIKKLRQQRRNLVPLIEEEAQAIL-
A0A2W1JVB9      ----VVLQ--QLQEVEGQLAVEG----TRLTPENPILQDLQEQASTLRATLQNRVGEAL-
A0A6H1U102      ----QLAS--QLKAVEAKYMEER----ARFHDTHPVVKNLQMQRDNLFNLLQYRSARVL-
A0A7C3ZEJ3      ----QLAT--QLKEIEAKYTEES----SRFYDTHPVVQNLLRQRESMRQLLQYRSQRVL-
A0A2P8W9H0      ----ALLN--QLLEVDSQLAADL----TLYLENSPEIEVVESRRENLQPLIE--------
A0A6I5P386      ----SLLD--RLTEIDSRLAEEL----SLYLEGSPEIEVIRDYRDNLQPLIE--------
A0A3M1SVZ4      ----EARQ--QLQEAEAQLAVEK----TRLTENHPTIIDLQDKVATLRSMLQSRVGDVS-
A0A318BG22      ----ALTG--QLATLEADYQQKR----QTYKPGYAPMEALAAQIASVRGQIATLRGRIV-
A0A2T1E9V8      ----GVIK--ELQEVQRKLANAR----SLYKDDHPIIVQFKEKEAQLNILLNSETTRIL-
A0A1Z4LN32      ----EVLS--ELQKVQTELTTLK----TRMTNAHPSILDLQDKEAALNNLLQTRIMESV-
A0A2I8A9F5      ----DAFI--ELQKIQTQLKIQQ----TRYTDANPIVINLKNQEKALNSLLKQRITEYL-
A0A218Q6R8      ----EVLG--ELQKVQTNLAIQQ----TRYTDQNPHIANLKNQEAALASLLQQRITESL-
A0A218QGE0      ----GLLA--ELQKVETQLAALK----ARYTERHPAIVDLESQKANINSLLQQQISQSL-
A0A846HDH5      ----GLLA--ELQKVETQLAALK----ARYTETHPAVVDLESQEANINSLLQQQISQSL-
A0A3M2GQQ6      ----QLAS--ELKAVEAQYTLEA----SRFYETHPVVKNLAIQRDNLFRQLQQRSRRVL-
A0A6H1U2X0      ----QLAS--ELKAVEAQYTLEA----SRFYETHPVVKNLAIQRDNLFRQLQQRSRRVL-
K9TLQ0          ----DLLN--RFHEIETKLAQES----TRFTVQSPAMQVLIDERNSLLPLLQEEALLVL-
K9QF04          ----ALLE--KLQRVDAKIASES----VKLSDEHPSLIALREERQHLLSLIQQQVINLL-
K9W1T3          ----KLLS--NLQDIQEKLATER----TRFQEGHPVIEDLKSKEANLKALLQQQLQQTF-
K9SGJ5          ----NLVK--QFQEAETHYYLER----TRFQDDHPEVQVAKDRRDQLYKLMQVQAETVL-
A0A6N2JS94      ----SLVK--QFQEVETNYFLER----TRFRGDHPSVVALKDRRDELYRLLETRAQSVV-
A0A6C2DSN4      ----SLVK--QFQDVETNYFLER----TRFREDYPSVLALKDRRDELYRLLEARAQSVV-
L8MYT6          ----SLVK--QFQDVETNYFLER----TRFREDYPSVLALKDRRDELYRLLEARAQSVV-
A0A352JGJ6      ----SLVK--QFREVETNYFLER----TRFREDHPTVQALKDRRNELYKLLETRAQALV-
A0A1J5GLS2      ----SLVK--QFQEVETNYFLER----TRFREDHPNVLALKDRRDELYRLLETRAQSVV-
A0A2W4W6M5      ----SLVK--QFQDVETSYFLER----TRFREDHPNVQALKDRRDELYKLLETRAQSVV-
A0A2W7AN33      ----SLVK--QFQEVETNYFLEQ----TRFRGDHPSVIALKDRRDELYRLLETRAQSVV-
A0A256BLV2      ----SLVK--QFQEVETNYFLER----TRFREDHPTVIALKDRRDELYRLLETRAQSVV-
A0A2W6ZXF3      ----SLVR--QFQEVETNYFLER----TRFREDHPNVLALKDRRDELYRLLETRAQSVV-
A0A2Z5WX66      ----SLVK--QFQETETNYFLER----TRFREDHPTVKALKDRRDELYKLLETRAQSVV-
Q7NEU3          ----ENLT--QLQKVETQLALEQ----ARFRDDYPAVQSLKSKRDRLRQVLASQAQQIL-
A0A3C0N2P0      ----ALLN--QLSEVESKLAKES----ARLTEDHPTILKLREEQRRLKPLVDQEAATVM-
A0A6P0JR04      ----SLLN--QLQEIETQIALES----ARFTEQNPTLQALRDRKENLLPLIREEAIAVL-
A0A6B3M6M6      ----ELLN--QLAEVERQIAMES----ARFTAESPTIAALEEQRQNLLPLLNQEVAKVV-
A0A6P0KD09      ----ELLN--QLAEVERQIAMES----ARFTTDSPAIAALEEQRQNLLPLLNQEVAKVV-
A0A6B3NIJ0      ----ELLN--QLAEVERQIAMES----ARFTTDSPAIAALEEQRQNLLPLLNQEVAKVV-
A0A6M0F053      ----ELLN--QLAEVERQIAMES----ARFTTDSPAIAALEEQRQNLLPLLNQEVAKVV-
A0A6P2ATU9      ----NLLN--QLQDIETQLALES----ARFTAGNPTIVGLRAQREKLLPLIQAEAQAVL-
A0A845XAM4      ----GLLN--DLKDVETELALES----TRFSANHPEIARLRDRRDKLLPLVQVEAAKVL-
A0A352XE00      ----DLLN--KLSEVETKIAVES----ARFTEESPTIQALRDEQKNLLPLLEKEAGTAL-
A0A6P0QC14      ----ELLN--QLTELDTKIATES----ARFTEENPIVQRLLEERERLLPLIEKEASTVI-
B4VS56          ----QLLN--QLTEIESKIASES----ARFTEQSPTIQALREKQQNLLPLLSQEAGTVL-
A0A352AAQ3      ----QLLN--QLSEVESKIAAES----ARFTEDSPTIQALREKQQRLLPLIEAEAANVV-
A0A350Y472      ----DLLN--QLSEVESQIATEL----ARFKEENPAIETLREKKERLLPLIEEEAANVV-
A0A355DVB4      ----DLLN--QLSEVESQIATEL----ARFKEENPAIETLREKKERLLPLIEEEAANVV-
A0A1Z4RMB9      ----SILD--QLAQTESDLSKER----QRFNDAHPSVVSLNAKKNDLTQQLEGLVANAV-
A0A318B4H2      ----GTIA--SLRQKRAELSARYSALLTKFEPGYPEAEALRTEIMGLDKAIAQ-------
A0A2K3BR24      ----KVLT--EYQAVEQELTLKR----SRYQPEHPIIKRLEEQEATLANLLQERVNAVL-
K9YXY1          ----KVLT--EYQAVEQELTLNR----SRYQPEHPIIKRLEEQEATLANLLQERVNAVL-
A0A1Q4RTR1      ----QLLD--EFRSTQNKLAVER----IRFSDEHPTIIDLADKVQVLRQQLQQRIIQTL-
A0A1Z4SQV2      ----PLLN--EFRSSQDKLAVER----TRYSDEHPIIIDLANKIQVLRQQLQLRIVQIL-
A0A2H2XGN1      ----PLLN--EFRSSQDKLAVER----TRYSDEHPIIIDLANKIQVLRQQLQLRIVQIL-
A0A433UXH8      ----QLLN--EFRSSQDKLAMER----TRYSDEHPIVIDLANKVQVLRQQLELRVVQTL-
A0A1U7HGH0      ----GVLA--ELQTVQRQIADAR----SRYRDDHPILDSLQEREARFQQLLQTQTNQVL-
K9XJD3          ----GILT--ELQTVQRQITDAR----SRYRDDHPILDSLQEREARFKQLLQTQINQVL-
K9SX01          ----ETLS--DLQKIDSQLVTLR----ATYTDNYPTITVLMEQRAPIQKLLQQRIKETL-
A0A4P7ZT55      GAFSQLLA--DLTDVEKQLAEAS----GTFRSSSPLVRSLTAQRNKLRPLLQRR------
A0A1E5QIR9      ----KAIA--ELQAIENRLELER----SRFLDEAPIIIDLETKQARLRGVLERRIIEVL-
A0A6P1A9A0      ----ELLN--QLQQIETQIALES----ARLTEISPQMQRLQEQRANLLPLLQQEARAVL-
A0A1Z4IBC7      ----KVLA--ELQETQSKLAIER----TRFEPEHPAITALEEKVAVLEKLLKERTGEVA-
A0A5Q0GKD1      ----KVLA--ELQETESKLAVER----TRFESEHPAITSLEEKIVVLKNLLKDRTGQVA-
Q3MDC6          ----KVLA--ELQETESKLAVER----TRFESEHPAITSLEEKIVVLKNLLKDRTGQVA-
A0A1Z4KM73      ----KVLA--ELQEAESKLAVER----TRFEAEHPAITSLEEKIVVLKNLLKDRTGQVA-
Q8YNX7          ----KVLA--ELQEAESKLAVER----TRFEAEHPAITSLEEKIVVLKNLLKDRTGQVA-
A0A367R4K6      ----KVLA--QLQEAESQLALER----TRFQSGHPTIINLEGKVTALRSLLKERIEQVA-
A0A1E2WSV8      ----KVLI--QLQETESQLALER----TRFEPEHPTITNLEEKVTALKSLLKERVGQVA-
A0A7D7L9Y1      ----KVLI--QLQETESQLALER----TRFEPEHPTITNLEEKVTALKSLLKERVGQVA-
A0A2R5FRT9      ----KVLA--QLQETESQLALER----TRFSPEHPTITNLQEKVAALQSLLKERIGQFA-
A0A2K8T1B6      ----KVFA--QLQDTESQLALER----TRFSPEHPTITNLQEKVVALQSLLKERIGQFA-
A0A235I9I0      ----KVLA--ELQETESKLAIER----TRFSPEHPTITNLEEKVVALKNLLKERTGQVA-
A0A2D0HQT8      ----KVLA--QLQETESQLALER----TRFSPEHPTITNLEEKVLALKNLLKERTGQVA-
A0A2L2NU95      ----KVLA--QLQETESQLALER----TRFSPEHPTITSLEEKVAALNNLLKERTGQVA-
A0A367S084      ----KVLA--QLQETESQLALER----TRFSPEHPTITNLEEKVLALKNLLKERTGQVA-
A0A1Z4SMD6      ----EVLS--ELQKAQTQLAVQR----TRYTEDHPSITSLKNQEINLNNLLRSRIEQVL-
A0A2H2Y096      ----EVLS--ELQKAQTQLAVQR----TRYTEDHPSITSLKNQEINLNNLLRSRIEQVL-
K9S8M8          ----QALS--ELQQIEDELAVAR----TRYQEQHPTIAGLRRKQAALQSLVQERVGQVL-
A0A1Z4NFV0      ----DAIT--ELQKLQRQLANER----SRYTEFHPKILNLKQEIAQVQGLIQQRVNASS-
A0A3M9ZEU1      ----EVLS--QYQNVQSQLAIEQ----ARYRSSHPTVANLQRQADQLRTLLQERVQQAI-
A0A1Z4JK72      ----EALS--QLQQVQTRLVTEQ----ARFKSTTPQIQTLQQQEQDLNALLQSRVSEAV-
A0A0N7Z489      ----DVLS--QLQTVESRLVTES----SRFKDTTPQIQTLKQQRDDLNALLQARVSEAV-
A0A0S3TXS2      ----DVLA--QLQSVESRLVTEQ----ARFKDTTPQIQTLKQQRDDLNALLQTRVSDAV-
A0A2A2TPF8      ----EVLG--ELQKVQSKLATAQ----SRYTSTHPSIANLKEEEKALTNLLQQRVSQSV-
A0A1Z4R0P8      ----EVLS--ELQKVQTKLATEK----SRYNSTHPSVINLEEQEKALASLLQQRASQSV-
A0A0T7BUI3      ----EVLS--ELQKTQSRLALER----VKYTNNHPNVVYLENQEKTLKSLLNRRTQEIT-
A0A1Z4LP32      ----EVLT--ELQKVQTELAAER----ANYTQIHPLIRKLESQESALNALLQQRKSEAS-
K9REP9          ----EVLG--ELQKVQTQLASER----ANYTSAHPLIRKLENQATLLQSLLQQRKQEAS-
A0A1Z4SIJ3      ----DVLS--ELQKVETKLAAER----GRYTNQHPSIVYLKNQQAALKSILNERAGKAL-
A0A2H2XPG4      ----DVLS--ELQKVETKLAAER----GRYTNQHPSIVYLKNQQAALKSILNERAGKAL-
A0A2A2TC28      ----EVLG--EQQKVQAKLATLK----ARYTDEHPAIADLKSQELALNSLVKQRVEQSL-
K9V3C7          ----GTLA--ELQKVENNLAVAR----ARYTENSPIVMDLREQQATLKQLLQERVADSS-
A0A1Z4T6Y7      ----ESLG--ELQKIQSQLATEA----TTYTSNHPKIISLRQKEAALNNLLQQRASQSL-
A0A2H2Y561      ----ESLG--ELQKIQSQLATEA----TTYTSNHPKIISLRQKEAALNNLLQQRASQSL-
A0A1Q4S362      ----EALG--ELQKVQTQIATQR----ALYTSDNPIMITLREKEASLNKLLQQRASQSL-
A0A3S1CIN8      ----EALG--ELQKVQSQIATQQ----ALYTSDNPIMITLREKEASLSQLLQQRASQSL-
A0A0C1NCB0      ----DVLT--ELQKVQTKLANER----ARYTEKHPSVVNLENEEVTLKALLKQRVGETA-
A0A844MLU2      ----DVLT--ELQKVQTKLANER----ARYTEKHPSVVNLQEQEVTLSTLLQRRIGETA-
A0A2N6K7Q9      ----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-
A0A2N6MXH6      ----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-
A0A2N6M5A8      ----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-
A0A2N6LL61      ----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-
A0A0S3TP66      ----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-
G6FP91          ----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-
A0A1U7GYR5      ----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-
A0A2N6KY52      ----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-
A0A2N6KMP5      ----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-
A0A2N6MA45      ----EVLT--ELQKVQTKLANAR----AIYTEVHPTITDLKNQQATLNSLLQQRTQEYS-
A0A4Q9J9V9      ----EVLT--ELQKVQTKLANAR----AIYTEKNPIIIDLKNQQSTLNSLLQQRTQQYS-
A0A328IGA1      ----EVLT--ELQKVQTKLANAR----AIYTERNPIIIDLKNQQSTLNSLLQQRTQQYS-
A0A4D9CE41      ----EVLT--ELQKVQTKLANAR----AIYTERNPIIIDLKNQQATLNSLLQQRTQQYS-
A0A0M0SFT2      ----EVLT--ELQKVQTKLANAR----AIYTEQHPIITDLKNQQATLNALLQQRTQQYS-
A0A1Z4TLC8      ----EVLT--ELQKIQTKLANAR----AIYTEQHPTITDLKNQQATLNSLLQQRTQQYS-
A0A1Z4IYV4      ----EVLS--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL-
A0A1Z4Q0T6      ----EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL-
A0A0C2PT44      ----EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL-
A0A1D2P6J4      ----EVLG--ELQKVQTKLANEK----ARYTSEHPDIAELKNQEVTLNALLQQRIEQVL-
A0A0C2LFH0      ----EVLT--ELQKVQTKLANER----ARYTSEHPAITELKNKEITLNALLQQRVEQVL-
A0A856M734      ----EVLS--ELQKVQTKLANDE----ARYTSDHPAITELKNKEITLNALLQQRVEQVL-
B4WP72          ----EVLT--ELQAVQSQLAIEQ----ARYQSTHPAVLNLQRQVNSLESLLRQRIRTVT-
A0A2T1CIL7      ----QLIS--ELQQVRIDLIEQR----DRFSDNAPQVNSLVKREVELEALLENQIEQIQ-
A0A433V7A0      ----DILK--KIQQVQSELAVQQ----TRLSNDHPSINNLKKQETALKSLLEDRVKAVV-
A0A2T1FTR8      ----KSLK--ELQEVEAKIATER----TRFSDNDPSILNLKEKRQALVEILQKRFKQSL-
K9UA41          ----KSLK--ELQEVEAKIATER----TRFSDNDPSILNLKEKRQALVEILQKRFKQSL-
A0A563VS48      ----TIYE--RLQQVKVELASTR----NYLSNNAPQVISLQEEAAELEQVLNQEIAQTL-
A0A7Y0NUK1      ----TIFE--RLQQSKVELAQRR----NYLSDNTPQVISLKEEIVELEKLLNQEIEKTL-
A0A0C2LBE2      ----QVLT--QLQEAQSQLAVER----SRLKPEHPIIVNLEEKVAALNSVLQQRMKQVT-
A0A433NN38      ----QLLS--QLQKTQADLEVAR----TRFQPEHPQIVNLEEQISALSQVLQQRVEQVA-
A0A2N6K0T2      ----KVLT--ELQEAQSQLTVAR----TRYQPGHPTVIDLEEKVAALRNLLQERVGQVA-
A0A2N6ML72      ----KVLT--ELQEAQSELTVAR----TRYQPGHPTVVNLEEKVSALRSLLQQRVQQVG-
G6FQZ6          ----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG-
A0A2N6MQX9      ----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG-
A0A2N6KXT6      ----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG-
A0A2N6KGB9      ----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRIQQVG-
A0A2N6L3Y5      ----KVLT--ELQEAQSELTVAR----TRYQPGHPTVVNLEEKVSALRSLLQQRIQQVG-
A0A0S3TIS7      ----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRVEQVG-
A0A1U7GW28      ----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRVEQVG-
A0A2N6LW63      ----KVLT--ELQEAQSELTVAR----TRYQPGHPTVANLEEKVSALRSLLQQRVEQVG-
A0A328IH74      ----EVIK--ELQEAQTELAVAR----TRYLPGHPTVSQLAEKVSALKNLLQQRVEQVG-
A0A4D9CIB0      ----EVIK--QLQEAQTELAVAR----TRYLPGHPTVSQLAEKVSALKNLLQQRVEQVG-
A0A1Z4TQ63      ----QVLK--ELQEAQTELTVAR----TRYLPGHPTVSNLEEKVSALKSLLQQRVEQVG-
A0A4Q9J8G2      ----EVIK--ELQEAQTDLAVAR----TRYLPGHPTVSQLEEKVSALKNLLRQRVEQVG-
A0A350Y0P6      ----QALI--ELEQVQEQLNIEG----TRFQNEAPIIVSLKEKEAARQRLLNQRVEQVI-
A0A352X940      ----QILV--DIEQIEAQLTVQR----TRYQEEHPIIQNLKRREDAQKSLLQERISKVL-
B8HTN4          ----VVLD--QYQQVEAELAVAR----TELQPDHPKIKTLEEQLTELNTILRERVRDVA-
A0A6P1AFJ5      ----ELLD--RLQQIEQQIALES----ARFTEISPLIQKLQEQKQNLLPLLAAEARAVL-
B0CAX4          ----QALA--DYQENERELAEAL----KVFQPTHPTVLDLKEKRIALKGVLGEQTSQII-
A0A1Z4RN12      ----RALS--QLQDVKVALAQKQ----AFLSNNAPQIVSLKQEEADLTSLLEQQIASTL-
A0A2T1CMF9      ----ETLA--QLQKIKVELAQKS----NVLSDSSPQIISLKEEQADLEDLLRQEVAGTL-
Q7NDC5          ----DLRK--TLLEIESKLAVAR----AQYQDSYPEVEQLIKRRGALRALLASEADRLL-
U5QGK3          ----ELRK--DLVEVESKLALAR----AQYQDNYPDVDRLIKQRNALRALLKTEAGRLL-
A0A2W4UY24      ----EVIT--TLQAVQSQLAIAL----TRYREGHPEIASLRSQEVALLTLLQTRVGLAL-
A0A838VM23      ----KVLE--SLQQAESDLALKR----SLFQEAHPLIQDLKHQTQILQVLLRERIAQSL-
A0A0D8ZUV2      ----KLLE--ESQQLEDRLATER----TRLQEDHPTIVNLKLRQAALKALLDKRV-----
A0A433VDI0      ----KTLE--ELRQVEDQLVVQR----TRLQEDHPAIVNLELKKNAFKAQLQGLVK----
A0A3D1PG43      ----KVVA--ELQQVEADLVVLQ----TRFLDGHPKIAELQNKKAALKALLQQRITQTL-
A0A2P8QQ72      ----KTLA--ELQRVEGDLVVLQ----TRFEDTYPEVQKLQQKRNALKQLLEGRIGQML-
K9TZQ7          ----KTLA--ELQRVEGDLVVLQ----TRFEDTYPEVQKLQQKRNALKQLLEGRIGQML-
A0A6N8G584      ----KVLT--EYQQVEAELAVQQ----TRFIGDHPTILGLTERRDALRALLEERVQGAI-
A0A2G7GPR0      ----KVLT--EYQQVEAELAVQQ----TRFVGEHPTILGLQERRDALRALLEERVQGAI-
K9XH68          ----KVLA--EYQQVEAELAVQQ----TRFVGDHPTLLSLTERRDALRALLEERVQGAI-
A0A1U7HW70      ----KVLA--EYQQVEAELAVQQ----TRFVGDHPTLLGLTERRDALRALLEERVQGAI-
A0A2S6VEJ8      ----KVLQ--EYQQVEAELAVQQ----TRFVGDHPTILSLTERRDALRALLEERVQGAI-
A0A140KBA0      ----KALT--QLQNVKVELASKR----NLFGENAPQIISLKEQEAELTALLEQQIRQTL-
K9XSG1          ----KALT--QLQDVKVQLATKR----NLFGENAPQIISLKEQEAELTALLEQQIQQTL-
A0A2T1GMT4      ----GILT--QLQDVDRQLATES----SRFSDDNPIIVSLKEKQSKLKTLLSQQIRNTI-
K9UI51          ----GILT--QLQDVDRQLATES----SRFSDDNPIIVGLKEKQSKLKALLEQQIRSTI-
A0A1Z4QL41      ----AILT--QLQEIDRQLAVER----SRFLDENPVIINLEAKRFNLKNLLQKQIEQTI-
K9TYI2          ----GVLT--QLQDTERQLASQR----SRYLNDNPIIVDLEAKKYNLEALLQKQIKQTV-
A0A252D4T4      ----GILT--QIQEVDRQLATER----SRFQEENPVIVNLVARRANLQALLKQEVGQNG-
A0A252DJH5      ----GILT--QIQEVDRQLATER----SRFQEENPVIVNLVARRANLQALLKQEVGQNG-
A0A252EB80      ----AILT--QLQEVDRQLATER----SRFQDENPVIVNLVAKKANLQALLKQEVGQNG-
A0A6G9SKZ9      ----GIVT--QLQDIDRQLATER----SRFLDDNPVIINLEQRKANLQALLNKELKQTG-
A0A1Z4HPW5      ----GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQRKANLQALLKKEIGQTD-
A0A1Z4MSN1      ----GILT--QLQDIDRQLASER----SRFLDDNPVIVNLEQRKANLQALLKKEIGQTG-
A0A1Z4U1C2      ----GILT--QLQDIDRQLASER----SRFLDDNPVIVNLEQRKANLQALLKKEIGQTG-
A0A0D6KV51      ----GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQRKTNLQALLKQEIGQTG-
A0A1Z4MKF8      ----GILT--QLQDIDRQLASER----SRFLDDNPVIINLEQRKTNLQALLKQEIGQTG-
A0A2C6WC43      ----GILT--QLQDIERQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTV-
A0A841WRE0      ----GILT--QLQDIERQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTV-
A0A1Z4L5A1      ----GILT--QLQDIERQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTV-
A0A367QD86      ----GILT--QLQDIDRQLASER----SRFQDDNPAIINLEAKKANLRALLQQQISQTI-
A0A2K8SM78      ----GVLT--QLQDTDRQLAIER----SRFLDDNPVIINLEAKKASLKSLLQQQIGQTV-
A0A2R5FPC0      ----GVLA--QLQDTDRQLAIER----SRFLDDNPVIINLQAKKASLQSLLQQQIGQTV-
A0A5P8W5T6      ----GVLT--QLQDTDRQLAVER----SRFLDDNPVIINLEAKKASLKSLLQQQIGQTV-
A0A7D7LDT7      ----GVLT--QLQETDRQLAVER----SRFLDDNPIIINLEARKASLNSLLQQQIGQTI-
A0A235IZ96      ----GVLV--QLQETDRQLAIER----SRFLDDNPVIINLEAKKANLKSLLQQQIGQTI-
A0A2L2NGP0      ----GVLV--QLQETDRQLAIEH----SRFLDDNPVIINLEAKKANLKSLLQQQIGQTI-
K9QM62          ----GALT--QYQDIERQLATER----SRFSEAHPTIVNLEARKSNLKTLLQQQINQTL-
A0A1Z4FWI3      ----GIVT--QLQDVERQLATER----SRFQDENPVIINLEAKKANLKALLQQEIGQAG-
A0A1Z4JYE7      ----GILS--QLQELERQLANER----SRFTDDNPIIVSLEAKKDNLNNLLQLQIAKTV-
A0A0F5YE28      ----GILT--ELENVESELVNER----KRFKDQNPRIIALKQKRDSLNAALQEQVEQVL-
U7QEH7          ----GILT--ELENVESELVNER----KRFKDQNPRIIALNQKRDSLNAALQEQVEQTL-
A0A3S1ATK5      ----EIVI--QLHEIERQLATER----SRYFDNNPVIISLEAKKANLNNLLQTQIKATI-
A0A2Z6CPH0      ----GVLT--QLQDVERQLANER----SRFLDDNPVIVGLEARKANLTNLLQQQITQTL-
A0A1Z4GT50      ----GILA--QLQDLERQLATER----SRFYDDNPVITNLEAKKTTLQTLLQKQIEQIV-
A0A1Z4GIX0      ----GVLT--QLQEVERQLANER----SRFLDDNPIIVSLEARKANLTALLQQQVGQTL-
A0A2H6LC24      ----GVLT--QLQEVERQLANER----SRFLDDNPIIVSLEARKANLTALLQQQVGQTL-
B2J6N5          ----GVLT--QLQETERQLAIER----SRFLDDNPVIINLEAKKASLKSLLQQQIGQTV-
A0A367RMI4      ----GILT--QLQETDRQLAVER----SRFLDDNPIIINLEAKKANLKSLLQQQVGQTV-
A0A235HUM0      ----GILT--QLQETDRQLAVER----SRFLDDNPIIINLEAKKTNLKSLLQQQVGQTV-
A0A2L2NW47      ----GILT--QLQETDRQLAVER----SRFLDDNPIIINLEAKKANLKSLLQQQVGQTI-
A0A1E2WUR1      ----GVLT--QLQETDRQLAVER----SRFLDDNPVIINLEARKASLNSLLQQQIGQTI-
A0A235IKU3      ----GVLV--QLQETDRQLAIER----SRFLDDNPVIINLEAKKANLKSLLQQQIGQTI-
A0A1U7MYU6      ----GVLQ--ELQEVERQLAVGN----NRYGKNHPVMIRLTKQQSSLRGHLQQQIDQIL-
A0A1D8TNX9      ----GVLQ--ELQEVERQLAVGR----NRYGKNHPIMIRLTKQQRSLTGHLQQQINQIL-
A0A6P0L6C2      ----GVLQ--ELQEVERQLAVGK----NRYGKNHPVMIRLTKQQRSLRGHLQQQINQIL-
A0A6P0MVH0      ----GVLQ--ELQEVERQLAVGR----NRYGKNHPVMIRLSKQQRSLRGHLQQQINQIL-
A0A6P0KJV0      ----GVLQ--ELQEVERQLAVGR----NRYGKNHPVMVRLTKQQRSLRGHLQQQIDQIL-
A0A6L9ZJG4      ----GVLQ--ELQEVERQLAVGK----NRYGKNHPVMIRLTKQQRSLRGHLQQQINQIL-
A0A846GI17      ----GVLQ--ELQEVERQLAVGR----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL-
F4XKF3          ----GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL-
A0A1D9FX10      ----GVLQ--ELQEVERQLAVSK----NRYGKNHPVMIRLTKQQRSLRGHLQQQIDQIL-
A0A6P0Q0T0      ----GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL-
A0A6P0W5I0      ----GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL-
A0A845XJ02      ----GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL-
A0A846D190      ----GVLQ--ELQEVERQLAVSK----NRYGKNHPIMIRLTKQQRSLRGHLQQQINQIL-
A0A3C0NJ41      ----EVLK--QYQDIQAQLTLQR----TRFLDDSPVIVSLKEKEASLKSLLQDRVSQTV-
A0A352AG88      ----QVLQ--EFQQVQSKLRVEQ----TRFQDEDPTIISLKEREAALRNLLQERVVQTI-
A0A350Y374      ----DILK--EFQKVQADLTIQR----TRFQEADPTIISLKQKEAALKSLLEERVGQTI-
A0A355DPX0      ----DILK--EFQTVQADLTIQR----TRFQEADPTIISLKQKEAALKSLLEERVGQTI-
A0A0S3TYD7      ----ETLK--RSQELQNQLAVTL----GRYRAGHPKVTELQRQVSELQELLQQRVATVV-
A0A2T1DNG3      ----AVLN--EIQKTELAIQQQR----VRFKENTLNMQPLLDQRQRQLKQLQLEASRLL-
A0A140K3H3      ----SLAS--QLKELETQYALGS----VNFYDSYHVMEDIKLKQAELRTLMQERSQQILG
K9XUB8          ----NLTS--RLKELESQYGLGS----VNFHDSYHVMEEFKLKQVELRKLMKERAQQILG
A0A563VLD6      ----KLAT--QLSGLETQYLLNS----TNFKDTFPIMQDLKDKGQELQELLRERATQVLG
A0A7Y0NVW6      ----NLAA--QLSDLETQYLLQS----TDYKDTFPIMQDLKNKQNELNKQLKDRAKQVLG
U5QL42          ----RLVS--KYKDAEADYVSQR----AKFKDAYKPVGDLKKQRDIYLRLLQEQATSVLG
A0A6H2NHD5      ----RLLS--DLRQVEQSIASEL----ARFQADTPMVEALEDQRQQLLPLLETEANRVLA
A0A2P8W4F7      ----ALLG--DLRELEQTIAAES----ARFQTDTPMIEALEDQRQQLLPLLEAEAQRLVG
A0A5Q4E0Z4      ----SLLG--DLRAIEQTIAAES----ARFQSDTPMIGALEDQRQQLLPLLAAEAQRLVG
A0A2P8VVX1      ----SLLN--SLQEAELALADRQ----ILFTDEDPNVQVLKQQRENQLAQLRAEISAISR
A0A2P8WHY0      ----QLLN--DIQESELALADRQ----LIFTDQDATVQMLRQELDNNRKQLRQEIAAAIR
A0A563VQJ3      ----STLT--ELSDTEAAIAKER----QRFKDNHPSIVSLQEKKANLRQQLEQSIAETVG
A0A7Y0IRJ7      ----STLT--ELANTEAALAKER----QRFNDNHPSIASLNEKKANLRRQLEQSVASTVG
A0A2T1CMT9      ----NLLN--NLKQMEQDLATQQ----TKFTNYNPALKSAIEEKKILQDLLSEEAERILG
A0A7G8J1V5      ----GLLE--QLAQVENELAEAR----AKFNPNSSMVTSLEERLNQLKPLLRS-------
A0A354B169      ----SLLQ--LLLKVESELAAAR----SKYKPSSSMVQGIEARQRQLQPMLLR-------
Q0IDT5          ----SLLQ--QLLKVETELAEAR----SKFVNNSSMVLSLEARLEQLQPLLRE-------
A0A7G8FZD9      ----SLLQ--QLLKVETELAEAR----STYLPSSSMVMGLEERINQLKPLLLK-------
G4FMX5          ----SLLQ--QLLKVETELAEAR----STYKPNSSMVTGLEERINQLKPLLLR-------
A3ZA21          ----SLLQ--QLLKVETELAEAR----AKYNPNSSMVLSLEARLNQLQPLLRQ-------
A0A076HBF2      ----SLLQ--QLLKVETELAEAR----SRYNPGSSMVLGLEERLNQLRPLLRQ-------
A0A7G8FP50      ----SLLQ--QLLKVETELAGAR----SRYTPGSSMVQGLEERLKQLRPLLRQ-------
A0A7G8E8K7      ----SLLQ--QLLKVETELAEAR----SRYTPGSSMVRGLEERLNQLRPLLRQ-------
A0A7G8GNR2      ----SLLQ--QLLKVETELAEAR----SRYNPGSSMVLGLEERLNQLRPLLRQ-------
A0A7G8ICD3      ----SLLQ--QLLKVETELAEAR----SRYNPGSSMVIGLEERLNQLRPLLRQ-------
A0A2D6FCW3      ----SLLQ--QLLKVETELAEAR----AKYNPDSSMVRGLEARLNQLQPLLRK-------
A0A7G7KJ95      ----SLLQ--QLLKVETELAEAR----SKYNPDSSMVQGLEARLNQLKPLLRK-------
A0A7G8EAN3      ----SLLQ--QLLKVETELAEAR----SKYNPDSSMVQGLEARLNQLKPLLRK-------
A0A1D8TX52      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A1D9G4T2      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A6P0PR27      ----NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVLG
A0A6P0WER7      ----NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVLG
A0A845XM36      ----NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVLG
A0A846DAT1      ----NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVLG
A0A846GZK8      ----NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVLG
F4XP71          ----NLLN--EIQRIELALVEQS----RIYTEAHPRIQKLIEQRQSVFALLQEETRRVLG
A0A6P0KZ31      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A6P0LPB8      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A6L9YR57      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A845WMG9      ----NLLN--EIQRIELALVEQS----RIYTEAHPIIQKLIEQRQSVFALLQEETRRVLG
A0A6P0SEV1      ----NLLN--EIQRIELALVEQS----RIYTEAHPTIQKLIEQRQSVFALLQEETRRVLG
A0A6B3N2I8      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A6M0B891      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A6P0IJQ1      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A6P0J8J8      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A6P0ZSH6      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A845VS63      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A1U7N5X9      ----NLLN--EIQRIELALVEQS----RIYTEAHPTIQKLIEQRQSVFALLQEETRRVLG
A0A6L9Z1V0      ----NLLN--EIQRIELALVEQS----RIYTEAHPTIQKLIEQRQSVFALLQEETRRVLG
A0A6P0LC12      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A6P0MVJ3      ----NLLN--EIQRIELALVEQS----RIYTEAHPSIQKLIEQRQSVFALLQEETRRVLG
A0A2W6ZAV2      ----SLLG--DLTDLEKQLAEAE----ASFSPTSPQVRSLRSRVNQLRPLLQRR------
K9W742          ----SLLD--EIQKTDLALAEQR----KRFTDDNPTIQKLLFQRQQQLALLEKEGERAVG
A0A3D1PBA3      ----TLLN--ELQKTELALSQRR----VTFTDEDPQVKKLLEQRQNTIEMLKSEGGRVVG
K9XPB0          ----SLLN--KLQQIEIELADKQ----ARFTDDNPVVKDLLAQKNTQTTLLLQEVKKILG
A0A350Y7Z1      ----ALLN--ELQKTELAIAQQR----VKFTDAEPRVEQLLEQRQRQLALLQEEAQRVLG
A0A352X2A7      ----SLLD--ELQKTELALAERR----TRFTDADPSVQKLMEQQSRQYRMLQEEGERVLG
A0A0D8ZYV0      ----SLLN--ELQRTDLLLAARR----GTFTDADPGVQKLIELRQSQQALLQAEQARVVG
A0A433VMS2      ----TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVLG
K9TYA7          ----TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVLG
A0A2P8QUE1      ----TLLN--ELQRTELALSQRR----VVFTDEDPNVKKLLEQRQNLLSMMKQEGGRVLG
K9SA61          ----ALLN--EIQKTEIELAQQR----LRFKDASPYVQQVIDKRQRQLALLQQEAQRVLS
A0A2G7GMH8      ----NLLN--EIQKTELALAQQR----LRYTDSSPQVELLLSQRDTQRELLQQEMQTVVG
A0A6N8FU92      ----NLLN--EIQKTELALAQER----LRYNDSSPQVELLIEQREKQHQLVQEEMQRVLG
A0A2T1DWE8      ----SLLN--EIQKSELAIAQQR----LRFKAASPYVQQAIDQRQRQRDLLAAEVQRILG
A0A832H7C4      ----ALLN--EIQKTELLLTQTR----TRYTDESPLVKKIVQRLNDQRAMLKQEAERVLG
A0A1U7I8L3      ----TLLS--EIQKIELELAKER----QRFTDSNPVIQNLLEQRQSQLALLQKEQQLVQG
A0A2T1DJL8      ----ALLN--EIQKTEVAIVQQR----LRFK-KGPFIDQLSEQRQKQQALLQQEVQRILG
A0A1Z4J9W0      ----ALLA--EIQKTEVELAQMQ----TKFTSNTPQVQQLAEQRQRQVSLLQQEAQRILG
A0A0N7Z5K9      ----ALLA--EIQKTEVALAQQQ----TRFTSKTPFVQQLLDQRQRQVALLQQEAQRVLG
A0A0S3TXC5      ----ALLA--EIQKTEVALAQQQ----TRFTAKTPFVQQLLDQRERQVALLQQEAQRVLG
A0A846FBD3      ----AALS--ELQTAQSQLDVER----TRYKSGHPTIANLERRVVALNGTLQRQIVQVL-
K1XF69          ----AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL-
B5W297          ----AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL-
H1W7M8          ----AALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLENLLQREIQVYL-
A0A5Q4H6A5      ----SALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLESLLQREIQVYL-
D5A466          ----SALQ--ELENVEGELAQEQ----RRFRDENPRIISLKGKRDNLESLLQREIQVYL-
B4WQE3          ----SLLD--QLLVVDSELADNL----TVYVEDSPEVEVIEERRANLEPLLE--------
U5QJM6          ----DVLK--QYQDTETQLALEK----TRFRDDYPTVQNLKDKRDSLQKRLNEQAGVLL-
A0A0V7ZFJ4      ----EALT--QYQKVQDELAVAQ----TQFTSEHPMVISLLGKEQALRNQLGKRVGQLI-
A0A235IXQ2      ----QVLS--EYQKVQDQLTVER----SRFTDEHPVITNLLSKEQALKEQLKGRVSQTL-
A0A367RIS1      ----EVLS--EYQKVQDLLAVER----SRFTDGHPVITSLLSKEQALKEQLERRVTQTL-
A0A841V8H9      ----EVLS--QYQKVQDELAVER----SRFTDGHPVITSLLSKEEALKKQLEGRVTQTL-
A0A5Q0GJJ5      ----QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKEQLEGRVSKTL-
Q3MEB7          ----QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKEQLEGRVSKTL-
A0A1Z4KHN9      ----QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKAQLEGRVSKTL-
Q8YT70          ----QVLS--EYQKVQDQLAVER----SRFTEEHPVIANLLNKEQALKAQLEGRVSKTL-
A0A7U3NLX2      ----QVLS--EYQQVQDQLAVER----SRLTEQHPTVVNLLEKEQALRAQLEARVTQTL-
A0A166IWU6      ----QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNKEQALKEQLEGRITQTL-
A0A2S0Q8C0      ----QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNKEQALKEQLEGRITQTL-
W6FSX4          ----QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNKEQALKEQLEGRITQTL-
A0A218Q4C1      ----QVLL--EYQKVQDQLAVER----SRLTDEHPVVVNLLNEEEALRIQLEGRVTQTL-
A0A6P1ZT04      ----QVLS--EYQKVQDQLAVER----SRLTDEHPVVVNLLNEEEALRIQLEGRVTQTL-
A0A0V7ZNJ9      ----QALQ--EYQKVQDRLAVAR----TRLTNQHPTVIDLSNKERALRNQLEKRVGQVV-
A0A5P8VSD1      ----QVLL--EYHKVQDLLAVER----SRLTDEHPVITSLLNKEQALRKQLEARVSQTL-
A0A1S1ZVW2      ----QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQSI-
A0A0R0M9H9      ----QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL-
A0A7H0F4U6      ----QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL-
A0A7W2A1T7      ----QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL-
A0A838WI98      ----QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL-
A0A853MJX6      ----QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL-
A0A1B7WX82      ----QVLT--EYQKTQYDLAIAR----TLYTNDNPKVVDLIMKEASLKTVLKERVAQTV-
A0A1B7WTD1      ----QVLT--EYQKTQHELAIAR----TLYTNDNPKVVDLLLKEAAQKKELEARVTETV-
A0A480ABC0      ----QVLT--EYQKTQHDLAIAR----TLYTNDNPKVVDLLLKEAAQKKELEARVTETV-
A0A1Z4LRU5      ----QVLT--EFQKTQKELAVAR----TKLTDQHPTVINLSKKLEALKNQLEGKVGQIV-
A0A1Z4JVB4      ----SVLK--EYQKAEDDLAVAK----TRYTNDNPTIINLEQKAQALRSQLEGRVSQTI-
K9PIA4          ----QVLT--EYQKVQDELAVAR----TRYTNNNPNILNLVEKEAALRNQVEGRVAQSL-
A0A1Z4HVE1      ----QVLT--DYQKTQDELAVAR----TRFSDEHPLVINLDKKATALRSQLEGRVSKIV-
A0A252ECZ1      ----QVLT--DYQKTEDELAVAR----TRFSDEHPTVINLDKKAAALRSQLEGRVSQTI-
A0A1Z4G5Y1      ----QVLT--EYQKAEDELAVAR----TRFSEEHPIVINLAQKAAALRSQLEGRVSQTI-
A0A252DNA2      ----QVLE--EYQKAEDELAVAR----TRFSEEHPIVINLDKKAAALRSQLEGRVSQTI-
A0A252E1Q4      ----QVLE--EYQKAEDELAVAR----TRFSEEHPIVINLDKKAAALRSQLEGRVSQTI-
A0A6G9SK36      ----QVLT--EYQKVQDELAVAQ----TRFTEDNPTIINLERKEIALRKQLEGRVAQTI-
A0A1Z4M597      ----QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLENQAVALKNQLEGRVAQTI-
A0A1Z4MWT1      ----QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLENQEVALRNQLEGRVAQTI-
A0A1Z4TX53      ----QVLT--EYQKVQDELAVAR----TRLTEDNPKIINLENQEVALRNQLEGRVAQTI-
A0A2A2TNQ5      ----QVLA--EYQKVQDDLAVAR----SRFTEEHPSVRNLVAKEQAFRQQMEKRVGRVI-
A0A3S1C4K5      ----QVLA--EYQKAQDELAVLQ----TRFTAEHPKVRDSEAKVQALREQLEKRVGKIV-
A0A1X4G3D5      ----EVLK--EYQKNEQELAVAQ----TTYTNDNPKVVSLTAKGQVLKKQLQERIYQSV-
D4TNI2          ----EVLK--EYQKNEQELAVAQ----TTYTNDNPKVVSLTAKGQVLKKQLQERIYQSV-
A0A1Z4H6Z8      ----QVLK--EYQKAEDEVAVAR----TRLTDDNPTLINLEQKQAALRNQLEGRVAQTI-
A0A3F3KPR9      ----QVLT--EYQKTQQELAIAE----TTYTSDNPKVVNLQLKEQALKKQLQERVSQTL-
A0A1Z4NPM1      ----QVLA--EYQKTQDELAVAK----TRLTNDHPTVINLTEKVNALRSQLEQRVGKVI-
A0A1Z4UZW9      ----QVLT--EYQKTQSELAIAR----SLYTNDNPKVVDLVMKEASLKNVLKERVAQTV-
A0A1B7VSH4      ----QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVMKEASLKKLLEERVGQTV-
A0A1B7W126      ----QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVMKEASLKKLLEERVGQTV-
A0A3D4C6Q6      ----QVLT--EYQKTQSELAVAR----TLYTDDNPKVVDLVMKEASLKKLLEERVGQTV-
A0A0K2M5H0      ----QVLT--EYQKTQSELAVAR----SLYTGDNPKVVDLVMKEASLKNVLEQRVSQTV-
A0A844I4P0      ----QVLT--EYQKTQSELAVAR----SLYTGDNPKVVDLAMKETSLKKLLEERVGQTV-
A0A1B7UVJ4      ----QVLT--EYQKTQYDLAIAR----TLYTNDNPKVVDLIMKEASLKTVLKERVAQTV-
A0A1B7UTR1      ----QVLT--EYQKTQYDLAKAR----TLYTSDNPKVVNLVMQEASLKDLLEKRVAQTI-
K7W0A4          ----QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLVLKEASLKKLLEERVTQTI-
A0A5C0DRW9      ----QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLLMQEASLKDLLEKRVAQTI-
A0A6H2C088      ----QVLT--EYQKTQYDLATAR----TLYTSDNPKVVNLVMQEASLKDLLEKRVAQTI-
A0A1Z4RPC6      ----SILD--QLATTETELAQER----QRFNDNHPTVISLNDKKQALNSQLQQLITQYV-
A0A2T1CMZ0      ----SILD--QLSTTETELSQER----QRFKDNHPAVISLQEKKQNLNSQLQGLISQYV-
L8M4F7          ----SIID--EMTRTENQLIQER----RRFKEDHPNIVSLQGKKAALNRQLQSLMSQTI-
A0A140K2P2      ----GLLK--EMATVESELAKEK----QRFLDNHPSIQSLEEKKASLNKELKDLISQNV-
K9XWX4          ----GLLK--EMATVESELAKER----QRFLDNHPSIKSLEEKKASLNQELKNLISQNV-
A0A140KB14      ----SIFK--DLADVETELAQQR----QRFRDNHPMIQSLLEKKQDLNQKLQGLITETV-
K9XX88          ----SIFK--DLADVETELAQQR----QRFRDNHPMVQSLLEKRQDLNQKLEGLITETV-
L8LZE9          ----SIVT--ELGNTESQLSQER----QRFNDNHPEIVSLLDTKASLRRELQQQIAQKV-
A0A563VSV6      ----SILT--ELGNTEIELAQER----QRFKDSHPSISSLLEKKANLRQDIEQQVAQAV-
A0A7Y0IQB0      ----SVLT--ELTNTETELAKER----QRFKDSHPSIASLLEKKADLRQNLEQQIAQAV-
A0A433NM31      ----KALA--DYQEVESKLANER----SRYQENTPVIADLKLKQASLREVLEKRVQQVF-
A0A1Z4NDS1      ----KVLS--QLQEVQSQLALQQ----TRFHPEHPSIQDLQARVATLQNLLQQRINQVD-
U9VXM0          ----NALE--QLQTVQSDLALAR----TRYREEHPEIVTLRNQESSLQALLQQRLDITL-
A0A6M0RI13      ----TVLA--QLQTVQSDLTLAR----TRYRDEHPEIITLRNQEAGLQALLQERLDVTL-
A0A6M0S1N5      ----TVLA--QLQTVQSDLTLAR----TRYRDEHPEIITLRNQEAGLQALLQERLDVTL-
K9F4D9          ----TVLE--QLQTVQSDLTLAR----TRYRDEHPEIITLRNQEAGLQALLQERLDVTL-
A0A6I5QPI5      ----EALS--QLQQVQTQLSNER----ARYREGHPAIERLELQQAEIEALLSDRIQEVL-
A0A1Z3HMQ0      ----RILE--DLQAVQTELASQR----SRYTASHPLIANLEREQASLQTLLNRRVGEVL-
A0A433W533      ----RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV-
A0A2P8QWJ3      ----RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV-
K9U6L7          ----RVLT--EYQKTEAELAQLR----TRYAETYPGISNLKQKRTALKALLSQRISQAV-
U5DPF5          ----DALE--SYQSIESELAVAE----SRYQPQHPAIVSLVESRDALRQVLNERIQTVL-
A0A1E5QP61      ----QVLT--EYQKVQDQLAVQR----TRYQSQHPIITNLERREAALSDLLQERVAQVL-
A0A846DWC7      ----QVLT--EYQKVQDQLAVQR----TRYQSQHPIITNLERREAALNDLLQERVAQVL-
A0A845Y5J4      ----QVLL--EVEQIEDQLNVQR----TRYEEKHPVIINLKDRKAAREALLGERVEEVL-
A0A6P0X488      ----QVLL--EVEQIEDQLNVQR----TRYEEKHPVIVNLKDRKAAREALLGERVEQVL-
A0A6P0VDM0      ----QALL--EVEQIEDQLNVQR----TRYEEKHPVIVNLKDRKAAREILLAERVEQVL-
A0A6P0UVD5      ----QALL--EVEQIEDQLNVQR----TRYEEKHPVIVNLKDRKAAREILLAERVEQVL-
A0A846BFF2      ----QALL--EVEQIEDQLNVQR----TRYEEKHPVIVNLKDRKAAREILLAERVEQVL-
A0A6M0G142      ----QVLL--EVEQIEEQLNVQR----TRYEEKHPVIVNLKDRKAARTGLLGDRIEQVL-
A0A6P0MR53      ----QVLL--EVEQIQEQLNVQR----TRYEEKHPVIVNLRDRKAAREALLGERVEQVL-
A0A3M2GIL5      ----NLFR--ELQQVENDLAVQR----TRYQSKHPIIANLTRKRVSLQALLQERIRDIL-
A0A6H1TSJ9      ----NLFR--ELQQVENDLAVQR----TRYQSKHPIIANLTRKRVSLQALLQERIRDIL-
A0A3M1PML8      ----EALT--QLQLAQQELAVER----TRYTEDHPAIANLQRRVRSLEDMLQSRAVSVA-
A0A6M8BE85      ----EALT--QLQAAQQELAVER----TRYTEDHPAIANLQRRVQSLEELLRNRAVSVA-
A0A0T7BPZ0      ----QMLT--QLREAETKLAVEQ----NRYLPGHPTLVNLQEQIASLKKLLQQRIKQVA-
A0A352X442      ----QALA--ELQKVQSQLAVER----GRFLEEAPIVQKLKEQETKLQTLVNQRIGENL-
A0A6B3NF44      ----QALT--QLQEVQAELAVER----TRYKEGYPTIENLKRKEAALETLVQKQVAQVL-
A0A6M0EPL4      ----QALT--QLQEVQAELAVER----TRYKEGYPTIENLKRKEAALETLVQKQVAQVL-
A0A6P0K6L6      ----QALT--QLQEVQAELAVER----TRYKEGYPTIENLKRKEAALETLVQKQVAQVL-
A0A6P0MRR9      ----NIRI--QLQKVISQLEIER----ARYKPGHPTVKNLERQAANLRILLKEKIRLVL-
A0A6P0X1X4      ----NLRI--QLKDTMSELAMER----ASYKSGHPKIKNLERQATNLRALLEQQIRLVL-
A0A6P0UX57      ----NLRV--QLQEIQSELKIER----ARYKPGHPTIKNLERQATNLKSLLEEQIRLAL-
A0A846B9S8      ----NLRV--QLQEIQSELKIER----ARYKPGHPTIKNLERQATNLKSLLEEQIRLAL-
A0A0M0SHU3      ----QVLK--ELQEAQTKLTVAR----TRYLPGHPTVSNLEEQVSALKNLLQQRVEQVG-
A0A1D2PBN3      ----QVLT--QLQEAQSQLAVER----TRLQPEHPIVINLEEKVAALNSLLQQRLKQVV-
A0A0C2LVR7      ----QVLT--QLQEAQSQLAVER----TRLQPEHPIIINLEEKVAALNSLLQQRLKQAV-
A0A1Z4PQB9      ----QVLT--QLQEAQSQLAVER----TRLQPEHPIIINLEEKVAALNSLLQQRLKQAV-
A0A1Z4SFN6      ----QVLT--QLQEAQNQLTIEQ----TRLQPGHPTIINLEEKIAALNSLLEERIKQVV-
K9PGI8          ----QVLT--QRQEAQSQLAIEL----IRLRPNHPTIINLKEKIAVLNLLLKGRIEEGV-
A0A654SFI6      ----SLRA--DLAKAEAQLATLN----ANYGPMYPPLVEKAAEVASLRASLGGEARAAL-
K9SSQ0          ----ALVK--QFQEAQTNYFLER----ARFQDAYPKVQALRDRRDQIYNLMQAQAQAIL-
A0A2W1JIN9      ----NLKS--AVTNLESQVAARR----TELTDSHPIVIQLVQELDAARTLYNQRLSQLGG
A0A318AJV1      ----DLRS--QRADIVRNLGEVE----GRYGPKHPESIRAHQQLADIDQQIRDEAQRVV-
A0A845WDS5      ----KLRA--KLADLDSELATVR----SRFNENHPTVLSLLEERNAIRSLYNQKIATIA-
A0A6P0IC70      ----KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIA-
A0A845VVD9      ----KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIA-
A0A6B3MUB5      ----KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIA-
A0A6M0B7N4      ----KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIA-
A0A6P0J9W3      ----KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIA-
A0A6P0ZWE1      ----KLRD--KLADLDSELATVR----SRFNENHPTVLSLLEERDAIRSLYNDKIATIA-
A0A1U7N2U4      ----ALRA--QLVNLERELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLLP
A0A6L9YZL1      ----ALRA--QLVNLERELAKAR----SRLTDQNPAVISLVQERYELLGLYNQKLSRLLP
A0A6P0KYM4      ----ALRA--QLVDLDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLLP
A0A6P0LSD6      ----ALRA--QLVDLDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLLP
A0A6P0PNZ7      ----ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLL-
F4XV38          ----ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLL-
A0A6P0W137      ----ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLL-
A0A845XHF7      ----ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLL-
A0A845ZEG9      ----ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLL-
A0A1D9G1F2      ----ALRA--QLVELDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLL-
A0A846CJ58      ----ALRA--QLVELDRELAKMR----SRLTDQNPAMISLVQERYELLTLYNQKLSRLL-
A0A6L9Y9E2      ----ALRA--QLVDLDRELAKMR----SRLTDQNPAVISLVQERYELLALYNQKLSRLLP
A0A6P0SGR0      ----ALRA--QLVDLERELAKMR----SRLTDQNPAMISLVQERYELLALYNQKLSRLLP
A0A6M0BK48      ----ALRA--QLVDLDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLLP
A0A845WG36      ----ALRA--QLVNLDRELAKMR----SRLTDQNPAVISLVQERYELLTLYNQKLSRLL-
A0A6P0X384      ----NLRT--KLAELDEQLTAAR----SRFTDENPTVISLLEEQEALLALYEEKVARLL-
A0A2P8QIL5      ----ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET-
A0A433W447      ----ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET-
K9U1K8          ----ALRT--QLVELEAKVASAQ----SKYKADSPPLLNLIEERDAARALYQQKIGSET-
A0A1Q4RZJ6      ----KLRA--KLAEQETQLIEAR----LKFTDSHPTVVKMLQQRDALRSLYAQELSRVA-
A0A1Z4SNV3      ----KLRA--KLADQETLLIEAR----LRFTDSHPTVAKLLQQRDALRSLYAQQLARVA-
A0A2H2XJQ1      ----KLRA--KLADQETLLIEAR----LRFTDSHPTVAKLLQQRDALRSLYAQQLARVA-
A0A3S5K358      ----KLRA--KLAEQETQLIEAR----LKFTDSHPTVVKMLQQRDALRNLYAQELSRVA-
A0A0T7BPJ4      ----KLRS--KLTELEQQVIQAK----LKFTEEHPTVTKLVQERDAVKAMYEQEVARVS-
A0A0C1QS61      ----ELRT--KLTELETKLAESR----AKYTEDHPDVRSLLYQRNTIRNLYIQGLNRVS-
A0A139X3R8      ----ELRT--KLTEFETKLAESR----AKYTENHPDVQSLLYQRNSVRNLYIQGLNRIS-
A0A844MZP8      ----ELRT--KLTELETKLAEVR----AKYTESHPDVQALLSQRDSVRNLYLQGLNRVS-
A0A1Z4I7C5      ----ALRT--KLTDIETKLIEAR----TKFKEAHPTVVDLVQQRDEIKALYGQQMARVS-
A0A844MST0      ----KLRA--KLAELEQQVIQTR----LRFTEQHPTLISLTEQRDTVRALYQQELARVS-
A0A0C2MDK7      ----KLRA--KLSELENKIIEAR----LRFTENHPVVANLVGERDALRKVLSEQLARVS-
A0A856MDH8      ----KLRA--KLSELENKIIEAR----LRFTDDHPAVANLVGERDALRAVLSEQLGRVS-
A0A1Y0RCK1      ----KLRA--KLSELENKIIEAR----LRFTEEHPNVRNLVGERDALRAIYSEQLARVS-
A0A1Z4PWZ0      ----KLRA--KLSELENKIIEAR----LRFTEEHPTVTNLVGERDALRAIYSEQVARVS-
A0A0C2QLT0      ----KLRA--NLSELENKIVEAR----LRFTDEHPNVTNLVGQRDALRAMYSEQLARVS-
A0A1Z4J2K1      ----KLRA--KLSDVENQLIEAR----LRFTDEHPNVTNLVGERDALRAMYSEQVARVS-
A0A3S0ZSX0      ----MLRA--KLAELEAKVIETR----LYFTENHPTVIKLVEQRDGLRAFYQKELARVS-
A0A2N6K4T3      ----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVS-
A0A370CKT2      ----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVS-
A0A0S3TL97      ----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVS-
A0A2N6M8A0      ----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVS-
A0A2N6M9E1      ----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVS-
A0A2N6KJI4      ----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVS-
A0A2N6MZ77      ----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLRALYQQGLARVS-
A0A2N6KT20      ----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVS-
G6FSN3          ----ALRN--KLAEIETQLVQAR----LSLTDNHPTVINLLGQRNGLGALYQQGLARVS-
A0A4D9CI02      ----ALRT--KLAEIETNLVEAR----LSLTDSHPTVMNLLGQRNGLRALYFQGLARVS-
A0A328I8B9      ----ALRT--KLAEIETKLVQAR----LSLTDSHPTVMNLLGQRNGLRALYFQGLARVS-
A0A4Q9J4Z7      ----ALRT--KLAEIETKLVQAR----LSLTDSHPTVMNLLGQRNGLRALYFQGLARVS-
A0A0M0SU69      ----ALRT--KLAEIETKLVQAR----LSLTDSHPTVINMLGQRNGLRALYFQGLARVS-
A0A1Z4TIZ8      ----ALRN--KLAEIETKLIQAR----LYLTESHPTVINLLGQRNGLRGLYLQGLARVS-
K9UYB2          ----KLRA--KLAESETKLIEAR----LKFTESNPIVIQLSEERDALRNLYSQGLNRVS-
A0A1Q4S1H4      ----NLRA--RLTELETQIVALQ----QRFTPEHPELNSLIQQRDTLRAMYQQELARIS-
A0A433VBU6      ----NLRV--KLTELQTQIVALQ----QRFTPEHPELNSLIQQRDTLRAVYQQELARVS-
A0A218QN17      ----TLRA--KLTELNTKLIEAR----LRLTENHPSVIALVEQRDKVNKLYTEQLAIVS-
A0A846HD20      ----TLRA--KLTELNTKLIEAR----LRLTENHPSVISLVEQRDNLNKLYTEQLGRVS-
K9RKN2          ----KMRA--NLAELEREFVEAR----LRFTFNHPKLIELSQKRNAFRQMYEQQLANVS-
A0A2I8ADV2      ----SLRA--KLTEIETQLIEAR----LQFTDNHPKVVSLLGQREQIRALYAQQVGRVS-
A0A5Q0GMF5      ----VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQQRDEIRALYGQQMARVS-
Q3MEW0          ----VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVQQRDEIRALYGQQMARVS-
A0A1Z4KIC7      ----VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVEQRNEIRALYGQQMARVS-
Q8YSM5          ----VLRT--KLTDIETKLIEAR----TKYQEAHPTVLDLVEQRNEIRALYGQQMARVS-
                                                                            

K9SLA9          ENLTTQNLRISDT-----------------------------------------------
A0A168TT23      ------------------------------------------------------------
A0A0M1JWX9      REIVTVARVPEAQ-----------------------------------------------
A0A844MWN9      ------------------------------------------------------------
A0A2T1M1V6      ------------------------------------------------------------
A0A2G7GCS2      ------------------------------------------------------------
K9XBH8          ------------------------------------------------------------
A0A1Z4LJ30      ------------------------------------------------------------
Q7NF11          ------------------------------------------------------------
K9RI76          ------------------------------------------------------------
A0A433VN22      ------------------------------------------------------------
A0A139WSU3      ------------------------------------------------------------
A0A844MJB7      ------------------------------------------------------------
A0A352AE27      ------------------------------------------------------------
A0A3B8JH60      ------------------------------------------------------------
A0A3C0N766      ------------------------------------------------------------
K9W9J7          ------------------------------------------------------------
Q7NJN6          ------------------------------------------------------------
U5QCC3          ------------------------------------------------------------
A0A1Z4JCS8      ------------------------------------------------------------
A0A846GVZ3      ------------------------------------------------------------
A0A6P0PI80      ------------------------------------------------------------
A0A6P0WGT6      ------------------------------------------------------------
F4XTX2          ------------------------------------------------------------
A0A3S0Y9N9      ------------------------------------------------------------
A0A6P0ZKB8      ------------------------------------------------------------
A0A846EDH6      ------------------------------------------------------------
A0A433UNK7      ------------------------------------------------------------
B8HNB0          ------------------------------------------------------------
A0A318BJ18      ------------------------------------------------------------
A0A3B8Y8H9      ------------------------------------------------------------
