BYKdb

Dataset for cluster tadcd of phylum chloroflexi

[Download (right click)] [Edit] [Sequences] [Repertoires]

81 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A535RWE5      ----------------MQSLVPEGDARPSADLSERPFVPPRRALLAGERLLRAIRR---W
A0A0P6WSP2      -------------------------------------MLSNREAVGLKWLANWNSP---S
A0A5C7JWY1      --------------------------MVKGESVNGKTVIMDEAEYTISEYATACWR---H
A0A1F8QGH2      --------------------------------------MTNNANTDLRRIFSVIRR---W
A0A1Q7TTL6      --------MTLSNLPAPLVPPPVTAPGLPQRGVAAFDSDHSESGVDWRRILSAVLR---F
A0A0S8KFR9      --------------------------------------------MELRAYLEILIR---R
A0A535SLQ0      --------MSRVMSEHPPNDARVTSGSIVDRG----ELEAPVSTVRLDDLFAVVRR---H
A0A363SX22      --------------------------------------------MELISFLKIFLK---R
A0A326UPN3      ------------------------------------------MRISLSRYILLAKK---W
A0A455STY5      ------------------------------------------MRISLSRYILLAKK---W
A0A3A4VPK9      ---------------------------------------MEDETIDLRQYGLLLKR---W
A9B6E3          -------------------------------------------MNIIRRYITGLRR---W
A0A3D0CW53      --------------------------------------------MELKEYASVLWK---W
A0A1F8SS27      ----------------------------------------MNDYIELHRLFTMVLR---K
A0A2E0L5X9      -------------------------------------------------MLRAILR---W
A0A3A0AXU8      --------------------------------------------MELLTYWKILRK---R
A0A3D1JCW0      -----------------------------MEHFDGEESTLNTGDTDLRKYLWLLWQ---W
A0A2N2MJJ0      ---------------------------MEENNDNDTLEFDLIDAASLRRMGGLLWR---N
A0A3M1LAM5      ----------------------------------------MSMTFSWRLVWRLVKQ---W
A0A536BZ00      --------------------------------------------MDLRRQLAVLRS---R
E8N5M1          ---------------MLYLDTGGMLPIRGNFSMEDFAEPVQQPSTDLRQYLWLLWQ---W
A0A1F8U7F0      --------------------------------------------MEIKRYFSLVRR---W
A5V160          --------------------------------------------MTLQRYLTLFWR---W
A0A2A6REI6      ------------------------------------------MDNELLRYLFIIRR---W
A0A426TTK3      ------------------------------------------MDNELLRYLFIVRR---W
A7NIZ1          ---------------------------------MRQVDEQSEHRMILQRYLTLFWR---W
A0A0P6XM68      --------------------------------------------MEIKEYLQIARR---W
A0A2N2MEG3      --------------------------------------------MEIKHYYMIAQR---W
A0A353RQ31      --------------------------------------------MDIKHFFNIAKR---W
A0A3B9KNR2      --------------------------------------------MDIKHFFSIAKR---W
A0A0P6XME1      --------------------------------------------MQPRDYLVLIRR---W
A0A3B9Q1T8      --------------------------------------------MDIRRILYLLKR---W
A0A1F8PTW9      --------------------------------------------MELKKYIFPLRK---W
A0A1F8QH26      --------------------------------------------MEFKRYLFPLRR---W
A0A359HML3      --------------------------------------------MDIAELIYPLRR---W
A0A3M1EJ46      --------------------------------------MINEDQMELRHYLAVLWT---W
A0A2U2S5W9      --------------------------------------------MTLRQYFAVIWR---W
A0A0M8KAF3      ----------------------------MNTPLVPPDMLTDEDTIDLRQYWLLIRR---W
A0A523V9H6      --------------------MSGSTVAGQAVGLSEGSALGEEQ--DLRVYLAVLRR---W
A0A3D1U3H5      ----------MGSLNRRQEFDSVGIALNPATQALDAEQSSGDRAALLRWYYHLVRR---W
A0A2N2MEK3      --------------------------------------------MEIKHYLGMLQR---W
A0A3B9J9U6      --------------------------------------------MEIKHYLGMLQR---W
A0A661VSD8      ------------------------------------------MEIDLRRYLMVIKR---W
A0A497C1E5      ------------------------------------------MNKQVTQYVRLIKR---W
A0A1W9UQ51      ------------------------------------------MNKQVAQYVRLLGK---W
A0A497B563      ------------------------------------------MNKQVAQYVRLLGK---W
A0A3D0UNQ0      -------------------------------------MDELNDFVEIRHYISIFLR---R
A0A2G6GG97      --------------------------------------------MELKNYFLLIWR---W
A0A521TS25      ------------------------------------------MTLQFARVWSLWARYGHW
A0A3M1H759      -------------------------------------------MAELRRYRNIV-R---W
A0A535D584      ----------------------------------------MERSFDLIQLLKLVRR---W
A0A5C7JS64      ------------------------------------------MDLTLHNLAAMARR---W
A0A535IMD1      -------------------------------------------MMELKRYLSTILK---W
A0A521UD91      ------------------------------------MLRKEGRVVELRQYATLVQK---W
A0A3C0LJ76      -----------------------------------------MDNRELQMYLRPLLR---W
I0I8T2          -----------------------------------------MNQRELQAYLRPILR---W
A0A497ASN6      -------------------------------MEELEKKSWVEEEIDIREYARVLQR---W
A0A3D1TRD4      MALIAPPMRYTDAGSVTWPAGLSQYSASDTSSADQFNRRYGESMLPNIDYLVWVRR---W
A0A3C0XJG2      ----------------------------------MDDSSRGVPGFARARVLFMFRR---W
A0A3M1ZZ81      --------------------------------------------MEIRQYIRLIWR---W
A0A497AF06      --------------------------------------------MELREILRVIQR---R
A0A661W444      --------------------------------------------MELREILRVIQR---R
A0A3D0D4X6      --------------------------------------------MELRQYARIVWK---W
A0A1J4ZRV4      --------------------------------------------MELRQYALLLRK---W
A0A1V5RXW5      --------------------------------------------MELREYMALLRK---W
A0A522N7L9      --------------------------------------------MDLRRQLTIVRA---H
A0A535W4H1      --------------------------------------------MDLRRQLHIVRT---R
A0A521IC37      --------------------------------------------MELRRYLSLLKK---W
A0A3A0B2P8      -----------------------------------------MEELNLRLLLRPLLK---W
D1CAL1          -----------------------------------------MRDLTFIEILGLIRR---W
A0A497BNC7      ----------------------------------------------LRQYIAIIRK---Y
D1C8M3          ---------------------------------------------MTSSILARGLR---W
I4EI06          ------------------------------------------MDMTIADMLKLGRR---W
A0A2E5F6N9      ---------------------------------MVEQNFDEESSLDLRQYVDALIR---W
A0A2E6J6X7      -----------------------------------MNQNEQEQSIDFKKYIGLAIS---Y
A0A3M1EAN8      --------------------------------------------MELKQYLLILWK---R
A0A535QK16      -----------------------------------------MVAVELIRYWRVVRR---L
A0A1F8RRT9      --------------------------------------------MQLARYLRLAGR---W
A0A535FRM3      ------------------------------------------MQSSLNRYILLAKR---W
A0A401ZA55      ------------------------------------------MRSTLSRYILLAKR---W
A0A4P6JS79      ------------------------------------------MRSSLSRYTLIVKR---W
                                                                            

A0A535RWE5      AGLVGIAMIVGAVVSFGVSRV-IPPEYRATAQLYLAPAPNATAS---------VDIVGGQ
A0A0P6WSP2      LRIVLGCVLIATLIACLVILL-IPPTYKSSTLLLIEPSPGLVTDDY-------SSIIAGE
A0A5C7JWY1      RWLILLVVGCFGIGAAVWSFL-QVPVYQAKATVVIDNPTPGGLDKD-------KSFYPDN
A0A1F8QGH2      LWLILGCTLVGGVIAFSVTSL-LPPVYKATATLLVEPSQESSPNDY-------STLMAGE
A0A1Q7TTL6      KWLIATMTLVGTVAGIGATRF-IKPEYSAQTKIWIDVEGRGQDRGP--------TPIRSA
A0A0S8KFR9      KWVVILTTLATVAAVVLVTSR-QQPVYSAAARVRVAQASSGSIEYV--------DYMYAE
A0A535SLQ0      IRLVLGVTAAVVAAAGYVAYV-TGSVYRAVAVIRLSDPRRAFTGGVVDDPALGADGRYAD
A0A363SX22      WWIIVLIFLVTVGSTAIFTWR-QNPTYSVTTTFVVSPSSTIFSDPR---SFLSGLDVLGG
A0A326UPN3      VWLVVVGVVICGVGTFAVSKLFIKPTYKASASIVVTLQTSSSPSDN---------ATAAL
A0A455STY5      AWLVVVGVVICGVGTFAVSKLFIKPTYKASASIVVTLQTSSSPSDN---------ATAAL
A0A3A4VPK9      SWLLVLSLVIGAATGLIVSLL-STPIFQSTAKVMITRAGQDQSSDV-------TAYLTTN
A9B6E3          LWLLVLGPVVAAGAAYGISSQ-QTPRYASSTRVIVGQTLKNSNPDY-------GSLVASE
A0A3D0CW53      LWLIIVAMLIAAVSSYWASLR-MQPIYQTSTTLMVGQFIQNPNPTD-------QDLRISQ
A0A1F8SS27      WWLLIMVTAFAAALGYTFGHR-QAPVYEARATLLVGQIFESANLEK-------QDLQTSE
A0A2E0L5X9      WWLIVLSVSLGVGVGYIVRSQ-QPDLYFSEATVIVGADSNNPVPTG-----------VDS
A0A3A0AXU8      LLLIVLLILVAEFGAVYYVVS-RVPLYSTTTTMIITPSAMGSLLSY-------QVNLTLG
A0A3D1JCW0      AWLIGLATLLAAGAAFIVSEL-QTPVYQASTTILVNEAPST--QSS----NYSAIYLTSQ
A0A2N2MJJ0      AWIIALAGLLLGLAAFIFGRM-QAPVYEARTQVLVSRPSMQ--SQI----VDITQSMNSQ
A0A3M1LAM5      WWLLVVGAVLAGGTGYYFASK-KPNIYAARTTLMVGANIRN---PD----PNSRDFGLTV
A0A536BZ00      SRLIIGSVLLAAIASALVSLA-LPKVYQSRVTLVVGQSLAA---VN----PDINQLLVSQ
E8N5M1          GWFIALAGVLAASGALILSLL-QTPIYAASTTILVNEARSG--QYY----DSTAIILTNE
A0A1F8U7F0      AWLGILGLVLGAAGGYFSSAN-QTPVYQASTRFVILRAAQT---TA----ADYYAYLDSQ
A5V160          LWLMLLMTLIAGGAAYLVSRQ-MTPIYEASTTLLINQAPAG--SSS----PDYQAVLTAE
A0A2A6REI6      AWLIIIGTVLSASAAFLVSRE-MTPVYQASTTLLINQASAS--NAN----ADYNAILSSE
A0A426TTK3      AWLIVMGTLLSAGAAFLVSRE-MTPVYQASTTLLISQASAN--NAN----ADYNAILSSE
A7NIZ1          LWLMLLMTLLAGGAAYLVSNR-MTPVYEASTTLLINQAPAS--SAS----PDYNAVLTAE
A0A0P6XM68      AWLLILGLLLGAVSAFFFANS-QTRIYESSIRVQIVSAVKT--VPN----MDYNSYVEQN
A0A2N2MEG3      AWLLILGLLLGGGGAYIFSSL-QEPVYQTTTRVQVVSASRVGGAGT----DAYSNFYIEN
A0A353RQ31      LWLVIAGVIIGAAVGYFVSSR-QTPIYEASSKFVILRAPQT----T----YDYYAYLDNQ
A0A3B9KNR2      LWLVIAGVIIGAAVGYFVSSR-QTPIYEASSKFVILRAPQT----T----YDYYAYLDNQ
A0A0P6XME1      LWLLGVGIFVGALGGLVFSLL-QKPIYQASTKVMVLGVPQS----N----LSDILNQNSE
A0A3B9Q1T8      SWLLIIVTLISGVAGYYFSSQ-QTPMYRASTRFVIMQPAST----D----SDNLSLVEIQ
A0A1F8PTW9      WWLLLASTLVAVVLSYLYILR-QPKIYQTHTTLMIGTTISDPNPSS-------NEFALGQ
A0A1F8QH26      WWLILASTLVAAVLSYLYLYQ-QPKIYQTHTTLMIGAAITNPNPSY-------NDFVLGQ
A0A359HML3      WWLIVLATVIAAGASFAVARQ-QPPTYQSRATLMIGRTI-ENPNPT----S--VQFSLEE
A0A3M1EJ46      VWLLLLAPLLAAGISLAVSMH-IQPVYRASATLLISQASGPSLDSN---SY--NSLLTSE
A0A2U2S5W9      LWLIVLAGAVAGGAAYASSQS-MPRVYQSTTTLMVGQKVMRDPNVT----A--QDLYVSQ
A0A0M8KAF3      WWAFVLALLLGAVAAYIASQF-QQPIYRAEARILVSQSSSSDLNDI----Y--RDIVIGE
A0A523V9H6      LWLVVVCTILGAASAFLVSSN-MAPVYEASATLLVHQAPSAGVSD-----Y--TAILTSE
A0A3D1U3H5      IWLIVLVTIAAGVTGYSVTTLFIKPTYVATATLQVDAGQ-LSSDVN----G--TGVIASQ
A0A2N2MEK3      AWLLALGLILGGVGSYLFSVN-QSPVYQSSTKLLVIRAP-QGQNSD----L--AYLA-SQ
A0A3B9J9U6      AWLLALGLILGGTASYLFSVN-QSSVYQSSTKLLVIRAP-QGQNSD----L--AYLA-SQ
A0A661VSD8      WWLLIIGAIIPAIISSYFTAK-QPALYQARVTLMVGTTL-QSSNPD----T--RAMQTSN
A0A497C1E5      WWLLLVSVIIPAVISYYFTTR-QPDLYQAKATIMVGASL-QNPDPD----P--GQMNLSN
A0A1W9UQ51      WWLFVISVIIPAVISYYFTAQ-QPALYQAKATIMVGASIFQDPNPD----Q--TAIRLGN
A0A497B563      WWLFVISVIIPAVISYYFTAQ-QPALYQAKATIMVGASIFQDPNPD----Q--TAIRLGN
A0A3D0UNQ0      WWLVLLTALVAAGIGYVVSQS-QDRVYRATTSVIVGQSIQATQ-LD----S--RDIQTSE
A0A2G6GG97      VWLIILGVVIAAIAAFLISKN-TAPVYQSTSRLLIDQAPGAGSGND----Y--TQILVEE
A0A521TS25      LWLIAVVTVVSGGVSYAVSRS-IPPEYRAVATLLVNQVQGSGGGAS----Y--TDIMTSE
A0A3M1H759      WWLVLLSTVIAAGASYYISDQ-QPRIYASTTTLMVGQAIAKAN-PS----D--QDLYLAD
A0A535D584      APVVAFMTLLAGGLAFVVARA-AVPSYQSCGLLRVAVQAPSG-----------SQAASAS
A0A5C7JS64      WWLLVLAPLVAGVVAFAQVSR-QQELYSASSTVEINPPSMGTD----------QFTYYDS
A0A535IMD1      WWLIALSTAVAAAFSYYASAQ-SPRIYQTATTLMVGQALQSPN-PD----N--IQVYAAT
A0A521UD91      WWLVLLGFVVAGAGSYYVSKS-QVPVYRASVTLLVDQAQDASG-PN----Y--DAILASE
A0A3C0LJ76      WWLILLSALLAGASAFVFVRL-RPPVYIASGTVMVGTAIQERN-PD----S--QQLSLTQ
I0I8T2          WWLILLAMALAGTSAYIFARM-RPDVYIASGTVMVGTALQERN-PD----S--QQLSLTQ
A0A497ASN6      LWLIALCSIIAAVSAYIISACFIQPVYKAEAVLMVEPSAGVSSSIR----Y--QDVLAGE
A0A3D1TRD4      LWLVLLGTLLGGGIAFGIAAT-TAPTYQSSATLLINASSTPNA-LT----Y--TDVLLSQ
A0A3C0XJG2      GPLIALATVVAGGTAFAVSEV-LPKEYSATSQLYVAPAANPTAAL--------QDAVLGQ
A0A3M1ZZ81      LWLIILGAIIAGGTAYVISKN-TVPIYRASSRLLIDEAPGSGSNNE----Y--AELLVEQ
A0A497AF06      LWLIVLGTLLISIVVFAVSKN-MKPVYRAKVTMMIKQSSSMPL-AD----Y--TSILTGE
A0A661W444      LWLIVLGTLLISIVVFAVSKN-MKPVYRAKVTMMIKQSSSMPL-AD----Y--TSILTGE
A0A3D0D4X6      LWLIVICTAVSGAIAYVVSIN-TAPVYQATASLLIREGKDPES-TT----Y--TDLLTSE
A0A1J4ZRV4      LWLVVICTVVAGGTAYGVSKN-STPIYQASATLLVNQASNPVSGAG----Y--QDILTSE
A0A1V5RXW5      LGLILACMILAGGVAFFVSRQ-SIPIYQASATVMINQASSPSAAAV----Y--ADILTAE
A0A522N7L9      WRLIVACALLAGVAAFAVSSI-LPKSYHSEATLIVGQGLTSTD-PN----Y--NELLASQ
A0A535W4H1      LWLILLVTIAFGGAGLLAATL-APRQYEARATILIGQSLSSVN-PD----Y--NQLLTSQ
A0A521IC37      GWLILLITGLAAAGSYFYSRT-IPPTYRTTAVLLVGQEQQSAN-PT----P--SEIYVSN
A0A3A0B2P8      WWLIAACTLLAGVSSGLYTLR-QPRTYLSRTTIMVGSSLLEPN-PN----S--NDLYLAG
D1CAL1          WWVFIVCPLLAAAAAYGVSRA-LTPIYRAEATLFIDQRETTGS-LN----V--GDIQAAQ
A0A497BNC7      WWLILLTTVLATGAAFYVSVA-APPVYRATTTLEIDLGTNPLS-DP----YTVSNARTVE
D1C8M3          WWIVLVGALAAAALAYLVSAA-MTPIYQAQLTLLIEESQGTGA-GD----Y--NDILAAE
I4EI06          WWVFVACPLLAAGAAYLVSSL-LTPIYEANLMLLINQSRVPGV-IN----Y--DDILAAQ
A0A2E5F6N9      SWVAIIVAVLAGAAAYFYTQS-RTPVYQASSLVQIQQTQGSALPTF-------SDLQLSR
A0A2E6J6X7      SWLIILLPTIVGTGAYFYSQQ-QTKLYEAKATLLVEQRSSGLSTSI-------SDYSLSA
A0A3M1EAN8      VWLLIAAPLLAGAISYAASL-RMVPVYRASATLLVSPSGESAALNY-------SSLLASE
A0A535QK16      AWLIVLCPVVAALAAGIISL-QLPKIYEAKASLLVRPAQPLSVDPG-------VAALTTD
A0A1F8RRT9      WWFIALAALIGGGSAYSISQ-LITPIYRADATLLVNQTQTPGVIAY-------NDILTSE
A0A535FRM3      LWIIVLGVVVCGGMTYIASK-ITRPTYQASTQLVL--AISTSQSPY-------ENASAAL
A0A401ZA55      AWVIILGMVICGGTTYLVTKLLMQPVYEAQTRILI--TL-AGTSQN-------DSTLAAI
A0A4P6JS79      AWVIVLGVVICGSVTYGITK-LMQPVYQATAQVIL--TIGTNQSPY-------ESTNAVI
                                          :     . :                         

