BYKdb

Dataset for cluster tadcd of phylum chloroflexi

[Download (right click)] [Edit] [Sequences] [Repertoires]

82 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A535RWE5      ----------------MQSLVPEGDARPSADLSERPFVPPRRALLAGERLL-RAIRR---
A0A0P6WSP2      -------------------------------------MLSNREAVGLKWLA-NWNSP---
A0A5C7JWY1      --------------------------MVKGESVNGKTVIMDEAEYTISEYA-TACWR---
A0A1F8QGH2      --------------------------------------MTNNANTDLRRIF-SVIRR---
A0A1Q7TTL6      --------MTLSNLPAPLVPPPVTAPGLPQRGVAAFDSDHSESGVDWRRIL-SAVLR---
A0A0S8KFR9      --------------------------------------------MELRAYL-EILIR---
A0A535SLQ0      --------MSRVMSEHPPNDARVTSGSIVDRG----ELEAPVSTVRLDDLF-AVVRR---
A0A363SX22      --------------------------------------------MELISFL-KIFLK---
A0A326UPN3      ------------------------------------------MRISLSRYI-LLAKK---
A0A455STY5      ------------------------------------------MRISLSRYI-LLAKK---
A0A3A4VPK9      ---------------------------------------MEDETIDLRQYG-LLLKR---
A9B6E3          -------------------------------------------MNIIRRYI-TGLRR---
A0A3D0CW53      --------------------------------------------MELKEYA-SVLWK---
A0A1F8SS27      ----------------------------------------MNDYIELHRLF-TMVLR---
A0A2E0L5X9      -------------------------------------------------ML-RAILR---
A0A3A0AXU8      --------------------------------------------MELLTYW-KILRK---
A0A3D1JCW0      -----------------------------MEHFDGEESTLNTGDTDLRKYL-WLLWQ---
A0A2N2MJJ0      ---------------------------MEENNDNDTLEFDLIDAASLRRMG-GLLWR---
A0A3M1LAM5      ----------------------------------------MSMTFSWRLVW-RLVKQ---
A0A536BZ00      --------------------------------------------MDLRRQL-AVLRS---
E8N5M1          ---------------MLYLDTGGMLPIRGNFSMEDFAEPVQQPSTDLRQYL-WLLWQ---
A0A1F8U7F0      --------------------------------------------MEIKRYF-SLVRR---
A5V160          --------------------------------------------MTLQRYL-TLFWR---
A0A2A6REI6      ------------------------------------------MDNELLRYL-FIIRR---
A0A426TTK3      ------------------------------------------MDNELLRYL-FIVRR---
A7NIZ1          ---------------------------------MRQVDEQSEHRMILQRYL-TLFWR---
A0A0P6XM68      --------------------------------------------MEIKEYL-QIARR---
A0A2N2MEG3      --------------------------------------------MEIKHYY-MIAQR---
A0A353RQ31      --------------------------------------------MDIKHFF-NIAKR---
A0A3B9KNR2      --------------------------------------------MDIKHFF-SIAKR---
A0A0P6XME1      --------------------------------------------MQPRDYL-VLIRR---
A0A3B9Q1T8      --------------------------------------------MDIRRIL-YLLKR---
A0A1F8PTW9      --------------------------------------------MELKKYI-FPLRK---
A0A1F8QH26      --------------------------------------------MEFKRYL-FPLRR---
A0A359HML3      --------------------------------------------MDIAELI-YPLRR---
A0A3M1EJ46      --------------------------------------MINEDQMELRHYL-AVLWT---
A0A2U2S5W9      --------------------------------------------MTLRQYF-AVIWR---
A0A0M8KAF3      ----------------------------MNTPLVPPDMLTDEDTIDLRQYW-LLIRR---
A0A523V9H6      --------------------MSGSTVAGQAVGLSEGSALGEEQ--DLRVYL-AVLRR---
A0A3D1U3H5      ----------MGSLNRRQEFDSVGIALNPATQALDAEQSSGDRAALLRWYY-HLVRR---
A0A2N2MEK3      --------------------------------------------MEIKHYL-GMLQR---
A0A3B9J9U6      --------------------------------------------MEIKHYL-GMLQR---
A0A661VSD8      ------------------------------------------MEIDLRRYL-MVIKR---
A0A497C1E5      ------------------------------------------MNKQVTQYV-RLIKR---
A0A1W9UQ51      ------------------------------------------MNKQVAQYV-RLLGK---
A0A497B563      ------------------------------------------MNKQVAQYV-RLLGK---
A0A3D0UNQ0      -------------------------------------MDELNDFVEIRHYI-SIFLR---
A0A2G6GG97      --------------------------------------------MELKNYF-LLIWR---
A0A521TS25      ------------------------------------------MTLQFARVW-SLWARYGH
A0A3M1H759      -------------------------------------------MAELRRYR-NIV-R---
A0A535D584      ----------------------------------------MERSFDLIQLL-KLVRR---
A0A5C7JS64      ------------------------------------------MDLTLHNLA-AMARR---
A0A535IMD1      -------------------------------------------MMELKRYL-STILK---
A0A521UD91      ------------------------------------MLRKEGRVVELRQYA-TLVQK---
A0A3C0LJ76      -----------------------------------------MDNRELQMYL-RPLLR---
I0I8T2          -----------------------------------------MNQRELQAYL-RPILR---
A0A497ASN6      -------------------------------MEELEKKSWVEEEIDIREYA-RVLQR---
A0A3D1TRD4      MALIAPPMRYTDAGSVTWPAGLSQYSASDTSSADQFNRRYGESMLPNIDYL-VWVRR---
A0A3C0XJG2      ----------------------------------MDDSSRGVPGFARARVL-FMFRR---
A0A3M1ZZ81      --------------------------------------------MEIRQYI-RLIWR---
A0A497AF06      --------------------------------------------MELREIL-RVIQR---
A0A661W444      --------------------------------------------MELREIL-RVIQR---
A0A3D0D4X6      --------------------------------------------MELRQYA-RIVWK---
A0A1J4ZRV4      --------------------------------------------MELRQYA-LLLRK---
A0A1V5RXW5      --------------------------------------------MELREYM-ALLRK---
A0A522N7L9      --------------------------------------------MDLRRQL-TIVRA---
A0A535W4H1      --------------------------------------------MDLRRQL-HIVRT---
A0A521IC37      --------------------------------------------MELRRYL-SLLKK---
A0A3A0B2P8      -----------------------------------------MEELNLRLLL-RPLLK---
D1CAL1          -----------------------------------------MRDLTFIEIL-GLIRR---
A0A497BNC7      ----------------------------------------------LRQYI-AIIRK---
D1C8M3          ---------------------------------------------MTSSIL-ARGLR---
I4EI06          ------------------------------------------MDMTIADML-KLGRR---
A0A2E5F6N9      ---------------------------------MVEQNFDEESSLDLRQYV-DALIR---
A0A2E6J6X7      -----------------------------------MNQNEQEQSIDFKKYI-GLAIS---
A0A3M1EAN8      --------------------------------------------MELKQYL-LILWK---
A0A535QK16      -----------------------------------------MVAVELIRYW-RVVRR---
A0A1F8RRT9      --------------------------------------------MQLARYL-RLAGR---
A0A6I1QLV0      --------------------------------------------MELRRYFSVLARR---
A0A535FRM3      ------------------------------------------MQSSLNRYI-LLAKR---
A0A401ZA55      ------------------------------------------MRSTLSRYI-LLAKR---
A0A4P6JS79      ------------------------------------------MRSSLSRYT-LIVKR---
                                                                            

A0A535RWE5      WAGLVGIAMIVGAVVSFGVSRV-IPPEYRATAQLYLAPAPNATAS---------VDIVGG
A0A0P6WSP2      SLRIVLGCVLIATLIACLVILL-IPPTYKSSTLLLIEPSPGLVTDDY-------SSIIAG
A0A5C7JWY1      HRWLILLVVGCFGIGAAVWSFL-QVPVYQAKATVVIDNPTPGGLDKD-------KSFYPD
A0A1F8QGH2      WLWLILGCTLVGGVIAFSVTSL-LPPVYKATATLLVEPSQESSPNDY-------STLMAG
A0A1Q7TTL6      FKWLIATMTLVGTVAGIGATRF-IKPEYSAQTKIWIDVEGRGQDRGP--------TPIRS
A0A0S8KFR9      RKWVVILTTLATVAAVVLVTSR-QQPVYSAAARVRVAQASSGSIEYV--------DYMYA
A0A535SLQ0      HIRLVLGVTAAVVAAAGYVAYV-TGSVYRAVAVIRLSDPRRAFTGGVVDDPALGADGRYA
A0A363SX22      RWWIIVLIFLVTVGSTAIFTWR-QNPTYSVTTTFVVSPSSTIFSDPR---SFLSGLDVLG
A0A326UPN3      WVWLVVVGVVICGVGTFAVSKLFIKPTYKASASIVVTLQTSSSPSDN---------ATAA
A0A455STY5      WAWLVVVGVVICGVGTFAVSKLFIKPTYKASASIVVTLQTSSSPSDN---------ATAA
A0A3A4VPK9      WSWLLVLSLVIGAATGLIVSLL-STPIFQSTAKVMITRAGQDQSSDV-------TAYLTT
A9B6E3          WLWLLVLGPVVAAGAAYGISSQ-QTPRYASSTRVIVGQTLKNSNPDY-------GSLVAS
A0A3D0CW53      WLWLIIVAMLIAAVSSYWASLR-MQPIYQTSTTLMVGQFIQNPNPTD-------QDLRIS
A0A1F8SS27      KWWLLIMVTAFAAALGYTFGHR-QAPVYEARATLLVGQIFESANLEK-------QDLQTS
A0A2E0L5X9      WWWLIVLSVSLGVGVGYIVRSQ-QPDLYFSEATVIVGADSNNPVPTG-----------VD
A0A3A0AXU8      RLLLIVLLILVAEFGAVYYVVS-RVPLYSTTTTMIITPSAMGSLLSY-------QVNLTL
A0A3D1JCW0      WAWLIGLATLLAAGAAFIVSEL-QTPVYQASTTILVNEAPST--QSS----NYSAIYLTS
A0A2N2MJJ0      NAWIIALAGLLLGLAAFIFGRM-QAPVYEARTQVLVSRPSMQ--SQI----VDITQSMNS
A0A3M1LAM5      WWWLLVVGAVLAGGTGYYFASK-KPNIYAARTTLMVGANIRN---PD----PNSRDFGLT
A0A536BZ00      RSRLIIGSVLLAAIASALVSLA-LPKVYQSRVTLVVGQSLAA---VN----PDINQLLVS
E8N5M1          WGWFIALAGVLAASGALILSLL-QTPIYAASTTILVNEARSG--QYY----DSTAIILTN
A0A1F8U7F0      WAWLGILGLVLGAAGGYFSSAN-QTPVYQASTRFVILRAAQT---TA----ADYYAYLDS
A5V160          WLWLMLLMTLIAGGAAYLVSRQ-MTPIYEASTTLLINQAPAG--SSS----PDYQAVLTA
A0A2A6REI6      WAWLIIIGTVLSASAAFLVSRE-MTPVYQASTTLLINQASAS--NAN----ADYNAILSS
A0A426TTK3      WAWLIVMGTLLSAGAAFLVSRE-MTPVYQASTTLLISQASAN--NAN----ADYNAILSS
A7NIZ1          WLWLMLLMTLLAGGAAYLVSNR-MTPVYEASTTLLINQAPAS--SAS----PDYNAVLTA
A0A0P6XM68      WAWLLILGLLLGAVSAFFFANS-QTRIYESSIRVQIVSAVKT--VPN----MDYNSYVEQ
A0A2N2MEG3      WAWLLILGLLLGGGGAYIFSSL-QEPVYQTTTRVQVVSASRVGGAGT----DAYSNFYIE
A0A353RQ31      WLWLVIAGVIIGAAVGYFVSSR-QTPIYEASSKFVILRAPQT----T----YDYYAYLDN
A0A3B9KNR2      WLWLVIAGVIIGAAVGYFVSSR-QTPIYEASSKFVILRAPQT----T----YDYYAYLDN
A0A0P6XME1      WLWLLGVGIFVGALGGLVFSLL-QKPIYQASTKVMVLGVPQS----N----LSDILNQNS
A0A3B9Q1T8      WSWLLIIVTLISGVAGYYFSSQ-QTPMYRASTRFVIMQPAST----D----SDNLSLVEI
A0A1F8PTW9      WWWLLLASTLVAVVLSYLYILR-QPKIYQTHTTLMIGTTISDPNPSS-------NEFALG
A0A1F8QH26      WWWLILASTLVAAVLSYLYLYQ-QPKIYQTHTTLMIGAAITNPNPSY-------NDFVLG
A0A359HML3      WWWLIVLATVIAAGASFAVARQ-QPPTYQSRATLMIGRTI-ENPNPT----S--VQFSLE
A0A3M1EJ46      WVWLLLLAPLLAAGISLAVSMH-IQPVYRASATLLISQASGPSLDSN---SY--NSLLTS
A0A2U2S5W9      WLWLIVLAGAVAGGAAYASSQS-MPRVYQSTTTLMVGQKVMRDPNVT----A--QDLYVS
A0A0M8KAF3      WWWAFVLALLLGAVAAYIASQF-QQPIYRAEARILVSQSSSSDLNDI----Y--RDIVIG
A0A523V9H6      WLWLVVVCTILGAASAFLVSSN-MAPVYEASATLLVHQAPSAGVSD-----Y--TAILTS
A0A3D1U3H5      WIWLIVLVTIAAGVTGYSVTTLFIKPTYVATATLQVDAGQ-LSSDVN----G--TGVIAS
A0A2N2MEK3      WAWLLALGLILGGVGSYLFSVN-QSPVYQSSTKLLVIRAP-QGQNSD----L--AYLA-S
A0A3B9J9U6      WAWLLALGLILGGTASYLFSVN-QSSVYQSSTKLLVIRAP-QGQNSD----L--AYLA-S
A0A661VSD8      WWWLLIIGAIIPAIISSYFTAK-QPALYQARVTLMVGTTL-QSSNPD----T--RAMQTS
A0A497C1E5      WWWLLLVSVIIPAVISYYFTTR-QPDLYQAKATIMVGASL-QNPDPD----P--GQMNLS
A0A1W9UQ51      WWWLFVISVIIPAVISYYFTAQ-QPALYQAKATIMVGASIFQDPNPD----Q--TAIRLG
A0A497B563      WWWLFVISVIIPAVISYYFTAQ-QPALYQAKATIMVGASIFQDPNPD----Q--TAIRLG
A0A3D0UNQ0      RWWLVLLTALVAAGIGYVVSQS-QDRVYRATTSVIVGQSIQATQ-LD----S--RDIQTS
A0A2G6GG97      WVWLIILGVVIAAIAAFLISKN-TAPVYQSTSRLLIDQAPGAGSGND----Y--TQILVE
A0A521TS25      WLWLIAVVTVVSGGVSYAVSRS-IPPEYRAVATLLVNQVQGSGGGAS----Y--TDIMTS
A0A3M1H759      WWWLVLLSTVIAAGASYYISDQ-QPRIYASTTTLMVGQAIAKAN-PS----D--QDLYLA
A0A535D584      WAPVVAFMTLLAGGLAFVVARA-AVPSYQSCGLLRVAVQAPSG-----------SQAASA
A0A5C7JS64      WWWLLVLAPLVAGVVAFAQVSR-QQELYSASSTVEINPPSMGTD----------QFTYYD
A0A535IMD1      WWWLIALSTAVAAAFSYYASAQ-SPRIYQTATTLMVGQALQSPN-PD----N--IQVYAA
A0A521UD91      WWWLVLLGFVVAGAGSYYVSKS-QVPVYRASVTLLVDQAQDASG-PN----Y--DAILAS
A0A3C0LJ76      WWWLILLSALLAGASAFVFVRL-RPPVYIASGTVMVGTAIQERN-PD----S--QQLSLT
I0I8T2          WWWLILLAMALAGTSAYIFARM-RPDVYIASGTVMVGTALQERN-PD----S--QQLSLT
A0A497ASN6      WLWLIALCSIIAAVSAYIISACFIQPVYKAEAVLMVEPSAGVSSSIR----Y--QDVLAG
A0A3D1TRD4      WLWLVLLGTLLGGGIAFGIAAT-TAPTYQSSATLLINASSTPNA-LT----Y--TDVLLS
A0A3C0XJG2      WGPLIALATVVAGGTAFAVSEV-LPKEYSATSQLYVAPAANPTAAL--------QDAVLG
A0A3M1ZZ81      WLWLIILGAIIAGGTAYVISKN-TVPIYRASSRLLIDEAPGSGSNNE----Y--AELLVE
A0A497AF06      RLWLIVLGTLLISIVVFAVSKN-MKPVYRAKVTMMIKQSSSMPL-AD----Y--TSILTG
A0A661W444      RLWLIVLGTLLISIVVFAVSKN-MKPVYRAKVTMMIKQSSSMPL-AD----Y--TSILTG
A0A3D0D4X6      WLWLIVICTAVSGAIAYVVSIN-TAPVYQATASLLIREGKDPES-TT----Y--TDLLTS
A0A1J4ZRV4      WLWLVVICTVVAGGTAYGVSKN-STPIYQASATLLVNQASNPVSGAG----Y--QDILTS
A0A1V5RXW5      WLGLILACMILAGGVAFFVSRQ-SIPIYQASATVMINQASSPSAAAV----Y--ADILTA
A0A522N7L9      HWRLIVACALLAGVAAFAVSSI-LPKSYHSEATLIVGQGLTSTD-PN----Y--NELLAS
A0A535W4H1      RLWLILLVTIAFGGAGLLAATL-APRQYEARATILIGQSLSSVN-PD----Y--NQLLTS
A0A521IC37      WGWLILLITGLAAAGSYFYSRT-IPPTYRTTAVLLVGQEQQSAN-PT----P--SEIYVS
A0A3A0B2P8      WWWLIAACTLLAGVSSGLYTLR-QPRTYLSRTTIMVGSSLLEPN-PN----S--NDLYLA
D1CAL1          WWWVFIVCPLLAAAAAYGVSRA-LTPIYRAEATLFIDQRETTGS-LN----V--GDIQAA
A0A497BNC7      YWWLILLTTVLATGAAFYVSVA-APPVYRATTTLEIDLGTNPLS-DP----YTVSNARTV
D1C8M3          WWWIVLVGALAAAALAYLVSAA-MTPIYQAQLTLLIEESQGTGA-GD----Y--NDILAA
I4EI06          WWWVFVACPLLAAGAAYLVSSL-LTPIYEANLMLLINQSRVPGV-IN----Y--DDILAA
A0A2E5F6N9      WSWVAIIVAVLAGAAAYFYTQS-RTPVYQASSLVQIQQTQGSALPTF-------SDLQLS
A0A2E6J6X7      YSWLIILLPTIVGTGAYFYSQQ-QTKLYEAKATLLVEQRSSGLSTSI-------SDYSLS
A0A3M1EAN8      RVWLLIAAPLLAGAISYAASL-RMVPVYRASATLLVSPSGESAALNY-------SSLLAS
A0A535QK16      LAWLIVLCPVVAALAAGIISL-QLPKIYEAKASLLVRPAQPLSVDPG-------VAALTT
A0A1F8RRT9      WWWFIALAALIGGGSAYSISQ-LITPIYRADATLLVNQTQTPGVIAY-------NDILTS
A0A6I1QLV0      W-WMILLGPLIAGVCAFVVSG-LLTPVYSASSTLLVNQVQSEGPIQY-------NDILTS
A0A535FRM3      WLWIIVLGVVVCGGMTYIASK-ITRPTYQASTQLVLAISTSQSP--Y-------ENASAA
A0A401ZA55      WAWVIILGMVICGGTTYLVTKLLMQPVYEAQTRILITL-AGTSQ--N-------DSTLAA
A0A4P6JS79      WAWVIVLGVVICGSVTYGITK-LMQPVYQATAQVILTIGTNQSP--Y-------ESTNAV
                                           :     . :                        