A0A2W1JVB9      ------------------------------------------------------------
A0A6H1U102      ------------------------------------------------------------
A0A7C3ZEJ3      ------------------------------------------------------------
A0A2P8W9H0      ------------------------------------------------------------
A0A6I5P386      ------------------------------------------------------------
A0A3M1SVZ4      ------------------------------------------------------------
A0A318BG22      ------------------------------------------------------------
A0A2T1E9V8      ------------------------------------------------------------
A0A1Z4LN32      ------------------------------------------------------------
A0A2I8A9F5      ------------------------------------------------------------
A0A218Q6R8      ------------------------------------------------------------
A0A218QGE0      ------------------------------------------------------------
A0A846HDH5      ------------------------------------------------------------
A0A3M2GQQ6      ------------------------------------------------------------
A0A6H1U2X0      ------------------------------------------------------------
K9TLQ0          ------------------------------------------------------------
K9QF04          ------------------------------------------------------------
K9W1T3          ------------------------------------------------------------
K9SGJ5          ------------------------------------------------------------
A0A6N2JS94      ------------------------------------------------------------
A0A6C2DSN4      ------------------------------------------------------------
L8MYT6          ------------------------------------------------------------
A0A352JGJ6      ------------------------------------------------------------
A0A1J5GLS2      ------------------------------------------------------------
A0A2W4W6M5      ------------------------------------------------------------
A0A2W7AN33      ------------------------------------------------------------
A0A256BLV2      ------------------------------------------------------------
A0A2W6ZXF3      ------------------------------------------------------------
A0A2Z5WX66      ------------------------------------------------------------
Q7NEU3          ------------------------------------------------------------
A0A3C0N2P0      ------------------------------------------------------------
A0A6P0JR04      ------------------------------------------------------------
A0A6B3M6M6      ------------------------------------------------------------
A0A6P0KD09      ------------------------------------------------------------
A0A6B3NIJ0      ------------------------------------------------------------
A0A6M0F053      ------------------------------------------------------------
A0A6P2ATU9      ------------------------------------------------------------
A0A845XAM4      ------------------------------------------------------------
A0A352XE00      ------------------------------------------------------------
A0A6P0QC14      ------------------------------------------------------------
B4VS56          ------------------------------------------------------------
A0A352AAQ3      ------------------------------------------------------------
A0A350Y472      ------------------------------------------------------------
A0A355DVB4      ------------------------------------------------------------
A0A1Z4RMB9      ------------------------------------------------------------
A0A318B4H2      ------------------------------------------------------------
A0A2K3BR24      ------------------------------------------------------------
K9YXY1          ------------------------------------------------------------
A0A1Q4RTR1      ------------------------------------------------------------
A0A1Z4SQV2      ------------------------------------------------------------
A0A2H2XGN1      ------------------------------------------------------------
A0A433UXH8      ------------------------------------------------------------
A0A1U7HGH0      ------------------------------------------------------------
K9XJD3          ------------------------------------------------------------
K9SX01          ------------------------------------------------------------
A0A4P7ZT55      ------------------------------------------------------------
A0A1E5QIR9      ------------------------------------------------------------
A0A6P1A9A0      ------------------------------------------------------------
A0A1Z4IBC7      ------------------------------------------------------------
A0A5Q0GKD1      ------------------------------------------------------------
Q3MDC6          ------------------------------------------------------------
A0A1Z4KM73      ------------------------------------------------------------
Q8YNX7          ------------------------------------------------------------
A0A367R4K6      ------------------------------------------------------------
A0A1E2WSV8      ------------------------------------------------------------
A0A7D7L9Y1      ------------------------------------------------------------
A0A2R5FRT9      ------------------------------------------------------------
A0A2K8T1B6      ------------------------------------------------------------
A0A235I9I0      ------------------------------------------------------------
A0A2D0HQT8      ------------------------------------------------------------
A0A2L2NU95      ------------------------------------------------------------
A0A367S084      ------------------------------------------------------------
A0A1Z4SMD6      ------------------------------------------------------------
A0A2H2Y096      ------------------------------------------------------------
K9S8M8          ------------------------------------------------------------
A0A1Z4NFV0      ------------------------------------------------------------
A0A3M9ZEU1      ------------------------------------------------------------
A0A1Z4JK72      ------------------------------------------------------------
A0A0N7Z489      ------------------------------------------------------------
A0A0S3TXS2      ------------------------------------------------------------
A0A2A2TPF8      ------------------------------------------------------------
A0A1Z4R0P8      ------------------------------------------------------------
A0A0T7BUI3      ------------------------------------------------------------
A0A1Z4LP32      ------------------------------------------------------------
K9REP9          ------------------------------------------------------------
A0A1Z4SIJ3      ------------------------------------------------------------
A0A2H2XPG4      ------------------------------------------------------------
A0A2A2TC28      ------------------------------------------------------------
K9V3C7          ------------------------------------------------------------
A0A1Z4T6Y7      ------------------------------------------------------------
A0A2H2Y561      ------------------------------------------------------------
A0A1Q4S362      ------------------------------------------------------------
A0A3S1CIN8      ------------------------------------------------------------
A0A0C1NCB0      ------------------------------------------------------------
A0A844MLU2      ------------------------------------------------------------
A0A2N6K7Q9      ------------------------------------------------------------
A0A2N6MXH6      ------------------------------------------------------------
A0A2N6M5A8      ------------------------------------------------------------
A0A2N6LL61      ------------------------------------------------------------
A0A0S3TP66      ------------------------------------------------------------
G6FP91          ------------------------------------------------------------
A0A1U7GYR5      ------------------------------------------------------------
A0A2N6KY52      ------------------------------------------------------------
A0A2N6KMP5      ------------------------------------------------------------
A0A2N6MA45      ------------------------------------------------------------
A0A4Q9J9V9      ------------------------------------------------------------
A0A328IGA1      ------------------------------------------------------------
A0A4D9CE41      ------------------------------------------------------------
A0A0M0SFT2      ------------------------------------------------------------
A0A1Z4TLC8      ------------------------------------------------------------
A0A1Z4IYV4      ------------------------------------------------------------
A0A1Z4Q0T6      ------------------------------------------------------------
A0A0C2PT44      ------------------------------------------------------------
A0A1D2P6J4      ------------------------------------------------------------
A0A0C2LFH0      ------------------------------------------------------------
A0A856M734      ------------------------------------------------------------
B4WP72          ------------------------------------------------------------
A0A2T1CIL7      ------------------------------------------------------------
A0A433V7A0      ------------------------------------------------------------
A0A2T1FTR8      ------------------------------------------------------------
K9UA41          ------------------------------------------------------------
A0A563VS48      ------------------------------------------------------------
A0A7Y0NUK1      ------------------------------------------------------------
A0A0C2LBE2      ------------------------------------------------------------
A0A433NN38      ------------------------------------------------------------
A0A2N6K0T2      ------------------------------------------------------------
A0A2N6ML72      ------------------------------------------------------------
G6FQZ6          ------------------------------------------------------------
A0A2N6MQX9      ------------------------------------------------------------
A0A2N6KXT6      ------------------------------------------------------------
A0A2N6KGB9      ------------------------------------------------------------
A0A2N6L3Y5      ------------------------------------------------------------
A0A0S3TIS7      ------------------------------------------------------------
A0A1U7GW28      ------------------------------------------------------------
A0A2N6LW63      ------------------------------------------------------------
A0A328IH74      ------------------------------------------------------------
A0A4D9CIB0      ------------------------------------------------------------
A0A1Z4TQ63      ------------------------------------------------------------
A0A4Q9J8G2      ------------------------------------------------------------
A0A350Y0P6      ------------------------------------------------------------
A0A352X940      ------------------------------------------------------------
B8HTN4          ------------------------------------------------------------
A0A6P1AFJ5      ------------------------------------------------------------
B0CAX4          ------------------------------------------------------------
A0A1Z4RN12      ------------------------------------------------------------
A0A2T1CMF9      ------------------------------------------------------------
Q7NDC5          ------------------------------------------------------------
U5QGK3          ------------------------------------------------------------
A0A2W4UY24      ------------------------------------------------------------
A0A838VM23      ------------------------------------------------------------
A0A0D8ZUV2      ------------------------------------------------------------
A0A433VDI0      ------------------------------------------------------------
A0A3D1PG43      ------------------------------------------------------------
A0A2P8QQ72      ------------------------------------------------------------
K9TZQ7          ------------------------------------------------------------
A0A6N8G584      ------------------------------------------------------------
A0A2G7GPR0      ------------------------------------------------------------
K9XH68          ------------------------------------------------------------
A0A1U7HW70      ------------------------------------------------------------
A0A2S6VEJ8      ------------------------------------------------------------
A0A140KBA0      ------------------------------------------------------------
K9XSG1          ------------------------------------------------------------
A0A2T1GMT4      ------------------------------------------------------------
K9UI51          ------------------------------------------------------------
A0A1Z4QL41      ------------------------------------------------------------
K9TYI2          ------------------------------------------------------------
A0A252D4T4      ------------------------------------------------------------
A0A252DJH5      ------------------------------------------------------------
A0A252EB80      ------------------------------------------------------------
A0A6G9SKZ9      ------------------------------------------------------------
A0A1Z4HPW5      ------------------------------------------------------------
A0A1Z4MSN1      ------------------------------------------------------------
A0A1Z4U1C2      ------------------------------------------------------------
A0A0D6KV51      ------------------------------------------------------------
A0A1Z4MKF8      ------------------------------------------------------------
A0A2C6WC43      ------------------------------------------------------------
A0A841WRE0      ------------------------------------------------------------
A0A1Z4L5A1      ------------------------------------------------------------
A0A367QD86      ------------------------------------------------------------
A0A2K8SM78      ------------------------------------------------------------
A0A2R5FPC0      ------------------------------------------------------------
A0A5P8W5T6      ------------------------------------------------------------
A0A7D7LDT7      ------------------------------------------------------------
A0A235IZ96      ------------------------------------------------------------
A0A2L2NGP0      ------------------------------------------------------------
K9QM62          ------------------------------------------------------------
A0A1Z4FWI3      ------------------------------------------------------------
A0A1Z4JYE7      ------------------------------------------------------------
A0A0F5YE28      ------------------------------------------------------------
U7QEH7          ------------------------------------------------------------
A0A3S1ATK5      ------------------------------------------------------------
A0A2Z6CPH0      ------------------------------------------------------------
A0A1Z4GT50      ------------------------------------------------------------
A0A1Z4GIX0      ------------------------------------------------------------
A0A2H6LC24      ------------------------------------------------------------
B2J6N5          ------------------------------------------------------------
A0A367RMI4      ------------------------------------------------------------
A0A235HUM0      ------------------------------------------------------------
A0A2L2NW47      ------------------------------------------------------------
A0A1E2WUR1      ------------------------------------------------------------
A0A235IKU3      ------------------------------------------------------------
A0A1U7MYU6      ------------------------------------------------------------
A0A1D8TNX9      ------------------------------------------------------------
A0A6P0L6C2      ------------------------------------------------------------
A0A6P0MVH0      ------------------------------------------------------------
A0A6P0KJV0      ------------------------------------------------------------
A0A6L9ZJG4      ------------------------------------------------------------
A0A846GI17      ------------------------------------------------------------
F4XKF3          ------------------------------------------------------------
A0A1D9FX10      ------------------------------------------------------------
A0A6P0Q0T0      ------------------------------------------------------------
A0A6P0W5I0      ------------------------------------------------------------
A0A845XJ02      ------------------------------------------------------------
A0A846D190      ------------------------------------------------------------
A0A3C0NJ41      ------------------------------------------------------------
A0A352AG88      ------------------------------------------------------------
A0A350Y374      ------------------------------------------------------------
A0A355DPX0      ------------------------------------------------------------
A0A0S3TYD7      ------------------------------------------------------------
A0A2T1DNG3      -----------------------------------------------------------G
A0A140K3H3      DAVSQVNLEAIIVSQGSTSQVMGIN-----------------------------------
K9XUB8          DAVSQVNLEAIIVNQGSTSQIMGIN-----------------------------------
A0A563VLD6      NTVSQAVLDKAIATSAEII-----------------------------------------
A0A7Y0NVW6      NTVSQAVLDQAINTATETIASNNVANTNNATTQEATTDNAT-------------------
U5QL42          SAKVAKLGLKSGAVPALGDSAITGSGGANPPVAPAASAPTPATVASKGEPAPPAAPTSKA
A0A6H2NHD5      ANAEVD----------------------------------------------------HD
A0A2P8W4F7      EA--VE----------------------------------------------------AN
A0A5Q4E0Z4      ST--VE----------------------------------------------------TD
A0A2P8VVX1      Q-----------------------------------------------------------
A0A2P8WHY0      R-----------------------------------------------------------
A0A563VQJ3      IG----------------------------------------------------------
A0A7Y0IRJ7      EG----------------------------------------------------------
A0A2T1CMT9      EL----------------------------------------------------------
A0A7G8J1V5      ------------------------------------------------------------
A0A354B169      ------------------------------------------------------------
Q0IDT5          ------------------------------------------------------------
A0A7G8FZD9      ------------------------------------------------------------
G4FMX5          ------------------------------------------------------------
A3ZA21          ------------------------------------------------------------
A0A076HBF2      ------------------------------------------------------------
A0A7G8FP50      ------------------------------------------------------------
A0A7G8E8K7      ------------------------------------------------------------
A0A7G8GNR2      ------------------------------------------------------------
A0A7G8ICD3      ------------------------------------------------------------
A0A2D6FCW3      ------------------------------------------------------------
A0A7G7KJ95      ------------------------------------------------------------
A0A7G8EAN3      ------------------------------------------------------------
A0A1D8TX52      QV--------------------------------------------------------PT
A0A1D9G4T2      QV--------------------------------------------------------PT
A0A6P0PR27      QV--------------------------------------------------------PT
A0A6P0WER7      QV--------------------------------------------------------PT
A0A845XM36      QV--------------------------------------------------------PT
A0A846DAT1      QV--------------------------------------------------------PT
A0A846GZK8      QV--------------------------------------------------------PT
F4XP71          QV--------------------------------------------------------PT
A0A6P0KZ31      QV--------------------------------------------------------PT
A0A6P0LPB8      QV--------------------------------------------------------PT
A0A6L9YR57      QV--------------------------------------------------------PT
A0A845WMG9      QV--------------------------------------------------------PT
A0A6P0SEV1      QV--------------------------------------------------------PT
A0A6B3N2I8      QV--------------------------------------------------------PT
A0A6M0B891      QV--------------------------------------------------------PT
A0A6P0IJQ1      QV--------------------------------------------------------PT
A0A6P0J8J8      QV--------------------------------------------------------PT
A0A6P0ZSH6      QV--------------------------------------------------------PT
A0A845VS63      QV--------------------------------------------------------PT
A0A1U7N5X9      QV--------------------------------------------------------PT
A0A6L9Z1V0      QV--------------------------------------------------------PT
A0A6P0LC12      QV--------------------------------------------------------PT
A0A6P0MVJ3      QV--------------------------------------------------------PT
A0A2W6ZAV2      ------------------------------------------------------------
K9W742          KN----------------------------------------------------------
A0A3D1PBA3      KE--------------------------------------------------------QA
K9XPB0          AV--------------------------------------------------------PP
A0A350Y7Z1      ET--------------------------------------------------------ST
A0A352X2A7      RV--------------------------------------------------------AR
A0A0D8ZYV0      AN---------------------------------------------------------V
A0A433VMS2      EGQASQ----------------------------------------------------AA
K9TYA7          EGQASQ----------------------------------------------------AA
A0A2P8QUE1      EGQASQ----------------------------------------------------AA
K9SA61          ST--------------------------------------------------------ST
A0A2G7GMH8      EN--------------------------------------------------------AI
A0A6N8FU92      ED--------------------------------------------------------VA
A0A2T1DWE8      NN--------------------------------------------------------AA
A0A832H7C4      SV--------------------------------------------------------PP
A0A1U7I8L3      NN--------------------------------------------------------NP
A0A2T1DJL8      AQ--------------------------------------------------------AA
A0A1Z4J9W0      SE--------------------------------------------------------AG
A0A0N7Z5K9      AD--------------------------------------------------------AG
A0A0S3TXC5      SE--------------------------------------------------------AS
A0A846FBD3      ------------------------------------------------------------
K1XF69          ------------------------------------------------------------
B5W297          ------------------------------------------------------------
H1W7M8          ------------------------------------------------------------
A0A5Q4H6A5      ------------------------------------------------------------
D5A466          ------------------------------------------------------------
B4WQE3          ------------------------------------------------------------
U5QJM6          ------------------------------------------------------------
A0A0V7ZFJ4      ------------------------------------------------------------
A0A235IXQ2      ------------------------------------------------------------
A0A367RIS1      ------------------------------------------------------------
A0A841V8H9      ------------------------------------------------------------
A0A5Q0GJJ5      ------------------------------------------------------------
Q3MEB7          ------------------------------------------------------------
A0A1Z4KHN9      ------------------------------------------------------------
Q8YT70          ------------------------------------------------------------
A0A7U3NLX2      ------------------------------------------------------------
A0A166IWU6      ------------------------------------------------------------
A0A2S0Q8C0      ------------------------------------------------------------
W6FSX4          ------------------------------------------------------------
A0A218Q4C1      ------------------------------------------------------------
A0A6P1ZT04      ------------------------------------------------------------
A0A0V7ZNJ9      ------------------------------------------------------------
A0A5P8VSD1      ------------------------------------------------------------
A0A1S1ZVW2      ------------------------------------------------------------
A0A0R0M9H9      ------------------------------------------------------------
A0A7H0F4U6      ------------------------------------------------------------
A0A7W2A1T7      ------------------------------------------------------------
A0A838WI98      ------------------------------------------------------------
A0A853MJX6      ------------------------------------------------------------
A0A1B7WX82      ------------------------------------------------------------
A0A1B7WTD1      ------------------------------------------------------------
A0A480ABC0      ------------------------------------------------------------
A0A1Z4LRU5      ------------------------------------------------------------
A0A1Z4JVB4      ------------------------------------------------------------
K9PIA4          ------------------------------------------------------------
A0A1Z4HVE1      ------------------------------------------------------------
A0A252ECZ1      ------------------------------------------------------------
A0A1Z4G5Y1      ------------------------------------------------------------
A0A252DNA2      ------------------------------------------------------------
A0A252E1Q4      ------------------------------------------------------------
A0A6G9SK36      ------------------------------------------------------------
A0A1Z4M597      ------------------------------------------------------------
A0A1Z4MWT1      ------------------------------------------------------------
A0A1Z4TX53      ------------------------------------------------------------
A0A2A2TNQ5      ------------------------------------------------------------
A0A3S1C4K5      ------------------------------------------------------------
A0A1X4G3D5      ------------------------------------------------------------
D4TNI2          ------------------------------------------------------------
A0A1Z4H6Z8      ------------------------------------------------------------
A0A3F3KPR9      ------------------------------------------------------------
A0A1Z4NPM1      ------------------------------------------------------------
A0A1Z4UZW9      ------------------------------------------------------------
A0A1B7VSH4      ------------------------------------------------------------
A0A1B7W126      ------------------------------------------------------------
A0A3D4C6Q6      ------------------------------------------------------------
A0A0K2M5H0      ------------------------------------------------------------
A0A844I4P0      ------------------------------------------------------------
A0A1B7UVJ4      ------------------------------------------------------------
A0A1B7UTR1      ------------------------------------------------------------
K7W0A4          ------------------------------------------------------------
A0A5C0DRW9      ------------------------------------------------------------
A0A6H2C088      ------------------------------------------------------------
A0A1Z4RPC6      ------------------------------------------------------------
A0A2T1CMZ0      ------------------------------------------------------------
L8M4F7          ------------------------------------------------------------
A0A140K2P2      ------------------------------------------------------------
K9XWX4          ------------------------------------------------------------
A0A140KB14      ------------------------------------------------------------
K9XX88          ------------------------------------------------------------
L8LZE9          ------------------------------------------------------------
A0A563VSV6      ------------------------------------------------------------
A0A7Y0IQB0      ------------------------------------------------------------
A0A433NM31      ------------------------------------------------------------
A0A1Z4NDS1      ------------------------------------------------------------
U9VXM0          ------------------------------------------------------------
A0A6M0RI13      ------------------------------------------------------------
A0A6M0S1N5      ------------------------------------------------------------
K9F4D9          ------------------------------------------------------------
A0A6I5QPI5      ------------------------------------------------------------
A0A1Z3HMQ0      ------------------------------------------------------------
A0A433W533      ------------------------------------------------------------
A0A2P8QWJ3      ------------------------------------------------------------
K9U6L7          ------------------------------------------------------------
U5DPF5          ------------------------------------------------------------
A0A1E5QP61      ------------------------------------------------------------
A0A846DWC7      ------------------------------------------------------------
A0A845Y5J4      ------------------------------------------------------------
A0A6P0X488      ------------------------------------------------------------
A0A6P0VDM0      ------------------------------------------------------------
A0A6P0UVD5      ------------------------------------------------------------
A0A846BFF2      ------------------------------------------------------------
A0A6M0G142      ------------------------------------------------------------
A0A6P0MR53      ------------------------------------------------------------
A0A3M2GIL5      ------------------------------------------------------------
A0A6H1TSJ9      ------------------------------------------------------------
A0A3M1PML8      ------------------------------------------------------------
A0A6M8BE85      ------------------------------------------------------------
A0A0T7BPZ0      ------------------------------------------------------------
A0A352X442      ------------------------------------------------------------
A0A6B3NF44      ------------------------------------------------------------
A0A6M0EPL4      ------------------------------------------------------------
A0A6P0K6L6      ------------------------------------------------------------
A0A6P0MRR9      ------------------------------------------------------------
A0A6P0X1X4      ------------------------------------------------------------
A0A6P0UX57      ------------------------------------------------------------
A0A846B9S8      ------------------------------------------------------------
A0A0M0SHU3      ------------------------------------------------------------
A0A1D2PBN3      ------------------------------------------------------------
A0A0C2LVR7      ------------------------------------------------------------
A0A1Z4PQB9      ------------------------------------------------------------
A0A1Z4SFN6      ------------------------------------------------------------
K9PGI8          ------------------------------------------------------------
A0A654SFI6      ------------------------------------------------------------
K9SSQ0          ------------------------------------------------------------
A0A2W1JIN9      GS----------------------------------------------------------
A0A318AJV1      ------------------------------------------------------------
A0A845WDS5      ------------------------------------------------------------
A0A6P0IC70      ------------------------------------------------------------
A0A845VVD9      ------------------------------------------------------------
A0A6B3MUB5      ------------------------------------------------------------
A0A6M0B7N4      ------------------------------------------------------------
A0A6P0J9W3      ------------------------------------------------------------
A0A6P0ZWE1      ------------------------------------------------------------
A0A1U7N2U4      TN----------------------------------------------------------
A0A6L9YZL1      TN----------------------------------------------------------
A0A6P0KYM4      TN----------------------------------------------------------
A0A6P0LSD6      TN----------------------------------------------------------
A0A6P0PNZ7      ------------------------------------------------------------
F4XV38          ------------------------------------------------------------
A0A6P0W137      ------------------------------------------------------------
A0A845XHF7      ------------------------------------------------------------
A0A845ZEG9      ------------------------------------------------------------
A0A1D9G1F2      ------------------------------------------------------------
A0A846CJ58      ------------------------------------------------------------
A0A6L9Y9E2      TN----------------------------------------------------------
A0A6P0SGR0      TN----------------------------------------------------------
A0A6M0BK48      TN----------------------------------------------------------
A0A845WG36      ------------------------------------------------------------
A0A6P0X384      ------------------------------------------------------------
A0A2P8QIL5      ------------------------------------------------------------
A0A433W447      ------------------------------------------------------------
K9U1K8          ------------------------------------------------------------
A0A1Q4RZJ6      ------------------------------------------------------------
A0A1Z4SNV3      ------------------------------------------------------------
A0A2H2XJQ1      ------------------------------------------------------------
A0A3S5K358      ------------------------------------------------------------
A0A0T7BPJ4      ------------------------------------------------------------
A0A0C1QS61      ------------------------------------------------------------
A0A139X3R8      ------------------------------------------------------------
A0A844MZP8      ------------------------------------------------------------
A0A1Z4I7C5      ------------------------------------------------------------
A0A844MST0      ------------------------------------------------------------
A0A0C2MDK7      ------------------------------------------------------------
A0A856MDH8      ------------------------------------------------------------
A0A1Y0RCK1      ------------------------------------------------------------
A0A1Z4PWZ0      ------------------------------------------------------------
A0A0C2QLT0      ------------------------------------------------------------
A0A1Z4J2K1      ------------------------------------------------------------
A0A3S0ZSX0      ------------------------------------------------------------
A0A2N6K4T3      ------------------------------------------------------------
A0A370CKT2      ------------------------------------------------------------
A0A0S3TL97      ------------------------------------------------------------
A0A2N6M8A0      ------------------------------------------------------------
A0A2N6M9E1      ------------------------------------------------------------
A0A2N6KJI4      ------------------------------------------------------------
A0A2N6MZ77      ------------------------------------------------------------
A0A2N6KT20      ------------------------------------------------------------
G6FSN3          ------------------------------------------------------------
A0A4D9CI02      ------------------------------------------------------------
A0A328I8B9      ------------------------------------------------------------
A0A4Q9J4Z7      ------------------------------------------------------------
A0A0M0SU69      ------------------------------------------------------------
A0A1Z4TIZ8      ------------------------------------------------------------
K9UYB2          ------------------------------------------------------------
A0A1Q4S1H4      ------------------------------------------------------------
A0A433VBU6      ------------------------------------------------------------
A0A218QN17      ------------------------------------------------------------
A0A846HD20      ------------------------------------------------------------
K9RKN2          ------------------------------------------------------------
A0A2I8ADV2      ------------------------------------------------------------
A0A5Q0GMF5      ------------------------------------------------------------
Q3MEW0          ------------------------------------------------------------
A0A1Z4KIC7      ------------------------------------------------------------
Q8YSM5          ------------------------------------------------------------
                                                                            

K9SLA9          ------------------------------------------------------------
A0A168TT23      --------------------------------------------------------GNVL
A0A0M1JWX9      ------------------------------------------------------AFQNSV
A0A844MWN9      -----------ANTK----VDTTIASES-QAG----------------------------
A0A2T1M1V6      -----------PGVSSSQ-VDVTL-GDSSTDS----------------------------
A0A2G7GCS2      -----------PGASANQ-IDPTLGGNGTRDS----------------------------
K9XBH8          -----------PNAASNQ-VDPTLSGSGTRDS----------------------------
A0A1Z4LJ30      -----------SVAG----VDTSVGQNT--------------------------------
Q7NF11          -----------PASRTERALDDSLAGGGNRDS----------------------------
K9RI76          -----------ANAGG---VNPAIGENT--------------------------------
A0A433VN22      -----------GNI-P---VDPTIATDS--QG----------------------------
A0A139WSU3      -----------AGT-K---VDTTVATDS--QG----------------------------
A0A844MJB7      -----------AST-K---VDTTVATDA--QG----------------------------
A0A352AE27      -----------GDA-S---IDTTMTGER--QG----------------------------
A0A3B8JH60      -----------AGT-R---VDTTVSTNN--EG----------------------------
A0A3C0N766      -----------AGT-R---VDTTVSTNN--EG----------------------------
K9W9J7          -----------AGT-Q---VDTTVSTNS--DG----------------------------
Q7NJN6          -----------PDASK---VNVSLGGNSYRDS----------------------------
U5QCC3          -----------PDSEK---VDTTLGGNTYRDS----------------------------
A0A1Z4JCS8      -----------AGRIS---ANTDFTTGA--EG----------------------------
A0A846GVZ3      -----------AGDTL---VDPTLTDSA--QG----------------------------
A0A6P0PI80      -----------AGDTL---VDPTLTDSA--QG----------------------------
A0A6P0WGT6      -----------AGDTL---VDPTLTDSA--QG----------------------------
F4XTX2          -----------AGDTL---VDPTLTDSA--QG----------------------------
A0A3S0Y9N9      ------IGEA----------------GRLNKSKDSESI---------------------V
A0A6P0ZKB8      ------IGKA----------------GRLNQVKDAENI---------------------V
A0A846EDH6      ------IGKA----------------GRLNQVKDAENI---------------------V
A0A433UNK7      ------IGKS----------------GRLNQSVEPEKI---------------------V
B8HNB0          ------RTQL------------NRDLTTLPSSASSGS-----------------SDGS-V
A0A318BJ18      ------------------------------------------------------------
A0A3B8Y8H9      ------GNIP------------QTSLTDLTALTSPNTI----------------------
A0A2W1JVB9      ------GVPS-------------------SPTQGTGQL----------------QVGE-L
A0A6H1U102      ------GDAV--------------------SQVDLSDVA---------------GYGA-I
A0A7C3ZEJ3      ------GSAV--------------------GQVDITDVS---------------GYGK-I
A0A2P8W9H0      ------------------------------------------------------REGLRV