A0A535RWE5      N--LAR--SYAQLANSSVVLRAAMDDVG--------------------------------
A0A0P6WSP2      Q--LAF--TYSQLMVEKQILETAIRRLE-----LD--LEPEDL-ARRVSAEPVSNTQLIR
A0A5C7JWY1      S--PEYFQTHFELMKSHFVLQRTARILD-----LA--ERPEYQ-PKPSVIKQFMKSFLPD
A0A1F8QGH2      R--LAL--TYSQMLKGPLILEKVITRLG-----LD--ETPEDL-SEKIVAEPVANTQLIR
A0A1Q7TTL6      Q--LLDAESWVDLLLSYVVLDQVVRDQRLF---VE--PGTPAD-GQAVEKLSVADQYQPG
A0A0S8KFR9      R--LMN--TYIEMLKSSSILEEVIKELD-----LS--SSPKDL-AKQIEADVVPDTELLS
A0A535SLQ0      P--LLS--Q-VELLKSHAVAGGVVDSMPMLRVVLR--KSSRSL-LERVLRRRLSPGLLGD
A0A363SX22      RVSVAN--TYSDIATSRRIKNDTIDALG-----LN----PVQAETLDVGSKILAGTNVIY
A0A326UPN3      T--LLP--TYIELVTNPTVLQPVVSKYH-----MQ---SANEL-ASKISVKQIGGTQVIE
A0A455STY5      T--LLP--TYIELVTNPTVLQPVVSKYH-----MQ---SANEL-ASKISVKQIGGTQVIE
A0A3A4VPK9      Q--QTQ--TYLQLLQTESILNIVSERLG-----FE-------LDEDAIDTKAIIDTQIIE
A9B6E3          R--LVA--TYAQIAQSRTTMQAVEQRLN-----LS-----DMASSAIITTRPVQETEFLD
A0A3D0CW53      Q--LAQ--SYARLLRRQMILQTTIDALG-----LQ--IPWQAL-AGRVSAASAPGSQLIQ
A0A1F8SS27      L--VAQ--TYSDLTRRQPILQSVVDVLG-----LN--KTWQQL-RKQVSVGLVEGTQLIQ
A0A2E0L5X9      T--VLD--AYSVLIGRNSLLQPVIDDLG-----LN--ISVLDL-MELMSLETNRSASLIT
A0A3A0AXU8      P--LAN--TYIQYMGTRSFGEMVAARMP-----VE--ISSAEV-LRSIQAEFVRDTQIFR
A0A3D1JCW0      Q--LTK--TYAEMLTKKPLLDKVRQNLG-----LS--ENVE----FDVKVNFIRDTQLVQ
A0A2N2MJJ0      Q--ITQ--TYVEMFKLASVRQAAAEHLQ-----IE--IKP-----GQVSVSALTNTQIVE
A0A3M1LAM5      T--LAQ--IYGEMAKRRPITQAVVDRLD-----LP--MEWWDL-AGRIETRVNPTAQLLE
A0A536BZ00      K--LSE--TYAEVARTDPVLQAVSNQLG-----LG--VSPDNL-RGRVSTDAPRDITLLR
E8N5M1          K--LTR--TYAEMMTKRPLLVKVAQKLN-----LP--YVI-----DTVKVTPVRDTQLMQ
A0A1F8U7F0      Q--LLQ--TYIQLLTTEKVLNAASEKLG-----YP--VYA-----GQASAQQVPDTQFVR
A5V160          R--LAR--TYAELLVKRPVLEDVVRELN-----LS--IAPSLL-AERVRVRPIRDTQLIV
A0A2A6REI6      R--LAR--TYASLMLTRPILEEVIAELE-----LV--TTPSAL-ADRITTTPVRDTQLIR
A0A426TTK3      R--LAR--TYASLMLTRPMLEAVIADLD-----LT--TSPDAL-ARRITTTPVRDTQLIR
A7NIZ1          R--LAR--TYAELLIKRPVLEEVVRELS-----LP--FAPSML-AERIRVRPIRDTQLIV
A0A0P6XM68      Q--LAQ--TYVQTLRSRPVLDAVAERIN-----TA--ITP-----EQIRAQIVQNTQLID
A0A2N2MEG3      Q--LAQ--TYVQTLKSHSIVDMVAERIG-----GS--VSP-----DQVQVQIVQGTQLID
A0A353RQ31      Q--LIS--TYVQLLSTESVLQKASDELG-----FP--IYK-----GQATASPITDTQFVV
A0A3B9KNR2      Q--LIA--TYVQLLSTESVLQQASEELG-----FP--VLK-----GQATARAITDTQFVE
A0A0P6XME1      L--LSQ--TFTELLVTRPVLEAASERLG-----YY--INS-----SQVRVQQVRGAQLIQ
A0A3B9Q1T8      Q--QIT--TYSQLISSTDLINQVSTELG-----FP--VDQ-----KQLEVEQIGDSQFVR
A0A1F8PTW9      Q--LAS--AYANIANRQMVRNATMNALD-----MN--------ELPEYTAWALPNTQLIE
A0A1F8QH26      Q--LAD--AYANLTNLQLIREATMNALN-----ID--------QLPEYKARVEPSTQLVV
A0A359HML3      Q--LAV--SYANIANREPLRDATMEALG-----LD-------W-LPEYSVTAVPNTQLIE
A0A3M1EJ46      R--VAK--TYAQLLTKRPLLEQVISDLH-----LK--LTPYQL-AGKIEVIQPANTQLLE
A0A2U2S5W9      Q--LAQ--TYIQMATRQPILQATIEALG-----LK--EDWTSL-RGRVNASPVQGTALLQ
A0A0M8KAF3      R--LVK--TYAEIMKSDAVLDLVAET-------VG--EEALEE-AK-ISVSPGQDTQLLV
A0A523V9H6      R--LAR--TYSEMITGRPVLDAVIDQLE-----LG--QTAEEL-AETVEVELVRDTQLIR
A0A3D1U3H5      Q--LAD--TEARLVVTQPVAVKAYKALH-----LHLPLTPSTL-LGGATASSDVNSQLVT
A0A2N2MEK3      Q--LAQ--TFIQLLKTKPVLDSASAELG-----YH--IS-----SGQIKAEQLRDTQVIT
A0A3B9J9U6      Q--LAQ--TFIQLLKTKPVLDSASAELG-----YR--IS-----SNQIKAEQLRDTQVIT
A0A661VSD8      S--LAQ--AYAELVRYRPITEAVIQRLG-----LE--RSHEAL-ASQIVAWVRPNANLLE
A0A497C1E5      T--LAT--AYAELVKQGPITEAVIERLG-----LE--RTPERL-AEQISARVQWGVYLLE
A0A1W9UQ51      T--LAA--AYAELLRQGPVVEAVIERLG-----LE--RTPEQL-AAQIGTGFYSGAQLLE
A0A497B563      T--LAA--AYAELLRQGPVVEAVIERLG-----LE--RTPEQL-AAQIGTGFYSGAQLLE
A0A3D0UNQ0      R--LAL--TYADIARRQPVLEAVIVSLD-----LD--YAWQNL-RNRVRVDLVPDTQLLE
A0A2G6GG97      R--LAQ--TYVELLKTDPILEETISQLE-----LP--MSVPTL-KKMISVSAPQETQIII
A0A521TS25      R--LAR--TYGELMRKRPVLEKTITELQ-----LA--TTNEQL-ARTIEVRPVRDTQLVT
A0A3M1H759      Q--LAN--VYAQMAEREPILQATIDALA-----LD--VEWDVL-GGQVSAFHPSQSQFLS
A0A535D584      D--ITQ--TDAVLMTQNGVLSEVIRDLH-----LR--ISSDQL-RAHLVARPGPSSELIT
A0A5C7JS64      S--IVA--TYQALITTSAVLDPVIESLG-----LP--MTEDQL-RAKITTSPVANTRLMR
A0A535IMD1      Q--LAQ--TYVQIVRRQPVMQAVVDDLK-----LT--VSWEQV-AAQTSVALIQGTQLIE
A0A521UD91      R--LTN--TYGELIRKTPVLSATIERVE-----LP--YTPAQL-AKLIQVQVVRNTQLLV
A0A3C0LJ76      G--LAQ--TYVKIAQRPSIREATRKALG-----MD--WLPE------YSVRIVPDSQLIE
I0I8T2          G--LAQ--TYARIMQRPSIKKATMEALG-----MD--WLPQ------YTVRT--ESQLIE
A0A497ASN6      R--IAR--TYAEILESRPLLEKTLIKLG-----YPPDLSDKEL-PFNVSVQAVRETQLIR
A0A3D1TRD4      Q--LTL--TYSKIAVQDPVLAQVIQEGH-----LP--FTVIQL-QKMVSAAPVLQTQLIT
A0A3C0XJG2      N--LAP--SYVQLAQSEVVLRRARDKVS-----WP---DSKSF-RERTQVAQVRNTSIIA
A0A3M1ZZ81      R--LTQ--TYLQILSTRPVMEETITRLN-----LP--YTPEQL-AAKVSASSPQDTQIII
A0A497AF06      N--LAL--TYSALLKTRPLLEIVIANLG-----LD--ISPDELIEHRLGTNLIPDTQLLE
A0A661W444      N--LAL--TYSALLKTRPLLEIVIANLG-----LD--ISPDELIEHRLGTNLIPDTQLLE
A0A3D0D4X6      R--LAR--TYSERLQSRPVLEETARALG-----LQ--QDLGTL-KVKITVQPVRDTQLIR
A0A1J4ZRV4      R--LAK--TYASLLTGWPMLDETARRLG-----VD----AKDL-EKTVTVSSVRDTQLLE
A0A1V5RXW5      R--LSR--TYANLLMSRPVVDQTAEQLG-----IE----PRSI-ERSIDVTPVRDTQLLK
A0A522N7L9      Q--LTQ--TYVSVATQRKQLEGVIAKLR-----LA--TTPEDL-AKTVNAQAAATSTLIT
A0A535W4H1      R--LTL--TYASLATRRPILDAVISTLG-----LK--TTADDL-LPRIDAEPSQTTAFLT
A0A521IC37      N--LAQ--AYALLVNQPSVLQAAAKELN-----WE--GSWESL-YFVVTANAPQGGQTFN
A0A3A0B2P8      Q--LAS--AYADIVQRSTVRDATQAALG-----LG--WLP------YYTARLVPNTQLIE
D1CAL1          E--LAA--TYSRLVTARPVLEQTINRLS-----LD--TTPEDL-VENISVTRIGSTQLVE
A0A497BNC7      S--VAA--IFAAKIQFPLFLQQVKERLG-----LP---ADVKV-DDMISVQQIGSTQLIH
D1C8M3          R--RTR--TFSRLVAQRPVLEETIRRLS-----LR--MTPEEL-MAVIEVTPIRDTQLVT
I4EI06          Q--RTQ--TYSRLVTTRPVLEETIRKLN-----LS--VTPEQL-LKKVDVSPVRDTQLFT
A0A2E5F6N9      A--LAS--TYKELITTTDILSAVTKELG-----LS--ASTGGL-RKNISVSILRDTSILR
A0A2E6J6X7      R--LSK--TYAKLITADPFLDQVRETNG-----FE--RLG------SVQTRTQENPPLIE
A0A3M1EAN8      R--VAK--TYAELLTKRPLLEQVIANLH-----LS--LTPRQL-AGKINVAQPADTQLLE
A0A535QK16      Q--ILR--TYARLMTERPLLEQVISDLN-----LK--TDPATL-SKQITVTPAPNTAILD
A0A1F8RRT9      R--LTM--TYRELISKRPVLEDVTEDLE-----LP--MSPDEL-GALIDVEAIEDTQLLR
A0A535FRM3      E--LLP--TYARLVANPQVLQPVATKYK-----LT--V--KQL-TEMITVKPQSNTQIIE
A0A401ZA55      A--QQS--TYSQLVTNPNVLAPVAAKHN-----ME--L--KQL-TGMVKTQSATNSPIID
A0A4P6JS79      A--LQP--TYAQLVTTPQVLQPVAARHG-----LT--L--KGL-SNLVVVNAPSNTPIIK
                                      .                                     

A0A535RWE5      ------------------------------------------------------------
A0A0P6WSP2      LSVRDSSPQNAALLAETIADEFVQHVRLLEREKFG-ESISGLQAEMESQTTLISANQARV
A0A5C7JWY1      SVLAFVRPAPKKEHADSADD----------------------------------------
A0A1F8QGH2      LTIRESSPEKVTLLANTIAEIFTDHIQALQTDRFT-DLLQSLQDQMSAASTQMNETESTM
A0A1Q7TTL6      VYRFTVDHSGQGYTLASADGVELERGTLGDSVGTRYGLRWAPDASTVAPGRAVQFNLTTL
A0A0S8KFR9      ITVTDHDPARAKDIANALATLLVERSRNLYFGGTR-SAREILQ----QQLDEVEAKLEQV
A0A535SLQ0      VAVAADAPA---------DSLPLTFDRDGFVVGAP-PERRRVAYDTLVKVDGVRFTVRRR
A0A363SX22      ITVEGPDPSLITTFANKLGETTV-------------------------------------
A0A326UPN3      VTVSDEDPKMATNITNDVAQNFA-------------------------------------
A0A455STY5      VTVSDEDPKMATNITNDVAQNFA-------------------------------------
A0A3A4VPK9      INVEDPDPQRAALTADMLVEVLI--------EQNE-------------------------
A9B6E3          IAVEANDPQQAADIANAIADQLI--------LTSP-------------------------
A0A3D0CW53      INVVDGDPQRARLLADEIAHQLI--------LHSP-------------------------
A0A1F8SS27      ITAEADSPDTAQMIADEVAHQLI-------LFSPG-------------------------
A0A2E0L5X9      IGITDTDPERAAAIANRIVDELI-----------R-------------------------
A0A3A0AXU8      ITATHRNPEVAQMLANTTAQMLI--------DANT-------------------------
A0A3D1JCW0      LLVEHTDPFLAANVANEMVAVFS--------EDIR-------------------------
A0A2N2MJJ0      IVVEDTNPALAGEIADTLVDVLI--------EKND-------------------------
A0A3M1LAM5      ITVFDTDPQVAALLANAVAEELV--------RQSP-------------------------
A0A536BZ00      ITATDGDPNQAARIANEVANQLI--------KLSP-------------------------
E8N5M1          VIVEDINPVYASDFANELVNAFA--------EQLQ-------------------------
A0A1F8U7F0      LTVTNTDPQRAADIANVLVMVLI--------DQNE-------------------------
A5V160          VTVEDIDPQRAADIANRIVAVFS--------EQNR-------------------------
A0A2A6REI6      VTVEGEDPAQVAAIANRLVTVFV--------ERNE-------------------------
A0A426TTK3      VTVEGEDPLQVAAIANRLVEVFV--------QGNE-------------------------
A7NIZ1          VTVEDIDPQRAADIANHIVAVFS--------EQNR-------------------------
A0A0P6XM68      IFVTDTDPQRAASIANTLVEVFI--------ERNS-------------------------
A0A2N2MEG3      ITVEDTDPERTALIANTLVDVFI--------ARNV-------------------------
A0A353RQ31      LTVRHTEPEKAALIANGLINVLI--------DENE-------------------------
A0A3B9KNR2      LTVRHTDPEKAALIANSLIDILI--------EQNE-------------------------
A0A0P6XME1      IIVEDSIPEKAAEIANTLVTVFL--------EQNA-------------------------
A0A3B9Q1T8      LTVTNEDPFKTAVIANALIDALI--------QNNE-------------------------
A0A1F8PTW9      ISVTDIDPKRAQAVANELATQLI--------LMSP-------------------------
A0A1F8QH26      ITVNDTDPNRAQAVANELAAQLI--------LLSP-------------------------
A0A359HML3      IVVVDTDPQRAQIVASEIANQLI------LGSPTS-------------------------
A0A3M1EJ46      LYVEDSDPEQAVAIANGIATLFM------QQNARR-------------------------
A0A2U2S5W9      VSVLDTSPEWAVAIADEIARQMI------LQSP-T-------------------------
A0A0M8KAF3      VAVEHPDPELAATIANEVVRVFS------AYMR-R-------------------------
A0A523V9H6      LSVEHNDAARAATIANALSDAFI------AYNA-G-------------------------
A0A3D1U3H5      LSVSSHDRVFAARAANALA-----------------------------------------
A0A2N2MEK3      LTVEDNDAGHAAAIANTLVGVLV------AQND-S-------------------------
A0A3B9J9U6      LTVEDNDAGRAAAIANTLVGVLV------AQND-S-------------------------
A0A661VSD8      IRVTDTNPKAAMMIANALAEELI------RQSP-G-------------------------
A0A497C1E5      IEVTDTNPEAAALIANALADELI------RRSP-A-------------------------
A0A1W9UQ51      IQVTDTNPEAAALIANALADELI------RRSP-A-------------------------
A0A497B563      IQVTDTNPEAAALIANALADELI------RRSP-A-------------------------
A0A3D0UNQ0      ISVDASSREEAISIADELAQQLI-------LISPT-------------------------
A0A2G6GG97      IQVEDTNKDRAALIANTLGQVFI--------FENQ-------------------------
A0A521TS25      VSVENRDPRLAADIANTVVRTFI--------AQVV-------------------------
A0A3M1H759      VTVQDTSPERAAVIADEIARQLI-------LQSPT-------------------------
A0A535D584      VCSSGASGTQQAAIVNAVMSVYA--------AQAT-------------------------
A0A5C7JS64      ISVSDPNPETAAILANAIAEQFQ--------TFAQ-------------------------
A0A535IMD1      IKFVDTNPQRAKLIADAIAQQVI--------AQSP-------------------------
A0A521UD91      VSVDDIDPLRAQETANTLAQTFI--------DQRH-------------------------
A0A3C0LJ76      ISVTDVDAQRAYAVATELINQLI--LLSPGGQERQ-------------------------
I0I8T2          INVTDVDPQRAYAVATELINQLI--LLSPGGQERQ-------------------------
A0A497ASN6      ISVESKDPQLAAKAANTLAETFI--------EERA-------------------------
A0A3D1TRD4      ITANTHDAKQAATIANLVANVFI-------------------------------------
A0A3C0XJG2      VSFRDRDPQRAAEIADLIANSFVEQVRALQS-SLQ-------------------------
A0A3M1ZZ81      ISVEDPNPELAAQIANTLGEVFI--------EQNR-------------------------
A0A497AF06      LTVEDTDAQRASNIANEIALTFI-------SLHNT-------------------------
A0A661W444      LTVEDTDAQRASNIANEIALTFI-------SLHNT-------------------------
A0A3D0D4X6      LTVEHTDPALAQAIANTIPQVFA-------N-RNA-------------------------
A0A1J4ZRV4      IQVEGPNPQLIVQIANTLPEVFI-------A-QNQ-------------------------
A0A1V5RXW5      ITVEGPNPWLIARVANTLPEVFI-------E-QNQ-------------------------
A0A522N7L9      ISADDPDPQRAAAVANALAQALL-------T-VSP-------------------------
A0A535W4H1      IVVRGRDAAETAAIANEVANQVI-------A-ASP-------------------------
A0A521IC37      VSATAGTPQRAQEIANEIARQVILQSPISQQQKAS-------------------------
A0A3A0B2P8      LSVVDTDPVRAQAVAAELVNQLL---QIGPGMQEG-------------------------
D1CAL1          IAVEDPDPRQAAQIANTLAQVFI---E-----ETH-------------------------
A0A497BNC7      VSAENNDPVLAQALADTIARVLI---E-----QET-------------------------
D1C8M3          LAVSDPSPARAAAIANTVAEVFI---E-----QTQ-------------------------
I4EI06          VAVSDPSPEQAATIANTIGQVFI---D-----QTR-------------------------
A0A2E5F6N9      ILAMNEDPALAASIANAVAQQFQ-------------------------------------
A0A2E6J6X7      IYVRDSDKVLVGEVANAISLNFI-------------------------------------
A0A3M1EAN8      LQVEDSNPQLAVAIANNIADTFV-------------------------------------
A0A535QK16      VAMRDTDPVRAKDTANTLVNDFI-------------------------------------
A0A1F8RRT9      LSVEHEDPDQARWLANATAQAFI-------------------------------------
A0A535FRM3      IYVESSNPVVATSIANDVAQNFA-------------------------------------
A0A401ZA55      ILVDSSNPQLAATLSKEVAQSFT-------------------------------------
A0A4P6JS79      ISVNNSDPRFAAQLANEVAASFA-------------------------------------
                                                                            