A0A535RWE5      QN--LAR--SYAQLANSSVVLRAAMDDVG-------------------------------
A0A0P6WSP2      EQ--LAF--TYSQLMVEKQILETAIRRLE-----LD--LEPEDL-ARRVSAEPVSNTQLI
A0A5C7JWY1      NS--PEYFQTHFELMKSHFVLQRTARILD-----LA--ERPEYQ-PKPSVIKQFMKSFLP
A0A1F8QGH2      ER--LAL--TYSQMLKGPLILEKVITRLG-----LD--ETPEDL-SEKIVAEPVANTQLI
A0A1Q7TTL6      AQ--LLDAESWVDLLLSYVVLDQVVRDQRLF---VE--PGTPAD-GQAVEKLSVADQYQP
A0A0S8KFR9      ER--LMN--TYIEMLKSSSILEEVIKELD-----LS--SSPKDL-AKQIEADVVPDTELL
A0A535SLQ0      DP--LLS--Q-VELLKSHAVAGGVVDSMPMLRVVLR--KSSRSL-LERVLRRRLSPGLLG
A0A363SX22      GRVSVAN--TYSDIATSRRIKNDTIDALG-----LN----PVQAETLDVGSKILAGTNVI
A0A326UPN3      LT--LLP--TYIELVTNPTVLQPVVSKYH-----MQ---SANEL-ASKISVKQIGGTQVI
A0A455STY5      LT--LLP--TYIELVTNPTVLQPVVSKYH-----MQ---SANEL-ASKISVKQIGGTQVI
A0A3A4VPK9      NQ--QTQ--TYLQLLQTESILNIVSERLG-----FE-------LDEDAIDTKAIIDTQII
A9B6E3          ER--LVA--TYAQIAQSRTTMQAVEQRLN-----LS-----DMASSAIITTRPVQETEFL
A0A3D0CW53      QQ--LAQ--SYARLLRRQMILQTTIDALG-----LQ--IPWQAL-AGRVSAASAPGSQLI
A0A1F8SS27      EL--VAQ--TYSDLTRRQPILQSVVDVLG-----LN--KTWQQL-RKQVSVGLVEGTQLI
A0A2E0L5X9      ST--VLD--AYSVLIGRNSLLQPVIDDLG-----LN--ISVLDL-MELMSLETNRSASLI
A0A3A0AXU8      GP--LAN--TYIQYMGTRSFGEMVAARMP-----VE--ISSAEV-LRSIQAEFVRDTQIF
A0A3D1JCW0      QQ--LTK--TYAEMLTKKPLLDKVRQNLG-----LS--ENVE----FDVKVNFIRDTQLV
A0A2N2MJJ0      QQ--ITQ--TYVEMFKLASVRQAAAEHLQ-----IE--IKP-----GQVSVSALTNTQIV
A0A3M1LAM5      VT--LAQ--IYGEMAKRRPITQAVVDRLD-----LP--MEWWDL-AGRIETRVNPTAQLL
A0A536BZ00      QK--LSE--TYAEVARTDPVLQAVSNQLG-----LG--VSPDNL-RGRVSTDAPRDITLL
E8N5M1          EK--LTR--TYAEMMTKRPLLVKVAQKLN-----LP--YVI-----DTVKVTPVRDTQLM
A0A1F8U7F0      QQ--LLQ--TYIQLLTTEKVLNAASEKLG-----YP--VYA-----GQASAQQVPDTQFV
A5V160          ER--LAR--TYAELLVKRPVLEDVVRELN-----LS--IAPSLL-AERVRVRPIRDTQLI
A0A2A6REI6      ER--LAR--TYASLMLTRPILEEVIAELE-----LV--TTPSAL-ADRITTTPVRDTQLI
A0A426TTK3      ER--LAR--TYASLMLTRPMLEAVIADLD-----LT--TSPDAL-ARRITTTPVRDTQLI
A7NIZ1          ER--LAR--TYAELLIKRPVLEEVVRELS-----LP--FAPSML-AERIRVRPIRDTQLI
A0A0P6XM68      NQ--LAQ--TYVQTLRSRPVLDAVAERIN-----TA--ITP-----EQIRAQIVQNTQLI
A0A2N2MEG3      NQ--LAQ--TYVQTLKSHSIVDMVAERIG-----GS--VSP-----DQVQVQIVQGTQLI
A0A353RQ31      QQ--LIS--TYVQLLSTESVLQKASDELG-----FP--IYK-----GQATASPITDTQFV
A0A3B9KNR2      QQ--LIA--TYVQLLSTESVLQQASEELG-----FP--VLK-----GQATARAITDTQFV
A0A0P6XME1      EL--LSQ--TFTELLVTRPVLEAASERLG-----YY--INS-----SQVRVQQVRGAQLI
A0A3B9Q1T8      QQ--QIT--TYSQLISSTDLINQVSTELG-----FP--VDQ-----KQLEVEQIGDSQFV
A0A1F8PTW9      QQ--LAS--AYANIANRQMVRNATMNALD-----MN--------ELPEYTAWALPNTQLI
A0A1F8QH26      QQ--LAD--AYANLTNLQLIREATMNALN-----ID--------QLPEYKARVEPSTQLV
A0A359HML3      EQ--LAV--SYANIANREPLRDATMEALG-----LD-------W-LPEYSVTAVPNTQLI
A0A3M1EJ46      ER--VAK--TYAQLLTKRPLLEQVISDLH-----LK--LTPYQL-AGKIEVIQPANTQLL
A0A2U2S5W9      QQ--LAQ--TYIQMATRQPILQATIEALG-----LK--EDWTSL-RGRVNASPVQGTALL
A0A0M8KAF3      ER--LVK--TYAEIMKSDAVLDLVAET-------VG--EEALEE-AK-ISVSPGQDTQLL
A0A523V9H6      ER--LAR--TYSEMITGRPVLDAVIDQLE-----LG--QTAEEL-AETVEVELVRDTQLI
A0A3D1U3H5      QQ--LAD--TEARLVVTQPVAVKAYKALH-----LHLPLTPSTL-LGGATASSDVNSQLV
A0A2N2MEK3      QQ--LAQ--TFIQLLKTKPVLDSASAELG-----YH--IS-----SGQIKAEQLRDTQVI
A0A3B9J9U6      QQ--LAQ--TFIQLLKTKPVLDSASAELG-----YR--IS-----SNQIKAEQLRDTQVI
A0A661VSD8      NS--LAQ--AYAELVRYRPITEAVIQRLG-----LE--RSHEAL-ASQIVAWVRPNANLL
A0A497C1E5      NT--LAT--AYAELVKQGPITEAVIERLG-----LE--RTPERL-AEQISARVQWGVYLL
A0A1W9UQ51      NT--LAA--AYAELLRQGPVVEAVIERLG-----LE--RTPEQL-AAQIGTGFYSGAQLL
A0A497B563      NT--LAA--AYAELLRQGPVVEAVIERLG-----LE--RTPEQL-AAQIGTGFYSGAQLL
A0A3D0UNQ0      ER--LAL--TYADIARRQPVLEAVIVSLD-----LD--YAWQNL-RNRVRVDLVPDTQLL
A0A2G6GG97      ER--LAQ--TYVELLKTDPILEETISQLE-----LP--MSVPTL-KKMISVSAPQETQII
A0A521TS25      ER--LAR--TYGELMRKRPVLEKTITELQ-----LA--TTNEQL-ARTIEVRPVRDTQLV
A0A3M1H759      DQ--LAN--VYAQMAEREPILQATIDALA-----LD--VEWDVL-GGQVSAFHPSQSQFL
A0A535D584      SD--ITQ--TDAVLMTQNGVLSEVIRDLH-----LR--ISSDQL-RAHLVARPGPSSELI
A0A5C7JS64      SS--IVA--TYQALITTSAVLDPVIESLG-----LP--MTEDQL-RAKITTSPVANTRLM
A0A535IMD1      TQ--LAQ--TYVQIVRRQPVMQAVVDDLK-----LT--VSWEQV-AAQTSVALIQGTQLI
A0A521UD91      ER--LTN--TYGELIRKTPVLSATIERVE-----LP--YTPAQL-AKLIQVQVVRNTQLL
A0A3C0LJ76      QG--LAQ--TYVKIAQRPSIREATRKALG-----MD--WLPE------YSVRIVPDSQLI
I0I8T2          QG--LAQ--TYARIMQRPSIKKATMEALG-----MD--WLPQ------YTVRT--ESQLI
A0A497ASN6      ER--IAR--TYAEILESRPLLEKTLIKLG-----YPPDLSDKEL-PFNVSVQAVRETQLI
A0A3D1TRD4      QQ--LTL--TYSKIAVQDPVLAQVIQEGH-----LP--FTVIQL-QKMVSAAPVLQTQLI
A0A3C0XJG2      QN--LAP--SYVQLAQSEVVLRRARDKVS-----WP---DSKSF-RERTQVAQVRNTSII
A0A3M1ZZ81      QR--LTQ--TYLQILSTRPVMEETITRLN-----LP--YTPEQL-AAKVSASSPQDTQII
A0A497AF06      EN--LAL--TYSALLKTRPLLEIVIANLG-----LD--ISPDELIEHRLGTNLIPDTQLL
A0A661W444      EN--LAL--TYSALLKTRPLLEIVIANLG-----LD--ISPDELIEHRLGTNLIPDTQLL
A0A3D0D4X6      ER--LAR--TYSERLQSRPVLEETARALG-----LQ--QDLGTL-KVKITVQPVRDTQLI
A0A1J4ZRV4      ER--LAK--TYASLLTGWPMLDETARRLG-----VD----AKDL-EKTVTVSSVRDTQLL
A0A1V5RXW5      ER--LSR--TYANLLMSRPVVDQTAEQLG-----IE----PRSI-ERSIDVTPVRDTQLL
A0A522N7L9      QQ--LTQ--TYVSVATQRKQLEGVIAKLR-----LA--TTPEDL-AKTVNAQAAATSTLI
A0A535W4H1      QR--LTL--TYASLATRRPILDAVISTLG-----LK--TTADDL-LPRIDAEPSQTTAFL
A0A521IC37      NN--LAQ--AYALLVNQPSVLQAAAKELN-----WE--GSWESL-YFVVTANAPQGGQTF
A0A3A0B2P8      GQ--LAS--AYADIVQRSTVRDATQAALG-----LG--WLP------YYTARLVPNTQLI
D1CAL1          QE--LAA--TYSRLVTARPVLEQTINRLS-----LD--TTPEDL-VENISVTRIGSTQLV
A0A497BNC7      ES--VAA--IFAAKIQFPLFLQQVKERLG-----LP---ADVKV-DDMISVQQIGSTQLI
D1C8M3          ER--RTR--TFSRLVAQRPVLEETIRRLS-----LR--MTPEEL-MAVIEVTPIRDTQLV
I4EI06          QQ--RTQ--TYSRLVTTRPVLEETIRKLN-----LS--VTPEQL-LKKVDVSPVRDTQLF
A0A2E5F6N9      RA--LAS--TYKELITTTDILSAVTKELG-----LS--ASTGGL-RKNISVSILRDTSIL
A0A2E6J6X7      AR--LSK--TYAKLITADPFLDQVRETNG-----FE--RLG------SVQTRTQENPPLI
A0A3M1EAN8      ER--VAK--TYAELLTKRPLLEQVIANLH-----LS--LTPRQL-AGKINVAQPADTQLL
A0A535QK16      DQ--ILR--TYARLMTERPLLEQVISDLN-----LK--TDPATL-SKQITVTPAPNTAIL
A0A1F8RRT9      ER--LTM--TYRELISKRPVLEDVTEDLE-----LP--MSPDEL-GALIDVEAIEDTQLL
A0A6I1QLV0      ER--LTN--TYAELIRQRPVLQTVIDRLD-----LE--MSIDDL-QDRVSVSTVQDTQLL
A0A535FRM3      LE--LLP--TYARLVANPQVLQPVATKYK-----LT----VKQL-TEMITVKPQSNTQII
A0A401ZA55      IA--QQS--TYSQLVTNPNVLAPVAAKHN-----ME----LKQL-TGMVKTQSATNSPII
A0A4P6JS79      IA--LQP--TYAQLVTTPQVLQPVAARHG-----LT----LKGL-SNLVVVNAPSNTPII
                                       .                                    

A0A535RWE5      ------------------------------------------------------------
A0A0P6WSP2      RLSVRDSSPQNAALLAETIADEFVQHVRLLEREKFG-ESISGLQAEMESQTTLISANQAR
A0A5C7JWY1      DSVLAFVRPAPKKEHADSADD---------------------------------------
A0A1F8QGH2      RLTIRESSPEKVTLLANTIAEIFTDHIQALQTDRFT-DLLQSLQDQMSAASTQMNETEST
A0A1Q7TTL6      GVYRFTVDHSGQGYTLASADGVELERGTLGDSVGTRYGLRWAPDASTVAPGRAVQFNLTT
A0A0S8KFR9      SITVTDHDPARAKDIANALATLLVERSRNLYFGGTR-SAREILQ----QQLDEVEAKLEQ
A0A535SLQ0      DVAVAADAPA---------DSLPLTFDRDGFVVGAP-PERRRVAYDTLVKVDGVRFTVRR
A0A363SX22      YITVEGPDPSLITTFANKLGETTV------------------------------------
A0A326UPN3      EVTVSDEDPKMATNITNDVAQNFA------------------------------------
A0A455STY5      EVTVSDEDPKMATNITNDVAQNFA------------------------------------
A0A3A4VPK9      EINVEDPDPQRAALTADMLVEVLI--------EQNE------------------------
A9B6E3          DIAVEANDPQQAADIANAIADQLI--------LTSP------------------------
A0A3D0CW53      QINVVDGDPQRARLLADEIAHQLI--------LHSP------------------------
A0A1F8SS27      QITAEADSPDTAQMIADEVAHQLI-------LFSPG------------------------
A0A2E0L5X9      TIGITDTDPERAAAIANRIVDELI-----------R------------------------
A0A3A0AXU8      RITATHRNPEVAQMLANTTAQMLI--------DANT------------------------
A0A3D1JCW0      QLLVEHTDPFLAANVANEMVAVFS--------EDIR------------------------
A0A2N2MJJ0      EIVVEDTNPALAGEIADTLVDVLI--------EKND------------------------
A0A3M1LAM5      EITVFDTDPQVAALLANAVAEELV--------RQSP------------------------
A0A536BZ00      RITATDGDPNQAARIANEVANQLI--------KLSP------------------------
E8N5M1          QVIVEDINPVYASDFANELVNAFA--------EQLQ------------------------
A0A1F8U7F0      RLTVTNTDPQRAADIANVLVMVLI--------DQNE------------------------
A5V160          VVTVEDIDPQRAADIANRIVAVFS--------EQNR------------------------
A0A2A6REI6      RVTVEGEDPAQVAAIANRLVTVFV--------ERNE------------------------
A0A426TTK3      RVTVEGEDPLQVAAIANRLVEVFV--------QGNE------------------------
A7NIZ1          VVTVEDIDPQRAADIANHIVAVFS--------EQNR------------------------
A0A0P6XM68      DIFVTDTDPQRAASIANTLVEVFI--------ERNS------------------------
A0A2N2MEG3      DITVEDTDPERTALIANTLVDVFI--------ARNV------------------------
A0A353RQ31      VLTVRHTEPEKAALIANGLINVLI--------DENE------------------------
A0A3B9KNR2      ELTVRHTDPEKAALIANSLIDILI--------EQNE------------------------
A0A0P6XME1      QIIVEDSIPEKAAEIANTLVTVFL--------EQNA------------------------
A0A3B9Q1T8      RLTVTNEDPFKTAVIANALIDALI--------QNNE------------------------
A0A1F8PTW9      EISVTDIDPKRAQAVANELATQLI--------LMSP------------------------
A0A1F8QH26      VITVNDTDPNRAQAVANELAAQLI--------LLSP------------------------
A0A359HML3      EIVVVDTDPQRAQIVASEIANQLI------LGSPTS------------------------
A0A3M1EJ46      ELYVEDSDPEQAVAIANGIATLFM------QQNARR------------------------
A0A2U2S5W9      QVSVLDTSPEWAVAIADEIARQMI------LQSP-T------------------------
A0A0M8KAF3      VVAVEHPDPELAATIANEVVRVFS------AYMR-R------------------------
A0A523V9H6      RLSVEHNDAARAATIANALSDAFI------AYNA-G------------------------
A0A3D1U3H5      TLSVSSHDRVFAARAANALA----------------------------------------
A0A2N2MEK3      TLTVEDNDAGHAAAIANTLVGVLV------AQND-S------------------------
A0A3B9J9U6      TLTVEDNDAGRAAAIANTLVGVLV------AQND-S------------------------
A0A661VSD8      EIRVTDTNPKAAMMIANALAEELI------RQSP-G------------------------
A0A497C1E5      EIEVTDTNPEAAALIANALADELI------RRSP-A------------------------
A0A1W9UQ51      EIQVTDTNPEAAALIANALADELI------RRSP-A------------------------
A0A497B563      EIQVTDTNPEAAALIANALADELI------RRSP-A------------------------
A0A3D0UNQ0      EISVDASSREEAISIADELAQQLI-------LISPT------------------------
A0A2G6GG97      IIQVEDTNKDRAALIANTLGQVFI--------FENQ------------------------
A0A521TS25      TVSVENRDPRLAADIANTVVRTFI--------AQVV------------------------
A0A3M1H759      SVTVQDTSPERAAVIADEIARQLI-------LQSPT------------------------
A0A535D584      TVCSSGASGTQQAAIVNAVMSVYA--------AQAT------------------------
A0A5C7JS64      RISVSDPNPETAAILANAIAEQFQ--------TFAQ------------------------
A0A535IMD1      EIKFVDTNPQRAKLIADAIAQQVI--------AQSP------------------------
A0A521UD91      VVSVDDIDPLRAQETANTLAQTFI--------DQRH------------------------
A0A3C0LJ76      EISVTDVDAQRAYAVATELINQLI--LLSPGGQERQ------------------------
I0I8T2          EINVTDVDPQRAYAVATELINQLI--LLSPGGQERQ------------------------
A0A497ASN6      RISVESKDPQLAAKAANTLAETFI--------EERA------------------------
A0A3D1TRD4      TITANTHDAKQAATIANLVANVFI------------------------------------
A0A3C0XJG2      AVSFRDRDPQRAAEIADLIANSFVEQVRALQS-SLQ------------------------
A0A3M1ZZ81      IISVEDPNPELAAQIANTLGEVFI--------EQNR------------------------
A0A497AF06      ELTVEDTDAQRASNIANEIALTFI-------SLHNT------------------------
A0A661W444      ELTVEDTDAQRASNIANEIALTFI-------SLHNT------------------------
A0A3D0D4X6      RLTVEHTDPALAQAIANTIPQVFA-------N-RNA------------------------
A0A1J4ZRV4      EIQVEGPNPQLIVQIANTLPEVFI-------A-QNQ------------------------
A0A1V5RXW5      KITVEGPNPWLIARVANTLPEVFI-------E-QNQ------------------------
A0A522N7L9      TISADDPDPQRAAAVANALAQALL-------T-VSP------------------------
A0A535W4H1      TIVVRGRDAAETAAIANEVANQVI-------A-ASP------------------------
A0A521IC37      NVSATAGTPQRAQEIANEIARQVILQSPISQQQKAS------------------------
A0A3A0B2P8      ELSVVDTDPVRAQAVAAELVNQLL---QIGPGMQEG------------------------
D1CAL1          EIAVEDPDPRQAAQIANTLAQVFI---E-----ETH------------------------
A0A497BNC7      HVSAENNDPVLAQALADTIARVLI---E-----QET------------------------
D1C8M3          TLAVSDPSPARAAAIANTVAEVFI---E-----QTQ------------------------
I4EI06          TVAVSDPSPEQAATIANTIGQVFI---D-----QTR------------------------
A0A2E5F6N9      RILAMNEDPALAASIANAVAQQFQ------------------------------------
A0A2E6J6X7      EIYVRDSDKVLVGEVANAISLNFI------------------------------------
A0A3M1EAN8      ELQVEDSNPQLAVAIANNIADTFV------------------------------------
A0A535QK16      DVAMRDTDPVRAKDTANTLVNDFI------------------------------------
A0A1F8RRT9      RLSVEHEDPDQARWLANATAQAFI------------------------------------
A0A6I1QLV0      RASVRDEDPALAADIANTLASAFI------------------------------------
A0A535FRM3      EIYVESSNPVVATSIANDVAQNFA------------------------------------
A0A401ZA55      DILVDSSNPQLAATLSKEVAQSFT------------------------------------
A0A4P6JS79      KISVNNSDPRFAAQLANEVAASFA------------------------------------
                                                                            