A0A6I5P386      ------------------------------------------------------KEGVRV
A0A3M1SVZ4      ------GSLK-----------------------SIGNL----------------EFSQ-M
A0A318BG22      ------GGFR--------------------------------------------------
A0A2T1E9V8      ------QGQK---------------------ISSYSNL----------------QVGS-I
A0A1Z4LN32      ------GYR---------------------TQIAPSSL----------------QIGR-V
A0A2I8A9F5      ------GYP---------------------IQIETARL----------------QIGE-I
A0A218Q6R8      ------GYP---------------------MQIPPTML----------------QMGE-I
A0A218QGE0      ------GYK---------------------AAIAPGKL----------------QMGE-I
A0A846HDH5      ------GYK---------------------AAIAPGKL----------------QMGE-I
A0A3M2GQQ6      ------GDAV--------------------AKVDLDEV----------------TGSGAI
A0A6H1U2X0      ------GDAV--------------------AKVDLDEV----------------TGSGAI
K9TLQ0          ------GPNV------------SQFRGDIRGLSTPNSL----------------------
K9QF04          ------GIQL------------FKEIQQLPGVASPSKI----------------------
K9W1T3          ------LGQQ---------------------PLPNRIV----------------PLADGV
K9SGJ5          ------GGRA------------AQVGISTAVPASADGS---------------------I
A0A6N2JS94      ------GVKG------------NTANITN----EPNSA---------------------I
A0A6C2DSN4      ------GVKG------------NTTNIAN----EPSSL---------------------I
L8MYT6          ------GVKG------------NTVNIAN----EPSSL---------------------I
A0A352JGJ6      ------GTKG--------------TNITN----EPNSP---------------------I
A0A1J5GLS2      ------GVGA------------NSRNLTN----EPNSL---------------------I
A0A2W4W6M5      ------GVRG------------GNVNLTN----EPNST---------------------I
A0A2W7AN33      ------G--D------------STANITN----QPNSA---------------------I
A0A256BLV2      ------GVRG------------STTNITN----EPNSA---------------------I
A0A2W6ZXF3      ------GVGV------------G-NNFTN----EPNSP---------------------I
A0A2Z5WX66      ------GLKG------------S-ANIAR----EPNST---------------------I
Q7NEU3          ------GDRTVPAIVSGGASLQDS------IADSVNNT----------------GSPKGI
A0A3C0N2P0      ------GNAA------------SG------VPDNAESL----------------ASPSSI
A0A6P0JR04      ------GQDA------------KN-------TDLGDLN----------------TSPNSI
A0A6B3M6M6      ------PNGT------------G--------INSAEAL----------------AAPSSV
A0A6P0KD09      ------PKGT------------G--------TNSAEAL----------------AAPSSV
A0A6B3NIJ0      ------PKGT------------G--------TNSAEAL----------------AAPSSV
A0A6M0F053      ------PKGT------------G--------TNSAEAL----------------AAPSSV
A0A6P2ATU9      ------GEAA------------GD------EAKSLA------------------ASPNPI
A0A845XAM4      ------GTAA------------ER------SPDFQA------------------IAPNSI
A0A352XE00      ------SSAK------------LT------QSDNLASL----------------ASPSSV
A0A6P0QC14      ------GNST------------SG------VPSDAPSL----------------ASPSSI
B4VS56          ------GANA------------SA------VPENPESL----------------ASPSSL
A0A352AAQ3      ------GSGS------------SG------VPNNAESL----------------ASPSSL
A0A350Y472      ------GNAA------------FG------IPNNPESL----------------ASPSSI
A0A355DVB4      ------GNAA------------FG------IPNNPESL----------------ASPSSI
A0A1Z4RMB9      ------GQG---------------------VQVSQGLL----------------EGQDGT
A0A318B4H2      ------------------------------------------------------EGGR-S
A0A2K3BR24      ------QEEL------------PSNA----LADDNFSL----------------QLSS-L
K9YXY1          ------QEEL------------PSNA----LADDNFSL----------------QLSS-L
A0A1Q4RTR1      ------GGAP------------QG--------LNERDL----------------NLDS-L
A0A1Z4SQV2      ------GST-------------QA--------LNERDL----------------QIDP-L
A0A2H2XGN1      ------GST-------------QA--------LNERDL----------------QIDP-L
A0A433UXH8      ------GKV-------------QN--------LNERDL----------------QIDP-L
A0A1U7HGH0      ------QGQ---------------------TPNGNNQL----------------QVGQ-I
K9XJD3          ------QGQ---------------------ALN-NSQL----------------QVGE-I
K9SX01          ------GTN---------------------ELISDQDL----------------QIGG-A
A0A4P7ZT55      ------------------------------------------------------QLDA--
A0A1E5QIR9      ------GNSP------------GA--------IAPGNL----------------QMGQ-L
A0A6P1A9A0      ------GTDR------------VSQNAQSMAA----------------------SPNP-I
A0A1Z4IBC7      ------GNAP------------VT----------QGSL----------------QVGQ-L
A0A5Q0GKD1      ------GTAQ------------VT----------QGSL----------------QVGQ-L
Q3MDC6          ------GTAQ------------VT----------QGSL----------------QVGQ-L
A0A1Z4KM73      ------GTAQ------------VT----------QGSL----------------QVGQ-L
Q8YNX7          ------GTAQ------------VT----------QGSL----------------QVGQ-L
A0A367R4K6      ------GEAQ------------VT----------EGSL----------------QVGQ-L
A0A1E2WSV8      ------GTAQ------------IT----------EGSL----------------QVGQ-L
A0A7D7L9Y1      ------GTAQ------------IT----------EGSL----------------QVGQ-L
A0A2R5FRT9      ------GTAQ------------IT----------EGSL----------------QVGQ-L
A0A2K8T1B6      ------GTGQ------------IT----------EGSL----------------QVGQ-L
A0A235I9I0      ------GGAQ------------IT----------QGSL----------------QVGQ-L
A0A2D0HQT8      ------GGAQ------------IT----------QGSL----------------QVGQ-L
A0A2L2NU95      ------GKAQ------------IT----------QGSL----------------QVGQ-L
A0A367S084      ------GGAQ------------IT----------QGSL----------------QVGQ-L
A0A1Z4SMD6      ------GPSG------------MNLVFGNRQTVSTGKL----------------QIGQ-I
A0A2H2Y096      ------GPSG------------MNLVFGNRQTVSTGKL----------------QIGQ-I
K9S8M8          ------NGT-------------------PASDINPS-Y----------------QSGE-L
A0A1Z4NFV0      ------GAN---------------------FNTTPERL----------------EVQG-L
A0A3M9ZEU1      ------GMQ---------------------IPISEGGL----------------QLGT-L
A0A1Z4JK72      ------GAS---------------------VQVAPGAL----------------QVGD-I
A0A0N7Z489      ------GSS---------------------VQVSPNRL----------------QVGD-I
A0A0S3TXS2      ------GAN---------------------VSVAPGAL----------------QVGD-I
A0A2A2TPF8      ------PSK--------------------NVKIDPNSL----------------QLGA-L
A0A1Z4R0P8      ------GAN---------------------VKISPNSL----------------QLGG-L
A0A0T7BUI3      ------GNQ---------------------LEVSLSNL----------------QVGK-I
A0A1Z4LP32      ------GRQ---------------------QNISNSRL----------------QIGD-I
K9REP9          ------GRQ---------------------QNIPNNRL----------------QIGE-I
A0A1Z4SIJ3      ------GTT---------------------DNISTNKL----------------QVGK-I
A0A2H2XPG4      ------GTT---------------------DNISTNKL----------------QVGK-I
A0A2A2TC28      ------GSG----------------KIGSTKNISPTNL----------------QIGK-I
K9V3C7          ------GSS---------------------QQITPGNL----------------QIGD-I
A0A1Z4T6Y7      ------GTN---------------------VKVSPNKL----------------QLGQ-L
A0A2H2Y561      ------GTN---------------------VKVSPNKL----------------QLGQ-L
A0A1Q4S362      ------GTN---------------------VKVSPDKL----------------QLGQ-L
A0A3S1CIN8      ------GTN---------------------VKVSPDKL----------------QLGQ-L
A0A0C1NCB0      ------GSQ---------------------REISTDKL----------------QLGK-I
A0A844MLU2      ------GSQ---------------------QKVSTSKL----------------QLGK-I
A0A2N6K7Q9      ------GIP----------------------IVSPGKL----------------QIGK-I
A0A2N6MXH6      ------GIP----------------------IVSPGKL----------------QIGK-I
A0A2N6M5A8      ------GIP----------------------IVSPDKL----------------QIGK-I
A0A2N6LL61      ------GIP----------------------IVSPGKL----------------QIGK-I
A0A0S3TP66      ------GIP----------------------IVSPGKL----------------QIGK-I
G6FP91          ------GIP----------------------IVSPGKL----------------QIGK-I
A0A1U7GYR5      ------GIP----------------------IVSPGKL----------------QIGK-I
A0A2N6KY52      ------GIP----------------------IVSPGKL----------------QIGK-I
A0A2N6KMP5      ------GIP----------------------IVSPGKL----------------QIGK-I
A0A2N6MA45      ------GIP----------------------IVSPGKL----------------QIGK-I
A0A4Q9J9V9      ------GIP----------------------LVSPSKL----------------QIGK-I
A0A328IGA1      ------GIP----------------------LVSPSKL----------------QIGK-I
A0A4D9CE41      ------GIP----------------------LVSPSKL----------------QIGK-I
A0A0M0SFT2      ------GIP----------------------LVSPSKL----------------QIGK-I
A0A1Z4TLC8      ------GIP----------------------LVSPGKL----------------QIGK-I
A0A1Z4IYV4      ------GTKG------------IKQVLGTQKNVPPGKL----------------QVGK-I
A0A1Z4Q0T6      ------GTKG------------IKQVLGTQQNVPPGKL----------------QVGK-I
A0A0C2PT44      ------GAKG------------IKQVLGTQQNVPPGKL----------------QVAK-I
A0A1D2P6J4      ------GTKG------------IEQVLGTQKNVPPGKL----------------QIGK-I
A0A0C2LFH0      ------GPSG------------VKQVLGTQQNVAPGKL----------------QIGK-I
A0A856M734      ------GPSG------------VKQVLGTQRNVAPGKL----------------QIGQ-I
B4WP72          ------TNGR------------QQ------FE--NSNM----------------QLGE-L
A0A2T1CIL7      -------GGK------------QL------GSLKSKLLSI--------------SDGA-S
A0A433V7A0      ------MQQP------------IP----------KGNF----------------QFGE-T
A0A2T1FTR8      ------VGEQ------------QFQGKLVELQ----------------------PSG--I
K9UA41          ------IGEQ------------QFQGKLVELQ----------------------PSG--I
A0A563VS48      ------GGEQ------------QA------LLGNTNIL----------------ALGE-S
A0A7Y0NUK1      ------GSEQ------------KA------LLTNTNIL----------------ALGE-L
A0A0C2LBE2      -------GSN------------QQ------IS--LGNL----------------QNGS-L
A0A433NN38      -------GKN------------QQ------VS--LKNL----------------QIGG-V
A0A2N6K0T2      -------GNN------------QP------VS--PANL----------------QMGE-V
A0A2N6ML72      -------GNN------------QQ------IS--TANL----------------QMGE-V
G6FQZ6          -------GNN------------QQ------IS--TANL----------------QMGE-V
A0A2N6MQX9      -------GNN------------QQ------IS--TANL----------------QMGE-V
A0A2N6KXT6      -------GNN------------QQ------IS--TANL----------------QMGE-V
A0A2N6KGB9      -------GNN------------QQ------IS--TANL----------------QMGE-V
A0A2N6L3Y5      -------GNN------------QQ------IS--TANL----------------QMGE-V
A0A0S3TIS7      -------GNN------------QQ------IS--TANL----------------QMGE-V
A0A1U7GW28      -------GNN------------QQ------IS--TANL----------------QMGE-V
A0A2N6LW63      -------GNN------------QQ------IS--TANL----------------QMGE-V
A0A328IH74      -------GNN------------QQ------IS--TANL----------------QMGE-V
A0A4D9CIB0      -------GNN------------QQ------IS--TANL----------------QMGE-V
A0A1Z4TQ63      -------GNN------------PQ------IS--TANL----------------QMGE-V
A0A4Q9J8G2      -------GNS------------QQ------MS--TANL----------------QMGE-V
A0A350Y0P6      -------GLK------------QS------IP--LNNL----------------QSNE-F
A0A352X940      -------GTG------------EI------LP--TENL----------------QIGD-L
B8HTN4          ------QASR------------KG------GSLPTSNL----------------QTGA-S
A0A6P1AFJ5      -------GSD------------NVDSEVQFLA----------------------ASPNPL
B0CAX4          -------ETK------------QP------QP--LRNL----------------QAGE-S
A0A1Z4RN12      -------GPG------------QQG-----LVNSVNIA----------------SLGE-L
A0A2T1CMF9      -------GPQ------------QQG-----LAGQINIL----------------RLGE-L
Q7NDC5          -------GRR------------GLPDSLLDANLGTGRTEPAAVPDDLP------RLDA-V
U5QGK3          -------GQP------------GLPDSLVDASVAAEAQAPAT-KDNLP------RLDL-V
A0A2W4UY24      ------GSDQ------------IA------LP--DDDL----------------QAGE-L
A0A838VM23      -------NGQ------------QL------VS--DASL----------------QMGA-S
A0A0D8ZUV2      --------AN------------TN------SPVQGANL----------------QIGE-S
A0A433VDI0      -------DAG------------VR------RQVTSQQL----------------QIGE-S
A0A3D1PG43      -------GE--------------P------KQVPIKDL----------------QMGA-L
A0A2P8QQ72      -------GN--------------S------KQVSNRNL----------------EAGE-L
K9TZQ7          -------GN--------------S------KQVSNRNL----------------EAGE-L
A0A6N8G584      -------GNA------------AA------TEVSPSNL----------------QMGQ-L
A0A2G7GPR0      -------GNA------------AA------TEVSPSNL----------------QMGE-I
K9XH68          -------GNA------------AA------TEVSPGNL----------------QMGE-I
A0A1U7HW70      ------GGNA------------AA------TEVSPGNL----------------QMGE-I
A0A2S6VEJ8      -------GNA------------AA------TEVSPGNL----------------QMGQ-I
A0A140KBA0      -------GSQ------------SASSV---AQ--LNIL----------------GLGR-L
K9XSG1          -------GSQ------------SASSV---AQ--LNIL----------------GLGK-L
A0A2T1GMT4      -------GSQ------------AQ------IP--QGLL----------------KIGD-L
K9UI51          -------GSQ------------AQ------IP--QGLL----------------KIGD-L
A0A1Z4QL41      -------GSQ------------TQ------FT--QGFL----------------QIGE-L
K9TYI2          -------GSQ------------TK------VA--AGLL----------------QIGE-L
A0A252D4T4      -------GTS------------AN------IQ--PKTL----------------QIGP-T
A0A252DJH5      -------GTS------------AN------IQ--PKTL----------------QIGP-T
A0A252EB80      -------GTQ------------VN------IQ--PQSL----------------QIGE-T
A0A6G9SKZ9      -------AVQ------------PN------SQ--PKTL----------------QIGE-T
A0A1Z4HPW5      -------AGP------------VN------YQ--PKTL----------------QIGE-T
A0A1Z4MSN1      -------AGP------------VN------YQ--PKTL----------------QIGE-T
A0A1Z4U1C2      -------AGP------------VN------YQ--PKTL----------------QIGE-T
A0A0D6KV51      -------AGP------------VN------YP--PKTL----------------QIGE-T
A0A1Z4MKF8      -------AGP------------VN------YP--PKTL----------------QIGE-T
A0A2C6WC43      -------GSN------------AQ------VP--QNLL----------------QIGE-L
A0A841WRE0      -------GSN------------AQ------VP--QNLL----------------QIGE-L
A0A1Z4L5A1      -------GSN------------AQ------VP--QNLL----------------QIGE-L
A0A367QD86      -------GNN------------AQ------VP--QNLL----------------QIGE-L
A0A2K8SM78      -------GNQ------------TQ------IP--QSLL----------------QIGE-L
A0A2R5FPC0      -------GNQ------------TQ------IP--QRLL----------------QIGD-L
A0A5P8W5T6      -------GNQ------------TQ------IP--QNLL----------------QIGE-L
A0A7D7LDT7      -------GNR------------TP------VP--QSLL----------------QIGE-L
A0A235IZ96      -------GNQ------------TQ------VP--QSLL----------------QIGE-L
A0A2L2NGP0      -------GNQ------------TQ------VP--QSLL----------------QIGE-L
K9QM62          -------GKR------------TT------VS--PKLL----------------QIGE-L
A0A1Z4FWI3      -------GNP------------SN------IQ--PRTL----------------QIGE-T
A0A1Z4JYE7      -------GLG------------QK------LQFSPTLL----------------QIGE-V
A0A0F5YE28      -------GSQ------------AV------VP--EGLL----------------QVPQGQ
U7QEH7          -------GSQ------------AV------VP--EGLL----------------QVPQGQ
A0A3S1ATK5      -------GSS------------AK------IP--EEQLQKTIASIGSGTQFPQGQAGE-I
A0A2Z6CPH0      -------GQQ------------SQ------FA--PRLL----------------QIGE-L
A0A1Z4GT50      -------GNQ------------VK------IP--QGQL----------------QIGE-L
A0A1Z4GIX0      -------GTQ------------AQ------VP--QRLL----------------QIGE-L
A0A2H6LC24      -------GTQ------------AQ------VP--QRLL----------------QIGE-L
B2J6N5          -------GNK------------TE------VS--QNLL----------------QIGG-L
A0A367RMI4      -------GNQ------------TQ------VP--QNLL----------------QIGE-L
A0A235HUM0      -------GNQ------------TQ------VP--TSLL----------------QIGE-L
A0A2L2NW47      -------GNQ------------TQ------VP--QSLL----------------QIGE-L
A0A1E2WUR1      -------GNQ------------AP------VP--QSLL----------------QIGE-L
A0A235IKU3      -------GNQ------------TQ------IP--QSLL----------------QIGE-L
A0A1U7MYU6      -------GSQ------------SLAGTQIQIT--QGLL----------------EVDQ-L
A0A1D8TNX9      -------GSQ------------SLASTQIQIT--QGLL----------------EVDQ-L
A0A6P0L6C2      -------GSQ------------SLASTQIQIT--QGLL----------------EVDQ-L
A0A6P0MVH0      -------GSQ------------SLAATQIQIT--QGLL----------------EVDQ-L
A0A6P0KJV0      -------GSQ------------SLAGTQIQIT--EGLL----------------EVDE-L
A0A6L9ZJG4      -------GSQ------------SLAATQIQIT--QGLL----------------EVDQ-L
A0A846GI17      -------GSQ------------SLAGTQIQIT--QGLL----------------EVDQ-L
F4XKF3          -------GSQ------------SLAGTQIQIT--QGLL----------------EVDQ-L
A0A1D9FX10      -------GSQ------------SLAGTQIQIT--EGLL----------------EVDE-L
A0A6P0Q0T0      -------GSQ------------SLAGTQIQIT--QGLL----------------EVDQ-L
A0A6P0W5I0      -------GSQ------------SLAGTQIQIT--QGLL----------------EVDQ-L
A0A845XJ02      -------GSQ------------SLAGTQIQIT--QGLL----------------EVDQ-L
A0A846D190      -------GSQ------------SLAGTQIQIT--QGLL----------------EVDQ-L
A0A3C0NJ41      -------GSQ------------QQ------VP--TGNL----------------QIGQ-F
A0A352AG88      -------GVV------------RP------VS--ASSL----------------QMGD-F
A0A350Y374      -------GYD------------QF------VA--TQNL----------------QIGE-F
A0A355DPX0      -------GYD------------QF------VA--TQNL----------------QIGE-F
A0A0S3TYD7      -----------GQTTAPRATED-----------DL-------------------QMG-QF
A0A2T1DNG3      SSSPGSGESLLSTG----------------------------------------QLG-GF
A0A140K3H3      -----------GADTQAQALNPGQPVDSQGASTQV-------------------SGTIST
K9XUB8          -----------TANTQVSAANTNQAVESQGGSTQV-------------------SGTIST
A0A563VLD6      -----------NNTNTTTSITNATESESTTENSEV-------------------NSQGNI
A0A7Y0NVW6      -----------TNADNQTTTNSGSTNNTTTNNSNI-------------------NSQGSV
U5QL42          PAALPEARSLAAAP----------------------------------------VRQ-TI
A0A6H2NHD5      -----------SLG----------------------------------------HQG-AV
A0A2P8W4F7      -----------SLG----------------------------------------YKG-SV
A0A5Q4E0Z4      -----------ALG----------------------------------------YQG-SV
A0A2P8VVX1      -NVTELDPTLLSYL----------------------------------------QLG-GI
A0A2P8WHY0      -PVETLNPDIASLL----------------------------------------QLG-GV
A0A563VQJ3      ---VEVSDGLLNAG----------------------------------------D---NN
A0A7Y0IRJ7      ---VEVSDGVLNTG----------------------------------------D---NS
A0A2T1CMT9      PPNFSSDLKLLQKQ----------------------------------------GLV-GS
A0A7G8J1V5      ------------------------------------------------------------
A0A354B169      ------------------------------------------------------------
Q0IDT5          ------------------------------------------------------------
A0A7G8FZD9      ------------------------------------------------------------
G4FMX5          ------------------------------------------------------------
A3ZA21          ------------------------------------------------------------
A0A076HBF2      ------------------------------------------------------------
A0A7G8FP50      ------------------------------------------------------------
A0A7G8E8K7      ------------------------------------------------------------
A0A7G8GNR2      ------------------------------------------------------------
A0A7G8ICD3      ------------------------------------------------------------
A0A2D6FCW3      ------------------------------------------------------------
A0A7G7KJ95      ------------------------------------------------------------
A0A7G8EAN3      ------------------------------------------------------------
A0A1D8TX52      -QLVSTGSNLLTEG----------------------------------------QLG-GV
A0A1D9G4T2      -QLVSTGSNLLTEG----------------------------------------QLG-GV
A0A6P0PR27      -KLVTTGNNLLTEG----------------------------------------QLG-GV
A0A6P0WER7      -KLVTTGNNLLTEG----------------------------------------QLG-GV
A0A845XM36      -KLVTTGNNLLTEG----------------------------------------QLG-GV
A0A846DAT1      -KLVTTGNNLLTEG----------------------------------------QLG-GV
A0A846GZK8      -KLVTTGNNLLTEG----------------------------------------QLG-GV
F4XP71          -KLVTTGNNLLTEG----------------------------------------QLG-GV
A0A6P0KZ31      -QLVSTGSNLLTEG----------------------------------------QLG-GV
A0A6P0LPB8      -QLVSTGSNLLTEG----------------------------------------QLG-GV
A0A6L9YR57      -QLVSTGSNLLTEG----------------------------------------QLG-GV
A0A845WMG9      -QLVSTGSNLLTEG----------------------------------------QLG-GV
A0A6P0SEV1      -QLVTTGNNLLTEG----------------------------------------QLG-GV
A0A6B3N2I8      -QLVTTGSNLLTEG----------------------------------------QLG-GV
A0A6M0B891      -QLVTTGSNLLTEG----------------------------------------QLG-GV
A0A6P0IJQ1      -QLVTTGSNLLTEG----------------------------------------QLG-GV
A0A6P0J8J8      -QLVTTGSNLLTEG----------------------------------------QLG-GV
A0A6P0ZSH6      -QLVSTGSNLLTEG----------------------------------------QLG-GV
A0A845VS63      -QLVTTGSNLLTEG----------------------------------------QLG-GV
A0A1U7N5X9      -QLVTTGNNLLTEG----------------------------------------QLG-GV
A0A6L9Z1V0      -QLVTTGNNLLTEG----------------------------------------QLG-GV
A0A6P0LC12      -QLVSTGSNLLTEG----------------------------------------QLG-GV
A0A6P0MVJ3      -QLVSTGSNLLTEG----------------------------------------QLG-GV
A0A2W6ZAV2      ------------------------------------------------------------
K9W742          -SSQLKGENLLTEG----------------------------------------QLG-ET
A0A3D1PBA3      -QSGSTGENILTQG----------------------------------------QLG-GI
K9XPB0          -NFAVQLQSLLRQG----------------------------------------ELV-NS
A0A350Y7Z1      -QIAFSTQNLLTEG----------------------------------------QLG-NN
A0A352X2A7      -GEDLTSNTLLTEG----------------------------------------QLG-EN
A0A0D8ZYV0      -AQANAAGDLLSQG----------------------------------------QRG-GL
A0A433VMS2      -AAGNAADGILQQG----------------------------------------QLG-AL
K9TYA7          -AAGNAADGILQQG----------------------------------------QLG-AL
A0A2P8QUE1      -AAGNAADGILQQG----------------------------------------QLG-AL
K9SA61          -GTSSQGDRLLTEG----------------------------------------QMG-EL
A0A2G7GMH8      -ASEEDTT---TAG----------------------------------------QQG-QL
A0A6N8FU92      -ASDEDTT---TAG----------------------------------------QQG-QL
A0A2T1DWE8      QVNVKGDGGLSV-G----------------------------------------QLS-AT
A0A832H7C4      QL---GNERLQKEG----------------------------------------QLG-DT
A0A1U7I8L3      LPPTTTNSNLLEKG----------------------------------------QLG-KL
A0A2T1DJL8      -AIAQSGDGLVAIG----------------------------------------QLG-EN
A0A1Z4J9W0      ---AASSESLFATG----------------------------------------QLG-EN
A0A0N7Z5K9      -AIAGSDSALFSTG----------------------------------------QLG-EN
A0A0S3TXC5      -SIAGSDAGLFSTG----------------------------------------QLG-EN
A0A846FBD3      -----------GSN---RSVSW---------G-DL-------------------QIR-DI
K1XF69          -----------GSS---RPFSR---------G-LL-------------------RVM-DV
B5W297          -----------GSS---RPFSR---------G-LL-------------------RVM-DV
H1W7M8          -----------GSS---RPFSR---------G-LL-------------------RVM-DV
A0A5Q4H6A5      -----------GSG---RAFSR---------G-LL-------------------RVM-DV
D5A466          -----------GSG---RAFSR---------G-LL-------------------RVM-DV
B4WQE3          ------------------------------------------------------REGVRV
U5QJM6          -----------GGD---GKQAE-----------SLRDSLAGTLESNRTSSSTADRYG-EL
A0A0V7ZFJ4      -----------DNG---NSISE---------R-NL-------------------QIG-EI
A0A235IXQ2      -----------GSS---EPIPE---------Q-DL-------------------QIG-EL
A0A367RIS1      -----------GSA---QPIPD---------Q-DL-------------------QIG-EL
A0A841V8H9      -----------GSS---QLIPD---------Q-DL-------------------QIG-EL
A0A5Q0GJJ5      -----------GSW---QPIPE---------Q-DL-------------------QIG-EL
Q3MEB7          -----------GSW---QPIPE---------Q-DL-------------------QIG-EL
A0A1Z4KHN9      -----------GSS---QPIPE---------Q-DL-------------------QIG-EL
Q8YT70          -----------GSS---QPIPE---------Q-DL-------------------QIG-EL
A0A7U3NLX2      -----------GSS---QPIPE---------Q-NL-------------------QMG-EL
A0A166IWU6      -----------GSS---QPIPE---------Q-DL-------------------QIG-EL
A0A2S0Q8C0      -----------GSS---QPIPE---------Q-DL-------------------QIG-EL
W6FSX4          -----------GSS---QPIPE---------Q-DL-------------------QIG-EL
A0A218Q4C1      -----------GSS---QPIPE---------Q-NL-------------------QIG-EL
A0A6P1ZT04      -----------GRS---QPIPD---------Q-DL-------------------QIG-EL
A0A0V7ZNJ9      -----------NNNSNDSSITE---------D-NL-------------------QVG-EI
A0A5P8VSD1      -----------SSS---QPIPE---------Q-DL-------------------QIG-EL
A0A1S1ZVW2      -----------GNV---EVLQQ---------S-NL-------------------QIG-EL
A0A0R0M9H9      -----------GNA---EVLQQ---------S-NL-------------------QIG-EL
A0A7H0F4U6      -----------GNA---EVLQQ---------S-NL-------------------QIG-EL
A0A7W2A1T7      -----------GNA---EVLQQ---------S-NL-------------------QIG-EL
A0A838WI98      -----------GNA---EVLQQ---------S-NL-------------------QIG-EL
A0A853MJX6      -----------GNA---EVLQQ---------S-NL-------------------QIG-EL
A0A1B7WX82      -----------GSS---DALPQ---------Q-NL-------------------QIG-EL
A0A1B7WTD1      -----------GNS---NSLPK---------Q-NL-------------------QIG-EL
A0A480ABC0      -----------GNS---NSLPK---------Q-NL-------------------QIG-EL
A0A1Z4LRU5      -----------GNG---VSVRE---------P-DL-------------------QIG-EL
A0A1Z4JVB4      -----------GTS---ADVPE---------Q-NL-------------------QIG-DL
K9PIA4          -----------GNS---KYVPE---------Q-KL-------------------QMG-KL
A0A1Z4HVE1      -----------GTS---ESVPE---------Q-NL-------------------QIG-QL
A0A252ECZ1      -----------GNS---EFVPE---------Q-NL-------------------QIG-KL
A0A1Z4G5Y1      -----------GSS---EFVPE---------Q-NL-------------------QIG-VL
A0A252DNA2      -----------GSS---EFVPE---------Q-NL-------------------QIG-KL
A0A252E1Q4      -----------GSS---EFVPE---------Q-NL-------------------QIG-KL
A0A6G9SK36      -----------GDS---EYMPE---------Q-NL-------------------QIG-KL
A0A1Z4M597      -----------GNS---EYMPE---------Q-NL-------------------QIG-NL
A0A1Z4MWT1      -----------GNS---EYTPE---------Q-NL-------------------QIG-NL
A0A1Z4TX53      -----------GNS---EYTPE---------Q-NL-------------------QIG-NL
A0A2A2TNQ5      -----------GVG---ESVKE---------Q-DL-------------------QIG-EL
A0A3S1C4K5      -----------DTK---QPVSE---------K-NL-------------------QIG-QL
A0A1X4G3D5      -----------GNV---GALGE---------R-SL-------------------YMP-SL
D4TNI2          -----------GNV---GALGE---------R-SL-------------------YMP-DL
A0A1Z4H6Z8      -----------GSS---ESVPE---------Q-NL-------------------QIG-EL
A0A3F3KPR9      -----------GNA---EVLQQ---------S-NL-------------------QIG-EL
A0A1Z4NPM1      -----------GGG---VAVPE---------R-DL-------------------QIG-QL
A0A1Z4UZW9      -----------GSS---ESLPK---------Q-NL-------------------HIG-EL
A0A1B7VSH4      -----------GNF---ESLSQ---------Q-NL-------------------QIG-EL
A0A1B7W126      -----------GNF---ESLSQ---------Q-NL-------------------QIG-EL
A0A3D4C6Q6      -----------GNF---ESLSQ---------Q-NL-------------------QIG-EL
A0A0K2M5H0      -----------GSS---EFLSK---------Q-NL-------------------QIG-EL
A0A844I4P0      -----------GNF---ESLSK---------Q-NL-------------------QIG-EL
A0A1B7UVJ4      -----------GSS---DALSQ---------Q-NL-------------------QIG-EL
A0A1B7UTR1      -----------GSS---KSLPQ---------Q-NL-------------------QVG-EL
K7W0A4          -----------GSS---KSLPQ---------Q-NL-------------------QVG-EL
A0A5C0DRW9      -----------GSS---KSLPQ---------Q-NL-------------------QVG-EL
A0A6H2C088      -----------GSS---KSLPQ---------Q-NL-------------------QVG-EL
A0A1Z4RPC6      -----------GT-----KVSE---------G-LL-------------------QAG-NV
A0A2T1CMZ0      -----------GA-----KVSE---------G-LL-------------------QSD-NL
L8M4F7          -----------GQ-----QVSP---------G-LI-------------------KNN-QY
A0A140K2P2      -----------GQG---VEISE---------G-LF-------------------NND-GL
K9XWX4          -----------GQG---VEISE---------G-LF-------------------NND-GL
A0A140KB14      -----------GSN---TKISE---------G-LL-------------------RSD-GN
K9XX88          -----------GSN---TKISE---------G-LL-------------------RSD-GN
L8LZE9          -----------GSN---VQISD---------G-LL-------------------QSDLGQ
A0A563VSV6      -----------GTG---VKVSD---------G-LL-------------------QDN-RF
A0A7Y0IQB0      -----------GSG---VKVSD---------G-LL-------------------QSD-RL
A0A433NM31      -----------KGQ---QPLLD---------Q-NL-------------------QIG-EL
A0A1Z4NDS1      -----------GNQ---QIQLD-----------NL-------------------QLG-DL
U9VXM0          -----------GAN---QLDLP---------EDDL-------------------QSG-DL
A0A6M0RI13      -----------GAN---ELNLP---------SDDL-------------------QSG-QL
A0A6M0S1N5      -----------GAN---ELNLP---------SDDL-------------------QSG-QL
K9F4D9          -----------GAN---ELNLP---------SDDL-------------------QSG-QL
A0A6I5QPI5      -----------GQE---LTVPV----DSLNVG-RL-------------------QLG-EL
A0A1Z3HMQ0      -----------GTQ---ANISP---------G-DL-------------------QMS-EL
A0A433W533      -----------GKT---RTLAD---------G-KL-------------------QIG-ES
A0A2P8QWJ3      -----------GKT---RTLAD---------G-KL-------------------QIG-ES
K9U6L7          -----------GKT---RTLAD---------G-KL-------------------QIG-ES
U5DPF5          -----------SES---PAAGGAIPVDVAIASGTL-------------------QLS-EV
A0A1E5QP61      -----------GNN---QAVDR---------R-DL-------------------QIG-EL
A0A846DWC7      -----------GNN---QVVDR---------R-DL-------------------QIG-EL
A0A845Y5J4      -----------GFG---QQIPG---------Q-NL-------------------QMG-EI
A0A6P0X488      -----------GFE---QLIPG---------D-SL-------------------QMG-DL
A0A6P0VDM0      -----------GFE---QLIPG---------E-SL-------------------QMG-EL
A0A6P0UVD5      -----------GFE---QLIPG---------E-SL-------------------QMG-EL
A0A846BFF2      -----------GFE---QLIPG---------E-SL-------------------QMG-EL
A0A6M0G142      -----------GFR---QLVPG---------E-NW-------------------QMG-EL
A0A6P0MR53      -----------GFE---QQIPG---------E-SL-------------------QMG-DL
A0A3M2GIL5      -----------GSQ---LQLPR---------E-SF-------------------EIG-LV
A0A6H1TSJ9      -----------GSQ---LQLPR---------E-SF-------------------EIG-LV
A0A3M1PML8      -----------KSD---WSSIR---------N-DL-------------------QAG-AL
A0A6M8BE85      -----------RSD---WNNIR---------N-DL-------------------QAG-AL
A0A0T7BPZ0      -----------GES---TKLSI---------Q-NL-------------------QIG-DV
A0A352X442      -----------GSE---AEVAT---------T-NL-------------------QIG-QT
A0A6B3NF44      -----------GGK---QQVPT---------E-NL-------------------QIG-EL
A0A6M0EPL4      -----------GGK---QQVPT---------E-NL-------------------QIG-EL
A0A6P0K6L6      -----------GGK---QQVPT---------E-NL-------------------QIG-EL
A0A6P0MRR9      -----------GDK---PEVVNLASGQSQLLE-NV-------------------ELS-SD
A0A6P0X1X4      -----------GDK---PGFITLASGQIQALE-NL-------------------EFS-RN
A0A6P0UX57      -----------GDR---PGVVTLASGQIQSLE-NV-------------------EVS-RD
A0A846B9S8      -----------GDR---PGVVTLASGQIQSLE-NV-------------------EVS-RD
A0A0M0SHU3      -----------GSN---QQMST---A-------SL-------------------QMG-EV
A0A1D2PBN3      -----------GSG---RQIPT---L-------NL-------------------QTG-EL
A0A0C2LVR7      -----------GNS---RQIPT---L-------NL-------------------QTG-EL
A0A1Z4PQB9      -----------GSD---RQIPT---L-------NL-------------------QTG-EL
A0A1Z4SFN6      -----------GSN---QQIPL---ENVQNLQ-NL-------------------QIG-EL
K9PGI8          -----------GST---KTVIK---G-------NL-------------------QIG-EL
A0A654SFI6      ------------------------------------------------------------
K9SSQ0          -----------GTK---PADVT-----------PE-------------------GQS-SI
A0A2W1JIN9      -SVNIAP-----------------------------------------------ESA-RV
A0A318AJV1      ------------------------------------------------------------
A0A845WDS5      ----------PNSK---TILPL-----------DV-------------------ASD-QL
A0A6P0IC70      ----------PNPQ---TISPS-----------DV-------------------ASD-QL
A0A845VVD9      ----------PNPQ---TISPS-----------DV-------------------ASD-QL
A0A6B3MUB5      ----------PNPQ---TISPS-----------DV-------------------ASD-QL
A0A6M0B7N4      ----------PNPQ---TISPS-----------DV-------------------ASD-QL
A0A6P0J9W3      ----------PNPQ---TISPS-----------DV-------------------ASD-QL
A0A6P0ZWE1      ----------PNPQ---TISPS-----------DV-------------------ASD-QL
A0A1U7N2U4      -Q----PTNQLTNQ---IIPPA-----------DV-------------------ASD-QL
A0A6L9YZL1      -QLTNQSTNQSNNQ---IIPPG-----------DV-------------------ASD-QL
A0A6P0KYM4      -QPTNQFT----NQ---IIPPG-----------DV-------------------ASD-QL
A0A6P0LSD6      -QPTNQFT----NQ---IIPPG-----------DV-------------------ASD-QL
A0A6P0PNZ7      ------PTNQSNNQ---IIAPG-----------DV-------------------ASD-QL
F4XV38          ------PTNQSNNQ---IIAPG-----------DV-------------------ASD-QL
A0A6P0W137      ------PTNQSNNQ---IIAPG-----------DV-------------------ASD-QL
A0A845XHF7      ------PTNQSNNQ---IIAPG-----------DV-------------------ASD-QL
A0A845ZEG9      ------PTNQSNNQ---IIAPG-----------DV-------------------ASD-QL
A0A1D9G1F2      ------PTNQSNNQ---IIAPG-----------DV-------------------ASD-QL
A0A846CJ58      ------PTNQSNNQ---IIAPG-----------DV-------------------ASD-QL
A0A6L9Y9E2      -QLTNQSTNQSNNQ---IIPPA-----------DV-------------------ASD-QL
A0A6P0SGR0      -QLTNQSTNQPNNQ---IIPPA-----------DV-------------------ASD-QL
A0A6M0BK48      -QLTNQPTNQLTNQ---IIPPG-----------DV-------------------ASD-QL
A0A845WG36      ------PTNQPTNQ---IIPPG-----------DV-------------------ASD-QL
A0A6P0X384      ------P----PNQ---SISSL-----------DI-------------------ASD-EL
A0A2P8QIL5      -----------GNP---AASTS-----------NP-------------------ATD-KL
A0A433W447      -----------GNP---AASTP-----------NA-------------------ATD-KL
K9U1K8          -----------GNP---AASTP-----------NA-------------------ATD-KL
A0A1Q4RZJ6      ------P---KAGA---NNSNN-----------NI-------------------AGD-PI
A0A1Z4SNV3      ------PVDTSSSN---NSNLN-----------NV-------------------AGD-AI
A0A2H2XJQ1      ------PVDTSSSN---NSNLN-----------NV-------------------AGD-AI
A0A3S5K358      ------P----GAG---VNNSN-----------NI-------------------AGD-PI
A0A0T7BPJ4      ------P----DGQ---S-QTT-----------NF-------------------ASD-DL
A0A0C1QS61      ------S----GER---PVSPN-----------NV-------------------AAD-QV
A0A139X3R8      ------S----ENQ---PVSPN-----------NV-------------------AAD-QV
A0A844MZP8      ------S----GNQ---PVAPN-----------NV-------------------RAD-EV
A0A1Z4I7C5      ------S----SNQ---TANFQ-----------DL-------------------AND-QI
A0A844MST0      ------T----GNR---DIAPK-----------NV-------------------ASD-QL
A0A0C2MDK7      ------T----KDQ---SVSTK-----------NF-------------------AGD-QL
A0A856MDH8      ------S----KNQ---SDSTN-----------NF-------------------AGD-QL
A0A1Y0RCK1      ------S----ENQ---NASAK-----------NF-------------------AGD-QL
A0A1Z4PWZ0      ------P----QGQ---TVSAN-----------NF-------------------AGD-QL
A0A0C2QLT0      ------S----QNQ---TTSAN-----------NF-------------------AGD-QL
A0A1Z4J2K1      ------P----KDQ---TSSAN-----------NF-------------------AGD-QL
A0A3S0ZSX0      ------P----QNQ---AIPTN-----------AV-------------------ASD-RI
A0A2N6K4T3      ------P----RNQ---SISSG-----------SV-------------------AGD-QI
A0A370CKT2      ------P----RNQ---SISSG-----------SV-------------------AGD-QI
A0A0S3TL97      ------P----RNQ---SISSG-----------SV-------------------AGD-QI
A0A2N6M8A0      ------P----RNQ---SISSG-----------SV-------------------AGD-QI
A0A2N6M9E1      ------P----RNQ---SISSG-----------SV-------------------AGD-QI
A0A2N6KJI4      ------P----RNQ---SISSG-----------SV-------------------AGD-QI
A0A2N6MZ77      ------P----RNQ---SISSD-----------SV-------------------AGD-QI
A0A2N6KT20      ------P----RNQ---SISSG-----------SV-------------------AGD-QI
G6FSN3          ------P----RNQ---SISSG-----------SV-------------------AGD-QI
A0A4D9CI02      ------P----RSK---SISSS-----------SV-------------------AGD-KI
A0A328I8B9      ------P----RSK---SISSS-----------SV-------------------AGD-KI
A0A4Q9J4Z7      ------P----RSK---SISSS-----------SV-------------------AGD-KI
A0A0M0SU69      ------P----GNT---SISSS-----------SV-------------------AGD-QI
A0A1Z4TIZ8      ------P----GNT---SISSS-----------SV-------------------AGD-KI
K9UYB2          ------P----DNQ---SIPDN-----------NI-------------------ADD-QI
A0A1Q4S1H4      ------N----GN------AVA-----------NI-------------------SND-TL
A0A433VBU6      ------S----GN------ALT-----------SV-------------------SND-NL
A0A218QN17      ------P----ANS---SVATN-----------SV-------------------AGD-QI
A0A846HD20      ------S----ANS---SVATN-----------SV-------------------AGD-QI
K9RKN2          ------N----TNN---SVRDN-----------QI-------------------ASD-EI
A0A2I8ADV2      ------A----NNQ---TIPTE-----------DV-------------------ASD-QI
A0A5Q0GMF5      ------S----SNQ---TANFN-----------NL-------------------SND-QI
Q3MEW0          ------S----SNQ---TANFN-----------NL-------------------SND-QI
A0A1Z4KIC7      ------S----SGQ---TDNFQ-----------DL-------------------AND-QI
Q8YSM5          ------S----SGQ---TDNFQ-----------DL-------------------AND-QI
                                                                            

K9SLA9          -------QAQLISNLANLETSKYGLRSRLEALSKLHQDYQKRIDSLPKIEQQQSQLERDL
A0A168TT23      -------------------AEYSNLEAEVAALEDEIAANEERILALNQQGVQYNILRREF
A0A0M1JWX9      -------RVGLIQQMVAAASQIEVLKMRNQVLAQAAGMLSEYREQFPIVIRQYTDLMREL
A0A844MWN9      -------RSTLIQQLILAESEASGQKKQAELLNLQIEKLNTILKSLPANQQKLVELQRQV
A0A2T1M1V6      -------RTAIVADLIRSQSTAQGLKQQASLLEKELDKLNNEVKFIAKNQGILIELQRKY
A0A2G7GCS2      -------RIEMIAELIRSQNNAAGLQQQANQIASEINRVNAELNSITQNRSQLINLQRQY
K9XBH8          -------RIDMIAELIRAQNTASGLQQQANQISSEINRVSTELNNITKNRAQLLDLQRRY
A0A1Z4LJ30      --------AALAEQMILAESQAFGMLKKAEQLQPTIDNLIKTLNGLPQKQATLLELQRQY
Q7NF11          -------RIDLILSLLEAERAAEARSRQSAQLGRTIEQATERLSAISTRQATLLDLQRRY
K9RI76          --------ASLAEQVILAESQVIGMQKKAEKLQPQIDKLSASLNSLPQKQAKLLELQRQY
A0A433VN22      -------RAVLIQQQLLSESEAEAQFQQARQLEKQITELQRYLNSLPAKQAQLLELQRQL
A0A139WSU3      -------RAALIQQQVLAESEATAQRRQAQQLNNQITQLQTTLKSFPVNQARLVELQRQV
A0A844MJB7      -------RAALIQQQILAESEATAQRRQAEKLNNQITELQTTLKSLPVNQAKLVELQRQV
A0A352AE27      -------RATLIQQLILAESTASAQQRQATQLQSQAEQLNATLKLIPGHQAKLLELKRQY
A0A3B8JH60      -------RATLIQQLATAESEASAQQRQADQLKSEIEKLNASLKALPGNQARVLELQRQV
A0A3C0N766      -------RATLIQQLATAESEASAQQRQADQLKSEIEKLNASLKALPGNQARVLELQRQV
K9W9J7          -------RATLIQQLVLAESEASGQRRQAEQLQNEIQKLSTTLRTFPANQSRLLELQRQV
Q7NJN6          -------RIDLILQLVQSQAENGALTNQAARIGEKAASLEERLRTLAPQQSRLKELQRRY
U5QCC3          -------RIDLILQLIQARSEGLAQNSQANQITEKIDSIDSQLRTMAPQQSKLLELNRRY
A0A1Z4JCS8      -------RNTLIEQLVLAETNANGQQRQAEQLQQQIDQRQKILNQLPANQAKLNALQRQA
A0A846GVZ3      -------RAMLIQQLILAESAASGQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLELTRQY
A0A6P0PI80      -------RAMLIQQLILAESAASGQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLELTRQY
A0A6P0WGT6      -------RAMLIQQLILAESAASGQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLELTRQY
F4XTX2          -------RAMLIQQLILAESAASGQQQQAEQLQQQIDQMKNTLTVIPVHQSRLLELTRQY
A0A3S0Y9N9      QLKPQGLQQGLLTNYASAEAERLSLQVRLKALAEMIQSYRQRADTIPQLELQQRQLEREI
A0A6P0ZKB8      QLRTLGLQQGLLGQFASVEAERLSLQVRLTSLADVIESYRARANTLPQLELQQRELEREI
A0A846EDH6      QLRTLGLQQGLLGQFASVEAERLSLQVRLTSLADVIESYRARANTLPQLELQQRELEREI
A0A433UNK7      QLRGQGLQQGLLGNYANVEAERLSLQVRLKSLAGVIESYRQRANTLPQLELQQRQLEREI
B8HNB0          -------VQGLTDKALEAQISLATQTAQLNGIRQAQQQVAERFQALPQLQQQYAELQRQL
A0A318BJ18      -------SGSIQAEYREAVQRENALQARVNQLKASYLDNRRR-------SIQYNIYQQEV
A0A3B8Y8H9      -------REDILSSLLKAETQLEELRARQKELIGLENDIRQEIAQLARLTSEYVDLQRKI
A0A2W1JVB9      -------QQRATSELVRFETERLAAEQVAAALATSQTDFQQRTEAIPALEKQLRQLLRDV
A0A6H1U102      -------QQGLATQLLQLETELEAQRSQLQEIRNAQGKVAVQFEQIPQLQQRYADLQREF
A0A7C3ZEJ3      -------QQDLAAQLLEVETELAAQSSQLQSIRQAQAQVENNFEKIPTLQQAYADLEREF
A0A2P8W9H0      -------QRELASYIRELENRDRALSETIVTL-------NQTTNRLSTVTRQYNALQREL
A0A6I5P386      -------QDQIANRIRELSERERALSETIEAL-------NVETKSLSTVARQYNDIQREL
A0A3M1SVZ4      -------EQELTQELVSLESERQGLNSQISALAQLQAGYQERLNVLPQLEQEERRLERQL
A0A318BG22      ------------AAYELALNQERALQVQLDQLKGSVSDLQTR-------SIQYMILQREV
