BYKdb

Dataset for cluster tadcd of phylum chloroflexi

[Download (right click)] [Edit] [Sequences] [Repertoires]

107 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      --------------------------------------MQSLVPEGDARPSADLSERPFV
A0A7C5A5U0      -------------------------------------------------------MEAIA
A0A0P6WSP2      -----------------------------------------------------------M
A0A5C7JWY1      ------------------------------------------------MVKGESVNGKTV
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------MTLSNLPAPLVPPPVTAPGLPQRGVAAFDS
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------MSRVMSEHPPNDARVTSGSIVDRG----EL
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A0M8KAF3      --------------------------------------------------MNTPLVPPDM
A0A523V9H6      --------------------------------------------MSGSTVAGQAVGLSEG
A0A2U2S5W9      ------------------------------------------------------------
A0A7C3W344      ------------------------------------------------------------
A0A7C1G8J6      ------------------------------------------------------------
A0A3D1U3H5      --------------------------------MGSLNRRQEFDSVGIALNPATQALDAEQ
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A7C0TV81      ----------------------------------------------------MRQTKRTN
A0A3D1JCW0      ---------------------------------------------------MEHFDGEES
A0A2N2MJJ0      -------------------------------------------------MEENNDNDTLE
A0A7C3QTG6      ------------------------------------------------------------
A0A7C2TGF5      ----------------------------------------------------------MD
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ----------------------------------------------------------MD
E8N5M1          -------------------------------------MLYLDTGGMLPIRGNFSMEDFAE
A0A1F8U7F0      ------------------------------------------------------------
A7NIZ1          -------------------------------------------------------MRQVD
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A2E5F6N9      -------------------------------------------------------MVEQN
A0A2E6J6X7      ---------------------------------------------------------MNQ
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A3D0UNQ0      -----------------------------------------------------------M
A0A2G6GG97      ------------------------------------------------------------
A0A6L7WZR1      -------------------------------------MPRQRPDATQIHHEPQLTGGAQL
A0A7C5QIC8      MLPGPDRFTVSLASPRCYTCTTAAAQPAVRPHHPAEMAGLPPGLLRPVQAWSPERREGME
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A497ASN6      -----------------------------------------------------MEELEKK
A0A3D1TRD4      ----------------------MALIAPPMRYTDAGSVTWPAGLSQYSASDTSSADQFNR
A0A5C7JS64      ------------------------------------------------------------
A0A7C5IJ97      -------------------------------------------MIVEIPCRVSLIERRIV
A0A7C3FJ85      ----------------------------------------------------------MQ
A0A3M1ZZ81      ------------------------------------------------------------
A0A3C0XJG2      --------------------------------------------------------MDDS
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ----------------------------------------------------------ML
I0I8T2          ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7C4K810      -----------------------------------------------------------M
A0A7C5MIR7      ----------------------------------------------------------MD
A0A7C5ARI8      ------------------------------------------------------------
A0A7D6GA99      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
                                                                            

A0A3A4VPK9      -MEDETIDLRQYG-LLL-KRWSWLLVLSLVIGAATGLIVSLL-STPIFQSTAKVMITRAG
A0A3D0CW53      ------MELKEYA-SVL-WKWLWLIIVAMLIAAVSSYWASLR-MQPIYQTSTTLMVGQFI
A0A535RWE5      PPRRALLAGERLL-RAI-RRWAGLVGIAMIVGAVVSFGVSRV-IPPEYRATAQLYLAPAP
A0A7C5A5U0      YPQEEEIDVRHLL-SLI-RHGAWLLILSAVLAAGAAFGFSRF-QTPIYEARTQVMVGRSS
A0A0P6WSP2      LSNREAVGLKWLA-NWN-SPSLRIVLGCVLIATLIACLVILL-IPPTYKSSTLLLIEPSP
A0A5C7JWY1      IMDEAEYTISEYA-TAC-WRHRWLILLVVGCFGIGAAVWSFL-QVPVYQAKATVVIDNPT
A0A1F8QGH2      MTNNANTDLRRIF-SVI-RRWLWLILGCTLVGGVIAFSVTSL-LPPVYKATATLLVEPSQ
A0A1Q7TTL6      DHSESGVDWRRIL-SAV-LRFKWLIATMTLVGTVAGIGATRF-IKPEYSAQTKIWIDVEG
A0A0S8KFR9      ------MELRAYL-EIL-IRRKWVVILTTLATVAAVVLVTSR-QQPVYSAAARVRVAQAS
A0A535SLQ0      EAPVSTVRLDDLF-AVV-RRHIRLVLGVTAAVVAAAGYVAYV-TGSVYRAVAVIRLSDPR
A0A1F8SS27      --MNDYIELHRLF-TMV-LRKWWLLIMVTAFAAALGYTFGHR-QAPVYEARATLLVGQIF
A0A2E0L5X9      -----------ML-RAI-LRWWWLIVLSVSLGVGVGYIVRSQ-QPDLYFSEATVIVGADS
A0A3A0AXU8      ------MELLTYW-KIL-RKRLLLIVLLILVAEFGAVYYVVS-RVPLYSTTTTMIITPSA
A0A359HML3      ------MDIAELI-YPL-RRWWWLIVLATVIAAGASFAVARQ-QPPTYQSRATLMIGRTI
A0A3M1EJ46      MINEDQMELRHYL-AVL-WTWVWLLLLAPLLAAGISLAVSMH-IQPVYRASATLLISQA-
A0A0M8KAF3      LTDEDTIDLRQYW-LLI-RRWWWAFVLALLLGAVAAYIASQF-QQPIYRAEARILVSQSS
A0A523V9H6      SALGEEQDLRVYL-AVL-RRWLWLVVVCTILGAASAFLVSSN-MAPVYEASATLLVHQ--
A0A2U2S5W9      ------MTLRQYF-AVI-WRWLWLIVLAGAVAGGAAYASSQS-MPRVYQSTTTLMVGQKV
A0A7C3W344      ------MTLRQYF-TVV-WRWLWLIVLAGTVAGGSAYVSSRS-MPRVYQSTTTLMVGQKA
A0A7C1G8J6      ------MTLKYYL-SLI-GRWWWVWLISLALALASGYLYTQR-QPRIYMSRTTLMVGQSI
A0A3D1U3H5      SSGDRAALLRWYY-HLV-RRWIWLIVLVTIAAGVTGYSVTTLFIKPTYVATATLQVDAGQ
A0A2N2MEK3      ------MEIKHYL-GML-QRWAWLLALGLILGGVGSYLFSVN-QSPVYQSSTKLLVIRAP
A0A3B9J9U6      ------MEIKHYL-GML-QRWAWLLALGLILGGTASYLFSVN-QSSVYQSSTKLLVIRAP
A0A661VSD8      ----MEIDLRRYL-MVI-KRWWWLLIIGAIIPAIISSYFTAK-QPALYQARVTLMVGTTL
A0A1W9UQ51      ----MNKQVAQYV-RLL-GKWWWLFVISVIIPAVISYYFTAQ-QPALYQAKATIMVGASI
A0A497B563      ----MNKQVAQYV-RLL-GKWWWLFVISVIIPAVISYYFTAQ-QPALYQAKATIMVGASI
A0A497C1E5      ----MNKQVTQYV-RLI-KRWWWLLLVSVIIPAVISYYFTTR-QPDLYQAKATIMVGASL
A0A7C0TV81      QSKMGGNTVRYYL-KLI-FHWWWLLIIGALIPGGVSYQLTSQ-KQDFYQAAATVMVGSGL
A0A3D1JCW0      TLNTGDTDLRKYL-WLL-WQWAWLIGLATLLAAGAAFIVSEL-QTPVYQASTTILVNEAP
A0A2N2MJJ0      FDLIDAASLRRMG-GLL-WRNAWIIALAGLLLGLAAFIFGRM-QAPVYEARTQVLVSRPS
A0A7C3QTG6      ------MELKDYF-SMA-RRWAWLLTLGLILGAMGGLLGSIF-QTPIYEASTRILVMRAP
A0A7C2TGF5      IRMNDFVELRRVM-SIVRRRWIWLFVF-VLLCGGGGWLFGRS-QTPVYQATATMLVGQ-I
A5V160          ------MTLQRYL-TLF-WRWLWLMLLMTLIAGGAAYLVSRQ-MTPIYEASTTLLINQAP
A0A2A6REI6      ----MDNELLRYL-FII-RRWAWLIIIGTVLSASAAFLVSRE-MTPVYQASTTLLINQAS
A0A426TTK3      ----MDNELLRYL-FIV-RRWAWLIVMGTLLSAGAAFLVSRE-MTPVYQASTTLLISQAS
A0A3M1LAM5      --MSMTFSWRLVW-RLV-KQWWWLLVVGAVLAGGTGYYFASK-KPNIYAARTTLMVGA-N
A0A536BZ00      ------MDLRRQL-AVL-RSRSRLIIGSVLLAAIASALVSLA-LPKVYQSRVTLVVGQ-S
A0A7C5LUL4      EDTTGTIEIQQYV-ALL-RRWLWLIVLATLLGAGAAYLASRL-STPIYEASTTLLITE-G
E8N5M1          PVQQPSTDLRQYL-WLL-WQWGWFIALAGVLAASGALILSLL-QTPIYAASTTILVNEAR
A0A1F8U7F0      ------MEIKRYF-SLV-RRWAWLGILGLVLGAAGGYFSSAN-QTPVYQASTRFVILRAA
A7NIZ1          EQSEHRMILQRYL-TLF-WRWLWLMLLMTLLAGGAAYLVSNR-MTPVYEASTTLLINQAP
A0A0P6XM68      ------MEIKEYL-QIA-RRWAWLLILGLLLGAVSAFFFANS-QTRIYESSIRVQIVSAV
A0A2N2MEG3      ------MEIKHYY-MIA-QRWAWLLILGLLLGGGGAYIFSSL-QEPVYQTTTRVQVVSAS
A0A353RQ31      ------MDIKHFF-NIA-KRWLWLVIAGVIIGAAVGYFVSSR-QTPIYEASSKFVILRAP
A0A3B9KNR2      ------MDIKHFF-SIA-KRWLWLVIAGVIIGAAVGYFVSSR-QTPIYEASSKFVILRAP
A0A0P6XME1      ------MQPRDYL-VLI-RRWLWLLGVGIFVGALGGLVFSLL-QKPIYQASTKVMVLGVP
A0A3B9Q1T8      ------MDIRRIL-YLL-KRWSWLLIIVTLISGVAGYYFSSQ-QTPMYRASTRFVIMQPA
A0A2E5F6N9      FDEESSLDLRQYV-DAL-IRWSWVAIIVAVLAGAAAYFYTQ-SRTPVYQASSLVQIQQTQ
A0A2E6J6X7      NEQEQSIDFKKYI-GLA-ISYSWLIILLPTIVGTGAYFYSQ-QQTKLYEAKATLLVEQRS
A0A1F8RRT9      ------MQLARYL-RLA-GRWWWFIALAALIGGGSAYSISQ-LITPIYRADATLLVNQTQ
A0A3M1EAN8      ------MELKQYL-LIL-WKRVWLLIAAPLLAGAISYAASL-RMVPVYRASATLLVSPSG
A0A363SX22      ------MELISFL-KIF-LKRWWIIVLIFLVTVGSTAIFTW-RQNPTYSVTTTFVVSPSS
A0A6I1QLV0      ------MELRRYFSVLA-RRW-WMILLGPLIAGVCAFVVSG-LLTPVYSASSTLLVNQVQ
A0A535FRM3      ----MQSSLNRYI-LLA-KRWLWIIVLGVVVCGGMTYIASK-ITRPTYQASTQLVLAIST
A0A401ZA55      ----MRSTLSRYI-LLA-KRWAWVIILGMVICGGTTYLVTKLLMQPVYEAQTRILITL-A
A0A4P6JS79      ----MRSSLSRYT-LIV-KRWAWVIVLGVVICGSVTYGITK-LMQPVYQATAQVILTIGT
A0A326UPN3      ----MRISLSRYI-LLA-KKWVWLVVVGVVICGVGTFAVSKLFIKPTYKASASIVVTLQT
A0A455STY5      ----MRISLSRYI-LLA-KKWAWLVVVGVVICGVGTFAVSKLFIKPTYKASASIVVTLQT
A0A535QK16      ---MVAVELIRYW-RVV-RRLAWLIVLCPVVAALAAGIISL-QLPKIYEAKASLLVRPAQ
A0A3D0UNQ0      DELNDFVEIRHYI-SIF-LRRWWLVLLTALVAAGIGYVVSQ-SQDRVYRATTSVIVGQSI
A0A2G6GG97      ------MELKNYF-LLI-WRWVWLIILGVVIAAIAAFLISK-NTAPVYQSTSRLLIDQAP
A0A6L7WZR1      FPKGCGVEPRWLT-AVV-MRWWWVLLIGMAAGGGSAWGVSR-AIDPTYRATATILVNQSA
A0A7C5QIC8      NEQAVDIDLRHYA-RVV-WRWLWLIVLASAIAGGGAFLASG-LMTPIYEASTTLLIREGQ
A0A1F8PTW9      ------MELKKYI-FPL-RKWWWLLLASTLVAVVLSYLYIL-RQPKIYQTHTTLMIGTTI
A0A1F8QH26      ------MEFKRYL-FPL-RRWWWLILASTLVAAVLSYLYLY-QQPKIYQTHTTLMIGAAI
A0A535D584      --MERSFDLIQLL-KLV-RRWAPVVAFMTLLAGGLAFVVAR-AAVPSYQSCGLLRVAVQA
A0A521TS25      -MTLQFARVWSLW-ARY-GHWLWLIAVVTVVSGGVSYAVSR-SIPPEYRAVATLLVNQVQ
A0A7C2TBJ3      ------MKLGDIF-YPL-WKWWWMLAVTTLIAILSSFYIVR-LQPPIYETRTTLLVGRAI
A0A7C3TYQ9      ------MEIRQYF-ALM-WKWAWLIALCVLLAAGSAYVVST-RQPATYQATVTLLINQAS
A9B6E3          -----MNIIRRYI-TGL-RRWLWLLVLGPVVAAGAAYGISS-QQTPRYASSTRVIVGQTL
A0A3M1H759      ---MAEL---RRY-RNI-VRWWWLVLLSTVIAAGASYYISD-QQPRIYASTTTLMVGQAI
A0A7C3J9I4      ----MELDIGQYF-KAI-LKWWWLIILSTVLGAGGSYYVSM-QQPRIYQTTTTLLVGQVI
A0A497ASN6      SWVEEEIDIREYA-RVL-QRWLWLIALCSIIAAVSAYIISACFIQPVYKAEAVLMVEPSA
A0A3D1TRD4      RYGESMLPNIDYL-VWV-RRWLWLVLLGTLLGGGIAFGIAA-TTAPTYQSSATLLINASS
A0A5C7JS64      ----MDLTLHNLA-AMA-RRWWWLLVLAPLVAGVVAFAQVS-RQQELYSASSTVEINPPS
A0A7C5IJ97      EEQSQSSAVRRYL-AVI-QRWLWLIVLTTLVAAAAAYVASR-LSTPIYEASSILLVNGGE
A0A7C3FJ85      DELTMDIDLRMYW-QLI-RRWLWLIVLAALLAGGTAYIISKWMVEPVYHAAVRIIVQPSS
A0A3M1ZZ81      ------MEIRQYI-RLI-WRWLWLIILGAIIAGGTAYVISK-NTVPIYRASSRLLIDEAP
A0A3C0XJG2      SRGVPGFARARVL-FMF-RRWGPLIALATVVAGGTAFAVSE-VLPKEYSATSQLYVAPAA
A0A7C3NE64      ------MELQRYF-KSV-LRWWWLLLLSTTIAAGANYYASM-QQPRIYQATATLLVGQVI
A0A7C4V0A1      ---MEEVELRRYW-WIL-RKWLLLVLLLPIVCGAVAYVISI-RSTPVYSASATLLVYRTP
A0A6J4UI39      ----MNLDLRTLL-RYA-RRWWWLLLLGPIIAGGSAYWTSS-QQQPMYSATSTLLISQS-
A0A521IC37      ------MELRRYL-SLL-KKWGWLILLITGLAAAGSYFYSR-TIPPTYRTTAVLLVGQEQ
A0A7C1K503      ------MDLRKYW-TVL-WRWSWLIALGTLLGAGAAFIVSR-NMTPVYSASATLLVNQAP
A0A535IMD1      -----MMELKRYL-STI-LKWWWLIALSTAVAAAFSYYASA-QSPRIYQTATTLMVGQAL
A0A7C3FPG2      ------MELRQYW-DLF-KKWLWLIALTTIIAGGVAFFVSS-RQTPIYRASVRLLVSQSV
A0A3A0B2P8      ---MEELNLRLLL-RPL-LKWWWLIAACTLLAGVSSGLYTL-RQPRTYLSRTTIMVGSSL
A0A497AF06      ------MELREIL-RVI-QRRLWLIVLGTLLISIVVFAVSK-NMKPVYRAKVTMMIKQSS
A0A661W444      ------MELREIL-RVI-QRRLWLIVLGTLLISIVVFAVSK-NMKPVYRAKVTMMIKQSS
A0A497BNC7      --------LRQYI-AII-RKYWWLILLTTVLATGAAFYVSV-AAPPVYRATTTLEIDLGT
A0A7C6DKX5      ------MDLQQCL-RAL-WKWAWLIGVAALLSGAVSYFASI-RATPVYQTTTTLRVGQFL
A0A521UD91      RKEGRVVELRQYA-TLV-QKWWWLVLLGFVVAGAGSYYVSK-SQVPVYRASVTLLVDQAQ
I0I8T2          ---MNQRELQAYL-RPI-LRWWWLILLAMALAGTSAYIFAR-MRPDVYIASGTVMVGTAL
A0A3C0LJ76      ---MDNRELQMYL-RPL-LRWWWLILLSALLAGASAFVFVR-LRPPVYIASGTVMVGTAI
A0A7C7DWW4      ---MNHRELQIYL-RPL-LRWWWLILLSALLAGVSAFIFVR-LRPPVYIASGTVMVGTAI
I4EI06          ----MDMTIADML-KLG-RRWWWVFVACPLLAAGAAYLVSS-LLTPIYEANLMLLINQSR
A0A522N7L9      ------MDLRRQL-TIV-RAHWRLIVACALLAGVAAFAVSS-ILPKSYHSEATLIVGQGL
A0A535W4H1      ------MDLRRQL-HIV-RTRLWLILLVTIAFGGAGLLAAT-LAPRQYEARATILIGQSL
A0A3D0D4X6      ------MELRQYA-RIV-WKWLWLIVICTAVSGAIAYVVSI-NTAPVYQATASLLIREGK
D1C8M3          -------MTSSIL-ARG-LRWWWIVLVGALAAAALAYLVSA-AMTPIYQAQLTLLIEESQ
D1CAL1          ---MRDLTFIEIL-GLI-RRWWWVFIVCPLLAAAAAYGVSR-ALTPIYRAEATLFIDQRE
A0A7C4K810      DTSTVSDELRRYL-ALF-WHFAWILLATTILAATIALLVSL-RMTPTYQAVTRVLINEAP
A0A7C5MIR7      TQESETAMARLYL-VIL-QRWLWLIVLAMLLGASIAYLLSR-SSQPVYEAVTTLLVSEGQ
A0A7C5ARI8      --MEQEIDLRAYG-RLL-QHWLWLIVLAAFVAGATSFGVSKWVTQPVYRARTRLLVQPST
A0A7D6GA99      ------MELRQYT-SIL-RRWIWLILLGTLLVGALTYVISR-NMTPVYRASATVFVDQAT
A0A1J4ZRV4      ------MELRQYA-LLL-RKWLWLVVICTVVAGGTAYGVSK-NSTPIYQASATLLVNQAS
A0A1V5RXW5      ------MELREYM-ALL-RKWLGLILACMILAGGVAFFVSR-QSIPIYQASATVMINQAS
                                                               :     . :    