A0A535RWE5      -------------WTDLKTFRDLANSAWVRDTSIITVSFKHGNADFAARAANAIANAFIV
A0A0P6WSP2      DSLSSQSIAHGSKMVHLQSQIDLDRGDYQF--------LQQSYFVAQSQADQIAEKIQIV
A0A5C7JWY1      -----------AEEALIKQFSQDIEIMPIRGARLAHVTANAIEPELAAEIANTLVSVYIE
A0A1F8QGH2      DGISARMIEEETKLVRLQTFVAELRADLQT--------LQQNQEELQSTIDEAANSVMIV
A0A1Q7TTL6      RDAATALSE-------------ALDARMDVDGSFLRVELRGHDPKRTTAIVNALAQRYVQ
A0A0S8KFR9      RTELQTLVDSVARENA---RVDALKARIRSEEEVYASLLSQYEQARVAEAARENSVTIVA
A0A535SLQ0      PDAARALLQVLSRDAAISQLLTELRVRPRMRTDIVDVAYSAPDPSRAQQVVNRVVDVFRA
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      -------------------------------------LISSERYDLMEESLSAQKAQIES
A9B6E3          -------------------------------------AGPQSAEAKLLDEVNR-------
A0A3D0CW53      -------------------------------------TTPEKEQEQYRQFVNQ-------
A0A1F8SS27      -------------------------------------RSNTSNSIMVRQFIQQ-------
A0A2E0L5X9      -------------------------------------QTSDRATLLDLEFINS-------
A0A3A0AXU8      -------------------------------------ERQLSQQEARLAAQRSPEALARQ
A0A3D1JCW0      -------------------------------------NLQQSKYAASKENLKAQLDYLDQ
A0A2N2MJJ0      -------------------------------------AIQSERYTNSEQSLSTQIADVEG
A0A3M1LAM5      -------------------------------------A--SQEGVERDFVLK--------
A0A536BZ00      -------------------------------------TLQGRNPAIEQSIAS--------
E8N5M1          -------------------------------------EMQISRFKASKENLQNQLSYLEQ
A0A1F8U7F0      -------------------------------------ELQAVRYLTSEQNLQSQIDQVQS
A5V160          -------------------------------------ELQSERFAESKRSLMN-------
A0A2A6REI6      -------------------------------------ALQGERFVATRASLEQ-------
A0A426TTK3      -------------------------------------ALQGERFVATRASLEL-------
A7NIZ1          -------------------------------------ELQSERFAESKRSLAG-------
A0A0P6XM68      -------------------------------------RMQAERFNESERSLEAQIAQIDA
A0A2N2MEG3      -------------------------------------QMQFERFATSEQSLEAQIEQVDA
A0A353RQ31      -------------------------------------QLQAIRYISAEQNLQNRIDETQQ
A0A3B9KNR2      -------------------------------------QLQAIRYIAAEQNLQNRIDETQQ
A0A0P6XME1      -------------------------------------KIQSSRFSASEESLQAQIQQVEA
A0A3B9Q1T8      -------------------------------------RLQSLRFESTEANLQRRAEDALQ
A0A1F8PTW9      -------------------------------------SNAQPEEQGRQEFINQ-------
A0A1F8QH26      -------------------------------------TTEHTEDQVRQEFINE-------
A0A359HML3      -------------------------------------T--NQADVERQAFISQ-------
A0A3M1EJ46      -------------------------------------QGDSSGLTGYEEMLAK-------
A0A2U2S5W9      -------------------------------------APEEAQRAKHRAFVEQ-------
A0A0M8KAF3      -------------------------------------V-QTERFAESKANLQA-------
A0A523V9H6      -------------------------------------L-QEARYSGSLTSVEE-------
A0A3D1U3H5      -------------------------------------------YAAQQSEQQH-------
A0A2N2MEK3      -------------------------------------L-QSSRYLTSEEGLQA-------
A0A3B9J9U6      -------------------------------------L-QSSRYLTSEEGLQA-------
A0A661VSD8      -------------------------------------S-RQGQRQQQQEFIKQ-------
A0A497C1E5      -------------------------------------S--GGSDPEQQEFIRG-------
A0A1W9UQ51      -------------------------------------S--GGSDPEQQEFIRR-------
A0A497B563      -------------------------------------S--GGSDPEQQEFIRR-------
A0A3D0UNQ0      -------------------------------------SLQSPEDENARLFVQE-------
A0A2G6GG97      -------------------------------------KRESLRYADPINNWEE-------
A0A521TS25      -------------------------------------DEQLGQTTSTKQVLQQ-------
A0A3M1H759      -------------------------------------SPQNKARQERAGFVQA-------
A0A535D584      -------------------------------------AQSERDIDQAGAALQS-------
A0A5C7JS64      -------------------------------------ERTQELTGPYREALNV-------
A0A535IMD1      -------------------------------------TPSEKQQEEHRQFVDA-------
A0A521UD91      -------------------------------------EDQIGQLSASRGVLRQ-------
A0A3C0LJ76      -------------------------------------QREV--------FIQE-------
I0I8T2          -------------------------------------QREQ--------FVQE-------
A0A497ASN6      -------------------------------------QGQARRFGSLKTSIET-------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      -------------------------------------STTATQLDEEISSVEA-------
A0A3M1ZZ81      -------------------------------------ERESLRYAEPIQNWET-------
A0A497AF06      -------------------------------------EQQLQNIAVLEQDVVK-------
A0A661W444      -------------------------------------EQQLQNIAVLEQDVVK-------
A0A3D0D4X6      -------------------------------------EQQSERFAASKESLQR-------
A0A1J4ZRV4      -------------------------------------ELQMGRVSESKASLER-------
A0A1V5RXW5      -------------------------------------ELLLGRLSQSRANLEQ-------
A0A522N7L9      -------------------------------------AIQ-GTGSASEQFIQA-------
A0A535W4H1      -------------------------------------TVS-GQQVDFAKAIDE-------
A0A521IC37      -------------------------------------DDQRAFITEQQALMQS-------
A0A3A0B2P8      -------------------------------------SEYQAFIADQLDQMEK-------
D1CAL1          -------------------------------------AQEDAATWSGRDELRR-------
A0A497BNC7      -------------------------------------SQQQARFQTGLSELET-------
D1C8M3          -------------------------------------QRQAEIAGPGADQVQQ-------
I4EI06          -------------------------------------DQNVAATGTSREALQK-------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      QSRSLQSS----------------------------------------------------
A0A0P6WSP2      EDAVVKEAAGSRGFSAYLTLLVDPSLIIGQGTYSTVTNSARVASAYGEIWTG--------
A0A5C7JWY1      RNQELSANSKELAAQWFTTHLEELRQKVQNSQQALYLFRAK-------------------
A0A1F8QGH2      EDAQVLTQEDSFFYEATVTLLVDQVHERSGDNYAAILANERLAQTYGEILAG--------
A0A1Q7TTL6      VYADLKRQKLVELTKILGEQLQHSQDNLRSAEADLQRFREQTITLPSDRPPTVGSGSVAG
A0A0S8KFR9      PAVKPAARDGPQVSYLATATVRVTQPYSAFPGYAEYGYVERLMNTYVELLKT--------
A0A535SLQ0      ASAEAAQRQSRLRREFLDAQLKVNDSVVADAQQALTAFRRRAHS-------D--------
A0A363SX22      --------------------------------KYVEEL----------------------
A0A326UPN3      -------------------------------QYQNTQL----------------------
A0A455STY5      -------------------------------QYQNTQL----------------------
A0A3A4VPK9      QIADLQNQINHASIKTIEEQEQWIQEQINVLQQESETL----------------------
A9B6E3          -------------------QIATLNEEITRTDEEIKTL----------------------
A0A3D0CW53      -------------------QLLTLQTRIEDAQKQVDEL----------------------
A0A1F8SS27      -------------------QLGNLQARIENGQSRLAEI----------------------
A0A2E0L5X9      -------------------QIEDMQNQINNLQSQYNQL----------------------
A0A3A0AXU8      KQMNDLIAVLQDELNYYDDQIRTLDNEIRNLEQGPQSV----------------------
A0A3D1JCW0      QIVENQNALDAIIQN----NLKQLQSSGENVEAQPTAA----------------------
A0A2N2MJJ0      QIADLQEKITVRSAEVLEEQKTNFESQISDTRAQIAEL----------------------
A0A3M1LAM5      -------------------ELNDTQAKIEEAQAQIDQL----------------------
A0A536BZ00      -------------------NLTALQQVIEDTQTRITAL----------------------
E8N5M1          QIQENSSALEKILQENIS-EVKRTNPDAANGTLSNATI----------------------
A0A1F8U7F0      QITTMQTQINDISEATVQDQLTQVKAQIEPLQTQVTTL----------------------
A5V160          -------------------EIAKLQADIDATQAEIAVL----------------------
A0A2A6REI6      -------------------ELEKLQLEIDTTQAQLNEA----------------------
A0A426TTK3      -------------------ELEKLQSEIDATQAQLDQA----------------------
A7NIZ1          -------------------EIAKLQSDIDTTQAELAAL----------------------
A0A0P6XM68      QIEALQSRSTAATTEQSEQQIEKAKSELDRLQTEILAI----------------------
A0A2N2MEG3      QIETLKTRSEAVSSAEAQEAIAKTQTEIERLQGEILAL----------------------
A0A353RQ31      QISLLEKQINELSTATVESQLESVQKQILETQSQMTAL----------------------
A0A3B9KNR2      QISLLEKQINELSTATVESQLESVQKQILETQSQMTAL----------------------
A0A0P6XME1      QIADLQRQLAQTSEQSNEKRIQDVTNIISGLQSEINQL----------------------
A0A3B9Q1T8      QMEELQNRIDQVTEKNVQEQLITVQSEIETLQSQVTDL----------------------
A0A1F8PTW9      -------------------RLNILEVQINETEDEIKKL----------------------
A0A1F8QH26      -------------------RLSVLETQINDTEEEIKQL----------------------
A0A359HML3      -------------------QLDTLQKQITDTQAELEDL----------------------
A0A3M1EJ46      -------------------QIAEVERDIQALEAERAQI----------------------
A0A2U2S5W9      -------------------QIADLQAKIEAAQQQVAEL----------------------
A0A0M8KAF3      -------------------QMERVQAEIEQLQQQLDAL----------------------
A0A523V9H6      -------------------QIGQVSALIEQTEEAIDDL----------------------
A0A3D1U3H5      -------------------QMSRFSAAIDAIDRQISSY----------------------
A0A2N2MEK3      -------------------QVEQVGAQIDQLQEQINRLTMENVEEQIGQAETKIAELQSE
A0A3B9J9U6      -------------------QVGQVGGQIDQLQEQINRLTMENVEEQIVQAEAKIAQLQSE
A0A661VSD8      -------------------QLDELEEKIEKKKAEIADL----------------------
A0A497C1E5      -------------------QLEELQIKIKDISGQISEL----------------------
A0A1W9UQ51      -------------------QLEELEAKVGNVGGQIEEL----------------------
A0A497B563      -------------------QLEELEAKVGNVGGQIEEL----------------------
A0A3D0UNQ0      -------------------RLQDLQKKIEASQARLDEL----------------------
A0A2G6GG97      -------------------RLQEIGDQIETIETEINTL----------------------
A0A521TS25      -------------------QIAEMERQIRGATDGMERE----------------------
A0A3M1H759      -------------------QLDDLERRIQDAQAEVKKL----------------------
A0A535D584      -------------------EIQKVEASLLQENQQLAAL----------------------
A0A5C7JS64      -------------------QIAETQANIRTTQQMIDDL----------------------
A0A535IMD1      -------------------QLKDLQDRIDQAKADIGEL----------------------
A0A521UD91      -------------------QIADLEKQLKDTSQALEAA----------------------
A0A3C0LJ76      -------------------QLRKLEQGMRDTEAEIVRK----------------------
I0I8T2          -------------------QLRKLEQSMRSTEEEISRR----------------------
A0A497ASN6      -------------------QLANIDEEIAKLDKQRGKA----------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      -------------------DRQRIDDELSRLRAALAAL----------------------
A0A3M1ZZ81      -------------------RLDEIGNEIQAIETEINAL----------------------
A0A497AF06      -------------------QMANLKEAIEYNQSAMDQS----------------------
A0A661W444      -------------------QMANLKEAIEYNQSAMDQS----------------------
A0A3D0D4X6      -------------------QLDTLAGDIEDAQGRLTRE----------------------
A0A1J4ZRV4      -------------------EITSVEADITRTQDALNAV----------------------
A0A1V5RXW5      -------------------EIANTEADIARTTDELSRA----------------------
A0A522N7L9      -------------------QLQATQSQIQQLQGQISAL----------------------
A0A535W4H1      -------------------DLQATRTEIESASMEAARL----------------------
A0A521IC37      -------------------QIVVGQKQLTELSQQAALE----------------------
A0A3A0B2P8      -------------------GITETTAEIERVKTELTGM----------------------
D1CAL1          -------------------QIEEVQQRIEDTSSRIAEL----------------------
A0A497BNC7      -------------------QIKTLETSIAETQAEIAAL----------------------
D1C8M3          -------------------NIEAIQRQIDEANARIAEL----------------------
I4EI06          -------------------EIDAAKQQIDDLTTQVANL----------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------AQHEKRRD----------------------
A0A535QK16      ----------------------AKIKDIQRTEAKAPTA----------------------
A0A1F8RRT9      ------------------------------DSNEQDGL----------------------
A0A535FRM3      ------------------------------QYS-RNGL----------------------
A0A401ZA55      ------------------------------SYA-TSHL----------------------
A0A4P6JS79      ------------------------------QYT-NTSM----------------------
                                                                            