A0A2T1E9V8      -------QQDLITTLTKLEIDRLGLITQKTTLLKQQAFYQKKAATLPELQQQQGELERQL
A0A1Z4LN32      -------KQELISRFVNLRSQRLGLTQKIDSLSDLKNRYKQRADVIPDLEKRQKELEQKL
A0A2I8A9F5      -------KRDLSLELGKLQSQRLGLEKRITSLSNLKSAYEQRLGAIPDLEKTHGELEQKM
A0A218Q6R8      -------RQEIVSEFVKLKSQRLGLAEKIQSISNFRNSYSQRVSNLPSLEKRQGELERKL
A0A218QGE0      -------KQNLTSDFVRLQSQRLGLEKKVEALSAVIASYKRRAQVMPNLEKQEGDLERRL
A0A846HDH5      -------KQNLTSDFVRLQSQRLGLEKKVEALSAIIASYKRRADVMPNLEKQQGDLERGL
A0A3M2GQQ6      -------KESLATQLLQVETEMSAGLSQLARIRQAQQDVAIQFENIPQLQQRYAELQREF
A0A6H1U2X0      -------KESLATQLLQVETEMSAGLSQLARIRQAQQDVAIQFENIPQLQQRYAELQREF
K9TLQ0          -------RSDLTGKLIETVNLMEMTRARQWAIAQAETIVQQQMQEQATLMRQYTDLQREL
K9QF04          -------RTEIIEKLIAASNQFQALLARQKALAIAENQARRNLQQFAGIARQYADLSRDL
K9W1T3          -------QQSLITDFARASAERASLEKQIYALANVEAAYRERINTLPKLEQQQRELERRL
K9SGJ5          -------QQNLAGALFETQTTMAVQAAQMGSVKLAQERVSAIFAQIPQLQQRYTELQRQL
A0A6N2JS94      -------QQNLASQLFDAQTTLAVSQAQLESIRNAQTEVSTAFSKIPQIQQKYVEIQRQL
A0A6C2DSN4      -------QQNLASQLFDAQTNLAVSQAQLESIRNAQSEVAAVFSKIPQIQQRYVEIQRQL
L8MYT6          -------QQNLASQLFDAQTNLAVSQAQLESIRNAQSEVAAVFSKIPQIQQRYVEIQRQL
A0A352JGJ6      -------QQTLATQLFEAQTSLAVNQAQLESIRGAQSEVAKAFSQIPQIQQRYIEIQRKL
A0A1J5GLS2      -------QQTLATQLFETQTNLAVSEAQLASIRSAQSEVSRAFSGIPQIQQRYVEIQRQL
A0A2W4W6M5      -------QQNLATQLFEAQTTLAVSQAQLESIRNAQAEVSSAFSKIPQIQQRYVEIQRQL
A0A2W7AN33      -------QQNLASQLFDAQTTLAVSQAQLQSIRNAQSEVSKAFSQIPQIQQKYVEIQRQL
A0A256BLV2      -------QQNLASQLFDAQTTLAVSQAQLESIRNAQSEVATAFSKIPQIQQRYVEIQRQL
A0A2W6ZXF3      -------QQGLATQLFETQTTLAVSEAQLESIRSAQSEVSRAFSGIPQIQQRYVEIQRQL
A0A2Z5WX66      -------QQTLATQLFETQTSLAVSQAQLESIRSAQAEVAKAFSQIPQIQQKYIEIQRQL
Q7NEU3          TDRLGDLQVNLAAELIKAENAYRVQTARVAGLENVKNRMIGQFKVVPSLAKRYQELVRDS
A0A3C0N2P0      -------RKDLAQKLVDTQNQIQVLEVRRNKIAKAESVVGQQLTALPDIARRYTDLQQQL
A0A6P0JR04      -------RLSLTQNLIETLNQQQVLTVREAALQSAENQAKAEMQKFAVLNRQYTDLQRQL
A0A6B3M6M6      -------RLNLIENLVNASNQMRVLEARQTAIAKAESEMKNNLENLAVISRQYTDLQRQL
A0A6P0KD09      -------RLNLIENLVNASNQMRVLEARQTSIAKAEGEMKKNLENLAVISRQYTDLQRQL
A0A6B3NIJ0      -------RLNLIENLVNASNQMRVLEARQTSIAKAEGEMKKNLENLAVISRQYTDLQRQL
A0A6M0F053      -------RLNLIENLVNASNQMRVLEARQTSIAKAEGEMKKNLENLAVISRQYTDLQRQL
A0A6P2ATU9      -------RLQLTQDFIGATNEKMVLEVRSAALALAENQTRQDLNRFADLSRQYMDLQRQL
A0A845XAM4      -------RLQLTQAFLDATNDRQVLAVRSAALALAEGQTRKDIQNFARLSREYSDLQREL
A0A352XE00      -------RLEITKKLIDTKNEIQSLSVREAALERTENLMESQIKQLPIIARQYTDLQREL
A0A6P0QC14      -------RQDLTQKLVETTNQIQLLEVRTREIAAAEGQLNQQLRNLPAIARNYTDYQRDL
B4VS56          -------RLALTQQLVETTNQINMLEVRSGAIAKAERLMSQQLKNLAVVARQYTDLQREL
A0A352AAQ3      -------RLDLTQKLVETENQIQVLQVRQTEIADAESRVSQQIKELPIIARRYTDLNRRL
A0A350Y472      -------RLNLTQKLVETKNQIQVLEVRRNEIADAEIRLSQQLKTLPVIARRYGDLQRRL
A0A355DVB4      -------RLNLTQKLVETKNQIQVLEVRRNEIADAEIRLSQQLKTLPVIARRYGDLQRRL
A0A1Z4RMB9      -------KENQLERFITLKIDELSRQRQVESLYQSQQEYLKRAKELPSLEKRDRELVRSA
A0A318B4H2      -------RSDAEAALRAAQSKEAQFREQVANLTKNFNT--QRTNLI-----EYQILQREV
A0A2K3BR24      -------KIDLVGDLVKAQINYLAQKSRIKGLKAEKADYQARAKILPKLEQRQRELERQL
K9YXY1          -------KIGLVGDLVKAQINYLAQKSRIKGLKAEKADYQARAKILPKLEQRQRELERQL
A0A1Q4RTR1      -------KQNLIAELVKLEVERTGLSNRISTLSNALTLYKQRATSLPRLEQNQSQLERDL
A0A1Z4SQV2      -------KQNLIAELVKLEVERTGLSNRVSTLGNAFTLYKQRAGILPRLEQNQRQLERNL
A0A2H2XGN1      -------KQNLIAELVKLEVERTGLSNRVSTLGNAFTLYKQRAGILPRLEQNQRQLERNL
A0A433UXH8      -------KQNLTAELVKLEVERTGLSNRVATLGNAFNLYKQRAKILPSLEQNQRQLERNL
A0A1U7HGH0      -------QQDLISDLIAAEIERQGLISQQATLTQQQKAYLQKATNLPRLEQQQRELEREL
K9XJD3          -------QQELISDLIAAEVERQGLISQQATLTQQQEAYLQKATHLPKLEQQQRELEREL
K9SX01          -------QLELITQLVTKEIERVGLEKQIATINDSFIEYQKRLVNIPKLEQQLLVLQRAV
A0A4P7ZT55      ----------VASALQENAAQQAEVQRQLAQLEKAFRV------VGPELVKQYDALNQRL
A0A1E5QIR9      -------QLDLMQQLVNSEVDRLVVNSQLNELLNEYAIHKQRANALPRLQESQRDLERQV
A0A6P1A9A0      -------RLQLTQQLIEATNQRQILEVRQVAIALAENQARQELQKMAAVIREYTDLQREL
A0A1Z4IBC7      -------RQSLIADITRAEAQRVGLERQITTLIQQRDAYIKRANYLPKLEQNQRELERRL
A0A5Q0GKD1      -------KQSIIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERRL
Q3MDC6          -------KQSIIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERRL
A0A1Z4KM73      -------KQSLIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERKL
Q8YNX7          -------KQSLIADITRAESQRVGLERQISTLLQQREAYIKRANYLPKLEQNQRELERKL
A0A367R4K6      -------RQSLIADITRAEAQGVGLERQINTLLQQRYAYARRANYLPKLEQTQRELERRL
A0A1E2WSV8      -------RQSLIADITRAQAERVGLERQIGTLLRQQDAYIKRANNLPRLEQSQRELERKL
A0A7D7L9Y1      -------RQSLIADITRAQAQRVGLERQIGTLLRQQDAYIKRANNLPRLEQSQRELERKL
A0A2R5FRT9      -------RQSLIADITRAQAERVGLERQIATLVRQQEAYIKRANNLPKLEQTQRELERKL
A0A2K8T1B6      -------RQSLIADITRAQAERVGLERQIATLLRQQDAYIKRANNLPKLEQSQRELERKL
A0A235I9I0      -------RQSLIADITRAQAERVGLERQIATLKEQQNAYIKRANNLPRLEQSQRELERKL
A0A2D0HQT8      -------RQSLIADITRAQAERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKL
A0A2L2NU95      -------RQSLIADITRAQAERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKL
A0A367S084      -------RQSLIADITRAQAERVGLERQIATLKQQQNAYIKRANNLPRLEQSQRELERKL
A0A1Z4SMD6      -------KQNLASQLSQLQTQRQGLEKKILALSNIRDSYKQRLSILPNLEKKQGDLERTL
A0A2H2Y096      -------KQNLASQLSQLQTQRQGLEKKILALSNIRDSYKQRLSILPNLEKKQGDLERTL
K9S8M8          -------HRTLTNNLVETENQRRGLREQVTALRESQVQYQQRANVLPQLEQRQRDLERQL
A0A1Z4NFV0      -------REKLLNEYVQLQAQQAGLASRVQELSNLHRIYRQRTTIIPNLEKRQGDLERRL
A0A3M9ZEU1      -------RETLTANLIDAEVERISLLGQTQTLRNTLSAYRQRASTLPKLAQTQGELARRL
A0A1Z4JK72      -------KRKLAESLATLQSQKLGLEGRVGTLAGLQSSFRSRMAATPTLVKQQSELERKQ
A0A0N7Z489      -------KRNLAAALSTLQSQRAGLEGRITTLSGLLINYSSRAARTPALIQQESELERRQ
A0A0S3TXS2      -------KRNLAAALSTLQSQRIGLEGRISTLAGLLANYRSRAAQTPALIQQEGELQRRQ
A0A2A2TPF8      -------KEQLLGESVRLQAQRLGFENKVQTLTNLHQEYKKRANILPNLEKKQGDLERRL
A0A1Z4R0P8      -------KEQLVGESVRLQAQRLGLANKVQTLTNLHQIYKRRANVLPNLEKKQGDLERRL
A0A0T7BUI3      -------REDLANQYVQLKTKRQGLQKKIAALQGVQQIYQKRLNAIPNLEKKQSDLERKL
A0A1Z4LP32      -------KQNLVNQLVQLQTQKDGLQNKLATLNNIKNDYQRKLAILPNLEKRQQDLERRL
K9REP9          -------KQSLVNQLVQVQTQKDGLQTKLQTLTNIRDNYQQKLAILPNLEKQQTELERRL
A0A1Z4SIJ3      -------KQDLAVQYLQFQGQRQGLEKKIRAMEAVQANYQQRLNVIPNLEKNLGDLERRQ
A0A2H2XPG4      -------KQDLAVQYLQFQGQRQGLEKKIRAMEAVQANYQQRLNVIPNLEKNLGDLERRQ
A0A2A2TC28      -------KEDLASQYVQLLAQRQGLEKKVQTLLNIREGYQRKLSILPNLDKLQTDLERKF
K9V3C7          -------KQDLANQYVSLQSQRAGLEEKVQTLSSLHEAYKRRANIFPNLEKQQGELERSL
A0A1Z4T6Y7      -------KEQLVGESVRLQAQRLGLENKVQTLSGLHEQFKQRAEVLPNLEKKQGDLERRL
A0A2H2Y561      -------KEQLVGESVRLQAQRLGLENKVQTLSGLHEQFKQRAEVLPNLEKKQGDLERRL
A0A1Q4S362      -------KEQLVGESVRLQAQRLGLESKVQTLSGIYEQFKQRAQVLPNLEKKQGDLERRL
A0A3S1CIN8      -------KEQLVGESVRLQAQRLGLESKVQTLSGLHQQFRQRAQVLPNLEKKQGDLERRV
A0A0C1NCB0      -------KQDMTVEYANLEKKRQGLEEKIKSLSDIRNGYKQRLTVMPNLEKKHGDLERRL
A0A844MLU2      -------KQDMTVEYASLEKKRQGLEEKIKSLSDIRNGYKQRLTVMPNLEKRHGDLERRL
A0A2N6K7Q9      -------REELTDKYVELKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRL
A0A2N6MXH6      -------REELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRL
A0A2N6M5A8      -------REELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRL
A0A2N6LL61      -------REELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRL
A0A0S3TP66      -------REELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRL
G6FP91          -------REELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRL
A0A1U7GYR5      -------REELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMVPSLEKKQQALERRL
A0A2N6KY52      -------REELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRL
A0A2N6KMP5      -------REELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRL
A0A2N6MA45      -------REELTDKYVEFKAERQGLEKKIRTLSNIRANYQQQLAMMPSLEKKQQALERRL
A0A4Q9J9V9      -------RESLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKL
A0A328IGA1      -------RESLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKL
A0A4D9CE41      -------RESLVDNYVQLKAERQGLEKKFRTLFNIRVNYQQQLAMMPSLEKQQQSLERKL
A0A0M0SFT2      -------RENLVDNYVQLKAERQGLEKKFRTLSNIRANYQQQLAVMPSLEKQQQGLERKL
A0A1Z4TLC8      -------REEMVGNYVQLKAERQGLEKKFRTLSNIRANYQQQLAVMPSLEKQQQGLERKL
A0A1Z4IYV4      -------KENLTSEFAKIQAQRQGLESKIQALSNIQASYKQRLAMMPNLEKKQGDLERKL
A0A1Z4Q0T6      -------KENLTSEFARIQAQRQGLESKIQALSNIQASYKQRLAMMPNLEKKQGDFERKL
A0A0C2PT44      -------KENLTSEFAKIQAQRQGLESKIQALSKIQASYKERLAMMPNLEKKQGDYERKL
A0A1D2P6J4      -------KENLTSEFAKVQAQRQGLESKIEALSNIQASYKQRLAMMPNLEKKQGDFERKL
A0A0C2LFH0      -------KENLTTQYALIQAQRQGLENKIQALSNIRGTYKQRLSALPNLEKKQGDLERRL
A0A856M734      -------KENLTSQYALIQAQRRGLESKIQELSNIQGSYKQRLSALPNLEKKQGDLERRL
B4WP72          -------QQSLIELYLQLEVDRVGLSQRVSELSDLQGVYRRRASTLPALEKTQRELERRL
A0A2T1CIL7      -------EQKMVAEYANLGVERSGLLGKLAELESNLQVRQQNLEKLPLLEKQQRELERRV
A0A433V7A0      -------HQKLLEELVKTQAKNLSLSSRLTSLENAKVRSQRRVSNIPKLEKDQRELQRKL
A0A2T1FTR8      -------QGNLIADYAKSEAQRTSLQKQIAALVYVVDAYKQRMNALPKLEQQQNALGRKL
K9UA41          -------QGNLIADYAKSEAQRTSLQKQIAALVYVVDAYKQRMNALPKLEQQQNALGRKL
A0A563VS48      -------EEGQINEFANLGLERKGLQKRLAAFNKIYSSNQERSSILPQLEEEQKELVRRV
A0A7Y0NUK1      -------KQGQIAEFAALGLNREGLQKKLAALSNIYTNNQKRSEVLPQLEEEQKELERRV
A0A0C2LBE2      -------RQKLLEDYAGTEAQRVGLVKQIATLSNQRTVYKERANILPKLEQTQRELERKL
A0A433NN38      -------RQNLIQDLANTEKVRLGLEKQIADLNNTLFEYKQRANILPKLEETQRELERKV
A0A2N6K0T2      -------RQRLIEDLANTEKERVGLERRIAELTNTWSVYKQRANVLPKLEQTQRELERKL
A0A2N6ML72      -------RQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKL
G6FQZ6          -------RQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKL
A0A2N6MQX9      -------RQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKL
A0A2N6KXT6      -------RQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKL
A0A2N6KGB9      -------RQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKL
A0A2N6L3Y5      -------RQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKL
A0A0S3TIS7      -------RQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKL
A0A1U7GW28      -------RQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKL
A0A2N6LW63      -------RQKLIEDLANTDKERVGLERRIAELTNTWSVYKQRANILPKLEQTQRELERKL
A0A328IH74      -------RQKLIEDLANTDKERAGLEKRIADLRNTWSLYKQRANTLPRLEQTQRELERKL
A0A4D9CIB0      -------RQKLIEDLANTDKERAGLEQRIADLRNTWSLYKQRANVLPRLEQTQRELERKL
A0A1Z4TQ63      -------RQKLIEDLANTDKERAGLEKRLADLRNTWSLYKQRANIMPRLEQTQRELERKL
A0A4Q9J8G2      -------RQKLIEDLASTDKERAGLEKRIADLRNTWSLYKQRANTLPRLEQTQRELERKL
A0A350Y0P6      -------QQQMMATLVNAEAERLSLAQRVASLEQTKLTYKRRANILPKLQEGLRDLERQL
A0A352X940      -------KESMTKDLVKAEVERLGFVRQAAYLERAKLAYQQRANLLPRLQEGLRDFERQL
B8HTN4          -------EQQLVDNFINAEVERLALSSQVTSLSRTEQTYQQRMNALPKLEQWLGELERRR
A0A6P1AFJ5      -------RLQLTQSLVETNNKILLLKVREENLAKTELELRNSLDKLAELDRKHTDLQRNL
B0CAX4          -------RQSLTDALVEAEVERLGLEKQVLSLAQTQAENKRRQGIIPKLEQQLIALERDR
A0A1Z4RN12      -------KQSQLAEFAELGLQKEGLDKRLASLRSNYNNYQQRSDNLPQLQEQQRELQRRV
A0A2T1CMF9      -------KQGQLTEFADLGLRKEGLEQRLASLKNSYNNYQKRSNLSPQLEEQQRQLERKL
Q7NDC5          -------RQQLLKDLIAARVEELAARTRTEALARVSAEYDARVAALPRLEESQRRLARQV
U5QGK3          -------RQKLLKDLVDARVEELAARTRTDALNSVSERYSSQVAAMPRLEETQRQLERQV
A0A2W4UY24      -------EQSLILSFLQLDAERAGLQQRLNQLTSAQAAQQSRAQLLPGLEKRNRELEREL
A0A838VM23      -------KQKLIDDFVKVEVERLGLANRLALLSQTAATYKRRIEILPKLEQEQRELERQL
A0A0D8ZUV2      -------KQKLNEELVQSEAERLGLAKQLALLSSTQDTYKQRANVFPKLEQNQRELERQL
A0A433VDI0      -------QQKLNEALVKLEEERSGLTSQLAELSNAQATYKQRVSILPKLEQEQRELERRL
A0A3D1PG43      -------KQKLTEDFATSEVERLSLSSRLAYLSKNLSAYKQRANVIPKLEQQQQELERQV
A0A2P8QQ72      -------QQKLAEDLVRAEVERLSLSNRLKFLAQARTNYRQRATVLPQLEQQQRELERQV
K9TZQ7          -------QQKLAEDLVRAEVERLSLSNRLKFLAQARTNYRQRATVLPQLEQQQRELERQV
A0A6N8G584      -------RQELTQNYVNSEIQRLGLSSRLSSLNNTYNAYRQRVNVLPRLEQTQRELERRL
A0A2G7GPR0      -------RQELTQNYVNSEIQRLGLTSRLSSLNNTYSAYRQRINVLPRLEQTQRELERRL
K9XH68          -------RQELTQNYVNSEIQRLGLTSRLNSLNNTYNAYRQRVNVLPRLEQTQRELERRL
A0A1U7HW70      -------RQELTQNYVNSEIQRLGLTSRLNSLNNTYNAYRQRVNVLPRLEQTQRELERRL
A0A2S6VEJ8      -------RQELTQNYVNSEIQRLGLVSRLNSLNNTYNAYRQRANVLPRLEQTQRELERRL
A0A140KBA0      -------KQEQISEFASLGLKKTGLEQKLANLKQTKTDYQQRLSVLPNLEKRQKELERKT
K9XSG1          -------KQEQISEFANLGLQKTGLEQKLANLKQTKTNYQQRLAVLPNLEKRQKELERKT
A0A2T1GMT4      -------KQNLITELLRSQVQQTGLVNKLNSLQSSRAAYEKRVSVIPKLVQTQRQLERKL
K9UI51          -------KQNLITELLRSQVQQTGLVNKLNSLQSSRAAYEKRVSVIPKLVQTQRQLERQL
A0A1Z4QL41      -------RQKLIQDFLQSEVQRIGLAKRLASLYNSRSAYEQRTKIIPRLAQTQSELERTI
K9TYI2          -------RQDLIENLLQSDVQRRSLAQKLASLSNSRSTYEQRKNIIPQLVQNQQELERRL
A0A252D4T4      -------KQDLIKEFLQSEVQRQGLAQKLNSLYNSRSIYEQRVKIIPQLEQQQRELQRRL
A0A252DJH5      -------KQDLIKEFLQSEVQRQGLAQKLNSLYNSRSIYEQRVKIIPQLEQQQRELQRRL
A0A252EB80      -------KQNLIRDFLQSEVQRQGLAQKLSSLYNSRSTYEQRVKIIPQLEQQQRELQRRL
A0A6G9SKZ9      -------KQNLIRDFLQSEVQRRGFEQKLTSLYNSRSVYEQRVKIIPQLEQQQRDLERRL
A0A1Z4HPW5      -------KQNLIREFLQSDVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRL
A0A1Z4MSN1      -------KQNLIRDFLQSDVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRL
A0A1Z4U1C2      -------KQNLIRDFLQSDVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRL
A0A0D6KV51      -------KQNLIRDFLQSEVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRL
A0A1Z4MKF8      -------KQNLIRDFLQSEVQRRGLEQKLTSLYNSRSVYEQRVRIIPQLEQQQRDLERRL
A0A2C6WC43      -------RQTLIQDFLQSEVQRFGLSQRLASLYNSRTNYQKRVQVIPQLIQNQRELERKL
A0A841WRE0      -------RQTLIQDFLQSEVQRFGLSQRLASLYNSRTNYQKRVQVIPQLIQNQRELERKL
A0A1Z4L5A1      -------RQNLIRDFLQSEVQRFGLSQRLASLYNSRSNYQKRVQVIPQLIQNQRELERKL
A0A367QD86      -------RQNLIQDFLQSEVQRYGLSQRLASLYNSRSNYQKRVQVIPQLIQNQRELERKL
A0A2K8SM78      -------RQNLIQNFLQSEIQRFGLAKRLSSLSNSRSTYEQRVKIIPQLAQNQRELERKV
A0A2R5FPC0      -------RQNLIQSFLQSEIQRFGLAKRLSSLSNSRFTYEQRVKIIPQLAQNQRELERKV
A0A5P8W5T6      -------RQNLIQSFLQSEVQRFGLAKRLSSLSNSRLAYEQRVKIIPQLAQNQRELERKV
A0A7D7LDT7      -------RQNLIQNFLQSEIQRFGLTQRLSSLYNSRSTYEQRVKLIPQLAQNQRELERKV
A0A235IZ96      -------RQGLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKV
A0A2L2NGP0      -------RQGLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKV
K9QM62          -------QQGLITDFLRSEVQRLGLAQRLTSLSNSRATYEQRMQKMPQLEQTLRELQRTL
A0A1Z4FWI3      -------KQNLINTFLQAEVQRQGLAQKLTSLYNSRGAYEKRVKVIPQLEQQQRELERRL
A0A1Z4JYE7      -------RQNLINNFLQLELQSTGLNQKLNSLLNTRSAHEKRMQILPKLAQQQRQLERKV
A0A0F5YE28      -------KNNQLERFIANEIQRVELTRQLDSLYASRINYEQRSQNLPQLEQEQQELQRKV
U7QEH7          -------KNNQLERFIANEIQRVELTRQLESLYTSRRNYEQRSQNLPQLEQEQQELQRKV
A0A3S1ATK5      -------RQKFIQDFLQVEVQRIGLSKRLASLYNSRSGYQRRVKIIPMLVQNQRDLERKV
A0A2Z6CPH0      -------RQNLIQNFLQLEVQSFGFKQRLASLYNSRSVYERRMRFIPQLIQTQHELERKV
A0A1Z4GT50      -------KQNLIKDFLQSEVQRNGLTKKLASLYNSRSAYEQRLKIIPLLVQNQRELEQKL
A0A1Z4GIX0      -------RQTLIQNFLQLEVQRFGLTNRLASLYNSRSAYERRMKVIPQLAQTQRELERKV
A0A2H6LC24      -------RQTLIQNFLQLEVQRFGLTNRLASLYNSRSAYGRRMKIIPQLAQTQRELERKV
B2J6N5          -------KQNLIQNFLQSEIQRIGLAKRLSSLYNSRSIYEKRVKLIPQLAQNQRELERKA
A0A367RMI4      -------RQSLIQNFLQSEIQRFGLTQRLSSLYNSRVSYEQRVKLIPQLAQNQRELERKV
A0A235HUM0      -------RQSLIQNFLQSEIQRFGLTQRLSSLYNSRVSYEQRVKLIPQLAQNQRELERKV
A0A2L2NW47      -------RQSLIQNFLQSEIQRFGLTQRLSSLYNSRVKYEQRVKLIPQLAQNQRELDRKV
A0A1E2WUR1      -------RQNLIQNFLQSEIQRFGLTQRLSSLYNSRSTYEQRVKLIPQLAQNQRELERKV
A0A235IKU3      -------RQGLIQNFLQSEIQRFGLTKRLSSLYNSRSSYEQRVKLIPQLAQNQRELERKV
A0A1U7MYU6      -------KQKLISDFIESEVKRRSLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRL
A0A1D8TNX9      -------KQKLINDFIESEVKRQSLAEGLATLAKARIGYEQRVNVLPRLEQTQQQLEQRV
A0A6P0L6C2      -------KQKLINDFIESEVKRQSLAEGLSTLANARIAYEQRVNVLPRLEQTQQQLEQRL
A0A6P0MVH0      -------KQKLINDFIESEVKRQSLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRV
A0A6P0KJV0      -------KQKLISDFIESEVKRRSLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRL
A0A6L9ZJG4      -------KQKLISDFIESEVKRRSLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRI
A0A846GI17      -------KQKLINDFIESEVKRQSLAEGLATLAKARIAYEQRVNVLPRLEQTQQQLEQRV
F4XKF3          -------KQKLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRV
A0A1D9FX10      -------KQKLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRL
A0A6P0Q0T0      -------KQKLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRV
A0A6P0W5I0      -------KQKLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRV
A0A845XJ02      -------KQKLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRV
A0A846D190      -------KQKLINDFIESEVKRQSLAEGLSTLAKARIAYEQRVNVLPRLEQTQQQLEQRV
A0A3C0NJ41      -------KEQLTSDFVKAEVERLGLANRLTQLSNTRSAYKQRLSILPKLEKEQRELQRRV
A0A352AG88      -------RQELTLNLVNAEVERLGLASQLNELENVRLAYQQRLTILPKLEKDQRELQRRL
A0A350Y374      -------KNQLIKDFVNSEVNRLGLKSKLDQLTNSRLIYKQRLNTLPKLEKEQRELQRRL
A0A355DPX0      -------KNQLIKDFVNSEVNRLGLKSKLDQLTNARLIYKQRLNTLPKLEKEQRELQRRL
A0A0S3TYD7      -------RQQLVTELVMAEIEQMSLEGQVESLSGALSAQQQRASTLPRLSTRQAELERRL
A0A2T1DNG3      -------DQTLIGQFVETQGSLSTAQARYLSLLSSEQKVRAELQRFPQLLAQYERLKPDI
A0A140K3H3      -------IQSLASMRSQVETEQAALQSQIAGIQQAKTKVEKTFKQIPQLQQYYAEVKRQF
K9XUB8          -------IQNLASMRLQVETEQASLQTQIAGIQRAKTQVENTFNSIPQLQQYYAELTRQF
A0A563VLD6      -------LASLGNQLLAAKHEIAILESQIGGTDKAKAKVENSFQDVPQLQEAYAELERQL
A0A7Y0NVW6      -------LGGLGSQLLQAKNEIAIIESQIEGTSKAKAKVENSFQNVPQLQETYAELERQL
U5QL42          -------QQSLASQLLSTQVTLSVQKAQLASLTKAQNDIVARFKKIPQLQQQYTELQRDY
A0A6H2NHD5      -------SRDLMQQLVNTANQVEVLRTQDQATSQVTQQLQGEIQRLADLSRSYQQIAREL
A0A2P8W4F7      -------SQGLMQQLVNTANQMQVLQTQDQAIGQVVQQLQAEIQRLADLSRSFQQIDREL
A0A5Q4E0Z4      -------SRGLMQQLVDTANQMQVLETQDQAIGQAVQQLRAEIQRLADLSRSYQQITREL
A0A2P8VVX1      -------DFGLVSQILEADVTLESLEARMETLASLESILRDEVNRYPSLMAEYDRLQPAV
A0A2P8WHY0      -------DLSLVTDLLEADVAIAGISARWESLATQEQSLRQELNRYPSWIAEYDRLQPRV
A0A563VQJ3      -------KETILENFINLKIEELSLQQQLSSVSQSQQEYLKRADELPRLEKKEQELMRKA
A0A7Y0IRJ7      -------KQTLLENFINLKIEELSLQQQLSTIAQAQQNNTNRAQELPRLEKTEQELIRKA
A0A2T1CMT9      -------DTGIANTVNDSQARLTGIRQRDLSLAQTEAALKQRLVGFPELISQYRNLTQES
A0A7G8J1V5      ------------NQLDAVNLALSLNAQRLLSAQAQQKTLNDRFLKKPELINQYSKLQGRL
A0A354B169      ------------SQLEAVDGALKLNAGRLAMARSQQQALTFQFLRQPALIKQFTDIMQDL
Q0IDT5          ------------NQLEAVDAALGLNANRLATARAQERTLQDNFLKQPALIKQYETLQTKL
A0A7G8FZD9      ------------NQLEAVDAALNLNQGRLETAQQQEAQLNAQFLKQPALIKQYEALQTRL
G4FMX5          ------------NQLEAVDAALNLNNGRLQTAQQQVAQLNAQFLKQPALIKQYEALQTRL
A3ZA21          ------------NQLEAVDAALSLNAGRLATAQAQERQLNVQFLRQPALIKQYEALQTRL
A0A076HBF2      ------------NQLEAADAALSLNAGRLATARMQQATLNQQFLQQPGLIKQYEALQQRL
A0A7G8FP50      ------------NQLEAVDAALSLNTGRLATARTQQATLNRQFLQQPGLIKQYEAVQQRL
A0A7G8E8K7      ------------NQLEAVDAALSLNAGRVETARTQQATLNRQFLQQPGLIKQYEALQQRL
A0A7G8GNR2      ------------NQLEAADAALSLNAGRLATARMQQATLNQQFLQQPGLIKQYEALRQRL
A0A7G8ICD3      ------------NQLEAVDAALSLNAGRLATARMQQATLNQQFLQQPGLIKQYEALQQRL
A0A2D6FCW3      ------------NQLEAVDAALNLNAGRLETAKAQETSLNNQFLKQPALIKQYEALQTRL
A0A7G7KJ95      ------------NQLEAVDAALSLNAGRLATARAQEQELNAQFLKQPALIKQYEALQTRL
A0A7G8EAN3      ------------NQLEAVDAALSLNAGRLATAKAQEQELNAQFLKQPALIKQYEALQTRL
A0A1D8TX52      -------DINLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQV
A0A1D9G4T2      -------DINLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQV
A0A6P0PR27      -------DLNLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQV
A0A6P0WER7      -------DLNLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQV
A0A845XM36      -------DLNLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQV
A0A846DAT1      -------DLNLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQV
A0A846GZK8      -------DLNLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQV
F4XP71          -------DLNLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQV
A0A6P0KZ31      -------DINLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQV
A0A6P0LPB8      -------DINLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQV
A0A6L9YR57      -------DINLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQV
A0A845WMG9      -------DINLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPGLIAQYNRLQPQV
A0A6P0SEV1      -------DINLVNELITSQINLVSLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQV
A0A6B3N2I8      -------DINLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQV
A0A6M0B891      -------DINLVNELITSQINLVSLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQV
A0A6P0IJQ1      -------DINLVNELITSQINLVSLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQV
A0A6P0J8J8      -------DINLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQV
A0A6P0ZSH6      -------DINLVNELITSQINLVSLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQV
A0A845VS63      -------DINLVNELITSQINLVSLQTRDQALAKTEEEIRIQLREFPALIAQYNRLQPQV
A0A1U7N5X9      -------DINLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQV
A0A6L9Z1V0      -------DINLVNELITSQINLVSLQTRDQALAKTEQEIRIQLREFPALIAQYNRLQPQV
A0A6P0LC12      -------DINLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQV
A0A6P0MVJ3      -------DINLVNELITSQINLVSLQTRDQALIKTEQEIRIQLREFPALIAQYNRLQPQV
A0A2W6ZAV2      -------------KLDSIKATLAENRSEQAEVNRQALQLSRQFATNPNLVKQYEAIEQRL
K9W742          -------DVNLTNKLLELESSIRGLMAREQTLAEKEQQLRVELERFPSVLADYNRLQPEI
A0A3D1PBA3      -------DLNLTNQLVDVQTNLNALRARDVSLEQTQKQLRTDLNRFPVLLAEYNRLQPLL
K9XPB0          -------KTNFIETITQSQADLKGLEERDRSLAQTESELREKLTQFPALIARYDSLTQEA
A0A350Y7Z1      -------DLTLSSQLAEAQTTLQALQARDRSLAITQQQLRAKLNRLPELMAEYERLQPEV
A0A352X2A7      -------DLDLSQKLAEAQSSIQGLQARDRSLAQTEQKLRTKINTLPQLMARYERMQPEV
A0A0D8ZYV0      -------DLNITAQLAEVQTSLSALQAQDVSLAKTEQGLRSQLNRFPKLLEEYNRLLPIV
A0A433VMS2      -------DLNLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFV
K9TYA7          -------DLNLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFV
A0A2P8QUE1      -------DLNLAGQLIEVQTNMNAMRARDNSLAQTQQKLRSDLKRFPVLLAEYNRLVPFV
K9SA61          -------DLNLAGQLVETQTRLQALQARGRSLSQTEQQLTGELQRFPQLLAEYGRLEPQL
A0A2G7GMH8      -------DINLAGELVEAQTNLVSLQANAQSLANAEQQLSAEIQRFPTLLAQYNRLLPEV
A0A6N8FU92      -------DIDLAGKLVEAQTNLASLQANAQSLANAEQQLSAELQRFPGLLAQYNRLLPEV
A0A2T1DWE8      -------DLTLANALVDAQVNLVALQGRAQSLNEAERSLQQQLRRFPSLLAEYGRLQPNV
A0A832H7C4      -------DQALTTQLVEARVALQALRARQQSLEASERSLSAEQRRFPRLLAEYGRLQPKV
A0A1U7I8L3      -------DVNLSSKLLEEQTNVQGWQARVQSLTQKAQQIQAELQRFPGMLSQYNRLEPEV
A0A2T1DJL8      -------DLKFASALVESQVNLVAAQARDRSLTNNELQLRGELKRFPSLLAEYNRLQPNV
A0A1Z4J9W0      -------DLKFASDLTDAQVEFFGARARDQELARTEQQLRGQLQRFPSLLAEYNRLQPLV
A0A0N7Z5K9      -------DLKFASDLTQAQVDFFAARARDQTLAAEAQRLQSQLQRFPTLLAEYNRLLPTV
A0A0S3TXC5      -------DLKFASDLTQAQVDFFAARARDQSLVAEAQRLQAQLQRFPTLLAEYNRLLPTV
A0A846FBD3      -------KQDLITKFAQSELERLRLIERITSLSNARAAYKDRTQDIPGLERTQRELERRL
K1XF69          -------KNNKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKA
B5W297          -------KNNKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKA
H1W7M8          -------KNNKIEEFVNAEIRRLDLTKQLDSLYEARDGLERRARILPQLEQQQQELERKA
A0A5Q4H6A5      -------KNNQIEEFVNAEIRRMDLTKQLDSLYEARDGLERRASILPQLEQQQQELERKA
D5A466          -------KNNKIEEFVNAEIRRMDLTKQLDSLYEARDGLERRASILPQLEQQQQELERKA
B4WQE3          -------QEQLASRIRELNARDQALRESIATLDE-------QIRNLSTVTRSYNSIQRDL
U5QJM6          -------RVSLAGDLVKAENLYLVQSARVTGLEAAKERLLGKFQLVPGLAKRYQELNRNA
A0A0V7ZFJ4      -------KQNLTAELVKSEVERLAAANRVGILRKNFITQQGRLRSLPKLEQTQRQLQRKL
A0A235IXQ2      -------KQTLTANLVQVEVEKLGLKNQVSVLMKAFLLYQARLRSLPKLEQEQLEVKRQL
A0A367RIS1      -------KQTLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRTLPKLEQLQLQRQRQL
A0A841V8H9      -------KQTLTANLVQVEVERLGLENQVGVLMKAFGRYQARLTSLPKLEQLQLQRQRQL
A0A5Q0GJJ5      -------KQTLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQL
Q3MEB7          -------KQTLTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQL
A0A1Z4KHN9      -------KQALTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQL
Q8YT70          -------KQALTANLVQVEVERLGLENQVGVLMKAFVLYQARLRVLPKLEQQQLQLQRQL
A0A7U3NLX2      -------KQALTANLVQVEVERLGLENQVNVLNQAFTTDEARLRTLPKLEQQQLQLQRQL
A0A166IWU6      -------KQALTANLVQVEVERLGLENQVGVLTNAFKQDRARLRILPKLQQQELQLQRQL
A0A2S0Q8C0      -------KQALTANLVQVEVERLGLENQVGVLTNAFKQDRARLKILPKLEQQQLQLQRQL
W6FSX4          -------KQALTANLVQVEVERLGLENQVGVLTNAFKQDRARLKILPKLEQQQLQLQRQL
A0A218Q4C1      -------KQALTANLVQVEVERLGLENQVDVLTQAFTFDQVRLRSLPRLEQQQLQLQRQL
A0A6P1ZT04      -------KQALTANLVQVEVERLGLENQVDVLTQAFTFDQVRLRSLPRLEQQQLQLQRQL
A0A0V7ZNJ9      -------KQTLTSELLKSEVERLAVAKQVGVLRKAFALQQARLTVLPKLEQQQRQVERKL
A0A5P8VSD1      -------KQTLTANLVQLEVQRLGLENQVGVLRKDFVLYQARIRSLPKLEQLQLQLQLEL
A0A1S1ZVW2      -------KQALTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQL
A0A0R0M9H9      -------KQGLTQDLVRSEVERLALANQVKALQSVFIINRRRLDSLPRLEQQQLQLQRQL
A0A7H0F4U6      -------KQGLTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQL
A0A7W2A1T7      -------KQGLTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQL
A0A838WI98      -------KQGLTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQL
A0A853MJX6      -------KQGLTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQL
A0A1B7WX82      -------KQSLTEALVKSEVERLALTNKIGELQRVFIVNRRRLDSLPRLEQQQLQLQRQL
A0A1B7WTD1      -------KQALTQDLVKSEVERLALTNQVGELRKVFMVNKSRLDSLPRLEQQQLQLQRQL
A0A480ABC0      -------KQALTQDLVKSEVERLALTNQVGELRKVFIVNKSRLDSLPRLEQQQLQLQRQL
A0A1Z4LRU5      -------KQSLTAELIKSEVERLAATNRVGLLRKAFVSNQARLSVLPKLEQQQRQLQRKL
A0A1Z4JVB4      -------KQNLSQDLVKAEVERLALANRVMELQRAYLLNKRRLDILPALEQQQLQLERQL
K9PIA4          -------KQTLTTDLVKSEVERLALARQLADLQQTFILSQKRLNSLPRLEQQQLQLQRQL
A0A1Z4HVE1      -------KQILSQDLVKAEVERLALAKRVAELRQAYLINQRRLDILPRLEQQQLQLQRQL
A0A252ECZ1      -------KQNLTEELVKSEVNRLAITNRLAELRQVYIVNQRRLDILPRLEQQQLQLQRQL
A0A1Z4G5Y1      -------KQNLTEALVKSEVDRLAFTNRVATLRQVYLTNQRRLDILPRLEQQQLQLQRQL
A0A252DNA2      -------KQNLTEELVKSEVDRLAVANRLAELRQVYVVNQRRLDILPRLEQQQLQLQRQL
A0A252E1Q4      -------KQNLTEELVKSEVDRLAVANRLAELRQVYVVNQRRLDILPRLEQQQLQLQRQL
A0A6G9SK36      -------KQTLTEELVKSEVERLALANQVGELQQTFIVNKERLDSLPRLEQQQLQLQRQL
A0A1Z4M597      -------KQTLTENLVKSEVERLALTNQVAELKQVLLVNKNRLDSLPRLEQQQLQLQRQL
A0A1Z4MWT1      -------KQTLTENLVKSEVERLALTNQVAELQQVLIVNKNRLDSLPRLEQQQLQLQRQL
A0A1Z4TX53      -------KQTLTENLVKSEVERLALTNQVAELQQVLIVNKNRLDSLPRLEQQQLQLQRQL
A0A2A2TNQ5      -------KQSLTGELVKSEVERLAALQRVQVLRNAYITYETRMRQLPKLEQRQRGLERRL
A0A3S1C4K5      -------KQTLTLDLVKSEVDRLAVNNQVQVLQTAYLNYQGRLTAIPRLEQQQRALERKL
A0A1X4G3D5      -------KQGLTEELVKSEIEKLTLSSNINALQNVLSIYKRRLTSLPRLGQQEARLRLRL
D4TNI2          -------KQGLTEELVKSEIEKLTLSSNINALQNVLSIYKRRLTSLPRLGQQEARLRLRL
A0A1Z4H6Z8      -------KQTLSEDLVKSEVEGLALQNRVAELRKAFIINKSRLDILPRLEQQQLQLQRQL
A0A3F3KPR9      -------KQGLTQDLVRSEVERLALANQVKALQSVFIINKRRLDSLPRLEQQQLQLQRQL
A0A1Z4NPM1      -------KQSLTADLVRAEADRLAAEQQVQVLSRALTDYQNRLAALPKLQQRQRALERKL
A0A1Z4UZW9      -------KQSLTQDLVKSEVERLALTKQVEELQRVFIVNRRRLDSLPRLEQQQLQLQRQL
A0A1B7VSH4      -------KQTLTQDLVKSEVERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQL
A0A1B7W126      -------KQTLTQDLVKSEVERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQL
A0A3D4C6Q6      -------KQTLTQDLVKSEVERLALTKQVEELQRVFIFNRRRLDSLPRLEQQQLQLQRQL
A0A0K2M5H0      -------KQALTQDLVKSEVERLALTKQIEELQRVFIVNRRRLDSLPRLEQQQQQLQRQL
A0A844I4P0      -------KQALTQDLVKSEVERLALTKQVEELQRVFIVNRKRLDSLPRLEQQQLQLQRQL
A0A1B7UVJ4      -------KQSLTQELVKSEVERLALTNKIGELQRVFIVKRRRLDSLPRLEQQQLQLQRQL
A0A1B7UTR1      -------KQALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQL
K7W0A4          -------KQALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQL
A0A5C0DRW9      -------KQALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQL
A0A6H2C088      -------KQALTQDLVKSEVERLALTNQIGELRKVFIINRRRLDSLPRLEQQQLQLQRQL
A0A1Z4RPC6      -------RENQLERFISLKIDELSLQTELASLYKYQQVYLDRAKEVPRLEKEEQALLREV
A0A2T1CMZ0      -------KDNQIEKFINLKIEELSLQTELSSLYQYQQVYLNRAKQIPSLEQQEQSLLREV
L8M4F7          -------APGQLEKFIELKIQELSLRRQNLALAQAQQIASKRAQAIPKLDSKEQELLLEL
A0A140K2P2      -------KENQLEKFITLEIDKINQQRQLSSLYQTQESYLERAQKLPSLEQKEKDLIRKV
K9XWX4          -------KENQLEKFITLEIDKINQQRQLSSLYQTQQSYLERAQKLPSLEQKEKDLIRKV
A0A140KB14      -------KENQLEKYISLEIDRISQQRQLASLYQSQQAYLQRARQLPQIEQQQQDLVRQV
K9XX88          -------KENPLEKYISLEIDRISQQRQLASLSQSQQAYLQRAKQLPQIEQQQQDLLRQV
L8LZE9          -------KENPLERFISLKIDELSLQQQFASMNDYQQAYLQRAKELPRLEKEEQEAIRKV
A0A563VSV6      -------QENPLEKFINLKIEELSLQQQLSSTYDYQQAYLKRAEQLPKLEQREREINQKV
A0A7Y0IQB0      -------SENTLEKFINLKIEELSLQQQLSSTYQYQQAYLQRAEQLPKLEQREREISQQV
A0A433NM31      -------QQKLTEDYVKTEVERIVFNNQLSALSKVYSNYKQRAGIIPQLQQKQRELEREV
A0A1Z4NDS1      -------RQKLMEDYARAEAERSGLARQLVSLQKQWLTYKQRANILPRLEQKQRELERKL
U9VXM0          -------EQELIAEYLRLDGEQSGLQQQVEQLANARLSQQSRARVIPVLEKQERGLERQL
A0A6M0RI13      -------EQDLIAEYLRLDGATSGLQQQVEELTTARLGQQSRARVIPVLEKQERALDRQL
A0A6M0S1N5      -------EQDLIAEYLRLDGATSGLQQQVEELTTARLGQQSRARVIPVLEKQERALDRQL
K9F4D9          -------EQDLIAEYLRLDGATSGLQQQVEELTTARLGQQSRARVIPVLEKQERALDRQL
A0A6I5QPI5      -------RQNLIAELTSLEIERIGLSNRMSQLMEARANYLERANDLPELEKQQRELDRQL
A0A1Z3HMQ0      -------SRQLTSQLTEAEVNRLSLASQVQALLDSRQAYIEWSQAFPALEKRQLELEQRL
A0A433W533      -------KQKLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQL
A0A2P8QWJ3      -------KQKLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQL
K9U6L7          -------KQKLTEAYIQLEVERLGLASRLASLSGEYNLYKQRANILPKLEQQQRELERQL
U5DPF5          -------EIQLTGDLVRAEVDRLGTSSRLSSLQREREAYQSRASVLPRLEQGQRELERQL
A0A1E5QP61      -------QQQLTADLVNAEVQRLGLGSNVSALVRAQGSYRDRANALPRLEQQQRDLQRQL
A0A846DWC7      -------QQQLTADLVNAEVQRLGLGSNVSALVRAQGSYRDRANALPRLEQQQRDLQRQL
A0A845Y5J4      -------KQAMTEKLVNTEVERLGLINRVASLESDKFAYQQRANVLPRLQEGLRDLERKL
A0A6P0X488      -------EQSMTEDLVNAEIERLGLINRVAALDSAKFTNQQRANILPRLQEGLRDLERKL
A0A6P0VDM0      -------EQSMTENLINAEVERLGLTNRVAALDRAKFTNQQRANILPRLQEGLRDRERKL
A0A6P0UVD5      -------EQSMTENLINAEVERLGLTNRVAALDRAKLTKQQRANILPRLQEGLRDRERKL
A0A846BFF2      -------EQSMTENLINAEVERLGLTNRVAALDRAKLTKQQRANILPRLQEGLRDRERKL
A0A6M0G142      -------EQSMTEALVNAEVERLGLANRVAALDRAKFNNQQRANILPRLQEGLRDRERKL
A0A6P0MR53      -------EQSMTEALVNAEVERLGLANRVAALDRAKFTNQQRANILPKLQEGLRDLQRKL
A0A3M2GIL5      -------QQQLLLDLVDSEVQRLGLVSQVRALEEARYSQQQRANVLPRLQEGLRELERKV
A0A6H1TSJ9      -------QQQLLLDLVDSEVQRLGLVSQVRALEEARYSQQQRANVLPRLQEGLRELERKV
A0A3M1PML8      -------QQDLIGELVRLEVQRQGIVLRLNTLSEASNAYRQRASALPRLEQQQRELERRL
A0A6M8BE85      -------QQDLIGELVRLEVQRQGIVLRLETLAQASNAYRQRAGALPRLEQQQRELERRL
A0A0T7BPZ0      -------RYELIADIVKTERERVVLERKLAKQKSTWAKYRERANALPKLAQTQRELERRL
A0A352X442      -------KQDLAAKLVAAEVEQSGLSRQLAVLTTARIAYKERSNSLPRLQEKEKELERRV
A0A6B3NF44      -------KEELAAALVDSQVERSGLGDHLKELQKTRTAYKTRSNALPRLEQKQRELERKL
A0A6M0EPL4      -------KEELAAALVDSQVERSGLGDHLKELQKTRTAYKTRSNALPRLEQKQRELERKL
A0A6P0K6L6      -------KEELAAALVDSQVERSGLGDHLKELQKTRTAYKTRSNALPRLEQKQRELERKL
A0A6P0MRR9      -------GQKIIHAYANLEAERLGLASKLTDLANTRATYKEQTRSFPKLEQKLGEMQRKL
A0A6P0X1X4      -------GQETIHAYANLEAKRLGLASELAALSQKRATYKAQTRSFPRLEQKLGEKEREL
A0A6P0UX57      -------GQQIMYAYANLEAERLGLVSELAVLSSTRATYKAQTRAFPRLEQKLGEKEREL
A0A846B9S8      -------GQQIMYAYANLEAERLGLVSELAVLSSTRATYKAQTRAFPRLEQKLGEKEREL
A0A0M0SHU3      -------RQKLIEDLANTDKERAGLEKRIAELKQTWSLYKQRANILPQLEQTQRELERKL
A0A1D2PBN3      -------RQKLLEDYARSEAERVGLERQITTLSNKRSAYKQRANVLPKLEQTQRELERKL
A0A0C2LVR7      -------RQKLLEDYARSEAERVGLERQIITLSSKRSAYKQRANVLPKLEQNQRQLERKL
A0A1Z4PQB9      -------RQKLLEDYARSEAERVGLEKKIITLSSKRSAYKQRANVLPKLEQNQRQLERKI
A0A1Z4SFN6      -------RQNLIQNFATTEAERVGLSQQIATLSSKLSSYKQRVNVLPRLEQIQRQLERKL
K9PGI8          -------RQGLIADFARSEVERAGLEGEITTLSNKLSVYKKRANGLPKFEQTQRQLERKL
A0A654SFI6      ----------------------KAASTREREIRKKLEEAKNKFLGQQTLTIQYGILKREV
K9SSQ0          -------KQNLATQLFDTQTRLATQTAELGSLKIAQTQVEQVFAQIPQLQQTYIELQRQL
A0A2W1JIN9      -------GQDLSVQLIQGKIERLSLQERLEAARGSMKQLESRRQQFPILEQWFTQMDRRR
A0A318AJV1      --------GSLQAQARAGDAQVASLRSTMAGLEAARARNTRNSADA-------ERLERDA
A0A845WDS5      -------SQELTSRYIISNTEQLALAEKLTVLQRERAILQNDLEQLPIKQQRLTALVRQR
A0A6P0IC70      -------SQELTSRYIISNTEQLALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQR
A0A845VVD9      -------SQELTSRYIISNTEQLALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQR
A0A6B3MUB5      -------SQELTSRYIISNTEQLALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQR
A0A6M0B7N4      -------SQELTSRYIISNTEQLALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQR
A0A6P0J9W3      -------SQELTSRYIISNTEQLALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQR
A0A6P0ZWE1      -------SQELTSRYIISNTEQLALAEKLKVLQRERAILQNHLEQLPIKQQRLTALVRQR
A0A1U7N2U4      -------SQDFTSRFILAETERSALEQKLYLVQTERIKLQNRLGQIPVLQQPFGTLVRRQ
A0A6L9YZL1      -------SQDFTSRFILAETERSVLEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQ
A0A6P0KYM4      -------SQDFTSRFILSETERSVLEQKLYLVQTERIKLQNRLGQIPVLRQPFANLVRRQ
A0A6P0LSD6      -------SQDFTSRFILAETERSVLEQKLYLVQTERIKLQNRLGQIPVLRQPFANLVRRQ
A0A6P0PNZ7      -------SQDFTSRFILAQTERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQ
F4XV38          -------SQDFTSRFILAQTERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQ
A0A6P0W137      -------SQDFTSRFILAQTERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQ
A0A845XHF7      -------SQDFTSRFILAQTERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQ
A0A845ZEG9      -------SQDFTSRFILAQTERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQ
A0A1D9G1F2      -------SQDFTSRFILAETERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQ
A0A846CJ58      -------SQDFTSRFILAQTERSALEQKLYLVQTERIKLQNRLGQIPVLRQPFASLVRRQ
A0A6L9Y9E2      -------SQDFTSRFILAETERSALEQKLYLVQTERIKLQNRLGQIPVLQQPFATLVRRQ
A0A6P0SGR0      -------SQDFTSRFILAETERSALEQKLYLVQTERIKLQNRLGQIPVLQQPFATLVRRQ
A0A6M0BK48      -------SQDFTSRFILAETERSVLEQKLYLVQTERIKLQNRLGQIPVLGQPFATLVRRQ
A0A845WG36      -------SQDFTSRFILAETERSVLEQKLYLVQTERIKLQNRLGQIPVLGQPFATLVRRQ
A0A6P0X384      -------SQTIITKFIEAETERLALQEKLKAVQVELTQLQYRLEQLPIAQKPFAALLRQQ
A0A2P8QIL5      -------SQDLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQR
A0A433W447      -------SQDLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQR
K9U1K8          -------SQDLATQLITGEVEASALEGRLAAIRRDRATLQERLNQLPIREQGLAALVRQR
A0A1Q4RZJ6      -------SQDLTSQLITNEIERAAVAEKLQLTQNNIAQLRNRLTQLPLQQQPLTALIRKR
A0A1Z4SNV3      -------SQDLTSKLITNEIERAAITDKLRVTQNNIAQLRNRLTQLPLQQQPLTALVRKR
A0A2H2XJQ1      -------SQDLTSKLITNEIERAAITDKLRVTQNNIAQLRNRLTQLPLQQQPLTALVRKR
A0A3S5K358      -------SQDLTSQLITNEIERAAVAQKLQLTQNNIAQLRNRLTQLPLQQQPLTALIRKR
A0A0T7BPJ4      -------TKDLTAQLITNQTESLAVQKKLRVIQAERANLQARLGKLPLQQQSVAALTRKR
A0A0C1QS61      -------SQNFSAQLIANDIERTAVENKLKSVQTQRANLQLRLAQLPIQQQNLTPLTRQR
A0A139X3R8      -------SQNFSAQLIANDIERTAVENKLKSVQAQRANLQTRFEQLPFKQQQLTPLTRQR
A0A844MZP8      -------SQNLSAQLIANNIERTAVENKLKSVQAQRGNLQLRLAQLPIKQQQLTPLTRQR
A0A1Z4I7C5      -------SQNLISELITNDITRLAVENRLNAIRQMRADIQRRLALIPIRQQPLTVLTRQR
A0A844MST0      -------SQDLTSQLIASEVESRAIENKLKLTRAEKTDLLARLAQIPIKQQQLTTLSRKR
A0A0C2MDK7      -------SQELNSKFILNRIEESAVKERLTLLQKKEADLQNRLAQLPIKQQQLTILTRKR
A0A856MDH8      -------SQDLNSKFILNRIEESAVNDRVKLLQQKKVELQNRLAQLPMKQQQLTVLTRKR
A0A1Y0RCK1      -------SQDLNSKFIVNRIEESAVNDRLKLLQTKKVNLQARLAQLPIKQQTLTVLTRKR
A0A1Z4PWZ0      -------SQELNSKFILNRIEESAVNDRLKLLQTTKTDLQKRLAQLPINQQTLMLLTRKR
A0A0C2QLT0      -------SQELNSKFILNSIEESAVNNRLKLLQVKKANLQARLAQLPITQQTLTVLTRKR
A0A1Z4J2K1      -------SQELNSKFILNSIEESAVNNRLKLLQVKKANLQARLSQLPITQQTLTVLTRKR
A0A3S0ZSX0      -------SQDLTSQLLVNDVERTAVENKLRVVQANRANLQTRLAELPIRQQKLTPLIRQR
A0A2N6K4T3      -------SQDLTSQLIINDVERLAVENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQR
A0A370CKT2      -------SQDLTSQLIINDVERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQR
A0A0S3TL97      -------SQDLTSQLIINDVERLAQENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQR
A0A2N6M8A0      -------SQDLTSQLIINDVERLALENKLKLVQTNRANLQTRLAQLPIQQQQLTPLTRQR
A0A2N6M9E1      -------SQDLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQR
A0A2N6KJI4      -------SQDLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQR
A0A2N6MZ77      -------SQDLTSQLIINDVERLALENKLKVVQTNRANLQARLAQLPIQQQQLTPLTRQR
A0A2N6KT20      -------SQDLTSQLIINDVERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQR
G6FSN3          -------SQDLTSQLIINDVERLALENKLKVVQTNRANLQTRLAQLPIQQQQLTPLTRQR
A0A4D9CI02      -------SQDLTSELIINDVERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKR
A0A328I8B9      -------SQDLTSELIVNDVERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKR
A0A4Q9J4Z7      -------SQDLTSELIVNDVERLAVEKKFRSVQANRNNLQARLAQLPIKQQQLTPLTRKR
A0A0M0SU69      -------SQDLTSQLIVNDVERLAVEKRFRSVQAHRANLQARLAQLPIKQQQLTPLTRKR
A0A1Z4TIZ8      -------SQDLTSQLIVNDVERLAIENKFRSVQANRANLQTRLAQLPIKQQQLTPLTRKR
K9UYB2          -------SQQLVSSLITSNIERAAIENKLTLVNASVSELRSRLNQLPAQQRPLTALTRKR
A0A1Q4S1H4      -------SQTLNSQLVTNTVEGTAVANKLRTLQAERVRLQNRLAQLPIKQEPLTALTRAR
A0A433VBU6      -------SQTLNSQLVTNTVEGTAIANKLRTLQAERVKLQTRLAQLPIKQEPLTALTRTR
A0A218QN17      -------SQELTSKLLANETERSAIENKLTTVKAQRTQLQVQIAKLPIQQKPLIALTRER
A0A846HD20      -------SQDLTSKLLANETERSAIENKLKTVQAQRTQLQSRLAKLPLQQQPLIALTRER
K9RKN2          -------SQELTSKLITNEIERLAVERKLAVVRAQTADLKARVAQLPIKQQPLTALVRQR
A0A2I8ADV2      -------SQNLTTQLINNEVERVAVENKLQTVQSLRKNLQAQLAVLPLRQQPLTMLTRQR
A0A5Q0GMF5      -------SQTLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQR
Q3MEW0          -------SQTLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQR
A0A1Z4KIC7      -------SQTLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQR
Q8YSM5          -------SQTLISDLITNDITRLAVENKLNAIQKMRANIQSRLALIPIQQQPLTVLTRQR
                                                                            

K9SLA9          TLARVNYDHLLQQQTSLRSQLRQISAGARIVSPATIP--TNAI----AP-NIPLNLSLGA
A0A168TT23      ETNRELYDGMLQRLKEIGVAAGAQENNIAVIDSALRP--GYPV----LP-DISRNLSIAL
A0A0M1JWX9      EVASQTLNQLLAQREQLRLEAAQSETPWEIIALPEIPRNEDGELIPFSP-NLLRNLVLGA
A0A844MWN9      DVAEGVYKGLVAQVQQNNIDAFNAYPNVQVLDPPKVD--SKPT----SP--KISLVVINT
A0A2T1M1V6      EIAEGVYKGIIAQLSQNKINAFDAYPNVQLIDGPSLN--PKPL----TA--SRKLIALGG
A0A2G7GCS2      EIAEGVYKSILGQVEQTKTNPFSVYPNVQTLDAPVID--PKPE----EP--SKRAIALGG
K9XBH8          EIAEGVYKSIIAQVEQAKTNPFNVYPNVQTLDAPTID--PKPE----EP--SRRVIALGG
A0A1Z4LJ30      DIAEGVYNGVVAQAEQAKLGSFSAYPSVQVLDQPIMD--TKPV----GP--KLRLMLLGA
Q7NF11          ELAEAAYKAIVAQMQQARLSAFNAFPDIEVLDKAYSN--PKEA----NP--RTLLIALGG
K9RI76          DIAEGVYNGVVAQIEQAKLGAFSAYPSVQVLDKPMVD--NKPS----GP--KLKLMLLGA
A0A433VN22      DVAEGIYKGLVAQVQQKSVDAFDAYPNVQVLDPPRVN--SKPI----SP--KLFLMAINA
A0A139WSU3      DVTEGVYKGLIAQIQQSNIDAFDAYPNIQVLDAPQVD--PKPV----SP--KFLLMAVNA
A0A844MJB7      DVAEGVYKGLIAQIQQSNIDAFDAYPNVQVLDAPQVD--PKPV----SP--KFFLMAVNA
A0A352AE27      EVAEGVYKGLVAQIQKVNIDAFNAYPNVQVLDPPTVS--SNPT----DP--KKTLIALNA
A0A3B8JH60      DVAEGVYKGLVAQVQKNNIDAFNTYPNVQVLDSPTVD--PKPS----SP--KKLLAALNA
A0A3C0N766      DVAEGVYKGLVAQVQKNNIDAFNTYPNVQVLDSPTVD--PKPS----SP--KKLLAALNA
K9W9J7          DVAEGIYKGLVAQVQQNNIDAFDTYPNVQVLDPAKVD--SKPS----GP--KRSIIVLSG
Q7NJN6          EIAEGIYRGLVAQVQQAKVNAFDAYPNVQILDAPSVD--SKPS-----P--SGLLVAVGG
U5QCC3          GIAEGVYKAMLAQVQQAKINAFDTYPNVQVLDPPAVD--PKPS-----P--RLFLIVLGA
A0A1Z4JCS8      DVAEGVYKGLVAQTQQSNIDAFNAYPNIQELNAPFVD--AKPS----SP--KKSLIAINA
A0A846GVZ3      DVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVD--EKPA----GP--KKLLIIANG
A0A6P0PI80      DVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVD--EKPA----GP--KKLLIIANG
A0A6P0WGT6      DVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVD--EKPA----GP--KKLLIIANG
F4XTX2          DVAAGVYNGLVAQMEQVNLDAFSAYPNVQVLDPPTVD--EKPA----GP--KKLLIIANG
A0A3S0Y9N9      SATESSYQTLLARYQELQVAENLQVSNARVITPALIP--TVPI----KS-RQYINLLQGF
A0A6P0ZKB8      VATESSYNSLLNRYQELQVAENLQVSNARVVTPALIP--SAPV----RS-RQYINLLQGF
A0A846EDH6      VATESSYNSLLNRYQELQVAENLQVSNARVVTPALIP--SAPV----RS-RQYINLLQGF
A0A433UNK7      AATDLSYQNLLARYQELQVAENLQVSNARIVTPALIP--GVPI----RS-RQYINLLQGL