A0A535RWE5      --------------WTDLKTFRDLANSAWVRDTSIITVSFKHGNADFAARAANAIANAFI
A0A0P6WSP2      VDSLSSQSIAHGSKMVHLQSQIDLDRGDYQF--------LQQSYFVAQSQADQIAEKIQI
A0A5C7JWY1      ------------AEEALIKQFSQDIEIMPIRGARLAHVTANAIEPELAAEIANTLVSVYI
A0A1F8QGH2      MDGISARMIEEETKLVRLQTFVAELRADLQT--------LQQNQEELQSTIDEAANSVMI
A0A1Q7TTL6      LRDAATALSE-------------ALDARMDVDGSFLRVELRGHDPKRTTAIVNALAQRYV
A0A0S8KFR9      VRTELQTLVDSVARENA---RVDALKARIRSEEEVYASLLSQYEQARVAEAARENSVTIV
A0A535SLQ0      RPDAARALLQVLSRDAAISQLLTELRVRPRMRTDIVDVAYSAPDPSRAQQVVNRVVDVFR
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      --------------------------------------LISSERYDLMEESLSAQKAQIE
A9B6E3          --------------------------------------AGPQSAEAKLLDEVNR------
A0A3D0CW53      --------------------------------------TTPEKEQEQYRQFVNQ------
A0A1F8SS27      --------------------------------------RSNTSNSIMVRQFIQQ------
A0A2E0L5X9      --------------------------------------QTSDRATLLDLEFINS------
A0A3A0AXU8      --------------------------------------ERQLSQQEARLAAQRSPEALAR
A0A3D1JCW0      --------------------------------------NLQQSKYAASKENLKAQLDYLD
A0A2N2MJJ0      --------------------------------------AIQSERYTNSEQSLSTQIADVE
A0A3M1LAM5      --------------------------------------A--SQEGVERDFVLK-------
A0A536BZ00      --------------------------------------TLQGRNPAIEQSIAS-------
E8N5M1          --------------------------------------EMQISRFKASKENLQNQLSYLE
A0A1F8U7F0      --------------------------------------ELQAVRYLTSEQNLQSQIDQVQ
A5V160          --------------------------------------ELQSERFAESKRSLMN------
A0A2A6REI6      --------------------------------------ALQGERFVATRASLEQ------
A0A426TTK3      --------------------------------------ALQGERFVATRASLEL------
A7NIZ1          --------------------------------------ELQSERFAESKRSLAG------
A0A0P6XM68      --------------------------------------RMQAERFNESERSLEAQIAQID
A0A2N2MEG3      --------------------------------------QMQFERFATSEQSLEAQIEQVD
A0A353RQ31      --------------------------------------QLQAIRYISAEQNLQNRIDETQ
A0A3B9KNR2      --------------------------------------QLQAIRYIAAEQNLQNRIDETQ
A0A0P6XME1      --------------------------------------KIQSSRFSASEESLQAQIQQVE
A0A3B9Q1T8      --------------------------------------RLQSLRFESTEANLQRRAEDAL
A0A1F8PTW9      --------------------------------------SNAQPEEQGRQEFINQ------
A0A1F8QH26      --------------------------------------TTEHTEDQVRQEFINE------
A0A359HML3      --------------------------------------T--NQADVERQAFISQ------
A0A3M1EJ46      --------------------------------------QGDSSGLTGYEEMLAK------
A0A2U2S5W9      --------------------------------------APEEAQRAKHRAFVEQ------
A0A0M8KAF3      --------------------------------------V-QTERFAESKANLQA------
A0A523V9H6      --------------------------------------L-QEARYSGSLTSVEE------
A0A3D1U3H5      --------------------------------------------YAAQQSEQQH------
A0A2N2MEK3      --------------------------------------L-QSSRYLTSEEGLQA------
A0A3B9J9U6      --------------------------------------L-QSSRYLTSEEGLQA------
A0A661VSD8      --------------------------------------S-RQGQRQQQQEFIKQ------
A0A497C1E5      --------------------------------------S--GGSDPEQQEFIRG------
A0A1W9UQ51      --------------------------------------S--GGSDPEQQEFIRR------
A0A497B563      --------------------------------------S--GGSDPEQQEFIRR------
A0A3D0UNQ0      --------------------------------------SLQSPEDENARLFVQE------
A0A2G6GG97      --------------------------------------KRESLRYADPINNWEE------
A0A521TS25      --------------------------------------DEQLGQTTSTKQVLQQ------
A0A3M1H759      --------------------------------------SPQNKARQERAGFVQA------
A0A535D584      --------------------------------------AQSERDIDQAGAALQS------
A0A5C7JS64      --------------------------------------ERTQELTGPYREALNV------
A0A535IMD1      --------------------------------------TPSEKQQEEHRQFVDA------
A0A521UD91      --------------------------------------EDQIGQLSASRGVLRQ------
A0A3C0LJ76      --------------------------------------QREV--------FIQE------
I0I8T2          --------------------------------------QREQ--------FVQE------
A0A497ASN6      --------------------------------------QGQARRFGSLKTSIET------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      --------------------------------------STTATQLDEEISSVEA------
A0A3M1ZZ81      --------------------------------------ERESLRYAEPIQNWET------
A0A497AF06      --------------------------------------EQQLQNIAVLEQDVVK------
A0A661W444      --------------------------------------EQQLQNIAVLEQDVVK------
A0A3D0D4X6      --------------------------------------EQQSERFAASKESLQR------
A0A1J4ZRV4      --------------------------------------ELQMGRVSESKASLER------
A0A1V5RXW5      --------------------------------------ELLLGRLSQSRANLEQ------
A0A522N7L9      --------------------------------------AIQ-GTGSASEQFIQA------
A0A535W4H1      --------------------------------------TVS-GQQVDFAKAIDE------
A0A521IC37      --------------------------------------DDQRAFITEQQALMQS------
A0A3A0B2P8      --------------------------------------SEYQAFIADQLDQMEK------
D1CAL1          --------------------------------------AQEDAATWSGRDELRR------
A0A497BNC7      --------------------------------------SQQQARFQTGLSELET------
D1C8M3          --------------------------------------QRQAEIAGPGADQVQQ------
I4EI06          --------------------------------------DQNVAATGTSREALQK------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      VQSRSLQSS---------------------------------------------------
A0A0P6WSP2      VEDAVVKEAAGSRGFSAYLTLLVDPSLIIGQGTYSTVTNSARVASAYGEIWTG-------
A0A5C7JWY1      ERNQELSANSKELAAQWFTTHLEELRQKVQNSQQALYLFRAK------------------
A0A1F8QGH2      VEDAQVLTQEDSFFYEATVTLLVDQVHERSGDNYAAILANERLAQTYGEILAG-------
A0A1Q7TTL6      QVYADLKRQKLVELTKILGEQLQHSQDNLRSAEADLQRFREQTITLPSDRPPTVGSGSVA
A0A0S8KFR9      APAVKPAARDGPQVSYLATATVRVTQPYSAFPGYAEYGYVERLMNTYVELLKT-------
A0A535SLQ0      AASAEAAQRQSRLRREFLDAQLKVNDSVVADAQQALTAFRRRAHS-------D-------
A0A363SX22      ---------------------------------KYVEEL---------------------
A0A326UPN3      --------------------------------QYQNTQL---------------------
A0A455STY5      --------------------------------QYQNTQL---------------------
A0A3A4VPK9      SQIADLQNQINHASIKTIEEQEQWIQEQINVLQQESETL---------------------
A9B6E3          --------------------QIATLNEEITRTDEEIKTL---------------------
A0A3D0CW53      --------------------QLLTLQTRIEDAQKQVDEL---------------------
A0A1F8SS27      --------------------QLGNLQARIENGQSRLAEI---------------------
A0A2E0L5X9      --------------------QIEDMQNQINNLQSQYNQL---------------------
A0A3A0AXU8      QKQMNDLIAVLQDELNYYDDQIRTLDNEIRNLEQGPQSV---------------------
A0A3D1JCW0      QQIVENQNALDAIIQN----NLKQLQSSGENVEAQPTAA---------------------
A0A2N2MJJ0      GQIADLQEKITVRSAEVLEEQKTNFESQISDTRAQIAEL---------------------
A0A3M1LAM5      --------------------ELNDTQAKIEEAQAQIDQL---------------------
A0A536BZ00      --------------------NLTALQQVIEDTQTRITAL---------------------
E8N5M1          QQIQENSSALEKILQENIS-EVKRTNPDAANGTLSNATI---------------------
A0A1F8U7F0      SQITTMQTQINDISEATVQDQLTQVKAQIEPLQTQVTTL---------------------
A5V160          --------------------EIAKLQADIDATQAEIAVL---------------------
A0A2A6REI6      --------------------ELEKLQLEIDTTQAQLNEA---------------------
A0A426TTK3      --------------------ELEKLQSEIDATQAQLDQA---------------------
A7NIZ1          --------------------EIAKLQSDIDTTQAELAAL---------------------
A0A0P6XM68      AQIEALQSRSTAATTEQSEQQIEKAKSELDRLQTEILAI---------------------
A0A2N2MEG3      AQIETLKTRSEAVSSAEAQEAIAKTQTEIERLQGEILAL---------------------
A0A353RQ31      QQISLLEKQINELSTATVESQLESVQKQILETQSQMTAL---------------------
A0A3B9KNR2      QQISLLEKQINELSTATVESQLESVQKQILETQSQMTAL---------------------
A0A0P6XME1      AQIADLQRQLAQTSEQSNEKRIQDVTNIISGLQSEINQL---------------------
A0A3B9Q1T8      QQMEELQNRIDQVTEKNVQEQLITVQSEIETLQSQVTDL---------------------
A0A1F8PTW9      --------------------RLNILEVQINETEDEIKKL---------------------
A0A1F8QH26      --------------------RLSVLETQINDTEEEIKQL---------------------
A0A359HML3      --------------------QLDTLQKQITDTQAELEDL---------------------
A0A3M1EJ46      --------------------QIAEVERDIQALEAERAQI---------------------
A0A2U2S5W9      --------------------QIADLQAKIEAAQQQVAEL---------------------
A0A0M8KAF3      --------------------QMERVQAEIEQLQQQLDAL---------------------
A0A523V9H6      --------------------QIGQVSALIEQTEEAIDDL---------------------
A0A3D1U3H5      --------------------QMSRFSAAIDAIDRQISSY---------------------
A0A2N2MEK3      --------------------QVEQVGAQIDQLQEQINRLTMENVEEQIGQAETKIAELQS
A0A3B9J9U6      --------------------QVGQVGGQIDQLQEQINRLTMENVEEQIVQAEAKIAQLQS
A0A661VSD8      --------------------QLDELEEKIEKKKAEIADL---------------------
A0A497C1E5      --------------------QLEELQIKIKDISGQISEL---------------------
A0A1W9UQ51      --------------------QLEELEAKVGNVGGQIEEL---------------------
A0A497B563      --------------------QLEELEAKVGNVGGQIEEL---------------------
A0A3D0UNQ0      --------------------RLQDLQKKIEASQARLDEL---------------------
A0A2G6GG97      --------------------RLQEIGDQIETIETEINTL---------------------
A0A521TS25      --------------------QIAEMERQIRGATDGMERE---------------------
A0A3M1H759      --------------------QLDDLERRIQDAQAEVKKL---------------------
A0A535D584      --------------------EIQKVEASLLQENQQLAAL---------------------
A0A5C7JS64      --------------------QIAETQANIRTTQQMIDDL---------------------
A0A535IMD1      --------------------QLKDLQDRIDQAKADIGEL---------------------
A0A521UD91      --------------------QIADLEKQLKDTSQALEAA---------------------
A0A3C0LJ76      --------------------QLRKLEQGMRDTEAEIVRK---------------------
I0I8T2          --------------------QLRKLEQSMRSTEEEISRR---------------------
A0A497ASN6      --------------------QLANIDEEIAKLDKQRGKA---------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      --------------------DRQRIDDELSRLRAALAAL---------------------
A0A3M1ZZ81      --------------------RLDEIGNEIQAIETEINAL---------------------
A0A497AF06      --------------------QMANLKEAIEYNQSAMDQS---------------------
A0A661W444      --------------------QMANLKEAIEYNQSAMDQS---------------------
A0A3D0D4X6      --------------------QLDTLAGDIEDAQGRLTRE---------------------
A0A1J4ZRV4      --------------------EITSVEADITRTQDALNAV---------------------
A0A1V5RXW5      --------------------EIANTEADIARTTDELSRA---------------------
A0A522N7L9      --------------------QLQATQSQIQQLQGQISAL---------------------
A0A535W4H1      --------------------DLQATRTEIESASMEAARL---------------------
A0A521IC37      --------------------QIVVGQKQLTELSQQAALE---------------------
A0A3A0B2P8      --------------------GITETTAEIERVKTELTGM---------------------
D1CAL1          --------------------QIEEVQQRIEDTSSRIAEL---------------------
A0A497BNC7      --------------------QIKTLETSIAETQAEIAAL---------------------
D1C8M3          --------------------NIEAIQRQIDEANARIAEL---------------------
I4EI06          --------------------EIDAAKQQIDDLTTQVANL---------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      -------------------------------AQHEKRRD---------------------
A0A535QK16      -----------------------AKIKDIQRTEAKAPTA---------------------
A0A1F8RRT9      -------------------------------DSNEQDGL---------------------
A0A6I1QLV0      -------------------------------TQN-AEEL---------------------
A0A535FRM3      -------------------------------QYS-RNGL---------------------
A0A401ZA55      -------------------------------SYA-TSHL---------------------
A0A4P6JS79      -------------------------------QYT-NTSM---------------------
                                                                            