A0A535RWE5      ------------------------------------------------------------
A0A0P6WSP2      ------ESYMQAVIDELGLDRDADDLANDVYFEPIPSTQLVRLRVDDPSAAQAKTLVEVI
A0A5C7JWY1      ------HGLLTGEERKSVAAHTLAELNSQLVKTEMAKAEAQSRFQQIRSVLNPQGAGTAG
A0A1F8QGH2      ------RKVMEAAISRIKSDESPDDLMNKVKVETVSGTQLIRLSVEDTNANQAKLLADAI
A0A1Q7TTL6      AAGGGGAAGAPDGARDPVFGGFFEMQITR--EEARRDRDALERVLAQYGDSGLSAEALAV
A0A0S8KFR9      ------QPILEEVLQKLDLPELPSALLQQIVIEVLPDTELLRITVEDRSPERARDIANAL
A0A535SLQ0      ------GSAQSSGREQTELPGL-ELQRQQLLAERRTDEDLLAALQESSTSRKAVQTALST
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      -------------------------PVEISQMG--------------------NPATPEE
A9B6E3          -------------------------KAEIEQIG---------------------------
A0A3D0CW53      -------------------------EKQLALES---------------------------
A0A1F8SS27      -------------------------EVEMVQVK---------------------------
A0A2E0L5X9      -------------------------VQEAATIT---------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      -------------------------LLERARML---------------------------
A0A2N2MJJ0      -------------------------ESEIASLP------------------------AES
A0A3M1LAM5      -------------------------RDKMLGMT---------------------------
A0A536BZ00      -------------------------------LN---------------------------
E8N5M1          -------------------------ENLARQIN---------------------------
A0A1F8U7F0      -------------------------ETEIADLQ------------------KNRYPTEEE
A5V160          -------------------------RGIDDPTR---------------------------
A0A2A6REI6      -------------------------TGAANAAE---------------------------
A0A426TTK3      -------------------------TGAANAIE---------------------------
A7NIZ1          -------------------------RGIDDPVR---------------------------
A0A0P6XM68      -------------------------RTALDTLR---------SPKAEAGWYSTPTPSPEI
A0A2N2MEG3      -------------------------QNELDLVK---------SPGRLPNSLSTPTPSPET
A0A353RQ31      -------------------------NVEVAKIN-------------------PATATEEE
A0A3B9KNR2      -------------------------NAEVAKIN-------------------PATATAEE
A0A0P6XME1      -------------------------QADIVRIEAERDPILGVNSLGQPARVTPTLTVDQQ
A0A3B9Q1T8      -------------------------ELNIASID-------------------PLYATDEE
A0A1F8PTW9      -------------------------QEDLGNMI---------------------------
A0A1F8QH26      -------------------------QEELGSII---------------------------
A0A359HML3      -------------------------SQLLGELN---------------------------
A0A3M1EJ46      NRGGSNSRSLPTAQNADTDTSSLEASAKDGRQQ---------------------------
A0A2U2S5W9      -------------------------EKQLGGAF---------------------------
A0A0M8KAF3      -------------------------G----------------------------------
A0A523V9H6      -------------------------D----------------------------------
A0A3D1U3H5      ----------------QKDMASATKKQAQAGGA---------------------------
A0A2N2MEK3      IASLENDIFYTTNRGRNPDLAPTEWTARLAQLK---------------------------
A0A3B9J9U6      IASLENDIYYTTNRGRTPDLAPTEWTARLAQLK---------------------------
A0A661VSD8      -------------------------NDSLADLT---------------------------
A0A497C1E5      -------------------------TASLSELT---------------------------
A0A1W9UQ51      -------------------------TASLSELT---------------------------
A0A497B563      -------------------------TASLSELT---------------------------
A0A3D0UNQ0      -------------------------ASAMDVAP---------------------------
A0A2G6GG97      -------------------------NAQGKE-----------------------------
A0A521TS25      -------------------------RRA--------------------------------
A0A3M1H759      -------------------------EAELETAF---------------------------
A0A535D584      -------------------------Q----------------------------------
A0A5C7JS64      -------------------------VKTKDV-----------------------------
A0A535IMD1      -------------------------EKSIVNEV---------------------------
A0A521UD91      -------------------------KAAFYP-----------------------------
A0A3C0LJ76      -------------------------RDELSSLL---------------------------
I0I8T2          -------------------------QTELSAAL---------------------------
A0A497ASN6      -------------------------Q----------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      -------------------------PAFPQG-----------------------------
A0A3M1ZZ81      -------------------------G---TP-----------------------------
A0A497AF06      -------------------------R---IS-----------------------------
A0A661W444      -------------------------R---IS-----------------------------
A0A3D0D4X6      -------------------------R----A-----------------------------
A0A1J4ZRV4      -------------------------T----------------------------------
A0A1V5RXW5      -------------------------T----------------------------------
A0A522N7L9      -------------------------T-AVAD-----------------------------
A0A535W4H1      -------------------------Q-AITS-----------------------------
A0A521IC37      -------------------------TDQAKL-----------------------------
A0A3A0B2P8      -------------------------FSARQI-----------------------------
D1CAL1          -------------------------Q-QSGA-----------------------------
A0A497BNC7      -------------------------GAPESA-----------------------------
D1C8M3          -------------------------QAQPNA-----------------------------
I4EI06          -------------------------RGRPDA-----------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      ------------LQGTAVQQ---------------------------------------L
A0A0P6WSP2      GRNIVQTTQTQ-LARPYTDR------------------------------------MQAL
A0A5C7JWY1      LGWSKLDSQIQVLNSPLIQT---LRAQEITVSAQVAELSEKYGPLHPKLAHMKAELQDLR
A0A1F8QGH2      AGAFLDEIQVL-LTEPYVTR------------------------------------LEAL
A0A1Q7TTL6      VG------SVQ-LNGELSQALKELTDKQAQLRAYRYKYSDEYPPVQRLIGDIATLQRQTI
A0A0S8KFR9      AGL-----LVE-QGQTLYSG--------D-----------------------TKSAREIL
A0A535SLQ0      PGVAPSPAVVQ-LNTQLFQY--------EMARDSLASLSTSHPDLPRLNVLISATEGKLL
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      RDALEQKKARLEQVELLLPL----------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      TSLAAEKRSQVEQLQSLLRS----------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      NAQLAEKEATLAQVKPILTL----------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      RAEINQKELELKELETTYDL----------------------------------------
A0A2N2MEG3      RSQINEGTLRLRQLQSTYDL----------------------------------------
A0A353RQ31      KARLAEYQAQLDQLSSVLSL----------------------------------------
A0A3B9KNR2      LTRLAEYQAQLDQLSSVLSL----------------------------------------
A0A0P6XME1      IEL-TQKRSRLDELRSLLSI----------------------------------------
A0A3B9Q1T8      LQQRIQFQAELGQTQSILDL----------------------------------------
A0A1F8PTW9      -------------------S----------------------------------------
A0A1F8QH26      -------------------S----------------------------------------
A0A359HML3      -------------------S----------------------------------------
A0A3M1EJ46      -------------------A----------------------------------------
A0A2U2S5W9      -------------------S----------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A3D1U3H5      -------------------G----------------------------------------
A0A2N2MEK3      -------------------S----------------------------------------
A0A3B9J9U6      -------------------S----------------------------------------
A0A661VSD8      -------------------S----------------------------------------
A0A497C1E5      -------------------S----------------------------------------
A0A1W9UQ51      -------------------S----------------------------------------
A0A497B563      -------------------S----------------------------------------
A0A3D0UNQ0      -------------------T----------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A3M1H759      -------------------S----------------------------------------
A0A535D584      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A535IMD1      -------------------S----------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A3C0LJ76      -------------------S----------------------------------------
I0I8T2          -------------------S----------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      DEQIKQLQDDIK----------GLDVQIAATAQQAQKV------------QLDSQRQTKQ
A0A0P6WSP2      QKQMDELSAQIE----------SAQAEIMTISAQKAQIEADLIKEESAKTKLSQD-----
A0A5C7JWY1      QRTQQEVQKIYDSVKHQYDMAVAQDKAVKEAITRYNTDKIRLEQNEIEHSMLERDADTSQ
A0A1F8QGH2      QTHIDDLYEGIE----------ATQAEIESLSAEKIRAETELA-------RLESRLVEDR
A0A1Q7TTL6      PRLARVLAGQLA----------AKETELGRRVDADARALRQIPARAIEEARLRRDANLAE
A0A0S8KFR9      QQRLSAVEGNLE----------QDREALQDLLDSSARENARID-------ALEMRIRSEE
A0A535SLQ0      RAVQAGIQGAIA----------SLDGRIAAINDLRARRAGNLQ-RDAEEARLTERVDNAR
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      ----------------------YEQSYTDLIVYGKQVDGAN-TSAGSQLTLLNTTQSLYQ
A9B6E3          ------------------------------------ADKPAAESLIANLQLKQQSQNQNR
A0A3D0CW53      -------------------------------------SARAIQDIQGQIGALQQTITTWQ
A0A1F8SS27      -------------------------------------SAEQLSELQRELNTLASLITSWE
A0A2E0L5X9      -------------------------------------SAFELNQNIEDRGEIEKSIQELR
A0A3A0AXU8      -------------------------------------------ETTQRTLELRDRILQYR
A0A3D1JCW0      --------------------------------------------NAAEIDRLETRISQYR
A0A2N2MJJ0      ----------------------YESAYNTLMV-----QKKILAADDEELTQLEKTFNLYQ
A0A3M1LAM5      -------------------------------------SAVELSEAQARLAELEQLKSNYR
A0A536BZ00      -------------------------------------NTSRTNAEDQELADLQSRLVTLR
E8N5M1          ---------------------------------------------QAEIDRLETRLAQYR
A0A1F8U7F0      ----------------------YQQLYTNLVVLGQPVDTGTNTSTRLQ--QLQTTLSLYQ
A5V160          ------------------------------------------------RARLEEALVQYR
A0A2A6REI6      ------------------------------------------------RSRLQELLAMYR
A0A426TTK3      ------------------------------------------------RSRLQELLAMYR
A7NIZ1          ------------------------------------------------RARLEEALVQYR
A0A0P6XM68      ----------------------YQQIYTNLVVLGESRNENSANVEQE---QMQSTLALYR
A0A2N2MEG3      ----------------------YQQIYTNLVVLGQNRAVGEADTEQE---QMQSTLALYR
A0A353RQ31      ----------------------YQQIYTNLVVLKTPAESGTTTATSAQLTQLQTTLNLYQ
A0A3B9KNR2      ----------------------YQQIYTNLVVLKTPAESGTTTATSAQLTQLQTTLNLYQ
A0A0P6XME1      ----------------------YQQIYVNLTF--SPSNQGNSNSTNS---QLQAALVLYQ
A0A3B9Q1T8      ----------------------YQELYTQLVVLGKPIDQENPSSRQSD--RLERTLSLYE
A0A1F8PTW9      ----------------------AQQI----------------DETQIQISSLQSKLSTMQ
A0A1F8QH26      ----------------------AQQI----------------EEVRSQISSLQSKLSDMQ
A0A359HML3      ----------------------AREI----------------SDTQNQISSLKNSLASLQ
A0A3M1EJ46      ----------------------LAEE----------------SARLAEVASLDAALQEAR
A0A2U2S5W9      ----------------------ARQI----------------QDLQGQINVLQNQINTWQ
A0A0M8KAF3      ----------------------TPET----------------EAEQTRQQQLQTLLTQQQ
A0A523V9H6      ----------------------APET----------------TEGLAELARLQTILAGYR
A0A3D1U3H5      ----------------------NAQT----------------QDLTREIDQDRTAINNLQ
A0A2N2MEK3      ----------------------TLELYQQIYANLLVLGKPTSSGASDRLTHLQKTLELYQ
A0A3B9J9U6      ----------------------TLELYQQIYANLLVLGKPTSSGASDRLTHLQKTLELYQ
A0A661VSD8      ----------------------AAEI----------------ADTMARIDALEQVASTYR
A0A497C1E5      ----------------------AAEI----------------QDVQDRIAALEDVKSTYQ
A0A1W9UQ51      ----------------------AAEI----------------QDVQDRIAALEEVKSTYQ
A0A497B563      ----------------------AAEI----------------QDVQDRIAALEEVKSTYQ
A0A3D0UNQ0      ----------------------PEEK----------------SQIQAEMNDLEGILVEWE
A0A2G6GG97      ------------------------IT----------------PEESATLSRLETNLNEAQ
A0A521TS25      ------------------------GG----------------EQSASRIAVLQSDLGQFQ
A0A3M1H759      ----------------------ARQI----------------RDLQSDIASWQSLINEWQ
A0A535D584      -------------------------------------------RGHQDTMALAGQIQADT
A0A5C7JS64      ------------------------TS----------------PEVAAQIETLRTQLADYQ
A0A535IMD1      ----------------------ARRI----------------QDVQSQIAAKQSQINQWQ
A0A521UD91      --------------------------------------------NTAEITRLQNVLSTAQ
A0A3C0LJ76      ----------------------ARQI----------------GQTETQISALEAKLTTLR
I0I8T2          ----------------------ARQI----------------RQLEDQIAALEAKMASLQ
A0A497ASN6      --------------------------------------------TQEDVKVIEQQLVNLR
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      ------------------------PP----------------ADLRSQISQLESTGTARQ
A0A3M1ZZ81      ------------------------ET----------------PEEEAELSRKDTKLKELQ
A0A497AF06      ------------------------SG----------------MLTEEETNLIQTTLSNQQ
A0A661W444      ------------------------SG----------------MLTEEETNLIQTTLSNQQ
A0A3D0D4X6      ------------------------AN----------------PRNEDEIDRLESRVTQLR
A0A1J4ZRV4      --------------------------------------------DDNQRMRLETSLAQYR
A0A1V5RXW5      --------------------------------------------DDAQKTRLETSLAQYR
A0A522N7L9      ------------------------RT----------------PSQDQELQALNGQLGTAR
A0A535W4H1      ------------------------PT----------------PRDQADLFALQDRLASLR
A0A521IC37      ------------------------DN------------------LNTRISALQTKIENWQ
A0A3A0B2P8      ------------------------QD------------------ARSQITALEAKLATLQ
D1CAL1          ------------------------SG----------------TAVQTELRTLQTQLSQDQ
A0A497BNC7      ------------------------PS----------------EFAQLERTRLESQMTRDQ
D1C8M3          ------------------------GD----------------PAVQEEIRNLQAQLAQFT
I4EI06          ------------------------ST----------------AAVQAQIADLEARLGQQQ
A0A2E5F6N9      -----------------------------------------SQTREKHLADIAEFMGVAQ
A0A2E6J6X7      -----------------------------------------DYVIERRLTEIARLQAAAS
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      QTLAQLLMTRDDIS------LAAA-RAQNTVSLWEAAV--APAEPDSPHVGLNTALGAIV
A0A0P6WSP2      --YQVLYDQMEQLR------KNAN-QASNSVMVVAQPS--IPDRPTQDRLLY-VLLAALL
A0A5C7JWY1      HLYDVFLKATKETD------LSSG-VRANNVYLADPAA--PSSMPSKPRTKLNIMLGLLA
A0A1F8QGH2      NDYRALKQDYEQLQ------LTAN-DASQAVSIVEPAQ--LPESPEEDRVLY-IGLAALT
A0A1Q7TTL6      NLYTTLQQKYDEAR------LAEA-SSLADVRVLDYAV--VPRRPVKNTRRRVVLLAFFG
A0A0S8KFR9      EVYLSLLRQYEEVR------VAEA-SRESSASIVAQAG--QPDAPSKPRVKFNLALGTLV
A0A535SLQ0      KVTDELRTEYQKAG------IAQA-VTVGQVEIVDHAT--LPTKPAGIGLPEQLVLGLLV
A0A363SX22      -------------------------YGVYDLKILDLAE--IPVFPIKPNWKLNLALAAVL
A0A326UPN3      -------------------------GGVSQLRVV-PAI--EPTRPSKPQPTQDAIVGALV
A0A455STY5      -------------------------GGVSQLRVV-PAI--EPTRPSKPQPTQDAIVGALV
A0A3A4VPK9      QIYVSVLNNLESVR------LAKL-QNMPNVVQIQPAI--VPDDPVRPRTMLNSVLGGII
A9B6E3          QTLSTLYSTALG-------------NRANSISVVEAAT--VNPTPIAPRPIRSAILAGIL
A0A3D0CW53      ATYASLLD------------FSKG-SRTNYLSVVEPAV--VPTTPISPNIQRNVSLATAI
A0A1F8SS27      NTYTQYLG------------FLQAKESPGTLTIIESAQ--VSPKPINPQVQLIAFLATGL
A0A2E0L5X9      TLLLSLIEN----------------APRSEIQVFEPAD--PNYFPLTANSVRDLLIAGVA
A0A3A0AXU8      TERIGVLTSLAETQNALSSAFEEPSSDVDTIVVVDPAL--LPVVARQRDFLQPMVAALVA
A0A3D1JCW0      QLYASILSSYEQIR------LAEA-QTTTSFIQVEPAT--PPEKPIRPRTLLNTALAAVV
A0A2N2MJJ0      QIYLNLLNNREALR------LARL-QNTLTVAKIDAAQ--VNPAPIRPRTTLNTLLGGLA
A0A3M1LAM5      ADYVRLAN------------LLNT-QSPNTLTIMEPAS--PSRRPIAPNPKKSAAIAAVA
A0A536BZ00      QTYVTLLG------------ISTG-SAANFLTVVEPAR--APTDPASPRLPINTGIGALM
E8N5M1          QIYASVLASYEQIR------LAEA-QNITSIIQVEPAT--PPDKPVRPQTLRNTAIAALV
A0A1F8U7F0      GIYVNLLNSLENVR------FARV-QNTPNVVQVEPAV--ASTSPISPRPFQSTALAAAV
A5V160          SSYATVLRSLEEVR------LAEA-QLTNSVNVVETAV--PVTTPVRPRIVTNTAMAAVA
A0A2A6REI6      TSYASLLKSIEEVR------MAEV-QQTNSVHTVEAAA--VPEYPVRPRIVQNTALAALV
A0A426TTK3      TSYASLLKSIEEVR------MAEV-QQTNSVHTVERAV--VPDVPVRPRVMQNTALAALV
A7NIZ1          SSYATVLRSLEEVR------LAEA-QLTNSVNVVESAA--PVYTPVRPQIATNTGMAAVA
A0A0P6XM68      QIHANLLSSYENIR------LARL-SSTSNIVSIEPAI--PPEEPLSPKPVRTGLLGGTV
A0A2N2MEG3      QIRANLLSSYESIR------LARL-SSTSNIVAIDLAQ--VPSSPIRPQPLSTAGLGAAV
A0A353RQ31      QIYLSSINSLEALR------LSRA-QNTPNVVQVEEAQ--IPSVPISPKPGQTALLAGAV
A0A3B9KNR2      QIYLSSINSLEALR------LSRA-QNTPNVVQVEKAH--PPSVPISPNPVQSATLSAAI
A0A0P6XME1      QIYANLLSNYEAIR------LARL-QSTPEVVQVEEAR--VPSRPVRPQTTTNVLLGGIL
A0A3B9Q1T8      QIYFSTLNSLEALN------LARD-QNKPTVAQIEAAA--VPVEPFFPRPIETGLLYGAV
A0A1F8PTW9      DNYGTLLSNTQQ-------------GAINSLTLIEPAA--LPSSPIGPKIGLTALLAAAL
A0A1F8QH26      NTYATLLSNTNQ-------------GAINSFTVVEPAA--LPVKPIGPWLGLSVLLASLA
A0A359HML3      LNYANLLSNTEK-------------GAINTLTIIEQPH--VPTSPVGSKMLVTVGLSAAV
A0A3M1EJ46      GSYARLLESYLQVK------SAT--GGSVVISIVEPAA--MPARKVKPRVYFNTFVAGVV
A0A2U2S5W9      ANYAQLLN------------FIEG-GSPNYLAVIEPAQ--LPTEPVSPRTSMNVLLAASI
A0A0M8KAF3      AAYTTLLRSYEEVR------LAEA-QAVDSIVVIDPAT--PPERPVRPRVLLNTLLGGVL
A0A523V9H6      NTYATLLQGYEEMR------LTAA-QSTDNVIVAEAAE--VPDEPVRPRVLMNTALAGVV
A0A3D1U3H5      TQLVTLQSTEAQ-------------TSANLDVRVPAQVPHFPSSPHPVRSAAI---AAFL
A0A2N2MEK3      QIYLQLLGSLEEVR------LARLQNTPSIVQIEEAAVPGSPVRPLPFKTAML---GAAV
A0A3B9J9U6      QIYLQLLGSLEEVR------LARLQNTPSIVQIEEAAVPGSPVRPLPFQTAML---GAAV
A0A661VSD8      TQYAALLQSYMG-------------DSVNVLSIVEPAV--EPRRPIGGKAKLIVAMSAGA
A0A497C1E5      TTYANLLTSYSA-------------ESPNVLSFFEPAV--APQWPVPSKTKLVVAVAGAA
A0A1W9UQ51      STYADLFNSYRA-------------ESPNALALFEPAV--TPQWPIPSKAKLIVAVAGAA
A0A497B563      STYADLFNSYRA-------------ESPNALALFEPAV--TPQWPIPSKAKLIVAVAGAA
A0A3D0UNQ0      NTYARFLQF-----------IGGE-ESANYIAVVDKAH--ARLNPVRPTIRLNTLVAGLV
A0A2G6GG97      IRYTETFNNLNDLQ------IKQA-KETSNLIQIEEAK--PHEIPIRPRTETNVLLAAAV
A0A521TS25      ATFAQLLRSQQEMT------LSET-RAMNAVRLAEAAI--EPALPVRPQVGLNTIVAAIV
A0A3M1H759      RTYTNLLDF-----------LQGG-DSPNYLSVVEPAV--VPDTPISPNIPQNVMLAAAT
A0A535D584      ATLTQLSANYSAFR------AQQG-VDVAHVSVAAAAV--APAAPISRNLYTDAGIGAVA
A0A5C7JS64      STYRELLISANRMD------LQEA-GAQTGVVVVQEAS--PPGAPYAPNVRLYTLLALMA
A0A535IMD1      ATYAQLLTFYK--------------GGTNVLSVIEPAS--VPVAPIAPRTDLNVMIAAAI
A0A521UD91      VTYSQLIKDDSQMR------LEEA-RTLNAVRLAEPAQ--TPLQPISPKVLQNTLLAAVV
A0A3C0LJ76      STYVGLLASTDQ-------------GSINTINVLDPPV--VPTEPVNDRWYLLVLVAAII
I0I8T2          STYVNLLANTDQ-------------GSTNTINILDPPA--VPTQPVPNRWWLLVAVAALI
A0A497ASN6      DMRTRLLTSLYDIQ------LAEA-QHTELITQLEKAD--VPDKPVRPRKLMNALIAGVL
A0A3D1TRD4      --------TQQHDR------MAKG-DASNAVSVVAPAQ--VPASPVSPRVKLDTVLGMVV
A0A3C0XJG2      DTLAQLMRTRDDLR------LVAA-RAENTVTVWEPAV--APTDPESPRVALNTILGAIA
A0A3M1ZZ81      IQYTEAFNNLNQLR------VSQA-KESSNIVPIEPAQ--PPQRPIRPRTFTNTIMATII
A0A497AF06      LAYASLLETYLNIR------LTQS-QLLD-VTVVEPAV--APTEPIRPNIVIYTFLGTFV
A0A661W444      LAYASLLETYLNIR------LTQS-QLLD-VTVVEPAV--APTEPIRPNIVIYTFLGTFV
A0A3D0D4X6      NTQSSLVQSFEQVR------LAEA-TSLNSIIVDEPAA--LPTKPVRPRPLTNTLLAAVV
A0A1J4ZRV4      STYSSLLSSYQQIR------LAEA-QATDNVAIAKPAR--VPELPIRPRTMTNTLLAAVV
A0A1V5RXW5      STYSTLVANYQQAR------LAEA-QTLDSIVLSEPAI--APERPVRPRTLTNTALAAVV
A0A522N7L9      STYATLLS------------ASSN-NAANLLSIIQPAV--APVDPASPRPLLNTLLALIV
A0A535W4H1      STYASLLG------------FQST-TASNLLTLIEPAV--APTSPSAPSRFLLTILAGIL
A0A521IC37      RTYLSMGTLLNQ-------------STGKYLTVIAPAP--LPAAPVSPNILQNVLLAAAV
A0A3A0B2P8      ANFANLLANSRQ-------------GAINTIHVLEPAN--LPTTPMSRGLKTNVAVAAAL
D1CAL1          ALYASLLEAQQRME------LAAA-QSATQIRVVEQAV--PPTKFVKPRILVNTALAGAL
A0A497BNC7      TRLVVLLSSAEEFR------LAMA-RYTDTITIYAPAE--LPSAPVNSRTLQNTLLGAVT
D1C8M3          ETHSALIEAQQRIL------ASAA-ASGPRIRVTADAI--PPDAPIRPRTTLNTALGGVL
I4EI06          SSYDGLRATQQQID------LANA-QANSQIRVAEPAV--APTKFVKPRIVVNTALSGVL
A0A2E5F6N9      SQGIRIQDDL----------LVSQMSSLSSVSIVEPAI--VPTAPIYPRVRFTVLVATFL
A0A2E6J6X7      AQGLSDVQSL----------VNAQFTALDSLYLLEPVS--TPTTPISPDVQQNITFGIMI
A0A3M1EAN8      -------------------------DLAVYIEVVEPAS--MPAYKLRPRPYFNTFVGALS
A0A535QK16      -------------------------SSADNLVIWTPAI--VPVDPVSPKPLLNIGLGILA
A0A1F8RRT9      -------------------------TRPGTVSIVEPAS--TPASPVRPRTTLNSIIGALA
A0A535FRM3      -------------------------NGMAQIQILPAL---EPTTPLRPRPLQDASIGSLV
A0A401ZA55      -------------------------ASQANFNTIDPV---VPTDPVRPRPSQDSLIGALI
A0A4P6JS79      -------------------------GGQVQPIIVQAL---PPTDPSQPKPSLDAGIGALV
                                                                            