B8HNB0          KVNEDVVGRFMERLQELRIAEAQRTTSWRVLEPAYLP--TAPI----SP-NMSRAILLGL
A0A318BJ18      DTNRALYDGLLQRYKEVGVAGGVGVNNISVVDTADAP--RHPS----SP-KLLINLLLSL
A0A3B8Y8H9      EIANQSLTSYLVFQQELELERAKTIYPWRLVSEIRTP--EEPV----SG--PLKLSVLGT
A0A2W1JVB9      EISQEIYANLVRKLQEIQVLEQQNLGNARILSPALIP--EEPI----AP-RKLLYIFSGF
A0A6H1U102      QVKSQAVNRFLEKLQELQIAEAQETAPWRILEPPYQP--QNPI----SP-NIRRNLLLGL
A0A7C3ZEJ3      KVKSEAVNRFLEKLQELQISEAQEIAPWQILEPPYLP--ENPV----SP-NIKRNLLLGL
A0A2P8W9H0      EIATTNLNQFLTKREALRIDAAQRQTPWEVLTPPSQP--RASA----ASAKRNLLL--GT
A0A6I5P386      DIATANLNQFLTKREALRIDAAQRQTPWELLTPAETP--RESS----ASVKQNLLL--GS
A0A3M1SVZ4      ELAQATYSQLQQKLQEVRLAESQSLGNASLVSPALVP--DKPI----S--KKSLYQAMGI
A0A318BG22      DTNRALYDALLQRFKEIGVAGGSGANNVSVIDTARAP--GAPA----SP-ILWLNLLLAI
A0A2T1E9V8      LASQSTYETLLKSLQEIKVKENRTVGNVQIVEYAEIP--VVAT----NA-SNKSSMIAAS
A0A1Z4LN32      SIAQKNYENLETRLQEIKVAESQTVGNASIVESAKVS--PSPQ----VQKQKFIVTFGSI
A0A2I8A9F5      LIAQKNYENLLTKYQEIKIVESQTIGNARILEYAEVD--SSPK----ASKKKGLTLMVSV
A0A218Q6R8      SRAEKNYENLLTRFQDIKIVESQTIGNARVLQYAEIG--SNSS----ANKKKIIILLGGG
A0A218QGE0      SIAQKSYENLLTRQLEIEVAKNQTVGNAKVVEYAKVA--FSPS----VKKKKLVITLGSG
A0A846HDH5      SIAQKSYENLLTRQQEIQVAENQTVGNAKVVEYAKVA--PSPA----VKRKRFVITLGSG
A0A3M2GQQ6      KVKSEAFNRFLEKLQELQIAEAQETAPWRVLEPPYEP--QLPI----SP-NVRRNLLLGL
A0A6H1U2X0      KVKSEAFNRFLEKLQELQIAEAQETAPWRVLEPPYEP--QLPI----SP-NVRRNLLLGL
K9TLQ0          ELGTESLNRFLAVRENLQIESAQKAMPWQLISQPEVG--TVPI----SP-NLSRSLLLGG
K9QF04          EIANQSLNRFLVAKENLQIETARKVPPWQVISRIEAP--NKPI----SP-NPVRDLLLGG
K9W1T3          KTAQSTYEILSPKLQEIRVQENQTVGNARIVTPASIP--ERAI----AP-KKAQNLAVGG
K9SGJ5          ELDSAVFTSLSEKLEELRIAEAQEISSWRVLDAALLP--LQPI----EP-NVLRNLVFGG
A0A6N2JS94      ALDSSTYNKLSEKLEELRISEAQEISSWKVLEPPLIP--IRPS----SP-DIERSLITGA
A0A6C2DSN4      DLDTSTYNKLTEKLEELRISEAQEISSWKILEPPLLP--VRPS----SP-DIERSLFISA
L8MYT6          DLDTSTYNKLTEKLEELRISEAQEISSWKILEPPLLP--VRPS----SP-DIERSLFISA
A0A352JGJ6      ALDTSTYQKLTEKLEELRISEAQEISSWRILEPPLIP--TRPS----SP-DIEKSLIAGT
A0A1J5GLS2      ALDTSTYNKLTEKLEELRISEAQEISSWRVLEPPLIP--TRPS----SP-DIERNLMTGA
A0A2W4W6M5      ALDTSTYNKLTEKLEELRISEAQEISSWKVLEPPLIP--TRPS----SP-DIEKGLIAGA
A0A2W7AN33      AIDSSTYNKLSEKLEELKVSEAQEISPWKILEPPLIP--TRPS----SP-DILMNLFVGG
A0A256BLV2      ALDTSTYNKLSEKLEELRISEAQEISSWKILEPPLTP--IKPS----SP-DIERSLITGA
A0A2W6ZXF3      ALDTSTYNKLTEKLEELRISEAQEISSWRILEPPLIP--TRPS----SP-DIERSLITGA
A0A2Z5WX66      ALDTSTYNKLTEKLEELRISEAQEISSWRVLEPPLIP--IRPS----SP-DIEKSLIIGA
Q7NEU3          NLASNSLNRLLERLQELRIQAAQELSPWRVIEPAAIP--EKPI----WP-KPLLTLGGGA
A0A3C0N2P0      KVATESLGRFLTVQETLQVEKARTSTSWKKISGPQKP--QAPI----SP-NVPRGILLGI
A0A6P0JR04      EVATESLKRFLSVQEDLQIEAAQRTMSWELMNQPHRP--QYPI----AP-NMSRGILLAV
A0A6B3M6M6      KVSTESLNRFLAVRETLEIESAQKTLPWQVIRKPQQP--QEPI----SP-NVPRGMILGV
A0A6P0KD09      KVSTESLNRFLAVRETLEIESAQKTLPWQVIRKPQQP--QEPI----SP-NVPRGIVLGV
A0A6B3NIJ0      KVSTESLNRFLAVRETLEIESAQKTLPWQVIRKPQQP--QEPI----SP-NVPRGIVLGV
A0A6M0F053      KVSTESLNRFLAVRETLEIESAQKTLPWQVIRKPQQP--QEPI----SP-NVPRGIVLGV
A0A6P2ATU9      SVATESLNRFLAVQEDLQIESAQRTTSWELLNAPDLP--MYPI----AP-DVTRGMAVAV
A0A845XAM4      TVATESLSRFLAVQQDLQIESAQRTAAWDLLNAPETP--LYPI----AP-NVPRGLALSI
A0A352XE00      KVATESLNRFLAVRETLQIESAQKTLPWQLIAPPQTP--IKPI----SP-NVPRGLVLAT
A0A6P0QC14      TAATESLGRFLAVRETLQIEASQKTPPWQKLSEPKQP--GAPI----SP-NVPRGLVLSA
B4VS56          KVATESLNRFLAVRETLQIEAAQKTLPWQLIAEPQQP--QAPI----SP-NIPHGIALGA
A0A352AAQ3      NVATESLSRFLAVREKLQIEESQKTPPWQKLSDPQKP--QTPI----SP-NVPRGIVLGT
A0A350Y472      TVATESLNRFLAVQEKLQIDESQKTPPWQQLSQPQKP--QQPI----SP-NIPRGIALGA
A0A355DVB4      TVATESLNRFLAVQEKLQIDESQKTPPWQQLSQPQKP--QQPI----SP-NIPRGIALGA
A0A1Z4RMB9      EAASKTYQTLLDSLQKAQIAENQQSGNTDIVEYATVP--DKGS----AG--RVMLMGLGV
A0A318B4H2      DTNRTLYDGLLQRYKEIGVA-GVGSNNVAIVDAAEVP--GGPS----EP-NLNKTLLVSL
A0A2K3BR24      NASQSTYQALLKRLQEVRVAENQNLGNARIIESASIP--TSPI----SP-RIKLNLALGG
K9YXY1          NASQSTYQALLKRLQEVRVAENQNLGNARIIESASMP--TSPI----SP-RIKLNLALGG
A0A1Q4RTR1      QVARQTYEQLLRRFQEVQVIENKTVGNARVVSQALVT--DNPV----SP-KIALNLALGG
A0A1Z4SQV2      QVARQTYEQLLRRYQEVQVIENKTVGNARIVSEAQVT--NRPV----SP-KLYLNLALGG
A0A2H2XGN1      QVARQTYEQLLRRYQEVQVIENKTVGNARIVSEAQVT--NRPV----SP-KLYLNLALGG
A0A433UXH8      QVARQTYEQLLRRLQEVQVIENKTIGNARIVSEAQVT--NRPV----SP-KLYLNLALGG
A0A1U7HGH0      SAAQSTYEALLRSLQEIKVIENRTVGNVQIIEYAQVP--SGAI----NA-SNTSALAAGS
K9XJD3          SAAQSTYEALLRSLQEIKVIENRTVGNVRIIEYAQVP--SGAI----NA-SNTSALAAGS
K9SX01          EISRTAYEGLLVKQQDIQLTEEQNIGNARILSPAVPS--GVPI----SP-KISNNLTTGA
A0A4P7ZT55      EIASENLSSYLKARESFRLEVAQKTLPWQVISPPEVD--ETPV----KP-NLSRNLMLGL
A0A1E5QIR9      EVAQSTYQTLLTRLQEVRIAEEQNIGNVRVIQAAVFP--ERPI----AP-QKKINFGLGG
A0A6P1A9A0      QVATESLNRFLTVRETLKIEEAQKATPWQLISNPFQP--SAPI----SP-DVPRGLLIGG
A0A1Z4IBC7      QAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALVP--DFPE----GP-RKILFVIGGG
A0A5Q0GKD1      QAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DFPE----GP-RKILFIIGGG
Q3MDC6          QAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DFPE----GP-RKILFIIGGG
A0A1Z4KM73      QAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DFPE----GP-RKILFIIGGG
Q8YNX7          QAAQGTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DFPE----GP-RKILFIIGGG
A0A367R4K6      KAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DKPE----GP-RKLLFIVGGG
A0A1E2WSV8      QAAQTTYETLLKKRQEIDVAQNQKIPNARVISYALIP--DKAE----GP-RKILFIVGGG
A0A7D7L9Y1      QAAQTTYETLLKKRQEIDVAQNQKIPNARVISYALIP--DKAE----GP-RKILFIVGGG
A0A2R5FRT9      QAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DKAE----GP-RKILFIVGGG
A0A2K8T1B6      QAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DKAE----GP-RKILFIVGGG
A0A235I9I0      QAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DKAE----GP-RKMLFIIGGA
A0A2D0HQT8      QAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALTP--DKAE----GP-RKMLFIIGGA
A0A2L2NU95      QAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALIP--DKAE----GP-RKMLFIVGGA
A0A367S084      QAAQTTYETLLKKRQEIDIAQNQKIPNARVISYALTP--DKAE----GP-RKMLFIIGGA
A0A1Z4SMD6      SVAQKNYESLVNRSQEIQVAERQTVGNARVIQHARVP--NKPT----LSKSTLALAGGGV
A0A2H2Y096      SVAQKNYESLVNRSQEIQVAERQTVGNARVIQHARVP--NKPT----LSKSTLALAGGGV
K9S8M8          ATYQSTYDILSRNLQQVQIIENQNVGNARIVSSASFP--SKPV----GPNKKVVLMGGMV
A0A1Z4NFV0      GVAQKTYEHLLSRLQEIRVAENQTVGNARIIQAAAPP--PLPA----KSKMSLLIGVGGV
A0A3M9ZEU1      QAAQSTYETLLTRLQEVQVAENQNVGNARVISSAIVP--EEPS----GLSKKVYLLAGGI
A0A1Z4JK72      DLAQKAYENLTSRLQEIQVARNQQVGNARVLQNALVP--TQPT----GRMRLILLAAGTM
A0A0N7Z489      EIALTAYQNLNARKQEIEVAKNQQVGNARVLQSAMVP--TRPA----GRMRLILLAAGAM
A0A0S3TXS2      EIALTAYQNLNARKQEIEVAKNQQVGNARVLQSAMVP--TRPA----GRMRLILLAAGAM
A0A2A2TPF8      TVAQESYKQLLTRLQEVRVAENQNVGSARIVQDAAVS--NQPV----RSKLTMYLAAGGV
A0A1Z4R0P8      EVAQESYKNLLTRLQEVRVAENQNVGSARIVQEAVVP--NQPV----SSKLTLYLAAGGI
A0A0T7BUI3      SVAKLNHENLNARLQEIQVAEKQTIGNAKIIQPAQIP--ETPM----LSKKSLMLALGSL
A0A1Z4LP32      SVAQTDYENLITRQQEIELAEKQTIGNSRIIQSARIP--NKTV----LSKMTIMLAGGGV
K9REP9          SVAQTDYENLITRLQEIELAEKQTIGNSSIIQKARVP--KKPS----LSKMTLLLAGGGV
A0A1Z4SIJ3      TLAQTNFQNLQDRLQEIEIAEKQTIGNARIIQPARLP--NKPV----LSRLTLLLAAGSA
A0A2H2XPG4      TLAQTNFQNLQDRLQEIEIAEKQTIGNARIIQPARLP--NKPV----LSRLTLLLAAGSA
A0A2A2TC28      NIAQTDYQNLVARLQEIEIVEKQTIGNARVVQPALVP--KIAA----MSKMTLLLLGGGV
K9V3C7          TIAQKTYEELLTRQQAIRLAENQAMGNARVIQNAIAP--NSPI----SSKLTLLLAVGGV
A0A1Z4T6Y7      MVAQKSYETLLGRLQEIRVAENQTVGNARVIQNAVVS--PNPA----RLRMMFLLGAGGI
A0A2H2Y561      MVAQKSYETLLGRLQEIRVAENQTVGNARVIQNAVVS--PNPA----RLRMMFLLGAGGI
A0A1Q4S362      IVAQKTYETLLGRLQEIRVAENQTIGSARIVQNAVVS--PNPA----RMRMMLLLGAGGI
A0A3S1CIN8      MVAQKTYETLLGRLQEIRVAENQTIGSARIVQNAVVS--PNPA----RMRMMLLLGAGGI
A0A0C1NCB0      DLAQKNYENLTLRLQEIQVAEKQTVGNARIIQPAQLP--QKPA----LSKLTLLLPVGGI
A0A844MLU2      ELAQKNYENLTLRLQEIHVAEKQTVGNARIIQPAQLP--KKPA----LSKLTLLLPVAGV
A0A2N6K7Q9      EAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLAGGSI
A0A2N6MXH6      EAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLAGGSI
A0A2N6M5A8      EAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLAGGSI
A0A2N6LL61      EAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLAGGSI
A0A0S3TP66      EAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLAGGSI
G6FP91          EAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLAGGSI
A0A1U7GYR5      EAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLAGGSI
A0A2N6KY52      EAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLAGGSI
A0A2N6KMP5      EAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLAGGSI
A0A2N6MA45      EAAKTGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLAGGSI
A0A4Q9J9V9      ESAKNGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLASGSI
A0A328IGA1      ESAKNGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLASGSI
A0A4D9CE41      ESAKNGYENLVTRLQEIQVAEKQTIGNARIVQPAQIP--KKPV----ISKTKILLASGSI
A0A0M0SFT2      ESAKNGYENLVSRLQEIQVAEKQTIGNARIVQPAQTP--KKPV----ISKTKILLASGSI
A0A1Z4TLC8      ESAKNGYENLVSRLQEIQVAEKQTIGNARIVQPAQIP--KKSV----ISKTKILLATGSI
A0A1Z4IYV4      SISKKNYENLVSTLQEIEVAEKQTVGNAKEIQAAKVP--KKPV----LSKVVLLLAGGGV
A0A1Z4Q0T6      SISKKNYENLVTRLQEIEVAEKQTVGNAKEIQPAKVP--KKPV----LSKLVLLLVGGGV
A0A0C2PT44      SISKKNYENLVTRLQEIEVAEKQTVGNAREIQPAKVP--KKPV----LSKVVLLLAGGGV
A0A1D2P6J4      SISKKNYENLVSRLQEIEVAEKQTVGNAKEIQPAQVP--KKPV----ISKVVLLLAGGGV
A0A0C2LFH0      SIAQKNYENLVTRLQDIEVAEKQTVGNAKEIQLAQVP--KRPS----VSKITFLLAGGSV
A0A856M734      SIAQKNYENLVSRLQEIEVAEKQTVGNAKEIQPAQVP--KKPS----VSKITFLLAGGSV
B4WP72          QASQTTYEALLTKLQEVQVAENQNVGNARVVEAAIAP--ESPV----DS-RRELILIAGI
A0A2T1CIL7      EATQSTYQTLLGQLQDTQVAENQNVGNVRIIADAIVP--EKPT----SSTQKKLITLIGS
A0A433V7A0      DAAQSTYQLLLQRLQEVRVAENQNIGNARIIESASIP-RHASD----FT-IKIIILGLGG
A0A2T1FTR8      ETTRTNYKTLLSKLQEIEIAENQTLGNSRILTHAELP--QEAL----SP-KKGQNIAIGG
K9UA41          ETTRTNYKTLLSKLQEIEIAENQTLGNSRILTHAELP--QEAL----SP-KKGQNIAIGG
A0A563VS48      EASQTTYETLLNKLQEIQIAEEQDIGKARVVSEAVVP--EFPI----GP-QKKMMMITGG
A0A7Y0NUK1      EAAQSTYEILLNKLQETKIAEEQDVGKVRVVAEAVVP--EEPI----NI-SKKKIVAAGG
A0A0C2LBE2      KAAQTTYETLLTRLQEVQVAENQNIGNARVISPALVP--DKST----GS-GKILIIGAGG
A0A433NN38      KAAQTTYENLLTRMQEVDVAENQNVGNATIISPALIP--DKPS----GP-RKTLLIAAGG
A0A2N6K0T2      KAAQTTYETLLTRLQEINVAENQNVGNARIISPALVP--DEPS----GV-RKALIAAGGG
A0A2N6ML72      KAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DEPS----GT-RKALIAAGGG
G6FQZ6          KAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DEPS----GT-RKALIAAGGG
A0A2N6MQX9      KAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DEPS----GT-RKALIAAGGG
A0A2N6KXT6      KAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DEPS----GT-RKALIAAGGG
A0A2N6KGB9      KAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DEPS----GT-RKALIAAGGG
A0A2N6L3Y5      KAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DEPS----GT-RKALIAAGGG
A0A0S3TIS7      KAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DEPS----GT-RKALIAAGGG
A0A1U7GW28      KAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DEPS----GT-RKALIAAGGG
A0A2N6LW63      KAAQTTYETLLTRIQEINVAENQNVSNARIISPALVP--DEPS----GT-RKALIAAGGG
A0A328IH74      KAAQTTYETLLTRLQEINVAENQSIGNARIISPALVP--DEPS----GM-RKALIVFGGG
A0A4D9CIB0      KAAQTTYETLLTRLQEINVAENQSIGNARIISPALVP--DEPS----GM-RKALIVFGGG
A0A1Z4TQ63      KAAQTTYETLLTRLQEINVAENQNIGNARIISPALVP--DEPS----GT-RKALIVLGGG
A0A4Q9J8G2      KAAQTTYETLLTRLQEINVAENQNIGNARIISPALVP--DEPS----GM-RKALIVFGGG
A0A350Y0P6      EASQATYDILLKNYQQIRIAENQNVGNARVITYASIP--EAPV----SP-KKKLILVGGI
A0A352X940      GAAQSTYEILLRNYQDVRIAENQNVGNADILARALVP--EDPV----SP-KKKLILGGGI
B8HTN4          VVAQTIYEGLLKTLQSLQISEQQNAGNVRLIQAATLS--DEPV----SP-KLLLNLILGT
A0A6P1AFJ5      KLKAENLQRFLLLRENLRIQQAQEALPWQLLDEVKSP--QKNV----SP-SKSRSLLIAA
B0CAX4          IVAQTTYEELLKALQQITISENQNIGNVRVIAAALEP--KEPV----SP-RKAFNLAVGF
A0A1Z4RN12      DATQSTYKTLLAKLQEAEIIEQRNTGKVRVTAPAAIA--EDPV----NP-DKKVIVAAGA
A0A2T1CMF9      KSVTENYQTLLSKANEISIRQDYKVDKVRVISVAALA--EDPV----NP-DAKVIVAAGA
Q7NDC5          EADQEAYRLLQKKFYEYRILEAQNIGNATLIEPAEVP--EIPA----WP-KPLLNLAAGG
U5QGK3          EADSAAYKLLQTKFHEYRILEAQNIGNAELIEPAVAP--ELPA----WP-SPLLNLGAGA
A0A2W4UY24      DAAQTTYETLLASRQQAQVLEKQDVGNARTISLADLP--EESI----SP-ALKLYLLAGG
A0A838VM23      EAAQSTYQTLLKKLQEVKVQENQNIGNARIIEPALVT--VKST----TT-QKILIVFVGG
A0A0D8ZUV2      QASQSTYQSLLQKLQELKVAENQNTGNASIVEPALVP--DKAS----IK-LRVMILGLGV
A0A433VDI0      AAAQSTYETLLKKIQEVRVAANQRIGNAQIIEPAPIP--KKPS----LL-KPAIILALGN
A0A3D1PG43      KASQATYEILLRKQQEVKVEENRNIGNASIIETALVP--EQPT----GG-KKLIILGLGS
A0A2P8QQ72      RAAQATYELMLKKLQELRVEQNRNIGNASIIETALVP--ETPL----LG-KRVMTLGLGG
K9TZQ7          RAAQATYELMLKKLQELRVEQNRNIGNASIIETALVP--ETPL----LG-KRVMTLGLGG
A0A6N8G584      NAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--ENAS----IR-KRAMILALGN
A0A2G7GPR0      EAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--ENSS----VR-KRAMILALGN
K9XH68          EAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--ENAS----VR-KKAMILALGN
A0A1U7HW70      EAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--ENAS----VR-KKAMILALGN
A0A2S6VEJ8      EAAQSTYETLLRRLQEVRVAENQNMGNARIIEFATVP--ENAS----VR-KKAMILALGN
A0A140KBA0      KAAQATYQTLLGKLQETQVAEKQNIGTVRVLANAIPP--DEPT----GP-SKKLIVAAGG
K9XSG1          KAAQATYQTLLGKLQETQVAEKQNIGTVRVLANAIPP--DEPS----GP-SKKLIVAAGG
A0A2T1GMT4      EVSQSTYQSLLKKLQELQVARNKSTSNARIISSAAVP--EKPD----PG-PKLIIGILGG
K9UI51          EVSQATYQSLLKKVQELQVARNKSTSNARIISSAAIP--EKPE----PG-PKLILGILGG
A0A1Z4QL41      EVAQSTYGTLLKKIQALQVAENQNTASARIITEAIIP--KKSS----GG-KKLIVLLLGG
K9TYI2          VVAQSTYQTLLKKVQELQVAENKTTAHARIIAQALVP--EKPV----LE-QKLIILALGI
A0A252D4T4      DVAQSTYQTLLKKVQELQVAENNNTPNARIIAKGLVP--NKAA----LG-LKPFVLVLGI
A0A252DJH5      DVAQSTYQTLLKKVQELQVAENNNTPNARIIAKGLVP--NKAA----LG-LKPFVLVLGI
A0A252EB80      EVAQSTYQTLLKKVQELQVAENNNTPNARIIAKGLVP--TKPA----LG-LKPFVLVLGI
A0A6G9SKZ9      EVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGLVP--KKPT----LG-LKPFVLVLGV
A0A1Z4HPW5      EVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSAP--KKPT----LG-LKPFILVLGV
A0A1Z4MSN1      EVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSVP--NKPT----LG-LKPFILVLGV
A0A1Z4U1C2      EVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSVP--NKPT----LG-LKPFILVLGV
A0A0D6KV51      EVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSVP--IKPT----LG-LKPFILVLGV
A0A1Z4MKF8      EVAQSTYQTLLKKVQELQLAENNNTPNARIIAKGSVP--IKPT----LG-LKPFILVLGV
A0A2C6WC43      EVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--TDPV----AG-KKFLVLLLGI
A0A841WRE0      EVAESTYQTLLKKVQELQLVENTNTASSRIIAQALAP--TDPV----AG-KKFLVLLLGV
A0A1Z4L5A1      EVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--ADPV----AG-KKLIVLLLGV
A0A367QD86      EVAESTYQTLLKKVQELQLVENTNTASSRIIAQALMP--TDPV----AG-KKFLVLLLGV
A0A2K8SM78      EVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--KDPV----VG-KKIIILLLGV
A0A2R5FPC0      EVAESTYQTLLKKVQELQLVENTNTPSSRIIAPAVVP--NKPV----IG-KKIIILLLGV
A0A5P8W5T6      EVAESTYQTLLKKVQELQLVENTNTASSRIIVPALVP--NKPV----TG-KKIIVLLLGV
A0A7D7LDT7      EVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--KDPV----AG-KKLIVLVLGV
A0A235IZ96      EVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--KDPI----VV-KKIIVLVLGV
A0A2L2NGP0      EVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--KDPI----VV-KKIIVLVLGV
K9QM62          EVAQSTYQNLLRKTQELQVAEHKNTANARIISQALVP--EEPV----LK-KKIIVVVLSV
A0A1Z4FWI3      EVAQSTYQTLLKKIQELQVAENDNTPNARIIARGLVP--TKPG----LG-LKPIVWLLGI
A0A1Z4JYE7      EVAESTYQTLLKKVQELQVAENANTANARIIARGSVP--EEPL----AA-KKMLVLVIGA
A0A0F5YE28      QVAQVTYETLLKNLEEVQVAENKSTNNARVIEEAIVP---EEG----ST-AKTKLIALGI
U7QEH7          QIAQVTYETLLKNLEEVQVAENKSTNNTRIIEEAMVP---EEG----ST-AKIQLLALGI
A0A3S1ATK5      EVAQSTYETILKKAQELQVAQNKNTANARIITQAKIP--EKPA----SG-KKPIVVAIGV
A0A2Z6CPH0      EVDQSTYQNLLKKVQELQLAENRNTANARIIAQALVP--EKPT----SG-KKLIILVMGV
A0A1Z4GT50      EVAQSTYQTLLKKVQELQVAANKNTANARIIAQASVP--EEAV----LG-KKPIVLSLGV
A0A1Z4GIX0      DVAESTYQTVLKKVQELQVAENKTTPNARVVAQATVP--EKPE----SG-KKLIFIALGL
A0A2H6LC24      DVAESTYQTVLKKVQELQVAENKTTPNARVVAQATVP--EKPE----SG-KKLIFIALGL
B2J6N5          EVAESTYQTLLKKVQELQLVENTNTASSRIIAQAIVP--DKPV----ES-KKIIVLVLGV
A0A367RMI4      EVAESTYQTLLKKVQELQLVENTNAPSSRIIAQALVP--KDPT----LT-KTIIVLVLGV
A0A235HUM0      EVAESTYQTLLKKVQELQLVENTNTPSSRIIAQALVP--KDPT----LG-KKIIVLVLGV
A0A2L2NW47      EVAESTYQTLLKKVQELQLVENTNTPSSRIIAQALVP--EDPT----LT-KTIIVLVLGV
A0A1E2WUR1      EVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--KDPV----AG-KKIIVLVLGV
A0A235IKU3      EVAESTYQTLLKKVQELQLVENTNTASSRIIAQALVP--KDPI----LV-KKIIVLVLGV
A0A1U7MYU6      QAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKIKVLALGV
A0A1D8TNX9      QAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKLKVLALGV
A0A6P0L6C2      QAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKIKVLALGV
A0A6P0MVH0      QAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKIKVLALGV
A0A6P0KJV0      QAARFTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKLKVLALGV
A0A6L9ZJG4      QAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKIKVLALGV
A0A846GI17      QAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKIKVLALGV
F4XKF3          QAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKIKVLALGV
A0A1D9FX10      QAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKIKVLALGV
A0A6P0Q0T0      QAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKIKVLALGV
A0A6P0W5I0      QAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKIKVLALGV
A0A845XJ02      QAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKIKVLALGV
A0A846D190      QAARLTYETLLKNLNELKVAENQDTANARIIEPAIVP--KKPL----GD-KKIKVLALGV
A0A3C0NJ41      EAAQSTYQALLKKQEELKLAENQSIGNARIIEPALVP--ETRS----PI-NAIITLLFGG
A0A352AG88      DASQSTYEILLKKLQEVRVAENQNIGNARIIEPAEVPLLPSSQ----MV-QTVLPVVGGG
A0A350Y374      DAAQLTYQTLLQKLQELRLAENQNIGNARIVEPAQIP--DSRS----SG-KSVLILLLGA
A0A355DPX0      DAAQLTYQTLLQKLQELRLAENQNIGNARIVEPAQIP--DSRS----SG-KSVLILLLGA
A0A0S3TYD7      RASQSTYESLLSKLQEIQVAEQQQLGNARITSKALIP--EKPTLLTSAL-GRSLLLAGSG
A0A2T1DNG3      ELNRDTLKQLLKAQQDLGLEIARGGFAWQVVEQAQIG---AKT----GP-NLQKNLMLGL
A0A140K3H3      DIKSKAVDYLMQRRQELYIEQAQENAPWQILEAPPLP--SIPI----SP-NLERGILLAL
K9XUB8          EVKSGAVNYLMQRRQELDINKAQENAPWQILEAPRLP--NVPI----SP-NLQRGIFLAL
A0A563VLD6      VVKSESLDYLLKRRQELQISLAQETAPWKVLDKPYLP--HKPI----SP-NIQRGLALAL
A0A7Y0NVW6      SIKSESVNYLLQRRQELQISLAQEIAPWKVLDEPYLP--NKPI----SP-NIQRSLALGF
U5QL42          NVNSQIVNGLLTKLEELRITEAQETSPWRVLEPPDLP--DTPV----SP-KIDQNLLYGF
A0A6H2NHD5      AVTEDSLNQLLASRQDLRFKMAQQTSPWQLVSPLDQA--SVVP----VT-NLPRNLLLST
A0A2P8W4F7      TVAESSLNQLLASRQELRLQMARQASPWEIISPLSES--SITQ----TT-NLPRKLLLST
A0A5Q4E0Z4      TVAESSLDQLLTSRQDMRLQMARQTAPWELISPLDES--SITE----MT-NLPRNLLLST
A0A2P8VVX1      DTERSTLQELLIQREQISAELSRGGFSWEVVEPPLPG--QRIG-----P-DPVRPLALGI
A0A2P8WHY0      EIERATLQDLLLQREQISAELARGGFDWQIVEPPDVG--DQIG-----P-DPLRPIALGV
A0A563VQJ3      DTANKTYTALLESLQQARLAENQQTGNVDIIEEAIAP--ETGS-----S-GRMALILLGF
A0A7Y0IRJ7      ETANKTYTALLDSLQQVRLAENQQTGNVEIIEAGIVP--EKGS-----S-GRLALIGIGV
A0A2T1CMT9      EIKRQAVQRLLEAKQKLEIELSRGGNNWQVIEPPQAG--LQIA-----P-NLAKDLLLSL
A0A7G8J1V5      KIAELNLSGLVNARETLQLELAQSAAPWRVISPPIVS--RTPI----KP-SLPRGFLQGS
A0A354B169      KIAEENLAGLVSARENFQLEMAQRSVPWRVIAPPQIN--PRPI----EP-SISRNLALGA
Q0IDT5          TLAQENLSGLVSARETFRLESAQSSVPWRVIDPPEID--PNPI----KP-SIPRNLALGA
A0A7G8FZD9      KLANENLSGLVSARENFQLEIAQRSVPWRVIDPPEIN--PTPI----KP-SVPRNLALGT
G4FMX5          TIANQNLAGLVSARENFQLEIAQRSVPWRVIDPPEIN--PNPI----KP-SIPRNLALGT
A3ZA21          KIAQDNLAGLVSARENFQLEIAQRSVPWRVIDPPKIN--PDPI----QP-SVPRNLALGA
A0A076HBF2      EIAKQNLAGLVSAREKFQLEIAQRSVPWRVIAEPTIN--PKPI----KP-SVPRNLALGT
A0A7G8FP50      GIAKRNLLGLESAREKFQLEMAQRTVPWRVIAEPTFN--PNPI----KP-SVPKNLALGT
A0A7G8E8K7      EIAKQNLAGLVSAREKFQLEIAQRSVPWRVIAPPTID--PKPI----KP-SIPRNLSLGT
A0A7G8GNR2      EIAKQNLAGLVTAREKFQLEIAQRTVPWRVIAEPTIN--PKPI----KP-SVPRNLALGT
A0A7G8ICD3      EIAKQNLAGLVSAREKFQLEIAQRTVPWRVIAEPTIN--PKPI----KP-SVPRNLALGT
A0A2D6FCW3      KIAQENLTGLVTARENFQLEIAQRSVPWRVIDPPEIN--PNPI----KP-SIPRNLALGA
A0A7G7KJ95      TIAQENLAGLVSARENFQLEIAQRSVPWRVIDPPEIN--PNPI----KP-SVPRNLALGA
A0A7G8EAN3      TIAQENLAGLVSARENFQLEIAQRSVPWRVIDPPEIN--PNPI----KP-SVPRNLALGA
A0A1D8TX52      AIKQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--FKTG-----P-NMTQDLLLGA
A0A1D9G4T2      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--FKTG-----P-NMTQDLLLGA
A0A6P0PR27      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SKTG-----P-NMTQDLLLGA
A0A6P0WER7      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SKTG-----P-NMTQDLLLGA
A0A845XM36      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SKTG-----P-NMTQDLLLGA
A0A846DAT1      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SKTG-----P-NMTQDLLLGA
A0A846GZK8      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SKTG-----P-NMTQDLLLGA
F4XP71          AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SKTG-----P-NMTQDLLLGA
A0A6P0KZ31      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--FKTG-----P-NMTQDLLLGA
A0A6P0LPB8      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--FKTG-----P-NMTQDLLLGA
A0A6L9YR57      AIKQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--FKTG-----P-NMTQDLLLGA
A0A845WMG9      AIKQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--FKTG-----P-NMTQDLLLGA
A0A6P0SEV1      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--FKTG-----P-NMTQDLLLGA
A0A6B3N2I8      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SKTG-----P-NMTQDLLLGA
A0A6M0B891      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SKTG-----P-NMTQDLLLGA
A0A6P0IJQ1      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SKTG-----P-NMTQDLLLGA
A0A6P0J8J8      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SKTG-----P-NMTQDLLLGA
A0A6P0ZSH6      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SKTG-----P-NMTQDLLLGA
A0A845VS63      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--SKTG-----P-NMTQDLLLGA
A0A1U7N5X9      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--LKTG-----P-NMTQDLLLGA
A0A6L9Z1V0      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--LKTG-----P-NMTQDLLLGA
A0A6P0LC12      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--FKTG-----P-NMTQDLLLGA
A0A6P0MVJ3      AIQQNTLQQLLQARQELSIELARGGFNWQVVEAPLPG--FKTG-----P-NMTQDLLLGA
A0A2W6ZAV2      EIARANLSTYIKTREDFRLEVAQRTRPWRIISPPEFE--DTPD----KP-NLRNSLMLSI
K9W742          KLKRETLDQLEKARQELSLEIARGGFDWQVVEQPLLG--EKTG-----P-KKAQIILLGA
A0A3D1PBA3      QINRNKLQQLLQAQQELSLEIARGGFDWQALEEPKQG--QQIG-----P-NLKLNLLLGL
K9XPB0          NLKKNALQRLLAAKQELEIALSRGAYNWQVIESPQLG--VQIA-----P-NTTKDILLSL
A0A350Y7Z1      QIRRDTLQKLLEARQELGIEIARGGFKWQVVEPPKPG--KQMG-----P-DTRRDLMLSV
A0A352X2A7      QLKRDTLQKLMQARQDLGIEIARGGFKWQVVEAPLPG--EQIG-----P-NTKQDIMLAV
A0A0D8ZYV0      QINREKLQQLLRAQQELSLEIARGGFEWQALEQPVLG--LQVG-----P-NIKQNLLLGL
A0A433VMS2      QINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLG--LKVG-----P-NLKLNLLLGL
K9TYA7          QINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLG--LKVG-----P-NLKLNLLLGL
A0A2P8QUE1      QINRDKLQQLLRAQQELSLEIARGGFDWQALEEPRLG--LKVG-----P-NLKLNLLLGL
K9SA61          QLRRETLQELLKARQELGLEIARGGFDWQVVEEPRTG--NQIA-----P-NLQRNLLLGA
A0A2G7GMH8      SVNRETLQQLMTARQELGLQLARGGFDWQVVEQPGIG--EQIS-----P-SIKRNLLLGI
A0A6N8FU92      AVNRDTLQQLMTARQELGLQLARGGFDWQVVEQPDLG--EQIS-----P-SIKRNILLGV
A0A2T1DWE8      QIGRNTLQQLLKARQDIALEIARGGFDWQVVEEPKLG--KQIG-----P-NVKQNILLGA
A0A832H7C4      QVDRETLQQLLKARQDLALETARGGFDWQVVEEPQLG--AQVS-----P-SWKKNLLLGV
A0A1U7I8L3      KLNRDTLEQLLKARQELSLEIARGGFDWQMVEEPQLG--LQIG-----P-SMKRNLLLGA
A0A2T1DJL8      QVNRDTLQQLLKARQDLGLEIARGGFDWQVVEQPKVG--QQIG-----P-NWLRNLLLGA
A0A1Z4J9W0      TLNRDTLDELQKARQDLSLEIARGGFDWQMVEQPKLG--RQVG-----P-SWMRNLLIGA
A0A0N7Z5K9      KLQRDTLDQLEKARQGLGLEIARGGFDWQIVEQAKVG--RQVG-----P-NWLRNLLIGG
A0A0S3TXC5      KLQRDTLDQLEKARQELGLEIARGGFDWQVVEQSKVG--RQVG-----P-NWMRNLMVGA
A0A846FBD3      AAAQTTYETLLTRLQAIQVAENQNVGNARLISAAQVP--GRPI----SP-RKPMNMAAGG
K1XF69          EVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--DEGK----TA-KVPL-LALGV
B5W297          EVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--DEGK----TA-KVPL-LALGV
H1W7M8          EVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--DEGK----TA-KVPL-LALGV
A0A5Q4H6A5      EVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--DEGR----TA-KIQL-LALGV
D5A466          EVARLTYRTLLQNLEEAQVAANKITNNARIIETANVP--DEGR----TA-KIQL-LALGV
B4WQE3          EIAATNLNEFLTKRETLRIEAAQQQTPWEILTPPSAP---QAF----SQ-TGKSSLLVGP
U5QJM6          VIASDSLNRLLQRLQELEIKAAQELSPWRVIEPAVLPDKEKPV----WP-KPLVTLGVGS
A0A0V7ZFJ4      EVAQLTYTELLKKLQEVQVVENRSVGNATIISEALVP--EHPI----SP-NITRNLLLGG
A0A235IXQ2      EVAQTTYEQMLKRLQEVQVLENQNVGNATIVSNALVP--KKRI----SP-RISLNLALGG
A0A367RIS1      QVAQTTYEQMLKRLQEVQVLENQNVGNARIVSEALLP--KKPI----SP-RILLNLALGG
A0A841V8H9      QVAQTTYEQMLKRLQEVQVLENQNVGNARIVSEALLP--KKPV----SP-RILLNLALGG
A0A5Q0GJJ5      QIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--KTPV----SP-RIVLNLALGG
Q3MEB7          QIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--KTPV----SP-RIVLNLALGG
A0A1Z4KHN9      QIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--KTPV----SP-RILLNLALGG
Q8YT70          QIAQTTYEQMLKRLQDVEVVENQNVGNARIVSEALLP--KTPV----SP-RILLNLALGG
A0A7U3NLX2      QVARVIYEQMLTRFQEVQVVENQNVGNARIISQALLP--DKSV----SP-RIQLNLALGG
A0A166IWU6      QVARITYEQMLRRLQEVQVAENQNVGNARIVSQALLP--EKSV----SP-RINLNLALGG
A0A2S0Q8C0      QVARTTYEQMLRRLQEVQVAENQNVGNARIVSQALLP--EKSV----SP-RINLNLALGG
W6FSX4          QVARTTYEQMLRRLQEVQVAENQNVGNARIVSQALLP--EKSV----SP-RINLNLALGG
A0A218Q4C1      QVARNTYEQLLGRLQEVQLVENQNVGNARIISEALLP--DKSI----SP-RIKLNLALGG
A0A6P1ZT04      QVARTTYEQLLGRFQEVQLVENQNVGNARIISKALLP--EKSV----SP-RIALNLALGG
A0A0V7ZNJ9      QIAQLTYQNLLKKLQEVQVIENQNIGNARIISEALVP--DKKI----SP-RIALNLLLGG
A0A5P8VSD1      EIAQTTYGQMMKRLQETQILENQNVGNARILSEALLP--KKPV----SP-IILLNLALGG
A0A1S1ZVW2      QVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALIP--EIPI----SP-RTALNIGIGG
A0A0R0M9H9      QVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVP--EIPI----SP-RTALNIGIGA
A0A7H0F4U6      QVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVP--EIPI----SP-RTALNIGIGA
A0A7W2A1T7      QVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVP--EIPI----SP-RTALNIGIGA
A0A838WI98      QVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVP--EIPI----SP-RTALNIGIGA
A0A853MJX6      QVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVP--EIPI----SP-RTALNIGIGA
A0A1B7WX82      SVAQLTYQEFLKQFQLVAVLENQNVGNSRIISQALVP--ERPV----SP-KKPLNLAMGG
A0A1B7WTD1      MVAQTTYQELLRQFQLVQVMENQNVGNARIISEALVP--EIAV----SP-KKPLNLALGG
A0A480ABC0      MVAQTTYQELLRQFQLVQVMENQNVGNARVISEALVP--EIAV----SP-KKPLNLALGG
A0A1Z4LRU5      QVAQSTYQQLLKQLQEVQVVEKQNVGNAKVIASALVP--NKPI----SP-KIALNLALGG
A0A1Z4JVB4      KVARITYEQVSKQLQESEIIENQKVGNARVLSEALVP--DKPI----SP-IIAINLALGG
K9PIA4          QVARVTYEQFLRQLQEIQVLENQNIGNARVISQALVP--NRPV----SP-VIHLNLALGG
A0A1Z4HVE1      QVARVTYEQLLKQLQEVEVIENQNIGNARVISQALVP--DKAI----SP-IIPLNLALGG
A0A252ECZ1      QVARLTYEQLSKQLQEVEVIENQNIGNARVISEALVP--ERPV----SP-VIPLNLALGG
A0A1Z4G5Y1      QVAKITYEQLMKQLQEVEVIENQNIGNSRVISDALVP--EKPV----SP-IVPLNLGLGG
A0A252DNA2      QVARVTYEQLLKQLQEVEVLENQNIGNSRVISEALVP--DKPV----SP-IVPLNLGLGG
A0A252E1Q4      QVARVTYEQLLKQLQEVEVLENQNIGNSRVISEALVP--DKPV----SP-IVPLNLGLGG
A0A6G9SK36      KVAQVTYEQLSKQLQEVEVVENQNVGNARIISEALVP--DKSV----FP-VIPLNLALGG
A0A1Z4M597      KVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVA--DKSV----SP-IIPLNLALGG
A0A1Z4MWT1      KVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVP--DKSV----SP-IIPLNLALGG
A0A1Z4TX53      KVAQVTYEQLSKQLQEVEVVENQNVGNARVISEALVP--DKSV----SP-IIPLNLALGG
A0A2A2TNQ5      EVAQTTYQQVQKQLQEVEVVEQQKVGNARIVSEALVP--EKPV----AP-KIPLNLALGG
A0A3S1C4K5      QVAQSTYQQVLKQLQEVEVVEQQKVGNARVVSAAEVP--EIPV----SP-KIPLNLALGG
A0A1X4G3D5      EIVVTTYKQLQKQLQELEILQGETTGTARVLSSALVP--KRPV----SP-RIPLNIGIGA
D4TNI2          EIVVTTYKQLQKQLQELEILQGETTGTARVLSSALVP--KRPV----SP-RIPLNIGIGA
A0A1Z4H6Z8      QVARVTYEQLVKQLQEVEMIENQNVGNARVISDALVP--DKAV----SP-IIPLNVALGG
A0A3F3KPR9      QVAQGTYQQLLKQLQEVQVLENQNVGNARVISSALVP--EIPI----SP-RTALNIGIGA
A0A1Z4NPM1      QVAQSTYQQVLKQLQEVEVAEQQKVGNARIVSPALVP--DKPV----SP-KIMLNLALGG
A0A1Z4UZW9      TVAQLTYQELLKQFQFIEVLENQNVGNSRIISEALVP--ERPV----SP-KIPLNLALGG
A0A1B7VSH4      TVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVP--ELPV----SP-KIPLNLALGG
A0A1B7W126      TVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVP--ELPV----FP-KIPLNLALGG
A0A3D4C6Q6      TVAQITYQEFLKQYQLVQVLENQNVGNSRVISEALVP--ELPV----FP-KIPLNLALGG
A0A0K2M5H0      TVAQITYQEFLKQFQLVQVLENQNVGNSRIISGALVP--ERPI----SP-KIPLNLALGG
A0A844I4P0      TVAQITYQEFLKQFQLVQVLENQNVGNSRIISGALVP--ERPI----SP-KIPLNLALGG
A0A1B7UVJ4      SVAQLTYQEFLKQFQLVAVLENQNVGNSRIISQALVP--ERPV----SP-KKPLNLAMGG
A0A1B7UTR1      SVAQITYQEFLKQFQLVQVLENQNVGNSRIISEALVP--ERPV----SP-KIPLNLALGG
K7W0A4          SVAQITYQEFLKQSQLVQVLENQNVGNSRIISEALVP--ERPV----SP-KIPLNLALGG
A0A5C0DRW9      SVAQITYQEFLKQFQLVQVLENQNVGNSRIISEALVP--ERPV----SP-KIPLNLALGG
A0A6H2C088      SVAQITYQEFLKQFQLVQVLENQNVGNSRIISEALVP--DRPV----SP-KIPLNLALGG
A0A1Z4RPC6      ESTRSTYNTLLDNKQEIDILVNQQTGNAEVIELGKVP--DKGS----TG-RVFLIAL-GV
A0A2T1CMZ0      DSARSTYKTLLENKSDLDVLVNQQTGNAQIIESGIVP--EEGS----TG-RLPLIVL-GV
L8M4F7          KIADANYKNLLDSLEQVELELLQETSNVEIVEPALVP--IKGT----SS-KMKLLAL-GV
A0A140K2P2      KAAQNTYETLLTSLQEVQLAENQQNGNAQIIELAKLP--EKGS----SG-RMAFMLV-GI
K9XWX4          KAAQTTYETLLTSLQEVQLAENQQNGNAQIIELAKLP--EKGS----SG-RIAFMLV-GI
A0A140KB14      EAAEKVYQNLLDSQQELQLLQNQKSGNAQIIELAQLP--EEGS----SG-RLALMVL-GV
K9XX88          EAAEKVYQNLLDSQQELKLLQNQTTGNAQIIELAQLP--EKGS----SG-RLALMVL-GL
L8LZE9          ENIRTTYENLLNTQVELDILQNKQTANARIIEPAIAP--EKGS----SG-QLALMAL-GI
A0A563VSV6      ETARSTYENLLSTQQELQILRNKQTGNAEIIEQAIAP--ENGS----TG-RMALMLL-GI
A0A7Y0IQB0      ETARKTYENLLSTQQELQILRNTKTGNAAIIEQAIAP--EQGS----TG-RMAFMLL-GI
A0A433NM31      DAAQSTYATLLKKLEEVRIAENQNVGNAQIVDVGRVA--EEPV----AP-KKLLNFALGG
A0A1Z4NDS1      KAAQTTYENLLNREQEIRIAENQNIGNARIVSYALVP--DTPA----GP-KKILIIAAGA
U9VXM0          DAAQTTYETLLQNLQQAQVLENQNVGNARIVSPALSP--TEPI----GP-SLKLFLLAGG
A0A6M0RI13      AAAQTTYETLLQNLQQAQVLENQNIGNARIVSPALIP--NEPL----GP-SLKLFLMTGG
A0A6M0S1N5      AAAQTTYETLLQNLQQAQVLENQNIGNARIVSPALIP--NEPL----GP-SLKLFLMTGG
K9F4D9          AAAQTTYETLLQNLQQAQVLENQNIGNARIVSPALIP--NEPL----GP-SLKLFLMTGG
A0A6I5QPI5      EAAQTTYETLLSQLQETRVIENQTVGNVRVVSLAQIP--NSPA----GP-DRRMYLVAGG
A0A1Z3HMQ0      LAAKTNYETLLVRLQEAQLAENQTVGSAQILEPAAPP--RFPV----GT-STKKYIAAGG
A0A433W533      KAAQSTYEILLQKLQEVRVAENQNMGNARIIESALAP--EKAL----SL-KPMIILAAGI
A0A2P8QWJ3      KAAQSTYEILLQKLQEVRVAENQNMGNARIIESALAP--EKAL----LF-KPMIILAAGI
K9U6L7          KAAQSTYEILLQKLQEVRVAENQNMGNARIIESALAP--EKAL----LF-KPMIILAAGI
U5DPF5          NAAQSTYEALLQRLQEVRVTENQNLGNARVVENALVP--INPI----WP-RMQLILMAGG
A0A1E5QP61      DAAQSAYQILLRNLQEVRIAENQNVGNARVISYATLP--VNPV----AP-NKKLLVAAGV
A0A846DWC7      DAAQSAYQILLRNLQEVRIAENQNVGNARVISYATLP--VNPV----AP-NKKLLVAAGV
A0A845Y5J4      EAAQSTYEILLKNYQEVQIAENQNVGNARIIAYAQEP--ELSV----GP-NKKLIIGAGV
A0A6P0X488      AAAQSTYEILLKNYQEVQIAENQNVGNARIIAYAQQP--EIAV----GP-NKKLIIGAGV
A0A6P0VDM0      AAAQSTYEILLKNYQEVQIAENQNVGNARIIAYAQQP--ELAV----GP-NKKLIIGAGV
A0A6P0UVD5      AAAQSTYEILLKNYQEVQIAENQNVGNARIIAYAQQP--ELAV----GP-NKKLIIGAGV
A0A846BFF2      AAAQSTYEILLKNYQEVQIAENQNVGNARIIAYAQQP--ELAV----GP-NKKLIIGAGV
A0A6M0G142      AAAQSTYEILLKNYNEVQIAENQNVGNARIIADALVP--EVAV----GP-NKKLIIAGGM
A0A6P0MR53      EAAQSTYEILLKNYQEVQIAENQNVGNARIIAYAQVP--EVPL----GP-KRKLIIAAGV
A0A3M2GIL5      NAAQSTYEILLKNLQEVQIVENQNVGNARVIASASPP--EFPV----GS-GKKLYLAAGI
A0A6H1TSJ9      NAAQSTYEILLKNLQEVQIVENQNVGNARVIASASPP--EFPV----GS-GKKLYLAAGI
A0A3M1PML8      NAAQTTYEALLLRLQEIQVAENQNIGNVRVVSPAIVP--DDPL----PS-QKKLFLIAGS
A0A6M8BE85      NAAQTTYEALLVRLQEIQVAENQNVGNVRVVSSATIP--DEPL----PS-KKKLFLVAGA
A0A0T7BPZ0      KASQTTYETLLTRLQEIHVAENQNMGNARIISTALVP--DKPG----NS-RKLLILGGAG
A0A352X442      EATQLTYSQLLQKLDETRLIENQNVGNARIVEAAAVP--EKPT----SS-KKKLIAAGGV
A0A6B3NF44      EAAQSTYGILLSKLQETRVAENQTVGNASIISTAIVP--ENPT----GS-KKKLILAAGG
A0A6M0EPL4      EAAQSTYGILLSKLQETRVAENQTVGNASIISTAIVP--ENPT----GS-KKKLILAAGG
A0A6P0K6L6      EAAQSTYGILLSKLQETRVAENQTVGNASIISTAIVP--ENPT----GS-KKKLILAAGG
A0A6P0MRR9      DIAQSTYQIILGKLQEAQVAENQNVGNARIISLATEP--KKPV----AS-KKKLVIAIGG
A0A6P0X1X4      QIAQSTYQVIEGKLQEAQVAENQNVGNAHIISYATEP--EKPI----AS-KKKLVIAAGS
A0A6P0UX57      DIAQSTYQIIEGKLQEAQVAENQNVGNAHIISYATEP--EKPV----AS-KKKLVIAAGG
A0A846B9S8      DIAQSTYQIIEGKLQEAQVAENQNVGNAHIISYATEP--EKPV----AS-KKKLVIAAGG
A0A0M0SHU3      KAAQTTYETLLTRLQEINVAENQNIGNARIISPALVP--DEPS----GA-RKALVVLGGG
A0A1D2PBN3      KAAQTTYETLLTRLQEIQVAENQNVGNARIISPALIP--DKPA----GS-RKILMITGGG
A0A0C2LVR7      KAAQTTYETLLTRLQEIQVAENQNVGNARIISPALIP--DKPA----GS-QKILVITGGG
A0A1Z4PQB9      KAAQTTYETLLTRLQEIQVAENQNVGNARIISPALIP--DKPA----GS-RKILMITGGG
A0A1Z4SFN6      KASQTTYEALLTRLQEVQVAENQNIGNARIISPALVP--DEPT----GP-RKALIIAGGG
K9PGI8          KAAQTTYEALLTKLQEVQVAENQNIGNARIISPALIP--DAPA----AS-QKNLIVLGGG
A0A654SFI6      ETNRQIYDALLQRYKELGAAGAGQ-NNIKLIDKADAP--LFPY----AP-SLLQNLLVAL
K9SSQ0          KQASTRLSTLSQKLEEAKSQEVQEATAWQILQSPSLP--SYPS----SP-NVILNLLLAG
A0A2W1JIN9      EALFNSIQLLERKLDEVRVAEAQLLSNFRILDLSEPS--GKPS----DP-NIPVVLILGT
A0A318AJV1      ASARAQFDKMSAMSLESTQAAHAAIAQAQIIDRADPP--VSPA----PP-GKVLLSGLAM
A0A845WDS5      EEATESLKFLQNKLEEARIAEAQLVSNIRIIAEAQVP--SLPS----EP-NKKVVLVLAT
A0A6P0IC70      EEATESLKFLQNKLEEARIAEAQLVSNIRIIAEAQVP--SLPS----EP-NKKVVLVLAT
A0A845VVD9      EEATESLKFLQNKLEEARIAEAQLVSNIRIIAEAQVP--SLPS----EP-NKKVVLVLAT
A0A6B3MUB5      EEATESLKFLQNKLEEARIAEAQLVSNIRIIAEAQVP--SLPS----EP-NKKVVLVLAT
A0A6M0B7N4      EEATESLKFLQNKLEEARIAEAQLVSNIRIIAEAQVP--SLPS----EP-NKKVVLVLAT
A0A6P0J9W3      EEATESLKFLQNKLEEARIAEAQLVSNIRIIAEAQVP--SLPS----EP-NKKVVLVLAT
A0A6P0ZWE1      EEATESLKFLQNKLEEARIAEAQLVSNIRIIAEAQVP--SLPS----EP-NKKVVLVLAT
A0A1U7N2U4      DEAIASLKLLQNKLEEARIAETQLVNNIQIIERAKLP--SSPK----EP-NPKVVLLIAS
A0A6L9YZL1      EEAIASLKLLQNKLEEAGIAEAQLVSNIQIIERAKLP--SSPK----QP-NPKVVLVIAT
A0A6P0KYM4      EEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--SSPK----QP-NPKLVLVIAT
A0A6P0LSD6      EEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--SSPK----QP-NPKLVLVIAT
A0A6P0PNZ7      EEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--SSPQ----EP-NPKVVLVIAT
F4XV38          EEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--SSPQ----EP-NPKVVLVIAT
A0A6P0W137      EEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--SSPQ----EP-NPKVVLVIAT
A0A845XHF7      EEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--SSPQ----EP-NPKVVLVIAT
A0A845ZEG9      EEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--SSPQ----EP-NPKVVLVIAT
A0A1D9G1F2      EEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--SSPK----EP-NPKVVLVIAT
A0A846CJ58      EEAIASLKLLQNKLEEARIAEAQLVSNIQIIERAKLP--SSPQ----EP-NPKVVLVIAT
A0A6L9Y9E2      EEAIASLKLLQNKLEEARIAEAQLVNNIQIIERAKLP--SSPK----EP-NPKVVLVIAT
A0A6P0SGR0      EEALASLKLLQNKLEEARIAEAQLVNNIQIIERAKLP--SSPK----EP-NPKVVLVIAT
A0A6M0BK48      DEAIASLKLLQNKLEEARIAEAQLVNNIQIIERAKLP--SSPK----EP-NPKVVLVIAT
A0A845WG36      DEAIASLKLLQNKLEEARIAEAQLVNNIQIIERAKLP--SSPK----EP-NPKVVLVIAT
A0A6P0X384      EEANNSLKFLQSKLEEARIAEAQLFSNLKIIEEAELP--SEPS----GP-NQKAMLVLAI
A0A2P8QIL5      QEAVTSLEFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RLPT----WP-NPAIVLVLAT
A0A433W447      QEAVTSLEFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RLPT----WP-NPAIVLVLAT
K9U1K8          QEAVTSLEFLQRKLEEARIAEAQKVSNLRPVDLAEPP--RLPT----WP-NPAIVLVLAT
A0A1Q4RZJ6      EEAAASLKFLQAKFEEARIAEAQKVSTLQVIQAAKAA--SIAS----SP-KPNVVLALAG
A0A1Z4SNV3      EEAAASLKFLQAKFEEARIAEAQKVSNLQVIQVAQPP--TEAS----SP-KPKVVLALAG
A0A2H2XJQ1      EEAAASLKFLQAKFEEARIAEAQKVSNLQVIQVAQPP--TEAS----SP-KPKVVLALAG
A0A3S5K358      EEAAASLKFLQAKFEEARIAEAQKVSTLQVIQAAKAA--SFAS----SP-KPNVVLALAG
A0A0T7BPJ4      EEAAESLKTLQRKLEEARIAEAQKVSNLSIIEFAKPG--TSPS----SP-KIPVVLVVAT
A0A0C1QS61      EEAAETLKLLQGKYEEARIAEAQQVGNLRIIEEAQPP--TSAT----SP-KKPAVLVLAT
A0A139X3R8      EEAAETLKLLQSKYEEARIAEAQQVGNIRIIEEALPP--TVAT----SP-RRSSVLVLAT
A0A844MZP8      EEAAETVKLLQSKYEEARIAEAQQVGNIRIIEEALPP--TAPA----SP-RRSVVLVLAT
A0A1Z4I7C5      EEAAESLKFLQSKLEEAQIAEAQKVSNIRILETAVVP--ELPS----SP-KRNVILVMAT
A0A844MST0      EEAAVSLKFLQSKLEEARIAEAQKVSNIHVIEEATLP--TSPA----SP-NVKAILVLAV
A0A0C2MDK7      EEAAASLKFLQGKLEEARLTEAQKVSNIRAIENAVAP--SSPS----QP-KQKVVLALAA
A0A856MDH8      EEAAVSLKFLQGKLEEARLTEAQKVSNIRTIENAVAP--SSPS----EP-KQKVVLALAG
A0A1Y0RCK1      EEAAASLKFLQSKLEEARLTEAQKVSNIRVIENAVAP--SSPS----EP-KQKVILALAS
A0A1Z4PWZ0      EEAAVSLKFLQSKLEEARLTEAQKVSNIRVIENAVPA--SSPS----DP-KPNVILALAS
A0A0C2QLT0      EEAAASLKFLQSKLEEARLTEAQKVSNIRVIENAVAP--SSPS----EP-KPKVILALAS
A0A1Z4J2K1      EEAAASLKFLQSKLEEARLTEAQKVSNIRVIENAVAP--SSPS----EP-KPKVILALAS
A0A3S0ZSX0      EESAASLKLLQSKLEEARIAEAQLVGNIQIIEAAQIP--LKPT----SP-HKKAVLAIAI
A0A2N6K4T3      EESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TKPS----LP-NKRSVLAIAT
A0A370CKT2      EESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TQPS----LP-NKRTVLAIAI
A0A0S3TL97      EESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TKPS----LP-NKRTVLAIAI
A0A2N6M8A0      EESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KKPS----LP-NKRSVLVIAI
A0A2N6M9E1      EESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TQPS----LP-NKRTVLAIAI
A0A2N6KJI4      EESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TKPS----LP-NKRTVLAIAI
A0A2N6MZ77      EESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TKPS----LP-NKRTVLAIAI
A0A2N6KT20      EESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TQPS----LP-NKRTVLAIAI
G6FSN3          EESAESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--TQPS----LP-NKRTVLAIAI
A0A4D9CI02      EEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KKPS----LP-NKKAVLAIAI
A0A328I8B9      EEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KKPS----LP-NKKAVLAIAI
A0A4Q9J4Z7      EEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KKPS----LP-NKKAVLAIAI
A0A0M0SU69      EEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KEPS----LP-NKKAVLAIAT
A0A1Z4TIZ8      EEAVESLKLLQSKLEEARIAEAQLVGNIQIIEAAQPP--KEPS----LP-NKKAILAIAT
K9UYB2          EETATSLKFLQDKLEEARIAEAQKVSNILIIDPAKPA--TIPA----SP-KIAVVLALAI
A0A1Q4S1H4      EEAAESFKGLQRKLEEARIAEAQKVSNIRIIEVANVP--TLPS----EP-QPAIILAIAG
A0A433VBU6      EQAAESFKALERKLEEARIAEAQKVSNIRVIEVATVP--TVPS----TP-KSTIILAIAG
A0A218QN17      EDATASLKSLQSKLEEARITEAQKVSNLRLIEAAKPP--TIAS----SP-KRSAVLALAT
A0A846HD20      EDATASLKSLQSKLEEARITEAQKVSNLRLIEAAKPP--TIAS----SP-KRSAVLALAT
K9RKN2          EESASTLKFLQGKLEEARLAQAQKVSNIRIIESATVP--ESPS----SP-KKPVVLALAT
A0A2I8ADV2      EEAAESLKLLQSKLEEARIAEAQKVSNLRIIELALVP--TDYA----YP-KRSVVLAIAI
A0A5Q0GMF5      EEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--ELPT----SP-KRTVVLVIAG
Q3MEW0          EEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--ELPT----SP-KRTVVLVIAG
A0A1Z4KIC7      EEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--ELPT----SP-KRTVVLVIAG
Q8YSM5          EEAAESLKFLQSKLEEAQIAEAQKVSNIRIIETAVAP--ELPT----SP-KRTVVLVIAG
                                                                            

K9SLA9          ILGLAFAGLVTFILAAIDKSIKTSEQASDISG-YSLLGIVP--------DFGYVAKHDQM
A0A168TT23      LLGLVVGVGLALLLEFLDSTVHRTEDVEKLVG-RPVLGLIP--------IVKLSEQRKKS
A0A0M1JWX9      MLGLMLGFGAALLVEQLDFVFHNPEDLKQATD-KPLLGLIP--------ISDRAK-----
A0A844MWN9      FLAAIISSLALVLLLERRNPLLSPKDLQAIR--FRIVARIP--------RLKQTNAGWQQ
A0A2T1M1V6      LLASLFGSLSVLLLLESRNPLFNSKDLQQAG--LPLVLRFP--------RLRSLSLEKGL
A0A2G7GCS2      ILAGLFGSISLIFFLEKRNPMLRPKDLEQVE--FPVLGRIS--------RLKRTDMERNL
K9XBH8          ILAALFGSVSLILFLESRNPMLSPRDLRQVE--FPVLGRIS--------RLKRPDMERAL