A0A535RWE5      ------------------------------------------------------------
A0A0P6WSP2      -------ESYMQAVIDELGLDRDADDLANDVYFEPIPSTQLVRLRVDDPSAAQAKTLVEV
A0A5C7JWY1      -------HGLLTGEERKSVAAHTLAELNSQLVKTEMAKAEAQSRFQQIRSVLNPQGAGTA
A0A1F8QGH2      -------RKVMEAAISRIKSDESPDDLMNKVKVETVSGTQLIRLSVEDTNANQAKLLADA
A0A1Q7TTL6      GAAGGGGAAGAPDGARDPVFGGFFEMQITR--EEARRDRDALERVLAQYGDSGLSAEALA
A0A0S8KFR9      -------QPILEEVLQKLDLPELPSALLQQIVIEVLPDTELLRITVEDRSPERARDIANA
A0A535SLQ0      -------GSAQSSGREQTELPGL-ELQRQQLLAERRTDEDLLAALQESSTSRKAVQTALS
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      --------------------------PVEISQMG--------------------NPATPE
A9B6E3          --------------------------KAEIEQIG--------------------------
A0A3D0CW53      --------------------------EKQLALES--------------------------
A0A1F8SS27      --------------------------EVEMVQVK--------------------------
A0A2E0L5X9      --------------------------VQEAATIT--------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      --------------------------LLERARML--------------------------
A0A2N2MJJ0      --------------------------ESEIASLP------------------------AE
A0A3M1LAM5      --------------------------RDKMLGMT--------------------------
A0A536BZ00      --------------------------------LN--------------------------
E8N5M1          --------------------------ENLARQIN--------------------------
A0A1F8U7F0      --------------------------ETEIADLQ------------------KNRYPTEE
A5V160          --------------------------RGIDDPTR--------------------------
A0A2A6REI6      --------------------------TGAANAAE--------------------------
A0A426TTK3      --------------------------TGAANAIE--------------------------
A7NIZ1          --------------------------RGIDDPVR--------------------------
A0A0P6XM68      --------------------------RTALDTLR---------SPKAEAGWYSTPTPSPE
A0A2N2MEG3      --------------------------QNELDLVK---------SPGRLPNSLSTPTPSPE
A0A353RQ31      --------------------------NVEVAKIN-------------------PATATEE
A0A3B9KNR2      --------------------------NAEVAKIN-------------------PATATAE
A0A0P6XME1      --------------------------QADIVRIEAERDPILGVNSLGQPARVTPTLTVDQ
A0A3B9Q1T8      --------------------------ELNIASID-------------------PLYATDE
A0A1F8PTW9      --------------------------QEDLGNMI--------------------------
A0A1F8QH26      --------------------------QEELGSII--------------------------
A0A359HML3      --------------------------SQLLGELN--------------------------
A0A3M1EJ46      -NRGGSNSRSLPTAQNADTDTSSLEASAKDGRQQ--------------------------
A0A2U2S5W9      --------------------------EKQLGGAF--------------------------
A0A0M8KAF3      --------------------------G---------------------------------
A0A523V9H6      --------------------------D---------------------------------
A0A3D1U3H5      -----------------QKDMASATKKQAQAGGA--------------------------
A0A2N2MEK3      EIASLENDIFYTTNRGRNPDLAPTEWTARLAQLK--------------------------
A0A3B9J9U6      EIASLENDIYYTTNRGRTPDLAPTEWTARLAQLK--------------------------
A0A661VSD8      --------------------------NDSLADLT--------------------------
A0A497C1E5      --------------------------TASLSELT--------------------------
A0A1W9UQ51      --------------------------TASLSELT--------------------------
A0A497B563      --------------------------TASLSELT--------------------------
A0A3D0UNQ0      --------------------------ASAMDVAP--------------------------
A0A2G6GG97      --------------------------NAQGKE----------------------------
A0A521TS25      --------------------------RRA-------------------------------
A0A3M1H759      --------------------------EAELETAF--------------------------
A0A535D584      --------------------------Q---------------------------------
A0A5C7JS64      --------------------------VKTKDV----------------------------
A0A535IMD1      --------------------------EKSIVNEV--------------------------
A0A521UD91      --------------------------KAAFYP----------------------------
A0A3C0LJ76      --------------------------RDELSSLL--------------------------
I0I8T2          --------------------------QTELSAAL--------------------------
A0A497ASN6      --------------------------Q---------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      --------------------------PAFPQG----------------------------
A0A3M1ZZ81      --------------------------G---TP----------------------------
A0A497AF06      --------------------------R---IS----------------------------
A0A661W444      --------------------------R---IS----------------------------
A0A3D0D4X6      --------------------------R----A----------------------------
A0A1J4ZRV4      --------------------------T---------------------------------
A0A1V5RXW5      --------------------------T---------------------------------
A0A522N7L9      --------------------------T-AVAD----------------------------
A0A535W4H1      --------------------------Q-AITS----------------------------
A0A521IC37      --------------------------TDQAKL----------------------------
A0A3A0B2P8      --------------------------FSARQI----------------------------
D1CAL1          --------------------------Q-QSGA----------------------------
A0A497BNC7      --------------------------GAPESA----------------------------
D1C8M3          --------------------------QAQPNA----------------------------
I4EI06          --------------------------RGRPDA----------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      -------------LQGTAVQQ---------------------------------------
A0A0P6WSP2      IGRNIVQTTQTQ-LARPYTDR------------------------------------MQA
A0A5C7JWY1      GLGWSKLDSQIQVLNSPLIQT---LRAQEITVSAQVAELSEKYGPLHPKLAHMKAELQDL
A0A1F8QGH2      IAGAFLDEIQVL-LTEPYVTR------------------------------------LEA
A0A1Q7TTL6      VVG------SVQ-LNGELSQALKELTDKQAQLRAYRYKYSDEYPPVQRLIGDIATLQRQT
A0A0S8KFR9      LAGL-----LVE-QGQTLYSG--------D-----------------------TKSAREI
A0A535SLQ0      TPGVAPSPAVVQ-LNTQLFQY--------EMARDSLASLSTSHPDLPRLNVLISATEGKL
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      ERDALEQKKARLEQVELLLPL---------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      STSLAAEKRSQVEQLQSLLRS---------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ENAQLAEKEATLAQVKPILTL---------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      IRAEINQKELELKELETTYDL---------------------------------------
A0A2N2MEG3      TRSQINEGTLRLRQLQSTYDL---------------------------------------
A0A353RQ31      EKARLAEYQAQLDQLSSVLSL---------------------------------------
A0A3B9KNR2      ELTRLAEYQAQLDQLSSVLSL---------------------------------------
A0A0P6XME1      QIEL-TQKRSRLDELRSLLSI---------------------------------------
A0A3B9Q1T8      ELQQRIQFQAELGQTQSILDL---------------------------------------
A0A1F8PTW9      --------------------S---------------------------------------
A0A1F8QH26      --------------------S---------------------------------------
A0A359HML3      --------------------S---------------------------------------
A0A3M1EJ46      --------------------A---------------------------------------
A0A2U2S5W9      --------------------S---------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A3D1U3H5      --------------------G---------------------------------------
A0A2N2MEK3      --------------------S---------------------------------------
A0A3B9J9U6      --------------------S---------------------------------------
A0A661VSD8      --------------------S---------------------------------------
A0A497C1E5      --------------------S---------------------------------------
A0A1W9UQ51      --------------------S---------------------------------------
A0A497B563      --------------------S---------------------------------------
A0A3D0UNQ0      --------------------T---------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A3M1H759      --------------------S---------------------------------------
A0A535D584      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A535IMD1      --------------------S---------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A3C0LJ76      --------------------S---------------------------------------
I0I8T2          --------------------S---------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      LDEQIKQLQDDIK----------GLDVQIAATAQQAQKV------------QLDSQRQTK
A0A0P6WSP2      LQKQMDELSAQIE----------SAQAEIMTISAQKAQIEADLIKEESAKTKLSQD----
A0A5C7JWY1      RQRTQQEVQKIYDSVKHQYDMAVAQDKAVKEAITRYNTDKIRLEQNEIEHSMLERDADTS
A0A1F8QGH2      LQTHIDDLYEGIE----------ATQAEIESLSAEKIRAETELA-------RLESRLVED
A0A1Q7TTL6      IPRLARVLAGQLA----------AKETELGRRVDADARALRQIPARAIEEARLRRDANLA
A0A0S8KFR9      LQQRLSAVEGNLE----------QDREALQDLLDSSARENARID-------ALEMRIRSE
A0A535SLQ0      LRAVQAGIQGAIA----------SLDGRIAAINDLRARRAGNLQ-RDAEEARLTERVDNA
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      -----------------------YEQSYTDLIVYGKQVDGAN-TSAGSQLTLLNTTQSLY
A9B6E3          -------------------------------------ADKPAAESLIANLQLKQQSQNQN
A0A3D0CW53      --------------------------------------SARAIQDIQGQIGALQQTITTW
A0A1F8SS27      --------------------------------------SAEQLSELQRELNTLASLITSW
A0A2E0L5X9      --------------------------------------SAFELNQNIEDRGEIEKSIQEL
A0A3A0AXU8      --------------------------------------------ETTQRTLELRDRILQY
A0A3D1JCW0      ---------------------------------------------NAAEIDRLETRISQY
A0A2N2MJJ0      -----------------------YESAYNTLMV-----QKKILAADDEELTQLEKTFNLY
A0A3M1LAM5      --------------------------------------SAVELSEAQARLAELEQLKSNY
A0A536BZ00      --------------------------------------NTSRTNAEDQELADLQSRLVTL
E8N5M1          ----------------------------------------------QAEIDRLETRLAQY
A0A1F8U7F0      -----------------------YQQLYTNLVVLGQPVDTGTNTSTRLQ--QLQTTLSLY
A5V160          -------------------------------------------------RARLEEALVQY
A0A2A6REI6      -------------------------------------------------RSRLQELLAMY
A0A426TTK3      -------------------------------------------------RSRLQELLAMY
A7NIZ1          -------------------------------------------------RARLEEALVQY
A0A0P6XM68      -----------------------YQQIYTNLVVLGESRNENSANVEQE---QMQSTLALY
A0A2N2MEG3      -----------------------YQQIYTNLVVLGQNRAVGEADTEQE---QMQSTLALY
A0A353RQ31      -----------------------YQQIYTNLVVLKTPAESGTTTATSAQLTQLQTTLNLY
A0A3B9KNR2      -----------------------YQQIYTNLVVLKTPAESGTTTATSAQLTQLQTTLNLY
A0A0P6XME1      -----------------------YQQIYVNLTF--SPSNQGNSNSTNS---QLQAALVLY
A0A3B9Q1T8      -----------------------YQELYTQLVVLGKPIDQENPSSRQSD--RLERTLSLY
A0A1F8PTW9      -----------------------AQQI----------------DETQIQISSLQSKLSTM
A0A1F8QH26      -----------------------AQQI----------------EEVRSQISSLQSKLSDM
A0A359HML3      -----------------------AREI----------------SDTQNQISSLKNSLASL
A0A3M1EJ46      -----------------------LAEE----------------SARLAEVASLDAALQEA
A0A2U2S5W9      -----------------------ARQI----------------QDLQGQINVLQNQINTW
A0A0M8KAF3      -----------------------TPET----------------EAEQTRQQQLQTLLTQQ
A0A523V9H6      -----------------------APET----------------TEGLAELARLQTILAGY
A0A3D1U3H5      -----------------------NAQT----------------QDLTREIDQDRTAINNL
A0A2N2MEK3      -----------------------TLELYQQIYANLLVLGKPTSSGASDRLTHLQKTLELY
A0A3B9J9U6      -----------------------TLELYQQIYANLLVLGKPTSSGASDRLTHLQKTLELY
A0A661VSD8      -----------------------AAEI----------------ADTMARIDALEQVASTY
A0A497C1E5      -----------------------AAEI----------------QDVQDRIAALEDVKSTY
A0A1W9UQ51      -----------------------AAEI----------------QDVQDRIAALEEVKSTY
A0A497B563      -----------------------AAEI----------------QDVQDRIAALEEVKSTY
A0A3D0UNQ0      -----------------------PEEK----------------SQIQAEMNDLEGILVEW
A0A2G6GG97      -------------------------IT----------------PEESATLSRLETNLNEA
A0A521TS25      -------------------------GG----------------EQSASRIAVLQSDLGQF
A0A3M1H759      -----------------------ARQI----------------RDLQSDIASWQSLINEW
A0A535D584      --------------------------------------------RGHQDTMALAGQIQAD
A0A5C7JS64      -------------------------TS----------------PEVAAQIETLRTQLADY
A0A535IMD1      -----------------------ARRI----------------QDVQSQIAAKQSQINQW
A0A521UD91      ---------------------------------------------NTAEITRLQNVLSTA
A0A3C0LJ76      -----------------------ARQI----------------GQTETQISALEAKLTTL
I0I8T2          -----------------------ARQI----------------RQLEDQIAALEAKMASL
A0A497ASN6      ---------------------------------------------TQEDVKVIEQQLVNL
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      -------------------------PP----------------ADLRSQISQLESTGTAR
A0A3M1ZZ81      -------------------------ET----------------PEEEAELSRKDTKLKEL
A0A497AF06      -------------------------SG----------------MLTEEETNLIQTTLSNQ
A0A661W444      -------------------------SG----------------MLTEEETNLIQTTLSNQ
A0A3D0D4X6      -------------------------AN----------------PRNEDEIDRLESRVTQL
A0A1J4ZRV4      ---------------------------------------------DDNQRMRLETSLAQY
A0A1V5RXW5      ---------------------------------------------DDAQKTRLETSLAQY
A0A522N7L9      -------------------------RT----------------PSQDQELQALNGQLGTA
A0A535W4H1      -------------------------PT----------------PRDQADLFALQDRLASL
A0A521IC37      -------------------------DN------------------LNTRISALQTKIENW
A0A3A0B2P8      -------------------------QD------------------ARSQITALEAKLATL
D1CAL1          -------------------------SG----------------TAVQTELRTLQTQLSQD
A0A497BNC7      -------------------------PS----------------EFAQLERTRLESQMTRD
D1C8M3          -------------------------GD----------------PAVQEEIRNLQAQLAQF
I4EI06          -------------------------ST----------------AAVQAQIADLEARLGQQ
A0A2E5F6N9      ------------------------------------------SQTREKHLADIAEFMGVA
A0A2E6J6X7      ------------------------------------------DYVIERRLTEIARLQAAA
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      QQTLAQLLMTRDDIS------LAAA-RAQNTVSLWEAAV--APAEPDSPHVGLNTALGAI
A0A0P6WSP2      ---YQVLYDQMEQLR------KNAN-QASNSVMVVAQPS--IPDRPTQDRLLY-VLLAAL
A0A5C7JWY1      QHLYDVFLKATKETD------LSSG-VRANNVYLADPAA--PSSMPSKPRTKLNIMLGLL
A0A1F8QGH2      RNDYRALKQDYEQLQ------LTAN-DASQAVSIVEPAQ--LPESPEEDRVLY-IGLAAL
A0A1Q7TTL6      ENLYTTLQQKYDEAR------LAEA-SSLADVRVLDYAV--VPRRPVKNTRRRVVLLAFF
A0A0S8KFR9      EEVYLSLLRQYEEVR------VAEA-SRESSASIVAQAG--QPDAPSKPRVKFNLALGTL
A0A535SLQ0      RKVTDELRTEYQKAG------IAQA-VTVGQVEIVDHAT--LPTKPAGIGLPEQLVLGLL
A0A363SX22      --------------------------YGVYDLKILDLAE--IPVFPIKPNWKLNLALAAV
A0A326UPN3      --------------------------GGVSQLRVV-PAI--EPTRPSKPQPTQDAIVGAL
A0A455STY5      --------------------------GGVSQLRVV-PAI--EPTRPSKPQPTQDAIVGAL
A0A3A4VPK9      QQIYVSVLNNLESVR------LAKL-QNMPNVVQIQPAI--VPDDPVRPRTMLNSVLGGI
A9B6E3          RQTLSTLYSTALG-------------NRANSISVVEAAT--VNPTPIAPRPIRSAILAGI
A0A3D0CW53      QATYASLLD------------FSKG-SRTNYLSVVEPAV--VPTTPISPNIQRNVSLATA
A0A1F8SS27      ENTYTQYLG------------FLQAKESPGTLTIIESAQ--VSPKPINPQVQLIAFLATG
A0A2E0L5X9      RTLLLSLIEN----------------APRSEIQVFEPAD--PNYFPLTANSVRDLLIAGV
A0A3A0AXU8      RTERIGVLTSLAETQNALSSAFEEPSSDVDTIVVVDPAL--LPVVARQRDFLQPMVAALV
A0A3D1JCW0      RQLYASILSSYEQIR------LAEA-QTTTSFIQVEPAT--PPEKPIRPRTLLNTALAAV
A0A2N2MJJ0      QQIYLNLLNNREALR------LARL-QNTLTVAKIDAAQ--VNPAPIRPRTTLNTLLGGL
A0A3M1LAM5      RADYVRLAN------------LLNT-QSPNTLTIMEPAS--PSRRPIAPNPKKSAAIAAV
A0A536BZ00      RQTYVTLLG------------ISTG-SAANFLTVVEPAR--APTDPASPRLPINTGIGAL
E8N5M1          RQIYASVLASYEQIR------LAEA-QNITSIIQVEPAT--PPDKPVRPQTLRNTAIAAL
A0A1F8U7F0      QGIYVNLLNSLENVR------FARV-QNTPNVVQVEPAV--ASTSPISPRPFQSTALAAA
A5V160          RSSYATVLRSLEEVR------LAEA-QLTNSVNVVETAV--PVTTPVRPRIVTNTAMAAV
A0A2A6REI6      RTSYASLLKSIEEVR------MAEV-QQTNSVHTVEAAA--VPEYPVRPRIVQNTALAAL
A0A426TTK3      RTSYASLLKSIEEVR------MAEV-QQTNSVHTVERAV--VPDVPVRPRVMQNTALAAL
A7NIZ1          RSSYATVLRSLEEVR------LAEA-QLTNSVNVVESAA--PVYTPVRPQIATNTGMAAV
A0A0P6XM68      RQIHANLLSSYENIR------LARL-SSTSNIVSIEPAI--PPEEPLSPKPVRTGLLGGT
A0A2N2MEG3      RQIRANLLSSYESIR------LARL-SSTSNIVAIDLAQ--VPSSPIRPQPLSTAGLGAA
A0A353RQ31      QQIYLSSINSLEALR------LSRA-QNTPNVVQVEEAQ--IPSVPISPKPGQTALLAGA
A0A3B9KNR2      QQIYLSSINSLEALR------LSRA-QNTPNVVQVEKAH--PPSVPISPNPVQSATLSAA
A0A0P6XME1      QQIYANLLSNYEAIR------LARL-QSTPEVVQVEEAR--VPSRPVRPQTTTNVLLGGI
A0A3B9Q1T8      EQIYFSTLNSLEALN------LARD-QNKPTVAQIEAAA--VPVEPFFPRPIETGLLYGA
A0A1F8PTW9      QDNYGTLLSNTQQ-------------GAINSLTLIEPAA--LPSSPIGPKIGLTALLAAA
A0A1F8QH26      QNTYATLLSNTNQ-------------GAINSFTVVEPAA--LPVKPIGPWLGLSVLLASL
A0A359HML3      QLNYANLLSNTEK-------------GAINTLTIIEQPH--VPTSPVGSKMLVTVGLSAA
A0A3M1EJ46      RGSYARLLESYLQVK------SAT--GGSVVISIVEPAA--MPARKVKPRVYFNTFVAGV
A0A2U2S5W9      QANYAQLLN------------FIEG-GSPNYLAVIEPAQ--LPTEPVSPRTSMNVLLAAS
A0A0M8KAF3      QAAYTTLLRSYEEVR------LAEA-QAVDSIVVIDPAT--PPERPVRPRVLLNTLLGGV
A0A523V9H6      RNTYATLLQGYEEMR------LTAA-QSTDNVIVAEAAE--VPDEPVRPRVLMNTALAGV
A0A3D1U3H5      QTQLVTLQSTEAQ-------------TSANLDVRVPAQVPHFPSSPHPVRSAAI---AAF
A0A2N2MEK3      QQIYLQLLGSLEEVR------LARLQNTPSIVQIEEAAVPGSPVRPLPFKTAML---GAA
A0A3B9J9U6      QQIYLQLLGSLEEVR------LARLQNTPSIVQIEEAAVPGSPVRPLPFQTAML---GAA
A0A661VSD8      RTQYAALLQSYMG-------------DSVNVLSIVEPAV--EPRRPIGGKAKLIVAMSAG
A0A497C1E5      QTTYANLLTSYSA-------------ESPNVLSFFEPAV--APQWPVPSKTKLVVAVAGA
A0A1W9UQ51      QSTYADLFNSYRA-------------ESPNALALFEPAV--TPQWPIPSKAKLIVAVAGA
A0A497B563      QSTYADLFNSYRA-------------ESPNALALFEPAV--TPQWPIPSKAKLIVAVAGA
A0A3D0UNQ0      ENTYARFLQF-----------IGGE-ESANYIAVVDKAH--ARLNPVRPTIRLNTLVAGL
A0A2G6GG97      QIRYTETFNNLNDLQ------IKQA-KETSNLIQIEEAK--PHEIPIRPRTETNVLLAAA
A0A521TS25      QATFAQLLRSQQEMT------LSET-RAMNAVRLAEAAI--EPALPVRPQVGLNTIVAAI
A0A3M1H759      QRTYTNLLDF-----------LQGG-DSPNYLSVVEPAV--VPDTPISPNIPQNVMLAAA
A0A535D584      TATLTQLSANYSAFR------AQQG-VDVAHVSVAAAAV--APAAPISRNLYTDAGIGAV
A0A5C7JS64      QSTYRELLISANRMD------LQEA-GAQTGVVVVQEAS--PPGAPYAPNVRLYTLLALM
A0A535IMD1      QATYAQLLTFYK--------------GGTNVLSVIEPAS--VPVAPIAPRTDLNVMIAAA
A0A521UD91      QVTYSQLIKDDSQMR------LEEA-RTLNAVRLAEPAQ--TPLQPISPKVLQNTLLAAV
A0A3C0LJ76      RSTYVGLLASTDQ-------------GSINTINVLDPPV--VPTEPVNDRWYLLVLVAAI
I0I8T2          QSTYVNLLANTDQ-------------GSTNTINILDPPA--VPTQPVPNRWWLLVAVAAL
A0A497ASN6      RDMRTRLLTSLYDIQ------LAEA-QHTELITQLEKAD--VPDKPVRPRKLMNALIAGV
A0A3D1TRD4      ---------TQQHDR------MAKG-DASNAVSVVAPAQ--VPASPVSPRVKLDTVLGMV
A0A3C0XJG2      QDTLAQLMRTRDDLR------LVAA-RAENTVTVWEPAV--APTDPESPRVALNTILGAI
A0A3M1ZZ81      QIQYTEAFNNLNQLR------VSQA-KESSNIVPIEPAQ--PPQRPIRPRTFTNTIMATI
A0A497AF06      QLAYASLLETYLNIR------LTQS-QLLD-VTVVEPAV--APTEPIRPNIVIYTFLGTF
A0A661W444      QLAYASLLETYLNIR------LTQS-QLLD-VTVVEPAV--APTEPIRPNIVIYTFLGTF
A0A3D0D4X6      RNTQSSLVQSFEQVR------LAEA-TSLNSIIVDEPAA--LPTKPVRPRPLTNTLLAAV
A0A1J4ZRV4      RSTYSSLLSSYQQIR------LAEA-QATDNVAIAKPAR--VPELPIRPRTMTNTLLAAV
A0A1V5RXW5      RSTYSTLVANYQQAR------LAEA-QTLDSIVLSEPAI--APERPVRPRTLTNTALAAV
A0A522N7L9      RSTYATLLS------------ASSN-NAANLLSIIQPAV--APVDPASPRPLLNTLLALI
A0A535W4H1      RSTYASLLG------------FQST-TASNLLTLIEPAV--APTSPSAPSRFLLTILAGI
A0A521IC37      QRTYLSMGTLLNQ-------------STGKYLTVIAPAP--LPAAPVSPNILQNVLLAAA
A0A3A0B2P8      QANFANLLANSRQ-------------GAINTIHVLEPAN--LPTTPMSRGLKTNVAVAAA
D1CAL1          QALYASLLEAQQRME------LAAA-QSATQIRVVEQAV--PPTKFVKPRILVNTALAGA
A0A497BNC7      QTRLVVLLSSAEEFR------LAMA-RYTDTITIYAPAE--LPSAPVNSRTLQNTLLGAV
D1C8M3          TETHSALIEAQQRIL------ASAA-ASGPRIRVTADAI--PPDAPIRPRTTLNTALGGV
I4EI06          QSSYDGLRATQQQID------LANA-QANSQIRVAEPAV--APTKFVKPRIVVNTALSGV
A0A2E5F6N9      QSQGIRIQDDL----------LVSQMSSLSSVSIVEPAI--VPTAPIYPRVRFTVLVATF
A0A2E6J6X7      SAQGLSDVQSL----------VNAQFTALDSLYLLEPVS--TPTTPISPDVQQNITFGIM
A0A3M1EAN8      --------------------------DLAVYIEVVEPAS--MPAYKLRPRPYFNTFVGAL
A0A535QK16      --------------------------SSADNLVIWTPAI--VPVDPVSPKPLLNIGLGIL
A0A1F8RRT9      --------------------------TRPGTVSIVEPAS--TPASPVRPRTTLNSIIGAL
A0A6I1QLV0      --------------------------GRPGTVSIAEEAR--IPDDPVEPRTTLNTVIAVV
A0A535FRM3      --------------------------NGMAQIQIL-PAL--EPTTPLRPRPLQDASIGSL
A0A401ZA55      --------------------------ASQANFNTI-DPV--VPTDPVRPRPSQDSLIGAL
A0A4P6JS79      --------------------------GGQVQPIIV-QAL--PPTDPSQPKPSLDAGIGAL
                                                                            