A0A535RWE5      AGLLVILAIGMLGYVEDRIT-DFDA-MHEKL-GITPLAEVY--R-----AGPSETAA---
A0A0P6WSP2      GGTVGIGAAFVLDQLDETVR-IRQD-VTSKM-GLNLLGCID----------AQKNGD---
A0A5C7JWY1      GLMSGVGLAIFVEGRSKKLM-APAD-VERYLPNVSLLGVVPRL--------SKAVAQ---
A0A1F8QGH2      CAVVAIGIAFLWEYLDDTIR-TPDD-ISDLT-GTSTLAII----------GQLPQGE---
A0A1Q7TTL6      SFAMAVVGAVLIDRVDPRVR-YPDQ-VSREM-GLTILGAVPHIR-----AGARPERS---
A0A0S8KFR9      GAVGGIALAFLFEYLDPTLH-STDD-LEAAA-GASVMGVIP--G-----FAPHAVSR---
A0A535SLQ0      GLMLGTGGAFVAERVGSSIA-RRVE-VE-HL-GLSVLGIVP--R-----CGRETDQK---
A0A363SX22      SLAVGMGISFLVEYMDDTLR-EPDE-ISQLF-QAPLIGFIPVMS-----KAAAHS-----
A0A326UPN3      GFGLAIALIVVFEWLDDRVP-NPEE-MQKLL-EADALTIIPELS-----KNQQGKNA---
A0A455STY5      GFGLAIALIVVFEWLDDRVP-NPEE-MQKLL-EADALTIIPELS-----KNQQGKNA---
A0A3A4VPK9      ALILSAGFLILKENLDTTMK-TSAQ-VEELL-KLNVIGYIAEMQ-----NSNGETIG---
A9B6E3          GFALVFGLALLIEYFDDSVQ-TPDE-GVDLV-NAPLLAAIVKQE-----TKVTKASQ---
A0A3D0CW53      AFVLAAMAALLLEYLDDTLK-SDED-VDRIL-KLPTLGATTRIP-----KIQQPSDH---
A0A1F8SS27      GFLLALGFIFLLGHFDDTLK-TAEE-ITQVS-GLPVLGMIRKLS-----RFKNTSDS---
A0A2E0L5X9      GGVLALLTIVLFTYFDDRLQWDEESSAETIL-GMRILGPL----------------GIIP
A0A3A0AXU8      ALALGFGLAWLLEYLDYTVK-TPEE-LDELF-GMPTQGAI---------AGVGGGNG-DQ
A0A3D1JCW0      GLMLAIGGVFAIDFLDDTLH-DPES-ITTLS-GLPILASI---------SEHEV------
A0A2N2MJJ0      GLILAVSIIFLRDFLDDTIK-SRED-VKRMF-GLTTLGQI---------PEHGA------
A0A3M1LAM5      GLILAVGAVILLEFFDDTIY-WYGE-QESIV-GARLLGTI---------GRFPA--KSDK
A0A536BZ00      GLLVAVGLALLIDHMDDTVK-TAEI-AGEVT-GLPTLGTI---------VRMRL--ATGR
E8N5M1          GIFLAIGIVFALDFLDDTIK-SPDW-ITTQT-KLPVIGTI---------HTFDP------
A0A1F8U7F0      GLMLAAGIAFLIEYLDDTLK-TMED-IERVM-QLPVVGYI---------AEIQY----ES
A5V160          GLLLAVGLALLIEYLSDRVS-SAED-VTAAT-HVGMLAAI---------GRIDG-----A
A0A2A6REI6      GLLLMVGVALLLEFLNDRVT-SSQQ-VAELL-DTSVLAAV---------GEIDG-----Q
A0A426TTK3      GLLFMVGVALLLEFLNDRVT-SSPQ-VAELL-DTSVLAAV---------SEIEG-----Q
A7NIZ1          GLLLAIGVALLIEYLSDRVN-SAED-VATTA-RVGMLAAI---------GRIDG-----A
A0A0P6XM68      GLLLAAGIVFLIEYLDDTVK-SAEQ-AEAAL-GVPVIGFI---------AELEH------
A0A2N2MEG3      GLMLAAAIVFLIEYLDDTIR-SADQ-AVEAL-GLPVIGYI---------AELEH------
A0A353RQ31      GLILTAGAAFLIEYLDDTIK-TPDE-VKEIL-NIPVIGLI---------GELHK---KNK
A0A3B9KNR2      GLILTSGIAFLVEYLDDTLK-TPDE-VKELL-NLPVIGLV---------GELRK---KSN
A0A0P6XME1      GLVLAAGIVFVVEYLDDSIR-NGET-VTRVL-ELPVLGYI---------NEING---KTP
A0A3B9Q1T8      GLFAVGGLVFLIEYLDDTIR-TPDE-AEQIL-GQPVIGTI---------GDINSSLLKRG
A0A1F8PTW9      GLMLAVGEAYLLEYLDDTLK-TADD-VARLF-SAPIIGHIFEQK-----NGKKQHH----
A0A1F8QH26      GCALAVGEAYLLEYLNNTLK-SSED-VVRLF-SAPVIGHIFEYK-----DGKTGNH----
A0A359HML3      GFTLAAAAAYLLEFLDKTIK-TVDE-VKRLI-KAPILGYIPEI-------PRKEDRW---
A0A3M1EJ46      GLILAIGFIFLLDHLDDTLS-RPEG-VEQAL-RIPTLAAIPAVR-----MRTSKNGN---
A0A2U2S5W9      GVLLALGAAFLLDYLDDTIK-SPDD-LVTTA-GLTPLGAITRMR------GEGYENK---
A0A0M8KAF3      ALVAVGAVVVLIEVLDDRVR-SPEV-IERLT-GLPMIGAIAHIE------GTNGDGV---
A0A523V9H6      GAMLAVGAAFLVEYLDDTIK-TSDD-ISREL-GLGTLGAVARLR--------NGDDV---
A0A3D1U3H5      ALLAATGLLFAREYFAGTLR-NPEEFQALMS-GAPVLGVVGDLN------RETKRPG---
A0A2N2MEK3      GLMLGFGIAFAIEYLDDSLR-SPMD-VDQVL-GLPVLGYIADMK------PANGPRQ---
A0A3B9J9U6      GLMLAFGIAFAIEYLDESLR-SPMD-VDQVL-GLPVLGYIADMK------PAEGPRQ---
A0A661VSD8      GLALALGAAFLIEYLDDTVH-WEDGRQQAVA-GLSILGAVPRM--------SSRRKT---
A0A497C1E5      GLGLALGAIFLIEFLDTSLR-WEEGGVQSIL-DLPVLGVIPQV--------S--RKD---
A0A1W9UQ51      GLVLALGAILLIEFLDTSLR-WEGDGVQSVL-GLPVLGAVPQV--------S--RKN---
A0A497B563      GLVLALGAILLIEFLDTSLR-WEGDGVQSVL-GLPVLGAVPQV--------S--RKN---
A0A3D0UNQ0      GFILALGVIFILDYLDDTVK-TVDD-ISQDL-NLTPLGTI---------GQYGNGKF--Q
A0A2G6GG97      GGMIAVGIIFLIEYLDDTIK-TPDQ-VLEKT-NLATLGAI---------AIIKDHTI--G
A0A521TS25      GLILAAGFAVLVEYIDDTVR-TPEA-VESAT-GLHTLGAV---------ALVPETDSIPG
A0A3M1H759      GFLLALGAAFMLEYIDSTIK-TSDD-LSPSL-GLTPLGSI---------ARIKGKGY--A
A0A535D584      GLLIGTAIAVVLQLLDQGLR-TEED-VRQKV-GVPVLGVI---------PSYSRDPK--S
A0A5C7JS64      GLCIGIGAVFLLEYLDNTTK-VDSP-FNELI-GAPLMTTL---------PIVPSMEK--L
A0A535IMD1      GCLLAVGGAFLLEYLDDTIK-TPED-AQRVA-NVSALGVI---------ARVSDIKS--P
A0A521UD91      GLFLALAAAFLIEYLDDTVK-SGTD-IERVT-KLPTLGVV---------GRIPSIKN--G
A0A3C0LJ76      GATVAIAGAYLLEFLDDRLV-DIEQ-ILQVT-GLTTLGT------------VPEIKL--D
I0I8T2          GAGVAVAGAYLLELLDDRLE-NVEQ-IQRVT-GLTTLGV------------LPESNV--D
A0A497ASN6      GGMLAVMGAFATEYLDTTIK-SPEQ-IEQIA-GLPVLGNI---------FEFEANPG--S
A0A3D1TRD4      GLLAAVGFIALVTYFDDTIK-SHND-VDRAL-QLPVLGLV---------QRNVGQAV--V
A0A3C0XJG2      GGLLTLTGIAVFTYMVDRIT-DVDE-VSERL-GVPALGEIPFAN-----EQTLGAHG---
A0A3M1ZZ81      GGMVALGFVFLMEYLDDTIK-TPDD-VLADT-NLPTLGAI---------AFIKGSAP--N
A0A497AF06      GFVLSAGVAFLVEYLNRSFE-TSEE-IKQIL-PLPTLGTI---------PRLQGKER--N
A0A661W444      GFVLSAGVAFLVEYLNRSFE-TSEE-IKQIL-PLPTLGTI---------PRLQGKER--N
A0A3D0D4X6      GAMIGLGTAFLIEYLDERVR-DPAM-VESLV-GLPILGQI---------TELPHEHS--T
A0A1J4ZRV4      GAMIAVGAAFLIEYLDDTIK-TPDD-VARVS-GLSTLGAI---------ARLKETGG--T
A0A1V5RXW5      GALLALGIAFLIEYLDDTIK-TPDD-IERVT-GLSTLGAI---------ARLKDAGS--A
A0A522N7L9      GALIAIGVAFLLDYLDDSLK-TSEA-VEETL-GLPTLGAI---------VQMRASGP--R
A0A535W4H1      GLLLATAILFAAEYLNDSLK-RPED-VEEVL-GLPTLGSI---------GRLRGDRS--V
A0A521IC37      GLVLAVGVVLLLEYLDDTIK-SSED-VERVL-QQTTLASVARIS-----PIRKPGDN---
A0A3A0B2P8      GFALAAAAAYTMYYLDNTLQ-NEDD-IQDHL-ALPALGLV---------PKNHAAEG--R
D1CAL1          GIVLAAGLVLVAGYLDDTVK-TSED-VQRLT-GRGALGLI---------PELRSPES---
A0A497BNC7      GLMIGVGVAFLLEYLDDTIK-SPQD-VKQTL-PVGVLGAL---------PRLKEMDG--Q
D1C8M3          GTLLGLGVVLVLVYLDDTVK-DAED-VRRLT-GRPALGWI---------PRFRGPSG---
I4EI06          GLLIAAGLVALAGYLDDTVK-TSGD-VRRLT-GKAPLGSI---------PVLVSADG---
A0A2E5F6N9      ATVSTILAIIVVEFFNDKAK-SSEE-IERRT-GLTRIATILRWT-----PKEIGAKE---
A0A2E6J6X7      GLALALGLTFLISNLRDTVR-NPDD-IRTKF-GVSVLGMVFEWS-----SKEVNEND---
A0A3M1EAN8      AFLLAVVFIFFMHHLDESLT-YTE--AEEVL-QIPTLATIPPLPAKSPLHRRRARSL---
A0A535QK16      GLVVGLGLAFLLDYLDQSVR-SDEI-LRERV-GLVPLGHIAFVL-----AKPERRGE---
A0A1F8RRT9      AVFIAGTVVLIYEYLDDTIK-TAED-VETAA-RLPTLGGVARFP-----RRVSSRSG---
A0A535FRM3      GLGLALALIVAFEWIDDRLT-NPEE-IRKLT-GQDALAVLPELS-----RKQGGCN----
A0A401ZA55      GLGLALAIIVIFEWIDDRLT-APEE-VNKLL-GIDALTIIPELS-----RKQRSRN----
A0A4P6JS79      GLGLALALIVVFEWLDDRLK-GPEE-AQRLL-GVETLTVIPELS-----RKQRIKN----
                                                                            

A0A535RWE5      ---GMLFVRDAPMSPDAEAFRGLRTNILFASPDRRPRTILVTSALPLEGKSVVSANLALA
A0A0P6WSP2      ---SGLEMDVHPRSKVAEDFRTLAINLCSVNAQNPIRTLLISSPGMAEGKSVVTANLALA
A0A5C7JWY1      ---KKALAPPNALTPVAESFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLAMA
A0A1F8QGH2      ---DELVVLAKPRSPYAEAFRMLAANIRFSSLDKPLQSLLVTSPSSQEGKSIVLANLAAA
A0A1Q7TTL6      ---GRRVRPPEEVAVVVEALRGVCLNLVYAHGAVAPMVVTLTSPGAGDGKSFLAANLGHT
A0A0S8KFR9      ---GKILLSSDGRSPEAEAFRMLRGNLLSVASTRPLKTLLITSAEPGAGKSTVLVNLAAA
A0A535SLQ0      ---G-----PGSADAAVEAFRGIRLNVLNGHGAPGPVVVAVTSPGSGDGKSFVSSNLALA
A0A363SX22      -----LYMVKLPQSVVAEAFRSLRTNLEFASVDKPLKTILVTSNGSSDGKSSIATNLAVA
A0A326UPN3      ----------EDTPELAEGCRVLCSNIATAQTQQPFKLIMLTSALAGEGKSTIAANLATF
A0A455STY5      ----------EDTPELAEGCRVLCSNIATAQTQQPFKLIMLTSALAGEGKSTIAANLATF
A0A3A4VPK9      -----LYTTNQPRSPIAEAFRSLRTNIEFSSIDKPIRTILVTSPEVSTGKTIISTNLAAI
A9B6E3          ----RLVSRLDPRSPTAETFRTLRTNLQFSNVDTKARTLIVTSSQPEEGKSTVAANLAWV
A0A3D0CW53      -----LVTVHSPRDPITEEYRVLRTNIQFTGLSNRSTTLLITSAALGEGKTTIAANLAVI
A0A1F8SS27      -----VYVSKNPRSPAAEDFRILRANLELLSTDQPLKTILVTSCDKATGKSFISTNLAMI
A0A2E0L5X9      RNKLPLYVESMPQSIETEAMRQLRARIALAAGGDMPHILTVVSYDSGEGKTLTTANLALE
A0A3A0AXU8      GRGLALVTATDPRSPVAEAFRALRTSVRMAGVDGPVHSLMVTSAGPGEGKTFVASNLAVV
A0A3D1JCW0      -EDGGPITQAHPRSPVSEAFRSLRTNVQYSSVDRPLRRIIVTSPTPEDGKTTIVANLAVV
A0A2N2MJJ0      AKETGLFIASQPRSPVSETYRALRTNLEFASVDNPLKTILVTSAGPGEGKSTVACNLAGA
A0A3M1LAM5      -----VIVRRAPRSPAAEMVRQLRSKILLAQPGRTFRTLLVTSAAPQDGKTVAVANLGAA
A0A536BZ00      EKFYSLPTLLYPRSRGAEAFRTLRTNLDFAHVDGPVKTILVSSAGQSEGKTTVSANLAIA
E8N5M1          -KAGDPVALSSPRSPVTESFRSLRTNVRYASVDHPLRVLLVTSPTPEDGKTTVAINLAVV
A0A1F8U7F0      GSDESLYVTRQPRSPVSEAFRLLRTNLEFAGVDRPIRRLLVTSAGPGEGKTTIAVNLAAI
A5V160          EPSDKLVMLRDPFSQVAEAYQMLRVKLEIARFEKPLHTLLVTSSSPGEGKSTTAANLALA
A0A2A6REI6      RSMDKLVTLISPHSKFSEAYQMMRVRLEIARYGHAFKTVLVTSGNQGEGKSITAANLAVV
A0A426TTK3      RPMDKLVTLISPHAKVSEAYQMMRVRLEIARYGQPLRTILVTSGNQGEGKSITAANLAVV
A7NIZ1          APSDKLVMLKDPFSQVAEAYQMLRVKLEIARFEKPLHTLLVTSSNPGEGKSTTAANLALA
A0A0P6XM68      -DQDKAYVAENPRSPVSEAFRTLRTNLEFAGVDRPIRSILVVSAHPGEGKSTVATNLAIT
A0A2N2MEG3      -DQDKAYVSENPRSPAAEAFRTLRTNLEFASVDKPIKTLLVVSAHPGEGKTTVATNLAVT
A0A353RQ31      DDKLGNYVVYHQRSPVAEAFRALRTNLEFSSLDFSLKSILVTSSGETEGKTTVACNLAII
A0A3B9KNR2      NDKFGSYVISNPRSPVAEAFRALRTNLEFAGIDSPLKSILVTSSGETEGKTTVACNLAVI
A0A0P6XME1      YEDYPPHVIAQPRSLITEAFRSIRTNLEFVEIDRPLKTLLVGSPSPDEGKTTIAVNLAIV
A0A3B9Q1T8      GKKSGVHVANQPRSPIAEAFRSLRTKLEFYNIDQPLKVLLVTSAGLEEGKTTVAANLAAI
A0A1F8PTW9      -----LYDTADLRHPIAEAFRILRTNIEVAEANQPLKTILVTSADIGDGKTSVATNLALF
A0A1F8QH26      -----LVDLTDLQQPLSEAFRVLRTNIELSGSDRPLKTILVTSADASDGKTFVAANLAMF
A0A359HML3      -----HFVTNHPRSPISDAFRNLRINVDLLGVET--KTIMISGSAISEGKSTIALNYAQI
A0A3M1EJ46      -----PFAANHPTSPFAEAHRTLRTNVQFSSGDVTAETLLITSALPRAGKTTTVANLGVV
A0A2U2S5W9      -----LVTMRHPRSSVAEAYRTLRTNIQFSTLDKPARTLLVTSPSALEGKSVTSANLAVS
A0A0M8KAF3      -----LVAREQPRAPVSEAYRVVRTNLQFAEVQSPLHSLVVTSSEPGEGKTTTAANLALV
A0A523V9H6      -----LVTLTEPLSPPSEAFQVLRTNLRFSALDKPLRTLQFTSAGPEEGKSLVLANLAVA
A0A3D1U3H5      -----LSVTENRRSLGAEMYRMVRTNLLFSGADAANKVILMTSCGEGEGKTTTSMNVAMV
A0A2N2MEK3      -----LHVAAFPRSPAAEAFRNLRSSIEFSGEDRPPKTLLVTSSRPGEGKTTVASNLAAI
A0A3B9J9U6      -----LHVAAFPRSPAAEAFRNLRSSIEFSGEDQPPRTLLVTSSRPGEGKTTVASNLAAI
A0A661VSD8      -----WAAIDRFRYPEIEAIRNLRTNIFLSTPGTSLDTILVTSPEIGDGKSFTVANLGLT
A0A497C1E5      -----VLSSRNPLSPVAEGARAVRASIFLMRPDQPYRVLLLTSPGAAEGKSFIIANLAVV
A0A1W9UQ51      -----ALSSDNP-------------------PDQPYKVLLLTSPGASEGKSFVIANLAVV
A0A497B563      -----ALSSDNPLSPVAEGVRAVRASVFLMRPDQPYKVLLLTSPGASEGKSFVIANLAVV
A0A3D0UNQ0      GR---MIVSEDPRSPVAESYRIIRSNIQFMFIDNPGRAILVTSAVPGDGKSTTAVNLAIA
A0A2G6GG97      SG---LITQNAPRDPISEAYRIIRTNLSFSTVDKELKSYLVTSASPGEGKSTTAANLAVV
A0A521TS25      SDRLRLVADTEAKSPVAESFRILRTNVEFAQVDRACRKLMITSPSQGEGKSTIAVNFAAV
A0A3M1H759      DR---LVTLHNPFSAASEAYRVLRSNIQFMAGEQPPKTIMLTSTTPEEGKSLTAANLSVV
A0A535D584      GT-------QMRTAVADEAYRSLRTSLLFAGVDRTLRSVVVTSARVGEGKTRTAANLSAV
A0A5C7JS64      PHQ--LFILDQPMSPESEAVRLLRANVEFAIANTEEKTLAVTSAGPGEGKSTIVANLAVA
A0A535IMD1      RDA--LVTATRPNDPVSEAYRLLRTNLQFSGVKNPAGSVLITSSSPGEGKSMTAANLAVS
A0A521UD91      TTAPRVLDDIAARSSLGESYRIVRANVDFAWAGQPGQLVMFTSTNPGEGKSTTLGNLATV
A0A3C0LJ76      TASQGLVMLQNPHSTDAEAIRVLRTNLLFASVDHKLSSLLVTSPTPGEGKSFISSNLAVA
I0I8T2          SSERPLIMLSAPHTSDAEAFRVLRTNLLFASVDRGLGALVVTSPTPGEGKSFVSSNLAIA
A0A497ASN6      NSN--LITLEQPRSHTTESFMVLRANLEFLNVDTPLQVLGITSPGVGEGKSNVAANLALV
A0A3D1TRD4      TV---GADSVAQDRHSAEVFRVVRANLGFATASYRSKILLVTSTQKAEGKTTTIAKLAVA
A0A3C0XJG2      -----LFVRDAPASPEAEAFRAVRANLVLAALDRPPRTIMVTSALSDEGKSLVAANLALA
A0A3M1ZZ81      QR---LITHHTPRDPISEAYRVLRTNLTFSAVDSELHSLLITSSSPGEGKSTTTANLAVV
A0A497AF06      GR---LVTLAMPVSPASEAYRALRTNIRFASVDEPLKTLLITSAEPKAGKTTVAANLGVV
A0A661W444      GR---LVTLAMPVSPASEAYRALRTNIRFASVDEPLKTLLITSAEPKAGKTTVAANLGVV
A0A3D0D4X6      PA-QAVILANAPRSPLAEAYRMLRTNLQFAMVDRPLHILVVTSPGPREGKSVTSANLAVA
A0A1J4ZRV4      RQ---LVAWLQTKAPESEAYRTLRTNIQFSSVDKPVRSLLVTSAGPSEGKSTTAANLAVV
A0A1V5RXW5      RE---RIAWLRTSAPESEAYRTLRTNIQFSSVDNPVRRLLVTSSSPGEGKSTTAANLGVV
A0A522N7L9      SEIYHLVALLYPRSPVTEAYRTLRTNVEFASVDAPVRTLLVTSSVPGEGKTTTAANLAVT
A0A535W4H1      NEVYRLVTLVNPRSPAAEAYRSIRANVDFTSVDRPIRTLLVASATASEGKTVTAGNLALV
A0A521IC37      -----LITLLHPRSPIAEEYRSLRTNLRYSGIENPGGALLVTSANPSEGKTTTAANLAVA
A0A3A0B2P8      AG---LEG-DDERAALNDAFSALRLNIQAALGGDVPKTLLVGSPAVGDGKSSVAANLALA
D1CAL1          -----IEAIAHPDSVGSEAYRTARTNLQFVAVGQSLRSFVVTSPRPGDGKTTTAVNLAAV
A0A497BNC7      IA---LVVAEYPLQPIAEAFRSLRTSIQFSSVDHPAKTLLVTSPLPTEGKTFTSANLAAV
D1C8M3          -----IALVTAPRSPVSEGYRSLRTNLQFATLGQEVRSILVTSARPGDGKTTTVVNLGAV
I4EI06          -----VESLRAPHSPAAERYRSLRTALQFATLGQPIRSLVITSPRPGDGKTATATNLGAV
A0A2E5F6N9      -----VTLLSQPRSSHAEAFRQAKVNVQFLSLTPPPKRYLVTSPGPGVGKTTFSVHLATA
A0A2E6J6X7      -----LIVDTSPKSSFAEAFKQIRTNLQFAATKSESRVYLTSSPGPGDGKSTLISNLAVA
A0A3M1EAN8      -----PLSMLEPLSAYAEAYRTLRTNLRFAGNGSPPGALLITSALPGEGKTTVAANLGTV
A0A535QK16      -----LVALGGDSPVV-EAYKALRTNLLFSSVDKEVKTVVITSAVPDEGKSRTAANLAIV
A0A1F8RRT9      -----LVVASTERSAAAEAYRVLRTNLQFSTLDA--QALLVSSANPGEGKTTTVANLAVA
A0A535FRM3      ---------IKDNPVLAESYRILSAHTSIMQTNHPFKLLMVTSAVAGEGKSTLATNLATF
A0A401ZA55      ---------AEDTPELAEGCRILCANLNMAQMMRPFKLVMVTSPMAGEGKSTIAANMASF
A0A4P6JS79      ---------AEDTPALAEGCRILCANLNRVQGAHPFKLVMITSALAGEGKSTIAANLASF
                                                          .     **:    : .  