A0A1Z4LJ30      LLACGFGSAAIILFSENRDPLLSPKDIVQTN--IPVLANIP--------YIKNIHGKLEQ
Q7NF11          LVAAVFGSLGLILRKEAINPLLGPKDLQSVE--LPVLARLP--------RTKGL---LPS
K9RI76          LLASGFGSAAIILFMENRNPLLSPKDIQQAN--IPVLASIP--------YVRHINAKADR
A0A433VN22      LLASVIGSIALVLFLESRNPLLSAKDLQEQK--FAIVERIP--------RIKHSGVISEL
A0A139WSU3      LLASIIGSIALVLFLESRNPLLNLKDLQGQK--FAIVQSIP--------RIKHSDPKIEM
A0A844MJB7      LLASVIGSIALVLFLESRNPLLSLKDLQNQK--FAIVQSIP--------RVKHSTPKIEI
A0A352AE27      FVASVVGSIALLLLLEARNPLLSPKDLQTLK--FAIVVRIP--------RLKQSVVGLGL
A0A3B8JH60      LIASIVGSVALVLFLESRNPLLSPKDLQAIK--FPIVVRIP--------RFKQSDRALKL
A0A3C0N766      LIASIVGSVALVLFLESRNPLLSPKDLQAIK--FPIVVRIP--------RFKQSDRALKL
K9W9J7          LMASIIGSIALVLLLESRNPLLSPKDLQATK--FPIVVRIP--------RLRHSNLSWQV
Q7NJN6          LVAMLSGSIALALWLERRNPMLGVRELDSTG--LPVLGRIP--------KLKDA----AL
U5QCC3          LLAMIAGSVALALLLERRNPLLAKRDIEVTG--LPVLARLP--------KFKDN----EL
A0A1Z4JCS8      LLASVIGSIALILLLEARNPLLTPKDLQALK--FSLVARIP--------KLKRLAIEPNS
A0A846GVZ3      FLASAVGSIALVLLLERRNPLLSPKDLQAIK--FPMVVNIP--------HLRHAGMGLEL
A0A6P0PI80      FLASAVGSIALVLLLERRNPLLSPKDLQAIK--FPMVVNIP--------HLRHAGMGLEL
A0A6P0WGT6      FLASAVGSIALVLLLERRNPLLSPKDLQAIK--FPMVVNIP--------HLRHAGMGLEL
F4XTX2          FLASAVGSIALVLLLERRNPLLSPKDLQAIK--FPMVVNIP--------HLRHAGMGLEL
A0A3S0Y9N9      IGGILLGVATAFILEKMDKTIKTPESARELLG-YNLLGYIP--------PFTNN------
A0A6P0ZKB8      IGGIVLAVTTAFVLERLDKTIKTPKSAKDLLG-YALLGYIP--------PFPNG------
A0A846EDH6      IGGIVLAVTTAFVLERLDKTIKTPKSAKDLLG-YALLGYIP--------PFPNG------
A0A433UNK7      IGGIVLGVATAFVLERLDKTIKTSKSAKDILG-YNLLGYIP--------PFPNG------
B8HNB0          FAGVLAGIGLALLIERLDSRIHSVEEVKRASG-LPLLGTVP-------------------
A0A318BJ18      LAGLGIGALAAFVLEQMDEAIADPIEVTRRLG-LPLLGSVP-------------------
A0A3B8Y8H9      FMGIVLGMGAGLLAEKLDDTFHNAEELKQETR-LPLLATIP-------------------
A0A2W1JVB9      VLGSLLAFGVALLLDSRDKSVKTLEDIKALFSDYTMLGVIP--------AIEGVQTKIKE
A0A6H1U102      IAGGLLGVAAVILLERTDQRLQRVDEAKELTG-LPSLGVVP-------------------
A0A7C3ZEJ3      IAGGLLGIGAAILLERTDQRVKGVEEAKELTG-LPTLALVP-------------------
A0A2P8W9H0      LLGLLLGAGAAIVVDRFSGKIYTIDELKAAVR-LPVLGNIP--------ISSLLNSGGSV
A0A6I5P386      ILGLLLGCGAAIAWDRIKSKINTVEELKDITE-LPVLGAIP--------HSRLLENGQNL
A0A3M1SVZ4      FLGGLAGVATALLLEVQDRSIKSVGEAKAQLQ-FALLGVIP--------QVRKSNRLLGH
A0A318BG22      GFGVLAGVGIAFIIEFVDDSIKMPDDVEQKLH-LPLLGITP-------------------
A0A2T1E9V8      LAGILVAGAVVYFLELTDKKIKTVKEARELFD-YRLLGTIP--------IFNKIAEIGSG
A0A1Z4LN32      FVGLVLSIGSAYFVDLIDRRLKTAKEAEKLFG-YTLLGLIP--------KFDTNNAKSNH
A0A2I8A9F5      FGGLLVGIAVAFLLDVIDRRLKTAKEAEELFG-YTLLGLIP--------KFSNNFNTT--
A0A218Q6R8      FVGLLLGVAAAFFIDLIDRRVKTAKEAEELFG-YTLLGLIP--------VFETKNISN--
A0A218QGE0      FVGLLLGVASAFFVDLIDRRLKTTKEAEALFG-YTLLGLIP--------KYE-KNTST--
A0A846HDH5      FVGLLLGVASAFFVDLIDRRLKTTKEAEALFG-YTLLGLIP--------KFENNNTST--
A0A3M2GQQ6      IAGGLLGVAAAILVERSDQRVKHVDEAKELTG-LPSLGMIP-------------------
A0A6H1U2X0      IAGGLLGVAAAILVERSDQRVKHVDEAKELTG-LPSLGMIP-------------------
K9TLQ0          IAGLMAGIGAALLAEKLDTKFHSVEDIKDYMG-FPILGTIP---------FEKDLKESLT
K9QF04          FAGLLAGIGTAIAVEKFDNKYHSPEEIQDNTG-LTLLGTIP-------------------
K9W1T3          LLGILLGIAVALALETTDKSIKDPEDAKRILG-YPLLGTIP--------IIEHMDSSTTI
K9SGJ5          FAGILFGVAIAMYLERSDERIREVEEVRELTH-VPLLGSIP--------RTDMLELS---
A0A6N2JS94      ISGLVLGILLALLLNRLDQRIREVGEVREIID-IPLLASIP--------MTETASLS---
A0A6C2DSN4      IAGLGLGVLIALLLDRLDQRIREVEEVREIID-VPLLASIP--------MTEVASLA---
L8MYT6          IAGLGLGVLIALLLDRLDQRIREVEEVREIID-VPLLASIP--------MTEVASLA---
A0A352JGJ6      FIGLTLGILCALLFNRLDQRIREVEEVKEIID-IPLLASVP--------LTEVASLS---
A0A1J5GLS2      FVGAVLGILSALALDRLDQRIREVEEVKEIID-VPLLASIP--------ITEVTSLS---
A0A2W4W6M5      FFGLVLGISSALILNRLDQRIREVEEVREIID-IPLLASIP--------MTEVASLS---
A0A2W7AN33      ISGLALGVLLALLLNRLDQRIRDVGEVREIID-VPLLASIP--------FTDPVALI---
A0A256BLV2      ISGIALGILFALLLNRLDQRIREVEEVRELID-IPLLASIP--------MTEVSSLS---
A0A2W6ZXF3      FVGAVLGILSALALDRLDQRIREVEEVKEIID-IPLLASIP--------MTEVASLS---
A0A2Z5WX66      LGGLVLGVLFALLLNRLDQRIREVEEVKEIID-IPLLASIP--------MTEVASLG---
Q7NEU3          LLGLVFGLGIASLLESVDDRVKSISQAKELLN-LPLLGAIP--------FTEEEDLQASS
A0A3C0N2P0      VTGLMAGAGVAFLAEKLDKVFHSPDELKDSTG-LPILGTIP--------FTKKLKEDIGS
A0A6P0JR04      VAGLLAGAGAALIAEKLDVRFHSPDDLKDSLG-LPLLGIIP--------YRKDFKER---
A0A6B3M6M6      VAGMLAGCGAGLLAEKLDRVFHTPDEIKETTA-LPVLGTIP--------FRKELKKGFIS
A0A6P0KD09      VAGMLAGGGAGLLTEKFDRVFHTPDEIKEATG-LPVLGTIP--------FHKELKKGLIS
A0A6B3NIJ0      VAGMLAGGGAGLLAEKFDRVFHTPDEIKEATG-LPVLGTIP--------FHKELKKGLSS
A0A6M0F053      VAGMLAGGGAGLLAEKFDRVFHTPDEIKEATG-LPVLGTIP--------FHKELKKGLSS
A0A6P2ATU9      MAGLVAGVGAMLIVEKLDVRFHSAEDLKEMVR-IPLLGVIP--------FRKEFRQRRGK
A0A845XAM4      VAGLLAGIGTTLIAEKLDVRFHSADELKEMAR-LPLLGTIP--------YRKEFKGKTG-
A0A352XE00      VAGLIAGAGAGSLAEKLDKAFHSLDELKDSTG-LPILGTIP--------FDKVVKNSKKQ
A0A6P0QC14      IAGLLAGAGAGFLAEKLDKVFHSPDELKDSTG-LPVLGTIP--------FTKQLKTRAKE
B4VS56          VAGLLAGAGAGFLAEKLDKVFHSAEEVKEKTG-LAVLGTIP--------FHKPLKKPSKS
A0A352AAQ3      VAGLLAGAGAGMLAEKLDKAFHSPDELKDSTG-LAVLGTIP--------FGKELKKGIAR
A0A350Y472      IAGLLAGAGAGMLAEKLDKAFHSTDELKDTTG-LPLLGTIP--------FSKELKKNITR
A0A355DVB4      IAGLLAGAGAGMLAEKLDKAFHSTDELKDSTG-LPLLGTIP--------FSKELKKTITR
A0A1Z4RMB9      ILGAFLANLSIILLEMQDRSLQSLAEIKKKFA-YNVIGMTP-------------------
A0A318B4H2      LIGLVLAVGLVVLAEEIDQSLRDPADVQRELG-LPLLGTIP--------KVEDK------
A0A2K3BR24      ILGAMLGIATALALDARDRTVKTVQEVKDRLG-YTVLGSIP--------LVKTKMD----
K9YXY1          ILGAMLGVATALALDARDRTVKTVQEVKDRLS-YTVLGSIP--------LVKTKMD----
A0A1Q4RTR1      FLGIILAVGAALTLEALDGTVKTIEEAQELLG-YALLGTIP------------------R
A0A1Z4SQV2      FLGIILAVGAALMSEALDGSVRTLSEAQELLG-YSLLGTIP------------------R
A0A2H2XGN1      FLGIILAVGAALMSEALDGSVRTLSEAQELLG-YSLLGTIP------------------R
A0A433UXH8      FLGIILAVGAALTLEALDGTVKTIEEAQELLG-YALLGTIP------------------R
A0A1U7HGH0      LAGLMIAGGIVYLLELTDKKIKTAKEAREIFE-YKLLGTIP--------LFHNESQTE--
K9XJD3          LAGLMIAGAIVYLLELTDKRIKTAKEAREIFE-YKLLGTIP--------LFHNDSQTE--
K9SX01          VLGIVAAISVALLLNSRDNLLRSGEDIKRLFG-YPLLGILP--------NFATRKLENLP
A0A4P7ZT55      LLGAMAGAGAALLRDRLDHVFHSPRDVEQGID-QPLLGSIP--------FLPLE-----R
A0A1E5QIR9      VVGIFLAVVTALVLDAKDTRIKTVREAREYLG-YTLLGIIP--------NFEKIDKGLSY
A0A6P1A9A0      MAGLLAGIGAAMLAEKFDNRFHSPDDLKEITG-LALLGTIP-----YQKQVKGQTSGDWA
A0A1Z4IBC7      AVGIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIP--------TLGRNSKDESP
A0A5Q0GKD1      VAGIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIP--------TLGRNTKDDIP
Q3MDC6          VAGIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIP--------TLGRNTKDDIP
A0A1Z4KM73      VAGIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIP--------TLGRNGKDDTP
Q8YNX7          VAGIFLGIIAAFSIDLIDRSVKTVKEAKEVLR-YTVLGVIP--------TLGRNGKDDTP
A0A367R4K6      AIGFFLGIIAAFSLDLIDRSVKTVKEAKEVLR-YTVLGVIP--------TLGRNGKEHSS
A0A1E2WSV8      GIGLFLGIIIAFGLDLIDRSVKTVKEAKEVLR-YSVLGVIP--------TQGRNGKESSS
A0A7D7L9Y1      GIGLFLGIIVAFGLDLIDRSVKTVKEAKEVLR-YSVLGVIP--------TQGRNAKDPSS
A0A2R5FRT9      GIGLFLGIIVAFGLDLVDRSVKSVKEAKEVMK-YSVLGVIP--------TQSKNGKDNPS
A0A2K8T1B6      GVGLFLGIIVAFGLDLIDRSLKTVKEAKEVLR-YSVLGVIP--------TQSRNGRDHSS
A0A235I9I0      GVGFFLGIIVAFTLDLIDRSVKTVKEAKEVLR-YSVLGVIP--------TQGRNGKDHSS
A0A2D0HQT8      GVGFFLGIIVAFTLDLIDRSVKTVKEAKEVLR-YSVLGVIP--------TQGRNGKDHSS
A0A2L2NU95      GVGFFLGIIVAFTLDLIDRSVKTVKEAKDVLR-YSVLGVIP--------TQARNGKDHSS
A0A367S084      GIGFFLGIIVAFTLDLIDRSVKTVKEAKEVLR-YSVLGVIP--------AQGRNGKDHSS
A0A1Z4SMD6      FGGLLFGVAVAFFIDLIDNSLKTVKEAEVLFD-LTLLGLIP--------KF--------E
A0A2H2Y096      FGGLLFGVAVAFFIDLIDNSLKTVKEAEVLFD-LTLLGLIP--------KF--------E
K9S8M8          VGGMLY-LIVAFVFELIDPTVKTAKEIRNLYQ-YTLLGMIP--------RSKKKRWWFGS
A0A1Z4NFV0      FAGLSLGIAAAFLIDLVDRSIKSVKEAESVFG-YTLLGLIP--------RF--------D
A0A3M9ZEU1      -VGALLAITTAFLLDLCDRSIKTVQEAKALFG-YTLLGLIP--------DY--------T
A0A1Z4JK72      -IGLLLGVAAAFFRDMMDKSLKTVKEAEAQYG-YTMLGLVP--------KF--------E
A0A0N7Z489      -VGLLLGIAAAFLVDTIDKSLKTVKDAEAQYG-YTLLGLVP--------RF--------E
A0A0S3TXS2      -VGLLLGIAAAFLVDSIDKSLKTVKDAEAQYG-YTLLGLVP--------RF--------E
A0A2A2TPF8      FVGLMFGIAAAFLIDIIDRSIKTIKEAETIFG-YTLLGLIP--------KF--------E
A0A1Z4R0P8      FVGLMLGIAAAFLIDIIDRSIKTTKEAQNIFG-YTLLGLIP--------KF--------S
A0A0T7BUI3      FAGSLLGIAGAFFVDLIDRSLKTVKEAENFFG-WTLLGLIP--------RF--------E
A0A1Z4LP32      FVGLLLGIAAAFTVDLIDRSLKTIKEIEEFFG-YTLIGLIP--------KF--------E
K9REP9          FVGLLFGIAAAFTVDLIDRSLKTVKEIEGFFN-YTLVGLIP--------KF--------E
A0A1Z4SIJ3      FAGLLFGVSIAFFVDLIDNSLKTIKETEAFFE-YPLLGLIP--------KF--------E
A0A2H2XPG4      FAGLLFGVSIAFFVDLIDNSLKTIKETEAFFE-YPLLGLIP--------KF--------E
A0A2A2TC28      FVGLLVGIASAFFIDLIDRSLKTVKESEKFFG-YTMLGFIP--------KF--------E
K9V3C7          FVGVFLGIAAAFLVDSIDKSIKTIKEAQTLFG-YTPLGLIP--------KF--------D
A0A1Z4T6Y7      FIGALLGVAAAFLVDVIDKSIKTVKEAQDVFG-YTMLGLIP--------KF--------E
A0A2H2Y561      FIGALLGVAAAFLVDVIDKSIKTVKEAQDVFG-YTMLGLIP--------KF--------E
A0A1Q4S362      FIGALLGVAAAFVVDVIDKSIKTVKEAQDVFG-YTLLGLIP--------KF--------D
A0A3S1CIN8      FIGTLLGVAAAFLVDVIDKSIKTVKEAQDVFG-YTLLGLIP--------KF--------D
A0A0C1NCB0      LGGLLLGVAAAFFVDLVDRSLKTAKEAEEFFK-YTVLGLIP--------TFESSTKSSSE
A0A844MLU2      FGGLLVGVAAAFFIDLIDRSLKTAKEAEAFFD-YTLLGLIP--------SF--------E
A0A2N6K7Q9      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
A0A2N6MXH6      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
A0A2N6M5A8      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
A0A2N6LL61      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
A0A0S3TP66      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
G6FP91          FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
A0A1U7GYR5      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
A0A2N6KY52      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
A0A2N6KMP5      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
A0A2N6MA45      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
A0A4Q9J9V9      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
A0A328IGA1      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
A0A4D9CE41      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YILLGLIP--------KY--------K
A0A0M0SFT2      FAGVLISIAAAFFVDLIDRSLKTIKETETFFG-YTLLGLIP--------KY--------K
A0A1Z4TLC8      FAGVLLSIAAAFFVDLIDRSLKTVKETETFFG-YTLLGLIP--------KY--------K
A0A1Z4IYV4      FVGLLLGIAAAFFVDLVDRSLKTVKEAETFFG-YTLLGLIP--------KF--------E
A0A1Z4Q0T6      FVGLLLGVAAAFFVDLVDRSLKTVKEAETFFG-YTMLGLIP--------KF--------E
A0A0C2PT44      FVGLLLGVAAAFFVDLVDRSLKTVKEAETFFG-YTMLGLIP--------KF--------E
A0A1D2P6J4      FVGLLVGVAAAFFVDLIDRSLKTVKEAETFFG-YTLLGLIP--------KF--------E
A0A0C2LFH0      FVGLLLGTAAAFFVDLIDRTLKTVKEAETFFG-YTLLGLIP--------KF--------E
A0A856M734      FVGLLLGTAAAFFVDLIDRTLKTVKEAETFFG-YTLLGLIP--------RF--------E
B4WP72          LAGSLVGISAAFAQDLLDRSIKTLNDCREQFG-YALLGAIP--------LFNETSNLHRS
A0A2T1CIL7      AMGVLLATAFAFLLDFKDRSIKNSKEAEEIFG-YPLQGVIPDSGYSAETTVSRGMQELSF
A0A433V7A0      LVGTLLATATIFVLELTDKSIKNIEEARKIFD-YTLLGVIP--------YYGSFEKHSSR
A0A2T1FTR8      FLGLFLGAATAFLLDGADKRIKTSEEAKSLLPGYPILGQIP--------VFEKSRQLPKL
K9UA41          FLGLFLGAATAFLLDGADKRIKTSEEAKNLLPGYPILGQIP--------VFEKSRQLPKL
A0A563VS48      AIGTLLGIAVAFLIDIRDNTIKNTREAEQMLP-YPLRGVIP--------DC---------
A0A7Y0NUK1      VLGTLLGIAMAFLLDIKDNTIKNTKEAEEMLP-YPLQGVIP--------KIPHL------
A0A0C2LBE2      ILGVLFGAVAAFALDTIDPSLKTVKQAKELFK-YTLLGVIP--------LTGRNQKKSLR
A0A433NN38      ILGILLGVVAAFSLELVDQSVKTLKEAKELFQ-YTLLGVIP--------NLSRYGKT--L
A0A2N6K0T2      VLGILLGIIAALAADLIDRSIKTVREARELFQ-YTLLGVIP--------SVSKTSKNNYS
A0A2N6ML72      VLGIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIP--------NVSRNNKNSYS
G6FQZ6          VLGIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIP--------NVSRNNKNSYS
A0A2N6MQX9      VLGIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIP--------NVSRNNKNSYS
A0A2N6KXT6      VLGIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIP--------NVSRNNKNSYS
A0A2N6KGB9      VLGIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIP--------NVSRNNKNSYS
A0A2N6L3Y5      VLGIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIP--------NVSRNNKNSYS
A0A0S3TIS7      VLGIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIP--------NVSRNTKNSYS
A0A1U7GW28      VLGIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIP--------NVSRNTKNSYS
A0A2N6LW63      VLGIMLGIIAALAVDLIDRSIKTVKEARELFQ-YTLLGVIP--------NVSRNTKNSYS
A0A328IH74      VLGILLGIITALASDLIDRSIKTVKEARELFQ-YTLLGVIP--------SVSRSGKNSYS
A0A4D9CIB0      ILGILLGIITALASDLIDRSIKTVKEARELFQ-YTLLGVIP--------SVSRSGKSSYS
A0A1Z4TQ63      VLGILLGIIAALTSDLIDRSIKTVREARELFQ-YTLLGVIP--------SVSRSGKSSYS
A0A4Q9J8G2      ILGILLGIIAALISDLIDRSIKTVKEARELFQ-YTLLGVIP--------SVSRSGKNSYS
A0A350Y0P6      VAGSLLYIVTAFVLDLMDPSIKTAKEIRQLFK-YTWLGMIP--------ESRKK--GFFW
A0A352X940      IAGSLLYIIVAFVLDLMDPSIKTAKEVRQLFR-YTWLGMIP--------NLRKK--GLLS
B8HTN4          ILGSLGAIVVIFILESKDKTLKSLEEIQQYFD-YVTLAMIP--------FDKAAATANKA
A0A6P1AFJ5      IAGLLAGGGAALVAEKLDRVFHSPEELHKTTN-LPILGTIP--------FQKKI------
B0CAX4          FLGGLLGLGTALLLEALDTSVKTVQEATGLFD-YTVLGNIP--------LLKDA--EKMT
A0A1Z4RN12      MMGALFGMALAFLLDLKDNTIKNTQEVENLFA-YPLHGVVP--------NLNLT--GERK
A0A2T1CMF9      MMGLLFGTALAFLLDLKDNTIKNTQEVENMFA-YPLHGVVP--------DLSLG--GNNQ
Q7NDC5          VLALILAALAAYTREFFDDSLRSVEEARGLLG-TSLLGSVP--------RWNAQ------
U5QGK3          LLGAILAMLVAYGREFFDDSLQTVEEATSLLG-TPLLGTIP--------RWTGA------
A0A2W4UY24      VVGALLGIAIAFLADLLETSVKTVTEGQKLYD-YPLLGVIP--------DWRKR--TARN
A0A838VM23      MLGMMLATGMVVILEVRDRSIKTLKEARELYG-YTLLGAIP--------SFGKK--NSLR
A0A0D8ZUV2      IVSALLAGATIIILEVRDTSVKTLKEAQELFG-YTFLGTIP--------MLGKK--ANSR
A0A433VDI0      MLGILLAAATIVILEVKDTSIKTLEEALELFG-YTLLGVIP--------ALNKK--AIPR
A0A3D1PG43      VLATLLATGTILILEISDRTIKTLREVRDAFG-YTVIACIP--------HV-GKKVGFRN
A0A2P8QQ72      IAAILLAIATITLLELSDASIKTLREVKQLFG-YTLIGSIP--------QL-GKFIKLKP
K9TZQ7          IAAILLAIATITLLELSDASIKTLREIKQLFG-YTLIGSIP--------QL-GKFIKLKP
A0A6N8G584      VLALILAILTICILELSDRSVKTLREARERLD-YTLLGTIP--------HF-GK--RYAT
A0A2G7GPR0      VLALILAILTICILELSDRSVKTLREARERLD-YTLLGTIP--------YF-GK--RYAN
K9XH68          ILALILAILTICILELSDRSVKTLREARERLD-YTLLGTIP--------YF-GK--RYAN
A0A1U7HW70      ILALILAILTICILELSDRSVKTLREARERLD-YTLLGTIP--------YF-GK--RYAN
A0A2S6VEJ8      VLALILAILTICILELSDRSVKTLREARERLD-YTLLGTIP--------YFGGK--RFAN
A0A140KBA0      LLGGLLGIAVAFLLDLKDNSLKNSQEIEEIFG-YPLQGVIP--------DLAKE--GSPN
K9XSG1          LLGGLLGIAVAFLLDLKDNSLKNSKEIEEIFG-YPLQGVIP--------DLEKE--GSPH
A0A2T1GMT4      LVGALFGTSAIAYLELRDGSLKTVKEIDKVFG-YTLLGMIP--------ATQRK--KNRA
K9UI51          LVGALLGTSAIAYLELRDSSLKTVKEIDKIFG-YTLLGMIP--------ATQKK--KIRS
A0A1Z4QL41      TLGVFLASSTIFILEMRDSSLKTVNEVREIFG-YTLLGMMP--------LLAKK--VPFR
K9TYI2          MIGALLSTSTVLFLELRDRSLKTLEEIRQRFR-YTLLGVIP--------LVANK--VRSN
A0A252D4T4      LLGAFLATTAVIFLETRDRSLKTLKQIREIFG-YTLLGIVP--------SSTKK--LRSR
A0A252DJH5      LLGAFLATTAVIFLETRDRSLKTLKQIREIFG-YTLLGIVP--------SSTKK--LRSR
A0A252EB80      LLGAFLATTAVVFLETRDRSLKTLKQIREIFG-YTLLGIVP--------SSTKK--LRSR
A0A6G9SKZ9      LLGAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVP--------SSTKK--IRSR
A0A1Z4HPW5      LLGAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVP--------SSTKK--IRSR
A0A1Z4MSN1      LLGAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVP--------SSTKK--IRSR
A0A1Z4U1C2      LLGAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVP--------SSTKK--IRSR
A0A0D6KV51      LLGAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVP--------SSTKK--IRSR
A0A1Z4MKF8      LLGAFLATTAVIFLETRDRSLKTLKEIREIFG-YTLLGIVP--------SSTKK--IRSR
A0A2C6WC43      MLGLFLATTTVLFLGMRDRSLKTLREVRDIFR-YTLLGIVP--------LSVKK--VRSR
A0A841WRE0      MLGLFLATTTVLFLGMRDRSLKTLREVRDIFR-YTLLGIVP--------LSVKK--VRSR
A0A1Z4L5A1      MFGLFLATTTVLFLGMRDRSLKTLKEVRDVFG-YTLLGIVP--------LSVKK--VRSR
A0A367QD86      MFGLFLATTTVLLLGMRDRSLKTLKEVRDVFR-YTLLGIIP--------LSVKK--VRSR
A0A2K8SM78      MFGLFLATTTILFLSMRDRSLKTLKEVRDVFR-YTLLGIIP--------LSVKK--VRSR
A0A2R5FPC0      MFGLFLATTTVLFLSMRDRSLKTLKEVRDVFR-YTLLGIIP--------LSVKK--VR-R
A0A5P8W5T6      MFGLFLATTAVLFLSMRDRSLKTLKEVRDIFR-YTLLGIVP--------LSVKK--VRSR
A0A7D7LDT7      MFGLFFATTTVFLLAMRDRSLKTLKEVRDIFG-YTLLGIVP--------LSVKK--LRSR
A0A235IZ96      MFGLFFATTTVLFLAMRDKSLKTLREVRDVFG-YTLLGIVP--------LSVKK--VRSR
A0A2L2NGP0      MFGLFFATTTVLFLAMRDKSLKTLREVRDVFG-YTLLGIVP--------LSVKK--VRSR
K9QM62          MFGAFLSTTTVLLLEMRDRSLKTLQEIRQVFE-YTLLGIIP--------TSPVS--HKTM
A0A1Z4FWI3      LLGAFLSTTAVVFLETRDRSLKTLNEIREIFGRYTLLGIVP--------SSTKK--LRSR
A0A1Z4JYE7      MFGLFLATSTILLLEIKDKSLKTLDKVKEAFNGYTLLGIIP--------LLPQK--TISR
A0A0F5YE28      MLGLVGATTSVLILAMGDQNIRTVEEAKKTFG-YTLLGIIP--------MFKNK--RFSD
U7QEH7          MLGLVAATTSVLLLEMGDKYIRSVEETKKIFG-YTLLGIIP--------MFKNK--RLSS
A0A3S1ATK5      LLGAFFGTTTILLLEMRDRSLKTLQEVRDIFG-YTLLGILP--------SLSKK--SLFW
A0A2Z6CPH0      MFGAFLSTTTVLFLEMRDKSLKTLKEIREVFE-YPLLGVIP--------LSAHK--THSR
A0A1Z4GT50      LLGLFLSTSAVAALETRDRSLKTLKEVKEIFG-YTLLGMLP--------LSTKK--GRSR
A0A1Z4GIX0      TFGAFLSTSAVLFLEMRDKSLKTLKEIREVFG-YTLLGGIP--------LSTNK--MRSR
A0A2H6LC24      TFGAFLSTSAVLFLEMRDKSLKTLKEIREVFG-YTLLGGIP--------LSTNK--MRSR
B2J6N5          MFGLFLATTTVLVLGMRDRSLKTLQEIRDIFR-YTLLGIVP--------LSVKK--IHSR
A0A367RMI4      MFGLFFATTTVLFLAMRDRSLKTLKEIRDVFR-YTLLGIVP--------LSVKK--LRSR
A0A235HUM0      MFGLFFATTTILFLAMRDRSLKTLKEIRDVFG-YTLLGIVP--------LSVKK--LRSR
A0A2L2NW47      MFGLFFATTTVLFLAMRDRSLKTLKEIRDVFG-YTLLGIVP--------LSVKK--LRSR
A0A1E2WUR1      MFGLFFATTTILLLAMRDRSLKTLKEVRDIFG-YTLLGIVP--------LSVKK--LRSR
A0A235IKU3      MFGLFFATTTVLFLAMRDKSLKTLREVRDVFG-YTLLGIVP--------LSVKK--VRSR
A0A1U7MYU6      MLGVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
A0A1D8TNX9      MLGVTLATTAILLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
A0A6P0L6C2      MLGVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
A0A6P0MVH0      MLGVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
A0A6P0KJV0      MLGVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
A0A6L9ZJG4      MLGVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
A0A846GI17      MLGVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
F4XKF3          MLGVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
A0A1D9FX10      MLGVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
A0A6P0Q0T0      MLGVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
A0A6P0W5I0      MLGVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
A0A845XJ02      MLGVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
A0A846D190      MLGVTLATTAVLLLEMRDRSIKTLKEVKQLLR-YPVLGVIP--------VFKHK--KLSR
A0A3C0NJ41      TAGTLLGMATIILLEVRDVSLKTLKEVREQFG-YTLLATIP--------LLGKK--PRRR
A0A352AG88      ALGILLAIVTIITLEVRDTSIKTLREVRELFG-YTLLGVIP--------SLTKK--GISR
A0A350Y374      MAGTLLAMATIIILEVRDNSIKTLKEVKDLFG-YTLLATIP--------TFGKK--TVSR
A0A355DPX0      MAGTLLAMATIIILEVRDNSIKTLKEIKDLFG-YTLLATIP--------TFGKK--TVPR
A0A0S3TYD7      GAGLLLAFAATVLAYLLDRRIRTVQDLKDVFD-YPVLGMIP--------SFTDSGLSQVM
A0A2T1DNG3      VVGILLGGVAAVSREVLDDSVHSSDELKQQTA-VPLLGTIP--------ELSLGAMSGKP
A0A140K3H3      VAGSLMGVATAFLLQKLDQRVKQVEEVKQMVR-LPLLGTIP-------------------
K9XUB8          MAGGFMGVATAFLLQKLDQRVKQVEQVKQIAR-LPLLGTIP-------------------
A0A563VLD6      AGGGFIGILTAWLLHQLDTRVKLIDEVKQITQ-LPLLGAVP-------------------
A0A7Y0NVW6      AGGSFLGILTAWLLHQLDTRIKLIDQVKQATQ-LPLIGAIP-------------------
U5QL42          IASVFLGLGAAFVPDLIDERIKGVEEAKELTG-LPLLGAIP-------------KTENLT
A0A6H2NHD5      VISLLLGGGAALLRDKFDQVFHDVDELAKVTR-LPNLALVP--------EASGLEHRSLL
A0A2P8W4F7      VIGLMLGGVAALLRDRMDQAFHSTDELIKTTQ-LPNLTTIP--------NAPALQKQPLL
A0A5Q4E0Z4      VVGLLLGGGAALLRDRADTAFHSADELVKATQ-LPNLALVP--------NAPALQKQPLL
A0A2P8VVX1      VAGLFVGGALAFGVESIDQRVRTSDELKKQVP-LPLLGMLP----RRPSSLPPLRRSEPD
A0A2P8WHY0      VAGLFVGGGLAFARDSMDKVVRTSDDLKRQVP-LPLLGILPVQPIRKGFSLPGRQDGGPP
A0A563VQJ3      LSGLFLSNLTAIALEWQDRTVKSIPELKKKLP-YKVLGVIP--------QMDDVKEQGVL
A0A7Y0IRJ7      LAGLLFSNLTAIVLEWRDRTIKSIPEIKKKLP-YKVLGVLP--------QVEDYQQQGVL
A0A2T1CMT9      VVASFVGGFAAFVKDFTDETINTSKEIERRTS-LPILGTAP--------GLSISSSNNLL
A0A7G8J1V5      MLALAAGVGAGLLRDRLDHVFHQPVDVKDDLN-LPLLGHVP--------HVSFFQGVRED
A0A354B169      ILGLVAGAFAGLLRDRLDHVFHTAAEAKADLR-LPLLGHIP--------HVNFFQGVREG
Q0IDT5          MLGLVAGVAAGLIRDRFDHVFHLPAEVKDDLN-LPLLGHIP--------HVAFFKGVRED
A0A7G8FZD9      MLGLVAGAGAGLLRDRKDHVFHNPGEVKAEMGELPLLGHVP--------YVDFFKGVRED
G4FMX5          LLGLVAGAGAGLLRDRKDHVFHSPGEVKAEIGDLPLLGHIP--------YVDFFKGVRED
A3ZA21          VLGLVAGAGAGLLRDRLDHVFHHPGEVKDDLG-LPLLGHIP--------HVSFFQGVRED
A0A076HBF2      VLGLVAGAAAGLLRDRMDHVFHHAGEVKDDLG-LPLLGHIP--------HVEFFKGVRED
A0A7G8FP50      VLGLVAGAAAGLLRDRMDHVFHHPGEVKDDLG-LPLLGYIP--------HVDFFKGVRED
A0A7G8E8K7      VLGLVAGAAAGLLRDRMDHVFHHAGEVKDDLN-LPLLGHIP--------HVEFFKGVRED
A0A7G8GNR2      VLGLVAGAAAGLLRDRMDHVFHHAGEVKDDLN-LPLLGHIP--------HVEFFKGVRED
A0A7G8ICD3      VLGLVAGAAAGLLRDRMDHVFHHAGEVKDDLG-LPLLGHIP--------HVEFFKGVREG
A0A2D6FCW3      VLGLVAGAAAGLLRDRMDHVFHHAGEVKMDLG-LPLLGHIP--------HVDLFKGVRED
A0A7G7KJ95      MLGLVAGAGAGLLRDRMDHVFHHAGEVKDELG-LPLLGHVP--------YVSFFQGVRED
A0A7G8EAN3      VLGLVAGAGAGLLRDRMDHVFHHAGEVKDELG-LPLLGHVP--------YVSFFQGVREN
A0A1D8TX52      VVGLFLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A1D9G4T2      VVGLFLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A6P0PR27      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------QLPEGKISKPV
A0A6P0WER7      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------QLPEGKISKPV
A0A845XM36      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------QLPEGKISKPV
A0A846DAT1      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------QLPEGKISKPV
A0A846GZK8      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------QLPEGKISKPV
F4XP71          VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------QLPEGKISKPV
A0A6P0KZ31      VVGLFLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A6P0LPB8      VVGLFLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A6L9YR57      VVGLFLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A845WMG9      VVGLFLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A6P0SEV1      VVGLFLGGVAAFVREAMDDGIHSSEDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A6B3N2I8      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A6M0B891      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A6P0IJQ1      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A6P0J8J8      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A6P0ZSH6      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A845VS63      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A1U7N5X9      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A6L9Z1V0      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A6P0LC12      VVGLFLGGVAAFVREAMDDGIHSSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A6P0MVJ3      VVGLFLGGVAAFVREAMDDGIHTSDDLKNQVA-LPLLGMIP--------ELPEGKISKPV
A0A2W6ZAV2      LIGGVAGVGAALLRDRLDHVFHQPQDVEDGLG-LPLLGRLP--------FLPVQDGLSIT
K9W742          VAGVMLGGIAAFIRETMDDAVRSSDELKQQVA-LPVLGMTP--------VLPKAKKSEPR
A0A3D1PBA3      VAGLMLGGVAAFLREAVDDSVHTSEELEKQVE-LPLLGMTP--------ELPKNKLAKPQ
K9XPB0          VVASFLGGTTAFIKESLDEQLYNSRQIQEKIA-LPLLGSTP--------GLPLAKHDQFV
A0A350Y7Z1      VVGLFLGGLAAFGREALDDAVHSSEELKRQVA-LPLLGIIP--------ELPRTGGSGLL
A0A352X2A7      VVGLFLGGIAAFGREFIDDGVHTSDQLKRNLT-LPFLGIIP--------ELPKTRSSSIF
A0A0D8ZYV0      VAGLMLGGVAAFLREATDDAVHTSDELEKQVS-IPLLGMTP--------EMPQTKASEPV
A0A433VMS2      VAGLMLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMTP--------ELPRGRVAQPE
K9TYA7          VAGLMLGSLAAFLRDAVDDSVHSSEDLERQFE-LPLLGMTP--------ELPRGRVAQPE
A0A2P8QUE1      VAGLMLGSLAAFLRDAVDDSVYSSEDLEKQFE-LPLLGMTP--------ELPRGRVAQPE
K9SA61          VAGLMLGAVAAFVREGVDDAVHTSDDLQKQVP-LPLLGMIP--------ELPRSVSVAEP
A0A2G7GMH8      VVGLTLGCFAAFIREAVDDAVHSSDELKKQVA-LPLLGLIP--------ELPP----AKP
A0A6N8FU92      VVGLTLGCFAAFIREAVDDAVHSSDELKKRVE-LPLLGLIP--------ELPP----AKP
A0A2T1DWE8      VAGLMLGSVAAFIRDTMDDAVHNADDL-KQVA-VPLLGMVP--------ALQYEGGLAAL
A0A832H7C4      FGGLVLGCFAAFAREAFDDAVHSSDELKKQVA-VPLLGMTP--------A-------APE
A0A1U7I8L3      VVGLMLGSIVAFIRDMIDDAVHTSDDLKKQVD-LPLLGIIP--------QLNPQTRTEPI
A0A2T1DJL8      VGGLMLGGVAAFLREAADDAVRTSEDFKQQVP-LPLLGMVP--------EVPLGEINPRS
A0A1Z4J9W0      AGGLMLGCVAAFLRESADKSIRTSEDLTKEAS-IPLIGMVP--------ELPMSELMPTT
A0A0N7Z5K9      AAGLMLGSVAAFLRESADKSIRTSEDLTKQAS-IPLIGMVP--------ELPMSELMPTT
A0A0S3TXC5      AGGLLLGCVAAFLRESADKSIRTSEDLTKQAS-IPLIGMVP--------ELPLSELMPTT
A0A846FBD3      VAGILSAIAIAFLIDLRDRSVKTVKEAKAFFD-YPLLGMIP--------AFGKSGPQ---
K1XF69          MGGLVASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGIIP--------SFAAPPFYRYL
B5W297          MGGLVASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGIIP--------SFAAPPFYRYL
H1W7M8          MGGLVASTTLLLLMEMGDKSLRTVAETRDLFG-YTLLGIIP--------SFAAPPFYRYL
A0A5Q4H6A5      MGGLVASTTLLLLMEMGDKSLRTVAETRDLLG-YTLLGIIP--------SFAAPPFYRYF
D5A466          MGGLVASTTLLLLMEMGDKSLRTVAETRDLLG-YTLLGIIP--------SFADPPFYRYF
B4WQE3          ILGLLLGSGIALLVDRVKGKICTVRELKDLTN-VPLLATIP--------YNHLLEGSKAS
U5QJM6          ILSVVFGLLVAVLLETFDDRVKTVERAKELMQ-LPLLGAIP--------YNDELNTTAKS
A0A0V7ZFJ4      IGGILLGVGTALLLERTDKSLKTVDKIKQLLD-YPLLGTIP--------KTPKTTKGST-
A0A235IXQ2      FLGFFFAIGVALLLEAGDKSVKTAEEAQHFLD-YPLLGKIP--------VFDQKARLAR-
A0A367RIS1      FLGFFLAIAAALLLEAGDTSVKTTEEAQELLD-YPLLGTIP--------VFEQKDKLAR-
A0A841V8H9      FLGFFLAIAAALLLESGDKSVKTTEEAQQLLD-YPLLGTIP--------VFDQKARLAR-
A0A5Q0GJJ5      FLGFFLAIGAALLLEAGDKSVRTQEEAQQLLD-YPLLGTIP--------AFDQKARLAR-
Q3MEB7          FLGFFLAIGAALLLEAGDKSVRTQEEAQQLLD-YPLLGTIP--------AFDQKARLAR-
A0A1Z4KHN9      FLGFFLAIGAALLLEAGDKSVRTLEEAQQLLD-YPLLGTIP--------VFDQKVRLAR-
Q8YT70          FLGFFLAIGAALLLEAGDKSVRTLEEAQQLLD-YPLLGTIP--------VFDQKVRLAR-
A0A7U3NLX2      FLGFFLAFAAALLLDAVDKSVKTAEEAQELFG-YPLLGTVP--------------KLSR-
A0A166IWU6      FLGILLAVGSALFLDALDKSVQTAAEAEQLLD-YPLLGKIP--------------KMIR-
A0A2S0Q8C0      FLGILLAVGSALLLDALDKSVQTAAEAEQLLD-YPLLGKIP--------------KMIR-
W6FSX4          FLGILLAVGSALLLDALDKSVQTAAEAEQLLD-YPLLGKIP--------------KMIR-
A0A218Q4C1      FLGILLAFGSALLLDAVDKSVQTAEEAEKLFD-YPLLGKVP--------------KLLR-
A0A6P1ZT04      FLGIVLAFGSALLLDAVDKSVQTAEEAEKLLG-YPLLGKVP--------------KLLR-
A0A0V7ZNJ9      FLGILLGAGTALILETMDKSLKTVDQAKRLLN-YPVLGTIP--------QFEGKG-----
A0A5P8VSD1      FLGFFLGIGAALLLEAEDKSVKTAEEAQQLLD-YPLLGTIP--------LFDQKTRLAR-
A0A1S1ZVW2      IVGLVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIP--------QYENTKRRKNQ
A0A0R0M9H9      LVGLVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIP--------QYENTKRRKNQ
A0A7H0F4U6      LVGVVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIP--------QYENTKRQKNA
A0A7W2A1T7      LVGVVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIP--------QYENTKRQKNA
A0A838WI98      LVGVVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIP--------QYENTKRQKNA
A0A853MJX6      LVGVVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIP--------QYENTKRQKNA
A0A1B7WX82      FLGILLGAGTALLLESMNQALKNVEEANRLLG-FPLLGMIP--------LYGGKNPKNQ-
A0A1B7WTD1      FLALLLGAGTALLLESMNQTLKNIEEANRLLG-FPLLGTIP--------LYGEKKTKNP-
A0A480ABC0      FLGLLLGAGTALLLESMNQTLKNIEEANRFLG-FPLLGTIP--------QYGEKKRKNTV
A0A1Z4LRU5      FLGILLGVGTALILEAMDKSLKTLDEAKKLLG-YPLLGTIP--------RVDE----K--
A0A1Z4JVB4      ALGILLGIGVAILLEAMDSSLKTVEQAQDLLD-YPLLGIIP--------KVETAKGNH--
K9PIA4          FLGILLGLGTALVLESMDNSLKNVEEVKRLLG-YPVLGTIP--------LAEKVKGSD--
A0A1Z4HVE1      FMGIMLGLGTALILEAMDNSLKTIEEVKRLLG-YPLLGTIP--------LAEKVKDSD--
A0A252ECZ1      FLGILLGVGTGLLLEAMDTSLKTIEEVKHLLD-YPLLGIIP--------LAEKAKGSD--
A0A1Z4G5Y1      VLAIALGVGAALMLEAADNSLKTIEEVKRLLD-YPLLGTIP--------LAEKPKGVD--
A0A252DNA2      VLGILLGVGVALMLEATDNSLKTIEEVKRLLD-YPLLGTIP--------LAEKPKGSD--
A0A252E1Q4      VLGILLGVGVALMLEATDNSLKTIEEVKRLLD-YPLLGTIP--------LAEKPKGSD--
A0A6G9SK36      LLGIVLGAGTALVLESIDNSLKTVEEAKRILE-YPLLGAIP--------LSEKAKNIE--
A0A1Z4M597      ILGIILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAIP--------QAEKAKGSE--
A0A1Z4MWT1      ILGIILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAIP--------LAEKAKGSE--
A0A1Z4TX53      ILGIILGAGTALVLESIDNSLKTVEEAKRLLD-YPLLGAIP--------LAEKAKGSE--
A0A2A2TNQ5      FLGVLLGAGTALLLEALDKSLKNVDEAKRLLG-YPLLGTVP--------NLAEK------
A0A3S1C4K5      VLGIILGVGAALVLEAMDKSLKSVEEAKRLLG-YPLLGTIP--------QLGGS------
A0A1X4G3D5      ILGVILGVGTALVLESLDKSVKNIEEINRLLD-LPLLGSIP--------NFETKKRKNKG
D4TNI2          ILGVILGVGTALVLESLDKSVKNIEEINRLLD-LPLLGSIP--------NFETKKRKNKG
A0A1Z4H6Z8      FLGILLGVGAALMLEATDNSLKTIEEVKRLLG-YPLLGTIP--------LAEKPKGSN--
A0A3F3KPR9      LVGVVLGVGTALLLETLDKSVKNIEELNRILD-LPMLGTIP--------QYENTKRQKNA
A0A1Z4NPM1      FLGVLLGAGSALLLEALDKTLRDIDEAKRLLG-LPVLGTIP--------QLMDK--KGK-
A0A1Z4UZW9      FLGIILGAGTALVLESMNQSLKNIEEANRLLG-FPLLGTIP--------LYIGKNPKNP-
A0A1B7VSH4      FLGVLLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTIP--------QHGEKNPKNP-
A0A1B7W126      FLGVLLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTIP--------QHGEKNPKNR-
A0A3D4C6Q6      FLGVLLGAGTALLLESMNQSLKNIEEANRLLG-FPLLGTIP--------QHGEKNPKNR-
A0A0K2M5H0      FLGVILGAGTALVLESMNQSLKNIEEANRLLG-FPLLGTIP--------QYGEKNPKNR-
A0A844I4P0      FLGVILGAGTALVLESMNQSLKNIEEANRLLG-FPLLGTIP--------QYGEKNPKNR-
A0A1B7UVJ4      FLGILLGAGTALLLESMNQALKNVEEANRLLG-FPLLGMIP--------LYGGKNPKNQ-
A0A1B7UTR1      FLGILLGVGTALLLESMNQSLKNVEEANRLLG-FPLLGMIP--------LYGGKNPKNQ-
K7W0A4          FLGILLGAGTALLLESMNQSLKNVEEANRLLG-FPLLGAIP--------QYGEKNPKHR-
A0A5C0DRW9      FLGILLGAGTALLLESMNQSLKNVEEANRLLG-FPLLGTIP--------QYGEKNPKHR-
A0A6H2C088      FLGILLGAGTALLLESMNQSLKNVEEANRLLG-FPLLGTIP--------QYGKKNPKNR-
A0A1Z4RPC6      LMGLFLSNLTVILLEMQDRTLKTIPEVKRKFG-YQVLGIVP--------FDSFQDS----
A0A2T1CMZ0      LTGLFLANLTAILLEMQDHSLKTISEIKQKFA-FQVLGIVP--------LDTLQNN----
L8M4F7          MGGLFFSNAAVLLLETRDRSLKTIGEIRKKLP-HTILGIIP--------IDDDARS----
A0A140K2P2      LLGLLLSNLSVLLVEMQDRSLKTVAEIKNKFG-YKVLGLVP--------KHAAEEN----
K9XWX4          LLGLLLSNLSVILVEMQDRSLKTVAEIKNKFG-YNVLGLVP--------KHEAEDN----
A0A140KB14      ILGLLLSNLSVLLLEMQDRSLKTMSEIKQRFP-YKVLGLIP--------QYSDDEP----
K9XX88          ILGLLLSNLSVLLLEMQDRSLKTIPEIKQRFP-YKVLGLIP--------QYTDDEP----
L8LZE9          LSGLLLSNLTAIILDKQDRSLKNISEVKKKLP-YKVLGIIP--------ENKFAKR----
A0A563VSV6      LMGLLLSNLTAIYLDMQDRTIKTIADIKKKLP-YKVLGIVP--------INELSDR----
A0A7Y0IQB0      LLGLLLSNLTVIYLETQDRTLKTIAEIKKKLP-YKVLGIVP--------LNNLSER----
A0A433NM31      VAGIILAVFIALARDAVDTSIKTLREAKEVLG-YTVLGVIP--------NFDKIDKLNSR
A0A1Z4NDS1      IAGFLCGVITAFALDLIDSSLKTVQEARELFR-YTLLGVIP--------QIPRNSKRKSE
U9VXM0          FVGFLLGLIAAFFADIIDQSITTVQEGQELYE-YPLLGIIP--------AWKRNNAKGTD
A0A6M0RI13      FAGLLLGLITAFMADLLDQSVKTVQEGQELYE-YPLLGIIP--------AWKRGNAKGSD
A0A6M0S1N5      FAGLLLGLITAFMADLLDQSVKTVQEGQELYE-YPLLGIIP--------AWKRGNAKGSD
K9F4D9          FAGLLLGLITAFMADLLDQSVKTVQEGQELYE-YPLLGIIP--------AWKRGNAKGSD
A0A6I5QPI5      FMGVLLAIATAFLLDLLDSSVKTVKEVKELYG-YTVLGVIP--------LVKGAGRSEAE
A0A1Z3HMQ0      AVGLLLGVAMAFFLDLIDKSIKTVKDGEALLG-YTLLGLIP--------KFGLLGNDGPD
A0A433W533      LLSVVLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAIP--------SLTKKA----A
A0A2P8QWJ3      LLSVVLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAIP--------SLTKKA----A
K9U6L7          LLSVVLSSGTVAVLEIKDTSVKTLKEARELFG-YTFLGAIP--------SLTKKA----A
U5DPF5          IVGALIGTATAITLDVRDQSLKTVQEAKNRLG-YVMLGSIP--------LFGR-------
A0A1E5QP61      VGGSMLYVLTAFLLELMDPSIKTAKELRMLFR-YTLLGMIP--------ATKKRFGFLGF
A0A846DWC7      VGGSMLYVLTAFLLELMDPSIKTAKELRMLFR-HTLLGMIP--------ATKKRFGFLGF
A0A845Y5J4      VAGSLLYIITAFVLDLMDPSIKTAKEVRQLFN-YTWLGMIP--------DYRKKG----L
A0A6P0X488      VAGSLLYIITAFVLDLMDPSIKTAKEVRQLFN-YTWLGMIP--------DYGKKG----F
A0A6P0VDM0      VAGSLLYIITAFVLDLMDPSIKTAKEVRRLFN-YTWLGMIP--------DYGKKG----F
A0A6P0UVD5      VAGSLLYIITAFVLDLMDPSIKTAKEVRRLFN-YTWLGMIP--------DYGKKG----F
A0A846BFF2      VAGSLLYIITAFVLDLMDPSIKTAKEVRRLFN-YTWLGMIP--------DYGKKG----F
A0A6M0G142      IAGSLLYIVTAFVLDLMDPSIKTAKEVRQLFR-YTWLGMIP--------DYRRKG----L
A0A6P0MR53      VVGSLLYIVTAFVLDLMDPSIKTAKEVRRLFN-YTWLGMIP--------DSRKKG----L
A0A3M2GIL5      VAGGMLYVVTAFLLELIDPSIKTAKEVREVFR-YTVLGMIP--------KYRK--KGFFF
A0A6H1TSJ9      VAGGMLYVVTAFLLELIDPSIKTAKEVREVFR-YTVLGMIP--------KYRK--KGFFF
A0A3M1PML8      LAGMLLGVATAFGLDLFDRSIKTVKEAKEALG-YTLLGVVP--------AFSRNAKSNVP
A0A6M8BE85      LSGMLLGVATAFGIDLFDRSIKTVKEAREALG-YTLLGVIP--------VFPRSGKSSSA
A0A0T7BPZ0      FFGLLVGIIAALALDLLDQSVKNVKQAKEIFG-YTLLGVIP--------QMNRSSKSSSG
A0A352X442      VVGGLLGIAVAFLVDLIDHSVKNVKEAKELFG-YTLLGVVP--------AFGKLGNRGFS
A0A6B3NF44      MVGILLGVTTAFLLDLIDSSVKTVKEAKELFS-TTLLAVIP--------AYGKPGKANYL
A0A6M0EPL4      MVGILLGVTTAFLLDLIDSSVKTVKEAKELFS-TTLLAVIP--------AYGKPGKANYL
A0A6P0K6L6      MVGILLGVTTAFLLDLIDSSVKTVKEAKELFS-TTLLAVIP--------AYGKPGKANYL
A0A6P0MRR9      IMGILLGIAIAFLLDLIDGSIKTVKEAKELFG-YTLLGIIP--------IYGKSRRVRRR
A0A6P0X1X4      IMGILLGLAVAFLLDLIDGSVKNVREAKELFR-YTLLGIIP--------VYGKSRRTRKR
A0A6P0UX57      VMGILLGLAVAFLLDLIDGSVKTVREAKELFG-YTLLGIIP--------VYGKSRRTRKR
A0A846B9S8      VMGILLGLAVAFLLDLIDGSVKTVREAKELFG-YTLLGIIP--------VYGKSRRTRKR
A0A0M0SHU3      VLGALLGIIAALAADLIDRSIKTVKEAREVFQ-YTLLGVIP--------SVSRTGKSGYS
A0A1D2PBN3      VLGILLGVIAAFTLDLIDRSVKTVKEARELFK-YTLLGVIP--------SINSNSKKSSF
A0A0C2LVR7      VLGILLGVIAAFSLDLIDRSVKTVKEARELFK-YTMLGVIP--------SINSNSKKSSF
A0A1Z4PQB9      VLGILLGVIAAFTLDLIDRSVKTVKEARELFK-YTLLGVIP--------SISSNSTKSSF
A0A1Z4SFN6      VLGILLGIMAAFTLDLIDRSLKTVKEARELFQ-YTLLGVIP--------LVGGNGKKSYY
K9PGI8          IFGAMLGLIAALTLDMIDRSVKTVKEARELLQ-YTLLGVIP--------LVGRNTKNSSL
A0A654SFI6      ITGLIGAGALIYGRVVLSQTIKDPQDVTRELG-LSLLGTIP--------KSDAADV----
K9SSQ0          LAGILVAAIIITVLENSDDRLQQVSQLQTLSD-LPLLGAVP--------YLATNAK----
A0A2W1JIN9      LAGAVLSIGTVILLEALNRKLYSADEIEELVE-LPVLSTLP--------RLSKNTL----
A0A318AJV1      LASLGCGLATVIVMEMLQGGLRTIGEVEARLG-LPVLASVP--------A----------
A0A845WDS5      AAGITLAIGIILLLEVIDNKLYDVSDAEALLK-LPRLGVLP--------EIPLSAL----
A0A6P0IC70      AAGITLAIGIILLLEVIDNKLYDVSDAEVLLK-LPRLGVLP--------EIPLSAL----
A0A845VVD9      AAGITLAIGIILLLEVIDNKLYDVSDAEVLLK-LPRLGVLP--------EIPLSAL----
A0A6B3MUB5      AAGITLAIGIILLLEVIDNKLYDVSDAEVLLK-LPRLGVLP--------EIPLSAL----
A0A6M0B7N4      AAGITLAIGIILLLEVIDNKLYDVSDAEVLLK-LPRLGVLP--------EIPLSAL----
A0A6P0J9W3      AAGITLAIGIILLLEVIDNKLYDVSDAEVLLK-LPRLGVLP--------EIPLSAL----
A0A6P0ZWE1      AAGITLAIGIILLLEVIDNKLYDVSDAEVLLK-LPRLGVLP--------EIPLSAL----
A0A1U7N2U4      AAGIALAVGMVLLLEVMDNTLHDGSEAEALLK-LPRLGVLP--------TIPAQAL----
A0A6L9YZL1      AAGIALAVGMVLLLEMMDNTLHDASEAEALLK-LPRLGVLP--------KMPAQAL----
A0A6P0KYM4      AAGIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLP--------KIPAQAL----
A0A6P0LSD6      AAGIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLP--------QIPAQAL----
A0A6P0PNZ7      AAGIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLP--------KIPAQAL----
F4XV38          AAGIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLP--------KIPAQAL----
A0A6P0W137      AAGIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLP--------KIPAQAL----
A0A845XHF7      AAGIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLP--------KIPAQAL----
A0A845ZEG9      AAGIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLP--------KIPAQAL----
A0A1D9G1F2      AAGIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLP--------KIPAQAL----
A0A846CJ58      AAGIALAVGMVLLLEVMDNTLHDASEAEALLK-LPRLGVLP--------KIPAQAL----
A0A6L9Y9E2      AAGIALAVGMVLLLEVMDNTLHDASEAEALLN-LPRLGVLP--------KIPAQAL----
A0A6P0SGR0      AAGIALAVGMVLLLEVMDNSLHDASEAEALLK-LPRLGVLP--------KIPAQAL----
A0A6M0BK48      AAGIALAVGMVLLLEVMDNTLNDASEAEALLK-LPRLGVLP--------KIPAQAL----
A0A845WG36      AAGIALAVGMVLLLEVMDNTLNDASEAEALLK-LPRLGVLP--------KIPAQAL----
A0A6P0X384      VAGVILAVGIILVLELIDNTLHEDLAVEELLN-LPKLGSLP--------DLPASAL----
A0A2P8QIL5      VAGGTLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVLP--------VISPEVR----
A0A433W447      VAGGTLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVLP--------VISPEVR----
K9U1K8          VAGGTLALGTVLLQEGLDGTLRNATEASSLVE-VPIMGVLP--------VISPEVR----
A0A1Q4RZJ6      AFGLLLATGVVILLEIMDNTLHDASEAEELLK-LPLLGVLP--------RLPAKTL----
A0A1Z4SNV3      AFGLLLATGVVILLELMDNTLRDASEAEELLK-LPLLGVLP--------RLPDRTL----
A0A2H2XJQ1      AFGLLLATGVVILLELMDNTLRDASEAEELLK-LPLLGVLP--------RLPDRTL----
A0A3S5K358      AFGLLLATGVVILLEVMDNTLHDASEAEELLK-LPLLGVLP--------RLPAKTL----
A0A0T7BPJ4      VFGTVLATGIILLLEAMDNTLRSGWEAQDLLK-LQLLGVLP--------RLPGSTL----
A0A0C1QS61      VLGTLLATSIVLLLEMMDNTLRDASEAEELLK-LSLLGVLP--------RLPSKTL----
A0A139X3R8      ALGTLLATSIVLLLEMMDNTLHDASEAEDLLK-LSLLGVLP--------RLPSKTL----
A0A844MZP8      ALSTLLATSIVLLLEMMDNTLRDASEAEDLLK-LSLLGVLP--------RLPSKTL----
A0A1Z4I7C5      FFGSVLAVGLVLLLELMDNTLRDASEAEELLQ-LPLLGVVP--------RLPATKL----
A0A844MST0      VFGAILATGVMLVLEVMDNTLRDASEAEKLLQ-LPLIGVLP--------QLPATTL----
A0A0C2MDK7      AFGTMLAVGVVLLLEVMDNTLRDATEAEELLQ-LPLLGILP--------RLPAKTL----
A0A856MDH8      VFGIMLGVGVVLLLEVMDNTLRDPAEAEELLQ-LPLLGILP--------RLPAKTL----
A0A1Y0RCK1      VFGSVLAVGVVLLLELMDNTLRDATEAEELLQ-LPLLGVLP--------RLPAKTL----
A0A1Z4PWZ0      VFGSMLAVGVVLLLEIMDNTLRDASEAEELLQ-LPLLGVLP--------RLSAKTL----
A0A0C2QLT0      VFGTMLAVGIVLLLEVMDNTLRDASEAEELLQ-LPLLGVLP--------RLPGKTL----
A0A1Z4J2K1      VFGSMLAVGVVLLLEMMDNTLRDASEAEELLQ-LPLLGVLP--------RLPAKTL----
A0A3S0ZSX0      VFGSALATGIVLLLELMDNTLKDASEAEELLD-LPLLGVLP--------RLPAKTL----
A0A2N6K4T3      LFGTALATGIVLLLELMDHTLKDASEAEELLR-LPLLGVLP--------CLPSRAI----
A0A370CKT2      VFGTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLP--------RLPGHAI----
A0A0S3TL97      VFGTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLP--------RLPGHAI----
A0A2N6M8A0      VFGTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLP--------RLPGHAI----
A0A2N6M9E1      VFGTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLP--------RLPGHAI----
A0A2N6KJI4      VFGTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLP--------RLPGHAI----
A0A2N6MZ77      VFGTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLP--------RLPGHAI----
A0A2N6KT20      VFGTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLP--------RLPGHAI----
G6FSN3          VFGTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLP--------RLPGHAI----
A0A4D9CI02      VFGTALATGIVLLLELMDHTLKDASEAEDLLK-LPLLAVLP--------SLPADAI----
A0A328I8B9      VFGTALATGIILLLELMDHTLKDASEAEDLLK-LPLLGVLP--------SLPAHAI----
A0A4Q9J4Z7      VFGTALATGIILLLELMDHTLKDASEAEDLLK-LPLLGVLP--------SLPAHAI----
A0A0M0SU69      VFGIALATGIVLLLEFMDHTLKDASEAEELLK-LPLLGVLP--------RLPADAI----
A0A1Z4TIZ8      VFGTALATGIVLLLELMDHTLKDASEAEELLK-LPLLGVLP--------RLPTHAI----
K9UYB2          AIGIVSAIALIILLEMLDNKLHDQDETEELLQ-LPLLGVLP--------RLPAKAT----
A0A1Q4S1H4      AFGILLSTGMVLLLEMMDNRLHDVAEAE-LLN-IPLLGILP--------RLSKSNL----
A0A433VBU6      AFGILLSTGMVLLLEMMDNRLHDVAEAE-LLE-LPLLGVLP--------RLSKSNL----
A0A218QN17      VFGTVLGTGVMLLLEVLDNTLKDASEAEELVS-LPLLGVLP--------RLPAKTL----
A0A846HD20      VFGTVLGTGVMLLLEVLDNTLKDASEAEELLS-LPLLGVLP--------RLPAKTL----
K9RKN2          IFGGILATGVILLLELMDNTLRDARDAEQLLN-LPLLGVLP--------RLPGKTL----
A0A2I8ADV2      FFGSILATGVVLLLELMDNRLYEVAEAEELLK-LPLLGILP--------RLPATKL----
A0A5Q0GMF5      FFGSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLP--------RLPATKL----
Q3MEW0          FFGSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLP--------RLPATKL----
A0A1Z4KIC7      FFGSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLP--------RLPATKL----
Q8YSM5          FFGSILAVGLVLLLELMDNTLRDATEAEELLQ-LPLLGVLP--------RLPATKL----
                  .                                     .                   