A0A535RWE5      VAGLLVILAIGMLGYVEDRIT-DFDA-MHEKL-GITPLAEVY--R-----AGPSETAA--
A0A0P6WSP2      LGGTVGIGAAFVLDQLDETVR-IRQD-VTSKM-GLNLLGCID----------AQKNGD--
A0A5C7JWY1      AGLMSGVGLAIFVEGRSKKLM-APAD-VERYLPNVSLLGVVPRL--------SKAVAQ--
A0A1F8QGH2      TCAVVAIGIAFLWEYLDDTIR-TPDD-ISDLT-GTSTLAII----------GQLPQGE--
A0A1Q7TTL6      GSFAMAVVGAVLIDRVDPRVR-YPDQ-VSREM-GLTILGAVPHIR-----AGARPERS--
A0A0S8KFR9      VGAVGGIALAFLFEYLDPTLH-STDD-LEAAA-GASVMGVIP--G-----FAPHAVSR--
A0A535SLQ0      VGLMLGTGGAFVAERVGSSIA-RRVE-VE-HL-GLSVLGIVP--R-----CGRETDQK--
A0A363SX22      LSLAVGMGISFLVEYMDDTLR-EPDE-ISQLF-QAPLIGFIPVMS-----KAAAHS----
A0A326UPN3      VGFGLAIALIVVFEWLDDRVP-NPEE-MQKLL-EADALTIIPELS-----KNQQGKNA--
A0A455STY5      VGFGLAIALIVVFEWLDDRVP-NPEE-MQKLL-EADALTIIPELS-----KNQQGKNA--
A0A3A4VPK9      IALILSAGFLILKENLDTTMK-TSAQ-VEELL-KLNVIGYIAEMQ-----NSNGETIG--
A9B6E3          LGFALVFGLALLIEYFDDSVQ-TPDE-GVDLV-NAPLLAAIVKQE-----TKVTKASQ--
A0A3D0CW53      IAFVLAAMAALLLEYLDDTLK-SDED-VDRIL-KLPTLGATTRIP-----KIQQPSDH--
A0A1F8SS27      LGFLLALGFIFLLGHFDDTLK-TAEE-ITQVS-GLPVLGMIRKLS-----RFKNTSDS--
A0A2E0L5X9      AGGVLALLTIVLFTYFDDRLQWDEESSAETIL-GMRILGPL----------------GII
A0A3A0AXU8      AALALGFGLAWLLEYLDYTVK-TPEE-LDELF-GMPTQGAI---------AGVGGGNG-D
A0A3D1JCW0      VGLMLAIGGVFAIDFLDDTLH-DPES-ITTLS-GLPILASI---------SEHEV-----
A0A2N2MJJ0      AGLILAVSIIFLRDFLDDTIK-SRED-VKRMF-GLTTLGQI---------PEHGA-----
A0A3M1LAM5      AGLILAVGAVILLEFFDDTIY-WYGE-QESIV-GARLLGTI---------GRFPA--KSD
A0A536BZ00      MGLLVAVGLALLIDHMDDTVK-TAEI-AGEVT-GLPTLGTI---------VRMRL--ATG
E8N5M1          VGIFLAIGIVFALDFLDDTIK-SPDW-ITTQT-KLPVIGTI---------HTFDP-----
A0A1F8U7F0      VGLMLAAGIAFLIEYLDDTLK-TMED-IERVM-QLPVVGYI---------AEIQY----E
A5V160          AGLLLAVGLALLIEYLSDRVS-SAED-VTAAT-HVGMLAAI---------GRIDG-----
A0A2A6REI6      VGLLLMVGVALLLEFLNDRVT-SSQQ-VAELL-DTSVLAAV---------GEIDG-----
A0A426TTK3      VGLLFMVGVALLLEFLNDRVT-SSPQ-VAELL-DTSVLAAV---------SEIEG-----
A7NIZ1          AGLLLAIGVALLIEYLSDRVN-SAED-VATTA-RVGMLAAI---------GRIDG-----
A0A0P6XM68      VGLLLAAGIVFLIEYLDDTVK-SAEQ-AEAAL-GVPVIGFI---------AELEH-----
A0A2N2MEG3      VGLMLAAAIVFLIEYLDDTIR-SADQ-AVEAL-GLPVIGYI---------AELEH-----
A0A353RQ31      VGLILTAGAAFLIEYLDDTIK-TPDE-VKEIL-NIPVIGLI---------GELHK---KN
A0A3B9KNR2      IGLILTSGIAFLVEYLDDTLK-TPDE-VKELL-NLPVIGLV---------GELRK---KS
A0A0P6XME1      LGLVLAAGIVFVVEYLDDSIR-NGET-VTRVL-ELPVLGYI---------NEING---KT
A0A3B9Q1T8      VGLFAVGGLVFLIEYLDDTIR-TPDE-AEQIL-GQPVIGTI---------GDINSSLLKR
A0A1F8PTW9      LGLMLAVGEAYLLEYLDDTLK-TADD-VARLF-SAPIIGHIFEQK-----NGKKQHH---
A0A1F8QH26      AGCALAVGEAYLLEYLNNTLK-SSED-VVRLF-SAPVIGHIFEYK-----DGKTGNH---
A0A359HML3      VGFTLAAAAAYLLEFLDKTIK-TVDE-VKRLI-KAPILGYIPEI-------PRKEDRW--
A0A3M1EJ46      VGLILAIGFIFLLDHLDDTLS-RPEG-VEQAL-RIPTLAAIPAVR-----MRTSKNGN--
A0A2U2S5W9      IGVLLALGAAFLLDYLDDTIK-SPDD-LVTTA-GLTPLGAITRMR------GEGYENK--
A0A0M8KAF3      LALVAVGAVVVLIEVLDDRVR-SPEV-IERLT-GLPMIGAIAHIE------GTNGDGV--
A0A523V9H6      VGAMLAVGAAFLVEYLDDTIK-TSDD-ISREL-GLGTLGAVARLR--------NGDDV--
A0A3D1U3H5      LALLAATGLLFAREYFAGTLR-NPEEFQALMS-GAPVLGVVGDLN------RETKRPG--
A0A2N2MEK3      VGLMLGFGIAFAIEYLDDSLR-SPMD-VDQVL-GLPVLGYIADMK------PANGPRQ--
A0A3B9J9U6      VGLMLAFGIAFAIEYLDESLR-SPMD-VDQVL-GLPVLGYIADMK------PAEGPRQ--
A0A661VSD8      AGLALALGAAFLIEYLDDTVH-WEDGRQQAVA-GLSILGAVPRM--------SSRRKT--
A0A497C1E5      AGLGLALGAIFLIEFLDTSLR-WEEGGVQSIL-DLPVLGVIPQV--------S--RKD--
A0A1W9UQ51      AGLVLALGAILLIEFLDTSLR-WEGDGVQSVL-GLPVLGAVPQV--------S--RKN--
A0A497B563      AGLVLALGAILLIEFLDTSLR-WEGDGVQSVL-GLPVLGAVPQV--------S--RKN--
A0A3D0UNQ0      VGFILALGVIFILDYLDDTVK-TVDD-ISQDL-NLTPLGTI---------GQYGNGKF--
A0A2G6GG97      VGGMIAVGIIFLIEYLDDTIK-TPDQ-VLEKT-NLATLGAI---------AIIKDHTI--
A0A521TS25      VGLILAAGFAVLVEYIDDTVR-TPEA-VESAT-GLHTLGAV---------ALVPETDSIP
A0A3M1H759      TGFLLALGAAFMLEYIDSTIK-TSDD-LSPSL-GLTPLGSI---------ARIKGKGY--
A0A535D584      AGLLIGTAIAVVLQLLDQGLR-TEED-VRQKV-GVPVLGVI---------PSYSRDPK--
A0A5C7JS64      AGLCIGIGAVFLLEYLDNTTK-VDSP-FNELI-GAPLMTTL---------PIVPSMEK--
A0A535IMD1      IGCLLAVGGAFLLEYLDDTIK-TPED-AQRVA-NVSALGVI---------ARVSDIKS--
A0A521UD91      VGLFLALAAAFLIEYLDDTVK-SGTD-IERVT-KLPTLGVV---------GRIPSIKN--
A0A3C0LJ76      IGATVAIAGAYLLEFLDDRLV-DIEQ-ILQVT-GLTTLGT------------VPEIKL--
I0I8T2          IGAGVAVAGAYLLELLDDRLE-NVEQ-IQRVT-GLTTLGV------------LPESNV--
A0A497ASN6      LGGMLAVMGAFATEYLDTTIK-SPEQ-IEQIA-GLPVLGNI---------FEFEANPG--
A0A3D1TRD4      VGLLAAVGFIALVTYFDDTIK-SHND-VDRAL-QLPVLGLV---------QRNVGQAV--
A0A3C0XJG2      AGGLLTLTGIAVFTYMVDRIT-DVDE-VSERL-GVPALGEIPFAN-----EQTLGAHG--
A0A3M1ZZ81      IGGMVALGFVFLMEYLDDTIK-TPDD-VLADT-NLPTLGAI---------AFIKGSAP--
A0A497AF06      VGFVLSAGVAFLVEYLNRSFE-TSEE-IKQIL-PLPTLGTI---------PRLQGKER--
A0A661W444      VGFVLSAGVAFLVEYLNRSFE-TSEE-IKQIL-PLPTLGTI---------PRLQGKER--
A0A3D0D4X6      VGAMIGLGTAFLIEYLDERVR-DPAM-VESLV-GLPILGQI---------TELPHEHS--
A0A1J4ZRV4      VGAMIAVGAAFLIEYLDDTIK-TPDD-VARVS-GLSTLGAI---------ARLKETGG--
A0A1V5RXW5      VGALLALGIAFLIEYLDDTIK-TPDD-IERVT-GLSTLGAI---------ARLKDAGS--
A0A522N7L9      VGALIAIGVAFLLDYLDDSLK-TSEA-VEETL-GLPTLGAI---------VQMRASGP--
A0A535W4H1      LGLLLATAILFAAEYLNDSLK-RPED-VEEVL-GLPTLGSI---------GRLRGDRS--
A0A521IC37      VGLVLAVGVVLLLEYLDDTIK-SSED-VERVL-QQTTLASVARIS-----PIRKPGDN--
A0A3A0B2P8      LGFALAAAAAYTMYYLDNTLQ-NEDD-IQDHL-ALPALGLV---------PKNHAAEG--
D1CAL1          LGIVLAAGLVLVAGYLDDTVK-TSED-VQRLT-GRGALGLI---------PELRSPES--
A0A497BNC7      TGLMIGVGVAFLLEYLDDTIK-SPQD-VKQTL-PVGVLGAL---------PRLKEMDG--
D1C8M3          LGTLLGLGVVLVLVYLDDTVK-DAED-VRRLT-GRPALGWI---------PRFRGPSG--
I4EI06          LGLLIAAGLVALAGYLDDTVK-TSGD-VRRLT-GKAPLGSI---------PVLVSADG--
A0A2E5F6N9      LATVSTILAIIVVEFFNDKAK-SSEE-IERRT-GLTRIATILRWT-----PKEIGAKE--
A0A2E6J6X7      IGLALALGLTFLISNLRDTVR-NPDD-IRTKF-GVSVLGMVFEWS-----SKEVNEND--
A0A3M1EAN8      SAFLLAVVFIFFMHHLDESLT-YTE--AEEVL-QIPTLATIPPLPAKSPLHRRRARSL--
A0A535QK16      AGLVVGLGLAFLLDYLDQSVR-SDEI-LRERV-GLVPLGHIAFVL-----AKPERRGE--
A0A1F8RRT9      AAVFIAGTVVLIYEYLDDTIK-TAED-VETAA-RLPTLGGVARFP-----RRVSSRSG--
A0A6I1QLV0      LGLLLAAGLVAVLEYLDDTVK-RPED-VEERA-GATTLALVPRFR-----QPRNRGRA--
A0A535FRM3      VGLGLALALIVAFEWIDDRLT-NPEE-IRKLT-GQDALAVLPELS-----RKQGGCNI--
A0A401ZA55      IGLGLALAIIVIFEWIDDRLT-APEE-VNKLL-GIDALTIIPELS-----RKQRSRNA--
A0A4P6JS79      VGLGLALALIVVFEWLDDRLK-GPEE-AQRLL-GVETLTVIPELS-----RKQRIKNA--
                                                                            

A0A535RWE5      ----GMLFVRDAPMSPDAEAFRGLRTNILFASPDRRPRTILVTSALPLEGKSVVSANLAL
A0A0P6WSP2      ----SGLEMDVHPRSKVAEDFRTLAINLCSVNAQNPIRTLLISSPGMAEGKSVVTANLAL
A0A5C7JWY1      ----KKALAPPNALTPVAESFRIIRTSLLLSNPDMLPSRILITSPGENEGKTTLAVNLAM
A0A1F8QGH2      ----DELVVLAKPRSPYAEAFRMLAANIRFSSLDKPLQSLLVTSPSSQEGKSIVLANLAA
A0A1Q7TTL6      ----GRRVRPPEEVAVVVEALRGVCLNLVYAHGAVAPMVVTLTSPGAGDGKSFLAANLGH
A0A0S8KFR9      ----GKILLSSDGRSPEAEAFRMLRGNLLSVASTRPLKTLLITSAEPGAGKSTVLVNLAA
A0A535SLQ0      ----G-----PGSADAAVEAFRGIRLNVLNGHGAPGPVVVAVTSPGSGDGKSFVSSNLAL
A0A363SX22      ------LYMVKLPQSVVAEAFRSLRTNLEFASVDKPLKTILVTSNGSSDGKSSIATNLAV
A0A326UPN3      -----------EDTPELAEGCRVLCSNIATAQTQQPFKLIMLTSALAGEGKSTIAANLAT
A0A455STY5      -----------EDTPELAEGCRVLCSNIATAQTQQPFKLIMLTSALAGEGKSTIAANLAT
A0A3A4VPK9      ------LYTTNQPRSPIAEAFRSLRTNIEFSSIDKPIRTILVTSPEVSTGKTIISTNLAA
A9B6E3          -----RLVSRLDPRSPTAETFRTLRTNLQFSNVDTKARTLIVTSSQPEEGKSTVAANLAW
A0A3D0CW53      ------LVTVHSPRDPITEEYRVLRTNIQFTGLSNRSTTLLITSAALGEGKTTIAANLAV
A0A1F8SS27      ------VYVSKNPRSPAAEDFRILRANLELLSTDQPLKTILVTSCDKATGKSFISTNLAM
A0A2E0L5X9      PRNKLPLYVESMPQSIETEAMRQLRARIALAAGGDMPHILTVVSYDSGEGKTLTTANLAL
A0A3A0AXU8      QGRGLALVTATDPRSPVAEAFRALRTSVRMAGVDGPVHSLMVTSAGPGEGKTFVASNLAV
A0A3D1JCW0      --EDGGPITQAHPRSPVSEAFRSLRTNVQYSSVDRPLRRIIVTSPTPEDGKTTIVANLAV
A0A2N2MJJ0      -AKETGLFIASQPRSPVSETYRALRTNLEFASVDNPLKTILVTSAGPGEGKSTVACNLAG
A0A3M1LAM5      K-----VIVRRAPRSPAAEMVRQLRSKILLAQPGRTFRTLLVTSAAPQDGKTVAVANLGA
A0A536BZ00      REKFYSLPTLLYPRSRGAEAFRTLRTNLDFAHVDGPVKTILVSSAGQSEGKTTVSANLAI
E8N5M1          --KAGDPVALSSPRSPVTESFRSLRTNVRYASVDHPLRVLLVTSPTPEDGKTTVAINLAV
A0A1F8U7F0      SGSDESLYVTRQPRSPVSEAFRLLRTNLEFAGVDRPIRRLLVTSAGPGEGKTTIAVNLAA
A5V160          AEPSDKLVMLRDPFSQVAEAYQMLRVKLEIARFEKPLHTLLVTSSSPGEGKSTTAANLAL
A0A2A6REI6      QRSMDKLVTLISPHSKFSEAYQMMRVRLEIARYGHAFKTVLVTSGNQGEGKSITAANLAV
A0A426TTK3      QRPMDKLVTLISPHAKVSEAYQMMRVRLEIARYGQPLRTILVTSGNQGEGKSITAANLAV
A7NIZ1          AAPSDKLVMLKDPFSQVAEAYQMLRVKLEIARFEKPLHTLLVTSSNPGEGKSTTAANLAL
A0A0P6XM68      --DQDKAYVAENPRSPVSEAFRTLRTNLEFAGVDRPIRSILVVSAHPGEGKSTVATNLAI
A0A2N2MEG3      --DQDKAYVSENPRSPAAEAFRTLRTNLEFASVDKPIKTLLVVSAHPGEGKTTVATNLAV
A0A353RQ31      KDDKLGNYVVYHQRSPVAEAFRALRTNLEFSSLDFSLKSILVTSSGETEGKTTVACNLAI
A0A3B9KNR2      NNDKFGSYVISNPRSPVAEAFRALRTNLEFAGIDSPLKSILVTSSGETEGKTTVACNLAV
A0A0P6XME1      PYEDYPPHVIAQPRSLITEAFRSIRTNLEFVEIDRPLKTLLVGSPSPDEGKTTIAVNLAI
A0A3B9Q1T8      GGKKSGVHVANQPRSPIAEAFRSLRTKLEFYNIDQPLKVLLVTSAGLEEGKTTVAANLAA
A0A1F8PTW9      ------LYDTADLRHPIAEAFRILRTNIEVAEANQPLKTILVTSADIGDGKTSVATNLAL
A0A1F8QH26      ------LVDLTDLQQPLSEAFRVLRTNIELSGSDRPLKTILVTSADASDGKTFVAANLAM
A0A359HML3      ------HFVTNHPRSPISDAFRNLRINVDLLGVET--KTIMISGSAISEGKSTIALNYAQ
A0A3M1EJ46      ------PFAANHPTSPFAEAHRTLRTNVQFSSGDVTAETLLITSALPRAGKTTTVANLGV
A0A2U2S5W9      ------LVTMRHPRSSVAEAYRTLRTNIQFSTLDKPARTLLVTSPSALEGKSVTSANLAV
A0A0M8KAF3      ------LVAREQPRAPVSEAYRVVRTNLQFAEVQSPLHSLVVTSSEPGEGKTTTAANLAL
A0A523V9H6      ------LVTLTEPLSPPSEAFQVLRTNLRFSALDKPLRTLQFTSAGPEEGKSLVLANLAV
A0A3D1U3H5      ------LSVTENRRSLGAEMYRMVRTNLLFSGADAANKVILMTSCGEGEGKTTTSMNVAM
A0A2N2MEK3      ------LHVAAFPRSPAAEAFRNLRSSIEFSGEDRPPKTLLVTSSRPGEGKTTVASNLAA
A0A3B9J9U6      ------LHVAAFPRSPAAEAFRNLRSSIEFSGEDQPPRTLLVTSSRPGEGKTTVASNLAA
A0A661VSD8      ------WAAIDRFRYPEIEAIRNLRTNIFLSTPGTSLDTILVTSPEIGDGKSFTVANLGL
A0A497C1E5      ------VLSSRNPLSPVAEGARAVRASIFLMRPDQPYRVLLLTSPGAAEGKSFIIANLAV
A0A1W9UQ51      ------ALSSDNP-------------------PDQPYKVLLLTSPGASEGKSFVIANLAV
A0A497B563      ------ALSSDNPLSPVAEGVRAVRASVFLMRPDQPYKVLLLTSPGASEGKSFVIANLAV
A0A3D0UNQ0      QGR---MIVSEDPRSPVAESYRIIRSNIQFMFIDNPGRAILVTSAVPGDGKSTTAVNLAI
A0A2G6GG97      GSG---LITQNAPRDPISEAYRIIRTNLSFSTVDKELKSYLVTSASPGEGKSTTAANLAV
A0A521TS25      GSDRLRLVADTEAKSPVAESFRILRTNVEFAQVDRACRKLMITSPSQGEGKSTIAVNFAA
A0A3M1H759      ADR---LVTLHNPFSAASEAYRVLRSNIQFMAGEQPPKTIMLTSTTPEEGKSLTAANLSV
A0A535D584      SGT-------QMRTAVADEAYRSLRTSLLFAGVDRTLRSVVVTSARVGEGKTRTAANLSA
A0A5C7JS64      LPHQ--LFILDQPMSPESEAVRLLRANVEFAIANTEEKTLAVTSAGPGEGKSTIVANLAV
A0A535IMD1      PRDA--LVTATRPNDPVSEAYRLLRTNLQFSGVKNPAGSVLITSSSPGEGKSMTAANLAV
A0A521UD91      GTTAPRVLDDIAARSSLGESYRIVRANVDFAWAGQPGQLVMFTSTNPGEGKSTTLGNLAT
A0A3C0LJ76      DTASQGLVMLQNPHSTDAEAIRVLRTNLLFASVDHKLSSLLVTSPTPGEGKSFISSNLAV
I0I8T2          DSSERPLIMLSAPHTSDAEAFRVLRTNLLFASVDRGLGALVVTSPTPGEGKSFVSSNLAI
A0A497ASN6      SNSN--LITLEQPRSHTTESFMVLRANLEFLNVDTPLQVLGITSPGVGEGKSNVAANLAL
A0A3D1TRD4      VTV---GADSVAQDRHSAEVFRVVRANLGFATASYRSKILLVTSTQKAEGKTTTIAKLAV
A0A3C0XJG2      ------LFVRDAPASPEAEAFRAVRANLVLAALDRPPRTIMVTSALSDEGKSLVAANLAL
A0A3M1ZZ81      NQR---LITHHTPRDPISEAYRVLRTNLTFSAVDSELHSLLITSSSPGEGKSTTTANLAV
A0A497AF06      NGR---LVTLAMPVSPASEAYRALRTNIRFASVDEPLKTLLITSAEPKAGKTTVAANLGV
A0A661W444      NGR---LVTLAMPVSPASEAYRALRTNIRFASVDEPLKTLLITSAEPKAGKTTVAANLGV
A0A3D0D4X6      TPA-QAVILANAPRSPLAEAYRMLRTNLQFAMVDRPLHILVVTSPGPREGKSVTSANLAV
A0A1J4ZRV4      TRQ---LVAWLQTKAPESEAYRTLRTNIQFSSVDKPVRSLLVTSAGPSEGKSTTAANLAV
A0A1V5RXW5      ARE---RIAWLRTSAPESEAYRTLRTNIQFSSVDNPVRRLLVTSSSPGEGKSTTAANLGV
A0A522N7L9      RSEIYHLVALLYPRSPVTEAYRTLRTNVEFASVDAPVRTLLVTSSVPGEGKTTTAANLAV
A0A535W4H1      VNEVYRLVTLVNPRSPAAEAYRSIRANVDFTSVDRPIRTLLVASATASEGKTVTAGNLAL
A0A521IC37      ------LITLLHPRSPIAEEYRSLRTNLRYSGIENPGGALLVTSANPSEGKTTTAANLAV
A0A3A0B2P8      RAG---LEG-DDERAALNDAFSALRLNIQAALGGDVPKTLLVGSPAVGDGKSSVAANLAL
D1CAL1          ------IEAIAHPDSVGSEAYRTARTNLQFVAVGQSLRSFVVTSPRPGDGKTTTAVNLAA
A0A497BNC7      QIA---LVVAEYPLQPIAEAFRSLRTSIQFSSVDHPAKTLLVTSPLPTEGKTFTSANLAA
D1C8M3          ------IALVTAPRSPVSEGYRSLRTNLQFATLGQEVRSILVTSARPGDGKTTTVVNLGA
I4EI06          ------VESLRAPHSPAAERYRSLRTALQFATLGQPIRSLVITSPRPGDGKTATATNLGA
A0A2E5F6N9      ------VTLLSQPRSSHAEAFRQAKVNVQFLSLTPPPKRYLVTSPGPGVGKTTFSVHLAT
A0A2E6J6X7      ------LIVDTSPKSSFAEAFKQIRTNLQFAATKSESRVYLTSSPGPGDGKSTLISNLAV
A0A3M1EAN8      ------PLSMLEPLSAYAEAYRTLRTNLRFAGNGSPPGALLITSALPGEGKTTVAANLGT
A0A535QK16      ------LVALGGDSPVV-EAYKALRTNLLFSSVDKEVKTVVITSAVPDEGKSRTAANLAI
A0A1F8RRT9      ------LVVASTERSAAAEAYRVLRTNLQFSTLDA--QALLVSSANPGEGKTTTVANLAV
A0A6I1QLV0      ------PVTEEWPHSALAETFRVMRTNLQFASMDLQVKSLLVTSAHPGEGKTTTCANLAV
A0A535FRM3      ------K-----DNPVLAESYRILSAHTSIMQTNHPFKLLMVTSAVAGEGKSTLATNLAT
A0A401ZA55      ------E-----DTPELAEGCRILCANLNMAQMMRPFKLVMVTSPMAGEGKSTIAANMAS
A0A4P6JS79      ------E-----DTPALAEGCRILCANLNRVQGAHPFKLVMITSALAGEGKSTIAANLAS
                                                           .     **:    : . 