A0A3A4VPK9      QDQSSDVTA------------YLTTNQQTQ--TYLQLLQTESILNIVSERL----G----
A0A3D0CW53      QNPNPTDQD------------LRISQQLAQ--SYARLLRRQMILQTTIDAL----G----
A0A535RWE5      NA--TAS---------VD---IVGGQNLAR--SYAQLANSSVVLRAAMDDV----G----
A0A7C5A5U0      SP--AQIND------VTQ---LLNVQQLAQ--TYAELLSQDWVRNVVASRV----G----
A0A0P6WSP2      GL--VTDDY-------SS---IIAGEQLAF--TYSQLMVEKQILETAIRRL----E----
A0A5C7JWY1      PG--GLDKD-------KS---FYPDNSPEYFQTHFELMKSHFVLQRTARIL----D----
A0A1F8QGH2      ES--SPNDY-------ST---LMAGERLAL--TYSQMLKGPLILEKVITRL----G----
A0A1Q7TTL6      RG--QDRGP--------T---PIRSAQLLDAESWVDLLLSYVVLDQVVRDQ----RLF--
A0A0S8KFR9      SG--SIEYV--------D---YMYAERLMN--TYIEMLKSSSILEEVIKEL----D----
A0A535SLQ0      RA--FTGGVVDDPALGAD---GRYADPLLS--Q-VELLKSHAVAGGVVDSM----PMLRV
A0A1F8SS27      ES---ANLE------KQD---LQTSELVAQ--TYSDLTRRQPILQSVVDVL----G----
A0A2E0L5X9      NNPVPTGVD------STV----------LD--AYSVLIGRNSLLQPVIDDL----G----
A0A3A0AXU8      MG---SLLS------YQV---NLTLGPLAN--TYIQYMGTRSFGEMVAARM----P----
A0A359HML3      -E--NPNPT------SVQ---FSLEEQLAV--SYANIANREPLRDATMEAL----G----
A0A3M1EJ46      -S--GPSLD------SNSYNSLLTSERVAK--TYAQLLTKRPLLEQVISDL----H----
A0A0M8KAF3      SS--DLNDI------YRD---IVIGERLVK--TYAEIMKSDAVLDLVAETV----G----
A0A523V9H6      ----APSAG------VSDYTAILTSERLAR--TYSEMITGRPVLDAVIDQL----E----
A0A2U2S5W9      MR--DPNVT------AQD---LYVSQQLAQ--TYIQMATRQPILQATIEAL----G----
A0A7C3W344      IR--DPNVT------AQD---LYVSQQLAQ--TYVQMATRQPILQATIEAL----G----
A0A7C1G8J6      -A--NPNPD------PQY---IGLARSLAQ--IYGDLAKRLPVTQPVIEKL----G----
A0A3D1U3H5      -L--SSDVN------GTG---VIASQQLAD--TEARLVVTQPVAVKAYKAL----H----
A0A2N2MEK3      -Q--GQNSD------LAY---LA-SQQLAQ--TFIQLLKTKPVLDSASAEL----G----
A0A3B9J9U6      -Q--GQNSD------LAY---LA-SQQLAQ--TFIQLLKTKPVLDSASAEL----G----
A0A661VSD8      -Q--SSNPD------TRA---MQTSNSLAQ--AYAELVRYRPITEAVIQRL----G----
A0A1W9UQ51      FQ--DPNPD------QTA---IRLGNTLAA--AYAELLRQGPVVEAVIERL----G----
A0A497B563      FQ--DPNPD------QTA---IRLGNTLAA--AYAELLRQGPVVEAVIERL----G----
A0A497C1E5      -Q--NPDPD------PGQ---MNLSNTLAT--AYAELVKQGPITEAVIERL----G----
A0A7C0TV81      -Q--NPDPD------LWQ---LNLSNTLAA--AYAELVRQGPVTSAVIERL----G----
A0A3D1JCW0      ST--QSSNY------SAI---YLTSQQLTK--TYAEMLTKKPLLDKVRQNL----G----
A0A2N2MJJ0      MQ--SQIVD------ITQ---SMNSQQITQ--TYVEMFKLASVRQAAAEHL----Q----
A0A7C3QTG6      QE----KTT------DYT---YLSDQQLVQ--TYIQLLTTRPVLESVSVRL----G----
A0A7C2TGF5      MQ--STSLS------RED---VQMSVAFAQ--TYSDIAVRQPVLKGVVEKL----E----
A5V160          AG--SSSPD------YQA---VLTAERLAR--TYAELLVKRPVLEDVVREL----N----
A0A2A6REI6      AS--NANAD------YNA---ILSSERLAR--TYASLMLTRPILEEVIAEL----E----
A0A426TTK3      AN--NANAD------YNA---ILSSERLAR--TYASLMLTRPMLEAVIADL----D----
A0A3M1LAM5      IR--NPDPN------SRD---FGLTVTLAQ--IYGEMAKRRPITQAVVDRL----D----
A0A536BZ00      LA--AVNPD------INQ---LLVSQKLSE--TYAEVARTDPVLQAVSNQL----G----
A0A7C5LUL4      QK--ATGQD------YNS---ILMSERVAK--TYAQMLKGSPVLSEARARL----G----
E8N5M1          SG--QYYDS------TAI---ILTNEKLTR--TYAEMMTKRPLLVKVAQKL----N----
A0A1F8U7F0      QT---TAAD------YYA---YLDSQQLLQ--TYIQLLTTEKVLNAASEKL----G----
A7NIZ1          AS--SASPD------YNA---VLTAERLAR--TYAELLIKRPVLEEVVREL----S----
A0A0P6XM68      KT--VPNMD------YNS---YVEQNQLAQ--TYVQTLRSRPVLDAVAERI----N----
A0A2N2MEG3      RVGGAGTDA------YSN---FYIENQLAQ--TYVQTLKSHSIVDMVAERI----G----
A0A353RQ31      QT----TYD------YYA---YLDNQQLIS--TYVQLLSTESVLQKASDEL----G----
A0A3B9KNR2      QT----TYD------YYA---YLDNQQLIA--TYVQLLSTESVLQQASEEL----G----
A0A0P6XME1      QS----NLS------DIL---NQNSELLSQ--TFTELLVTRPVLEAASERL----G----
A0A3B9Q1T8      ST----DSD------NLS---LVEIQQQIT--TYSQLISSTDLINQVSTEL----G----
A0A2E5F6N9      G-SALP-TF----------SDLQLSRALAS--TYKELITTTDILSAVTKEL----G----
A0A2E6J6X7      S-GLST-SI----------SDYSLSARLSK--TYAKLITADPFLDQVRETN----G----
A0A1F8RRT9      T-PGVI-AY----------NDILTSERLTM--TYRELISKRPVLEDVTEDL----E----
A0A3M1EAN8      E-SAAL-NY----------SSLLASERVAK--TYAELLTKRPLLEQVIANL----H----
A0A363SX22      TIFSDPRSF------LSGLDVLGGRVSVAN--TYSDIATSRRIKNDTIDAL----G----
A0A6I1QLV0      S-EGPI-QY----------NDILTSERLTN--TYAELIRQRPVLQTVIDRL----D----
A0A535FRM3      S-QSP---Y----------ENASAALELLP--TYARLVANPQVLQPVATKY----K----
A0A401ZA55      G-TSQ---N----------DSTLAAIAQQS--TYSQLVTNPNVLAPVAAKH----N----
A0A4P6JS79      N-QSP---Y----------ESTNAVIALQP--TYAQLVTTPQVLQPVAARH----G----
A0A326UPN3      SSSPSD--------------NATAALTLLP--TYIELVTNPTVLQPVVSKY----H----
A0A455STY5      SSSPSD--------------NATAALTLLP--TYIELVTNPTVLQPVVSKY----H----
A0A535QK16      PLSVDP--G----------VAALTTDQILR--TYARLMTERPLLEQVISDL----N----
A0A3D0UNQ0      Q-ATQL-DS----------RDIQTSERLAL--TYADIARRQPVLEAVIVSL----D----
A0A2G6GG97      GAGSGN-DY----------TQILVEERLAQ--TYVELLKTDPILEETISQL----E----
A0A6L7WZR1      A-PGTV-TY----------SDALLSQQLVK--TYARMATQRMVLEQVAQEL----E----
A0A7C5QIC8      N-EAGL-DY----------NSVLMSERLAR--TYSQLLKDAPVLEEVINRL----K----
A0A1F8PTW9      S-DPNP-SS----------NEFALGQQLAS--AYANIANRQMVRNATMNAL-DMNE----
A0A1F8QH26      T-NPNP-SY----------NDFVLGQQLAD--AYANLTNLQLIREATMNAL-NIDQ----
A0A535D584      P------SG----------SQAASASDITQ--TDAVLMTQNGVLSEVIRDL----H----
A0A521TS25      GSGGGA-SY----------TDIMTSERLAR--TYGELMRKRPVLEKTITEL----Q----
A0A7C2TBJ3      A-EPNP-NN----------NEFFLSQQLAG--AYATMVMRDPVRSRTMETL-QLEE----
A0A7C3TYQ9      STTQ---DY----------NAILTGERLAR--TYAQMLTKRPVMEETARQL----G----
A9B6E3          K-NSNP-DY----------GSLVASERLVA--TYAQIAQSRTTMQAVEQRL----N----
A0A3M1H759      A-KANP-SD----------QDLYLADQLAN--VYAQMAEREPILQATIDAL----A----
A0A7C3J9I4      Q-ESNP-SG----------SDFSTTQQLAE--SYAQIAIRQPILQATVEKL----D----
A0A497ASN6      GVSSSI-RY----------QDVLAGERIAR--TYAEILESRPLLEKTLIKL----G----
A0A3D1TRD4      T-PNAL-TY----------TDVLLSQQLTL--TYSKIAVQDPVLAQVIQEG----H----
A0A5C7JS64      MGTDQF---------------TYYDSSIVA--TYQALITTSAVLDPVIESL----G----
A0A7C5IJ97      T-AAGP-DY----------NGVLMSERLVG--TYSQLLKGPPIYEGIRALL----K----
A0A7C3FJ85      S-LTGS-DY----------ADIMAGQRAAQ--TYAEMLNSRPLQEAALLRL----G----
A0A3M1ZZ81      GSGSNN-EY----------AELLVEQRLTQ--TYLQILSTRPVMEETITRL----N----
A0A3C0XJG2      NPTA---AL----------QDAVLGQNLAP--SYVQLAQSEVVLRRARDKV----S----
A0A7C3NE64      Q-EINP-TS----------QDFLTVGQLAQ--SYAQIGRRQPVLQATIDSL----G----
A0A7C4V0A1      S-GDIT-DY----------NAIVTSERLAR--TYSTMIPRRPVLEAVIQRM----G----
A0A6J4UI39      --DPSQQDL----------SGLQAGERLGS--TYQQLVNTDPVLQAVIDRL----Q----
A0A521IC37      Q-SANP-TP----------SEIYVSNNLAQ--AYALLVNQPSVLQAAAKEL----N----
A0A7C1K503      R-SGLT-DY----------SSILTSQQLAK--TYSELLHKRPVLEAAIEKLYGLGG----
A0A535IMD1      Q-SPNP-DN----------IQVYAATQLAQ--TYVQIVRRQPVMQAVVDDL----K----
A0A7C3FPG2      SNSASL-QY----------ADILAAERLSS--TYAQMLTARPMLVAAIAKA----G----
A0A3A0B2P8      L-EPNP-NS----------NDLYLAGQLAS--AYADIVQRSTVRDATQAAL----G----
A0A497AF06      S-MPLA-DY----------TSILTGENLAL--TYSALLKTRPLLEIVIANL----G----
A0A661W444      S-MPLA-DY----------TSILTGENLAL--TYSALLKTRPLLEIVIANL----G----
A0A497BNC7      NPLSDPYTV----------SNARTVESVAA--IFAAKIQFPLFLQQVKERL----G----
A0A7C6DKX5      D-NPDP-LG----------SEITTSQALAQ--SYALAAKRQPILQATLDAL----K----
A0A521UD91      D-ASGP-NY----------DAILASERLTN--TYGELIRKTPVLSATIERV----E----
I0I8T2          Q-ERNP-DS----------QQLSLTQGLAQ--TYARIMQRPSIKKATMEAL----G----
A0A3C0LJ76      Q-ERNP-DS----------QQLSLTQGLAQ--TYVKIAQRPSIREATRKAL----G----
A0A7C7DWW4      Q-ERNP-DS----------QQLSLTQGLAQ--TYVKIAQRPSIREATRQAL----G----
I4EI06          V-PGVI-NY----------DDILAAQQRTQ--TYSRLVTTRPVLEETIRKL----N----
A0A522N7L9      T-STDP-NY----------NELLASQQLTQ--TYVSVATQRKQLEGVIAKL----R----
A0A535W4H1      S-SVNP-DY----------NQLLTSQRLTL--TYASLATRRPILDAVISTL----G----
A0A3D0D4X6      D-PEST-TY----------TDLLTSERLAR--TYSERLQSRPVLEETARAL----G----
D1C8M3          G-TGAG-DY----------NDILAAERRTR--TFSRLVAQRPVLEETIRRL----S----
D1CAL1          T-TGSL-NV----------GDIQAAQELAA--TYSRLVTARPVLEQTINRL----S----
A0A7C4K810      A-TKSS-DY----------ASILTSERLAL--TYSELLTTEKVLSGVISAL----D----
A0A7C5MIR7      K-IGGT-DY----------DVLLMDERLAR--TYGELLKGSLLLKQVSAQV----S----
A0A7C5ARI8      S-MAAV-NY----------SDILAGERIAQ--TYAELLGSANLQEEALERL---------
A0A7D6GA99      N-TNES-SY----------GIIIASERLAQ--TYAQLMLTRPVVDAVAVQL---------
A0A1J4ZRV4      NPVSGA-GY----------QDILTSERLAK--TYASLLTGWPMLDETARRL---------
A0A1V5RXW5      SPSAAA-VY----------ADILTAERLSR--TYANLLMSRPVVDQTAEQL---------
                                                                            