K9SLA9          MRKSA---------------------------------------------------KLAK
A0A168TT23      GTTTR---------------------------------------------------AEDR
A0A0M1JWX9      -------------------------------------------------QLASSSWIADS
A0A844MWN9      GKNTEIE-----------------------------------------------------
A0A2T1M1V6      DEKSEVE-----------------------------------------------------
A0A2G7GCS2      SGEVAIE-----------------------------------------------------
K9XBH8          SAEVPID-----------------------------------------------------
A0A1Z4LJ30      KLGGEIE-----------------------------------------------------
Q7NF11          GDPPRLE-----------------------------------------------------
K9RI76          KLGGEIE-----------------------------------------------------
A0A433VN22      AIETEVE-----------------------------------------------------
A0A139WSU3      TSVSEVE-----------------------------------------------------
A0A844MJB7      TYETEVE-----------------------------------------------------
A0A352AE27      TTETEVE-----------------------------------------------------
A0A3B8JH60      GTDTEVE-----------------------------------------------------
A0A3C0N766      GTDTEVE-----------------------------------------------------
K9W9J7          GTETEVE-----------------------------------------------------
Q7NJN6          SAAEAEE-----------------------------------------------------
U5QCC3          -IATAEE-----------------------------------------------------
A0A1Z4JCS8      SFEGEIE-----------------------------------------------------
A0A846GVZ3      GTETDVE-----------------------------------------------------
A0A6P0PI80      GTETDVE-----------------------------------------------------
A0A6P0WGT6      GTETDVE-----------------------------------------------------
F4XTX2          GTETDVE-----------------------------------------------------
A0A3S0Y9N9      -------------------------------------------------SPIPE--VVVK
A0A6P0ZKB8      -------------------------------------------------TFTPE--VIVK
A0A846EDH6      -------------------------------------------------TFTPE--VIVK
A0A433UNK7      -------------------------------------------------NFIPE--VIVK
B8HNB0          --------------------------------------------------------RSRS
A0A318BJ18      -----------------------------------------------------K--TAEG
A0A3B8Y8H9      -------------------------------------------------QLPRK--LLQN
A0A2W1JVB9      KGASVAA------------------------------------------DVKRD--LYVR
A0A6H1U102      --------K----------------------------------------VKVPL--VEGS
A0A7C3ZEJ3      --------R----------------------------------------VSAPV--IESY
A0A2P8W9H0      LFAVREINSIGLTSDF---------------------------------SLPPLSYELRT
A0A6I5P386      ALAMTQLGDLGFNMDL---------------------------------PLSSGPSNL--
A0A3M1SVZ4      R------------------------------------------------RSIPQ--IIVR
A0A318BG22      -------------------------------------------------TVEGAEIPALL
A0A2T1E9V8      A-------------------------------------------------------VPVI
A0A1Z4LN32      NIPVGKDKIA---------------------------------------GVSER--VIVA
A0A2I8A9F5      QLEDSA--LA---------------------------------------EPARR--VIVE
A0A218Q6R8      TLDTEEPIVE---------------------------------------QFSPR--IVVE
A0A218QGE0      FLDRS---LE---------------------------------------KVSER--IIVA
A0A846HDH5      PLDSS---LE---------------------------------------KVSQR--IIVA
A0A3M2GQQ6      -------------------------------------------------KVSCPLVSQRK
A0A6H1U2X0      -------------------------------------------------KVSCPLVSQRK
K9TLQ0          V-------------------------------------------------------SDGE
K9QF04          -------------------------------------------------FQKEL--KAAT
K9W1T3          RFGNQQ-------------------------------------------RIVPS--IVVT
K9SGJ5          -------------------------------------------------PVVEKETALAP
A0A6N2JS94      -------------------------------------------------AISSQ--GILP
A0A6C2DSN4      -------------------------------------------------PLLSQ--GILP
L8MYT6          -------------------------------------------------PLLSQ--GILP
A0A352JGJ6      -------------------------------------------------AMVSQ--GILP
A0A1J5GLS2      -------------------------------------------------AMVGQ--SILP
A0A2W4W6M5      -------------------------------------------------AMISH--GILP
A0A2W7AN33      -------------------------------------------------SM-AK--GQFP
A0A256BLV2      -------------------------------------------------AATNQ--GILP
A0A2W6ZXF3      -------------------------------------------------AMISQ--GILP
A0A2Z5WX66      -------------------------------------------------AMLSQ--GILP
Q7NEU3          QPQFSKERQKP--------------------------------------DLPKS--SLEK
A0A3C0N2P0      LSDGSM--------------------------------------------IDPE--NLEF
A0A6P0JR04      ----------------------------------------------------------KD
A0A6B3M6M6      P-------------------------------------------------VGDL--ISES
A0A6P0KD09      P-------------------------------------------------VGNL--VSES
A0A6B3NIJ0      P-------------------------------------------------VGDL--VSES
A0A6M0F053      P-------------------------------------------------VGDL--VSES
A0A6P2ATU9      TAQSEK--ETT--------------------------------------PMLPV--PRGD
A0A845XAM4      -----------------------------------------------------V--ARTL
A0A352XE00      IKTNSKVYQNS--------------------------------------QVNRE--VLEL
A0A6P0QC14      PGAAAI--------------------------------------------PDPS--EFQ-
B4VS56          AKTAGK--------------------------------------------LETP--LLAS
A0A352AAQ3      PVPAAT--------------------------------------------PEGQ--QLES
A0A350Y472      SATPSK--------------------------------------------SHSE--PLEL
A0A355DVB4      PATPPK--------------------------------------------SHSE--PLEL
A0A1Z4RMB9      ---------------------------------------------LEPPSYQGR--IITR
A0A318B4H2      -------------------------------------------------DVAEE--LQNK
A0A2K3BR24      -------------------------------------------------NTSSF--LPLR
K9YXY1          -------------------------------------------------DTSSF--LPLR
A0A1Q4RTR1      LSVSRHYRN----------------------------------------RHIST--LPIR
A0A1Z4SQV2      LSITRPHRN----------------------------------------RDIST--LPIR
A0A2H2XGN1      LSITRPHRN----------------------------------------RDIST--LPIR
A0A433UXH8      LSVSRHYRN----------------------------------------RDIST--LPIR
A0A1U7HGH0      -------------------------------------------------REQWR--VPVL
K9XJD3          -------------------------------------------------REEWQ--VPVL
K9SX01          AFVLRNPES--VLSKLYLKIRKSKAYRSFASSLESFKISILNAVSEPENTTALT--VFVR
A0A4P7ZT55      FQSVNGLWE------------------------------------------------QLD
A0A1E5QIR9      GKDGE--------------------------------------------RVKAK--LPVK
A0A6P1A9A0      KPSTRRGDR----------------------------------------ASVLS--VTPA
A0A1Z4IBC7      IPGLD--------------------------------------------RPVPK--IIGR
A0A5Q0GKD1      IPGLD--------------------------------------------RAVPK--IIGR
Q3MDC6          IPGLD--------------------------------------------RAVPK--IIGR
A0A1Z4KM73      IPGLD--------------------------------------------RAVPK--IIGR
Q8YNX7          IPGLD--------------------------------------------RAVPK--IIGR
A0A367R4K6      IAGLD--------------------------------------------RPIPK--IIGR
A0A1E2WSV8      IAGLD--------------------------------------------RAIPK--IIGR
A0A7D7L9Y1      IAGLD--------------------------------------------RAIPK--IIGR
A0A2R5FRT9      IAGLD--------------------------------------------RAIPK--IIGR
A0A2K8T1B6      IAGLD--------------------------------------------RPIPK--IIGR
A0A235I9I0      IPGLD--------------------------------------------RAIPK--IIGR
A0A2D0HQT8      IPGLD--------------------------------------------RPIPK--IIGR
A0A2L2NU95      IAGLD--------------------------------------------RPIPK--IIGR
A0A367S084      IPGLD--------------------------------------------RPIPK--IIGR
A0A1Z4SMD6      PSPSTVPSIK---------------------------------------GISPR--IVIG
A0A2H2Y096      PSPSTVPSIK---------------------------------------GISPR--IVIG
K9S8M8          GSN----------------------------------------------TSVPK--VVVQ
A0A1Z4NFV0      SSVSSNRSE--ELFA----------------------------------GVSPR--VIVA
A0A3M9ZEU1      KLGASG--R--KSAE----------------------------------PATLR--IFPR
A0A1Z4JK72      TSDTPTIVS--PSAD----------------------------------DISPR--VIAM
A0A0N7Z489      TSDTPTILS--PGAD----------------------------------DISPR--VIAM
A0A0S3TXS2      TSDTPTILS--PGAD----------------------------------DISPR--VIAM
A0A2A2TPF8      TNNNAIAQT--FIE-----------------------------------AASPR--IIVA
A0A1Z4R0P8      TNNAAIEQI--SIE-----------------------------------GASPR--VIVG
A0A0T7BUI3      ANHKSVAAN--ITDD----------------------------------GISER--VIVN
A0A1Z4LP32      PNSKSLDSN--FIDD----------------------------------NISPR--IIVA
K9REP9          PDSKSTDSN--PIVD----------------------------------TISPR--IIVA
A0A1Z4SIJ3      SNNQDSSKETRLLGRINGLLAKYQQKNQIVSLPSTNFDSKLLPIRLVGLEVSNR--IIVA
A0A2H2XPG4      SNNQDSSKETRLLGRINGLLAKYQQKNQIVSLPSTNFDSKLLPIRLVGLEVSNR--IIVA
A0A2A2TC28      PNNTHSSLHQ-IMGD----------------------------------NVSPR--VIVA
K9V3C7          ANSTSLIEE--MSGD----------------------------------GVSPR--IIVA
A0A1Z4T6Y7      -NAPTIEQT--I--E----------------------------------GASPR--IVVG
A0A2H2Y561      -NAPTIEQT--I--E----------------------------------GASPR--IVVG
A0A1Q4S362      TNSASIQQT--M--E----------------------------------GASPR--VIVG
A0A3S1CIN8      TNSASIEQT--M--E----------------------------------GASPR--VVVG
A0A0C1NCB0      SSTKSSSDR--LMGE----------------------------------ATSPR--VIVA
A0A844MLU2      SSITSASDR--LMRE----------------------------------GISPR--VIVA
A0A2N6K7Q9      PNNSVSGVQ--EIEA----------------------------------GVYPQ--VIAT
A0A2N6MXH6      LNNSVSGVQ--EIEA----------------------------------GVYPQ--VITT
A0A2N6M5A8      LNNSVSGVQ--EIEA----------------------------------GVYPQ--VITT
A0A2N6LL61      LNNSVSGVQ--EIEA----------------------------------GVYPQ--VITT
A0A0S3TP66      LNNSVSGVQ--EIEA----------------------------------GVYPQ--VITT
G6FP91          LNNSVSGVQ--EIET----------------------------------GVYPQ--VITT
A0A1U7GYR5      LNNSVSGVQ--EIEA----------------------------------GVYPQ--VITT
A0A2N6KY52      LNNSVSGVQ--EIET----------------------------------GVYPQ--VITT
A0A2N6KMP5      LNNSVSGVQ--QIET----------------------------------GVYPQ--VITT
A0A2N6MA45      LNNSVSGVQ--QIEA----------------------------------GVYPQ--VITT
A0A4Q9J9V9      PNNFVSAVQ--DIED----------------------------------GVYPQ--VITT
A0A328IGA1      PNNFVSAVQ--DIED----------------------------------GVYPQ--VITT
A0A4D9CE41      PNNFVSAVQ--DIED----------------------------------GVYPQ--VITT
A0A0M0SFT2      PNNFVNAVQ--DIED----------------------------------GVYPQ--VITT
A0A1Z4TLC8      PNNFVNAVQDVDVED----------------------------------GVYPQ--VITT
A0A1Z4IYV4      SNTTSTPDK--LMSE----------------------------------GVSAR--VIVA
A0A1Z4Q0T6      SNSTSAPTK--LMSE----------------------------------GVSAR--VIVA
A0A0C2PT44      SNSTSAATK--LMSE----------------------------------GVSAR--VIVA
A0A1D2P6J4      SNSTSAPAE--LMSE----------------------------------GVSGR--VIVA
A0A0C2LFH0      SKKTSAPVN--LMSD----------------------------------KASAR--IIVA
A0A856M734      SKKTSSPVN--LMSD----------------------------------KASAR--IIVA
B4WP72          KSHSKQLAS----------------------------------------SVFSN--VRTR
A0A2T1CIL7      ATSRDNNSS----------------------------------------LSIPD--LNLA
A0A433V7A0      H---KEI-E----------------------------------------QTALN--VHVR
A0A2T1FTR8      S---KGA-A----------------------------------------RAPGQ--LVLT
K9UA41          S---KGA-A----------------------------------------RAPGQ--LVLT
A0A563VS48      ----KGITQ----------------------------------------GKQQP--VLAE
A0A7Y0NUK1      ----KDTNQ----------------------------------------GNQKQ--LLED
A0A0C2LBE2      V---PEV-D----------------------------------------QSIPK--VIGR
A0A433NN38      T---GRL-D----------------------------------------RPTPR--VIGR
A0A2N6K0T2      V---QGL-D----------------------------------------RPIPR--VVGR
A0A2N6ML72      V---QGL-D----------------------------------------RPIPR--VVGR
G6FQZ6          V---QGL-D----------------------------------------RPIPR--VVGR
A0A2N6MQX9      V---QGL-D----------------------------------------RPIPR--VVGR
A0A2N6KXT6      V---QGL-D----------------------------------------RPIPR--VVGR
A0A2N6KGB9      V---QGL-D----------------------------------------RPIPR--VVGR
A0A2N6L3Y5      V---QGL-D----------------------------------------RPIPR--VVGR
A0A0S3TIS7      V---QGL-D----------------------------------------RPIPR--VVGR
A0A1U7GW28      V---QGL-D----------------------------------------RPIPR--VVGR
A0A2N6LW63      V---QGL-D----------------------------------------RPIPR--VVGR
A0A328IH74      V---EGL-D----------------------------------------RPVPR--VIGR
A0A4D9CIB0      V---EGL-D----------------------------------------RPVPR--VVGR
A0A1Z4TQ63      V---EGL-D----------------------------------------RPVPR--VVGR
A0A4Q9J8G2      V---EGL-D----------------------------------------RPVPR--VVGR
A0A350Y0P6      R---QKL-N----------------------------------------GNVPQ--LVVR
A0A352X940      R---RKS-D----------------------------------------GDIPQ--LPVR
B8HTN4          FKPTQGL-E----------------------------------------RATPQ--LYLR
A0A6P1AFJ5      ----EESPG----------------------------------------TSEKN--SSRG
B0CAX4          R---KGL-D----------------------------------------RPTPD--LVVR
A0A1Z4RN12      QLQLPGNST----------------------------------------ANLPE--QVTT
A0A2T1CMF9      QFQLPGSEK----------------------------------------ANLPE--QIVS
Q7NDC5          --------S----------------------------------------VRGPL--MALR
U5QGK3          --------E----------------------------------------GPG-L--VAQS
A0A2W4UY24      R-------E----------------------------------------LDAPR--IIVK
A0A838VM23      H---QVI-E----------------------------------------AAIPE--LLVR
A0A0D8ZUV2      G---KDA-E----------------------------------------ATIPE--LPVR
A0A433VDI0      G---RDK-E----------------------------------------WAVPE--LPVR
A0A3D1PG43      Q---K-Q-E----------------------------------------WAVPE--ISVL
A0A2P8QQ72      G---RQE-D----------------------------------------CPIPE--LAVR
K9TZQ7          E---RQQ-D----------------------------------------CPVPE--LAVR
A0A6N8G584      R---RNP-E----------------------------------------WSIPE--LPVI
A0A2G7GPR0      R---RNQ-E----------------------------------------WSIPE--LPVI
K9XH68          R---RNQ-E----------------------------------------WSIPE--LPVI
A0A1U7HW70      R---RNQ-E----------------------------------------WSIPE--LPVI
A0A2S6VEJ8      R---RNQ-E----------------------------------------WSIPE--LPVI
A0A140KBA0      L-LVGDV-V----------------------------------------DTLPQ--LPAG
K9XSG1          L-LVGDV-V----------------------------------------DTLPQ--LPAS
A0A2T1GMT4      R---ATTPE----------------------------------------QTTLE--IAVR
K9UI51          R---ATTPE----------------------------------------QTTLE--IAVR
A0A1Z4QL41      H---QKA-Q----------------------------------------TNTQN--IVVR
K9TYI2          D---GYV-E----------------------------------------STIPE--ISVR
A0A252D4T4      N---RET-D----------------------------------------LINPE--IAVI
A0A252DJH5      N---RET-D----------------------------------------LINPE--IAVI
A0A252EB80      N---RET-D----------------------------------------LINPE--IAVI
A0A6G9SKZ9      Y---RET-E----------------------------------------IATQE--IAVI
A0A1Z4HPW5      Y---RET-E----------------------------------------IATQE--IAVI
A0A1Z4MSN1      Y---RET-E----------------------------------------IATQE--IAVI
A0A1Z4U1C2      Y---RET-E----------------------------------------IATQE--IAVI
A0A0D6KV51      Y---RET-E----------------------------------------IATQE--IAVI
A0A1Z4MKF8      Y---RET-E----------------------------------------IATQE--IAVI
A0A2C6WC43      F---SSA-E----------------------------------------SITQK--VAVR
A0A841WRE0      F---SSA-E----------------------------------------SITQK--VAVR
A0A1Z4L5A1      F---SSA-E----------------------------------------SITQK--VAVR
A0A367QD86      F---SSA-E----------------------------------------SITQK--VAVR
A0A2K8SM78      Y---SNL-E----------------------------------------SITQK--IAVR
A0A2R5FPC0      D---SNV-E----------------------------------------P---K--IAVR
A0A5P8W5T6      H---SNL-E----------------------------------------SITQK--IAVR
A0A7D7LDT7      Y---SDA-E----------------------------------------STVQT--IAVR
A0A235IZ96      Y---SNL-E----------------------------------------LPTQT--VAVR
A0A2L2NGP0      Y---SNL-E----------------------------------------LPTQT--VAVR
K9QM62          SFYLQDT-E----------------------------------------SITPS--IAVR
A0A1Z4FWI3      N---REA-E----------------------------------------LAPPE--IAVI
A0A1Z4JYE7      K---REG-E----------------------------------------YQIPR--IAVR
A0A0F5YE28      Y---FQG-E----------------------------------------RASQQ--IPVV
U7QEH7          Y---FQG-E----------------------------------------KATPD--IPVI
A0A3S1ATK5      H---QNA-D----------------------------------------YITPE--IASK
A0A2Z6CPH0      K---LDTKK----------------------------------------LTTPE--IAVR
A0A1Z4GT50      N---RDA-E----------------------------------------SITPE--VPVR
A0A1Z4GIX0      E---SDG-E----------------------------------------LASPE--IAVR
A0A2H6LC24      E---SDG-E----------------------------------------LASPE--IAVR
B2J6N5          Y---SNT-E----------------------------------------SINQT--IAVR
A0A367RMI4      Y---SNA-E----------------------------------------SISQT--IAVR
A0A235HUM0      D---SNA-E----------------------------------------FTSQT--VAVR
A0A2L2NW47      Y---SNA-E----------------------------------------SISQT--IAVR
A0A1E2WUR1      Y---SDT-E----------------------------------------STVQT--IAVR
A0A235IKU3      Y---SNL-E----------------------------------------LPTQT--VAVR
A0A1U7MYU6      R---RDD-L----------------------------------------FFGGE--LPVT
A0A1D8TNX9      R---RDD-L----------------------------------------FFGGE--LPVR
A0A6P0L6C2      R---RDD-L----------------------------------------FFGGE--LPVR
A0A6P0MVH0      R---RDD-L----------------------------------------FFGGE--LPVR
A0A6P0KJV0      R---RDD-L----------------------------------------FFGGE--LPVT
A0A6L9ZJG4      R---RDD-L----------------------------------------FFGGE--LPVT
A0A846GI17      R---RDD-L----------------------------------------FFGGE--LPVT
F4XKF3          R---RDD-L----------------------------------------FFGGE--LPVT
A0A1D9FX10      R---RDD-L----------------------------------------FFGGE--LPVT
A0A6P0Q0T0      R---RDD-L----------------------------------------FFGGE--LPVT
A0A6P0W5I0      R---RDD-L----------------------------------------FFGGE--LPVT
A0A845XJ02      R---RDD-L----------------------------------------FFGGE--LPVT
A0A846D190      R---RDD-L----------------------------------------FFGGE--LPVT
A0A3C0NJ41      T---KHQ-E----------------------------------------RTVPE--LPVR
A0A352AG88      S---RDL-E----------------------------------------GTIPE--LPVR
A0A350Y374      F---TAQ-E----------------------------------------RTIPE--LPVR
A0A355DPX0      L---KAQ-E----------------------------------------RTIPE--LPVR
A0A0S3TYD7      ESLTKNL------------------------------------------QKLGN--LNVV
A0A2T1DNG3      SLRLSGQ------------------------------------------TQALL--PPIT
A0A140K3H3      ------------------------------------------------------------
K9XUB8          ------------------------------------------------------------
A0A563VLD6      ------------------------------------------------------------
A0A7Y0NVW6      ------------------------------------------------------------
U5QL42          ETLVAPS------------------------------------------RDGVV------
A0A6H2NHD5      MNPRLVS------------------------------------------TMEEV------
A0A2P8W4F7      IEPNLAV------------------------------------------TMADV------
A0A5Q4E0Z4      MVPSLIA------------------------------------------TTADL------
A0A2P8VVX1      ARGLHPE------------------------------------------LADSD------
A0A2P8WHY0      I--LHPE------------------------------------------LADSD------
A0A563VQJ3      VK---EE------------------------------------------PDSYV------
A0A7Y0IRJ7      VK---EE------------------------------------------PDSYV------
A0A2T1CMT9      TRLPFRS------------------------------------------ISSDT------
A0A7G8J1V5      KRFLLQE------------------------------------------LDQSV--QATN
A0A354B169      KRFQLQE------------------------------------------LDQLV-----A
Q0IDT5          KRFLLNE------------------------------------------LDQSS--NNNA
A0A7G8FZD9      KRFLLKE------------------------------------------LDSET--Q--A
G4FMX5          KRFPLKE------------------------------------------LDSET--Q--A
A3ZA21          KRFLLQE------------------------------------------LDQSV-----S
A0A076HBF2      KRFLLQE------------------------------------------LDRSV--T--G
A0A7G8FP50      KRFLLQD------------------------------------------LDKSV--TSDS
A0A7G8E8K7      KRFLLQE------------------------------------------LDKSV--T--T
A0A7G8GNR2      KRFLLQE------------------------------------------LDKSV--T--T
A0A7G8ICD3      KRFLLQE------------------------------------------LDQSV--T--R
A0A2D6FCW3      KRFLLQE------------------------------------------LDINN--P--S
A0A7G7KJ95      KRFMLNE------------------------------------------LDSQT--L--P
A0A7G8EAN3      KRFMLKE------------------------------------------LDTQT--L--P
A0A1D8TX52      LNLSLSQ------------------------------------------SERAL------
A0A1D9G4T2      LNLSLSQ------------------------------------------SEKTL------
A0A6P0PR27      LNLGLSQ------------------------------------------SERTL------
A0A6P0WER7      LNLGLSQ------------------------------------------SERTL------
A0A845XM36      LNLGLSQ------------------------------------------SERTL------
A0A846DAT1      LNLGLSQ------------------------------------------SERTL------
A0A846GZK8      LNLGLSQ------------------------------------------SERTL------
F4XP71          LNLGLSQ------------------------------------------SERTL------
A0A6P0KZ31      LNLNLSQ------------------------------------------SERAL------
A0A6P0LPB8      LNLNLSQ------------------------------------------SERAL------
A0A6L9YR57      LNLSLSQ------------------------------------------SERAL------
A0A845WMG9      LNLSLSQ------------------------------------------SERAL------
A0A6P0SEV1      LNLSLSQ------------------------------------------SEKAL------
A0A6B3N2I8      LNLSLSQ------------------------------------------SEKAL------
A0A6M0B891      LNLSLSQ------------------------------------------SEKAL------
A0A6P0IJQ1      LNLSLSQ------------------------------------------SEKAL------
A0A6P0J8J8      LNLSLSQ------------------------------------------SEKAL------
A0A6P0ZSH6      LNLSLSQ------------------------------------------SEKAL------
A0A845VS63      LNLSLSQ------------------------------------------SEKAL------
A0A1U7N5X9      LNLSLSQ------------------------------------------SEKAL------
A0A6L9Z1V0      LNLSLSQ------------------------------------------SEKAL------
A0A6P0LC12      LNLSLSQ------------------------------------------SEKTL------
A0A6P0MVJ3      LNFNLSQ------------------------------------------SERAL------
A0A2W6ZAV2      EVVEGME------------------------------------------PEARF------
K9W742          MLLPFGK------------------------------------------SQALE--PVGN
A0A3D1PBA3      ISLPFGK------------------------------------------PHLLA------
K9XPB0          VKLPFLS------------------------------------------PK--E------
A0A350Y7Z1      VHLPFRR------------------------------------------TQVAA------
A0A352X2A7      VNLPFRK------------------------------------------SSVTE------
A0A0D8ZYV0      VSLPFGK------------------------------------------PNVLA------
A0A433VMS2      VSLPFGK------------------------------------------PLHLS------
K9TYA7          VSLPFGK------------------------------------------PLHLS------
A0A2P8QUE1      VSLPFGK------------------------------------------PLHLS------
K9SA61          TIKLPLR------------------------------------------RSETF------
A0A2G7GMH8      NGLI---------------------------------------------KLNKQ------
A0A6N8FU92      SGSIINL------------------------------------------SLGKA------
A0A2T1DWE8      VPF---R------------------------------------------EVGVP------
A0A832H7C4      ITV---G------------------------------------------KSQPR------
A0A1U7I8L3      IHLPFRQ------------------------------------------QPILT------
A0A2T1DJL8      IAMPFQK------------------------------------------AENLA------
A0A1Z4J9W0      PNFAFSR------------------------------------------NAFEE------
A0A0N7Z5K9      -NFAFGR------------------------------------------ST--G------
A0A0S3TXC5      -NFAFGR------------------------------------------STNAG------
A0A846FBD3      ---------------------------------------------------KPR--IL--
K1XF69          TGGDRS---------------------------------------------SVQ--VP--
B5W297          TGGDRS---------------------------------------------SVQ--VP--
H1W7M8          TGGDRS---------------------------------------------SVQ--VP--
A0A5Q4H6A5      TGGDRS---------------------------------------------SVQ--VP--
D5A466          TGGDRS---------------------------------------------SVQ--VP--
B4WQE3          ILPRYEA------------------------------------------TRQPI--YFNE
U5QJM6          EKQSKEI------------------------------------------AKISK--KAKS
A0A0V7ZFJ4      --DNQ----------------------------------------------EIE--LP--
A0A235IXQ2      --GEN----------------------------------------------ITE--LP--
A0A367RIS1      --GES----------------------------------------------ITE--LP--
A0A841V8H9      --GES----------------------------------------------LTE--LP--
A0A5Q0GJJ5      --GES----------------------------------------------ITE--LP--
Q3MEB7          --GES----------------------------------------------ITE--LP--
A0A1Z4KHN9      --GES----------------------------------------------ITE--LP--
Q8YT70          --GES----------------------------------------------ITE--LP--
A0A7U3NLX2      --EQN----------------------------------------------TTE--LP--
A0A166IWU6      --DDN----------------------------------------------TSE--LP--
A0A2S0Q8C0      --DDN----------------------------------------------TSE--LP--
W6FSX4          --DDN----------------------------------------------TSE--LP--
A0A218Q4C1      --DEH----------------------------------------------TTE--LP--
A0A6P1ZT04      --DEG----------------------------------------------TSE--LP--
A0A0V7ZNJ9      --FDG----------------------------------------------NPE--LP--
A0A5P8VSD1      --GES----------------------------------------------ITE--LP--
A0A1S1ZVW2      EQEEN----------------------------------------------QRE--LP--
A0A0R0M9H9      EQEEN----------------------------------------------QRE--LP--
A0A7H0F4U6      GGEES----------------------------------------------QRE--LP--
A0A7W2A1T7      GGEES----------------------------------------------QRE--LP--
A0A838WI98      GGEES----------------------------------------------QRE--LP--
A0A853MJX6      GGEES----------------------------------------------QRE--LP--
A0A1B7WX82      --EES----------------------------------------------RRE--LP--
A0A1B7WTD1      --VEG----------------------------------------------LLE--VP--
A0A480ABC0      --VEG----------------------------------------------LLE--VP--
A0A1Z4LRU5      --DKD----------------------------------------------RQE--LP--
A0A1Z4JVB4      --DER----------------------------------------------TAA--LP--
K9PIA4          --GEG----------------------------------------------GAE--LP--
A0A1Z4HVE1      --GEE----------------------------------------------GAE--LP--
A0A252ECZ1      --GEG----------------------------------------------STE--LP--
A0A1Z4G5Y1      --GEG----------------------------------------------SAE--LP--
A0A252DNA2      --GEG----------------------------------------------SAE--LP--
A0A252E1Q4      --GEG----------------------------------------------SAE--LP--
A0A6G9SK36      --GEG----------------------------------------------EQE--LP--
A0A1Z4M597      --GVG----------------------------------------------EVE--LP--
A0A1Z4MWT1      --AAS----------------------------------------------EQE--LP--
A0A1Z4TX53      --AAS----------------------------------------------EQE--LP--
A0A2A2TNQ5      --GKM----------------------------------------------ATE--IP--
A0A3S1C4K5      --KGN----------------------------------------------GDD--LP--
A0A1X4G3D5      E-WEG----------------------------------------------EGD--LP--
D4TNI2          E-WEG----------------------------------------------EGD--LP--
A0A1Z4H6Z8      --SEA----------------------------------------------GSE--LP--
A0A3F3KPR9      GGEES----------------------------------------------QRE--LP--
A0A1Z4NPM1      --KAG----------------------------------------------DEE--LP--
A0A1Z4UZW9      --QEG----------------------------------------------RQE--LP--
A0A1B7VSH4      --QEG----------------------------------------------RQE--LP--
A0A1B7W126      --QEG----------------------------------------------RQE--LP--
A0A3D4C6Q6      --QEG----------------------------------------------RQE--LP--
A0A0K2M5H0      --QEG----------------------------------------------RQE--LP--
A0A844I4P0      --QEG----------------------------------------------RQE--LP--
A0A1B7UVJ4      --EES----------------------------------------------RGE--LP--
A0A1B7UTR1      --EES----------------------------------------------RGE--LP--
K7W0A4          --QEG----------------------------------------------RQE--LP--
A0A5C0DRW9      --QEG----------------------------------------------RQE--LP--
A0A6H2C088      --QEG----------------------------------------------RQE--LP--
A0A1Z4RPC6      ---------------------------------------------------HGS--II--
A0A2T1CMZ0      ---------------------------------------------------RGG--LV--
L8M4F7          ---------------------------------------------------KRR--VV--
A0A140K2P2      ---------------------------------------------------Q-G--II--
K9XWX4          ---------------------------------------------------Q-G--II--
A0A140KB14      ---------------------------------------------------N-G--IV--
K9XX88          ---------------------------------------------------N-G--IV--
L8LZE9          ---------------------------------------------------EDG--IM--
A0A563VSV6      ---------------------------------------------------Q-G--VL--
A0A7Y0IQB0      ---------------------------------------------------E-G--VI--
A0A433NM31      NENPEQT--------------------------------------------LPK--IP--
A0A1Z4NDS1      QPERN----------------------------------------------LPQ--IV--
U9VXM0          ---------------------------------------------------VPS--IL--
A0A6M0RI13      ---------------------------------------------------IPS--IL--
A0A6M0S1N5      ---------------------------------------------------IPS--IL--
K9F4D9          ---------------------------------------------------VPS--IL--
A0A6I5QPI5      AADDHP---------------------------------------------YPR--LL--
A0A1Z3HMQ0      LELPAGE------------------------------------------GISPR--VI--
A0A433W533      ADGKNAE------------------------------------------ATTIA--LP--
A0A2P8QWJ3      ADGKSAE------------------------------------------ATTIA--LP--
K9U6L7          ADGKNAE------------------------------------------ATTIA--LP--
U5DPF5          FNRPVDG------------------------------------------TRPVT--LP--
A0A1E5QP61      SSRRE----------------------------------------------IPL--LP--
A0A846DWC7      SSRRE----------------------------------------------IPL--LP--
A0A845Y5J4      FGRRKLG------------------------------------------DSIPQ--LP--
A0A6P0X488      FGRRKLG------------------------------------------DLVPL--LP--
A0A6P0VDM0      FGRKKLG------------------------------------------DLVPQ--LP--
A0A6P0UVD5      FGRKKLG------------------------------------------DLVPQ--LP--
A0A846BFF2      FGRKKLG------------------------------------------DLVPQ--LP--
A0A6M0G142      FGRRKSG------------------------------------------DMVPQ--LP--
A0A6P0MR53      FGRRKSE------------------------------------------ALIPQ--LP--
A0A3M2GIL5      QNKIDQI--------------------------------------------TPD--LP--
A0A6H1TSJ9      QNKIDQI--------------------------------------------TPD--LP--
A0A3M1PML8      LGALDYP--------------------------------------------APR--VV--
A0A6M8BE85      LGALDHP--------------------------------------------APR--VV--
A0A0T7BPZ0      TTEIDRQ--------------------------------------------IPR--VI--
A0A352X442      FKKSEAK--------------------------------------------DVR--LV--
A0A6B3NF44      LGESEHR--------------------------------------------APL--VF--
A0A6M0EPL4      LGESEHR--------------------------------------------APL--VF--
A0A6P0K6L6      LGESEHR--------------------------------------------APL--VF--
A0A6P0MRR9      LGDVEGS--------------------------------------------ERR--II--
A0A6P0X1X4      LGEVEGS--------------------------------------------EPR--IL--
A0A6P0UX57      LGELEGG--------------------------------------------EPR--IL--
A0A846B9S8      LGELEGG--------------------------------------------EPR--IL--
A0A0M0SHU3      VEGLDRP--------------------------------------------VPR--VI--
A0A1D2PBN3      LPGVDQP--------------------------------------------IPR--VI--
A0A0C2LVR7      LPGVDQP--------------------------------------------IPR--VI--
A0A1Z4PQB9      LRGVDQP--------------------------------------------IPR--VI--
A0A1Z4SFN6      LPGADQQ--------------------------------------------IPR--VI--
K9PGI8          LPGGEQP------------------------------------------FAIPR--LI--
A0A654SFI6      ------------------------------------------------------------
K9SSQ0          ------------------------------------------------------------
A0A2W1JIN9      ------------------------------------------------------------
A0A318AJV1      ------------------------------------------------------------
A0A845WDS5      ------------------------------------------------------------
A0A6P0IC70      ------------------------------------------------------------
A0A845VVD9      ------------------------------------------------------------
A0A6B3MUB5      ------------------------------------------------------------
A0A6M0B7N4      ------------------------------------------------------------
A0A6P0J9W3      ------------------------------------------------------------
A0A6P0ZWE1      ------------------------------------------------------------
A0A1U7N2U4      ------------------------------------------------------------
A0A6L9YZL1      ------------------------------------------------------------
A0A6P0KYM4      ------------------------------------------------------------
A0A6P0LSD6      ------------------------------------------------------------
A0A6P0PNZ7      ------------------------------------------------------------
F4XV38          ------------------------------------------------------------
A0A6P0W137      ------------------------------------------------------------
A0A845XHF7      ------------------------------------------------------------
A0A845ZEG9      ------------------------------------------------------------
A0A1D9G1F2      ------------------------------------------------------------
A0A846CJ58      ------------------------------------------------------------
A0A6L9Y9E2      ------------------------------------------------------------
A0A6P0SGR0      ------------------------------------------------------------
A0A6M0BK48      ------------------------------------------------------------
A0A845WG36      ------------------------------------------------------------
A0A6P0X384      ------------------------------------------------------------
A0A2P8QIL5      ------------------------------------------------------------
A0A433W447      ------------------------------------------------------------
K9U1K8          ------------------------------------------------------------
A0A1Q4RZJ6      ------------------------------------------------------------
A0A1Z4SNV3      ------------------------------------------------------------
A0A2H2XJQ1      ------------------------------------------------------------
A0A3S5K358      ------------------------------------------------------------
A0A0T7BPJ4      ------------------------------------------------------------
A0A0C1QS61      ------------------------------------------------------------
A0A139X3R8      ------------------------------------------------------------
A0A844MZP8      ------------------------------------------------------------
A0A1Z4I7C5      ------------------------------------------------------------
A0A844MST0      ------------------------------------------------------------
A0A0C2MDK7      ------------------------------------------------------------
A0A856MDH8      ------------------------------------------------------------
A0A1Y0RCK1      ------------------------------------------------------------
A0A1Z4PWZ0      ------------------------------------------------------------
A0A0C2QLT0      ------------------------------------------------------------
A0A1Z4J2K1      ------------------------------------------------------------
A0A3S0ZSX0      ------------------------------------------------------------
A0A2N6K4T3      ------------------------------------------------------------
A0A370CKT2      ------------------------------------------------------------
A0A0S3TL97      ------------------------------------------------------------
A0A2N6M8A0      ------------------------------------------------------------
A0A2N6M9E1      ------------------------------------------------------------
A0A2N6KJI4      ------------------------------------------------------------
A0A2N6MZ77      ------------------------------------------------------------
A0A2N6KT20      ------------------------------------------------------------
G6FSN3          ------------------------------------------------------------
A0A4D9CI02      ------------------------------------------------------------
A0A328I8B9      ------------------------------------------------------------
A0A4Q9J4Z7      ------------------------------------------------------------
A0A0M0SU69      ------------------------------------------------------------
A0A1Z4TIZ8      ------------------------------------------------------------
K9UYB2          ------------------------------------------------------------
A0A1Q4S1H4      ------------------------------------------------------------
A0A433VBU6      ------------------------------------------------------------
A0A218QN17      ------------------------------------------------------------
A0A846HD20      ------------------------------------------------------------
K9RKN2          ------------------------------------------------------------
A0A2I8ADV2      ------------------------------------------------------------
A0A5Q0GMF5      ------------------------------------------------------------
Q3MEW0          ------------------------------------------------------------
A0A1Z4KIC7      ------------------------------------------------------------
Q8YSM5          ------------------------------------------------------------
                                                                            

K9SLA9          GSVLITRDMPQSTLAET----------------FRILHTNLK-----FL-----EPGKAP
A0A168TT23      AVSHYSELHPKSAVSEA----------------FRSLRTSLM-----FS-----TPQGMP
A0A0M1JWX9      NGRERLQDDRDFGFLEA----------------FRALNTNIR-----FL-----STDQPI
A0A844MWN9      ---------------------------------FQRLASSIS-----LQ-------SIND
A0A2T1M1V6      ---------------------------------FQRLAAIVS-----SF-------ELEN
A0A2G7GCS2      ---------------------------------LQRLASAV-------L-------MLEH
K9XBH8          ---------------------------------LQRLASAV-------L-------MLEH
A0A1Z4LJ30      ---------------------------------FQRLASAVS-----LM-------QLGS
Q7NF11          ---------------------------------SRQLASTVS-----LM-------DLPN
K9RI76          ---------------------------------FQRLASAVS-----LM-------QLNS
A0A433VN22      ---------------------------------FQRLASAIS-----LQ-------PLEN
A0A139WSU3      ---------------------------------FQRLASAIS-----LQ-------PLNN
A0A844MJB7      ---------------------------------FQRLASAIS-----LQ-------PLNN
A0A352AE27      ---------------------------------FQRLASAIS-----LQ-------PLKN
A0A3B8JH60      ---------------------------------FQRLASAIS-----LQ-------PLQD
A0A3C0N766      ---------------------------------FQRLASAIS-----LQ-------PLQD
K9W9J7          ---------------------------------FQRLASAIS-----LQ-------PLKD
Q7NJN6          ---------------------------------FRQLASVVS-----LL-------PLPA
U5QCC3          ---------------------------------FLQLASIVS-----LM-------PLEG
A0A1Z4JCS8      ---------------------------------FQRVASAIS-----LQ-------PLKG
A0A846GVZ3      ---------------------------------FQRLASVIS-----LR-------SGED
A0A6P0PI80      ---------------------------------FQRLASVIS-----LR-------SGED
A0A6P0WGT6      ---------------------------------FQRLASVIS-----LR-------SGED
F4XTX2          ---------------------------------FQRLASVIS-----LR-------SGED
A0A3S0Y9N9      NKPDS-------PVSEA----------------FRILQTNLR-----FF----NS-KQHI
A0A6P0ZKB8      KQPDS-------SISEA----------------FRMLQTNLR-----FF----NS-EQTV
A0A846EDH6      KQPDS-------SISEA----------------FRMLQTNLR-----FF----NS-EQTV
A0A433UNK7      NQPDS-------SVSEA----------------FRMLQTNLR-----FF----NS-EQSI
B8HNB0          SEPHKDTDS---PFVEA----------------VRSLGLNLR-----YL----SP-DTEL
A0A318BJ18      TTPREQLLDRKSNLVDA----------------YLAINTNLG-----FT----TE-HGVP
A0A3B8Y8H9      KTDFPGSNPNFSLFLEA----------------FLGLQTNLV-----LL----NP-KQTI
A0A2W1JVB9      DTPNS-------PPSEA----------------VRMVQSNLK-----YL----NS-DKPL
A0A6H1U102      RMDGDRYRAHGSPFTEA----------------IRSLALNLR-----YL----GA-KDEV
A0A7C3ZEJ3      RGQNGEAIRYGSAFTEA----------------VRSLGLNLR-----YL----GA-KDEV
A0A2P8W9H0      DQVAM-------PFLEA----------------FRILATNIR-----LS----NP-EQPL
A0A6I5P386      ----T-------PFLEA----------------FKRLSTNLR-----LN----NP-DTHL
A0A3M1SVZ4      DNPRS-------LISEA----------------YRMLQTKLK-----FA----CA-EQSV
A0A318BG22      ANKRS-------SLSEA----------------YYSIQTALQ-----LA----TP-GGLP
A0A2T1E9V8      EDPRA-------FISES----------------YRMLQFNLE-----VA----S--SKAL
A0A1Z4LN32      TSPRT-------VIHEA----------------YQMLQANLK-----FI----SL-DRKI
A0A2I8A9F5      TTPRS-------MIHES----------------FGMLQANLK-----FI----SL-DKKI
A0A218Q6R8      TSPRS-------VIHES----------------YQMLQANLK-----FM----SL-DKKV
A0A218QGE0      TSPRT-------VIHEA----------------YQMLQANLK-----FI----SL-DRKV
A0A846HDH5      TSPRT-------VIHEA----------------YQMLQANLK-----FI----SL-DRKI
A0A3M2GQQ6      GEGRSLPSYYTEPFTEA----------------VRSLALNLR-----YL----GA-EDEA
A0A6H1U2X0      GEGRSLPSYYTEPFTEA----------------VRSLALNLR-----YL----GA-EDEA
K9TLQ0          NLVQASGGYLFSRFFEA----------------FRSLHADLY-----FM----SP-DRPL
K9QF04          NQLTHYGNYTLSHYWEA----------------YISLQTNLD-----FL----DP-DKPL
K9W1T3          NTAGS-------PISEA----------------YRMIHTSLR-----FM----SL-DNQL
K9SGJ5          SMMHS-------AFREA----------------LRSLALNLR-----YL----GG-DLSI
A0A6N2JS94      TSSYY-------AFKEA----------------LGSLALNLR-----YL----GT-DNMM
A0A6C2DSN4      TSSYY-------AFKEA----------------LSSLALNLR-----YL----GT-DNMM
L8MYT6          TSSYY-------AFKEA----------------LSSLALNLR-----YL----GT-DNMM
A0A352JGJ6      TSSYY-------AFKEA----------------LSSLALNLR-----YL----GT-DNTM
A0A1J5GLS2      SSSYY-------AFKEA----------------LSSLALNLR-----YL----GT-DNMM
A0A2W4W6M5      TSSYY-------AFKEA----------------LSSLALNLR-----YL----GT-DNMM
A0A2W7AN33      NNNYH-------AFKEA----------------LGSLALNLR-----HL----GM-DNLM
A0A256BLV2      SSSYY-------AFKEA----------------LGSLALNLR-----YL----GT-DNMM
A0A2W6ZXF3      SSSYY-------AFKEA----------------LSSLALNLR-----YL----GT-DNMM
A0A2Z5WX66      TSSYY-------AFKEA----------------LSSLALNLR-----YL----GT-DNTM
Q7NEU3          SM-----------LREA----------------FRSLLTNLR-----FL----SS-DRKL
A0A3C0N2P0      QLSAQSYGYNASPLLES----------------FRSLNTNLQ-----FV----SP-DEAV
A0A6P0JR04      SLPSFSRRYRASPFVEA----------------FRSLNANLS-----FF----TP-DKPL
A0A6B3M6M6      EKVEFNHSYISSPFLEA----------------FRSLQVNLH-----FL----GT-DESI
A0A6P0KD09      EKVEFNNSYISSPFLEA----------------FRSLQVNLH-----FL----GT-DESI
A0A6B3NIJ0      EKVEFNNSYISSPFLEA----------------FRSLQVNLH-----FL----GT-DESI
A0A6M0F053      EKVEFNNSYISSPFLEA----------------FRSLQVNLH-----FL----GT-DDPI
A0A6P2ATU9      RYGSTGNRYRTTPFLEA----------------FRSLNANLS-----FL----TP-DKPL
A0A845XAM4      PLRSLSQRYRTSPFLEA----------------FRSLNANLS-----FF----TP-DKPL
A0A352XE00      AFS-GYSRYRPSPFLEA----------------FRSLHTNLN-----FI----SP-DRPI
A0A6P0QC14      --GRSYGGYSASPLLEA----------------FRSLNTNLQ-----FL----SP-DQPI
B4VS56          PISQSTYRYHASPFLEA----------------FRSLQTNLQ-----FI----SP-DQPI
A0A352AAQ3      EFNQRSYRYTASPVLEA----------------FRSLHANLH-----FL----SP-DRPI
A0A350Y472      ELRRRSSRYNASPLLEA----------------FRSLHANLH-----FL----SP-DKSI
A0A355DVB4      ELRRRSSRYNASPLLEA----------------FRSLHANLH-----FL----SP-DKTI
A0A1Z4RMB9      EEPDS-------FSSEI----------------YRMIQANLK-----FL----TS-DKPP
A0A318B4H2      KT----------QLYES----------------YLAVRTNLS-----FL----TD-HGAP
A0A2K3BR24      DLPQS-------SASEA----------------FRMLQANLK-----FS----SV-DQKM
K9YXY1          DLPQS-------SASEA----------------FRMLQANLK-----FS----SV-DQKM
A0A1Q4RTR1      DNPWS-------PASAA----------------FEKLQSTLE-----YT----LP-DQVL
A0A1Z4SQV2      DNPWS-------PASAA----------------FEKLQSTLE-----YT----LP-DQVL
A0A2H2XGN1      DNPWS-------PASAA----------------FEKLQSTLE-----YT----LP-DQVL
A0A433UXH8      DNPWS-------PASAA----------------FEKLQSTLE-----YT----LP-DQVL
A0A1U7HGH0      AEPRS-------FITES----------------YRMLLANLK-----FP----PSLDRSS
K9XJD3          AEPRS-------FVTES----------------YRMLLANLK-----FP----PSLERSS
K9SX01          DNPRA-------PASEA----------------YRMLQTSLR-----FL----NS-DRQI
A0A4P7ZT55      DQQRF-------GLRES----------------LRNLYRSLQ-----LV----RA-GGNL
A0A1E5QIR9      DAPRS-------LISES----------------YRMLYANLK-----FL----GS-DRQV
A0A6P1A9A0      HYHSS-------PFLDA----------------FRSLHANLY-----FI----SP-DRPL
A0A1Z4IBC7      DIPYF-------PLGDA----------------YQILQVNLK-----FL----CS-DKPL
A0A5Q0GKD1      DIPYF-------PLGDA----------------YQILQVNLK-----FL----CS-DKPL
Q3MDC6          DIPYF-------PLGDA----------------YQILQVNLK-----FL----CS-DKPL
A0A1Z4KM73      DIPYF-------PLGDA----------------YQILQVNLK-----FL----CS-DKPL
Q8YNX7          DIPYF-------PLGDA----------------YQILQVNLK-----FL----CS-DKPL
A0A367R4K6      DIPYF-------PLGDA----------------YQILQVNLK-----FL----CS-DKPL