A0A535RWE5      AFAQ-AGSPTVLIDADLRRPSQHRLF-GLDSSK----GLTTLLTADDPLG-----RLDAF
A0A0P6WSP2      ALAR-LGLKILVVDADLRLPSLHRIF-GVDQEN----GLSEALVS-GKGT-----DHLKT
A0A5C7JWY1      AMAQLEDTQVVLIDVDFRNKQIHPLY-DVGSSEEPPKGLGHLLRGEANLA-----DVVHQ
A0A1F8QGH2      AMAG-SGQRIVVVDADLRLPRLHQVF-KLDGKE----GLTDSLIN-SSLD-----GNLQA
A0A1Q7TTL6      TFAE-AGHRTLLIDGDLRRGVLHRRL-GARRRP----GVSDFLRGEVPLE-----AIVQA
A0A0S8KFR9      AMAQ-AGQKVVVVDGDLRYPCLHEVF-ELPNDM----GLSNVLSDLRRMS-----TALQE
A0A535SLQ0      AFAH-ANHRTLLVDADLRRGALHRAL-QLRREP----GLTDLLVAKASPE-----QVLQA
A0A363SX22      AFAQ-SGKKVVLLDADLRRPSLHGFF-SIPNQT----GISDIIRGQVSLE-----EAIYR
A0A326UPN3      FLAM-SGKRVLLVDADLRNPVLDKHF-HINNQN----GLAQILMGVWGNNEMALDGI--P
A0A455STY5      FLAM-SGKRVLLVDADLRNPVLDKHF-HINNQN----GLAQILMGVWGNNEMALDGI--P
A0A3A4VPK9      IYAQ-KGEKVLLLDADLRRPRVHKTM-GITNHI----GLTDLL----RGSHDLQDVIQKM
A9B6E3          VLAQ-AGQKVVLIDADLRKPMMHRVF-EVSSEY----GLTNLLT---NNEDPTIRERTVL
A0A3D0CW53      IMAM-AGKRVILVDGDLRRPSVHRFF-GIPNRL----GLTNLL----VDEALALETVLME
A0A1F8SS27      ILAH-SDREIILLDADLRNSNIHKMM-SIPNEY----GLSDILRNGMNVS-----QALRN
A0A2E0L5X9      ESAQ-TGLRTLIIDGDMRRGDMHEIF-QLPNMY----GLGDILQSN-EPLANLLPNVLLD
A0A3A0AXU8      VFAQ-EGRRTILVDLDLRKPQVGARF-GLRREP----GFSNLV----VDRELAVEHCLQA
A0A3D1JCW0      VLAQ-GGINTLLLDADLRRPRLHKIF-KCENKL----GLSSLF---VQPMDGLEKVIVHS
A0A2N2MJJ0      ALAQ-AGKKVLLIDTDLRRPRIHQYL-GLGNRF----GLSDLFL--SHGKLADVTQVYEG
A0A3M1LAM5      AMAS-AGMRTVVVDADFRAPSLHESF-DLPNVL----GLAELLSAGRDEYQALLDKALLE
A0A536BZ00      ALGQ-AGRSTILVDADLRVPELHDYF-QLTNDQ----GLTSLL---RDETLP-VSAVARE
E8N5M1          VIAQ-SGNRSVLIDADLRRPRIHKVL-GLDNRQ----GLSG-L---FIQNPTMLNGALQQ
A0A1F8U7F0      IMAQ-GGKRVVLVDADLRRPKIHRFL-GLSNKV----GLSD-L---FRGVVAVRMVSQQV
A5V160          AIAR-SGKRVILVDTDLRRPSLHRFF-RHANLR----GVTTAL---VRDPSDSLYNHMIA
A0A2A6REI6      VLAR-AGKRVLLVDADLRRPTTHTYF-AHHNLR----GLTTAL---VREGDTPVDFHLHS
A0A426TTK3      VLAR-AGKRVLLVDADLRRPTIHTYF-AHHNLR----GLTTAL---VREGDTPVDFHLHS
A7NIZ1          AIAR-SGKRVILVDTDLRRPSLHRFF-RHANLR----GVTTAL---VRDPSDSLYNHMIA
A0A0P6XM68      TMAQ-GGKKTLLIDADLRRPRVHQYL-NLPNRV----GLSN-L---FRDAKSLHEVMGQW
A0A2N2MEG3      TIAQ-GGKRVLLIDADLRRPRVHHHL-GLNNRV----GLSN-L---FRDSIAIGDVAHAW
A0A353RQ31      ILAQ-GGNRVLLMDTDMRRPNVHVQF-NLHNRI----GLSD-L---VRGKLSLHEVVRSI
A0A3B9KNR2      ILAQ-GGKKVLLLDTDMRRPNVHTQF-NLHNRV----GLSD-L---VRGRLTLEEVVRTI
A0A0P6XME1      VIAQ-AGKRVLLIDTDMRRPQIHERL-RLPNRF----GLSD-I---LREHGSLDESLHHL
A0A3B9Q1T8      IMAN-NNKNVLLIDADMRKPKIHTHL-GLSNRY----GLSD-L---ILGRSA-SVVQRAG
A0A1F8PTW9      FVAQ-RNKKVVLLDADLRSPNIHKYF-NLANDR----GLVDLISNGATSN-----DVLRV
A0A1F8QH26      FMAQ-RRKKVVLVDADMRRPTIHEYF-NLDNDK----GLTDFFSKNASIS-----DVLRI
A0A359HML3      IATQ-ANKKVVFVDGDLRKSKMKEAL-KLEQDT----GLSTLLNSPAKLKDVVFTLD---
A0A3M1EJ46      VMAQ-AGMKVLLIDTDLRAGNLHQVF-GVPDRP----GLTDLLLSNAVPDESM----LLK
A0A2U2S5W9      SMAQ-AGFKTVLVDADLRRPVQHKIF-GLSNQQ----GLTNALLQPGEPSADGHLQSTEI
A0A0M8KAF3      VMAQ-AGRKVVLVDADLRKPLVHRLF-QLSNAQ----GLTSALMHP-EIAVDRFLQRVDA
A0A523V9H6      AMAQ-AGLKVILVDGDLRRPRQHALF-GLHLLG----GLTSSLLQG---STDGRLQPAEQ
A0A3D1U3H5      VMAE-IGRKVLLIDADLRRPHIHQVA-GIENRG----GLTALLLG--MDGGDIMTSTVQS
A0A2N2MEK3      IFAQ-SGKRVVLVDADLRRPSVHRAL-GIPNRL----GLTTLFRDSLKLESVWKHSNGIS
A0A3B9J9U6      IFAQ-SGKRVVLVDADLRRPSVHRAL-GIPNRL----GLTTLFRDSLKLESVWKHSNGIS
A0A661VSD8      TIAV-TGMRVVLVDADLRNPTLHEMF-DRPNVM----GLSELLSGDSPISESRPPMELQP
A0A497C1E5      VLAS-AGNRVIVVDADMRRPSLHELF-DQPNVI----GLADVLGDHKVDND-FSSIPLQE
A0A1W9UQ51      VLAA-AGNRVIVVDADMRRPSLHELF-DRPNVT----GLADVLSDHKVDDEGLLSVPLLE
A0A497B563      VLAA-AGNRVIVVDADMRRPSLHELF-DRPNVT----GLADVLSDHKVDDEGLLSVPLLE
A0A3D0UNQ0      AMAH-NEKRTVIVDADLRNSELHEIF-GVSNSN----GLTEQLR---QPESQKK-IHLFD
A0A2G6GG97      VLAQ-TGKKVVLIDADLRRPIQHKIF-NLPNNM----GLTTSIL---DGRTPVT-AHLQQ
A0A521TS25      VVAQ-AGKRVLLVDCDLRRPSLHRTF-RWENQQ----GLTNLLV---RGTIDWH-AVTRQ
A0A3M1H759      VMAQ-ADFKTILVDADLRKPSIHKIF-EISNSQ----GLSDLIS---NPDMEPE-AVLQD
A0A535D584      VLGA-AGSRVLLLDADMRRPGQHRLF-NHSAEP----GLSELLLTVATTGQPPNLSGAQK
A0A5C7JS64      AMAQ-AGYSVIVIDADMRRPAQHEAF-NLSNER----GLSTLLA---RSDVDWN-SVARS
A0A535IMD1      SMAQ-SQKRIILVDTDLRRPSQHKIF-GMTNKR----GVTSLML---DETLALD-DVLQT
A0A521UD91      VFAK-DSRTIIMVDCDLRRPSLHRAF-AMQGDR----GLTNLLA---DHRAKLD-DYLVP
A0A3C0LJ76      AFAQ-TGKRVILVDADLRKPTLHRVF-GLVNNI----GVTSALV---SDAADVE-AALQA
I0I8T2          AFAQ-TGQRVILVDADLRKPTLHRAF-GLVNNV----GVTSALV---SNLDEFT-AALQQ
A0A497ASN6      VMAR-GGKRVILIDADLRRPMIHSLT-GLAQSP----GLSEALV---EKEIPLE-EYLQT
A0A3D1TRD4      ALAE-AGKRVVLVDADLRLSSLHRMF-KLDNRR----GLSNLLVDPVASPAELL-PYLQQ
A0A3C0XJG2      AFAE-SGSLTVLVDADMRKPMQHLLY-GLDSTV----GLADLLRE--TVPLA---DIRKF
A0A3M1ZZ81      VMAQ-TGKQVILVDADLRRPTQHKIF-QLSNNQ----GLTTAILD--SLTPVSY--HLQK
A0A497AF06      VCAQ-AGLRVVLIDTDLRFPNLHQLF-DLNNHT----GLTD-LLV--GNARSVK-ECMME
A0A661W444      VCAQ-AGLRVVLIDTDLRFPNLHQLF-DLNNHT----GLTD-LLV--GNARSVK-ECMME
A0A3D0D4X6      AVAQ-TGARVILVDADLRRPSQHTLF-TLPNQT----GLTS-AIV--SDEVDLQ-ALLKP
A0A1J4ZRV4      VMAQ-TGQRVVLVDTDLRRPVMHKVF-GVANNT----GLTSALLN--GEQVVLD-GHLQG
A0A1V5RXW5      VLAQ-TGQRVILVDTDLRRPTLHKVF-GIPNNT----GLTTALLA--SQDTPIM-EQLQP
A0A522N7L9      TFAQ-AGRRVLLVDADLRKPGLHRIL-DLPNQH----GLTT-LLG--TDQVGLE-SLIQG
A0A535W4H1      VFAQ-AGRRVLLIDADLRRPGVHTIF-RATNAR----GVTS-LVL--DPNLDPA-RVVQM
A0A521IC37      AMAQ-SGKRVILLDADLRRPGIHPLF-GLSNQM----GLMTLFWE--ETPRVEE--VMQT
A0A3A0B2P8      AFVE-AGYRALLVDADLRRPSLHRQF-NLPNQR----GLTTLLLG--EEHNLEL--LIQQ
D1CAL1          VLAQ-GGQRVILVDADLRRPQVHRYFAGLNTRS----GLSNLLLS--EWDVKLT-PTLRQ
A0A497BNC7      VMAQ-GGQSVILVDADLRHPRVHRAF-DVSREP----GLTAALLS--PDGWEQA---LRP
D1C8M3          VLAQ-GGQQVIVVDADLRRPRLHAALGNVPNRF----GLTNLLLA--DDEVDLA-ALLQE
I4EI06          VLAQ-AGQRVILVDADLRKPQLHTHFAGVKNRA----GLTNLLLA--QPGDGLADALLQP
A0A2E5F6N9      AIAQ-EGKNVILIDSDFRRPGVPPYF-SLSNQM----GLSSLL----ANPELQLEDLLQS
A0A2E6J6X7      AIAQ-TGKKVLIVDGDLRRPTLHRRFKNITRDT----GLSNYL----SDNTETLGAVTQT
A0A3M1EAN8      VMAQ-AGRKVLLVDADLRHPDLHRLF-DVPNRR----GVADLLLN--GQLPDETWL--VE
A0A535QK16      VLAQ-AGHPTLLVDADFRRPSQHRMF-GKVRNV----GLSNLIVQ--DMPESALFV--PD
A0A1F8RRT9      AIAQ-TGLRVIVIDSDLRRPALHRIF-GLSNGA----GLTNALLS--RQPEIQRFL--QP
A0A6I1QLV0      AIAQ-TGRRVIVVDSDLRRPSLHLLF-SQPNRQ----GLTNQLLL--GEGGITRFL--RA
A0A535FRM3      FLAL-SDKRVLLVDADLRRSVLDQHF-QLDNHH----GLADTLLT--PWEQIKTALEGQL
A0A401ZA55      FLAM-SGKRVLLVDADLRHPVLDQHF-QLNNQK----GLSNAFLG--IWNQVETELDGQP
A0A4P6JS79      FLAM-SGKRVLLVDADLRHPVLDQHF-QLDNRQ----GLSNAFLE--MWTQVQPQMEGQP
                          :.:* *:*                   *.                     