A0A3A4VPK9      -FE------LDED-AIDTKAIIDTQIIEINVEDPDPQRAALTADMLVEVLIEQNEL----
A0A3D0CW53      -LQ--IPWQALAG-RVSAASAPGSQLIQINVVDGDPQRARLLADEIAHQLILHSPT----
A0A535RWE5      ------------------------------------------------------------
A0A7C5A5U0      -------EEITPR-QVSVKVVTNTSLINITVQHTDPQRASFIADTFVQVLVEQNEETQSQ
A0A0P6WSP2      -LD--LEPEDLAR-RVSAEPVSNTQLIRLSVRDSSPQNAALLAETIADEFVQHVRLLERE
A0A5C7JWY1      -LA--ERPEYQPK-PSVIKQFMKSFLPDSVLAFVRPAPKKEHADSADD------------
A0A1F8QGH2      -LD--ETPEDLSE-KIVAEPVANTQLIRLTIRESSPEKVTLLANTIAEIFTDHIQALQTD
A0A1Q7TTL6      -VE--PGTPADGQ-AVEKLSVADQYQPGVYRFTVDHSGQGYTLASADGVELERGTLGDSV
A0A0S8KFR9      -LS--SSPKDLAK-QIEADVVPDTELLSITVTDHDPARAKDIANALATLLVERSRNLYFG
A0A535SLQ0      VLR--KSSRSLLE-RVLRRRLSPGLLGDVAVAADAPA---------DSLPLTFDRDGFVV
A0A1F8SS27      -LN--KTWQQLRK-QVSVGLVEGTQLIQITAEADSPDTAQMIADEVAHQLILFSPGR---
A0A2E0L5X9      -LN--ISVLDLME-LMSLETNRSASLITIGITDTDPERAAAIANRIVDELIRQTSDR---
A0A3A0AXU8      -VE--ISSAEVLR-SIQAEFVRDTQIFRITATHRNPEVAQMLANTTAQMLIDANTER---
A0A359HML3      -LD-------WLP-EYSVTAVPNTQLIEIVVVDTDPQRAQIVASEIANQLILGS-PT---
A0A3M1EJ46      -LK--LTPYQLAG-KIEVIQPANTQLLELYVEDSDPEQAVAIANGIATLFMQQN-AR---
A0A0M8KAF3      ------EEALEEA-KISVSPGQDTQLLVVAVEHPDPELAATIANEVVRVFSAYM-RR---
A0A523V9H6      -LG--QTAEELAE-TVEVELVRDTQLIRLSVEHNDAARAATIANALSDAFIAYN-AG---
A0A2U2S5W9      -LK--EDWTSLRG-RVNASPVQGTALLQVSVLDTSPEWAVAIADEIARQMILQSPTA---
A0A7C3W344      -LK--EDWTTLRG-RVNASLVQGTALLQVSALDTSPEWAAAIADELARQMILQSPTA---
A0A7C1G8J6      -LK--LTPDELAK-RMETRVLFDAQLLEITVYDTDPQWAATIANAVAEELIRQS-PS---
A0A3D1U3H5      -LHLPLTPSTLLG-GATASSDVNSQLVTLSVSSHDRVFAARAANALA-------------
A0A2N2MEK3      -YH--IS----SG-QIKAEQLRDTQVITLTVEDNDAGHAAAIANTLVGVLVAQN-DS---
A0A3B9J9U6      -YR--IS----SN-QIKAEQLRDTQVITLTVEDNDAGRAAAIANTLVGVLVAQN-DS---
A0A661VSD8      -LE--RSHEALAS-QIVAWVRPNANLLEIRVTDTNPKAAMMIANALAEELIRQS-PG---
A0A1W9UQ51      -LE--RTPEQLAA-QIGTGFYSGAQLLEIQVTDTNPEAAALIANALADELIRRS-PA---
A0A497B563      -LE--RTPEQLAA-QIGTGFYSGAQLLEIQVTDTNPEAAALIANALADELIRRS-PA---
A0A497C1E5      -LE--RTPERLAE-QISARVQWGVYLLEIEVTDTNPEAAALIANALADELIRRS-PA---
A0A7C0TV81      -LE--RSPEQLAE-QIGTRIYSGAQLLEIQVTDTDPEAAALIANALADELIRRS-PA---
A0A3D1JCW0      -LS--ENVE---F-DVKVNFIRDTQLVQLLVEHTDPFLAANVANEMVAVFSEDIRN----
A0A2N2MJJ0      -IE--IKP----G-QVSVSALTNTQIVEIVVEDTNPALAGEIADTLVDVLIEKNDA----
A0A7C3QTG6      -SM--VDS----G-QVDVEQIRDTQAIQLTVEDETPQRAADIANILVQVLIDQNEL----
A0A7C2TGF5      -LI--ESWQKLRK-RVRVSPVEGTQLISIVVEYDSPEMARKIADEVANQLILLSPTK---
A5V160          -LS--IAPSLLAE-RVRVRPIRDTQLIVVTVEDIDPQRAADIANRIVAVFSEQNRE----
A0A2A6REI6      -LV--TTPSALAD-RITTTPVRDTQLIRVTVEGEDPAQVAAIANRLVTVFVERNEA----
A0A426TTK3      -LT--TSPDALAR-RITTTPVRDTQLIRVTVEGEDPLQVAAIANRLVEVFVQGNEA----
A0A3M1LAM5      -LP--MEWWDLAG-RIETRVNPTAQLLEITVFDTDPQVAALLANAVAEELVRQSPA----
A0A536BZ00      -LG--VSPDNLRG-RVSTDAPRDITLLRITATDGDPNQAARIANEVANQLIKLSPT----
A0A7C5LUL4      -VQ--VDAAS-----ITVTPVADTQLLTLRVRHADPQLAAQLANTIPQVFIEQTDK----
E8N5M1          -LP--YVI----D-TVKVTPVRDTQLMQVIVEDINPVYASDFANELVNAFAEQLQE----
A0A1F8U7F0      -YP--VYA----G-QASAQQVPDTQFVRLTVTNTDPQRAADIANVLVMVLIDQNEE----
A7NIZ1          -LP--FAPSMLAE-RIRVRPIRDTQLIVVTVEDIDPQRAADIANHIVAVFSEQNRE----
A0A0P6XM68      -TA--ITP----E-QIRAQIVQNTQLIDIFVTDTDPQRAASIANTLVEVFIERNSR----
A0A2N2MEG3      -GS--VSP----D-QVQVQIVQGTQLIDITVEDTDPERTALIANTLVDVFIARNVQ----
A0A353RQ31      -FP--IYK----G-QATASPITDTQFVVLTVRHTEPEKAALIANGLINVLIDENEQ----
A0A3B9KNR2      -FP--VLK----G-QATARAITDTQFVELTVRHTDPEKAALIANSLIDILIEQNEQ----
A0A0P6XME1      -YY--INS----S-QVRVQQVRGAQLIQIIVEDSIPEKAAEIANTLVTVFLEQNAK----
A0A3B9Q1T8      -FP--VDQ----K-QLEVEQIGDSQFVRLTVTNEDPFKTAVIANALIDALIQNNER----
A0A2E5F6N9      -LS--ASTGGLRK-NISVSILRDTSILRILAMNEDPALAASIANAVAQQFQS--------
A0A2E6J6X7      -FE--RLG------SVQTRTQENPPLIEIYVRDSDKVLVGEVANAISLNFID--------
A0A1F8RRT9      -LP--MSPDELGA-LIDVEAIEDTQLLRLSVEHEDPDQARWLANATAQAFI---------
A0A3M1EAN8      -LS--LTPRQLAG-KINVAQPADTQLLELQVEDSNPQLAVAIANNIADTFV---------
A0A363SX22      -LN----PVQAETLDVGSKILAGTNVIYITVEGPDPSLITTFANKLGETTV---------
A0A6I1QLV0      -LE--MSIDDLQD-RVSVSTVQDTQLLRASVRDEDPALAADIANTLASAFI---------
A0A535FRM3      -LT----VKQLTE-MITVKPQSNTQIIEIYVESSNPVVATSIANDVAQNFA---------
A0A401ZA55      -ME----LKQLTG-MVKTQSATNSPIIDILVDSSNPQLAATLSKEVAQSFT---------
A0A4P6JS79      -LT----LKGLSN-LVVVNAPSNTPIIKISVNNSDPRFAAQLANEVAASFA---------
A0A326UPN3      -MQ---SANELAS-KISVKQIGGTQVIEVTVSDEDPKMATNITNDVAQNFA---------
A0A455STY5      -MQ---SANELAS-KISVKQIGGTQVIEVTVSDEDPKMATNITNDVAQNFA---------
A0A535QK16      -LK--TDPATLSK-QITVTPAPNTAILDVAMRDTDPVRAKDTANTLVNDFI---------
A0A3D0UNQ0      -LD--YAWQNLRN-RVRVDLVPDTQLLEISVDASSREEAISIADELAQQLILISPTSLQS
A0A2G6GG97      -LP--MSVPTLKK-MISVSAPQETQIIIIQVEDTNKDRAALIANTLGQVFIFE-------
A0A6L7WZR1      -LA--ISPADLDD-MLSGVAIAQTQLLEVRAETTHPELARGLANAVARVFI---------
A0A7C5QIC8      -LG--ISPEALAR-MITVDNLRDTLLISLKVRSPNAEQAAAIANTVVEVFAEQ-------
A0A1F8PTW9      -LP-----------EYTAWALPNTQLIEISVTDIDPKRAQAVANELATQLILMSPSNAQP
A0A1F8QH26      -LP-----------EYKARVEPSTQLVVITVNDTDPNRAQAVANELAAQLILLSPTTEHT
A0A535D584      -LR--ISSDQLRA-HLVARPGPSSELITVCSSGASGTQQAAIVNAVMSVYAAQ-------
A0A521TS25      -LA--TTNEQLAR-TIEVRPVRDTQLVTVSVENRDPRLAADIANTVVRTFIAQ-------
A0A7C2TBJ3      -LP-----------EYKAQIVPNSQFIEIVVIDISPLRAQVVANELANQLIMQSPTSSRQ
A0A7C3TYQ9      -LN--ISPEELAA-KVKVNLVRDTQLITLQVVDEDPSVAMRVANKIPEVFSIQ-------
A9B6E3          -LSDMASSA-----IITTRPVQETEFLDIAVEANDPQQAADIANAIADQLILTSPAGPQS
A0A3M1H759      -LD--VEWDVLGG-QVSAFHPSQSQFLSVTVQDTSPERAAVIADEIARQLILQSPTSPQN
A0A7C3J9I4      -LS--MTWLALRD-LVNVSPVPETQLLAITVQDTSPERAVAIADEIAYQLILQSPTSPEN
A0A497ASN6      -YPPDLSDKELPF-NVSVQAVRETQLIRISVESKDPQLAAKAANTLAETFI-----EE--
A0A3D1TRD4      -LP--FTVIQLQK-MVSAAPVLQTQLITITANTHDAKQAATIANLVANVFI---------
A0A5C7JS64      -LP--MTEDQLRA-KITTSPVANTRLMRISVSDPNPETAAILANAIAEQFQTF-------
A0A7C5IJ97      -LN--FSDAQMDR-MIIVEPVRDTQLITLKVRSADAGLAARIANTAPQVLI---------
A0A7C3FJ85      -YA----EEQLIPYELTITPVRDTQVLQISVESIDAQLTADLANMLAQVFM-----EE--
A0A3M1ZZ81      -LP--YTPEQLAA-KVSASSPQDTQIIIISVEDPNPELAAQIANTLGEVFI-----EQ--
A0A3C0XJG2      -WP---DSKSFRE-RTQVAQVRNTSIIAVSFRDRDPQRAAEIADLIANSFVEQVRALQSS
A0A7C3NE64      -LE--INWQSLKG-HVNIQQIAGTQLLEISVLDNSPERAKIIADEIAHQLILQSPTSPEN
A0A7C4V0A1      -LN--ESPASLAK-RMRVNLIQDTQLIQLDVEDADPQRAADIANAIAEEFI-----RQ--
A0A6J4UI39      -LP--LTIADLRG-SVSASVVTGTQLLRVSVSDSDPARAARIADAVAEEFSVV-------
A0A521IC37      -WE--GSWESLYF-VVTANAPQGGQTFNVSATAGTPQRAQEIANEIARQVILQSPISQQQ
A0A7C1K503      -AGPVPDPAELAR-AVSVDLIRDTQLIVLNVENTSPERAAALANTIAEVFI-----AQ--
A0A535IMD1      -LT--VSWEQVAA-QTSVALIQGTQLIEIKFVDTNPQRAKLIADAIAQQVIAQSPTPSEK
A0A7C3FPG2      -LEGVVDPEDLEE-AISVQRVRDTQLIDLHVEYPDPIIAAKLANAIPEVFV-----EF--
A0A3A0B2P8      -LG--WLP------YYTARLVPNTQLIELSVVDTDPVRAQAVAAELVNQLLQIGPGMQ--
A0A497AF06      -LD--ISPDELIEHRLGTNLIPDTQLLELTVEDTDAQRASNIANEIALTFISLH------
A0A661W444      -LD--ISPDELIEHRLGTNLIPDTQLLELTVEDTDAQRASNIANEIALTFISLH------
A0A497BNC7      -LP--ADV-KVDD-MISVQQIGSTQLIHVSAENNDPVLAQALADTIARVLI-----EQ--
A0A7C6DKX5      -LD--WEWQALAN-NVNATVV-GSQFLQITVQDSHPQRVKAIADEIARQMILQSPTAQQE
A0A521UD91      -LP--YTPAQLAK-LIQVQVVRNTQLLVVSVDDIDPLRAQETANTLAQTFI-----DQ--
I0I8T2          -M-------DWLP-QYTVRT--ESQLIEINVTDVDPQRAYAVATELINQLILLSPGGQ--
A0A3C0LJ76      -M-------DWLP-EYSVRIVPDSQLIEISVTDVDAQRAYAVATELINQLILLSPGGQ--
A0A7C7DWW4      -M-------DWLP-EYSVRVVPDSQLIEVNVTDVDPQRAYAVATELINQLILLSPGGQ--
I4EI06          -LS--VTPEQLLK-KVDVSPVRDTQLFTVAVSDPSPEQAATIANTIGQVFI-----DQ--
A0A522N7L9      -LA--TTPEDLAK-TVNAQAAATSTLITISADDPDPQRAAAVANALAQALL-----TV--
A0A535W4H1      -LK--TTADDLLP-RIDAEPSQTTAFLTIVVRGRDAAETAAIANEVANQVI-----AA--
A0A3D0D4X6      -LQ--QDLGTLKV-KITVQPVRDTQLIRLTVEHTDPALAQAIANTIPQVFA-----NR--
D1C8M3          -LR--MTPEELMA-VIEVTPIRDTQLVTLAVSDPSPARAAAIANTVAEVFI-----EQ--
D1CAL1          -LD--TTPEDLVE-NISVTRIGSTQLVEIAVEDPDPRQAAQIANTLAQVFI-----EE--
A0A7C4K810      -LD--MSPGALKR-AIQVEPVRDTQLIELRVEDTDPIRATRIVNTLVTVFI-----NE--
A0A7C5MIR7      -PS--VNSDDLRK-MIIVDTVRDTQLITLRVRHTDPKLAARIANAIPQVFM-----KQ--
A0A7C5ARI8      --G--IAGNGF---SVRVQRPRDTQLLDLQVDSTDPVLAARLANTIAQVFI-----EQ--
A0A7D6GA99      --G--LAERNL---TVEVEPLPDTQLIQVDVEDSDRDLATLIANTLPAVFI-----QQ--
A0A1J4ZRV4      --G--VDAKDLEK-TVTVSSVRDTQLLEIQVEGPNPQLIVQIANTLPEVFI-----AQ--
A0A1V5RXW5      --G--IEPRSIER-SIDVTPVRDTQLLKITVEGPNPWLIARVANTLPEVFI-----EQ--
                                                                            

A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      -----------------------------------------WTDLKTFRDLANSAWVRDT
A0A7C5A5U0      RYA------------EAEQSLSNQIGDMEKQIAALQAQIEKEKQAAYQQALTSAQQKIQD
A0A0P6WSP2      KFG-ESISGLQAEMESQTTLISANQARVDSLSSQSIAHGSKMVHLQSQIDLDRGDYQF--
A0A5C7JWY1      ---------------------------------------AEEALIKQFSQDIEIMPIRGA
A0A1F8QGH2      RFT-DLLQSLQDQMSAASTQMNETESTMDGISARMIEEETKLVRLQTFVAELRADLQT--
A0A1Q7TTL6      GTRYGLRWAPDASTVAPGRAVQFNLTTLRDAATALSE-------------ALDARMDVDG
A0A0S8KFR9      GTR-SAREILQ----QQLDEVEAKLEQVRTELQTLVDSVARENA---RVDALKARIRSEE
A0A535SLQ0      GAP-PERRRVAYDTLVKVDGVRFTVRRRPDAARALLQVLSRDAAISQLLTELRVRPRMRT
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A7C3W344      ------------------------------------------------------------
A0A7C1G8J6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A7C0TV81      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A7C3QTG6      ------------------------------------------------------------
A0A7C2TGF5      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A3D0UNQ0      PEDE--------------------------------------------------------
A0A2G6GG97      -NQK--------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A7C5QIC8      -HAQ--------------------------------------------------------
A0A1F8PTW9      -EEQ--------------------------------------------------------
A0A1F8QH26      -EDQ--------------------------------------------------------
A0A535D584      -ATA--------------------------------------------------------
A0A521TS25      -VVD--------------------------------------------------------
A0A7C2TBJ3      -LSS--------------------------------------------------------
A0A7C3TYQ9      -NEQ--------------------------------------------------------
A9B6E3          -AEA--------------------------------------------------------
A0A3M1H759      KARQ--------------------------------------------------------
A0A7C3J9I4      EARQ--------------------------------------------------------
A0A497ASN6      -RAQ--------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A5C7JS64      -AQE--------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      -NRE--------------------------------------------------------
A0A3M1ZZ81      -NRE--------------------------------------------------------
A0A3C0XJG2      -LQS--------------------------------------------------------
A0A7C3NE64      QERR--------------------------------------------------------
A0A7C4V0A1      -NSA--------------------------------------------------------
A0A6J4UI39      -ISQ--------------------------------------------------------
A0A521IC37      KASD--------------------------------------------------------
A0A7C1K503      -NAA--------------------------------------------------------
A0A535IMD1      -QQE--------------------------------------------------------
A0A7C3FPG2      -TNQ--------------------------------------------------------
A0A3A0B2P8      -EGS--------------------------------------------------------
A0A497AF06      -NTE--------------------------------------------------------
A0A661W444      -NTE--------------------------------------------------------
A0A497BNC7      -ETS--------------------------------------------------------
A0A7C6DKX5      SERA--------------------------------------------------------
A0A521UD91      -RHE--------------------------------------------------------
I0I8T2          -ERQ--------------------------------------------------------
A0A3C0LJ76      -ERQ--------------------------------------------------------
A0A7C7DWW4      -ERQ--------------------------------------------------------
I4EI06          -TRD--------------------------------------------------------
A0A522N7L9      -SPA--------------------------------------------------------
A0A535W4H1      -SPT--------------------------------------------------------
A0A3D0D4X6      -NAE--------------------------------------------------------
D1C8M3          -TQQ--------------------------------------------------------
D1CAL1          -THA--------------------------------------------------------
A0A7C4K810      -NTA--------------------------------------------------------
A0A7C5MIR7      -NAE--------------------------------------------------------
A0A7C5ARI8      -SRE--------------------------------------------------------
A0A7D6GA99      -HNE--------------------------------------------------------
A0A1J4ZRV4      -NQE--------------------------------------------------------
A0A1V5RXW5      -NQE--------------------------------------------------------
                                                                            