A0A535RWE5      FAQ-AGSPTVLIDADLRRPSQHRLF-GLDSSK----GLTTLLTADDPLG-----RLDAFS
A0A0P6WSP2      LAR-LGLKILVVDADLRLPSLHRIF-GVDQEN----GLSEALVS-GKGT-----DHLKTT
A0A5C7JWY1      MAQLEDTQVVLIDVDFRNKQIHPLY-DVGSSEEPPKGLGHLLRGEANLA-----DVVHQT
A0A1F8QGH2      MAG-SGQRIVVVDADLRLPRLHQVF-KLDGKE----GLTDSLIN-SSLD-----GNLQAT
A0A1Q7TTL6      FAE-AGHRTLLIDGDLRRGVLHRRL-GARRRP----GVSDFLRGEVPLE-----AIVQAT
A0A0S8KFR9      MAQ-AGQKVVVVDGDLRYPCLHEVF-ELPNDM----GLSNVLSDLRRMS-----TALQET
A0A535SLQ0      FAH-ANHRTLLVDADLRRGALHRAL-QLRREP----GLTDLLVAKASPE-----QVLQAT
A0A363SX22      FAQ-SGKKVVLLDADLRRPSLHGFF-SIPNQT----GISDIIRGQVSLE-----EAIYRS
A0A326UPN3      LAM-SGKRVLLVDADLRNPVLDKHF-HINNQN----GLAQILMGVWGNNEMALDGI--PT
A0A455STY5      LAM-SGKRVLLVDADLRNPVLDKHF-HINNQN----GLAQILMGVWGNNEMALDGI--PT
A0A3A4VPK9      YAQ-KGEKVLLLDADLRRPRVHKTM-GITNHI----GLTDLL----RGSHDLQDVIQKMD
A9B6E3          LAQ-AGQKVVLIDADLRKPMMHRVF-EVSSEY----GLTNLLT---NNEDPTIRERTVLS
A0A3D0CW53      MAM-AGKRVILVDGDLRRPSVHRFF-GIPNRL----GLTNLL----VDEALALETVLMET
A0A1F8SS27      LAH-SDREIILLDADLRNSNIHKMM-SIPNEY----GLSDILRNGMNVS-----QALRNY
A0A2E0L5X9      SAQ-TGLRTLIIDGDMRRGDMHEIF-QLPNMY----GLGDILQSN-EPLANLLPNVLLDS
A0A3A0AXU8      FAQ-EGRRTILVDLDLRKPQVGARF-GLRREP----GFSNLV----VDRELAVEHCLQAT
A0A3D1JCW0      LAQ-GGINTLLLDADLRRPRLHKIF-KCENKL----GLSSLF---VQPMDGLEKVIVHSQ
A0A2N2MJJ0      LAQ-AGKKVLLIDTDLRRPRIHQYL-GLGNRF----GLSDLFL--SHGKLADVTQVYEGP
A0A3M1LAM5      MAS-AGMRTVVVDADFRAPSLHESF-DLPNVL----GLAELLSAGRDEYQALLDKALLET
A0A536BZ00      LGQ-AGRSTILVDADLRVPELHDYF-QLTNDQ----GLTSLL---RDETLP-VSAVARET
E8N5M1          IAQ-SGNRSVLIDADLRRPRIHKVL-GLDNRQ----GLSG-L---FIQNPTMLNGALQQT
A0A1F8U7F0      MAQ-GGKRVVLVDADLRRPKIHRFL-GLSNKV----GLSD-L---FRGVVAVRMVSQQVQ
A5V160          IAR-SGKRVILVDTDLRRPSLHRFF-RHANLR----GVTTAL---VRDPSDSLYNHMIAT
A0A2A6REI6      LAR-AGKRVLLVDADLRRPTTHTYF-AHHNLR----GLTTAL---VREGDTPVDFHLHST
A0A426TTK3      LAR-AGKRVLLVDADLRRPTIHTYF-AHHNLR----GLTTAL---VREGDTPVDFHLHST
A7NIZ1          IAR-SGKRVILVDTDLRRPSLHRFF-RHANLR----GVTTAL---VRDPSDSLYNHMIAA
A0A0P6XM68      MAQ-GGKKTLLIDADLRRPRVHQYL-NLPNRV----GLSN-L---FRDAKSLHEVMGQWK
A0A2N2MEG3      IAQ-GGKRVLLIDADLRRPRVHHHL-GLNNRV----GLSN-L---FRDSIAIGDVAHAWQ
A0A353RQ31      LAQ-GGNRVLLMDTDMRRPNVHVQF-NLHNRI----GLSD-L---VRGKLSLHEVVRSIP
A0A3B9KNR2      LAQ-GGKKVLLLDTDMRRPNVHTQF-NLHNRV----GLSD-L---VRGRLTLEEVVRTIP
A0A0P6XME1      IAQ-AGKRVLLIDTDMRRPQIHERL-RLPNRF----GLSD-I---LREHGSLDESLHHLA
A0A3B9Q1T8      MAN-NNKNVLLIDADMRKPKIHTHL-GLSNRY----GLSD-L---ILGRSA-SVVQRAGS
A0A1F8PTW9      VAQ-RNKKVVLLDADLRSPNIHKYF-NLANDR----GLVDLISNGATSN-----DVLRVI
A0A1F8QH26      MAQ-RRKKVVLVDADMRRPTIHEYF-NLDNDK----GLTDFFSKNASIS-----DVLRIG
A0A359HML3      ATQ-ANKKVVFVDGDLRKSKMKEAL-KLEQDT----GLSTLLNSPAKLKDVVFTLD----
A0A3M1EJ46      MAQ-AGMKVLLIDTDLRAGNLHQVF-GVPDRP----GLTDLLLSNAVPDESM----LLKT
A0A2U2S5W9      MAQ-AGFKTVLVDADLRRPVQHKIF-GLSNQQ----GLTNALLQPGEPSADGHLQSTEI-
A0A0M8KAF3      MAQ-AGRKVVLVDADLRKPLVHRLF-QLSNAQ----GLTSALMHP-EIAVDRFLQRVDAG
A0A523V9H6      MAQ-AGLKVILVDGDLRRPRQHALF-GLHLLG----GLTSSLLQG---STDGRLQPAEQV
A0A3D1U3H5      MAE-IGRKVLLIDADLRRPHIHQVA-GIENRG----GLTALLLG--MDGGDIMTSTVQSE
A0A2N2MEK3      FAQ-SGKRVVLVDADLRRPSVHRAL-GIPNRL----GLTTLFRDSLKLESVWKHSNGISR
A0A3B9J9U6      FAQ-SGKRVVLVDADLRRPSVHRAL-GIPNRL----GLTTLFRDSLKLESVWKHSNGISR
A0A661VSD8      IAV-TGMRVVLVDADLRNPTLHEMF-DRPNVM----GLSELLSGDSPISESRPPMELQPT
A0A497C1E5      LAS-AGNRVIVVDADMRRPSLHELF-DQPNVI----GLADVLGDHKVDND-FSSIPLQET
A0A1W9UQ51      LAA-AGNRVIVVDADMRRPSLHELF-DRPNVT----GLADVLSDHKVDDEGLLSVPLLET
A0A497B563      LAA-AGNRVIVVDADMRRPSLHELF-DRPNVT----GLADVLSDHKVDDEGLLSVPLLET
A0A3D0UNQ0      MAH-NEKRTVIVDADLRNSELHEIF-GVSNSN----GLTEQLR---QPESQKK-IHLFDT
A0A2G6GG97      LAQ-TGKKVVLIDADLRRPIQHKIF-NLPNNM----GLTTSIL---DGRTPVT-AHLQQT
A0A521TS25      VAQ-AGKRVLLVDCDLRRPSLHRTF-RWENQQ----GLTNLLV---RGTIDWH-AVTRQS
A0A3M1H759      MAQ-ADFKTILVDADLRKPSIHKIF-EISNSQ----GLSDLIS---NPDMEPE-AVLQDT
A0A535D584      LGA-AGSRVLLLDADMRRPGQHRLF-NHSAEP----GLSELLLTVATTGQPPNLSGAQKT
A0A5C7JS64      MAQ-AGYSVIVIDADMRRPAQHEAF-NLSNER----GLSTLLA---RSDVDWN-SVARSN
A0A535IMD1      MAQ-SQKRIILVDTDLRRPSQHKIF-GMTNKR----GVTSLML---DETLALD-DVLQTT
A0A521UD91      FAK-DSRTIIMVDCDLRRPSLHRAF-AMQGDR----GLTNLLA---DHRAKLD-DYLVPT
A0A3C0LJ76      FAQ-TGKRVILVDADLRKPTLHRVF-GLVNNI----GVTSALV---SDAADVE-AALQAT
I0I8T2          FAQ-TGQRVILVDADLRKPTLHRAF-GLVNNV----GVTSALV---SNLDEFT-AALQQT
A0A497ASN6      MAR-GGKRVILIDADLRRPMIHSLT-GLAQSP----GLSEALV---EKEIPLE-EYLQTI
A0A3D1TRD4      LAE-AGKRVVLVDADLRLSSLHRMF-KLDNRR----GLSNLLVDPVASPAELL-PYLQQT
A0A3C0XJG2      FAE-SGSLTVLVDADMRKPMQHLLY-GLDSTV----GLADLLRE--TVPLA---DIRKFE
A0A3M1ZZ81      MAQ-TGKQVILVDADLRRPTQHKIF-QLSNNQ----GLTTAILD--SLTPVSY--HLQKT
A0A497AF06      CAQ-AGLRVVLIDTDLRFPNLHQLF-DLNNHT----GLTD-LLV--GNARSVK-ECMMET
A0A661W444      CAQ-AGLRVVLIDTDLRFPNLHQLF-DLNNHT----GLTD-LLV--GNARSVK-ECMMET
A0A3D0D4X6      VAQ-TGARVILVDADLRRPSQHTLF-TLPNQT----GLTS-AIV--SDEVDLQ-ALLKPT
A0A1J4ZRV4      MAQ-TGQRVVLVDTDLRRPVMHKVF-GVANNT----GLTSALLN--GEQVVLD-GHLQGT
A0A1V5RXW5      LAQ-TGQRVILVDTDLRRPTLHKVF-GIPNNT----GLTTALLA--SQDTPIM-EQLQPT
A0A522N7L9      FAQ-AGRRVLLVDADLRKPGLHRIL-DLPNQH----GLTT-LLG--TDQVGLE-SLIQGT
A0A535W4H1      FAQ-AGRRVLLIDADLRRPGVHTIF-RATNAR----GVTS-LVL--DPNLDPA-RVVQMT
A0A521IC37      MAQ-SGKRVILLDADLRRPGIHPLF-GLSNQM----GLMTLFWE--ETPRVEE--VMQTT
A0A3A0B2P8      FVE-AGYRALLVDADLRRPSLHRQF-NLPNQR----GLTTLLLG--EEHNLEL--LIQQP
D1CAL1          LAQ-GGQRVILVDADLRRPQVHRYFAGLNTRS----GLSNLLLS--EWDVKLT-PTLRQT
A0A497BNC7      MAQ-GGQSVILVDADLRHPRVHRAF-DVSREP----GLTAALLS--PDGWEQA---LRPT
D1C8M3          LAQ-GGQQVIVVDADLRRPRLHAALGNVPNRF----GLTNLLLA--DDEVDLA-ALLQET
I4EI06          LAQ-AGQRVILVDADLRKPQLHTHFAGVKNRA----GLTNLLLA--QPGDGLADALLQPT
A0A2E5F6N9      IAQ-EGKNVILIDSDFRRPGVPPYF-SLSNQM----GLSSLL----ANPELQLEDLLQST
A0A2E6J6X7      IAQ-TGKKVLIVDGDLRRPTLHRRFKNITRDT----GLSNYL----SDNTETLGAVTQTS
A0A3M1EAN8      MAQ-AGRKVLLVDADLRHPDLHRLF-DVPNRR----GVADLLLNGQLPDETWL----VET
A0A535QK16      LAQ-AGHPTLLVDADFRRPSQHRMF-GKVRNV----GLSNLIVQDMPESALFV----PDE
A0A1F8RRT9      IAQ-TGLRVIVIDSDLRRPALHRIF-GLSNGA----GLTNALLSRQPEIQRFL----QPT
A0A535FRM3      LAL-SDKRVLLVDADLRRSVLDQHF-QLDNHH----GLADTLLTPWEQIKTAL--EGQLT
A0A401ZA55      LAM-SGKRVLLVDADLRHPVLDQHF-QLNNQK----GLSNAFLGIWNQVETEL--DGQPT
A0A4P6JS79      LAM-SGKRVLLVDADLRHPVLDQHF-QLDNRQ----GLSNAFLEMWTQVQPQM--EGQPT
                         :.:* *:*                   *.                      