A0A535RWE5      SVAPNLHVVPSGPL-----PPDPAEFLSSARMSTLLE-LLAKRAPNA--TVIVDTSPTLA
A0A0P6WSP2      TKEAGVKIMTSGSL-----PPNPSELLNSKKLTILLE-KLSQQA--D--LVLVDSPPILS
A0A5C7JWY1      TFVSNLSVIPHGGR-----PTNPTELLHSKSMTQLLN-WGTTNR--Y--HIILDCPPVLP
A0A1F8QGH2      TKMDGLKVITSGKL-----PSNPVEVIGSAHMRIFLK-EFEEKT--D--LVIIDSPPVLP
A0A1Q7TTL6      TPYPSFSLIGCGTR-----AYNAPELLGSQAMSQLFT-TLRPNY--D--VILVDSPPLSA
A0A0S8KFR9      TNIEGVRVLTSGPV-----PPNPAEPPPLSKLPQLLG-KLAKEA--D--LVLLDSPPILA
A0A535SLQ0      TTHPSLDFLASGSR-----RGDAPELLGSARMADFMT-RLRSSY--G--VIVVDTPPLGA
A0A363SX22      SAKGGVALILAGPL-----PPNPAEMLGSKKMENILA-SLEEIA--D--VVILDSAPLL-
A0A326UPN3      TEIPTLRLMPAGTR-----PQNPAELLISDTARRLFK-HYQDTN--RFDYVIFDTPPLLP
A0A455STY5      TEIPTLRLMPAGTR-----PQNPAELLISDTARRLFK-HYQDTN--RFDYVIFDTPPLLP
A0A3A4VPK9      DGAENLTIVSSGSL-----PPNPAELLGSARMEQILL-ELGNKY--N--IIVIDSPPSI-
A9B6E3          SVAENLWLIPSGPL-----PPNPSELLSSKRMEMLIW-LLQQEY--D--WILFDTPPILT
A0A3D0CW53      TPVAGLKIIPSGPV-----PPNPAELLSSERMKQRGN-EMKELA--D--VIIFDSPPALV
A0A1F8SS27      YDGVNGGVITGGTV-----APNPFELLGSKKMDEILA-KLKKSD-----YVIIDSPPLF-
A0A2E0L5X9      SGYENLNIIPAGRS-----EADPAALLGRTRLNNLID-LLSKRY--D--AIFIDAVPTIG
A0A3A0AXU8      TAIPHLLVIAAGTI-----PPHPSELLGSVRAGEVIE-QIKALA--D--MVIFDTAPAAT
A0A3D1JCW0      QRTEGLHLITSGGT-----PPNPAELLGSQKMKEILN-RLSQSF--D--TLLLDTPPVLT
A0A2N2MJJ0      PNNTHFEVVTTGAI-----PPNPGELLSSERMKTLLA-EAVKNS--E--IVILDSAPSL-
A0A3M1LAM5      TNVERLTLLPAGRP-----PLDPTMLLTSPRFPELLD-LLLERF--D--AIVMDSPPVLL
A0A536BZ00      TEEPRLRVVTSGPV-----PPNPAELLGSQRMRGVIE-RLKNAA--D--VIVFDSPPLSA
E8N5M1          TRLETLKVLPSGGT-----PPTPSELLGSRKMKEILD-SVASEA--E--MIVVDTPPVLS
A0A1F8U7F0      QDVETVSVLTSGSL-----PPNPTELLASVRMEQILQ-EAEQDA--D--IVIIDSPPSL-
A5V160          TGLENLLVLPSGPV-----PSDPAVMVSSKKMLDLID-ELKRMA--D--VVVFDSPPILA
A0A2A6REI6      TKLNNLLLMPSGPL-----PSDPAAMLSSPQLVELIE-ELKTQV--D--VLVFDSPPLLQ
A0A426TTK3      TKLSNLLLMPSGPL-----PSDPAAVLSSPKLVELVE-ALKAKV--D--ILVFDSPPLLQ
A7NIZ1          AGEENLLVLPSGPV-----PSDPAVMVSSKRMLDLID-ELKRIA--D--VVVFDSPPILA
A0A0P6XM68      KE-TTLQVITSGGL-----PPNPTDLLASDRMAAVLQ-SALEEA--D--VVVVDAPPFL-
A0A2N2MEG3      QD-SNLSVITSGGV-----PPNPADLLASERMAAILE-SANKLF--D--MVIVDAPPFL-
A0A353RQ31      PEVKNMDIITSGSL-----PPNPAELLASERMRNLLD-ELKKSY--D--VIVLDSPPLI-
A0A3B9KNR2      PEVKSMDIITSGSL-----PPNPAELLASERMRKLLE-ELKSHY--D--VIVMDSPPLV-
A0A0P6XME1      AT-EGIDVITSGIL-----PPNPAEVLSSERMAKLME-EVAQRY--D--KVILDGPPFL-
A0A3B9Q1T8      SN-KKFSVVTSGSI-----PPNPSELLASEKFTRIID-KVSQQF--D--MVVIDSPPGF-
A0A1F8PTW9      IEDGKLTILTSGNT-----PPNPTELLSSNKMDQLLS-KLKEIY--D--IVIIDSPPFI-
A0A1F8QH26      GENRKLGVITAGKP-----NPHPAEFLSSNKMNQFLS-KLKTVV--D--YIIIDSPPFI-
A0A359HML3      ---QRLTIIPSGSC-----PPNPTELLGSEKMDRILT-HIKGMA--D--LIVVDSPPLFV
A0A3M1EJ46      TEVLNLYLLPSGPL-----PPTPSELLSSDRMVSLIE-HFRGRV--D--VLLMDSPPVLA
A0A2U2S5W9      ---ENLRVLTSGPI-----PPNPSELLGSAKMQALLQ-RLKEEY--E--VVIFDSPPALV
A0A0M8KAF3      GGGQTLWVLPSGPL-----PPNPAEVVGSRRMQELLD-ELMTFA--D--IVILDTPPVLV
A0A523V9H6      VEGLSL--LSAGKS-----PPNPAQILSSQRLRELID-ELAQKA--D--VVLVDSPPVLP
A0A3D1U3H5      EADPHLYFLPSGPI-----PPNPTALLSSQRMRDLLH-AFKQSF--D--TIIVDSPPLLA
A0A2N2MEK3      RG---MLVITSGSL-----PANPSELLGSEKMLHILA-ELRQKA--D--IIIFDGPPMMV
A0A3B9J9U6      RG---MLVITSGSL-----PANPSELLGSEKMLHILA-ELRQKA--D--VIIFDGPPMMV
A0A661VSD8      TGVDNLFLLSSGRP-----PTDPAALLVSPRLPALLD-TLEKFA--D--VVILDSPPALI
A0A497C1E5      TGFDNLLLLPAGRP-----PVDPATLLTSPRFPALLQ-FLKGQG--D--VLLIDSPPVLG
A0A1W9UQ51      TDFDNLYLLPAGRP-----PADPATLLTSPRLFALLD-SLGSQM--D--MVLIDSPPVLG
A0A497B563      TDFDNLYLLPAGRP-----PADPATLLTSPRLFALLD-SLGSQM--D--MVLIDSPPVLG
A0A3D0UNQ0      TKVEGLQLLTAGEP-----PPNPSELLGSQRMVKLVD-TLNSEA--D--VVIFDSPPAAY
A0A2G6GG97      TKISNLGLLTSGPI-----PPNPSELLNSRRMQDVLK-ELEDNS--D--LVIFDTPPVLT
A0A521TS25      SAIPNLSVILSGPV-----PPNPSELLGSSRFASVID-ELASEF--D--LVILDTPPTIA
A0A3M1H759      TTVKNLRVLTSGPL-----PPNPAEKLSSQRMSQLVH-LLEETA--D--VVIFDTTPVMA
A0A535D584      TRFTNLSLMTAGMT-----PPNPSELLASRAAELTLR-WLEHSY--D--IVVIDTPPVDA
A0A5C7JS64      NAELKLQVITSGPI-----PPNPGDLLKSPRFGALLE-TLSSEA--D--LVIVDTPPALA
A0A535IMD1      TDLENLRVLTSGPL-----PPNPAEVLNSTQMLSIIN-QLKDCS--D--MVIFDSPPVLA
A0A521UD91      TKQPNLWLLPSGPI-----PPNPSELLGSNRMLAILD-ELRQRA--D--MVFIDTPPLLA
A0A3C0LJ76      TATPELRVMTSGPL-----PPNPSELLSSHKMQELLT-HLQSLC--D--VVIIDSPPVLV
I0I8T2          TIVPELRVMTSGPL-----PPNPSELLSSRRMQELLD-RLRSDC--D--LLVIDSPPVTV
A0A497ASN6      IGIENLRILTSGRR-----PPNPADLLASRRMGELIA-HFKSLC--D--MVIVDSPPLLA
A0A3D1TRD4      TPLPTLRVLTAGVM-----PPNPTELLQSENMATLLA-MLAELA--D--VVLIDSPPVLA
A0A3C0XJG2      EVMPNLIVLPTGRP-----PLNPAEPLSSTKMLSLIL-SLSQLA--DAATVVIDTSPVLA
A0A3M1ZZ81      TRVPGLRVMTSGPI-----PPNPAELLNSHRMKQVLE-ALQQEA--D--LIIFDTPPVLT
A0A497AF06      TGIDNLRVITSGPI-----PPNPSELLGSKRMEAVLA-EVKQSA--E--LVILDTPPMLA
A0A661W444      TGIDNLRVITSGPI-----PPNPSELLGSKRMEAVLA-EVKQSA--E--LVILDTPPMLA
A0A3D0D4X6      TTMSGLSVMTSGPI-----PPNPAELLNSERMSHLLQ-ELAAQA--E--LVILDTPPTLA
A0A1J4ZRV4      TEVENLSLLTSGPI-----PPNPSELLGSHRMARLVE-KLAGQA--D--LVIFDSPPVLA
A0A1V5RXW5      TEVPDLHILTSGPI-----PPNPSELLGSQRMAYLIE-MLAEIA--D--IIIFDSPPVLA
A0A522N7L9      TEQDGLAVLTTGPL-----PANPAELLASQRMRAILE-HLTGLA--D--LVIIDSPPLQA
A0A535W4H1      TEQGHLTILTSGPL-----PPNPAEILGSHRFGAILE-QLAADF--D--LIVIDTPPLQA
A0A521IC37      TDVPGLRVIAAGEP-----PPNPAEILDSKRMTEILV-ELRSQA--D--MVVVDSPPLLV
A0A3A0B2P8      PAQQRLSLLTSGPL-----PPNPTRLLSRKELRGVLA-EMAQKF--D--IVLLDTPPLTA
D1CAL1          TTIAGLTVLPAGPL-----PPNPLDLLSSPRMREVLD-WLAEQA--D--VVIFDAPPL-A
A0A497BNC7      TEIAGLQIVTSGSS-----PPNPAELLASERMREFVS-WLAEQA--D--VVILDSPPVLA
D1C8M3          TDVPGLRVLTTGPL-----PPNPTDVLDSPRMHELIA-GLERMA--D--MVLVDAPPV-P
I4EI06          TEIPGLRVLTTGPL-----PPNPADVLNLPRMREILT-SLEDAA--D--VVLVDAPPM-A
A0A2E5F6N9      TAIPTLKVLTAGPN-----PPNSVELLGSSRMEAIMD-EVAARG--D--ILVIDSAPIMA
A0A2E6J6X7      SGVSGVDVITSGPI-----PPNPSELLNSPRMKDGIE-KAKDIY--D--IILVDCPPVLM
A0A3M1EAN8      TSQPRLYLLPGGPFTADPRSPTPAELFDATRLQALLD-HLRFLAEV----IIVDSSPVLE
A0A535QK16      EQVKDLVILASGAT-----PPNPSEVLGSAHMKALLA---RFRKGFD--YVVIDTPPVNA
A0A1F8RRT9      TAFEGLSVLTSGPL-----PPNPSELLSSRRMDAIVD---AARKEAE--ILLFDSPPALA
A0A6I1QLV0      TEVEGITFLPAGLL-----PPNPAELLGSPRMGRLLD-ELTATGAM----VLLDSPPLLS
A0A535FRM3      TEVPALRVLTSGAY-----SSNPAELLQSPLAQELFNKHFREMDQFD--YIIFDTPPLLP
A0A401ZA55      TEIPSLRVLTAGVL-----PSNPSELLQSQLASQLFN-HFRNSQKFD--YIIFDTPPLLP
A0A4P6JS79      TELPSLRVLTAGVL-----PSNPSELLQSPLAQQLFK-HFRESKQFD--YIIFDTPPLLP
                        :  *          .                           :..*  *   

A0A535RWE5      VTDAIALSAKVDACLVVVDAARTRTGSAIRTVESL---R-RVRARIVGGVVNKVRSTPAG
A0A0P6WSP2      VADSIILAGELDGTMLVARSGMTTRKMLREAEENL---R-QVRGNLIGVVLNGVPRDQHS
A0A5C7JWY1      IADAAVLASKVDGVLLVVSAGETTRDACHLAIQRI---K-QAGGRLLGVVMQKAPVSESS
A0A1F8QGH2      VADAAILTSLVDRVILVLRAGQTRHRAAQQAVKSL---Q-QAGAQQIWVVLNAVPHHMDG
A0A1Q7TTL6      GVDPLILGTLTGHLVVVLRTGFSHRDVAAAKLEVL---Q-RLPVRLLGAILN--AVPAGE
A0A0S8KFR9      IADAATMASMVDGVLLVAAKDQATGRRVQRALQQM---A-RVGAKPLGVVFNRASAADGD
A0A535SLQ0      GVDAFVLASLAGCLLMVLRLGKTDRELAEVKIDLL---R-QSPVRVLGAVLN--DVREGS
A0A363SX22      VADAWALSAKVDGVVLVVEPGRLKRKTAQAIMDRI---Q-LSRVRIVGLVLNRVKKGSES
A0A326UPN3      VADAQIVASYAEVSVLVVAASRSPRRLLNRAMQIL---R-RTGTRVLGLAINRSQWPEYG
A0A455STY5      VADAQIVASYAEVSVLVVAASRSPRRLLNRAMQIL---R-RTGTRVLGLAINRSQWPEYG
A0A3A4VPK9      VADSQILSSKVDAVLLVIQPGKTSKEAAKATEDLI---K-RAGGHIIGVVFNRIPRDRVD
A9B6E3          VTDPIALIPRVDGVVLVAEAKRTRRDMLAKCRAAV---Q-TVGGRVIGLVFNKLDPRSEG
A0A3D0CW53      VTDATILGTLSSGIVYVVNAGRTRSGVVRRGKETL---D-QVGLKILGVVLNNSTSHRAR
A0A1F8SS27      VSDSMVLSPKVDGVLLVAELSQTKKKQIRRTVEQL---N-RTGAQVIGVVLNRATGESLK
A0A2E0L5X9      GSDSVFLGEISDGVIIIVNARRTRLSSLRRSKDEL---MAAPNVNILGVVFNRVRLQVTS
A0A3A0AXU8      VTDALLVVPHMDGALQVVDAGSTRRDLALRCKALL---E-RAGARLLGPVLNRVEAGDLG
A0A3D1JCW0      VTDTVALSKAVDGILIVVRLGKTKRGEFLQAIEHL---R-QVNANLVGVVINGVSPRHAR
A0A2N2MJJ0      VADSQSVSASADGIIIVVEAGGTRAEPVRAMLESL---R-RTHTRILGLVINRMK-----
A0A3M1LAM5      APDAVILATRADGTVMVVSAEHTSRQAARRAIKVL---RDQEGVNFLGVVVNRIPLHHYA
A0A536BZ00      VTDAAILASAVDGTLLVVDAHRTRRDLARGGANAL---K-RVGARVLGVVLNRVSGGTLD
E8N5M1          VTDAAVLSPLVDGVLLVVKMGTTKQSALLQAVEQL---Q-QVNARILGVVVNGVNPKKSH
A0A1F8U7F0      VADVQVLAGKVDGVILIIHPGHTQEDASLATLEML---N-RAGARTLGVVLNRIP-RGRS
A5V160          VADAIPLAHICDATLLVVLAGATRTSQLRRACDQL---L-QAGVEPQGVVLNRVT-KEQG
A0A2A6REI6      VADASMLMQLCDTVVLVATDGKTRTSALRHSMQLL---E-QSGVKLAGVVLNRVR-KSRY
A0A426TTK3      VADAALLMQLCDTVVLVATDGKTRTSALRHSAHLL---A-QSGVKLAGVVLNRVR-KSRY
A7NIZ1          VADAMPLAHVCDATLLVVLAGVTRTSQLRRACDQL---L-QAGVEPQGVVLNRVT-REQV
A0A0P6XM68      VADASILASRVDGVLFVIHPGRTPVDAAQATLEQM---R-RVGANVLGLVLNRIP-RNRP
A0A2N2MEG3      VADASILAARADGVVLVIRPGKTPLDAAMTTLEQM---K-RAGANILGVVLNRIP-RNRP
A0A353RQ31      VSDSQILATRVEGVLYVIVPGSTRIESAKRPLEEL---E-RINAHLLGVVMNRIP-HNRS
A0A3B9KNR2      VSDSQILSTRVEGVLYVIIPGFTRIDSARRPLEEL---E-RINAHILGVVMNRIP-QNRS
A0A0P6XME1      ISDAIVLASRVDGVLLVLRARNTSQSVALEVLDQL---D-RVKARVVGAVLNRVQDTTSN
A0A3B9Q1T8      VTDAQILGTKVDGVIFVIRAGKTRANIARMSLDEF---N-RVGAKVVGLVMNRVP-RNQR
A0A1F8PTW9      IADTMILASKVDGVLLVVRPGHTRQPLAQVTTEQI---N-LVGARLVGVVLNRIPLHGAD
A0A1F8QH26      ISDAMILAAKVDGLLLVVRPGHTRQPLAKVTKEQI---G-QIGANLIGVVLNRIPLRNAV
A0A359HML3      T-DAAVLAKKVDGILLVVQLGKSRRDTVKEMMVQI---E-RTGTSVLGVIINKISSGSNY
A0A3M1EJ46      VTDAAILASLVDGVLLVIESGRTSKGEAQRALHTL---Q-AVGGRVLGAVLTRSKAEGIG
A0A2U2S5W9      VTDASVLATRVDGVVIVTDSGHTRRDTVVRAREAL---R-KVGANLLGGVVNRL-SPRSG
A0A0M8KAF3      VADPALLARMSDGVLLVTRMNVTHRQALQRAIEQL---R-YAEARILGVVVNDL-TARDG
A0A523V9H6      VADAAALAQAVDGVVLVVDAGATRRGAAQQAVENL---R-QVGANVIGAVLNNVPMTRRG
A0A3D1U3H5      VTDSAVLSTMADRVVLVADPRKATRHTLLRAKDVL---E-RVGSRVSGVVLNRVGEESSG
A0A2N2MEK3      A-DAQILASLMDGVLLVLQPG---KSPADEAKSTLAQLK-RSGAKVIGTVFNRVPKNGGQ
A0A3B9J9U6      S-DAQILASLMDGVLLVLQPG---KSPADEAKSTLAQLK-RSGAKVIGTVFNRVPKNGSQ
A0A661VSD8      APDAAILASIADGTLLVVSEGQTSNGAAAKAQALL--SS-RSGVNLLGVAFNRVKLVET-
A0A497C1E5      PPDATVMATLVEGTILVASVGLTRREAVRQARDRLLGLG-QQGVTLLGLAVNRAKLDGS-
A0A1W9UQ51      PPDAMILATLVEGTVLVVSAGVTRRETIQQAKERLLGFD-QREVNLLGLTVNRAKLDGS-
A0A497B563      PPDAMILATLVEGTVLVVSAGVTRRETIQQAKERLLGFD-QREVNLLGLTVNRAKLDSS-
A0A3D0UNQ0      VTDAAILSRLVDGVVLVISAGKTRRDEARQAIFNL---E-QAGANILGVVLNGMAEKRGG
A0A2G6GG97      VADASIIGPQVNGVLLVINTGRTRQEAFINAVDRL---R-RTGTHIFGAIFNRVKLDRSS
A0A521TS25      VSDPMVMAPVADGVIVVVDAGRTSADLLRRTRDSL---Q-RAGANVLGVVLNKLTERSGA
A0A3M1H759      VTDAAVLANRVDGVILVIRSGRIPRATLKKAVARL---K-QIRANILGAIVNQTPGKGDG
A0A535D584      VTDALPLAAEASATVVVIEAGATGARQLQRALEVL---K-GSGANVIGVVLNKSRRDPPR
A0A5C7JS64      VSDALVVADVAKDVLLVCRANETRVDRLQAAVGAL---P-ET-ARVIGVALNYQKRGKAE
A0A535IMD1      VADALILSGKLNSTLLVVDSGKTRADAVRRSIETL---N-KVNAKVVGVVLNKMRRRHAE
A0A521UD91      VADPALLATRADGVILIVEAGGARVQSIVRANEVL---S-RTSARVLGVVLNKLSRRSSE
A0A3C0LJ76      VSDTAVLASRADGVLLAFTHEKLRRDPARNTIGAL---R-QVQARILGVVLNRVEGSQHG
I0I8T2          VSDTAALASRTDGVLLVFSREKMNRDLAHKTMGAL---R-QVNASVLGIVLNRVTSGEHG
A0A497ASN6      VADTIFLGKWLDGILVIAEWGRTDRSAFVESVERA---R-QSGLRVLGAVLNKVKPPSRG
A0A3D1TRD4      VADAMTIAPNVQGILFIIESGSIRLGRLNEALGRL---R-RSGTPILGVILNKVKADTEG
A0A3C0XJG2      VADAHALSTMVDGCVVVVDSARTPARASRRAVDVL---N-AVHARILGVVLNKVPAIQLD
A0A3M1ZZ81      VADAAILAPRVNGCVVVAEAGSTRRPLFLQAIERL---A-RTGTNLYGVVMNRSKPGRAS
A0A497AF06      VTDAVVLASKASGVILLIEAKRTSHEAARRAYESL---Q-RVGATILGAVLTKAKPERKA
A0A661W444      VTDAVVLASKASGVILLIEAKRTSHEAARRAYESL---Q-RVGATILGAVLTKAKPERKA
A0A3D0D4X6      ATDAAILAAKADGTLLVIDTNLTKRTELVHTTEQL---Q-RVGATLLGATLNRLRRHNLA
A0A1J4ZRV4      VTDAAVMGRQVDGVVLVVDAGQTREQVLAQAAAEL---Q-QTGANLLGVVLNRLDSRRGG
A0A1V5RXW5      VTDAAVLGRQMDGVLLVVDTGTTREQVLGNAVAEL---Q-KTGVNILGVALNRLDTRRNG
A0A522N7L9      VTDAAILAAMVDGALLVVDGSRTRRGAVQMGREAL---A-KADAHVLGVVLNRLSERVYA
A0A535W4H1      VADAAILSARVDGTIIVVDAGKSRRESVVRARDTL---V-RAGAQILGVVLNRVARDVDG
A0A521IC37      VADANILASRCSGAIIVMDSGRTRTDAARKVVETL---T-RSKVKILGIVLNRVSGRRGG
A0A3A0B2P8      TVDASILATHVEAMLLVVAAGRTQRTPTQRVVKSL---R-HLQVNLLGVVLNAVPVSQTV
D1CAL1          VSDALVLSRLTNGVILVSETGRVRTAEIADAVQQI---Q-QSGSTLLGIILNRFPLEKSG
A0A497BNC7      VTDAAVLSTLADGTMLVFDCGETRKPAAVQAFERL---V-SVGGQVLGVVLNRLAPSGDG
D1C8M3          VSDALVLAGLVDRVLLVAYSGRTRSAELARAVEEL---T-RAGTPLLGVLLNRAEAGAGG
I4EI06          VSDPLIIAGLVDGVLLIMTGGRTRSGELTQVVQEL---T-RTSTPLIGAVINRVDVKGDG
A0A2E5F6N9      VTDSSILASKQIETVLLVDP-NTRMGWLKDCIGAL---R-KADATVLGYIHNRINARRFG
A0A2E6J6X7      VADTPIISTVVDMAILVVDSFTTKTSSFGATVETL---N-NSGVEIAGVIMNKLKKPKFG
A0A3M1EAN8      VPDGLELAALVDGVLLAMQNGRSGRYEVQDAVRRL---Q-YARAELLGTVLTRCQGRGG-
A0A535QK16      VTDASVLAAGVDAAILVIDTNKATYPAVQHAKQAL---E-RVGGNVLGSVMNKMKAAGGN
A0A1F8RRT9      VADASILAGKVDGAILVVDTGRTRAHALQRASEAL---A-LSKTKVLGAVLNKLTGRGQG
A0A6I1QLV0      VADAAILAAQTDGVILVVDAGKTRHEAVRRARATL---D-RAGARILGAVLNRVTGRREG
A0A535FRM3      VADAQIMASYMDATLLVIDATIASRKQILQAVNIL---R-KSGTNLIGTALNKSQWPEYN
A0A401ZA55      IADAQIMAAYMQVTIMVVNASRTPRKAMVRAKQAL---A-RTGTRILGVALNKSYWPEYG
A0A4P6JS79      IADAQILASYVDVSVLVVDASKTARSLLTRTKEVL---T-KAGTEFIGVVLNKSQWSEYG
                  *   :       :                                             