A0A3A4VPK9      ------ISSERY--DLMEESLSAQKAQIESQIADLQNQINHASIKTIEEQEQWIQEQINV
A0A3D0CW53      ------TPEKEQ--EQYRQFVNQ--------------------------QLLTLQTRIED
A0A535RWE5      SIITVSFKHGNA--DFAARAANAIANAFIVQSRSLQSS----------------------
A0A7C5A5U0      TQQMIDNALAEI--ARLKALGSAANAQYRLNVAQRQEEQLKALLENQQNELEELRTW---
A0A0P6WSP2      ------LQQSYF--VAQSQADQIAEKIQIVEDAVVKEAAGSRGFSAYLTLLVDPSLIIGQ
A0A5C7JWY1      RLAHVTANAIEP--ELAAEIANTLVSVYIERNQELSANSKELAAQWFTTHLEELRQKVQN
A0A1F8QGH2      ------LQQNQE--ELQSTIDEAANSVMIVEDAQVLTQEDSFFYEATVTLLVDQVHERSG
A0A1Q7TTL6      SFLRVELRGHDP--KRTTAIVNALAQRYVQVYADLKRQKLVELTKILGEQLQHSQDNLRS
A0A0S8KFR9      EVYASLLSQYEQ--ARVAEAARENSVTIVAPAVKPAARDGPQVSYLATATVRVTQPYSAF
A0A535SLQ0      DIVDVAYSAPDP--SRAQQVVNRVVDVFRAASAEAAQRQSRLRREFLDAQLKVNDSVVAD
A0A1F8SS27      ------SNTSNS--IMVRQFIQQ--------------------------QLGNLQARIEN
A0A2E0L5X9      ------AT------LLDLEFINS--------------------------QIEDMQNQINN
A0A3A0AXU8      ------QLSQQEARLAAQRSPEA-----------------LARQKQMNDLIAVLQDELNY
A0A359HML3      ------STNQAD--VERQAFISQ--------------------------QLDTLQKQITD
A0A3M1EJ46      ------RQGDSSGLTGYEEMLAK--------------------------QIAEVERDIQA
A0A0M8KAF3      ------VQTERF--AESKANLQA--------------------------QMERVQAEIEQ
A0A523V9H6      ------LQEARY--SGSLTSVEE--------------------------QIGQVSALIEQ
A0A2U2S5W9      ------PEEAQR--AKHRAFVEQ--------------------------QIADLQAKIEA
A0A7C3W344      ------PEEAQR--TKHRAFVEQ--------------------------QIADLQAKIEA
A0A7C1G8J6      ------V----D--TENERFVRQ--------------------------QLDDLQSQIEK
A0A3D1U3H5      -----------Y--AAQQSEQQH--------------------------QMSRFSAAIDA
A0A2N2MEK3      ------LQSSRY--LTSEEGLQA--------------------------QVEQVGAQIDQ
A0A3B9J9U6      ------LQSSRY--LTSEEGLQA--------------------------QVGQVGGQIDQ
A0A661VSD8      ------SRQGQR--QQQQEFIKQ--------------------------QLDELEEKIEK
A0A1W9UQ51      ------S-GGSD--PEQQEFIRR--------------------------QLEELEAKVGN
A0A497B563      ------S-GGSD--PEQQEFIRR--------------------------QLEELEAKVGN
A0A497C1E5      ------S-GGSD--PEQQEFIRG--------------------------QLEELQIKIKD
A0A7C0TV81      ------S-GGSD--PAQQEFIRR--------------------------QLEELQMKVTD
A0A3D1JCW0      ------LQQSKY--AASKENLKAQLDYLDQQIVENQNALDAIIQN----NLKQLQSSGEN
A0A2N2MJJ0      ------IQSERY--TNSEQSLSTQIADVEGQIADLQEKITVRSAEVLEEQKTNFESQISD
A0A7C3QTG6      ------IQASRY--TQTEQSIQAQITQIESQIAQMGTEIDNVSAETVLQQQQQVEAQIAT
A0A7C2TGF5      ------SNAGED--SFVNSFIQQ--------------------------QIVDSQERILN
A5V160          ------LQSERF--AESKRSLMN--------------------------EIAKLQADIDA
A0A2A6REI6      ------LQGERF--VATRASLEQ--------------------------ELEKLQLEIDT
A0A426TTK3      ------LQGERF--VATRASLEL--------------------------ELEKLQSEIDA
A0A3M1LAM5      ------SQE-----GVERDFVLK--------------------------ELNDTQAKIEE
A0A536BZ00      ------LQG-RN--PAIEQSIAS--------------------------NLTALQQVIED
A0A7C5LUL4      ------ARAQRI--ADSQANVTR--------------------------EMQALQSELEG
E8N5M1          ------MQISRF--KASKENLQNQLSYLEQQIQE--------NSSALEKILQENISEVKR
A0A1F8U7F0      ------LQAVRY--LTSEQNLQSQIDQVQSQITTMQTQINDISEATVQDQLTQVKAQIEP
A7NIZ1          ------LQSERF--AESKRSLAG--------------------------EIAKLQSDIDT
A0A0P6XM68      ------MQAERF--NESERSLEAQIAQIDAQIEALQSRSTAATTEQSEQQIEKAKSELDR
A0A2N2MEG3      ------MQFERF--ATSEQSLEAQIEQVDAQIETLKTRSEAVSSAEAQEAIAKTQTEIER
A0A353RQ31      ------LQAIRY--ISAEQNLQNRIDETQQQISLLEKQINELSTATVESQLESVQKQILE
A0A3B9KNR2      ------LQAIRY--IAAEQNLQNRIDETQQQISLLEKQINELSTATVESQLESVQKQILE
A0A0P6XME1      ------IQSSRF--SASEESLQAQIQQVEAQIADLQRQLAQTSEQSNEKRIQDVTNIISG
A0A3B9Q1T8      ------LQSLRF--ESTEANLQRRAEDALQQMEELQNRIDQVTEKNVQEQLITVQSEIET
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A535QK16      -------------------------------------------------------AKIKD
A0A3D0UNQ0      ------NARLFV--QERLQDLQK--------------------------KIEASQARLDE
A0A2G6GG97      ------RESLRY--ADPINNWEE--------------------------RLQEIGDQIET
A0A6L7WZR1      ------------------------------------------------------------
A0A7C5QIC8      ------IASTSY--SSSMQSLDR--------------------------EMQQLQSQIQA
A0A1F8PTW9      ------GRQEFI--NQRLNILEV--------------------------QINETEDEIKK
A0A1F8QH26      ------VRQEFI--NERLSVLET--------------------------QINDTEEEIKQ
A0A535D584      ------QSERDI--DQAGAALQS--------------------------EIQKVEASLLQ
A0A521TS25      ------EQLGQT--TSTKQVLQQ--------------------------QIAEMERQIRG
A0A7C2TBJ3      ------ERQAFV--DQQLAEMEA--------------------------SILATENEIST
A0A7C3TYQ9      ------MQLSRY--SSSNENLQK--------------------------QMEAVNLDIAA
A9B6E3          ------KLLDEV--NRQIATLNE--------------------------EITRTDEEIKT
A0A3M1H759      ------ERAGFV--QAQLDDLER--------------------------RIQDAQAEVKK
A0A7C3J9I4      ------ERSQFV--QKELDDMEA--------------------------KIETARGRIAE
A0A497ASN6      ------GQARRF--GSLKTSIET--------------------------QLANIDEEIAK
A0A3D1TRD4      ------------------------------------------------------------
A0A5C7JS64      ------RTQELT--GPYREALNV--------------------------QIAETQANIRT
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------RQTARF--QDALARLQK--------------------------QIDALEQDIGE
A0A3M1ZZ81      ------RESLRY--AEPIQNWET--------------------------RLDEIGNEIQA
A0A3C0XJG2      ------TTATQL--DEEISSVEA--------------------------DRQRIDDELSR
A0A7C3NE64      ------ERRQFV--QNQLDDLEQ--------------------------RIQTTQTRMEE
A0A7C4V0A1      ------LQEARF--AESLENIKA--------------------------QISELSGLMEQ
A0A6J4UI39      ------RSTQLS--SGSREALQT--------------------------QITGTQQQIAD
A0A521IC37      ------DQRAFI--TEQQALMQS--------------------------QIVVGQKQLTE
A0A7C1K503      ------QQTSRF--ASSKESLSK--------------------------EIAAVQASLAQ
A0A535IMD1      ------EHRQFV--DAQLKDLQD--------------------------RIDQAKADIGE
A0A7C3FPG2      ------QQTARY--QELKQSLQD--------------------------QLQQLSEEIQA
A0A3A0B2P8      ------EYQAFI--ADQLDQMEK--------------------------GITETTAEIER
A0A497AF06      ------QQLQNI--AVLEQDVVK--------------------------QMANLKEAIEY
A0A661W444      ------QQLQNI--AVLEQDVVK--------------------------QMANLKEAIEY
A0A497BNC7      ------QQQARF--QTGLSELET--------------------------QIKTLETSIAE
A0A7C6DKX5      ------RRSGFV--ERQLDSLQG--------------------------QIQSAERKIAE
A0A521UD91      ------DQIGQL--SASRGVLRQ--------------------------QIADLEKQLKD
I0I8T2          ------QREQFV--QEQLRKLEQ--------------------------SMRSTEEEISR
A0A3C0LJ76      ------QREVFI--QEQLRKLEQ--------------------------GMRDTEAEIVR
A0A7C7DWW4      ------QREVFI--QEQLRKLEQ--------------------------GMRDTEAEIVR
I4EI06          ------QNVAAT--GTSREALQK--------------------------EIDAAKQQIDD
A0A522N7L9      ------IQGTGS--ASEQ-FIQA--------------------------QLQATQSQIQQ
A0A535W4H1      ------VSGQQV--DFAK-AIDE--------------------------DLQATRTEIES
A0A3D0D4X6      ------QQSERF--AASKESLQR--------------------------QLDTLAGDIED
D1C8M3          ------RQAEIA--GPGADQVQQ--------------------------NIEAIQRQIDE
D1CAL1          ------QEDAAT--WSGRDELRR--------------------------QIEEVQQRIED
A0A7C4K810      ------LQEMRF--ETIKKSLTE--------------------------QLNELQGRIDE
A0A7C5MIR7      ------QQAARL--DSSKQIIKQ--------------------------QMQSSQAEIVS
A0A7C5ARI8      ------RQTARF--AASKQALEQ--------------------------QIAEVEQEIAQ
A0A7D6GA99      ------RQLXRS--SRNRASLDK--------------------------EIRSLSSNISQ
A0A1J4ZRV4      ------LQMGRV--SESKASLER--------------------------EITSVEADITR
A0A1V5RXW5      ------LLLGRL--SQSRANLEQ--------------------------EIANTEADIAR
                                                                            

A0A3A4VPK9      LQQESETL-----------------------------------------------PVEIS
A0A3D0CW53      AQKQVDEL-----------------------------------------------EKQLA
A0A535RWE5      ------------------------------------------------------------
A0A7C5A5U0      ------------------------------------DELRRHHWGEFGLENAGEVAAKQA
A0A0P6WSP2      GTYSTVTNSARVASAYGEIWTG--------------ESYMQAVIDELGLDRDADDLANDV
A0A5C7JWY1      SQQALYLFRAK-------------------------HGLLTGEERKSVAAHTLAELNSQL
A0A1F8QGH2      DNYAAILANERLAQTYGEILAG--------------RKVMEAAISRIKSDESPDDLMNKV
A0A1Q7TTL6      AEADLQRFREQTITLPSDRPPTVGSGSVAGAAGGGGAAGAPDGARDPVFGGFFEMQITR-
A0A0S8KFR9      PGYAEYGYVERLMNTYVELLKT--------------QPILEEVLQKLDLPELPSALLQQI
A0A535SLQ0      AQQALTAFRRRAHS-------D--------------GSAQSSGREQTELPGL-ELQRQQL
A0A1F8SS27      GQSRLAEI-----------------------------------------------EVEMV
A0A2E0L5X9      LQSQYNQL-----------------------------------------------VQEAA
A0A3A0AXU8      YDDQIRTL-----------------------------------------------DNEIR
A0A359HML3      TQAELEDL-----------------------------------------------SQLLG
A0A3M1EJ46      LEAERAQI----------------------NRGGSNSRSLPTAQNADTDTSSLEASAKDG
A0A0M8KAF3      LQQQLDAL-----------------------------------------------G----
A0A523V9H6      TEEAIDDL-----------------------------------------------D----
A0A2U2S5W9      AQQQVAEL-----------------------------------------------EKQLG
A0A7C3W344      AQKQVADL-----------------------------------------------EKQLG
A0A7C1G8J6      ADADIKSL-----------------------------------------------RSAIL
A0A3D1U3H5      IDRQISSY-----------------------------------------------QKDMA
A0A2N2MEK3      LQEQINRLTMENVEEQIGQAETKIAELQSEIASLENDIFYTTNRGRNPDLAPTEWTARLA
A0A3B9J9U6      LQEQINRLTMENVEEQIVQAEAKIAQLQSEIASLENDIYYTTNRGRTPDLAPTEWTARLA
A0A661VSD8      KKAEIADL-----------------------------------------------NDSLA
A0A1W9UQ51      VGGQIEEL-----------------------------------------------TASLS
A0A497B563      VGGQIEEL-----------------------------------------------TASLS
A0A497C1E5      ISGQISEL-----------------------------------------------TASLS
A0A7C0TV81      VNERINAL-----------------------------------------------TTSLA
A0A3D1JCW0      VEAQPTAA-----------------------------------------------LLERA
A0A2N2MJJ0      TRAQIAEL-----------------------------------------------ESEIA
A0A7C3QTG6      LQVEVSQL-----------------------------------------------EAEIQ
A0A7C2TGF5      SQQRVREI-----------------------------------------------DAAME
A5V160          TQAEIAVL-----------------------------------------------RG---
A0A2A6REI6      TQAQLNEA-----------------------------------------------TG---
A0A426TTK3      TQAQLDQA-----------------------------------------------TG---
A0A3M1LAM5      AQAQIDQL-----------------------------------------------RDKML
A0A536BZ00      TQTRITAL-----------------------------------------------LN---
A0A7C5LUL4      TQRALDVA-----------------------------------------------RD---
E8N5M1          TNPDAANG-----------------------------------------------TLSNA
A0A1F8U7F0      LQTQVTTL-----------------------------------------------ETEIA
A7NIZ1          TQAELAAL-----------------------------------------------RGIDD
A0A0P6XM68      LQTEILAI-----------------------------------------------RTALD
A0A2N2MEG3      LQGEILAL-----------------------------------------------QNELD
A0A353RQ31      TQSQMTAL-----------------------------------------------NVEVA
A0A3B9KNR2      TQSQMTAL-----------------------------------------------NAEVA
A0A0P6XME1      LQSEINQL-----------------------------------------------QADIV
A0A3B9Q1T8      LQSQVTDL-----------------------------------------------ELNIA
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A535QK16      IQRT--------------------------------------------------------
A0A3D0UNQ0      LASAMDVA----------------------------------------------------
A0A2G6GG97      IETEINTL----------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A7C5QIC8      TQQALDAE----------------------------------------------------
A0A1F8PTW9      LQEDLGNM----------------------------------------------------
A0A1F8QH26      LQEELGSI----------------------------------------------------
A0A535D584      ENQQLAAL----------------------------------------------------
A0A521TS25      ATDGMERE----------------------------------------------------
A0A7C2TBJ3      TQEELAKL----------------------------------------------------
A0A7C3TYQ9      AEKTLESL----------------------------------------------------
A9B6E3          LKAEIEQI----------------------------------------------------
A0A3M1H759      LEAELETA----------------------------------------------------
A0A7C3J9I4      LEAEVSAA----------------------------------------------------
A0A497ASN6      LDKQRGKA----------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A5C7JS64      TQQMIDDL----------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      YRVRLDSV----------------------------------------------------
A0A3M1ZZ81      IETEINAL----------------------------------------------------
A0A3C0XJG2      LRAALAAL----------------------------------------------------
A0A7C3NE64      LKAELVTA----------------------------------------------------
A0A7C4V0A1      TQRQLEAL----------------------------------------------------
A0A6J4UI39      LTLQIQQL----------------------------------------------------
A0A521IC37      LSQQAALE----------------------------------------------------
A0A7C1K503      TQAALDAL----------------------------------------------------
A0A535IMD1      LEKSIVNE----------------------------------------------------
A0A7C3FPG2      TDARLQAL----------------------------------------------------
A0A3A0B2P8      VKTELTGM----------------------------------------------------
A0A497AF06      NQSAMDQS----------------------------------------------------
A0A661W444      NQSAMDQS----------------------------------------------------
A0A497BNC7      TQAEIAAL----------------------------------------------------
A0A7C6DKX5      LQAKLPEQ----------------------------------------------------
A0A521UD91      TSQALEAA----------------------------------------------------
I0I8T2          RQTELSAA----------------------------------------------------
A0A3C0LJ76      KRDELSSL----------------------------------------------------
A0A7C7DWW4      KQDELSTM----------------------------------------------------
I4EI06          LTTQVANL----------------------------------------------------
A0A522N7L9      LQGQISAL----------------------------------------------------
A0A535W4H1      ASMEAARL----------------------------------------------------
A0A3D0D4X6      AQGRLTRE----------------------------------------------------
D1C8M3          ANARIAEL----------------------------------------------------
D1CAL1          TSSRIAEL----------------------------------------------------
A0A7C4K810      INSQLSRL----------------------------------------------------
A0A7C5MIR7      TQQSID------------------------------------------------------
A0A7C5ARI8      LQQEA-------------------------------------------------------
A0A7D6GA99      VQTKITEL----------------------------------------------------
A0A1J4ZRV4      TQDALN------------------------------------------------------
A0A1V5RXW5      TTDELS------------------------------------------------------
                                                                            