A0A1E2WSV8      DIPYF-------PVGNA----------------YQILQVNLK-----FL----CS-DKPL
A0A7D7L9Y1      DIPYF-------PVGNA----------------YQILQVNLK-----FL----CS-DKPL
A0A2R5FRT9      DIPYF-------PLGNA----------------YQVLQVNLK-----FL----CS-DKPL
A0A2K8T1B6      DIPYF-------PLGNA----------------YQILQVNLK-----FL----CS-DKPL
A0A235I9I0      DIPYF-------PVGNA----------------YQILQVNLK-----FL----CS-DKPL
A0A2D0HQT8      DIPYF-------PVGNA----------------YQILQVNLK-----FL----CS-DKPL
A0A2L2NU95      DIPYF-------PVGNA----------------YQILQVNLK-----FL----CS-DKPL
A0A367S084      DIPYF-------PVGNA----------------YQILQVNLK-----FL----CS-DKPL
A0A1Z4SMD6      TYPHT-------IVHDA----------------YQMLQANLK-----FI----S--DKKV
A0A2H2Y096      TYPHT-------IVHDA----------------YQMLQANLK-----FI----S--DKKV
K9S8M8          EAPHS-------IISEN----------------YRMLQANLR-----FL----SP-DREL
A0A1Z4NFV0      TTPRS-------VIHEA----------------YQMLQANLK-----FI----S--HKKV
A0A3M9ZEU1      DLPRS-------PISEA----------------YHMLQANLK-----FL----SS-DQEI
A0A1Z4JK72      TSPRS-------MIHEA----------------YQMLQANLK-----FM----SL-DKKV
A0A0N7Z489      STPRS-------MIHEA----------------YQMLQANLK-----FM----SL-DKPV
A0A0S3TXS2      TSPRS-------MIHEA----------------YQMLQANLK-----FM----SL-DKKV
A0A2A2TPF8      TLPRS-------VIHEA----------------YQMLQANLN-----FI----S--HKKV
A0A1Z4R0P8      TLPRS-------VIHEA----------------YQMLEANLN-----FI----S--HKRV
A0A0T7BUI3      SSPRT-------IIHEA----------------YQMLQANLN-----FI----S--HKKV
A0A1Z4LP32      SSPRT-------MIHEA----------------YQMLQANLK-----FI----S--HKEV
K9REP9          SSPRT-------MIHEA----------------YQMLQANLK-----FI----S--HKEV
A0A1Z4SIJ3      SAPHT-------VIHDA----------------YQMLQANLK-----FI----S--HKKV
A0A2H2XPG4      SAPHT-------VIHDA----------------YQMLQANLK-----FI----S--HKKV
A0A2A2TC28      SSPRT-------VIHEA----------------YQMLQANLK-----FI----S--HKKV
K9V3C7          TSPRT-------VIHEA----------------YQMLRANLK-----FI----S--HKQV
A0A1Z4T6Y7      TLPRS-------VIHEA----------------YQMLQANLK-----FI----S--HKKV
A0A2H2Y561      TLPRS-------VIHEA----------------YQMLQANLK-----FI----S--HKKV
A0A1Q4S362      TLPRS-------VIHEA----------------YQMLQANLK-----FI----S--HKTV
A0A3S1CIN8      TLPRS-------VIHEA----------------YQMLQANLK-----FI----S--HKTV
A0A0C1NCB0      TSPRT-------VVHEA----------------YQMLQANLK-----FI----S--HKRL
A0A844MLU2      TSPRT-------VIHEA----------------YQMLQANLK-----FI----S--HKRL
A0A2N6K7Q9      TSPRT-------VVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A2N6MXH6      TSPRT-------VVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A2N6M5A8      TSPRT-------VVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A2N6LL61      TSPRT-------VVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A0S3TP66      TSPRT-------VVHEA----------------YQMLQANLK-----FI----S--HRKV
G6FP91          TSPRT-------VVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A1U7GYR5      TSPRT-------VVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A2N6KY52      TSPRT-------VVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A2N6KMP5      TSPRT-------VVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A2N6MA45      TSPRT-------VVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A4Q9J9V9      TSPRT-------LVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A328IGA1      TSPRT-------LVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A4D9CE41      TSPRT-------LVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A0M0SFT2      TSPRT-------LVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A1Z4TLC8      TSPRT-------LVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A1Z4IYV4      TSPRS-------VIHEA----------------YQMLQANLK-----FI----S--HKKV
A0A1Z4Q0T6      TSPRS-------VIHEA----------------YQMLQANLK-----FI----S--HKKV
A0A0C2PT44      TSPRS-------VIHEA----------------YQMLQANLK-----FI----S--HKKV
A0A1D2P6J4      TSPRS-------VVHEA----------------YQMLQANLK-----FI----S--HKRV
A0A0C2LFH0      TSPRS-------VVHEA----------------YQMLQANLK-----FI----S--HRKV
A0A856M734      TSPRS-------VVHEA----------------YQMLQANLK-----FI----S--HRKV
B4WP72          SRNVHAS-----VVTEA----------------YQMLWSNLK-----SV----TS-RQEL
A0A2T1CIL7      AVRYN----------EA----------------YNMLQANLK-----FL----TT-NWDR
A0A433V7A0      DNSRS-------FIYEL----------------YCMIQANLK-----FL----CS-DKAL
A0A2T1FTR8      GMTTG-------IEGES----------------FRMLQTNLQ-----FL----NA-DDSL
K9UA41          GMTTG-------IEGES----------------FRMLQTNLQ-----FL----NA-DDSL
A0A563VS48      SSSAITDDGLILPVKEA----------------FQDIQINLQ-----LL----DP-KERI
A0A7Y0NUK1      LSSN-SNRILSLALREA----------------YQNIQVNLK-----YL----QG-QEAI
A0A0C2LBE2      DIPHF-------PVGDA----------------YQMLQANLK-----FL----SS-DREP
A0A433NN38      DIHLF-------AIRDA----------------YQMLQANLR-----FL-----S-DKQL
A0A2N6K0T2      DIPHF-------PVGDA----------------YQMLQANLK-----FL-----S-DKQL
A0A2N6ML72      DIPHF-------PVGDA----------------YQMLQANLK-----FL-----S-YKQL
G6FQZ6          DIPHF-------PVGDA----------------YQMLQANLK-----FL-----S-YKQL
A0A2N6MQX9      DIPHF-------PVGDA----------------YQMLQANLK-----FL-----S-YKQL
A0A2N6KXT6      DIPHF-------PVGDA----------------YQMLQANLK-----FL-----S-YKQL
A0A2N6KGB9      DIPHF-------PVGDA----------------YQMLQANLK-----FL-----S-YKQL
A0A2N6L3Y5      DIPHF-------PVGDA----------------YQMLQANLK-----FL-----S-YKQL
A0A0S3TIS7      DIPHF-------PVGDA----------------YQMLQANLK-----FL-----S-YKQL
A0A1U7GW28      DIPHF-------PVGDA----------------YQMLQANLK-----FL-----S-YKQL
A0A2N6LW63      DIPHF-------PVGDA----------------YQMLQANLK-----FL-----S-YKQL
A0A328IH74      DVPHF-------PVGDA----------------YQMLQANLK-----FL-----S-DKQL
A0A4D9CIB0      DVPYF-------PVGDA----------------YQMLQANLK-----FL-----S-DKQL
A0A1Z4TQ63      DIPHF-------PVGDA----------------YQMLQANLK-----FL-----S-DKQL
A0A4Q9J8G2      DVPHF-------PVGDA----------------YQMLQANLK-----FL-----S-DKQL
A0A350Y0P6      DVPHG-------ITSEA----------------YRMLEANLK-----FL----SP-DHVL
A0A352X940      DAPHA-------IVSEA----------------YRMLEANLK-----FL----SP-DKML
B8HTN4          DQPNS-------HLSEA----------------YRTLQANLK-----FL----SSPDHPI
A0A6P1AFJ5      RYQVS-------AFSEA----------------FRSLNTNIQ-----FL----SS-DAKI
B0CAX4          DSPRS-------SVSES----------------YRMLQANLK-----FL----SS-DHHV
A0A1Z4RN12      DASML-------PLKEA----------------YQNIQVNLK-----LL----GA-NVET
A0A2T1CMF9      EVSMM-------PLKEA----------------YQNIQVNLN-----LL----DA-DAKK
Q7NDC5          D-PLS-------PVSEA----------------YRSIRTHLK-----FL----SS-ERGL
U5QGK3          D-PLS-------PMSEA----------------YRSVRTYLK-----FL----SA-ESPL
A0A2W4UY24      QRHRV-------PLVES----------------YQSLQANLK-----FS----YF-DGSL
A0A838VM23      DNPRS-------PIAEG----------------YRMLQANLK-----FL----SS-DKPL
A0A0D8ZUV2      DMPRS-------PLSEA----------------YRMLQANLK-----FL----SS-DKPL
A0A433VDI0      DIPNS-------PISEA----------------YRMLQANLK-----FL----GS-DKAL
A0A3D1PG43      ENSLS-------PIAEN----------------YRMLQANLK-----FL----SS-ERAL
A0A2P8QQ72      NSPRS-------LTAEA----------------YRMLQANLR-----FL----NL-DRPL
K9TZQ7          NSPRS-------LTAEA----------------YRMLQANLR-----FL----NL-DRPL
A0A6N8G584      NLPRS-------PISEA----------------YRMLQANLK-----FL----SS-DKPL
A0A2G7GPR0      NLPRS-------PISEA----------------YRMLQANLK-----FL----SS-DKPL
K9XH68          NLPRS-------PISEA----------------YRMLQANLK-----FL----SS-DKPL
A0A1U7HW70      NLPRS-------PISEA----------------YRMLQANLK-----FL----SS-DKPL
A0A2S6VEJ8      NLPRS-------PISEA----------------YRMLQANLK-----FL----SS-DKPL
A0A140KBA0      QNDSSHHRHALLPIREA----------------YQILQANLK-----LL----SL-SQAR
K9XSG1          QNAHSNNRHVFLPIREA----------------YQILQANLK-----LL----SL-SQER
A0A2T1GMT4      DTPQS-------ITSEM----------------SRTIQSNLR-----FL----GA-DKPL
K9UI51          DTPQS-------ITSEM----------------SRTIQSNLR-----FL----SA-DKPL
A0A1Z4QL41      DQPYS-------LASEM----------------YRMIQANLR-----LV----SS-DQVL
K9TYI2          DKPHS-------LTSEI----------------YRMIQANLK-----FL----SP-DRAL
A0A252D4T4      DTPHS-------LTSEI----------------YRMIQANLR-----FL----SS-DKVL
A0A252DJH5      DTPHS-------LTSEI----------------YRMIQANLR-----FL----SS-DKVL
A0A252EB80      DTPHS-------LTSEI----------------YRMIQANLR-----FL----SS-DKVL
A0A6G9SKZ9      DSPNS-------LTSEI----------------YRMIQANLR-----FL----SS-DKVL
A0A1Z4HPW5      DSPSS-------LTSEI----------------YRMIQANLR-----FL----SS-DKVL
A0A1Z4MSN1      DSPTS-------LTSEI----------------YRMIQANLR-----FL----SS-DKVL
A0A1Z4U1C2      DSPTS-------LTSEI----------------YRMIQANLR-----FL----SS-DKVL
A0A0D6KV51      DSPSS-------LTSEI----------------YRMIQANLR-----FL----SS-DKVL
A0A1Z4MKF8      DSPSS-------LTSEI----------------YRMIQANLR-----FL----SS-DKVL
A0A2C6WC43      DMPYS-------LTSEM----------------YRMIQANLK-----FL----SS-DKVL
A0A841WRE0      DMPYS-------LTSEM----------------YRMIQANLK-----FL----SS-DKVL
A0A1Z4L5A1      DMPHS-------LTSEM----------------YRMIQANLK-----FL----SS-DKVL
A0A367QD86      DMPHS-------LTSEM----------------YRMIQANLK-----FL----SS-DKVL
A0A2K8SM78      DTPYS-------LTSEM----------------YRMIQANLK-----FL----SS-DKVL
A0A2R5FPC0      DTPYS-------LTSEM----------------YRMIQANLK-----FL----SS-DKVL
A0A5P8W5T6      DTPYS-------LTSEM----------------YRMIQANLK-----FL----SS-DKVL
A0A7D7LDT7      DTPHS-------LTSEM----------------YRMIQANLK-----FL----SS-DKVL
A0A235IZ96      DTPYS-------LTSEM----------------YRMIQANLK-----FL----SS-DKAL
A0A2L2NGP0      DTPYS-------LTSEM----------------YRMIQANLK-----FL----SS-DKAL
K9QM62          DRPYS-------LTSEM----------------YRMLQANLK-----FL----SS-DKEL
A0A1Z4FWI3      DTPQS-------LTSEI----------------YRMIQANLR-----FL----SS-DKVL
A0A1Z4JYE7      DTPDS-------LTSEI----------------YRMIQANLK-----FL----SS-DKLL
A0A0F5YE28      EASDS-------FISEI----------------YRMLQANLK-----FL----SS-DKRI
U7QEH7          EASDS-------FISEI----------------YRMLQANLK-----FL----SS-DKRI
A0A3S1ATK5      DAPQS-------LTSEM----------------YRVIQANLR-----LL----SS-DKVI
A0A2Z6CPH0      DMPHS-------LTSEI----------------YRMIQANLK-----FL----SS-DKVL
A0A1Z4GT50      DTPNS-------LTSEI----------------YRMIQANLR-----FL----SS-DKVV
A0A1Z4GIX0      DMPHS-------LTSEM----------------YRMIQANLK-----FL----SS-DKVL
A0A2H6LC24      DMPHS-------LTSEM----------------YRMIQANLK-----FL----SS-DKVL
B2J6N5          DTPYT-------LTSEM----------------YRMIQANLK-----FL----SS-DKVL
A0A367RMI4      DTPHS-------LTSEM----------------YRMIQANLK-----FL----SS-DNVL
A0A235HUM0      DTPHS-------LTSEM----------------YRMIQANLK-----FL----SS-DNLL
A0A2L2NW47      DTPHS-------LTSEM----------------YRMIQANLK-----FL----SS-DHLL
A0A1E2WUR1      DTPHS-------LTSEM----------------YRMIQANLK-----FL----SS-DKVL
A0A235IKU3      DTPYS-------LTSEM----------------YRMIQANLK-----FL----SS-EKAL
A0A1U7MYU6      DQPHS-------MVSEV----------------YRMIQANLK-----FL----RS-DHPL
A0A1D8TNX9      DQPHS-------MVSEV----------------YRMIQANLK-----FL----KS-DHPP
A0A6P0L6C2      DQPHS-------MVSEV----------------YRMIQANIK-----FL----KS-DHPP
A0A6P0MVH0      DQPHS-------MVSEV----------------YRMIQANLK-----FL----KS-DHPP
A0A6P0KJV0      EQPHS-------MVSEV----------------YRMIQANLK-----FL----RS-DHPL
A0A6L9ZJG4      EQPHS-------MVSEV----------------YRMIQANLK-----FL----RS-DHPL
A0A846GI17      EQPHS-------MVSEV----------------YRMIQANLK-----FL----RS-DHPL
F4XKF3          EQPHS-------MVSEV----------------YRMIQANLK-----FL----RS-DHPL
A0A1D9FX10      EQPHS-------MVSEV----------------YRMIQANLK-----FL----RS-DHPL
A0A6P0Q0T0      EQPHS-------MVSEV----------------YRMIQANLK-----FL----RS-DHPL
A0A6P0W5I0      EQPHS-------MVSEV----------------YRMIQANLK-----FL----RS-DHPL
A0A845XJ02      EQPHS-------MVSEV----------------YRMIQANLK-----FL----RS-DHPL
A0A846D190      EQPHS-------MVSEV----------------YRMIQANLK-----FL----RS-DHPL
A0A3C0NJ41      DTPRS-------PISEA----------------YRMLQANLK-----FL----SS-DKPL
A0A352AG88      DTPRL-------PISEA----------------YRMLQANLK-----FL----SS-DKTP
A0A350Y374      DNPLA-------AISEV----------------YRMLQANLK-----FL----SS-DKPP
A0A355DPX0      DNPLA-------AISEV----------------YRMLQANLK-----FL----SS-DKPP
A0A0S3TYD7      DTELVVRDAPRSAPAAA----------------YQMLQSNLK-----YV----S-SDREA
A0A2T1DNG3      QLTKWRPFR----------------------ESLDLLYQNLQ-----LI----N-ATAEL
A0A140K3H3      --KVEKPLIQVNGETN---TKAHYYNYSSFTEGLRTLAMNLR-----YT----LTEKGKI
K9XUB8          --KVEEPVIQINGETH---SRAHYYNYSSFTEGLRALAMNLR-----YT----ITETGKI
A0A563VLD6      --KVLEPRIVLSNEAEINISKGYNYSYSSFTEAFRAIAMNLG-----YM----MAQSGKI
A0A7Y0NVW6      --KVLDPRVVLSNETQINISQGYNYRYSSFTESFRAIAMNLS-----YL----MAKSGKI
U5QL42          -------------IGDRLVTRQYTRSPF--KEALRSLALSLR-----YL----G-SNNSV
A0A6H2NHD5      --------------LVQHQGDNSPYTSFSFTEAFYSLDANLR-----LL----S-SDAPI
A0A2P8W4F7      --------------LTQSQSPEKLYTSFSFAEAFYSLEANLR-----ML----S-SDVPV
A0A5Q4E0Z4      --------------LAQSQSPGNLYSSFSFAEAFYSLEANLR-----ML----S-SDTPV
A0A2P8VVX1      ------------------LMKTVMWPQF--RDSLDLIANNLQ-----LL----Q-NSHPS
A0A2P8WHY0      ------------------LMQIVQWPTF--REALDLVANNVQ-----LM----L-KGKGN
A0A563VQJ3      ------------------------------SELYRMLQANLK-----FM----N-SQRAP
A0A7Y0IRJ7      ------------------------------SELYRMLQANLK-----FM----S-SQRSP
A0A2T1CMT9      ----------------SSIQNVIQWQPF--REAIDLIYENLK-----LAYLNSSLVGSAL
A0A7G8J1V5      SNPIDADINNNAPFESNDNRREKRYQRFFYQEAFRNLYTSIR-----FL----N-AESPL
A0A354B169      N-------------PASEAFEKYRSQLFYCQEAFRSLFTSLR-----FL----N-SEKPL
Q0IDT5          T-------------NAPESRKQDRYQRFFYQEAFRNLFTSLR-----FL----N-TERPL
A0A7G8FZD9      D-------------VGETERKAARYQRFFYQEAFRNLFTSLR-----FL----N-SDKPL
G4FMX5          D-------------VGETERKAARYQRFFYQEAFRNLFTSLR-----FL----N-SDRPL
A3ZA21          G-------------GDADDRREQRYQRFFYQEAFRNLFTSIR-----FL----N-SDRPL
A0A076HBF2      E-------------DDPEAAKQRRYQRFLYQEAFRNLFTSIR-----FL----N-SDQPL
A0A7G8FP50      D-------------DDPATAKKRRYQRFFYQEAFRNLFTSIR-----FL----N-SDQPL
A0A7G8E8K7      G-------------DDPEAAKQRRYQRFFYQEAFRNLFTSIR-----FL----N-SDQPL
A0A7G8GNR2      G-------------EDADTAKQRRYQRFFYQEAFRNLFTSIR-----FL----N-SDQPL
A0A7G8ICD3      G-------------EDADTAKQRRYQRFFYQEAFRNLFTSIR-----FL----N-SDQPL
A0A2D6FCW3      E-------------EDQNTKQKAKYQRFFYQEAFRNLFTSIR-----FL----N-SDQPL
A0A7G7KJ95      V-------------SDPQQKQEAGYQRFFYQEAFRNLFTSLR-----FL----N-SDRPL
A0A7G8EAN3      V-------------SDPQQKQEARYQRFFYQEAFRNLFTSLR-----FL----N-SDRPL
A0A1D8TX52      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-PGSEW
A0A1D9G4T2      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A6P0PR27      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEL
A0A6P0WER7      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEL
A0A845XM36      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEL
A0A846DAT1      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEL
A0A846GZK8      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEL
F4XP71          -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEL
A0A6P0KZ31      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A6P0LPB8      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A6L9YR57      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-PGSEW
A0A845WMG9      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-PGSEW
A0A6P0SEV1      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A6B3N2I8      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A6M0B891      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A6P0IJQ1      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A6P0J8J8      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A6P0ZSH6      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A845VS63      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A1U7N5X9      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A6L9Z1V0      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A6P0LC12      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSDW
A0A6P0MVJ3      -----------------PMMELLGWRPF--QEALDMIYVNIQ-----LL----N-SGSEW
A0A2W6ZAV2      --------------------------GL--RESLRNLFSSFR-----LL----R-ADKVV
K9W742          Q-PIIKLPFGKPKVLAPWTVEVLHWSPS--WQSLDLIYKNIQ-----LL----S-SVSTL
A0A3D1PBA3      ----------------PWTVQVSNWPPT--WESLDLIYKNIQ-----LM----N-ELASF
K9XPB0          ----------------SSVQEIINWQPF--RESLDLIYENLQ-----RL----G-SGFAF
A0A350Y7Z1      ----------------ASTLPMVYWLPF--RESLDLIYKHIQ-----LL----N-SSATL
A0A352X2A7      ----------------ISTSHLAYSSAF--RESLDLIYKNIQ-----LV----N-AGRLL
A0A0D8ZYV0      ----------------PWTVQVSNWPPS--WESLDLIYKNIQ-----LL----NTAVASL
A0A433VMS2      ----------------PWTVQVRNWPPS--WESLDLIYRNLQ-----LM----N-EMAAF
K9TYA7          ----------------PWTVQVRNWPPS--WESLDLIYRNLQ-----LM----N-EMAAF
A0A2P8QUE1      ----------------PWTVQVRNWPPS--WESLDLIYRNLQ-----LM----N-EMAAF
K9SA61          ---------------TTASLEVIHWPPF--RESMDLIYQNIQ-----LL----N-AASPL
A0A2G7GMH8      ---------------QTQVLPMLCLQSF--RDALDLIYKNIR-----LL------TAFPV
A0A6N8FU92      ---------------QPQGLSMLCWQSF--RDALDLIYKNIR-----LL----N-SAFPI
A0A2T1DWE8      ---------------APPIMQVIHWQPF--RESLDLIYKNIQ-----LL----P-SAAGL
A0A832H7C4      ---------------LPETAQVIQWQPF--REAMDLIYKNLQ-----LL----N-PDFPL
A0A1U7I8L3      ----------------SSTIELISWQPF--RESLDLIYQNIQ-----LV----N-STGSL
A0A2T1DJL8      ----------------PSMMQVIHWAPF--RESLDLIYKNIQ-----LL----T-AANPL
A0A1Z4J9W0      ---------------NSSMLQVLHWAPF--RESLDLIYKNLQ-----LM----T-DGDPL
A0A0N7Z5K9      ---------------DTSMLQVLHWAPF--RESLDLIYKNLQ-----LM----T-DGDPM
A0A0S3TXC5      ---------------DTSMLQVLHWAPF--RESLDLIYKNLQ-----LM----T-DGSPM
A0A846FBD3      ---VKSSPY--TPIHGA----------------YQRLQASLT-----LL----R-SNPEL
K1XF69          ---VVDTPG--SLISEI----------------YRMIQANLK-----FL----G-SDRKV
B5W297          ---VVDTPG--SLISEI----------------YRMIQANLK-----FL----G-SDRKV
H1W7M8          ---VVDTPG--SLISEI----------------YRMIQANLK-----FL----G-SDRKV
A0A5Q4H6A5      ---VVDTPG--SLISEI----------------YRMIQANLK-----FL----G-SDRKV
D5A466          ---VVDTPG--SLISEI----------------YRMIQANLK-----FL----G-SDRKV
B4WQE3          GVQHLDRTT--GPFLEA----------------FKLLATNVC-----QG----G-SQDIA
U5QJM6          NGRVQNPPYTRSAYEEA----------------FRSLLTNIR-----FL----N-SDKKV
A0A0V7ZFJ4      ---VLDNPY--SSVTSA----------------FEILQTNLA-----FT----V-SDKTL
A0A235IXQ2      ---VLNNPY--SSVNAA----------------FEMLQINLG-----FS----F-SDKEL
A0A367RIS1      ---VLNNPY--SSVNAA----------------FEMLQINLG-----FT----F-SDKEL
A0A841V8H9      ---VLNNPY--SLVNAA----------------FEMLQINLG-----FT----F-SDKKL
A0A5Q0GJJ5      ---VLNNPY--SSVNAA----------------FEMLQINLG-----FS----F-SDKKL
Q3MEB7          ---VLNNPY--SSVNAA----------------FEMLQINLG-----FS----F-SDKKL
A0A1Z4KHN9      ---VLNNPY--SSVNAA----------------FEMLQINLG-----FT----F-SDKKL
Q8YT70          ---VLNNPY--SSVNAA----------------FEMLQINLG-----FT----F-SDKKL
A0A7U3NLX2      ---VLNNPY--SSVNAA----------------FEMLQINLG-----FS----L-SDQEL
A0A166IWU6      ---LLNNPY--SSVNTA----------------FEMLQINLG-----FT----I-SDKEL
A0A2S0Q8C0      ---LLNNPY--SSVNTA----------------FEMLQINLG-----FT----I-SDKEL
W6FSX4          ---LLNNPY--SSVNTA----------------FEMLQINLG-----FT----I-SDKEL
A0A218Q4C1      ---LLDNPY--SSVNTA----------------FEMLQINLG-----FT----I-SDKKL
A0A6P1ZT04      ---LLDNPY--SSVNTA----------------FEMLQINLG-----FT----I-SDKEL
A0A0V7ZNJ9      ---TLNNPY--SVESSA----------------FEMLQTNLS-----FT----S-SDKTL
A0A5P8VSD1      ---VLNNPY--SSVNAA----------------FEMLQINLG-----FT----F-YDKEL
A0A1S1ZVW2      ---VLDNPY--SPVSTS----------------IEMLQTNLG-----FA------TDKEL
A0A0R0M9H9      ---VLDNPY--SPVSTS----------------IEMLQTNLG-----FA------TDKEL
A0A7H0F4U6      ---ILDNPY--SPVSTS----------------IEMLQTNLG-----FA------TDKEL
A0A7W2A1T7      ---ILDNPY--SPVSTS----------------IEMLQTNLG-----FA------TDKEL
A0A838WI98      ---ILDNPY--SPVSTS----------------IEMLQTNLG-----FA------TDKEL
A0A853MJX6      ---ILDNPY--SPVSTS----------------IEMLQTNLG-----FA------TDKEL
A0A1B7WX82      ---LLDNIY--SPVSTS----------------FEMLQTNLG-----FT----L-SDKEL
A0A1B7WTD1      ---LLDQPY--SPVSTS----------------LEMLHTNLG-----FT----I-SDKEL
A0A480ABC0      ---LLDQPY--SPVSTS----------------LEMLNTNLG-----FT----I-SDKEL
A0A1Z4LRU5      ---VLNNPY--SPASTA----------------FEILQTNLG-----FT----M-SDKAL
A0A1Z4JVB4      ---VLHNPY--SPAAVA----------------FEMFQTNLG-----FS----I-CEQKL
K9PIA4          ---VLNNPY--SPESAA----------------FEMLQTNLG-----FS----I-SDKKL
A0A1Z4HVE1      ---VLNNPY--SAESAA----------------FEMLQANLG-----FS----I-SDKTL
A0A252ECZ1      ---VLNNPY--SPESSA----------------FEMLQANLS-----FS----I-SDKKL
A0A1Z4G5Y1      ---VLHNPY--SPESAA----------------FEMLQTNLG-----FS----I-SDKTL
A0A252DNA2      ---TLHNPY--SPESAA----------------FEMLQANLG-----FS----I-SDKTL
A0A252E1Q4      ---TLHNPY--SPESAA----------------FEMLQANLG-----FS----I-SDKTL
A0A6G9SK36      ---VLNNPY--SPVSSA----------------FEMLQTNLS-----FS----I-SDKML
A0A1Z4M597      ---VLNNPY--SPVSSA----------------FEMLQTNLS-----FS----I-SDKML
A0A1Z4MWT1      ---VLNNPY--SPVSSA----------------FEMLQTNLS-----FS----I-SDKML
A0A1Z4TX53      ---VLNNPY--SPVSSA----------------FEMLQTNLS-----FS----I-SDKML
A0A2A2TNQ5      ---ARDNPY--SSGSMA----------------FEMLMTNLA-----FS----V-SDQEL
A0A3S1C4K5      ---VLKDPY--SPATSA----------------FEMLVTNLS-----FT----L-SDQAL
A0A1X4G3D5      ---LFDQPY--SPISRS----------------FQILQTNLG-----FA------RDREL
D4TNI2          ---LFDQPY--SPISRS----------------FQILQTNLG-----FA------RDREL
A0A1Z4H6Z8      ---VLNNPY--SPESTA----------------FEMLQVNLG-----FS----I-SDKTL
A0A3F3KPR9      ---ILDNPY--SPVSTS----------------IEMLQTNLG-----FA------TDKEL
A0A1Z4NPM1      ---VLNNPY--SPASVA----------------FEMLQTNLS-----FT----V-SDNEL
A0A1Z4UZW9      ---VLNNPY--SPVSTS----------------FEMLQTNLG-----FT----L-SDKEL
A0A1B7VSH4      ---LLDDPY--SPVSTS----------------FEMLQTNLG-----FT----V-SDKKL
A0A1B7W126      ---LLDDPY--SPVSTS----------------FEMLQTNLG-----FT----V-SDKEL
A0A3D4C6Q6      ---LLDDPY--SPVSTS----------------FEMLQTNLG-----FT----V-SDKEL
A0A0K2M5H0      ---LLDDPY--SPVSTS----------------FEMLQTNLG-----FT----C-SDKEL
A0A844I4P0      ---LLDNPY--SPVSTS----------------FEMLQTNLG-----FT----V-SDKEL
A0A1B7UVJ4      ---LLDNIY--SPVSTS----------------FEMLQTNLG-----FT----L-SDKQL
A0A1B7UTR1      ---LLDNIY--SPVSTS----------------FEMLQTNLG-----FT----L-SDKQL
K7W0A4          ---LLDNPY--SPVSTS----------------FEMLQTNLG-----FT----L-SDKEL
A0A5C0DRW9      ---LLDNPY--SPVTTS----------------FEMLQTNLG-----FT----L-SDKKL
A0A6H2C088      ---LLDNPY--SPVTTS----------------FEMLQTNLG-----FT----L-SDKEL
A0A1Z4RPC6      ---VQREPD--SFASEI----------------YRMIQTNLK-----FL----A-VKRQP
A0A2T1CMZ0      ---VQREPD--SFASEI----------------YRMIQTNLK-----FL----A-VKQQP
L8M4F7          ---VEQSPD--SYTSEI----------------YRMIRTNLT-----AR----S-SQVLP
A0A140K2P2      ---VQKQPD--SFASEV----------------YRMIQANLK-----FM----S-LENST
K9XWX4          ---VHKQPD--SFASEV----------------YRMIQANLK-----FM----S-LEHPP
A0A140KB14      ---VQREPD--SFNSEL----------------YRMIQANLK-----IL----N-QDNPP
K9XX88          ---VQREPD--SFNSEI----------------YRMIQANLK-----IL----N-QDNPP
L8LZE9          ---VQQDPD--SYTSEI----------------YRMIQANLK-----FM----T-SQRPP
A0A563VSV6      ---VQQEPD--SYASET----------------YRMIQANLK-----FM----T-TQRPP
A0A7Y0IQB0      ---VQRQPD--SYASEI----------------YRMIQANLK-----FV----T-AQRPP
A0A433NM31      ---VKCTPR--SMISEI----------------YGMIYANLK-----FL----G-SDQEL
A0A1Z4NDS1      ---GRDTPQ--FPFSDA----------------YQMLQANLK-----FL----A-SDNEL
U9VXM0          ---VRNTEY--SSVLDA----------------YQSLQANLK-----FS----C-VESQV
A0A6M0RI13      ---VKNSEY--SSILDA----------------YQALQANLK-----FS----C-VDTHV
A0A6M0S1N5      ---VKNSEY--SSILDA----------------YQALQANLK-----FS----C-VDTHV
K9F4D9          ---VKNSEY--SSILDA----------------YQALQANLK-----FS----C-VDTHV
A0A6I5QPI5      ---VNQPAH--VGVREA----------------YQMMQANLK-----FL----Q-SDTEL
A0A1Z3HMQ0      ---AFSQTQ--PMVTAA----------------YQMLQANLK-----FI----S-SDTPR
A0A433W533      ---VRDTPR--APIAEA----------------FRMLQANLK-----FS----S-SDK-L
A0A2P8QWJ3      ---VRDTPR--APIAEA----------------FRMLQANLK-----FS----S-SDK-L
K9U6L7          ---VRDTPR--APIAEA----------------FRMLQANLK-----FS----S-SDK-L
U5DPF5          ---VRDYPR--SSMSEA----------------FRMLQANLK-----FS----T-TDRKL
A0A1E5QP61      ---TRDQPT--TYTSEA----------------YRTLQANLK-----FI----S-PDREI
A0A846DWC7      ---TRDQPT--TYTSEA----------------YRTLQANLK-----FI----S-PDREI
A0A845Y5J4      ---VRDAPH--AVISEA----------------YRMLEANLK-----FL----S-PDKEL
A0A6P0X488      ---VRDAPH--AVISEA----------------YRMLEANLK-----FL----S-PDKEL
A0A6P0VDM0      ---VRDAPH--AVISEA----------------YRMLEANLK-----FL----S-PDKEL
A0A6P0UVD5      ---VRDAPH--AVISEA----------------YRMLEANLK-----FL----S-PDKEL
A0A846BFF2      ---VRDAPH--AVISEA----------------YRMLEANLK-----FL----S-PDKEL
A0A6M0G142      ---VRDAPH--AVISEA----------------YRMLEANLK-----FL----S-PDKEL
A0A6P0MR53      ---VRDAPH--AISSEA----------------YRMLEANLK-----FL----S-PDKEL
A0A3M2GIL5      ---VRDRPH--WVVSET----------------YRMLQANLR-----FL----S-PDKEL
A0A6H1TSJ9      ---VRDRPH--WVVSET----------------YRMLQANLR-----FL----S-PDKEL
A0A3M1PML8      ---VRDMPQ--SPIAAS----------------YQMLQANLK-----FL----S-SDKAV
A0A6M8BE85      ---VQDMPQ--SPIAAS----------------YQMLQANLK-----FL----S-SDKAV
A0A0T7BPZ0      ---GRDVPS--FPMDEV----------------YQMLQANLK-----FL------SDRRI
A0A352X442      ---ARDTPG--SPIAQA----------------YQMLRANLK-----FL----S-SDKQI
A0A6B3NF44      ---ARDLPR--SPFNEA----------------YQMLQANLK-----FL----S-SDKQI
A0A6M0EPL4      ---ARDLPR--SPFNEA----------------YQMLQANLK-----FL----S-SDKQI
A0A6P0K6L6      ---ARDLPR--SPFNEA----------------YQMLQANLK-----FL----S-SDKQI
A0A6P0MRR9      ---VRDLPH--SPISAA----------------YQMLQANLK-----FL----S-SDEPL
A0A6P0X1X4      ---VRDLPH--SPLSAA----------------YQMLQANLK-----FL----S-SDKPL
A0A6P0UX57      ---VRDLPH--SPLSAA----------------YQMLQANLK-----FL----S-SDKPP
A0A846B9S8      ---VRDLPH--SPLSAA----------------YQMLQANLK-----FL----S-SDKPP
A0A0M0SHU3      ---GRDVPH--FPVGDA----------------YQMLQANLK-----FL------SDKQL
A0A1D2PBN3      ---GTDIPQ--FPVGDA----------------YQMLQANLK-----FL----S-SDKQL
A0A0C2LVR7      ---GTDIPQ--FPVGDA----------------YQMLQANLM-----FL----S-SDNQL
A0A1Z4PQB9      ---GTDIPQ--FPVGDA----------------YQMLQANLK-----FL----S-SDNEL
A0A1Z4SFN6      ---GRDIPH--FPVGDA----------------YQILQANLK-----FL----S-SDKKL
K9PGI8          ---GRDIPH--YPIGNA----------------YQMLQANLK-----FL----G-SDEEL
A0A654SFI6      ---LKDLIN--SASD---LSEA-----------YQATRANLA-----FL----T-SDGAP
K9SSQ0          ---LLSPSL--ELISERAFLPH-----SYNHSAFTEAVNSLALNIQNLA------AQRTF
A0A2W1JIN9      ---NLGEPA--SFYENSAILEA-----------YRALFKALE-----FR------GLEEF
A0A318AJV1      -----EGGR--RWFRSRGRVSPADLIGVAGATVYSEAIRNLRASLIGVR------QASGM
A0A845WDS5      ---SLKHPE--QFLADLSLVEP-----------YRLLLKKLE-----FR------TQEKL
A0A6P0IC70      ---SLKHPE--QFLDDLSLVEP-----------YRLLLKKLE-----FR------TQQKL
A0A845VVD9      ---SLKHPE--QFLDDLSLVEP-----------YRLLLKKLE-----FR------TQQKL
A0A6B3MUB5      ---SLKHPE--QFLDDLSLVEP-----------YRLLLKKLE-----FR------TQQKL
A0A6M0B7N4      ---SLKHPE--QFLDDLSLVEP-----------YRLLLKKLE-----FR------TQQKL
A0A6P0J9W3      ---SLKHPE--QFLDDLSLVEP-----------YRLLLKKLE-----FR------TQQKL
A0A6P0ZWE1      ---SLKHPE--QFLDDLSLVEP-----------YRLLLKKLE-----FR------TQQKL
A0A1U7N2U4      ---SVEQPK--GFLEDMRLMEP-----------YRLLLTTME-----LR------AQKRL
A0A6L9YZL1      ---SLEQPK--RFLADIRLMEP-----------YRLLLTTME-----LR------AQNRL
A0A6P0KYM4      ---SLEQPK--RFLADIRLMEP-----------YRLLLTTME-----LR------AQKRL
A0A6P0LSD6      ---SLEQPK--RFLADIRLMEP-----------YRLLLTTME-----LR------AQKRL
A0A6P0PNZ7      ---SLEQPN--RFLEDMRLMEP-----------YRLLLTTME-----LR------AQKRL
F4XV38          ---SLEQPN--RFLEDMRLMEP-----------YRLLLTTME-----LR------AQKRL
A0A6P0W137      ---SLEQPN--RFLEDMRLMEP-----------YRLLLTTME-----LR------AQKTL
A0A845XHF7      ---SLEQPN--RFLEDMRLMEP-----------YRLLLTTME-----LR------AQKTL
A0A845ZEG9      ---SLEQPN--RFLEDMRLMEP-----------YRLLLTTME-----LR------AQKTL
A0A1D9G1F2      ---SLEQPN--RFLEDMRLMEP-----------YRLLLTTME-----LR------AQKRL
A0A846CJ58      ---SLEQPN--RFLEDMRLMEP-----------YRLLLTTME-----LR------AQKTL
A0A6L9Y9E2      ---SLKQPN--RFLADMRLIEP-----------YRLLLTTME-----LR------AQKKL
A0A6P0SGR0      ---SLEQPN--RFLADMRLMEP-----------YRLLLTTME-----LR------AQKKL
A0A6M0BK48      ---SLKQPN--RFLADMRLIEP-----------YRLLLTTME-----LR------AQKRL
A0A845WG36      ---SLKQPN--RFLADMRLIEP-----------YRLLLTTME-----LR------AQKRL
A0A6P0X384      ---VLEPPE--QFLDDGKLVEP-----------YRLLLKKLE-----FC----I-QEEKL
A0A2P8QIL5      ---GKEYAD--ALMQEPAILES-----------YRSLLRSSE-----FA------ANEDI
A0A433W447      ---GKEYAD--ALMQEPAILES-----------YRSLLRSSE-----FA------ANEDI
K9U1K8          ---GKEYAD--ALMQEPAILES-----------YRSLLRSSE-----FA------ANEDI
A0A1Q4RZJ6      ---ALEPAD--GFLDNVALVEP-----------YRMLFKSLE-----FR------TSE-L
A0A1Z4SNV3      ---VLNPAN--RFLDNVGLVEP-----------YRMLFKSLE-----FR------TSE-L
A0A2H2XJQ1      ---VLNPAN--RFLDNVGLVEP-----------YRMLFKSLE-----FR------TSE-L
A0A3S5K358      ---ALEPAD--GFLDNVALVEP-----------YRMLFKSLE-----FR------TSE-L
A0A0T7BPJ4      ---KLQSAD--TFLDDIGSVEP-----------YRMLLKNIE-----FR------NLEDL
A0A0C1QS61      ---VLEPSQ--RFLDNMSLVEP-----------YRMLFKTLE-----FR------S-DRM
A0A139X3R8      ---VLEPSH--RFLDNVSLVEP-----------YRMLFKTLE-----FR------S-DQM
A0A844MZP8      ---VLEPAR--RFLDNVSLVEP-----------YRMLFKTLE-----FR------S-EQM
A0A1Z4I7C5      ---SLEPAE--QFLDDLGLVEP-----------YRMLLKNLE-----FR------SIDNL
A0A844MST0      ---SLAPGE--QFLDNVGLVEP-----------YRTLFKNLE-----FR------SPNDI
A0A0C2MDK7      ---VLEPAN--QFLDNMELIEP-----------YRTLFKTLE-----FR------RSEQL
A0A856MDH8      ---VLDPAS--QFLDNMELIEP-----------YRTLFKTLE-----FR------KSEQL
A0A1Y0RCK1      ---VLKPAN--QFLDNISLVEP-----------YRTLFKTLE-----FR------SREQL
A0A1Z4PWZ0      ---VLEPAN--RFLDNIGLVEP-----------YRTLFKTLE-----FR------SSEQL
A0A0C2QLT0      ---VLKPAN--RFLDNIGLVEP-----------YRTLFKTLE-----FR------SPEQV
A0A1Z4J2K1      ---VLEPAN--RFLDNIGLVEP-----------YRTLFKTLE-----FR------SPEQV
A0A3S0ZSX0      ---MLEPSE--RFLDNSALIEP-----------FRMLFKNLE-----FR------SSEPL
A0A2N6K4T3      ---ALEPSV--RFLDHVGLVEP-----------YRTLFKNLE-----FR------SRESL
A0A370CKT2      ---ALEPSA--QFLDHVGLVEP-----------YRTLFKNLE-----FR------SSEPL
A0A0S3TL97      ---ALEPSA--QFLDHVGLVEP-----------YRTLFKNLE-----FR------SSEPL
A0A2N6M8A0      ---ALEPSA--QFLDHVGLVEP-----------YRTLFKNLE-----FR------SSEPL
A0A2N6M9E1      ---ALEPSA--QFLDHVGLVEP-----------YRTLFKNLE-----FR------SSEPL
A0A2N6KJI4      ---ALEPSA--QFLDHVGLVEP-----------YRTLFKNLE-----FR------SSEPL
A0A2N6MZ77      ---ALEPSA--QFLDHVGLVEP-----------YRTLFKNLE-----FR------SSEPL
A0A2N6KT20      ---ALEPSA--QFLDHVGLVEP-----------YRTLFKNLE-----FR------SSEPL
G6FSN3          ---ALEPSA--QFLDHVGLVEP-----------YRTLFKNLE-----FR------SSEPL
A0A4D9CI02      ---ALEPSG--QFLDHLGLVEP-----------YRTLLKNLE-----FR------NPESL
A0A328I8B9      ---ALEPSG--QFLDHVGLVEP-----------YRTLLKNLE-----FR------NPESL
A0A4Q9J4Z7      ---ALEPSG--QFLDHLGLVEP-----------YRTLLKNLE-----FR------NPESL
A0A0M0SU69      ---ALEPSG--RFLDHVGLVEP-----------YRTLFKNLE-----FR------STEPL
A0A1Z4TIZ8      ---ALESSG--RFLDHVGLIEP-----------YRTLFKNLE-----FR------SNEPL
K9UYB2          ---ILQPAN--FFFNEISLVEP-----------YRMLFKNLE-----FS------TAENL
A0A1Q4S1H4      ---ALAEAD--LFLDDMGLVEP-----------YRMLLKTLE-----CR------SPGKL
A0A433VBU6      ---ALAEAD--LFLDDMGLVEP-----------YRMLLKTLE-----CR------SASKL
A0A218QN17      ---VLEPAE--RFLDNISLVEP-----------YRMLLKTLE-----FR------SNDKV
A0A846HD20      ---VLEPAD--RFLDDIGLVEP-----------YRMLLKTLE-----FR------STDKV
K9RKN2          ---VLEPSD--RFLDQVGLVEP-----------YRMLFKTLE-----FR------SDDEL
A0A2I8ADV2      ---TLEPAE--KFLDDVGLVEP-----------YRMLLKNLE-----FR------SHEKL
A0A5Q0GMF5      ---SLEPAE--QFLDDLGLVEP-----------YRMLLKNLE-----FR------NVDNL
Q3MEW0          ---SLEPAE--QFLDDLGLVEP-----------YRMLLKNLE-----FR------NVDNL
A0A1Z4KIC7      ---SLEPAE--QFLDDLGLVEP-----------YRMLLKNLE-----FR------NVDNL
Q8YSM5          ---SLEPAE--QFLDDLGLVEP-----------YRMLLKNLE-----FR------NVDNL
                                                                            

K9SLA9          KVIAITSSIAKEGKSTFTANLAI-AAAQMGAKVLLIDADLRKPTQH-QLWQ--VP--NSQ
A0A168TT23      KTILMTSPGPGDGKTTNAINLAT-VLAQNGARVLLIDADLRKPRLH-RDFS--IQ--QAP
A0A0M1JWX9      RAIAVASAVAAEGKSTAAVNLAQ-AAATMGQRVLLVDGDLRRPQVH-AKLG--IL--NRQ
A0A844MWN9      GRLLITSAIMGEGKTTMTVGLAS-ALVDLGFRVLVVDGDLRHAQLS-----------RCF
A0A2T1M1V6      RRLMITSATRSEGKTTLTLGLAW-ALVQLGFRVLLVDADLRQAEMS-----------RKL
A0A2G7GCS2      QRLLVTSPTSGEGKTTVTLGLAL-ALVNFGFRVLIVDGDLRQAELS-----------RRL
K9XBH8          QRILITSPTAGEGKTTMTLGLAL-ALVNCGFRVLMVDGDLRQAELS-----------RRL
A0A1Z4LJ30      GRLMIASATTSEGKTTATLGLAN-ALINLGFKVLVVDGDFRKSELS-----------QSL
Q7NF11          RRLMITSSTAGEGKTTLTLGLAN-ALAEMGFRVLLVDADFRQASLS-----------RLL
K9RI76          GRLMIASANTEEGKTTTTIGLAN-ALLVLGFKVLLVDGDFRRGELS-----------ESL
A0A433VN22      RRLLVTSAIMGEGKTTVAIGLAN-ALVDLGFKVLLVDADFRQAALS-----------RRL
A0A139WSU3      RRLLVTSATQGEGKTTVAIGLAY-GLVDLGFRVLLVDGDFRSAELS-----------RSL
A0A844MJB7      RRLLVTSATQGEGKTTVATGLAY-ALVDLGFRVLLVDGDFRRATLS-----------RNL
A0A352AE27      RRLLVTSATMGEGKTTVTLGLAT-ALVDLGFRVLLVDGDFRKAQLS-----------HRL
A0A3B8JH60      HRLLVTSAIMGEGKTTVTLGLAT-ALADLGFRVLLVDGDFRKAELS-----------RRL
A0A3C0N766      HRLLVTSAIMGEGKTTVTLGLAT-ALADLGFRVLLVDGDFRKAELS-----------RRL
K9W9J7          HRLLITSAIMGEGKTTVTLGLAR-ALADLGFRVLLVDGDFRKAELS-----------RRL
Q7NJN6          RRLMITSANTGEGKTTVTLGLAK-ALRELGFRVLVVDADFRQAGLG-----------RKL
U5QCC3          QRLMITSSTFGEGKTTVTLGLAR-ALRSLGFRVLVVDADFRQAGLG-----------RLL
A0A1Z4JCS8      IRLLIASAITGEGKTTVALQLAH-ALTELGFRVLLVDGDFRKAQLS-----------HQL
A0A846GVZ3      RRILITSAMVSEGKTTVTLGLAT-ALVDLGFRVLVVDGDFRQATLS-----------QRL
A0A6P0PI80      RRILITSAMVSEGKTTVTLGLAT-ALVDLGFRVLVVDGDFRQATLS-----------QRL
A0A6P0WGT6      RRILITSAMVSEGKTTVTLGLAT-ALVDLGFRVLVVDGDFRQATLS-----------QRL
F4XTX2          RRILITSAMVSEGKTTVTLGLAT-ALVDLGFRVLVVDGDFRQATLS-----------QRL
A0A3S0Y9N9      KVIVVSSAVPQEGKSTIAANLAF-SISQIGRKVLLVDADFRRPSQD-KIWN--IM--NHA
A0A6P0ZKB8      KVIVVSSAVPKEGKSTVAANLAY-SISQLGRNVLLVDADLRHPSQH-KIWE--IP--NEV
A0A846EDH6      KVIVVSSAVPKEGKSTVAANLAY-SISQLGRNVLLVDADLRHPSQH-KIWE--IP--NEV
A0A433UNK7      KVIVVSSSVPKEGKSTIAANLAF-SISQLGRNILLVDADLRNPSQH-KIWE--IP--NEV
B8HNB0          RTIAFTSTIPSEGKSTIVYNLGR-MLAELGQKVLIVDADTRNPTIH-QIIE--QP--NLR
A0A318BJ18      RSFLVTSTRPAEGKSTTALALAT-MLARAGKRTILVDGDMRSPSVH-QLGG--VD--HDH
A0A3B8Y8H9      KSLTISSAIPEEGKSTVAAHLAQ-AAAKMGQKVLLVDGDLRLPQLH-HQPG--LTSSNQY
A0A2W1JVB9      KVIVMTSGIPSEGKSTASANLAM-AMAELGQKVLLVDADLRRPVQH-RTWE--LL--NRV
A0A6H1U102      KTLALTSSTPSEGKSTLTYNLAR-SLAELGQRVLIVDADMRKPTIH-EFIK--QT--NAL
A0A7C3ZEJ3      KTLAFTSSTPSEGKSTLTYNLAR-VLAELGHRVLLVDADMRKPTVH-QMIK--QP--NAL
A0A2P8W9H0      KSITVSSAVPNSGKTTVSFHLAY-TMALLGYRTLVVDNDFRRPSLH-TLCH--LP--NEK
A0A6I5P386      KSLAISSATPNSGKSTVSFHLAH-TNATLGQKTLLVDMDLRRPTLH-KFCN--HA--NDK
A0A3M1SVZ4      KTIVVTSAIAKEGKSTIAANLAA-AISQVGRRVLLVDADLRRPLQH-EIWN--LG--NEM
A0A318BG22      RTLLVTSAAMAEGKSTTSAALAQ-GVADRGKRVLLVDADLRKPTLH-HRFA--QT--NQV
A0A2T1E9V8      KVIAITSSVPNEGKSTTCANLAA-VMAQLEHKVLIIDADFRHPSQH-LIWQ--IS--NEE
A0A1Z4LN32      RSIAVTSSVAGEGKTEVAANLAA-VMAQVGRRVLLVDADMRQPSQH-HLWG--LI--NSI
A0A2I8A9F5      RTIAVTSSIAGEGKSEIAANLAA-VIAQTGRRVLLIDADMRRPSQH-HLWN--LI--NSA
A0A218Q6R8      RTIVVTSSVPGEGKSEVSANLAA-VMAQVGRKVLLVDADMRQPSQH-HLWG--LL--NSI
A0A218QGE0      SAIVVTSSISGEGKTEVAANLAA-VMSLAGRRVLLVDADMRQPSQH-HLWG--LI--NSV
A0A846HDH5      STIVVTSSVSGEGKTEVAANLAA-VMSLAGRRVLLVDADMRQPSQH-HLWG--LI--NSV
A0A3M2GQQ6      KTLALTSATSGEGKSTLTYNLGR-VLSELGQRVLIVDADMRKPTVH-EFIK--QP--NAL
A0A6H1U2X0      KTLALTSATSGEGKSTLTYNLGR-VLSELGQRVLIVDADMRKPTVH-EFIK--QP--NAL
K9TLQ0          KSIVISSTLPAEGKTTISMKLAE-AASAMGNRVLLVDADLRRPQID-QRMD--LP--NVW
K9QF04          KSLVISSALPGEGKSTIAVYLAQ-VAASMGKRVLLIDADLRRPTIHTRVHS--LT--NVW
K9W1T3          KVMVISSSVPKEGKSTTAANLAV-AISQLGQRVLLIDADMRKPSQH-KIWQ--LP--NET
K9SGJ5          KSIAFTSAVPSEGKSTLVFNLAS-ILAELGHKVLVVDADMRKPNVH-HLAK--LR--NNY
A0A6N2JS94      KVIAFTSSVPSEGKSTMTYNLAI-ILSALGYRILLVDADMRKPTVH-KLAG--LS--NKV
A0A6C2DSN4      KVIAFTSSVPSEGKSTLTYNLAM-ILSSLGYRILLVDADLRKPTVH-KLAR--LS--NKF
L8MYT6          KVIAFTSSVPSEGKSTLTYNLAM-ILSSLGYRILLVDADLRKPTVH-KLAR--LS--NKF
A0A352JGJ6      KVIAFTSSVPSEGKSTLTYNLAT-ILAALGYKVLLVDADMRKPTVH-KLSK--LS--NKF
A0A1J5GLS2      KVIAFTSSVPSEGKSTLTYNLST-ILAVLGYRVLLVDADMRKPTIH-KLSK--LP--NKV
A0A2W4W6M5      KVIAFTSSVPSEGKSTLTYNLAT-ILAALGYKVLLVDADMRKPTVH-KLTK--LS--NKV
A0A2W7AN33      KVIAFTSSVPSEGKSTLTYNLAV-ILSSLGYRVLLVDADMRKPTIH-KLAG--LS--NKV
A0A256BLV2      KVIAFTSSVPSEGKSTLTYNLAT-ILSALGYRVLLVDADMRKPSIH-KLAG--LS--NKV
A0A2W6ZXF3      KVIAFTSSVPSEGKSTLTYNLST-ILAALGYRVLLVDADMRKPTVH-KLSK--LP--NKV
A0A2Z5WX66      KVIAFTSSVPSEGKSTLTYNLST-ILAALGYKVLLVDADMRKPTVH-KLTN--LS--NKS
Q7NEU3          KVFVVSSSMPGEGKSTVATNLAK-VVGGLNRKALLVDADLRRPTVS-NKLE--LS--NGP
A0A3C0N2P0      RSVVISSATPGDGKSTITTFLAQ-AAAAMGQRVLLVDADLRRPRIH-ETTD--LP--NVW
A0A6P0JR04      QTLVISSSVPLEGKSTTSANLAQ-AAAAMGQRVLLVDADLRRPQIH-AMTD--LP--NVW
A0A6B3M6M6      RSLVISSTVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVH-LRMD--LP--NVW
A0A6P0KD09      RSLVISSTVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVH-ERMD--LP--NVW
A0A6B3NIJ0      RSLVISSTVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVH-ERMD--LP--NVW
A0A6M0F053      RSLVISSTVPADGKSTVASFLAQ-AAAAMGRRVLLVDADLRRPQVH-ERMD--LP--NVW
A0A6P2ATU9      QVLVISSSVPLEGKSTTSIHLAQ-TAASMGQRVLLVDADLRRPQVH-VVAD--LP--NVW
A0A845XAM4      QVLLVSSSVPLEGKSTTSIHLAQ-TAAAMGQRVLLVDADLRRPQVH-AMTD--LP--NVW
A0A352XE00      RSLVMSSAVPADGKSTTSMFLAQ-AAAAMGEKVLLVDADLRRPQIH-VRMN--LL--NMW
A0A6P0QC14      RSLVLSSSVPADGKSTVAIYLAQ-AAAAMGQRVLLVDADLRRPQVH-VRTD--LP--NVW
B4VS56          RSVVISSAVPADGKSTIATFMAQ-AAAAMGQRVLLVDADLRRPQLH-VRTD--LP--NVW
A0A352AAQ3      RSLVMSSAVPADGKSTTSAFLAQ-AAAAMGERVLLVDADLRRPQVH-VKTD--LP--NVW
A0A350Y472      RSLVVSSAVPADGKSTVAAFLSQ-AAAAMGERVLLVDADLRRPQVH-VKTD--LP--NVW
A0A355DVB4      RSLVVSSAVPADGKSTVAAFLAQ-AAAAMGERVLLVDADLRRPQVH-VKTD--LP--NVW
A0A1Z4RMB9      KVMLITSSVPEEGKSTVVANLAA-AIAQLGRSVLLIDADLRRSSQH-TLWG--VD--NNL
A0A318B4H2      GVLMLTSSRPNEGKSLSAYALSR-LFAETGASVVLIDADMRNTRLD-DLVA--LD--ARP
A0A2K3BR24      KVIVLTSSIPNEGKSTVSANLGM-ALAELGHRVLIIDADLRRPSQH-QVWE--EP--NAV
K9YXY1          KVIVLTSSIPSEGKSTISANLGM-ALAELGNKVLIIDGDLRRPSQH-QVWE--EP--NAV
A0A1Q4RTR1      KSIVITSAIPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSSQH-EVWK--VE--NSQ
A0A1Z4SQV2      KSIVITSAVPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSRQH-EIWK--VE--NSQ
A0A2H2XGN1      KSIVITSAVPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSRQH-EIWK--VE--NSQ
A0A433UXH8      KTIVITSAIPNEGKSFVSANLAL-AMAQLGRRVLIIDADMRCSNQH-QIWK--VE--NSQ
A0A1U7HGH0      RVILVTSSIPKEGKSTTCANLAA-VMALLNYKVLIIDADLRHPSQH-QIWE--IA--NHI
K9XJD3          RVILVTSSAPKEGKSTTCANLAA-VMALLNYKVLIIDADLRHPSQH-QIWE--IA--NHI
K9SX01          KAIVITSSVPGEGKSTVSANLAV-AIAQLGKRVLLVDVDMRRPSQH-KIWG--LG--NAS
A0A4P7ZT55      RMLAVTSTASGEGKTTSVALLGQ-ALADLGLKVLLVDGDLRQMQLH-QRFA--AD--GAR
A0A1E5QIR9      RVIAVTSAIPKEGKSTVSANLAL-AIAQLGFRVLLVDADMRHPSQQ-AFWD--TP--KTV
A0A6P1A9A0      RSLAISSSVPAEGKSTTSVNLAQ-AAAAMGQRVLLVDADLRRPQIH-IMMD--LP--NVW
A0A1Z4IBC7      KSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWE--LS--NEI
A0A5Q0GKD1      KSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWD--LS--NAI
Q3MDC6          KSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWD--LS--NAI
A0A1Z4KM73      KSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWD--LS--NAI
Q8YNX7          KSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWD--LS--NAI
A0A367R4K6      KSIVVTSSVPKEGKSEVSANLAV-TMAQAGRRVLLVDTDMRHPIQH-HIWE--LK--NTV
A0A1E2WSV8      KSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWG--LP--NAM
A0A7D7L9Y1      KSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWG--LP--NAM
A0A2R5FRT9      KSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRNPMQH-HIWG--LT--NVT
A0A2K8T1B6      RSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRNPIQH-HIWG--LK--NTI
A0A235I9I0      KSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWG--LT--NTS
A0A2D0HQT8      KSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWG--LT--NTM
A0A2L2NU95      KSIVITSSVAREGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWG--LT--NTM
A0A367S084      KSIVITSSVAKEGKSDVSANLAV-TMAQAGRRVLLVDADMRHPIQH-HIWG--LT--NTM
A0A1Z4SMD6      RTIAVASSVALEGKSEVSANLAA-ALANAGRRVLIVDTDMRQPRQH-HLWG--LI--NST
A0A2H2Y096      RTIAVASSVALEGKSEVSANLAA-ALANAGRRVLIVDTDMRQPRQH-HLWG--LI--NST
K9S8M8          KVIVVTSPVPQEGKSTVSANLAA-AMAQLGRRVLLVDADMRHPMQH-HVWH--LT--NLA
A0A1Z4NFV0      RTIVITSSVAGEGKSEVAANLAT-SIAQSGRRVLLVDADMRNPSQH-HLWG--RI--NPT
A0A3M9ZEU1      RVVVVTSAVAKEGKSTIAANLAA-AAAQVGRRVLLIDADLRYPQQH-HIWD--LL--NTG
A0A1Z4JK72      KTIVISSAVPREGKSEVAANLAA-TMAQSGRKVLLVDADMRNPSQH-HLWG--IV--NSV
A0A0N7Z489      KTIVISSAVPREGKSEVAANLAA-TMAQSGRRVLLVDADMRNPSQH-HLWG--LV--NSV
A0A0S3TXS2      KTIVISSAVPREGKSEVAANLAA-TMAQSGRKVLLVDADMRNPSQH-HLWG--LV--NSV
A0A2A2TPF8      RTIVVTSSVAGEGKSEVSANLAA-VMAQAGKRVLIIDADMRNPSQH-HLWG--VM--NLT
A0A1Z4R0P8      RTLVVTSSVAGEGKSEVSANLAA-VIAQTGKRVLLIDADMRNPSQH-HLWG--VM--NLT
A0A0T7BUI3      RAIAITSCVPGEGKSEVSANLAA-ILAQAGRRVLLIDADMRKPSQH-HLWG--LI--NSV
A0A1Z4LP32      RTIVVTSSVVGEGKSEVSANLAA-ILAQSGKRVLLVDADMRQPNQH-HLWG--LI--NGG
K9REP9          RTIAVTSSVVGEGKSEVTANLGA-ILAQGGQRVLIVDADMRQPMQH-HLWG--LI--NSG
A0A1Z4SIJ3      CTLAITSSVAGEGKSEVAANLAA-ALAQSGRQVLLVDADMRQPAQH-RLWG--LI--NSV
A0A2H2XPG4      CTLAITSSVAGEGKSEVAANLAA-ALAQSGRQVLLVDADMRQPAQH-RLWG--LI--NSV
A0A2A2TC28      CTIVVTSSVAGEGKSEVTANLAA-IIAQSGRRVLLVDADMRQPSQH-HLWG--LI--NSS
K9V3C7          RTIVVTSSVAGEGKSEVSANLAA-AIAQTGKRVLLVDADMRQPSQH-HLWG--LM--NVK
A0A1Z4T6Y7      RTIVITSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDGDMRNPAQH-HLWG--VM--NLT
A0A2H2Y561      RTIVITSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDGDMRNPAQH-HLWG--VM--NLT
A0A1Q4S362      RTIVVTSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDSDMRNPSQH-HLWG--VM--NLT
A0A3S1CIN8      RTIVVTSSVPGEGKSEVSANLAA-VIAQAGKRVLLVDSDMRNPSQH-HLWG--VM--NLT
A0A0C1NCB0      RTIVVTSSVPGEGKSEVSANLAA-VLAQSERKVLLIDADMRLPSQH-HIWG--LI--NSV
A0A844MLU2      RTIVVTSSVPGEGKSEVSANLAA-VLAQSERRVLLIDADMRQPSQH-HLWG--LI--NSA
A0A2N6K7Q9      RKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--NSV
A0A2N6MXH6      RKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--NSV
A0A2N6M5A8      RKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--NSV
A0A2N6LL61      RKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--NSV
A0A0S3TP66      RKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--NSV
G6FP91          RKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--NSV
A0A1U7GYR5      RKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--FI--NSV
A0A2N6KY52      RKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--NSV
A0A2N6KMP5      RKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--NSV
A0A2N6MA45      RKIVVTSSVTAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWG--LI--NSV
A0A4Q9J9V9      RKIVVTSSVSAEGKSEVSANLAA-IIAQSGKRVLLVDADMRKPTQH-HLWS--LI--NSV
A0A328IGA1      RKIVVTSSVSAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWS--LI--NSV
A0A4D9CE41      RKIVVTSSVSAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWS--LI--NSV
A0A0M0SFT2      RKIVVTSSVSAEGKSEVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWS--LI--NSV
A0A1Z4TLC8      RKIVVTSSVSAEGKSDVSANLAA-VIAQSGKRVLLVDADMRKPTQH-HLWS--LI--NSV
A0A1Z4IYV4      RTIVVTSSVPGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQH-HLWG--VI--NSV
A0A1Z4Q0T6      RTIVVTSSVAGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQH-HLWG--VI--NSV
A0A0C2PT44      RTIVVTSSVAGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQH-HFWG--VI--NSV
A0A1D2P6J4      RTIVVTSSVAEEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPTQH-HLWG--VI--NSV
A0A0C2LFH0      RTIVVTSSVPGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPSQH-HLWG--LV--NSV
A0A856M734      RTIVVTSSVPGEGKSEVSANLAA-VLAQAGRRVLLVDADMRKPSQH-HLWG--LV--NSV
B4WP72          KTIVITSAAAGEGKSEVSVNLAT-TIAQSGQRVLLIDADMRHPSLH-KTWN--IS--NRV
A0A2T1CIL7      KAIAVTSSVPQEGKSEVASNLAK-SMADLGRRVLLIDADLRRPTQH-HILG--LS--NTA
A0A433V7A0      KVIVITSTVPSEGKSTVAANLAA-AIAQLGKQVLLVDADMRHPSQH-TAWN--LI--NEV
A0A2T1FTR8      KVVVVSSSQSGEGKSTVAANLAL-AVAELGKRVLLVDADMRKPAQH-LIWR--QG--NYE
K9UA41          KVVVVSSSQSGEGKSTVAANLAL-AVAELGKRVLLVDADMRKPAQH-LIWR--QG--NYE
A0A563VS48      KTIAITSAVAQEGKSSVSANYAI-AQAQCGKRILLIDGDLRRSSQH-DLWQ--IP--NQI
A0A7Y0NUK1      KSIAVTSAVAKEGKTSVSANYAS-AQAQCGKRILLIDGDLRCPSQH-RRWQ--IS--NQV
A0A0C2LBE2      RVIVVTSSVSGEGKSEVAANLAM-AMTQVGHRVLLVDADMRHPVQH-HVWN--LT--NAV
A0A433NN38      KAIAVTSSVAKEGKSEVSANLAV-VMAQVGRRVLLVDADMRRPCQH-HIWG--LT--NAQ
A0A2N6K0T2      KAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQH-HIWQ--LR--NNQ
A0A2N6ML72      KAITVTSSIPREGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQH-HIWQ--LS--NNQ
G6FQZ6          KAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQH-HIWQ--LS--NNQ
A0A2N6MQX9      KAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQH-HIWQ--LS--NNQ
A0A2N6KXT6      KAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQH-HIWQ--LS--NNQ
A0A2N6KGB9      KAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQH-HIWQ--LS--NNQ
A0A2N6L3Y5      KAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQH-HIWQ--LS--NNQ
A0A0S3TIS7      KAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQH-HIWQ--LS--NNQ
A0A1U7GW28      KAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQH-HIWQ--LS--NNQ
A0A2N6LW63      KAITVTSSIPKEGKSEVSANLAV-AMAQVERRVLLVDADMRHPIQH-HIWQ--LS--NNQ
A0A328IH74      KAITVTSSIPKEGKSEVCANLAV-AMAEVERRVLLVDADMRHPIQH-HIWQ--LS--NKK
A0A4D9CIB0      KAITVTSSIPKEGKSEVCANLAV-AMAEVERRVLLVDADMRHPIQH-HIWQ--LS--NKK
A0A1Z4TQ63      KAITVTSSIPKEGKSEVSANLAV-AMAEVERRVLLVDADMRHPIQH-HIWQ--LS--NKK
A0A4Q9J8G2      KAITVTSSIPKEGKSEVSANLAV-AMVEVERRVLLVDADMRHPIQH-HIWQ--LS--NKK
A0A350Y0P6      KRIVVTSSVAQEGKSTVSANLAI-AMAQVGRRVLLVDADMRHPMQH-HIWD--LA--NTV
A0A352X940      KVIVVTSSVSREGKSTVSANLAA-AMAQLGRKVLLIDADMRHPIQH-HIWD--LA--NAM
B8HTN4          RTIVITSTRPQEGKSTVSANLAL-AIAELGHKVLLIDADLRLPLQH-QIWE--LP--NAT
A0A6P1AFJ5      HSLVVSSSVPMEGKSTISFNLAQ-AAAAMGQKVLLVDADLRRPQVH-IMAE--IS--NVW
B0CAX4          QVFVVTSSIPKEGKSTVVANLAL-ALGELGHRVLVIDADMRRPSQH-QVWE--LP--NAL
A0A1Z4RN12      KTIAVTSSVPQEGKSSVSANLAV-ARAQCGQKVLLVDADMRRPTQH-RIWE--IT--NEI
A0A2T1CMF9      KVIAITSSVPQEGKSSVSANLAV-ARSQCSQRILLIDADMRRPTQH-HIWE--IS--NQI
Q7NDC5          RAFVLTSASPQEGKSTTAANLAA-VSAQAGARVLLVDGDLRKPRQH-ALWD--LD--NRQ
U5QGK3          TAVVFTSASPQEGKSTTVANLAI-VSAQSGARVLLIDADLRKPRQH-KLWE--VS--NQQ
A0A2W4UY24      KAITVTSAVGGEGKSEISANLAL-TLAQLGHSVLLIDADMRSPIQH-HIWD--IS--NLK
A0A838VM23      QVIVVTSAVPKEGKSTVSANLAT-AIAQLGRRVLLVDADMRHPLQH-HIWN--LT--NAA
A0A0D8ZUV2      RVIVVTSSVPREGKSTVSANLAT-AMAQLGYRVLLVDADMRRPVQH-HIWK--LN--NIT
A0A433VDI0      KVIVVTSAVSKEGKSTVSANLAA-AIAQLERQVLLVDADMRRPVQH-HVWE--LT--NAV
A0A3D1PG43      KAVVVSSSVPKEGKSTVSANLA</