A0A535RWE5      YYGY-------YGPGDARKNASRASGIRLPFSSRWLLVPLIGIVVLGAGALFARAGQTVV
A0A0P6WSP2      AYRY--------------------------------------------------------
A0A5C7JWY1      YY---------YG--------------------------------------AYQQQR---
A0A1F8QGH2      YNSY-------YT--------------------------------------NEHEDKNSG
A0A1Q7TTL6      AYRY-------YS--------------------------------------YYLPGYEAV
A0A0S8KFR9      YYYP-------YG--------------------------------------RGIIG---G
A0A535SLQ0      EYHA-------YG--------------------------------------YYMDGYELT
A0A363SX22      DYYSG------YLADASKYDSQASNKR---------------------------------
A0A326UPN3      DIHD------------YRGSVQTQGAPLLKAAPAAQQRVPQQASPVANQPQMQPAQMQPM
A0A455STY5      DIHD------------YRGSVQTQGAPLLKAAPAAQQRVPQQASPVANQPQMQPAQMQPM
A0A3A4VPK9      YYSGN------YQYQYYSKD----------------------------------------
A9B6E3          YGVY-------YTYYYDQHHTSNRGRR---------------------------------
A0A3D0CW53      GYYYQR-----YYYSHESTGERRGRRL---------------------------------
A0A1F8SS27      YYGA-------KQYVGYGLEEADEKLP---------------------------------
A0A2E0L5X9      KYNN-------TYYRQTPALTPEKLSREMARSGSGLFGMRRHIITTGRGERLFSVSACAA
A0A3A0AXU8      YYANY------YSYGGYYHEEAEEAKG---------------------------------
A0A3D1JCW0      ---YHYYYRNYYYYQYSAYYGEGEKRKPSSNGSRSNGKHAPVPHPAGESAPREPL-----
A0A2N2MJJ0      -----------AHHGEYGHYSNSYYQDDIEGN----------------------------
A0A3M1LAM5      YYLP----------------------------PQVTGEAAAVSLP---------------
A0A536BZ00      VYGPSYYDEDRAARPKSRSGAGSRSREPKPGTPRVARAPGAATSPAPAQAAAGSPVAAGS
E8N5M1          YYYRNYGYYQYYYYGDNGNL------------KKKRKTAISE------------------
A0A1F8U7F0      -----------DYYGGYRHY------SPYYSGYHYYHSMDGQ------------------
A5V160          GYDH-----YYYYYGQNRKRSR---RGVLSRLFKRRRRRNAVPGVVDTLDTVMSGSGQTL
A0A2A6REI6      GYGYGYGYGYGYGYGYEPEPEKLTWRRRLRRMWRRLLGRKAAPQ-PSTASGVAGGDWEDL
A0A426TTK3      GYGYGYGYGYGYGYGYEAEPEKLNWWRKFRRALRHLRGGKTRAH-PRPVPSGSPEDWEDL
A7NIZ1          GYEH-----YYYYYGGERKRSSRSALSRLFKRRRRRQSGMPGMVDTVDAGVTGIASGTRP
A0A0P6XM68      -----------NYYGGYRYY------SGYYKGEYSY--------------YDDEARGNGK
A0A2N2MEG3      -----------NYYGGYRHY------SGYYKGEYSYHNYYDEGSSSNQRAYRGNGNGNGK
A0A353RQ31      -----------YYYGGYDYY------SPYSSRDKYRHSYGSE------------------
A0A3B9KNR2      -----------YYYGGHDYY------SPYSARDKYRHSYGSE------------------
A0A0P6XME1      -----------HYYRSLKSY-----------------TYVSK------------------
A0A3B9Q1T8      -----------YYYGGYQYYGLKGEVNAAYDQGDPSENTVDL------------------
A0A1F8PTW9      YYTG-------KNYLYTYYLSNYGAER---------------------------------
A0A1F8QH26      YYTG-------EGYLYTHYMSGYGAAK---------------------------------
A0A359HML3      YSKY-------YGS--YYNIPDSEQND-------------------ADISETEIENNPQE
A0A3M1EJ46      -----------YRY-------------------------------------DRRGVTPSQ
A0A2U2S5W9      GYYY-------YYY--YYYAADGN-GE---------------------------------
A0A0M8KAF3      GYYY-------YAYSQYYHHDDGSGGD---------------------------------
A0A523V9H6      GYYY-------YYY--YYHQHYGE------------------------------------
A0A3D1U3H5      YYGY-------YYYGGYSAYVTDGQKV---------------------------------
A0A2N2MEK3      HYGG-------YRY--YSTDSYNTYEQ------------------------KKPATPIRV
A0A3B9J9U6      HYGG-------YRY--YSTDS---------------------------------------
A0A661VSD8      -----------YAY--YSRYHDDGHGPVAKLRGLVTRWRRQESEDRPLVGLDEAAERLGI
A0A497C1E5      -----------YGY--YSSGLEAVGSS-----------QKRVEGDSVWLTLGEAAEQLGI
A0A1W9UQ51      -----------Y-H--YSSDQEGGEQK-----------QKGTSRDGAWLTLGEAAARLGV
A0A497B563      -----------Y-H--YSSDQEGGEQK-----------QKGTSRDGAWLTLGEAAARLGV
A0A3D0UNQ0      YYYR-------YGS--SPHDQSLIGNR---------------------------------
A0A2G6GG97      YGYY-------YYS--SYEYNAKSKKR---------------------------------
A0A521TS25      YYYR-------YYY--AYYGEDQHGGK---------------------------------
A0A3M1H759      YAEY-------FTP--LAQIQTETAKR---------------------------------
A0A535D584      EYLD-------YYF--SQAAASQPDSA---------------------------------
A0A5C7JS64      SYYY-------Y----YSSDDSSGGSK---------------------------------
A0A535IMD1      AYSY-------YYQ--YYTPGGEPARK---------------------------------
A0A521UD91      YYY----------R--NYHRYYAASPV---------------------------------
A0A3C0LJ76      YYYS-------YHK--SYGNRYYTTPY---------------------------------
I0I8T2          YYYS-------YHK--SYSSRYYSGYY---------------------------------
A0A497ASN6      YYYY-------YYY----------ESS---------------------------------
A0A3D1TRD4      YYYY-------AYD--GYYSSSGKPAT---------------------------------
A0A3C0XJG2      YYQS-------YA-----------------------------------------------
A0A3M1ZZ81      YYDD-------YYY--YATYEYVEGRR---------------------------------
A0A497AF06      YYYY------------------AERAR---------------------------------
A0A661W444      YYYY------------------AERAR---------------------------------
A0A3D0D4X6      GYYY------------YYYDVSSDHNE---------------------------------
A0A1J4ZRV4      YYYY-------Y----YYYSEEEGGQR---------------------------------
A0A1V5RXW5      YYYY-------YYH--YYYQEDESGER---------------------------------
A0A522N7L9      DYYH------------YYGASGYHEAQ---------------------------------
A0A535W4H1      AAYI------------TYAAAAPDEDR---------------------------------
A0A521IC37      YYNN-------YYY--YASPKSNGKAK---------------------------------
A0A3A0B2P8      YHAG-------YGY--AVPRAADAEGT---------------------------------
D1CAL1          GYYT-------YYR--SQEDDAGGARR---------------------------------
A0A497BNC7      YYYY-------YSY--YSHADGGAAGG---------------------------------
D1C8M3          YDLY-------YAE--YYSAEPDTGDQ---------------------------------
I4EI06          FYAH-------YAS--YYGAGSDRVGD---------------------------------
A0A2E5F6N9      YGYT-----YYNYYNY-YKSYNEGGSDDARAPSFIGRIRNKLFSS---------------
A0A2E6J6X7      YGYGYNYGYYYNYYYYNYKYSLEDTNPESKSSKNPFRIFRSIFNR---------------
A0A3M1EAN8      -------------YTYTVHPAPAPHTP---------------------------------
A0A535QK16      YYY--------YAYDYNYGHPNGKAPI---------------------------------
A0A1F8RRT9      YYY--------YSYHYYSSSDDGKNGH---------------------------------
A0A6I1QLV0      YY-----------YDGYYSAP--AQDA---------------------------------
A0A535FRM3      HV-----------QE-YLATLHAQRTK---------------------------------
A0A401ZA55      EV-----------HD-YLSNI--QSRP---------------------------------
A0A4P6JS79      FI-----------LE-YLGSV--QQRP---------------------------------
                                                                            

A0A535RWE5      PEAPRKTVSLERAIEELAAARAAWEGDLHDASSARSRLESADAYLADATAAGADATRVSS
A0A0P6WSP2      ----------ESGEEERPSAQRWFDVLQYWVKTPWFKKK---------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      GSTLQVSLEGEEKNASPTLD----------------------------------------
A0A1Q7TTL6      DEEAERA---SGGKGQPFVI----------------------------------------
A0A0S8KFR9      AEPVLPSFL-GNFVGRFSIIRRIWERAPGLDEDRSPEDQ---------------------
A0A535SLQ0      GEPLFRPLVDGTKRGRPPVTARK-------------------------------------
A0A363SX22      -----KANLQDIQSTSGLGLSLIPKKTPGNSHRFRNAQKQNKPTPINEPNSGEINRNISN
A0A326UPN3      QQMQPGHQMAPNSPSMMPNAPSMAPGSAPMMPPLNGSRGLLSQQQPQQNNQRR-------
A0A455STY5      QQMQPGHQMAPNSPSMMPNAPSMAPGSAPMMPPLNGSRGLLSQQQPQQNNQRR-------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          -----FWNRKDDHQPVPSMSEPAPLDLHDPALDRSEAAYEMASHERSK------------
A0A3D0CW53      -----RAGAVSHRFAVNGQGTGQLKSSTTDHPTTSEDDVR--------------------
A0A1F8SS27      ---NVKSYLNAVRAIPNYIARRFSRSNEAKLEKK--------------------------
A0A2E0L5X9      RLGVKRRTVQGWIETGHLQAESRFMRQWIPESAIDMVLSQRITTVEPPTPASGVSEESPD
A0A3A0AXU8      -----GFWRGRGGRRAAPVRESALPAAPQPARPAVASRMAGAREKGGRVSDGG-------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      -----------------------------------NGKKSRLRLPWAKKVQQD-------
A0A3M1LAM5      --RRVWRRLTGFLKPIRRRLGLGRERIHEDGRVLLSLAEAAHLLGVRKETARRWCAS-GR
A0A536BZ00      IASSVARPPSTSMQPAAPRAATSPPPFSLPAAPVARSSAAAQSPAPQPVSPRPVPPRLAR
E8N5M1          -----------------------------------PGSQPVTSINPPSKPTSR-------
A0A1F8U7F0      ---------------DLKPSRMRRLFGKLSPFNHNGHKKVEAGVVEENVIEKP-------
A5V160          YGAPDVVEATVHRRAPDMTTHPDAQPAVTATTAVQGLDERRNGRAPHQ------------
A0A2A6REI6      TAIEQMETTHANGQNGH-NGHNGQNSQPQPVQQKSDTGRQQSSRSRGRRRSGD-------
A0A426TTK3      VALEQMEGVSGNGHNGNGNGKEHARPGDSATPTGNASSRQSSSRPRSRRRSGD-------
A7NIZ1          DRGAPIDIVMDGFYATPTPETIDRHPVSAGAVVATRTDERRNGMTPHQMNQTK-------
A0A0P6XM68      KH----------------------------STFRWRTRKNQTQEEKTAESGQE-------
A0A2N2MEG3      SK----------------------------MTSWFGRAKKAPGEAPAQEQEKQ-------
A0A353RQ31      -----------------------------------ESTEVALTEQKGNKVLHH-------
A0A3B9KNR2      -----------------------------------ENIDLAFTEQKGT------------
A0A0P6XME1      -----------------------------------ETDELTLLEN---------------
A0A3B9Q1T8      -----------------------------------QKEGIQRMDN---------------
A0A1F8PTW9      --------------------DDLIIDD---------------------------------
A0A1F8QH26      --------------------KTNNNGEGGEVGEGGEVGEGGEGGEGGEGGEGE-------
A0A359HML3      PGVETDATSEPPKDEMKPDPEIILNEQNREISSHSEDVPQGRNPKLRGLLTFG-------
A0A3M1EJ46      LADMVSMLTPSGKGLS--------------------------------------------
A0A2U2S5W9      -----QKRKRKKKHTNHSEQGGFLRGLFGRSQEHTGSSGEGRTENVQHS-----------
A0A0M8KAF3      -----GTRPERKRRRADASRKGVMARLLSFVNVKS-------------------------
A0A523V9H6      ---------EEGKKSRGGRRKGFLAGLRRRRAKRGEEREAAGEG----------------
A0A3D1U3H5      -----SSGSRNGKRAAK-------------------------------------------
A0A2N2MEK3      MAPVPAAFEPTTRPNGHHSVELVN------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      SKGMARRWCKEGRLPAHKSRLRWW-VKREDLENLVESLRNGDAEIIRET-----------
A0A497C1E5      SRDQARRWCKSGRLPAVRKW-FWWRVESDGLDRMLEDTWEIKRSG---------------
A0A1W9UQ51      SKDQARRWCKSGRLPATKKWQLWWRIDPGGLERMLEDTWELKAKV---------------
A0A497B563      SKDQARRWCKSGRLPATKKWQLWWRIDPGGLERMLEDTWELKAKV---------------
A0A3D0UNQ0      -----IRAGLQQARNTLTSAYERLRKKEDVIQDSTQLPDEGKEMTHNIP-----------
A0A2G6GG97      -----RSRRLSKSSRIPSWITSIIKRS---------------------------------
A0A521TS25      -----KSRRRRPKILRALGIGGR-------------------------------------
A0A3M1H759      -----PWWKPSFLR----------------------------------------------
A0A535D584      -----NAEKPARRPAVQSPVASAR------------------------------------
A0A5C7JS64      -----PPSQNGSGRNFGQKVRELVPGGASKL-----------------------------
A0A535IMD1      -----KGLFSRRHRTSAKKNEAVQ------------------------------------
A0A521UD91      -----S---PNGSKK---------EPALIGGRHSNGGHRL--------------------
A0A3C0LJ76      -----SQHKPKSGKRSAPTARTVSQPGA-------NGAGATHVTEAAPSKKRA-------
I0I8T2          -----A---PRRHAKAAAETTMVVSPQPVPHRSINNGAPLEPESVGQPKSVK--------
A0A497ASN6      -----DGKKPWWKRLFKKHKKRSVRKQG--------------------------------
A0A3D1TRD4      -----EHVNGVIEVVEHGAAPVGDGKSGSRRQG---------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3M1ZZ81      -----KKRRRRSRSLLPGWITAIIKR----------------------------------
A0A497AF06      -----PTRHPLWKRWLKAYPKSAGSSGFNRLGND--------------------------
A0A661W444      -----PTRHPLWKRWLGGFVKSR-------------------------------------
A0A3D0D4X6      -----SGPAPAQRRKRKGFLGSARHTAE--------------------------------
A0A1J4ZRV4      -----RRSISPHGADEEGAPARGRARFPWPRLRA--------------------------
A0A1V5RXW5      -----RKHSSRRGTGV-------RFRLPWPRKAA--------------------------
A0A522N7L9      -----SGHDGASDAPATHREPRPTLRVP--------------------------------
A0A535W4H1      -----ATSSKPG------------------------------------------------
A0A521IC37      -----GTPALSVKGNGHANGNGHTNGNGAGKTETPSEKSKM-------------------
A0A3A0B2P8      -----RRGALQIQANGQAGAHTL---PALQEGIKPASNPLYQALRKR-------------
D1CAL1          -----GESPSVIPHWADGAGDRVVIRRSLRPTISKPADSET-------------------
A0A497BNC7      -----RRPRSWIARLLKPGRSRRRRGAEVQGGGRTGAQR---------------------
D1C8M3          -----DGSGPGASTRLSQRLGTLVSGRAVDATQRGNQ-----------------------
I4EI06          -----GNPVASLGTDLDGRHAS--PDRPVRRVGDPGD-----------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      -----KVVPLVAPPDGKETLFPPEQHPG--------------------------------
A0A535QK16      -----ETAKPSPAEKETPVAGSKG------------------------------------
A0A1F8RRT9      -----RKGRLFRGKRSQPAEETRTHA----------------------------------
A0A6I1QLV0      -----AAGRSGAQPAGAAARSQAVRRPMVDK-----------------------------
A0A535FRM3      -----KVDIVPVTPAYQPIADEQIPDDTLSLKQLP-------------------------
A0A401ZA55      -----RADIAMAMPPNTPAINHAIDATNTAILPSTNNKR---------------------
A0A4P6JS79      -----RADISMSIPPTTASSNGSVDGDTSITASLRKGSD---------------------
                                                                            

A0A535RWE5      VAQDVARLRATLDAAPAKSALVVNLAKLDKAAMPTQIVIAGVTYALDSGTQKIWRIDTDG
A0A0P6WSP2      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A363SX22      KLL---------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      SSNGTHGTPGDLRAQREAILDFVSRPNKSDSEN---------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A3M1LAM5      LPAVKRGLRWWVEEEALQAMLNVQLGWDPDGWRQVVREQARGVTGHRGAEAPGQPGDAAP
A0A536BZ00      LPRPPQRLP----------------PWPPHRWAR------RRLGQHRGGYHRPRARRRIP
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      SATAVIQKGLAGIGSPQRMAVAGDVLYVLDDGGKIFKWQRETLTPLSVADRRYKDVAQFV
A0A0P6WSP2      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A3M1LAM5      AMEPVAVDSNLVREEDADGPA---------------------------------------
A0A536BZ00      RLSACRE-----------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      VVANSMYVLDKTSAQVWRYQLVVGGFAAPVALLDQPVPGTPRSLAVDSDIWIVTTDAQVL
A0A0P6WSP2      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      RYHINAGATTASRVPFDIHWTADAALPIDLQVRDGDSRLFLLDDRARRFIVVDRDGREIA
A0A0P6WSP2      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
                                                                            

A0A535RWE5      RIATAPELPRPIAFAISGDGILSANEGTIQRTPIPK
A0A0P6WSP2      ------------------------------------
A0A5C7JWY1      ------------------------------------
A0A1F8QGH2      ------------------------------------
A0A1Q7TTL6      ------------------------------------
A0A0S8KFR9      ------------------------------------
A0A535SLQ0      ------------------------------------
A0A363SX22      ------------------------------------
A0A326UPN3      ------------------------------------
A0A455STY5      ------------------------------------
A0A3A4VPK9      ------------------------------------
A9B6E3          ------------------------------------
A0A3D0CW53      ------------------------------------
A0A1F8SS27      ------------------------------------
A0A2E0L5X9      ------------------------------------
A0A3A0AXU8      ------------------------------------
A0A3D1JCW0      ------------------------------------
A0A2N2MJJ0      ------------------------------------
A0A3M1LAM5      ------------------------------------
A0A536BZ00      ------------------------------------
E8N5M1          ------------------------------------
A0A1F8U7F0      ------------------------------------
A5V160          ------------------------------------
A0A2A6REI6      ------------------------------------
A0A426TTK3      ------------------------------------
A7NIZ1          ------------------------------------
A0A0P6XM68      ------------------------------------
A0A2N2MEG3      ------------------------------------
A0A353RQ31      ------------------------------------
A0A3B9KNR2      ------------------------------------
A0A0P6XME1      ------------------------------------
A0A3B9Q1T8      ------------------------------------
A0A1F8PTW9      ------------------------------------
A0A1F8QH26      ------------------------------------
A0A359HML3      ------------------------------------
A0A3M1EJ46      ------------------------------------
A0A2U2S5W9      ------------------------------------
A0A0M8KAF3      ------------------------------------
A0A523V9H6      ------------------------------------
A0A3D1U3H5      ------------------------------------
A0A2N2MEK3      ------------------------------------
A0A3B9J9U6      ------------------------------------
A0A661VSD8      ------------------------------------
A0A497C1E5      ------------------------------------
A0A1W9UQ51      ------------------------------------
A0A497B563      ------------------------------------
A0A3D0UNQ0      ------------------------------------
A0A2G6GG97      ------------------------------------
A0A521TS25      ------------------------------------
A0A3M1H759      ------------------------------------
A0A535D584      ------------------------------------
A0A5C7JS64      ------------------------------------
A0A535IMD1      ------------------------------------
A0A521UD91      ------------------------------------
A0A3C0LJ76      ------------------------------------
I0I8T2          ------------------------------------
A0A497ASN6      ------------------------------------
A0A3D1TRD4      ------------------------------------
A0A3C0XJG2      ------------------------------------
A0A3M1ZZ81      ------------------------------------
A0A497AF06      ------------------------------------
A0A661W444      ------------------------------------
A0A3D0D4X6      ------------------------------------
A0A1J4ZRV4      ------------------------------------
A0A1V5RXW5      ------------------------------------
A0A522N7L9      ------------------------------------
A0A535W4H1      ------------------------------------
A0A521IC37      ------------------------------------
A0A3A0B2P8      ------------------------------------
D1CAL1          ------------------------------------
A0A497BNC7      ------------------------------------
D1C8M3          ------------------------------------
I4EI06          ------------------------------------
A0A2E5F6N9      ------------------------------------
A0A2E6J6X7      ------------------------------------
A0A3M1EAN8      ------------------------------------
A0A535QK16      ------------------------------------
A0A1F8RRT9      ------------------------------------
A0A6I1QLV0      ------------------------------------
A0A535FRM3      ------------------------------------
A0A401ZA55      ------------------------------------
A0A4P6JS79      ------------------------------------
                                                    

© 1998-2021Legal notice