A0A3A4VPK9      QMG--------------------NPATPEERDALEQKKARLEQVELLLPL----------
A0A3D0CW53      LES---------------------------------------------------------
A0A535RWE5      ------------------------------------------LQGTAVQQ----------
A0A7C5A5U0      RLEELSQ-------LVDQTQQQLDEVEQTIAWLTPLVEAGA-ISKAIAQQ----------
A0A0P6WSP2      YFEPIPSTQLVRLRVDDPSAAQAKTLVEVIGRNIVQTTQTQ-LARPYTDR----------
A0A5C7JWY1      VKTEMAKAEAQSRFQQIRSVLNPQGAGTAGLGWSKLDSQIQVLNSPLIQT---LRAQEIT
A0A1F8QGH2      KVETVSGTQLIRLSVEDTNANQAKLLADAIAGAFLDEIQVL-LTEPYVTR----------
A0A1Q7TTL6      -EEARRDRDALERVLAQYGDSGLSAEALAVVG------SVQ-LNGELSQALKELTDKQAQ
A0A0S8KFR9      VIEVLPDTELLRITVEDRSPERARDIANALAGL-----LVE-QGQTLYSG--------D-
A0A535SLQ0      LAERRTDEDLLAALQESSTSRKAVQTALSTPGVAPSPAVVQ-LNTQLFQY--------EM
A0A1F8SS27      QVK---------------------------------------------------------
A0A2E0L5X9      TIT---------------------------------------------------------
A0A3A0AXU8      NLE---------------------------------------------------------
A0A359HML3      ELN----------------------------------------------S----------
A0A3M1EJ46      RQQ----------------------------------------------A----------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A2U2S5W9      GAF----------------------------------------------S----------
A0A7C3W344      EAF----------------------------------------------S----------
A0A7C1G8J6      NMT----------------------------------------------S----------
A0A3D1U3H5      SAT----------------------------------------------K----------
A0A2N2MEK3      QLK----------------------------------------------S----------
A0A3B9J9U6      QLK----------------------------------------------S----------
A0A661VSD8      DLT----------------------------------------------S----------
A0A1W9UQ51      ELT----------------------------------------------S----------
A0A497B563      ELT----------------------------------------------S----------
A0A497C1E5      ELT----------------------------------------------S----------
A0A7C0TV81      DLT----------------------------------------------S----------
A0A3D1JCW0      RML---------------------------------------------------------
A0A2N2MJJ0      SLP------------------------AESTSLAAEKRSQVEQLQSLLRS----------
A0A7C3QTG6      ELS---------------------ASPSADQTLLADRQARLGQVQPLLEL----------
A0A7C2TGF5      GSL---------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      GMT---------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          TIE---------------------------------------------------------
A0A1F8U7F0      DLQ------------------KNRYPTEEENAQLAEKEATLAQVKPILTL----------
A7NIZ1          PVR---------------------------------------------------------
A0A0P6XM68      TLR---------SPKAEAGWYSTPTPSPEIRAEINQKELELKELETTYDL----------
A0A2N2MEG3      LVK---------SPGRLPNSLSTPTPSPETRSQINEGTLRLRQLQSTYDL----------
A0A353RQ31      KIN-------------------PATATEEEKARLAEYQAQLDQLSSVLSL----------
A0A3B9KNR2      KIN-------------------PATATAEELTRLAEYQAQLDQLSSVLSL----------
A0A0P6XME1      RIEAERDPILGVNSLGQPARVTPTLTVDQQIEL-TQKRSRLDELRSLLSI----------
A0A3B9Q1T8      SID-------------------PLYATDEELQQRIQFQAELGQTQSILDL----------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A7D6GA99      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
                                                                            

A0A3A4VPK9      ----------------------------------------------------YEQSYTDL
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      -----------------------------LDEQIKQLQDDIK----------GLDVQIAA
A0A7C5A5U0      ------------------------------EKIASEQQSLLA----------AYQDSYGR
A0A0P6WSP2      --------------------------MQALQKQMDELSAQIE----------SAQAEIMT
A0A5C7JWY1      VSAQVAELSEKYGPLHPKLAHMKAELQDLRQRTQQEVQKIYDSVKHQYDMAVAQDKAVKE
A0A1F8QGH2      --------------------------LEALQTHIDDLYEGIE----------ATQAEIES
A0A1Q7TTL6      LRAYRYKYSDEYPPVQRLIGDIATLQRQTIPRLARVLAGQLA----------AKETELGR
A0A0S8KFR9      ----------------------TKSAREILQQRLSAVEGNLE----------QDREALQD
A0A535SLQ0      ARDSLASLSTSHPDLPRLNVLISATEGKLLRAVQAGIQGAIA----------SLDGRIAA
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      ----------------------------------------------------AREI----
A0A3M1EJ46      ----------------------------------------------------LAEE----
A0A0M8KAF3      ----------------------------------------------------TPET----
A0A523V9H6      ----------------------------------------------------APET----
A0A2U2S5W9      ----------------------------------------------------ARQI----
A0A7C3W344      ----------------------------------------------------ARQI----
A0A7C1G8J6      ----------------------------------------------------ATEI----
A0A3D1U3H5      ----------------------------------------------------KQAQ----
A0A2N2MEK3      ----------------------------------------------------TLELYQQI
A0A3B9J9U6      ----------------------------------------------------TLELYQQI
A0A661VSD8      ----------------------------------------------------AAEI----
A0A1W9UQ51      ----------------------------------------------------AAEI----
A0A497B563      ----------------------------------------------------AAEI----
A0A497C1E5      ----------------------------------------------------AAEI----
A0A7C0TV81      ----------------------------------------------------AAEI----
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ----------------------------------------------------YESAYNTL
A0A7C3QTG6      ----------------------------------------------------YQQIYTDL
A0A7C2TGF5      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ----------------------------------------------------YQQLYTNL
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ----------------------------------------------------YQQIYTNL
A0A2N2MEG3      ----------------------------------------------------YQQIYTNL
A0A353RQ31      ----------------------------------------------------YQQIYTNL
A0A3B9KNR2      ----------------------------------------------------YQQIYTNL
A0A0P6XME1      ----------------------------------------------------YQQIYVNL
A0A3B9Q1T8      ----------------------------------------------------YQELYTQL
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A7D6GA99      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
                                                                            

A0A3A4VPK9      IVYGKQVDGAN-TSAGSQLTLLNTTQSLYQQIYVSVLNNLESVR------LAKL-QNMPN
A0A3D0CW53      -------SARAIQDIQGQIGALQQTITTWQATYASLLD------------FSKG-SRTNY
A0A535RWE5      TAQQAQKV------------QLDSQRQTKQQTLAQLLMTRDDIS------LAAA-RAQNT
A0A7C5A5U0      LLASSVESTTSTE-----IANLEKQLGLYQQIYLSLLNNRETVR------LERM-QNMPN
A0A0P6WSP2      ISAQKAQIEADLIKEESAKTKLSQD-------YQVLYDQMEQLR------KNAN-QASNS
A0A5C7JWY1      AITRYNTDKIRLEQNEIEHSMLERDADTSQHLYDVFLKATKETD------LSSG-VRANN
A0A1F8QGH2      LSAEKIRAETELA-------RLESRLVEDRNDYRALKQDYEQLQ------LTAN-DASQA
A0A1Q7TTL6      RVDADARALRQIPARAIEEARLRRDANLAENLYTTLQQKYDEAR------LAEA-SSLAD
A0A0S8KFR9      LLDSSARENARID-------ALEMRIRSEEEVYLSLLRQYEEVR------VAEA-SRESS
A0A535SLQ0      INDLRARRAGNLQ-RDAEEARLTERVDNARKVTDELRTEYQKAG------IAQA-VTVGQ
A0A1F8SS27      -------SAEQLSELQRELNTLASLITSWENTYTQYLG------------FLQAKESPGT
A0A2E0L5X9      -------SAFELNQNIEDRGEIEKSIQELRTLLLSLIEN----------------APRSE
A0A3A0AXU8      -------QGPQSVETTQRTLELRDRILQYRTERIGVLTSLAETQNALSSAFEEPSSDVDT
A0A359HML3      ------------SDTQNQISSLKNSLASLQLNYANLLSNTEK-------------GAINT
A0A3M1EJ46      ------------SARLAEVASLDAALQEARGSYARLLESYLQVK------SAT--GGSVV
A0A0M8KAF3      ------------EAEQTRQQQLQTLLTQQQAAYTTLLRSYEEVR------LAEA-QAVDS
A0A523V9H6      ------------TEGLAELARLQTILAGYRNTYATLLQGYEEMR------LTAA-QSTDN
A0A2U2S5W9      ------------QDLQGQINVLQNQINTWQANYAQLLN------------FIEG-GSPNY
A0A7C3W344      ------------QDLQGQINVLQNQINTWQANYAQLLN------------FMEG-GSPNY
A0A7C1G8J6      ------------NEAQSRIRELEQLKRDNQSTYSQLLLSLNT-------------NRPNT
A0A3D1U3H5      ---AGGAGNAQTQDLTREIDQDRTAINNLQTQLVTLQSTEAQ-------------TSANL
A0A2N2MEK3      YANLLVLGKPTSSGASDRLTHLQKTLELYQQIYLQLLGSLEEVR------LARLQNTPSI
A0A3B9J9U6      YANLLVLGKPTSSGASDRLTHLQKTLELYQQIYLQLLGSLEEVR------LARLQNTPSI
A0A661VSD8      ------------ADTMARIDALEQVASTYRTQYAALLQSYMG-------------DSVNV
A0A1W9UQ51      ------------QDVQDRIAALEEVKSTYQSTYADLFNSYRA-------------ESPNA
A0A497B563      ------------QDVQDRIAALEEVKSTYQSTYADLFNSYRA-------------ESPNA
A0A497C1E5      ------------QDVQDRIAALEDVKSTYQTTYANLLTSYSA-------------ESPNV
A0A7C0TV81      ------------QDAQDRIAALEEVKNRYQMTYANLLDSYQA-------------ESPNV
A0A3D1JCW0      --------------NAAEIDRLETRISQYRQLYASILSSYEQIR------LAEA-QTTTS
A0A2N2MJJ0      MV-----QKKILAADDEELTQLEKTFNLYQQIYLNLLNNREALR------LARL-QNTLT
A0A7C3QTG6      VVLGKPVTSGDETS---RLSQLQTTMQLYQEIYINLLNNLEAIR------LARL-QNTPN
A0A7C2TGF5      -------SPTEMAELQVEKTTLEGLIADYVKNYVELLNY-----------AGQE-RKPNS
A5V160          ------------IDDPTRRARLEEALVQYRSSYATVLRSLEEVR------LAEA-QLTNS
A0A2A6REI6      ------------AANAAERSRLQELLAMYRTSYASLLKSIEEVR------MAEV-QQTNS
A0A426TTK3      ------------AANAIERSRLQELLAMYRTSYASLLKSIEEVR------MAEV-QQTNS
A0A3M1LAM5      -------SAVELSEAQARLAELEQLKSNYRADYVRLAN------------LLNT-QSPNT
A0A536BZ00      -------NTSRTNAEDQELADLQSRLVTLRQTYVTLLG------------ISTG-SAANF
A0A7C5LUL4      -------GTTPNTA---EVARLEALLAQQRSTHASLLQSYEEIR------LSEL-RAADT
E8N5M1          --------NLARQINQAEIDRLETRLAQYRQIYASVLASYEQIR------LAEA-QNITS
A0A1F8U7F0      VVLGQPVDTGTNTSTRLQ--QLQTTLSLYQGIYVNLLNSLENVR------FARV-QNTPN
A7NIZ1          ------------------RARLEEALVQYRSSYATVLRSLEEVR------LAEA-QLTNS
A0A0P6XM68      VVLGESRNENSANVEQE---QMQSTLALYRQIHANLLSSYENIR------LARL-SSTSN
A0A2N2MEG3      VVLGQNRAVGEADTEQE---QMQSTLALYRQIRANLLSSYESIR------LARL-SSTSN
A0A353RQ31      VVLKTPAESGTTTATSAQLTQLQTTLNLYQQIYLSSINSLEALR------LSRA-QNTPN
A0A3B9KNR2      VVLKTPAESGTTTATSAQLTQLQTTLNLYQQIYLSSINSLEALR------LSRA-QNTPN
A0A0P6XME1      TF--SPSNQGNSNSTNS---QLQAALVLYQQIYANLLSNYEAIR------LARL-QSTPE
A0A3B9Q1T8      VVLGKPIDQENPSSRQSD--RLERTLSLYEQIYFSTLNSLEALN------LARD-QNKPT
A0A2E5F6N9      ---------------QTREKHLADIAEFMGVAQSQGIRIQDDLL------VSQM-SSLSS
A0A2E6J6X7      ---------------YVIERRLTEIARLQAAASAQGLSDVQSLV------NAQF-TALDS
A0A1F8RRT9      ----------------------------------------DSNE------QDGL-TRPGT
A0A3M1EAN8      ----------------------------------------AQHE------KRRD-DLAVY
A0A363SX22      ------------------------------------------KY------VEEL-YGVYD
A0A6I1QLV0      -----------------------------------------TQN------AEEL-GRPGT
A0A535FRM3      -----------------------------------------QYS------RNGL-NGMAQ
A0A401ZA55      -----------------------------------------SYA------TSHL-ASQAN
A0A4P6JS79      -----------------------------------------QYT------NTSM-GGQVQ
A0A326UPN3      -----------------------------------------QYQ------NTQL-GGVSQ
A0A455STY5      -----------------------------------------QYQ------NTQL-GGVSQ
A0A535QK16      -----------------------------------------EAK------APTA-SSADN
A0A3D0UNQ0      ----PTPEEKSQI--QAEMNDLEGILVEWENTYARFLQF-----------IGGE-ESANY
A0A2G6GG97      ----NAQGKEITPEESATLSRLETNLNEAQIRYTETFNNLNDLQ------IKQA-KETSN
A0A6L7WZR1      --------------------------------------ERQQPF------LPAG-REAQV
A0A7C5QIC8      ----RAKAIPS----SAEIARLETLAAQYRSTYADLLQSYEGMR------VAAA-SSSEA
A0A1F8PTW9      ----ISAQQIDET--QIQISSLQSKLSTMQDNYGTLLSN------------TQQ-GAINS
A0A1F8QH26      ----ISAQQIEEV--RSQISSLQSKLSDMQNTYATLLSN------------TNQ-GAINS
A0A535D584      ----QRG--------HQDTMALAGQIQADTATLTQLSANYSAFR------AQQG-VDVAH
A0A521TS25      ----RRAGGEQS---ASRIAVLQSDLGQFQATFAQLLRSQQEMT------LSET-RAMNA
A0A7C2TBJ3      ----TSAIQIADT--QQRLAALQEKLSLLRNNYANLLSN------------TGG-GAINT
A0A7C3TYQ9      ----KAASEPD----QLEISRLTEQLLQYRTTYANLLRSYEEIR------VAEA-KTLDT
A9B6E3          ----GADKPAAESL-IANLQLKQQSQNQNRQTLSTLYST------------ALG-NRANS
A0A3M1H759      ----FSARQIRDL--QSDIASWQSLINEWQRTYTNLLDF-----------LQGG-DSPNY
A0A7C3J9I4      ----VSASQIQSL--QDEITNLDNLIRGWQRNYTELLSF-----------LEGE-GSPNY
A0A497ASN6      ----QT---------QEDVKVIEQQLVNLRDMRTRLLTSLYDIQ------LAEA-QHTEL
A0A3D1TRD4      --------------------------------------TQQHDR------MAKG-DASNA
A0A5C7JS64      ----VKTKDVTSPEVAAQIETLRTQLADYQSTYRELLISANRMD------LQEA-GAQTG
A0A7C5IJ97      -----------------------------------------QQN------FQAS-ARLAS
A0A7C3FJ85      ----SD---------SAERSELESQITRLQDSLSRLTTAYQSIQ------LAEL-QAADL
A0A3M1ZZ81      ----GTPETPEE---EAELSRKDTKLKELQIQYTEAFNNLNQLR------VSQA-KESSN
A0A3C0XJG2      ----PAFPQGPPADLRSQISQLESTGTARQDTLAQLMRTRDDLR------LVAA-RAENT
A0A7C3NE64      ----LSARQIQEL--QTEITSLEELINNWQANYAELLSF-----------LDGR-DSPNY
A0A7C4V0A1      ----KAAGASSD---QAEVARLEGILAGYRNTYSELVQTYEKMR------LSAA-QTMDS
A0A6J4UI39      ----EAAEAAGATDVSSQLGSLRVTLTQAQIVYGDLLSQQGEME------LAEA-SLQSR
A0A521IC37      ----TDQAKLDNL--NTRISALQTKIENWQRTYLSMGT------------LLNQ-STGKY
A0A7C1K503      ----GEPDTPEE---QAQKTQLETSLAQYRSSYANLLQSYENIR------AAEA-QELNN
A0A535IMD1      ----VSARRIQDV--QSQIAAKQSQINQWQATYAQLLTFYK--------------GGTNV
A0A7C3FPG2      ----GDATDAET---NSRRAILEDRLAQYRSTYGNVLAQLENIR------LAEA-NALDT
A0A3A0B2P8      ----FSARQIQDA--RSQITALEAKLATLQANFANLLAN------------SRQ-GAINT
A0A497AF06      ----RISSGMLT---EEETNLIQTTLSNQQLAYASLLETYLNIR------LTQS-QLLD-
A0A661W444      ----RISSGMLT---EEETNLIQTTLSNQQLAYASLLETYLNIR------LTQS-QLLD-
A0A497BNC7      ----GAPESAPSEFAQLERTRLESQMTRDQTRLVVLLSSAEEFR------LAMA-RYTDT
A0A7C6DKX5      ----TSATAIKEI--QDQITSLQLQITTWQATYANLLSH------------NAG-SSTNY
A0A521UD91      ----KAAFYPN----TAEITRLQNVLSTAQVTYSQLIKDDSQMR------LEEA-RTLNA
I0I8T2          ----LSARQIRQL--EDQIAALEAKMASLQSTYVNLLAN------------TDQ-GSTNT
A0A3C0LJ76      ----LSARQIGQT--ETQISALEAKLTTLRSTYVGLLAS------------TDQ-GSINT
A0A7C7DWW4      ----LSARQIGQT--ETQIAALEAKLATLQSTYVGLLAS------------TDQ-GSANT
I4EI06          ----RGRPDASTAAVQAQIADLEARLGQQQSSYDGLRATQQQID------LANA-QANSQ
A0A522N7L9      ----TAVADRTPSQ-DQELQALNGQLGTARSTYATLLS------------ASSN-NAANL
A0A535W4H1      ----QAITSPTPRD-QADLFALQDRLASLRSTYASLLG------------FQST-TASNL
A0A3D0D4X6      ----RA----ANPRNEDEIDRLESRVTQLRNTQSSLVQSFEQVR------LAEA-TSLNS
D1C8M3          ----QAQPNAGDPAVQEEIRNLQAQLAQFTETHSALIEAQQRIL------ASAA-ASGPR
D1CAL1          ----QQSGASGTAV-QTELRTLQTQLSQDQALYASLLEAQQRME------LAAA-QSATQ
A0A7C4K810      ----GD----SSRD-EAERSRLQTILAQYRQIHSSLLLSYEQVR------LAQA-QTENN
A0A7C5MIR7      -----AERVKATPD-PNTLAHLETLLAQSRAAYQELQQQYQSIQ------LAQT-EASQT
A0A7C5ARI8      ----------AQAQ-GEKRNGLETRLTQLRDILARLQSSYESVR------LAEA-QSVDL
A0A7D6GA99      ----EASTSRTAAQ-DADLARLRDNLQQYRASYANLLQSFENLR------LTEA-RSSDT
A0A1J4ZRV4      ----------AVTD-DNQRMRLETSLAQYRSTYSSLLSSYQQIR------LAEA-QATDN
A0A1V5RXW5      ----------RATD-DAQKTRLETSLAQYRSTYSTLVANYQQAR------LAEA-QTLDS
                                                                            