A0A535RWE5      VAPNLHVVPSGPL-----PPDPAEFLSSARMSTLLE---LLAKRAPNA--TVIVDTSPTL
A0A0P6WSP2      KEAGVKIMTSGSL-----PPNPSELLNSKKLTILLE---KLSQQA--D--LVLVDSPPIL
A0A5C7JWY1      FVSNLSVIPHGGR-----PTNPTELLHSKSMTQLLN---WGTTNR--Y--HIILDCPPVL
A0A1F8QGH2      KMDGLKVITSGKL-----PSNPVEVIGSAHMRIFLK---EFEEKT--D--LVIIDSPPVL
A0A1Q7TTL6      PYPSFSLIGCGTR-----AYNAPELLGSQAMSQLFT---TLRPNY--D--VILVDSPPLS
A0A0S8KFR9      NIEGVRVLTSGPV-----PPNPAEPPPLSKLPQLLG---KLAKEA--D--LVLLDSPPIL
A0A535SLQ0      THPSLDFLASGSR-----RGDAPELLGSARMADFMT---RLRSSY--G--VIVVDTPPLG
A0A363SX22      AKGGVALILAGPL-----PPNPAEMLGSKKMENILA---SLEEIA--D--VVILDSAPLL
A0A326UPN3      EIPTLRLMPAGTR-----PQNPAELLISDTARRLFK---HYQDTN--RFDYVIFDTPPLL
A0A455STY5      EIPTLRLMPAGTR-----PQNPAELLISDTARRLFK---HYQDTN--RFDYVIFDTPPLL
A0A3A4VPK9      GAENLTIVSSGSL-----PPNPAELLGSARMEQILL---ELGNKY--N--IIVIDSPPSI
A9B6E3          VAENLWLIPSGPL-----PPNPSELLSSKRMEMLIW---LLQQEY--D--WILFDTPPIL
A0A3D0CW53      PVAGLKIIPSGPV-----PPNPAELLSSERMKQRGN---EMKELA--D--VIIFDSPPAL
A0A1F8SS27      DGVNGGVITGGTV-----APNPFELLGSKKMDEILA---KLKKSD-----YVIIDSPPLF
A0A2E0L5X9      GYENLNIIPAGRS-----EADPAALLGRTRLNNLID---LLSKRY--D--AIFIDAVPTI
A0A3A0AXU8      AIPHLLVIAAGTI-----PPHPSELLGSVRAGEVIE---QIKALA--D--MVIFDTAPAA
A0A3D1JCW0      RTEGLHLITSGGT-----PPNPAELLGSQKMKEILN---RLSQSF--D--TLLLDTPPVL
A0A2N2MJJ0      NNTHFEVVTTGAI-----PPNPGELLSSERMKTLLA---EAVKNS--E--IVILDSAPSL
A0A3M1LAM5      NVERLTLLPAGRP-----PLDPTMLLTSPRFPELLD---LLLERF--D--AIVMDSPPVL
A0A536BZ00      EEPRLRVVTSGPV-----PPNPAELLGSQRMRGVIE---RLKNAA--D--VIVFDSPPLS
E8N5M1          RLETLKVLPSGGT-----PPTPSELLGSRKMKEILD---SVASEA--E--MIVVDTPPVL
A0A1F8U7F0      DVETVSVLTSGSL-----PPNPTELLASVRMEQILQ---EAEQDA--D--IVIIDSPPSL
A5V160          GLENLLVLPSGPV-----PSDPAVMVSSKKMLDLID---ELKRMA--D--VVVFDSPPIL
A0A2A6REI6      KLNNLLLMPSGPL-----PSDPAAMLSSPQLVELIE---ELKTQV--D--VLVFDSPPLL
A0A426TTK3      KLSNLLLMPSGPL-----PSDPAAVLSSPKLVELVE---ALKAKV--D--ILVFDSPPLL
A7NIZ1          GEENLLVLPSGPV-----PSDPAVMVSSKRMLDLID---ELKRIA--D--VVVFDSPPIL
A0A0P6XM68      E-TTLQVITSGGL-----PPNPTDLLASDRMAAVLQ---SALEEA--D--VVVVDAPPFL
A0A2N2MEG3      D-SNLSVITSGGV-----PPNPADLLASERMAAILE---SANKLF--D--MVIVDAPPFL
A0A353RQ31      EVKNMDIITSGSL-----PPNPAELLASERMRNLLD---ELKKSY--D--VIVLDSPPLI
A0A3B9KNR2      EVKSMDIITSGSL-----PPNPAELLASERMRKLLE---ELKSHY--D--VIVMDSPPLV
A0A0P6XME1      T-EGIDVITSGIL-----PPNPAEVLSSERMAKLME---EVAQRY--D--KVILDGPPFL
A0A3B9Q1T8      N-KKFSVVTSGSI-----PPNPSELLASEKFTRIID---KVSQQF--D--MVVIDSPPGF
A0A1F8PTW9      EDGKLTILTSGNT-----PPNPTELLSSNKMDQLLS---KLKEIY--D--IVIIDSPPFI
A0A1F8QH26      ENRKLGVITAGKP-----NPHPAEFLSSNKMNQFLS---KLKTVV--D--YIIIDSPPFI
A0A359HML3      --QRLTIIPSGSC-----PPNPTELLGSEKMDRILT---HIKGMA--D--LIVVDSPPLF
A0A3M1EJ46      EVLNLYLLPSGPL-----PPTPSELLSSDRMVSLIE---HFRGRV--D--VLLMDSPPVL
A0A2U2S5W9      --ENLRVLTSGPI-----PPNPSELLGSAKMQALLQ---RLKEEY--E--VVIFDSPPAL
A0A0M8KAF3      GGQTLWVLPSGPL-----PPNPAEVVGSRRMQELLD---ELMTFA--D--IVILDTPPVL
A0A523V9H6      EGLSL--LSAGKS-----PPNPAQILSSQRLRELID---ELAQKA--D--VVLVDSPPVL
A0A3D1U3H5      ADPHLYFLPSGPI-----PPNPTALLSSQRMRDLLH---AFKQSF--D--TIIVDSPPLL
A0A2N2MEK3      G---MLVITSGSL-----PANPSELLGSEKMLHILA---ELRQKA--D--IIIFDGPPMM
A0A3B9J9U6      G---MLVITSGSL-----PANPSELLGSEKMLHILA---ELRQKA--D--VIIFDGPPMM
A0A661VSD8      GVDNLFLLSSGRP-----PTDPAALLVSPRLPALLD---TLEKFA--D--VVILDSPPAL
A0A497C1E5      GFDNLLLLPAGRP-----PVDPATLLTSPRFPALLQ---FLKGQG--D--VLLIDSPPVL
A0A1W9UQ51      DFDNLYLLPAGRP-----PADPATLLTSPRLFALLD---SLGSQM--D--MVLIDSPPVL
A0A497B563      DFDNLYLLPAGRP-----PADPATLLTSPRLFALLD---SLGSQM--D--MVLIDSPPVL
A0A3D0UNQ0      KVEGLQLLTAGEP-----PPNPSELLGSQRMVKLVD---TLNSEA--D--VVIFDSPPAA
A0A2G6GG97      KISNLGLLTSGPI-----PPNPSELLNSRRMQDVLK---ELEDNS--D--LVIFDTPPVL
A0A521TS25      AIPNLSVILSGPV-----PPNPSELLGSSRFASVID---ELASEF--D--LVILDTPPTI
A0A3M1H759      TVKNLRVLTSGPL-----PPNPAEKLSSQRMSQLVH---LLEETA--D--VVIFDTTPVM
A0A535D584      RFTNLSLMTAGMT-----PPNPSELLASRAAELTLR---WLEHSY--D--IVVIDTPPVD
A0A5C7JS64      AELKLQVITSGPI-----PPNPGDLLKSPRFGALLE---TLSSEA--D--LVIVDTPPAL
A0A535IMD1      DLENLRVLTSGPL-----PPNPAEVLNSTQMLSIIN---QLKDCS--D--MVIFDSPPVL
A0A521UD91      KQPNLWLLPSGPI-----PPNPSELLGSNRMLAILD---ELRQRA--D--MVFIDTPPLL
A0A3C0LJ76      ATPELRVMTSGPL-----PPNPSELLSSHKMQELLT---HLQSLC--D--VVIIDSPPVL
I0I8T2          IVPELRVMTSGPL-----PPNPSELLSSRRMQELLD---RLRSDC--D--LLVIDSPPVT
A0A497ASN6      GIENLRILTSGRR-----PPNPADLLASRRMGELIA---HFKSLC--D--MVIVDSPPLL
A0A3D1TRD4      PLPTLRVLTAGVM-----PPNPTELLQSENMATLLA---MLAELA--D--VVLIDSPPVL
A0A3C0XJG2      VMPNLIVLPTGRP-----PLNPAEPLSSTKMLSLIL---SLSQLA--DAATVVIDTSPVL
A0A3M1ZZ81      RVPGLRVMTSGPI-----PPNPAELLNSHRMKQVLE---ALQQEA--D--LIIFDTPPVL
A0A497AF06      GIDNLRVITSGPI-----PPNPSELLGSKRMEAVLA---EVKQSA--E--LVILDTPPML
A0A661W444      GIDNLRVITSGPI-----PPNPSELLGSKRMEAVLA---EVKQSA--E--LVILDTPPML
A0A3D0D4X6      TMSGLSVMTSGPI-----PPNPAELLNSERMSHLLQ---ELAAQA--E--LVILDTPPTL
A0A1J4ZRV4      EVENLSLLTSGPI-----PPNPSELLGSHRMARLVE---KLAGQA--D--LVIFDSPPVL
A0A1V5RXW5      EVPDLHILTSGPI-----PPNPSELLGSQRMAYLIE---MLAEIA--D--IIIFDSPPVL
A0A522N7L9      EQDGLAVLTTGPL-----PANPAELLASQRMRAILE---HLTGLA--D--LVIIDSPPLQ
A0A535W4H1      EQGHLTILTSGPL-----PPNPAEILGSHRFGAILE---QLAADF--D--LIVIDTPPLQ
A0A521IC37      DVPGLRVIAAGEP-----PPNPAEILDSKRMTEILV---ELRSQA--D--MVVVDSPPLL
A0A3A0B2P8      AQQRLSLLTSGPL-----PPNPTRLLSRKELRGVLA---EMAQKF--D--IVLLDTPPLT
D1CAL1          TIAGLTVLPAGPL-----PPNPLDLLSSPRMREVLD---WLAEQA--D--VVIFDAPPL-
A0A497BNC7      EIAGLQIVTSGSS-----PPNPAELLASERMREFVS---WLAEQA--D--VVILDSPPVL
D1C8M3          DVPGLRVLTTGPL-----PPNPTDVLDSPRMHELIA---GLERMA--D--MVLVDAPPV-
I4EI06          EIPGLRVLTTGPL-----PPNPADVLNLPRMREILT---SLEDAA--D--VVLVDAPPM-
A0A2E5F6N9      AIPTLKVLTAGPN-----PPNSVELLGSSRMEAIMD---EVAARG--D--ILVIDSAPIM
A0A2E6J6X7      GVSGVDVITSGPI-----PPNPSELLNSPRMKDGIE---KAKDIY--D--IILVDCPPVL
A0A3M1EAN8      SQPRLYLLPGGPFTADPRSPTPAELFDATRLQALLD---HLRFLA--E--VIIVDSSPVL
A0A535QK16      QVKDLVILASGAT-----PPNPSEVLGSAHMKALLA---RFRKGF--D--YVVIDTPPVN
A0A1F8RRT9      AFEGLSVLTSGPL-----PPNPSELLSSRRMDAIVD---AARKEA--E--ILLFDSPPAL
A0A535FRM3      EVPALRVLTSGAY-----SSNPAELLQSPLAQELFNKHFREMDQF--D--YIIFDTPPLL
A0A401ZA55      EIPSLRVLTAGVL-----PSNPSELLQSQLASQLFN-HFRNSQKF--D--YIIFDTPPLL
A0A4P6JS79      ELPSLRVLTAGVL-----PSNPSELLQSPLAQQLFK-HFRESKQF--D--YIIFDTPPLL
                       :  *          .                             :..*  *  

A0A535RWE5      AVTDAIALSAKVDACLVVVDAARTRTGSAIRTVESL---R-RVRARIVGGVVNKVRSTPA
A0A0P6WSP2      SVADSIILAGELDGTMLVARSGMTTRKMLREAEENL---R-QVRGNLIGVVLNGVPRDQH
A0A5C7JWY1      PIADAAVLASKVDGVLLVVSAGETTRDACHLAIQRI---K-QAGGRLLGVVMQKAPVSES
A0A1F8QGH2      PVADAAILTSLVDRVILVLRAGQTRHRAAQQAVKSL---Q-QAGAQQIWVVLNAVPHHMD
A0A1Q7TTL6      AGVDPLILGTLTGHLVVVLRTGFSHRDVAAAKLEVL---Q-RLPVRLLGAILN--AVPAG
A0A0S8KFR9      AIADAATMASMVDGVLLVAAKDQATGRRVQRALQQM---A-RVGAKPLGVVFNRASAADG
A0A535SLQ0      AGVDAFVLASLAGCLLMVLRLGKTDRELAEVKIDLL---R-QSPVRVLGAVLN--DVREG
A0A363SX22      -VADAWALSAKVDGVVLVVEPGRLKRKTAQAIMDRI---Q-LSRVRIVGLVLNRVKKGSE
A0A326UPN3      PVADAQIVASYAEVSVLVVAASRSPRRLLNRAMQIL---R-RTGTRVLGLAINRSQWPEY
A0A455STY5      PVADAQIVASYAEVSVLVVAASRSPRRLLNRAMQIL---R-RTGTRVLGLAINRSQWPEY
A0A3A4VPK9      -VADSQILSSKVDAVLLVIQPGKTSKEAAKATEDLI---K-RAGGHIIGVVFNRIPRDRV
A9B6E3          TVTDPIALIPRVDGVVLVAEAKRTRRDMLAKCRAAV---Q-TVGGRVIGLVFNKLDPRSE
A0A3D0CW53      VVTDATILGTLSSGIVYVVNAGRTRSGVVRRGKETL---D-QVGLKILGVVLNNSTSHRA
A0A1F8SS27      -VSDSMVLSPKVDGVLLVAELSQTKKKQIRRTVEQL---N-RTGAQVIGVVLNRATGESL
A0A2E0L5X9      GGSDSVFLGEISDGVIIIVNARRTRLSSLRRSKDEL---MAAPNVNILGVVFNRVRLQVT
A0A3A0AXU8      TVTDALLVVPHMDGALQVVDAGSTRRDLALRCKALL---E-RAGARLLGPVLNRVEAGDL
A0A3D1JCW0      TVTDTVALSKAVDGILIVVRLGKTKRGEFLQAIEHL---R-QVNANLVGVVINGVSPRHA
A0A2N2MJJ0      -VADSQSVSASADGIIIVVEAGGTRAEPVRAMLESL---R-RTHTRILGLVINRMK----
A0A3M1LAM5      LAPDAVILATRADGTVMVVSAEHTSRQAARRAIKVL---RDQEGVNFLGVVVNRIPLHHY
A0A536BZ00      AVTDAAILASAVDGTLLVVDAHRTRRDLARGGANAL---K-RVGARVLGVVLNRVSGGTL
E8N5M1          SVTDAAVLSPLVDGVLLVVKMGTTKQSALLQAVEQL---Q-QVNARILGVVVNGVNPKKS
A0A1F8U7F0      -VADVQVLAGKVDGVILIIHPGHTQEDASLATLEML---N-RAGARTLGVVLNRIP-RGR
A5V160          AVADAIPLAHICDATLLVVLAGATRTSQLRRACDQL---L-QAGVEPQGVVLNRVT-KEQ
A0A2A6REI6      QVADASMLMQLCDTVVLVATDGKTRTSALRHSMQLL---E-QSGVKLAGVVLNRVR-KSR
A0A426TTK3      QVADAALLMQLCDTVVLVATDGKTRTSALRHSAHLL---A-QSGVKLAGVVLNRVR-KSR
A7NIZ1          AVADAMPLAHVCDATLLVVLAGVTRTSQLRRACDQL---L-QAGVEPQGVVLNRVT-REQ
A0A0P6XM68      -VADASILASRVDGVLFVIHPGRTPVDAAQATLEQM---R-RVGANVLGLVLNRIP-RNR
A0A2N2MEG3      -VADASILAARADGVVLVIRPGKTPLDAAMTTLEQM---K-RAGANILGVVLNRIP-RNR
A0A353RQ31      -VSDSQILATRVEGVLYVIVPGSTRIESAKRPLEEL---E-RINAHLLGVVMNRIP-HNR
A0A3B9KNR2      -VSDSQILSTRVEGVLYVIIPGFTRIDSARRPLEEL---E-RINAHILGVVMNRIP-QNR
A0A0P6XME1      -ISDAIVLASRVDGVLLVLRARNTSQSVALEVLDQL---D-RVKARVVGAVLNRVQDTTS
A0A3B9Q1T8      -VTDAQILGTKVDGVIFVIRAGKTRANIARMSLDEF---N-RVGAKVVGLVMNRVP-RNQ
A0A1F8PTW9      -IADTMILASKVDGVLLVVRPGHTRQPLAQVTTEQI---N-LVGARLVGVVLNRIPLHGA
A0A1F8QH26      -ISDAMILAAKVDGLLLVVRPGHTRQPLAKVTKEQI---G-QIGANLIGVVLNRIPLRNA
A0A359HML3      VT-DAAVLAKKVDGILLVVQLGKSRRDTVKEMMVQI---E-RTGTSVLGVIINKISSGSN
A0A3M1EJ46      AVTDAAILASLVDGVLLVIESGRTSKGEAQRALHTL---Q-AVGGRVLGAVLTRSKAEGI
A0A2U2S5W9      VVTDASVLATRVDGVVIVTDSGHTRRDTVVRAREAL---R-KVGANLLGGVVNRL-SPRS
A0A0M8KAF3      VVADPALLARMSDGVLLVTRMNVTHRQALQRAIEQL---R-YAEARILGVVVNDL-TARD
A0A523V9H6      PVADAAALAQAVDGVVLVVDAGATRRGAAQQAVENL---R-QVGANVIGAVLNNVPMTRR
A0A3D1U3H5      AVTDSAVLSTMADRVVLVADPRKATRHTLLRAKDVL---E-RVGSRVSGVVLNRVGEESS
A0A2N2MEK3      VA-DAQILASLMDGVLLVLQPG---KSPADEAKSTLAQLK-RSGAKVIGTVFNRVPKNGG
A0A3B9J9U6      VS-DAQILASLMDGVLLVLQPG---KSPADEAKSTLAQLK-RSGAKVIGTVFNRVPKNGS
A0A661VSD8      IAPDAAILASIADGTLLVVSEGQTSNGAAAKAQALL--SS-RSGVNLLGVAFNRVKLVET
A0A497C1E5      GPPDATVMATLVEGTILVASVGLTRREAVRQARDRLLGLG-QQGVTLLGLAVNRAKLDGS
A0A1W9UQ51      GPPDAMILATLVEGTVLVVSAGVTRRETIQQAKERLLGFD-QREVNLLGLTVNRAKLDGS
A0A497B563      GPPDAMILATLVEGTVLVVSAGVTRRETIQQAKERLLGFD-QREVNLLGLTVNRAKLDSS
A0A3D0UNQ0      YVTDAAILSRLVDGVVLVISAGKTRRDEARQAIFNL---E-QAGANILGVVLNGMAEKRG
A0A2G6GG97      TVADASIIGPQVNGVLLVINTGRTRQEAFINAVDRL---R-RTGTHIFGAIFNRVKLDRS
A0A521TS25      AVSDPMVMAPVADGVIVVVDAGRTSADLLRRTRDSL---Q-RAGANVLGVVLNKLTERSG
A0A3M1H759      AVTDAAVLANRVDGVILVIRSGRIPRATLKKAVARL---K-QIRANILGAIVNQTPGKGD
A0A535D584      AVTDALPLAAEASATVVVIEAGATGARQLQRALEVL---K-GSGANVIGVVLNKSRRDPP
A0A5C7JS64      AVSDALVVADVAKDVLLVCRANETRVDRLQAAVGAL---P-ET-ARVIGVALNYQKRGKA
A0A535IMD1      AVADALILSGKLNSTLLVVDSGKTRADAVRRSIETL---N-KVNAKVVGVVLNKMRRRHA
A0A521UD91      AVADPALLATRADGVILIVEAGGARVQSIVRANEVL---S-RTSARVLGVVLNKLSRRSS
A0A3C0LJ76      VVSDTAVLASRADGVLLAFTHEKLRRDPARNTIGAL---R-QVQARILGVVLNRVEGSQH
I0I8T2          VVSDTAALASRTDGVLLVFSREKMNRDLAHKTMGAL---R-QVNASVLGIVLNRVTSGEH
A0A497ASN6      AVADTIFLGKWLDGILVIAEWGRTDRSAFVESVERA---R-QSGLRVLGAVLNKVKPPSR
A0A3D1TRD4      AVADAMTIAPNVQGILFIIESGSIRLGRLNEALGRL---R-RSGTPILGVILNKVKADTE
A0A3C0XJG2      AVADAHALSTMVDGCVVVVDSARTPARASRRAVDVL---N-AVHARILGVVLNKVPAIQL
A0A3M1ZZ81      TVADAAILAPRVNGCVVVAEAGSTRRPLFLQAIERL---A-RTGTNLYGVVMNRSKPGRA
A0A497AF06      AVTDAVVLASKASGVILLIEAKRTSHEAARRAYESL---Q-RVGATILGAVLTKAKPERK
A0A661W444      AVTDAVVLASKASGVILLIEAKRTSHEAARRAYESL---Q-RVGATILGAVLTKAKPERK
A0A3D0D4X6      AATDAAILAAKADGTLLVIDTNLTKRTELVHTTEQL---Q-RVGATLLGATLNRLRRHNL
A0A1J4ZRV4      AVTDAAVMGRQVDGVVLVVDAGQTREQVLAQAAAEL---Q-QTGANLLGVVLNRLDSRRG
A0A1V5RXW5      AVTDAAVLGRQMDGVLLVVDTGTTREQVLGNAVAEL---Q-KTGVNILGVALNRLDTRRN
A0A522N7L9      AVTDAAILAAMVDGALLVVDGSRTRRGAVQMGREAL---A-KADAHVLGVVLNRLSERVY
A0A535W4H1      AVADAAILSARVDGTIIVVDAGKSRRESVVRARDTL---V-RAGAQILGVVLNRVARDVD
A0A521IC37      VVADANILASRCSGAIIVMDSGRTRTDAARKVVETL---T-RSKVKILGIVLNRVSGRRG
A0A3A0B2P8      ATVDASILATHVEAMLLVVAAGRTQRTPTQRVVKSL---R-HLQVNLLGVVLNAVPVSQT
D1CAL1          AVSDALVLSRLTNGVILVSETGRVRTAEIADAVQQI---Q-QSGSTLLGIILNRFPLEKS
A0A497BNC7      AVTDAAVLSTLADGTMLVFDCGETRKPAAVQAFERL---V-SVGGQVLGVVLNRLAPSGD
D1C8M3          PVSDALVLAGLVDRVLLVAYSGRTRSAELARAVEEL---T-RAGTPLLGVLLNRAEAGAG
I4EI06          AVSDPLIIAGLVDGVLLIMTGGRTRSGELTQVVQEL---T-RTSTPLIGAVINRVDVKGD
A0A2E5F6N9      AVTDSSILASKQIETVLLVDP-NTRMGWLKDCIGAL---R-KADATVLGYIHNRINARRF
A0A2E6J6X7      MVADTPIISTVVDMAILVVDSFTTKTSSFGATVETL---N-NSGVEIAGVIMNKLKKPKF
A0A3M1EAN8      EVPDGLELAALVDGVLLAMQNGRSGRYEVQDAVRRL---Q-YARAELLGTVLTRCQGRGG
A0A535QK16      AVTDASVLAAGVDAAILVIDTNKATYPAVQHAKQAL---E-RVGGNVLGSVMNKMKAAGG
A0A1F8RRT9      AVADASILAGKVDGAILVVDTGRTRAHALQRASEAL---A-LSKTKVLGAVLNKLTGRGQ
A0A535FRM3      PVADAQIMASYMDATLLVIDATIASRKQILQAVNIL---R-KSGTNLIGTALNK----SQ
A0A401ZA55      PIADAQIMAAYMQVTIMVVNASRTPRKAMVRAKQAL---A-RTGTRILGVALNK----SY
A0A4P6JS79      PIADAQILASYVDVSVLVVDASKTARSLLTRTKEVL---T-KAGTEFIGVVLNK----SQ
                   *   :       :                                            