A0A3A4VPK9      VVQIQPAIV--PDDPVRPRTMLNSVLGGIIALILSAGFLILKENLDTTMK-TSA-QVEEL
A0A3D0CW53      LSVVEPAVV--PTTPISPNIQRNVSLATAIAFVLAAMAALLLEYLDDTLK-SDE-DVDRI
A0A535RWE5      VSLWEAAVA--PAEPDSPHVGLNTALGAIVAGLLVILAIGMLGYVEDRIT-DFD-AMHEK
A0A7C5A5U0      VVQITPALP--SDKPVRPRTLLNTVLGGIGGFVLALAFVIVRDALDVSVK-SSE-DVERI
A0A0P6WSP2      VMVVAQPSI--PDRPTQDRLLY-VLLAALLGGTVGIGAAFVLDQLDETVR-IRQ-DVTSK
A0A5C7JWY1      VYLADPAAP--SSMPSKPRTKLNIMLGLLAGLMSGVGLAIFVEGRSKKLM-APA-DVERY
A0A1F8QGH2      VSIVEPAQL--PESPEEDRVLY-IGLAALTCAVVAIGIAFLWEYLDDTIR-TPD-DISDL
A0A1Q7TTL6      VRVLDYAVV--PRRPVKNTRRRVVLLAFFGSFAMAVVGAVLIDRVDPRVR-YPD-QVSRE
A0A0S8KFR9      ASIVAQAGQ--PDAPSKPRVKFNLALGTLVGAVGGIALAFLFEYLDPTLH-STD-DLEAA
A0A535SLQ0      VEIVDHATL--PTKPAGIGLPEQLVLGLLVGLMLGTGGAFVAERVGSSIA-RRV-EVE-H
A0A1F8SS27      LTIIESAQV--SPKPINPQVQLIAFLATGLGFLLALGFIFLLGHFDDTLK-TAE-EITQV
A0A2E0L5X9      IQVFEPADP--NYFPLTANSVRDLLIAGVAGGVLALLTIVLFTYFDDRLQWDEESSAETI
A0A3A0AXU8      IVVVDPALL--PVVARQRDFLQPMVAALVAALALGFGLAWLLEYLDYTVK-TPE-ELDEL
A0A359HML3      LTIIEQPHV--PTSPVGSKMLVTVGLSAAVGFTLAAAAAYLLEFLDKTIK-TVD-EVKRL
A0A3M1EJ46      ISIVEPAAM--PARKVKPRVYFNTFVAGVVGLILAIGFIFLLDHLDDTLS-RPE-GVEQA
A0A0M8KAF3      IVVIDPATP--PERPVRPRVLLNTLLGGVLALVAVGAVVVLIEVLDDRVR-SPE-VIERL
A0A523V9H6      VIVAEAAEV--PDEPVRPRVLMNTALAGVVGAMLAVGAAFLVEYLDDTIK-TSD-DISRE
A0A2U2S5W9      LAVIEPAQL--PTEPVSPRTSMNVLLAASIGVLLALGAAFLLDYLDDTIK-SPD-DLVTT
A0A7C3W344      LAVIEPAQV--PTEPVSPRTTMNVLLAAGIGILLALGAAFLLEYLDDTVK-SPD-DLVSA
A0A7C1G8J6      LRVMEPAIV--PDQPVGPKLTLNVAIAGAIGLMLAVATIVFLEYMDDTIRWDGQ-IHSKV
A0A3D1U3H5      DVRVPAQVPHFPSSPHPVRSAAI---AAFLALLAATGLLFAREYFAGTLRNPEE-FQALM
A0A2N2MEK3      VQIEEAAVPGSPVRPLPFKTAML---GAAVGLMLGFGIAFAIEYLDDSLR-SPM-DVDQV
A0A3B9J9U6      VQIEEAAVPGSPVRPLPFQTAML---GAAVGLMLAFGIAFAIEYLDESLR-SPM-DVDQV
A0A661VSD8      LSIVEPAVE--PRRPIGGKAKLIVAMSAGAGLALALGAAFLIEYLDDTVHWEDG-RQQAV
A0A1W9UQ51      LALFEPAVT--PQWPIPSKAKLIVAVAGAAGLVLALGAILLIEFLDTSLRWEGD-GVQSV
A0A497B563      LALFEPAVT--PQWPIPSKAKLIVAVAGAAGLVLALGAILLIEFLDTSLRWEGD-GVQSV
A0A497C1E5      LSFFEPAVA--PQWPVPSKTKLVVAVAGAAGLGLALGAIFLIEFLDTSLRWEEG-GVQSI
A0A7C0TV81      LSLFEPAVP--PQWPIASKTKLIVAIASMAGVGLALGAIFLMEYLDTSLRWEEA-GTQSI
A0A3D1JCW0      FIQVEPATP--PEKPIRPRTLLNTALAAVVGLMLAIGGVFAIDFLDDTLH-DPE-SITTL
A0A2N2MJJ0      VAKIDAAQV--NPAPIRPRTTLNTLLGGLAGLILAVSIIFLRDFLDDTIK-SRE-DVKRM
A0A7C3QTG6      VVQIESATV--PSSPVRPRPLMNIALAGTVGLMLAAGIAFLIEYVDDTIR-TPD-DIERI
A0A7C2TGF5      LSVIESAQV--GEDPIRPKVQLFGLLGGGVGVALALGLIFLLEMLDDTFR-SLD-DIHQF
A5V160          VNVVETAVP--VTTPVRPRIVTNTAMAAVAGLLLAVGLALLIEYLSDRVS-SAE-DVTAA
A0A2A6REI6      VHTVEAAAV--PEYPVRPRIVQNTALAALVGLLLMVGVALLLEFLNDRVT-SSQ-QVAEL
A0A426TTK3      VHTVERAVV--PDVPVRPRVMQNTALAALVGLLFMVGVALLLEFLNDRVT-SSP-QVAEL
A0A3M1LAM5      LTIMEPASP--SRRPIAPNPKKSAAIAAVAGLILAVGAVILLEFFDDTIY-WYG-EQESI
A0A536BZ00      LTVVEPARA--PTDPASPRLPINTGIGALMGLLVAVGLALLIDHMDDTVK-TAE-IAGEV
A0A7C5LUL4      ISIFEPAQV--PGVPVLPRTMTNVLLAAVVGAMLAVGAAFLVEYLDDTVK-TPA-DVQRL
E8N5M1          IIQVEPATP--PDKPVRPQTLRNTAIAALVGIFLAIGIVFALDFLDDTIK-SPD-WITTQ
A0A1F8U7F0      VVQVEPAVA--STSPISPRPFQSTALAAAVGLMLAAGIAFLIEYLDDTLK-TME-DIERV
A7NIZ1          VNVVESAAP--VYTPVRPQIATNTGMAAVAGLLLAIGVALLIEYLSDRVN-SAE-DVATT
A0A0P6XM68      IVSIEPAIP--PEEPLSPKPVRTGLLGGTVGLLLAAGIVFLIEYLDDTVK-SAE-QAEAA
A0A2N2MEG3      IVAIDLAQV--PSSPIRPQPLSTAGLGAAVGLMLAAAIVFLIEYLDDTIR-SAD-QAVEA
A0A353RQ31      VVQVEEAQI--PSVPISPKPGQTALLAGAVGLILTAGAAFLIEYLDDTIK-TPD-EVKEI
A0A3B9KNR2      VVQVEKAHP--PSVPISPNPVQSATLSAAIGLILTSGIAFLVEYLDDTLK-TPD-EVKEL
A0A0P6XME1      VVQVEEARV--PSRPVRPQTTTNVLLGGILGLVLAAGIVFVVEYLDDSIR-NGE-TVTRV
A0A3B9Q1T8      VAQIEAAAV--PVEPFFPRPIETGLLYGAVGLFAVGGLVFLIEYLDDTIR-TPD-EAEQI
A0A2E5F6N9      VSIVEPAIV--PTAPIYPRVRFTVLVATFLATVSTILAIIVVEFFNDKAK-SSE-EIERR
A0A2E6J6X7      LYLLEPVST--PTTPISPDVQQNITFGIMIGLALALGLTFLISNLRDTVR-NPD-DIRTK
A0A1F8RRT9      VSIVEPAST--PASPVRPRTTLNSIIGALAAVFIAGTVVLIYEYLDDTIK-TAE-DVETA
A0A3M1EAN8      IEVVEPASM--PAYKLRPRPYFNTFVGALSAFLLAVVFIFFMHHLDESL--TYT-EAEEV
A0A363SX22      LKILDLAEI--PVFPIKPNWKLNLALAAVLSLAVGMGISFLVEYMDDTLR-EPD-EISQL
A0A6I1QLV0      VSIAEEARI--PDDPVEPRTTLNTVIAVVLGLLLAAGLVAVLEYLDDTVK-RPE-DVEER
A0A535FRM3      IQIL-PALE--PTTPLRPRPLQDASIGSLVGLGLALALIVAFEWIDDRLT-NPE-EIRKL
A0A401ZA55      FNTI-DPVV--PTDPVRPRPSQDSLIGALIGLGLALAIIVIFEWIDDRLT-APE-EVNKL
A0A4P6JS79      PIIV-QALP--PTDPSQPKPSLDAGIGALVGLGLALALIVVFEWLDDRLK-GPE-EAQRL
A0A326UPN3      LRVV-PAIE--PTRPSKPQPTQDAIVGALVGFGLAIALIVVFEWLDDRVP-NPE-EMQKL
A0A455STY5      LRVV-PAIE--PTRPSKPQPTQDAIVGALVGFGLAIALIVVFEWLDDRVP-NPE-EMQKL
A0A535QK16      LVIWTPAIV--PVDPVSPKPLLNIGLGILAGLVVGLGLAFLLDYLDQSVR-SDE-ILRER
A0A3D0UNQ0      IAVVDKAHA--RLNPVRPTIRLNTLVAGLVGFILALGVIFILDYLDDTVK-TVD-DISQD
A0A2G6GG97      LIQIEEAKP--HEIPIRPRTETNVLLAAAVGGMIAVGIIFLIEYLDDTIK-TPD-QVLEK
A0A6L7WZR1      LRVAQPAAL--PTVPIAPRPIVNTLVGIAFGLLAAVAIAGLLEYRDDTVK-SPD-DVAA-
A0A7C5QIC8      LILTKPAKV--PAQPILPRKELNTALAGAIGALLGLAAAFLIEHLDDTIK-TEG-DVQRV
A0A1F8PTW9      LTLIEPAAL--PSSPIGPKIGLTALLAAALGLMLAVGEAYLLEYLDDTLK-TAD-DVARL
A0A1F8QH26      FTVVEPAAL--PVKPIGPWLGLSVLLASLAGCALAVGEAYLLEYLNNTLK-SSE-DVVRL
A0A535D584      VSVAAAAVA--PAAPISRNLYTDAGIGAVAGLLIGTAIAVVLQLLDQGLR-TEE-DVRQK
A0A521TS25      VRLAEAAIE--PALPVRPQVGLNTIVAAIVGLILAAGFAVLVEYIDDTVR-TPE-AVESA
A0A7C2TBJ3      LSVIEPASL--PTRPIGPNKPGIVALSAAIGLALAASAAHLLEYLNNTLE-SPQ-EISRV
A0A7C3TYQ9      VTVVEPADL--PTAPVGPKTMTNTVLAGMVGAMLAVGVAFLVEYLDDTVK-TDA-DVASF
A9B6E3          ISVVEAATV--NPTPIAPRPIRSAILAGILGFALVFGLALLIEYFDDSVQ-TPD-EGVDL
A0A3M1H759      LSVVEPAVV--PDTPISPNIPQNVMLAAATGFLLALGAAFMLEYIDSTIK-TSD-DLSPS
A0A7C3J9I4      LTVIEPAQL--PTVAVSPNIAVNVVVAAAIGFILALMAALLLEYLDDTIK-SID-NLSAS
A0A497ASN6      ITQLEKADV--PDKPVRPRKLMNALIAGVLGGMLAVMGAFATEYLDTTIK-SPE-QIEQI
A0A3D1TRD4      VSVVAPAQV--PASPVSPRVKLDTVLGMVVGLLAAVGFIALVTYFDDTIK-SHN-DVDRA
A0A5C7JS64      VVVVQEASP--PGAPYAPNVRLYTLLALMAGLCIGIGAVFLLEYLDNTTK-VDS-PFNEL
A0A7C5IJ97      IIVAQPAKT--PTVPVLPRTLLNTLLAAFSGMVIGVGSAFLFEYADDTIK-SPS-DVERI
A0A7C3FJ85      VSIIEPARY--PEGPIRPRKAMNALLAAVVGSMVAVGGVFLQEYLDTSVK-SAN-EAERL
A0A3M1ZZ81      IVPIEPAQP--PQRPIRPRTFTNTIMATIIGGMVALGFVFLMEYLDDTIK-TPD-DVLAD
A0A3C0XJG2      VTVWEPAVA--PTDPESPRVALNTILGAIAGGLLTLTGIAVFTYMVDRIT-DVD-EVSER
A0A7C3NE64      LTVIEPAQV--PTSSISPNVRLNILLAAAVGFGLALATAFLLEYIDDTVK-SVD-ELSES
A0A7C4V0A1      VTLFEPAQP--PSAPVRPKPLNTAAVAATAGLVAAIALAFLVEYLDDTVK-TPD-EVRDS
A0A6J4UI39      VSVWEQARV--PTAPYEPRTLLYTLLAVIAGLIIAAASVFLLEYLDNTVK-NEE-DVVEL
A0A521IC37      LTVIAPAPL--PAAPVSPNILQNVLLAAAVGLVLAVGVVLLLEYLDDTIK-SSE-DVERV
A0A7C1K503      VSVVEPAVP--PRAPIRPRVELNTLLAGLVGMVLAGAVAYVFEYLDDTLK-SPE-DISQR
A0A535IMD1      LSVIEPASV--PVAPIAPRTDLNVMIAAAIGCLLAVGGAFLLEYLDDTIK-TPE-DAQRV
A0A7C3FPG2      ITVVEPATP--PERPVRPRVLMNTLLAMIVGGMMGLGAAFLIEYLDDTVK-TPD-DISRI
A0A3A0B2P8      IHVLEPANL--PTTPMSRGLKTNVAVAAALGFALAAAAAYTMYYLDNTLQ-NED-DIQDH
A0A497AF06      VTVVEPAVA--PTEPIRPNIVIYTFLGTFVGFVLSAGVAFLVEYLNRSFE-TSE-EIKQI
A0A661W444      VTVVEPAVA--PTEPIRPNIVIYTFLGTFVGFVLSAGVAFLVEYLNRSFE-TSE-EIKQI
A0A497BNC7      ITIYAPAEL--PSAPVNSRTLQNTLLGAVTGLMIGVGVAFLLEYLDDTIK-SPQ-DVKQT
A0A7C6DKX5      LTVFEPASV--PRQPVSPNVPRNVLLATLIGLTLAAGAALLMEYLDDTVK-NRD-DLARL
A0A521UD91      VRLAEPAQT--PLQPISPKVLQNTLLAAVVGLFLALAAAFLIEYLDDTVK-SGT-DIERV
I0I8T2          INILDPPAV--PTQPVPNRWWLLVAVAALIGAGVAVAGAYLLELLDDRLE-NVE-QIQRV
A0A3C0LJ76      INVLDPPVV--PTEPVNDRWYLLVLVAAIIGATVAIAGAYLLEFLDDRLV-DIE-QILQV
A0A7C7DWW4      INVLDPPVV--PTEPVNDRWYLLVLVAAVIGAAVAIAGAYLLEFLDDRLV-DIE-QIQQV
I4EI06          IRVAEPAVA--PTKFVKPRIVVNTALSGVLGLLIAAGLVALAGYLDDTVK-TSG-DVRRL
A0A522N7L9      LSIIQPAVA--PVDPASPRPLLNTLLALIVGALIAIGVAFLLDYLDDSLK-TSE-AVEET
A0A535W4H1      LTLIEPAVA--PTSPSAPSRFLLTILAGILGLLLATAILFAAEYLNDSLK-RPE-DVEEV
A0A3D0D4X6      IIVDEPAAL--PTKPVRPRPLTNTLLAAVVGAMIGLGTAFLIEYLDERVR-DPA-MVESL
D1C8M3          IRVTADAIP--PDAPIRPRTTLNTALGGVLGTLLGLGVVLVLVYLDDTVK-DAE-DVRRL
D1CAL1          IRVVEQAVP--PTKFVKPRILVNTALAGALGIVLAAGLVLVAGYLDDTVK-TSE-DVQRL
A0A7C4K810      LVQVEEAAP--PSRPIRPNTVTNVVVAGLVGFLLGAGIIFLIDVFDDTLK-GPD-DVTRH
A0A7C5MIR7      LTVSEPAQV--PQQPILPRTPLNIVVGALLGLMGGIAVASLITYVDNTIR-NAD-DVERA
A0A7C5ARI8      ITVVEAAQV--PVAPIRPQILKNTLLAAVVGAMLGVGVAFLIEYLDTSVH-TPE-QAEAA
A0A7D6GA99      ITIVEPAEV--PRLPVRPRAXLNTLLGLMVGLVLSVGAVLLIEYLDDTIK-NPD-DVTR-
A0A1J4ZRV4      VAIAKPARV--PELPIRPRTMTNTLLAAVVGAMIAVGAAFLIEYLDDTIK-TPD-DVARV
A0A1V5RXW5      IVLSEPAIA--PERPVRPRTLTNTALAAVVGALLALGIAFLIEYLDDTIK-TPD-DIERV
                                                                            

A0A3A4VPK9      L-KLNVIGYIAEMQN----SNGETIGL-YTTNQPRSPIAEAFRSLRTNIEF---SSI--D
A0A3D0CW53      L-KLPTLGATTRIPK----IQQPSDHL-VTVHSPRDPITEEYRVLRTNIQF---TGL--S
A0A535RWE5      L-GITPLAEVY--RA--GPSETAAGML-FVRDAPMSPDAEAFRGLRTNILF---ASP--D
A0A7C5A5U0      T-GLPILAYVPWIKA--NGEGIGP----YVEKHPRSPFAEAFRSLRTNLEF---LAL--Q
A0A0P6WSP2      M-GLNLLGCID-------AQKNGDSGL-EMDVHPRSKVAEDFRTLAINLCS---VNA--Q
A0A5C7JWY1      LPNVSLLGVVPRL-----SKAVAQKKA-LAPPNALTPVAESFRIIRTSLLL---SNP--D
A0A1F8QGH2      T-GTSTLAII-------GQLPQGEDEL-VVLAKPRSPYAEAFRMLAANIRF---SSL--D
A0A1Q7TTL6      M-GLTILGAVPHIRA--GARPERSGRR-VRPPEEVAVVVEALRGVCLNLVY---AHG--A
A0A0S8KFR9      A-GASVMGVIP--GF--APHAVSRGKI-LLSSDGRSPEAEAFRMLRGNLLS---VAS--T
A0A535SLQ0      L-GLSVLGIVP--RC--GRETDQKG------PGSADAAVEAFRGIRLNVLN---GHG--A
A0A1F8SS27      S-GLPVLGMIRKLSR----FKNTSDSV-YVSKNPRSPAAEDFRILRANLEL---LST--D
A0A2E0L5X9      L-GMRILGPLGII-------PRNKLPL-YVESMPQSIETEAMRQLRARIAL---AAG--G
A0A3A0AXU8      F-GMPTQGAIAGVGG-GNGDQGRGLAL-VTATDPRSPVAEAFRALRTSVRM---AGV--D
A0A359HML3      I-KAPILGYIPEI------PRKEDRWH-FVTNHPRSPISDAFRNLRINVDL---LGV--E
A0A3M1EJ46      L-RIPTLAAIPAVRM----RTSKNGNP-FAANHPTSPFAEAHRTLRTNVQF---SSG--D
A0A0M8KAF3      T-GLPMIGAIAHIE-----GTNGDGVL-VAREQPRAPVSEAYRVVRTNLQF---AEV--Q
A0A523V9H6      L-GLGTLGAVARLR-----NG--DDVL-VTLTEPLSPPSEAFQVLRTNLRF---SAL--D
A0A2U2S5W9      A-GLTPLGAITRMR-----GEGYENKL-VTMRHPRSSVAEAYRTLRTNIQF---STL--D
A0A7C3W344      A-GLTPLGAVARMR-----GEGYENKL-VTARHPRSSIAEAYRTLRTNIQF---STL--D
A0A7C1G8J6      M-GMPVLGAMPRL-------SSKDERL-IAWSAPHSGAAELVRQLRTNIFL---ARP--G
A0A3D1U3H5      S-GAPVLGVVGDLN-----RETKRPGL-SVTENRRSLGAEMYRMVRTNLLF---SGA--D
A0A2N2MEK3      L-GLPVLGYIADMK-----PANGPRQL-HVAAFPRSPAAEAFRNLRSSIEF---SGE--D
A0A3B9J9U6      L-GLPVLGYIADMK-----PAEGPRQL-HVAAFPRSPAAEAFRNLRSSIEF---SGE--D
A0A661VSD8      A-GLSILGAVPRM-------SSRRKTW-AAIDRFRYPEIEAIRNLRTNIFL---STP--G
A0A1W9UQ51      L-GLPVLGAVPQV-------S--RKNA-LSSDNP----------------------P--D
A0A497B563      L-GLPVLGAVPQV-------S--RKNA-LSSDNPLSPVAEGVRAVRASVFL---MRP--D
A0A497C1E5      L-DLPVLGVIPQV-------S--RKDV-LSSRNPLSPVAEGARAVRASIFL---MRP--D
A0A7C0TV81      L-EMPVLGVIPQQ-------T--SRKA-SLIFNPLSPVSEGVRTIQANIFL---MRP--D
A0A3D1JCW0      S-GLPILASISEHEV-------EDGGP-ITQAHPRSPVSEAFRSLRTNVQY---SSV--D
A0A2N2MJJ0      F-GLTTLGQIPE------HGAAKETGL-FIASQPRSPVSETYRALRTNLEF---ASV--D
A0A7C3QTG6      L-NLPVIGYIGDMSD----GQDVVDDL-HVVRRPRSPISEAFRSLRTNLEF---TNV--D
A0A7C2TGF5      A-DLNILGAVGRI-----KGRKFSEKI-IAHLEPYSPTMEAYRMVRNKLQF---GSV--F
A5V160          T-HVGMLAAIGRI-----DGAEPSDKL-VMLRDPFSQVAEAYQMLRVKLEI---ARF--E
A0A2A6REI6      L-DTSVLAAVGEI-----DGQRSMDKL-VTLISPHSKFSEAYQMMRVRLEI---ARY--G
A0A426TTK3      L-DTSVLAAVSEI-----EGQRPMDKL-VTLISPHAKVSEAYQMMRVRLEI---ARY--G
A0A3M1LAM5      V-GARLLGTIGRF-------PAKSDKV-IVRRAPRSPAAEMVRQLRSKILL---AQP--G
A0A536BZ00      T-GLPTLGTIVRMRL-ATGREKFYSLP-TLLY-PRSRGAEAFRTLRTNLDF---AHV--D
A0A7C5LUL4      A-RLPTFATILRF----AGDEADAERP-LMVSRPSSAAGEAYRVLRTNLQF---ATLGMG
E8N5M1          T-KLPVIGTIHTFDP-------KAGDP-VALSSPRSPVTESFRSLRTNVRY---ASV--D
A0A1F8U7F0      M-QLPVVGYIAEIQY----ESGSDESL-YVTRQPRSPVSEAFRLLRTNLEF---AGV--D
A7NIZ1          A-RVGMLAAIGRIDG-----AAPSDKL-VMLKDPFSQVAEAYQMLRVKLEI---ARF--E
A0A0P6XM68      L-GVPVIGFIAELEH-------DQDKA-YVAENPRSPVSEAFRTLRTNLEF---AGV--D
A0A2N2MEG3      L-GLPVIGYIAELEH-------DQDKA-YVSENPRSPAAEAFRTLRTNLEF---ASV--D
A0A353RQ31      L-NIPVIGLIGELHK---KNKDDKLGN-YVVYHQRSPVAEAFRALRTNLEF---SSL--D
A0A3B9KNR2      L-NLPVIGLVGELRK---KSNNDKFGS-YVISNPRSPVAEAFRALRTNLEF---AGI--D
A0A0P6XME1      L-ELPVLGYINEING---KTPYEDYPP-HVIAQPRSLITEAFRSIRTNLEF---VEI--D
A0A3B9Q1T8      L-GQPVIGTIGDINSSLLKRGGKKSGV-HVANQPRSPIAEAFRSLRTKLEF---YNI--D
A0A2E5F6N9      T-GLTRIATILRWT----PKEIGAKEV-TLLSQPRSSHAEAFRQAKVNVQF---LSL--T
A0A2E6J6X7      F-GVSVLGMVFEWS----SKEVNENDL-IVDTSPKSSFAEAFKQIRTNLQF---AAT--K
A0A1F8RRT9      A-RLPTLGGVARFP----RRVSSRSGL-VVASTERSAAAEAYRVLRTNLQF---STL--D
A0A3M1EAN8      L-QIPTLATIPPLPAKSPLHRRRARSLPLSMLEPLSAYAEAYRTLRTNLRF---AGN--G
A0A363SX22      F-QAPLIGFIPVMS-----KAAAH-SL-YMVKLPQSVVAEAFRSLRTNLEF---ASV--D
A0A6I1QLV0      A-GATTLALVPRFR----QPRNRGRAP-VTEEWPHSALAETFRVMRTNLQF---ASM--D
A0A535FRM3      T-GQDALAVLPELS----RKQGGCNIK------DNPVLAESYRILSAHTSI---MQT--N
A0A401ZA55      L-GIDALTIIPELS----RKQRSRNAE------DTPELAEGCRILCANLNM---AQM--M
A0A4P6JS79      L-GVETLTVIPELS----RKQRIKNAE------DTPALAEGCRILCANLNR---VQG--A
A0A326UPN3      L-EADALTIIPELSKNQQGKNAED----------TPELAEGCRVLCSNIAT---AQT--Q
A0A455STY5      L-EADALTIIPELSKNQQGKNAED----------TPELAEGCRVLCSNIAT---AQT--Q
A0A535QK16      V-GLVPLGHIAFVL----AKPERR-GE-LVALGGDSPVVEAYKALRTNLLF---SSV--D
A0A3D0UNQ0      L-NLTPLGTIGQYG----NGKFQG-RM-IVSEDPRSPVAESYRIIRSNIQF---MFI--D
A0A2G6GG97      T-NLATLGAIAIIK----DHTIGS-GL-ITQNAPRDPISEAYRIIRTNLSF---STV--D
A0A6L7WZR1      T-GLASLGIVGVLNGGESHTPGAG--------NLAPPAAEAYRKIRTGIDL---WGL--A
A0A7C5QIC8      T-QVPTLATIPRFS---RSQSASK-AP-LMAAHPESAEAEAYRLLRANFQF---ATL--G
A0A1F8PTW9      F-SAPIIGHIFEQK----NGKKQH-HL-YDTADLRHPIAEAFRILRTNIEV---AEA--N
A0A1F8QH26      F-SAPVIGHIFEYK----DGKTGN-HL-VDLTDLQQPLSEAFRVLRTNIEL---SGS--D
A0A535D584      V-GVPVLGVIPSYSRDPKSGTQMR----------TAVADEAYRSLRTSLLF---AGV--D
A0A521TS25      T-GLHTLGAVALVPETDSIPGSDRLRL-VADTEAKSPVAESFRILRTNVEF---AQV--D
A0A7C2TBJ3      L-GLPILGYIAEVK-----DSKGV-WF-YVHKHPRSPISEAFRSLRANLDF---ASL--D
A0A7C3TYQ9      L-GLPTLGGVVDLG------ENDG-AA-IAVEQPKSVAVEAYRALRTNIQF---SSP--D
A9B6E3          V-NAPLLAAIVKQE--TKVTKASQ-RL-VSRLDPRSPTAETFRTLRTNLQF---SNV--D
A0A3M1H759      L-GLTPLGSIARIK----GKGYAD-RL-VTLHNPFSAASEAYRVLRSNIQF---MAG--E
A0A7C3J9I4      L-DVTALGSISRIK----GKNYRE-QL-VTAHTSFSPLTEAYRGLRTNIQF---MGV--D
A0A497ASN6      A-GLPVLGNIFEFE---ANPGSNS-NL-ITLEQPRSHTTESFMVLRANLEF---LNV--D
A0A3D1TRD4      L-QLPVLGLVQRNVGQAVVTVGAD-SV-AQDRHS----AEVFRVVRANLGF---ATA--S
A0A5C7JS64      I-GAPLMTTLPIVP---SMEKLPH-QL-FILDQPMSPESEAVRLLRANVEF---AIA--N
A0A7C5IJ97      S-HLPTLASVLRSA---HMGAQGE-EP-LVALRGKSPLAEGYRELRTNMQFLTKSDV--K
A0A7C3FJ85      V-EAPVLGRIWHEAEMDKLNGSGE-HG-VIINHPLSLGAEAYRLLRTNLQF---TSV--D
A0A3M1ZZ81      T-NLPTLGAIAFIK----GSAPNQ-RL-ITHHTPRDPISEAYRVLRTNLTF---SAV--D
A0A3C0XJG2      L-GVPALGEIPFAN---EQTLGAH-GL-FVRDAPASPEAEAFRAVRANLVL---AAL--D
A0A7C3NE64      L-GLMILGGISKIK----AKDHKD-KL-IAPKDPFSPTTEAFRRVRSNIQY---MAV--D
A0A7C4V0A1      L-GLGTLGAIPAMN------ENGN-EL-IVIDDPSSPIMEAFRKVRTNLWF---ASV--D
A0A6J4UI39      A-GVPMLSEIRVVP---KLAQGRD-QL-FVLNRPTSAASEAVRLLRTNLEF---AAA--S
A0A521IC37      L-QQTTLASVARIS---PIRKPGD-NL-ITLLHPRSPIAEEYRSLRTNLRY---SGI--E
A0A7C1K503      L-GLWTLAAIGRIE----GKTAQD-RL-VTLSAPRSPIAEAYRLLRTNFQF---AAV--D
A0A535IMD1      A-NVSALGVIARVS---DIKSPRD-AL-VTATRPNDPVSEAYRLLRTNLQF---SGV--K
A0A7C3FPG2      T-TLSTLGIIAKSK------GNDG-KL-IALEDPRSPIVEAYRTVRTGIQF---AGI--D
A0A3A0B2P8      L-ALPALGLVPKNH-----AAEGR-AG-LEGDDERAALNDAFSALRLNIQA---ALG--G
A0A497AF06      L-PLPTLGTIPRLQ----GKERNG-RL-VTLAMPVSPASEAYRALRTNIRF---ASV--D
A0A661W444      L-PLPTLGTIPRLQ----GKERNG-RL-VTLAMPVSPASEAYRALRTNIRF---ASV--D
A0A497BNC7      L-PVGVLGALPRLK----EMDGQI-AL-VVAEYPLQPIAEAFRSLRTSIQF---SSV--D
A0A7C6DKX5      L-GRPVLGSIGRIS---GPPSVPD-HL-VTLQDPMSSLSEAFRVLRTNLLF---MSV--G
A0A521UD91      T-KLPTLGVVGRIP-SIKNGTTAP-RV-LDDIAARSSLGESYRIVRANVDF---AWA--G
I0I8T2          T-GLTTLGVLPESN----VDSSER-PL-IMLSAPHTSDAEAFRVLRTNLLF---ASV--D
A0A3C0LJ76      T-GLTTLGTVPEIK----LDTASQ-GL-VMLQNPHSTDAEAIRVLRTNLLF---ASV--D
A0A7C7DWW4      T-GLTTLGTIPDVK----LDAASQ-GL-VMLQNPHSTDAEAIRVLRTNLLF---ASV--D
I4EI06          T-GKAPLGSIPVLV-------SAD-GV-ESLRAPHSPAAERYRSLRTALQF---ATL--G
A0A522N7L9      L-GLPTLGAIVQMR-ASGPRSEIY-HL-VALLYPRSPVTEAYRTLRTNVEF---ASV--D
A0A535W4H1      L-GLPTLGSIGRLR-GDRSVNEVY-RL-VTLVNPRSPAAEAYRSIRANVDF---TSV--D
A0A3D0D4X6      V-GLPILGQITELP--HEHSTPAQ-AV-ILANAPRSPLAEAYRMLRTNLQF---AMV--D
D1C8M3          T-GRPALGWIPRFR-------GPS-GI-ALVTAPRSPVSEGYRSLRTNLQF---ATL--G
D1CAL1          T-GRGALGLIPELR-------SPE-SI-EAIAHPDSVGSEAYRTARTNLQF---VAV--G
A0A7C4K810      L-GLPVLGLIARHE-------KDV-KV-ITVSQPRSPISEAYRSLRTNLQF---ASV--D
A0A7C5MIR7      T-RQAVLGSILRIK----GKGDAQ-KP-ILATLPNSAAAESYRVLSTNLEF---AVL--G
A0A7C5ARI8      T-QAPILGQIWASPALTGVSSNGN-RF-FV-EQARSPTAEAFRTLRANLYY---SSV--D
A0A7D6GA99      G-GVSTLGAIPRSRGDTPNNGEGR-PL-VTHLSPKAPTSEAYRVLRTNIQF---SSL--D
A0A1J4ZRV4      S-GLSTLGAIARLK----ETGGTR-QL-VAWLQTKAPESEAYRTLRTNIQF---SSV--D
A0A1V5RXW5      T-GLSTLGAIARLK----DAGSAR-ER-IAWLRTSAPESEAYRTLRTNIQF---SSV--D
                                                                            