A0A535RWE5      GYYGY-------YGPGDARKNASRASGIRLPFSSRWLLVPLIGIVVLGAGALFARAGQTV
A0A0P6WSP2      SAYRY-------------------------------------------------------
A0A5C7JWY1      SYY---------YG--------------------------------------AYQQQR--
A0A1F8QGH2      GYNSY-------YT--------------------------------------NEHEDKNS
A0A1Q7TTL6      EAYRY-------YS--------------------------------------YYLPGYEA
A0A0S8KFR9      DYYYP-------YG--------------------------------------RGIIG---
A0A535SLQ0      SEYHA-------YG--------------------------------------YYMDGYEL
A0A363SX22      SDYYSG------YLADASKYDSQASNKR--------------------------------
A0A326UPN3      GDIHD------------YRGSVQTQGAPLLKAAPAAQQRVPQQASPVANQPQMQPAQMQP
A0A455STY5      GDIHD------------YRGSVQTQGAPLLKAAPAAQQRVPQQASPVANQPQMQPAQMQP
A0A3A4VPK9      DYYSGN------YQYQYYSKD---------------------------------------
A9B6E3          GYGVY-------YTYYYDQHHTSNRGRR--------------------------------
A0A3D0CW53      RGYYYQR-----YYYSHESTGERRGRRL--------------------------------
A0A1F8SS27      KYYGA-------KQYVGYGLEEADEKLP--------------------------------
A0A2E0L5X9      SKYNN-------TYYRQTPALTPEKLSREMARSGSGLFGMRRHIITTGRGERLFSVSACA
A0A3A0AXU8      GYYANY------YSYGGYYHEEAEEAKG--------------------------------
A0A3D1JCW0      R---YHYYYRNYYYYQYSAYYGEGEKRKPSSNGSRSNGKHAPVPHPAGESAPREPL----
A0A2N2MJJ0      ------------AHHGEYGHYSNSYYQDDIEGN---------------------------
A0A3M1LAM5      AYYLP----------------------------PQVTGEAAAVSLP--------------
A0A536BZ00      DVYGPSYYDEDRAARPKSRSGAGSRSREPKPGTPRVARAPGAATSPAPAQAAAGSPVAAG
E8N5M1          HYYYRNYGYYQYYYYGDNGNL------------KKKRKTAISE-----------------
A0A1F8U7F0      S-----------DYYGGYRHY------SPYYSGYHYYHSMDGQ-----------------
A5V160          GGYDH-----YYYYYGQNRKRSR---RGVLSRLFKRRRRRNAVPGVVDTLDTVMSGSGQT
A0A2A6REI6      YGYGYGYGYGYGYGYGYEPEPEKLTWRRRLRRMWRRLLGRKAAPQ-PSTASGVAGGDWED
A0A426TTK3      YGYGYGYGYGYGYGYGYEAEPEKLNWWRKFRRALRHLRGGKTRAH-PRPVPSGSPEDWED
A7NIZ1          VGYEH-----YYYYYGGERKRSSRSALSRLFKRRRRRQSGMPGMVDTVDAGVTGIASGTR
A0A0P6XM68      P-----------NYYGGYRYY------SGYYKGEYSY--------------YDDEARGNG
A0A2N2MEG3      P-----------NYYGGYRHY------SGYYKGEYSYHNYYDEGSSSNQRAYRGNGNGNG
A0A353RQ31      S-----------YYYGGYDYY------SPYSSRDKYRHSYGSE-----------------
A0A3B9KNR2      S-----------YYYGGHDYY------SPYSARDKYRHSYGSE-----------------
A0A0P6XME1      N-----------HYYRSLKSY-----------------TYVSK-----------------
A0A3B9Q1T8      R-----------YYYGGYQYYGLKGEVNAAYDQGDPSENTVDL-----------------
A0A1F8PTW9      DYYTG-------KNYLYTYYLSNYGAER--------------------------------
A0A1F8QH26      VYYTG-------EGYLYTHYMSGYGAAK--------------------------------
A0A359HML3      YYSKY-------YGS--YYNIPDSEQND-------------------ADISETEIENNPQ
A0A3M1EJ46      G-----------YRY-------------------------------------DRRGVTPS
A0A2U2S5W9      GGYYY-------YYY--YYYAADGN-GE--------------------------------
A0A0M8KAF3      GGYYY-------YAYSQYYHHDDGSGGD--------------------------------
A0A523V9H6      GGYYY-------YYY--YYHQHYGE-----------------------------------
A0A3D1U3H5      GYYGY-------YYYGGYSAYVTDGQKV--------------------------------
A0A2N2MEK3      QHYGG-------YRY--YSTDSYNTYEQ------------------------KKPATPIR
A0A3B9J9U6      QHYGG-------YRY--YSTDS--------------------------------------
A0A661VSD8      ------------YAY--YSRYHDDGHGPVAKLRGLVTRWRRQESEDRPLVGLDEAAERLG
A0A497C1E5      ------------YGY--YSSGLEAVGSS-----------QKRVEGDSVWLTLGEAAEQLG
A0A1W9UQ51      ------------Y-H--YSSDQEGGEQK-----------QKGTSRDGAWLTLGEAAARLG
A0A497B563      ------------Y-H--YSSDQEGGEQK-----------QKGTSRDGAWLTLGEAAARLG
A0A3D0UNQ0      GYYYR-------YGS--SPHDQSLIGNR--------------------------------
A0A2G6GG97      SYGYY-------YYS--SYEYNAKSKKR--------------------------------
A0A521TS25      AYYYR-------YYY--AYYGEDQHGGK--------------------------------
A0A3M1H759      GYAEY-------FTP--LAQIQTETAKR--------------------------------
A0A535D584      REYLD-------YYF--SQAAASQPDSA--------------------------------
A0A5C7JS64      ESYYY-------Y----YSSDDSSGGSK--------------------------------
A0A535IMD1      EAYSY-------YYQ--YYTPGGEPARK--------------------------------
A0A521UD91      EYYY----------R--NYHRYYAASPV--------------------------------
A0A3C0LJ76      GYYYS-------YHK--SYGNRYYTTPY--------------------------------
I0I8T2          GYYYS-------YHK--SYSSRYYSGYY--------------------------------
A0A497ASN6      GYYYY-------YYY----------ESS--------------------------------
A0A3D1TRD4      GYYYY-------AYD--GYYSSSGKPAT--------------------------------
A0A3C0XJG2      DYYQS-------YA----------------------------------------------
A0A3M1ZZ81      SYYDD-------YYY--YATYEYVEGRR--------------------------------
A0A497AF06      AYYYY------------------AERAR--------------------------------
A0A661W444      AYYYY------------------AERAR--------------------------------
A0A3D0D4X6      AGYYY------------YYYDVSSDHNE--------------------------------
A0A1J4ZRV4      GYYYY-------Y----YYYSEEEGGQR--------------------------------
A0A1V5RXW5      GYYYY-------YYH--YYYQEDESGER--------------------------------
A0A522N7L9      ADYYH------------YYGASGYHEAQ--------------------------------
A0A535W4H1      GAAYI------------TYAAAAPDEDR--------------------------------
A0A521IC37      GYYNN-------YYY--YASPKSNGKAK--------------------------------
A0A3A0B2P8      VYHAG-------YGY--AVPRAADAEGT--------------------------------
D1CAL1          GGYYT-------YYR--SQEDDAGGARR--------------------------------
A0A497BNC7      GYYYY-------YSY--YSHADGGAAGG--------------------------------
D1C8M3          GYDLY-------YAE--YYSAEPDTGDQ--------------------------------
I4EI06          GFYAH-------YAS--YYGAGSDRVGD--------------------------------
A0A2E5F6N9      GYGYT-----YYNYYNY-YKSYNEGGSDDARAPSFIGRIRNKLFSS--------------
A0A2E6J6X7      GYGYGYNYGYYYNYYYYNYKYSLEDTNPESKSSKNPFRIFRSIFNR--------------
A0A3M1EAN8      YTY----------------------TVH--------------------------------
A0A535QK16      NYYYY-------AYDYNYGHPNGKAPIE--------------------------------
A0A1F8RRT9      GYYYY-------SYHYYSSSDDGKNGHR--------------------------------
A0A535FRM3      WPEYN-------HVQEYLATLHAQRTKK--------------------------------
A0A401ZA55      WPEYG-------EVHDYLSNI--QSRPR--------------------------------
A0A4P6JS79      WSEYG-------FILEYLGSV--QQRPR--------------------------------
                                                                            

A0A535RWE5      VPEAPRKTVSLERAIEELAAARAAWEGDLHDASSARSRLESADAYLADATAAGADATRVS
A0A0P6WSP2      -----------ESGEEERPSAQRWFDVLQYWVKTPWFKKK--------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      GGSTLQVSLEGEEKNASPTLD---------------------------------------
A0A1Q7TTL6      VDEEAERA---SGGKGQPFVI---------------------------------------
A0A0S8KFR9      GAEPVLPSFL-GNFVGRFSIIRRIWERAPGLDEDRSPEDQ--------------------
A0A535SLQ0      TGEPLFRPLVDGTKRGRPPVTARK------------------------------------
A0A363SX22      ------KANLQDIQSTSGLGLSLIPKKTPGNSHRFRNAQKQNKPTPINEPNSGEINRNIS
A0A326UPN3      MQQMQPGHQMAPNSPSMMPNAPSMAPGSAPMMPPLNGSRGLLSQQQPQQNNQRR------
A0A455STY5      MQQMQPGHQMAPNSPSMMPNAPSMAPGSAPMMPPLNGSRGLLSQQQPQQNNQRR------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          ------FWNRKDDHQPVPSMSEPAPLDLHDPALDRSEAAYEMASHERSK-----------
A0A3D0CW53      ------RAGAVSHRFAVNGQGTGQLKSSTTDHPTTSEDDVR-------------------
A0A1F8SS27      ----NVKSYLNAVRAIPNYIARRFSRSNEAKLEKK-------------------------
A0A2E0L5X9      ARLGVKRRTVQGWIETGHLQAESRFMRQWIPESAIDMVLSQRITTVEPPTPASGVSEESP
A0A3A0AXU8      ------GFWRGRGGRRAAPVRESALPAAPQPARPAVASRMAGAREKGGRVSDGG------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------NGKKSRLRLPWAKKVQQD------
A0A3M1LAM5      ---RRVWRRLTGFLKPIRRRLGLGRERIHEDGRVLLSLAEAAHLLGVRKETARRWCAS-G
A0A536BZ00      SIASSVARPPSTSMQPAAPRAATSPPPFSLPAAPVARSSAAAQSPAPQPVSPRPVPPRLA
E8N5M1          ------------------------------------PGSQPVTSINPPSKPTSR------
A0A1F8U7F0      ----------------DLKPSRMRRLFGKLSPFNHNGHKKVEAGVVEENVIEKP------
A5V160          LYGAPDVVEATVHRRAPDMTTHPDAQPAVTATTAVQGLDERRNGRAPHQ-----------
A0A2A6REI6      LTAIEQMETTHANGQNGH-NGHNGQNSQPQPVQQKSDTGRQQSSRSRGRRRSGD------
A0A426TTK3      LVALEQMEGVSGNGHNGNGNGKEHARPGDSATPTGNASSRQSSSRPRSRRRSGD------
A7NIZ1          PDRGAPIDIVMDGFYATPTPETIDRHPVSAGAVVATRTDERRNGMTPHQMNQTK------
A0A0P6XM68      KKH----------------------------STFRWRTRKNQTQEEKTAESGQE------
A0A2N2MEG3      KSK----------------------------MTSWFGRAKKAPGEAPAQEQEKQ------
A0A353RQ31      ------------------------------------ESTEVALTEQKGNKVLHH------
A0A3B9KNR2      ------------------------------------ENIDLAFTEQKGT-----------
A0A0P6XME1      ------------------------------------ETDELTLLEN--------------
A0A3B9Q1T8      ------------------------------------QKEGIQRMDN--------------
A0A1F8PTW9      ---------------------DDLIIDD--------------------------------
A0A1F8QH26      ---------------------KTNNNGEGGEVGEGGEVGEGGEGGEGGEGGEGE------
A0A359HML3      EPGVETDATSEPPKDEMKPDPEIILNEQNREISSHSEDVPQGRNPKLRGLLTFG------
A0A3M1EJ46      QLADMVSMLTPSGKGLS-------------------------------------------
A0A2U2S5W9      ------QKRKRKKKHTNHSEQGGFLRGLFGRSQEHTGSSGEGRTENVQHS----------
A0A0M8KAF3      ------GTRPERKRRRADASRKGVMARLLSFVNVKS------------------------
A0A523V9H6      ----------EEGKKSRGGRRKGFLAGLRRRRAKRGEEREAAGEG---------------
A0A3D1U3H5      ------SSGSRNGKRAAK------------------------------------------
A0A2N2MEK3      VMAPVPAAFEPTTRPNGHHSVELVN-----------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ISKGMARRWCKEGRLPAHKSRLRWW-VKREDLENLVESLRNGDAEIIRET----------
A0A497C1E5      ISRDQARRWCKSGRLPAVRKW-FWWRVESDGLDRMLEDTWEIKRSG--------------
A0A1W9UQ51      VSKDQARRWCKSGRLPATKKWQLWWRIDPGGLERMLEDTWELKAKV--------------
A0A497B563      VSKDQARRWCKSGRLPATKKWQLWWRIDPGGLERMLEDTWELKAKV--------------
A0A3D0UNQ0      ------IRAGLQQARNTLTSAYERLRKKEDVIQDSTQLPDEGKEMTHNIP----------
A0A2G6GG97      ------RSRRLSKSSRIPSWITSIIKRS--------------------------------
A0A521TS25      ------KSRRRRPKILRALGIGGR------------------------------------
A0A3M1H759      ------PWWKPSFLR---------------------------------------------
A0A535D584      ------NAEKPARRPAVQSPVASAR-----------------------------------
A0A5C7JS64      ------PPSQNGSGRNFGQKVRELVPGGASKL----------------------------
A0A535IMD1      ------KGLFSRRHRTSAKKNEAVQ-----------------------------------
A0A521UD91      ------S---PNGSKK---------EPALIGGRHSNGGHRL-------------------
A0A3C0LJ76      ------SQHKPKSGKRSAPTARTVSQPGA-------NGAGATHVTEAAPSKKRA------
I0I8T2          ------A---PRRHAKAAAETTMVVSPQPVPHRSINNGAPLEPESVGQPKSVK-------
A0A497ASN6      ------DGKKPWWKRLFKKHKKRSVRKQG-------------------------------
A0A3D1TRD4      ------EHVNGVIEVVEHGAAPVGDGKSGSRRQG--------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3M1ZZ81      ------KKRRRRSRSLLPGWITAIIKR---------------------------------
A0A497AF06      ------PTRHPLWKRWLKAYPKSAGSSGFNRLGND-------------------------
A0A661W444      ------PTRHPLWKRWLGGFVKSR------------------------------------
A0A3D0D4X6      ------SGPAPAQRRKRKGFLGSARHTAE-------------------------------
A0A1J4ZRV4      ------RRSISPHGADEEGAPARGRARFPWPRLRA-------------------------
A0A1V5RXW5      ------RKHSSRRGTGV-------RFRLPWPRKAA-------------------------
A0A522N7L9      ------SGHDGASDAPATHREPRPTLRVP-------------------------------
A0A535W4H1      ------ATSSKPG-----------------------------------------------
A0A521IC37      ------GTPALSVKGNGHANGNGHTNGNGAGKTETPSEKSKM------------------
A0A3A0B2P8      ------RRGALQIQANGQAGAHTL---PALQEGIKPASNPLYQALRKR------------
D1CAL1          ------GESPSVIPHWADGAGDRVVIRRSLRPTISKPADSET------------------
A0A497BNC7      ------RRPRSWIARLLKPGRSRRRRGAEVQGGGRTGAQR--------------------
D1C8M3          ------DGSGPGASTRLSQRLGTLVSGRAVDATQRGNQ----------------------
I4EI06          ------GNPVASLGTDLDGRHAS--PDRPVRRVGDPGD----------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------PAPAPHTPKVVPLVAPPDGKETLFPPEQHPG-----------------------
A0A535QK16      ------TAKPSPAEKETPVAGSKG------------------------------------
A0A1F8RRT9      ------KGRLFRGKRSQPAEETRTHA----------------------------------
A0A535FRM3      ------VDIVPVTPAYQPIADEQIPDDTLSLKQLP-------------------------
A0A401ZA55      ------ADIAMAMPPNTPAINHAIDATNTAILPSTNNKR---------------------
A0A4P6JS79      ------ADISMSIPPTTASSNGSVDGDTSITASLRKGSD---------------------
                                                                            

A0A535RWE5      SVAQDVARLRATLDAAPAKSALVVNLAKLDKAAMPTQIVIAGVTYALDSGTQKIWRIDTD
A0A0P6WSP2      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A363SX22      NKLL--------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      DSSNGTHGTPGDLRAQREAILDFVSRPNKSDSEN--------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A3M1LAM5      RLPAVKRGLRWWVEEEALQAMLNVQLGWDPDGWRQVVREQARGVTGHRGAEAPGQPGDAA
A0A536BZ00      RLPRPPQRLP----------------PWPPHRWAR------RRLGQHRGGYHRPRARRRI
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      GSATAVIQKGLAGIGSPQRMAVAGDVLYVLDDGGKIFKWQRETLTPLSVADRRYKDVAQF
A0A0P6WSP2      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A3M1LAM5      PAMEPVAVDSNLVREEDADGPA--------------------------------------
A0A536BZ00      PRLSACRE----------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      VVVANSMYVLDKTSAQVWRYQLVVGGFAAPVALLDQPVPGTPRSLAVDSDIWIVTTDAQV
A0A0P6WSP2      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      LRYHINAGATTASRVPFDIHWTADAALPIDLQVRDGDSRLFLLDDRARRFIVVDRDGREI
A0A0P6WSP2      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      ARIATAPELPRPIAFAISGDGILSANEGTIQRTPIPK
A0A0P6WSP2      -------------------------------------
A0A5C7JWY1      -------------------------------------
A0A1F8QGH2      -------------------------------------
A0A1Q7TTL6      -------------------------------------
A0A0S8KFR9      -------------------------------------
A0A535SLQ0      -------------------------------------
A0A363SX22      -------------------------------------
A0A326UPN3      -------------------------------------
A0A455STY5      -------------------------------------
A0A3A4VPK9      -------------------------------------
A9B6E3          -------------------------------------
A0A3D0CW53      -------------------------------------
A0A1F8SS27      -------------------------------------
A0A2E0L5X9      -------------------------------------
A0A3A0AXU8      -------------------------------------
A0A3D1JCW0      -------------------------------------
A0A2N2MJJ0      -------------------------------------
A0A3M1LAM5      -------------------------------------
A0A536BZ00      -------------------------------------
E8N5M1          -------------------------------------
A0A1F8U7F0      -------------------------------------
A5V160          -------------------------------------
A0A2A6REI6      -------------------------------------
A0A426TTK3      -------------------------------------
A7NIZ1          -------------------------------------
A0A0P6XM68      -------------------------------------
A0A2N2MEG3      -------------------------------------
A0A353RQ31      -------------------------------------
A0A3B9KNR2      -------------------------------------
A0A0P6XME1      -------------------------------------
A0A3B9Q1T8      -------------------------------------
A0A1F8PTW9      -------------------------------------
A0A1F8QH26      -------------------------------------
A0A359HML3      -------------------------------------
A0A3M1EJ46      -------------------------------------
A0A2U2S5W9      -------------------------------------
A0A0M8KAF3      -------------------------------------
A0A523V9H6      -------------------------------------
A0A3D1U3H5      -------------------------------------
A0A2N2MEK3      -------------------------------------
A0A3B9J9U6      -------------------------------------
A0A661VSD8      -------------------------------------
A0A497C1E5      -------------------------------------
A0A1W9UQ51      -------------------------------------
A0A497B563      -------------------------------------
A0A3D0UNQ0      -------------------------------------
A0A2G6GG97      -------------------------------------
A0A521TS25      -------------------------------------
A0A3M1H759      -------------------------------------
A0A535D584      -------------------------------------
A0A5C7JS64      -------------------------------------
A0A535IMD1      -------------------------------------
A0A521UD91      -------------------------------------
A0A3C0LJ76      -------------------------------------
I0I8T2          -------------------------------------
A0A497ASN6      -------------------------------------
A0A3D1TRD4      -------------------------------------
A0A3C0XJG2      -------------------------------------
A0A3M1ZZ81      -------------------------------------
A0A497AF06      -------------------------------------
A0A661W444      -------------------------------------
A0A3D0D4X6      -------------------------------------
A0A1J4ZRV4      -------------------------------------
A0A1V5RXW5      -------------------------------------
A0A522N7L9      -------------------------------------
A0A535W4H1      -------------------------------------
A0A521IC37      -------------------------------------
A0A3A0B2P8      -------------------------------------
D1CAL1          -------------------------------------
A0A497BNC7      -------------------------------------
D1C8M3          -------------------------------------
I4EI06          -------------------------------------
A0A2E5F6N9      -------------------------------------
A0A2E6J6X7      -------------------------------------
A0A3M1EAN8      -------------------------------------
A0A535QK16      -------------------------------------
A0A1F8RRT9      -------------------------------------
A0A535FRM3      -------------------------------------
A0A401ZA55      -------------------------------------
A0A4P6JS79      -------------------------------------
                                                     

© 1998-2020Legal notice