A0A3A4VPK9      KP--IRTILVTSPEVSTGKTIISTNLAAIYAQ-KGEKVLLLDADLRRPRVHKTM-GITNH
A0A3D0CW53      NR--STTLLITSAALGEGKTTIAANLAVIMAM-AGKRVILVDGDLRRPSVHRFF-GIPNR
A0A535RWE5      RR--PRTILVTSALPLEGKSVVSANLALAFAQ-AGSPTVLIDADLRRPSQHRLF-GLDSS
A0A7C5A5U0      TP--MQVIQITSPEQGEGKSTIALNLAAIIAQ-GGKRALVLDADLRRPNLHRLC-GISNR
A0A0P6WSP2      NP--IRTLLISSPGMAEGKSVVTANLALALAR-LGLKILVVDADLRLPSLHRIF-GVDQE
A0A5C7JWY1      ML--PSRILITSPGENEGKTTLAVNLAMAMAQLEDTQVVLIDVDFRNKQIHPLY-DVGSS
A0A1F8QGH2      KP--LQSLLVTSPSSQEGKSIVLANLAAAMAG-SGQRIVVVDADLRLPRLHQVF-KLDGK
A0A1Q7TTL6      VA--PMVVTLTSPGAGDGKSFLAANLGHTFAE-AGHRTLLIDGDLRRGVLHRRL-GARRR
A0A0S8KFR9      RP--LKTLLITSAEPGAGKSTVLVNLAAAMAQ-AGQKVVVVDGDLRYPCLHEVF-ELPND
A0A535SLQ0      PG--PVVVAVTSPGSGDGKSFVSSNLALAFAH-ANHRTLLVDADLRRGALHRAL-QLRRE
A0A1F8SS27      QP--LKTILVTSCDKATGKSFISTNLAMILAH-SDREIILLDADLRNSNIHKMM-SIPNE
A0A2E0L5X9      DM--PHILTVVSYDSGEGKTLTTANLALESAQ-TGLRTLIIDGDMRRGDMHEIF-QLPNM
A0A3A0AXU8      GP--VHSLMVTSAGPGEGKTFVASNLAVVFAQ-EGRRTILVDLDLRKPQVGARF-GLRRE
A0A359HML3      T----KTIMISGSAISEGKSTIALNYAQIATQ-ANKKVVFVDGDLRKSKMKEAL-KLEQD
A0A3M1EJ46      VT--AETLLITSALPRAGKTTTVANLGVVMAQ-AGMKVLLIDTDLRAGNLHQVF-GVPDR
A0A0M8KAF3      SP--LHSLVVTSSEPGEGKTTTAANLALVMAQ-AGRKVVLVDADLRKPLVHRLF-QLSNA
A0A523V9H6      KP--LRTLQFTSAGPEEGKSLVLANLAVAMAQ-AGLKVILVDGDLRRPRQHALF-GLHLL
A0A2U2S5W9      KP--ARTLLVTSPSALEGKSVTSANLAVSMAQ-AGFKTVLVDADLRRPVQHKIF-GLSNQ
A0A7C3W344      KP--ARTLLVTSPGALEGKSVTSANLAVSMAQ-AGFKTVLVDADLRRPAQHKIF-GLPNQ
A0A7C1G8J6      GT--TRVLLVTSPASHDGKTLIAGNLAVSIAS-AGMRVVLVDTDLRIPMLHELF-DLPNT
A0A3D1U3H5      AA--NKVILMTSCGEGEGKTTTSMNVAMVMAE-IGRKVLLIDADLRRPHIHQVA-GIENR
A0A2N2MEK3      RP--PKTLLVTSSRPGEGKTTVASNLAAIFAQ-SGKRVVLVDADLRRPSVHRAL-GIPNR
A0A3B9J9U6      QP--PRTLLVTSSRPGEGKTTVASNLAAIFAQ-SGKRVVLVDADLRRPSVHRAL-GIPNR
A0A661VSD8      TS--LDTILVTSPEIGDGKSFTVANLGLTIAV-TGMRVVLVDADLRNPTLHEMF-DRPNV
A0A1W9UQ51      QP--YKVLLLTSPGASEGKSFVIANLAVVLAA-AGNRVIVVDADMRRPSLHELF-DRPNV
A0A497B563      QP--YKVLLLTSPGASEGKSFVIANLAVVLAA-AGNRVIVVDADMRRPSLHELF-DRPNV
A0A497C1E5      QP--YRVLLLTSPGAAEGKSFIIANLAVVLAS-AGNRVIVVDADMRRPSLHELF-DQPNV
A0A7C0TV81      HP--FKTLLLTSPGISEGKSFVLANLAVVLAA-AGNRVIVVDSDMRRPTLHEYL-DRPNA
A0A3D1JCW0      RP--LRRIIVTSPTPEDGKTTIVANLAVVLAQ-GGINTLLLDADLRRPRLHKIF-KCENK
A0A2N2MJJ0      NP--LKTILVTSAGPGEGKSTVACNLAGALAQ-AGKKVLLIDTDLRRPRIHQYL-GLGNR
A0A7C3QTG6      RT--LNKILVTSSGPGEGKTTISANLAAIIAQ-SGKSVLLIDADMRRPRIHSLF-GLSNR
A0A7C2TGF5      SP--SKSIVVTSPASGEGKSITAANLGVIMAQ-ADRKTIIVDADFRRPTLHQVF-NVNRE
A5V160          KP--LHTLLVTSSSPGEGKSTTAANLALAIAR-SGKRVILVDTDLRRPSLHRFF-RHANL
A0A2A6REI6      HA--FKTVLVTSGNQGEGKSITAANLAVVLAR-AGKRVLLVDADLRRPTTHTYF-AHHNL
A0A426TTK3      QP--LRTILVTSGNQGEGKSITAANLAVVLAR-AGKRVLLVDADLRRPTIHTYF-AHHNL
A0A3M1LAM5      RT--FRTLLVTSAAPQDGKTVAVANLGAAMAS-AGMRTVVVDADFRAPSLHESF-DLPNV
A0A536BZ00      GP--VKTILVSSAGQSEGKTTVSANLAIALGQ-AGRSTILVDADLRVPELHDYF-QLTND
A0A7C5LUL4      NS--AVAVLVTSAGPQEGKSTTVVNLGISLAQ-AGKRVLLVDTDLRRPTLHKQF-GLPND
E8N5M1          HP--LRVLLVTSPTPEDGKTTVAINLAVVIAQ-SGNRSVLIDADLRRPRIHKVL-GLDNR
A0A1F8U7F0      RP--IRRLLVTSAGPGEGKTTIAVNLAAIMAQ-GGKRVVLVDADLRRPKIHRFL-GLSNK
A7NIZ1          KP--LHTLLVTSSNPGEGKSTTAANLALAIAR-SGKRVILVDTDLRRPSLHRFF-RHANL
A0A0P6XM68      RP--IRSILVVSAHPGEGKSTVATNLAITMAQ-GGKKTLLIDADLRRPRVHQYL-NLPNR
A0A2N2MEG3      KP--IKTLLVVSAHPGEGKTTVATNLAVTIAQ-GGKRVLLIDADLRRPRVHHHL-GLNNR
A0A353RQ31      FS--LKSILVTSSGETEGKTTVACNLAIILAQ-GGNRVLLMDTDMRRPNVHVQF-NLHNR
A0A3B9KNR2      SP--LKSILVTSSGETEGKTTVACNLAVILAQ-GGKKVLLLDTDMRRPNVHTQF-NLHNR
A0A0P6XME1      RP--LKTLLVGSPSPDEGKTTIAVNLAIVIAQ-AGKRVLLIDTDMRRPQIHERL-RLPNR
A0A3B9Q1T8      QP--LKVLLVTSAGLEEGKTTVAANLAAIMAN-NNKNVLLIDADMRKPKIHTHL-GLSNR
A0A2E5F6N9      PP--PKRYLVTSPGPGVGKTTFSVHLATAIAQ-EGKNVILIDSDFRRPGVPPYF-SLSNQ
A0A2E6J6X7      SE--SRVYLTSSPGPGDGKSTLISNLAVAIAQ-TGKKVLIVDGDLRRPTLHRRFKNITRD
A0A1F8RRT9      ----AQALLVSSANPGEGKTTTVANLAVAIAQ-TGLRVIVIDSDLRRPALHRIF-GLSNG
A0A3M1EAN8      SP--PGALLITSALPGEGKTTVAANLGTVMAQ-AGRKVLLVDADLRHPDLHRLF-DVPNR
A0A363SX22      KP--LKTILVTSNGSSDGKSSIATNLAVAFAQ-SGKKVVLLDADLRRPSLHGFF-SIPNQ
A0A6I1QLV0      LQ--VKSLLVTSAHPGEGKTTTCANLAVAIAQ-TGRRVIVVDSDLRRPSLHLLF-SQPNR
A0A535FRM3      HP--FKLLMVTSAVAGEGKSTLATNLATFLAL-SDKRVLLVDADLRRSVLDQHF-QLDNH
A0A401ZA55      RP--FKLVMVTSPMAGEGKSTIAANMASFLAM-SGKRVLLVDADLRHPVLDQHF-QLNNQ
A0A4P6JS79      HP--FKLVMITSALAGEGKSTIAANLASFLAM-SGKRVLLVDADLRHPVLDQHF-QLDNR
A0A326UPN3      QP--FKLIMLTSALAGEGKSTIAANLATFLAM-SGKRVLLVDADLRNPVLDKHF-HINNQ
A0A455STY5      QP--FKLIMLTSALAGEGKSTIAANLATFLAM-SGKRVLLVDADLRNPVLDKHF-HINNQ
A0A535QK16      KE--VKTVVITSAVPDEGKSRTAANLAIVLAQ-AGHPTLLVDADFRRPSQHRMF-GKVRN
A0A3D0UNQ0      NP--GRAILVTSAVPGDGKSTTAVNLAIAMAH-NEKRTVIVDADLRNSELHEIF-GVSNS
A0A2G6GG97      KE--LKSYLVTSASPGEGKSTTAANLAVVLAQ-TGKKVVLIDADLRRPIQHKIF-NLPNN
A0A6L7WZR1      HP---IHLLVTSAGQGEGKSTTAANLATTFGQ-LDRRVVLVDADLRRPQLHQFF-GLRNT
A0A7C5QIC8      MGNSAITVVVSSAQPQEGKTTVAVNLSLSLAR-IGKQVLLVDTDLRRPTLHSQF-GLPND
A0A1F8PTW9      QP--LKTILVTSADIGDGKTSVATNLALFVAQ-RNKKVVLLDADLRSPNIHKYF-NLAND
A0A1F8QH26      RP--LKTILVTSADASDGKTFVAANLAMFMAQ-RRKKVVLVDADMRRPTIHEYF-NLDND
A0A535D584      RT--LRSVVVTSARVGEGKTRTAANLSAVLGA-AGSRVLLLDADMRRPGQHRLF-NHSAE
A0A521TS25      RA--CRKLMITSPSQGEGKSTIAVNFAAVVAQ-AGKRVLLVDCDLRRPSLHRTF-RWENQ
A0A7C2TBJ3      YP--LKSIFIASPDTAEGKTTVAINLAVTMGQ-VGKKVILVDADLRKPTVYKYP-GATTK
A0A7C3TYQ9      RP--PRTLLVTSPLSEEGKTTTVANLGAVFAR-AGASTVIVDADLRKPRQHRVF-KVDNR
A9B6E3          TK--ARTLIVTSSQPEEGKSTVAANLAWVLAQ-AGQKVVLIDADLRKPMMHRVF-EVSSE
A0A3M1H759      QP--PKTIMLTSTTPEEGKSLTAANLSVVMAQ-ADFKTILVDADLRKPSIHKIF-EISNS
A0A7C3J9I4      QP--AKSILITSSNPREGKSLTVANLGVAMAQ-AFLKTILVDTDLRQPSLHKIF-GLSNQ
A0A497ASN6      TP--LQVLGITSPGVGEGKSNVAANLALVMAR-GGKRVILIDADLRRPMIHSLT-GLAQS
A0A3D1TRD4      YR--SKILLVTSTQKAEGKTTTIAKLAVALAE-AGKRVVLVDADLRLSSLHRMF-KLDNR
A0A5C7JS64      TE--EKTLAVTSAGPGEGKSTIVANLAVAMAQ-AGYSVIVIDADMRRPAQHEAF-NLSNE
A0A7C5IJ97      AG--GQVLMITSSQPLEGKTTTLANLGVSLAR-IGRQVILVDADLRRPALHRPF-GLRNQ
A0A7C3FJ85      EP--LKAILVTSPSPGEGKSTVALNLALALEA-TGKRVILIDADMRRPKLCKYA-QVERE
A0A3M1ZZ81      SE--LHSLLITSSSPGEGKSTTTANLAVVMAQ-TGKQVILVDADLRRPTQHKIF-QLSNN
A0A3C0XJG2      RP--PRTIMVTSALSDEGKSLVAANLALAFAE-SGSLTVLVDADMRKPMQHLLY-GLDST
A0A7C3NE64      RP--IKSILITSPEPNVGKSTVVANLAVVMAQ-ANLRTIVIDADLRRPAIHKFF-NMSNL
A0A7C4V0A1      HP--LHTILVTSPSPVEGKSFISANLAAAIAQ-SGKRVILVDADLRRPRLHRLF-KIRPE
A0A6J4UI39      KE--ITVLLVSSAGPSEGKSTVTANLAAAIAG-SGLVTVVVDADLRRPTQHRIF-DIPND
A0A521IC37      NP--GGALLVTSANPSEGKTTTAANLAVAMAQ-SGKRVILLDADLRRPGIHPLF-GLSNQ
A0A7C1K503      RP--LRRIVVTSPGPGDGKSTTAANLAVVFAQ-SGKSVILVDADLRRPQQHRIF-QRTAS
A0A535IMD1      NP--AGSVLITSSSPGEGKSMTAANLAVSMAQ-SQKRIILVDTDLRRPSQHKIF-GMTNK
A0A7C3FPG2      KP--LRTLVVTSAEPGEGKSTVAANLAIVMAQ-AGSKVVLIDADLRKPTQHKRW-GLPNT
A0A3A0B2P8      DV--PKTLLVGSPAVGDGKSSVAANLALAFVE-AGYRALLVDADLRRPSLHRQF-NLPNQ
A0A497AF06      EP--LKTLLITSAEPKAGKTTVAANLGVVCAQ-AGLRVVLIDTDLRFPNLHQLF-DLNNH
A0A661W444      EP--LKTLLITSAEPKAGKTTVAANLGVVCAQ-AGLRVVLIDTDLRFPNLHQLF-DLNNH
A0A497BNC7      HP--AKTLLVTSPLPTEGKTFTSANLAAVMAQ-GGQSVILVDADLRHPRVHRAF-DVSRE
A0A7C6DKX5      NN--ADCVLVTSAVLGEGKTTVACNLAAAMAL-AGKQVILVDADLRRPNVHGFF-GVGND
A0A521UD91      QP--GQLVMFTSTNPGEGKSTTLGNLATVFAK-DSRTIIMVDCDLRRPSLHRAF-AMQGD
I0I8T2          RG--LGALVVTSPTPGEGKSFVSSNLAIAFAQ-TGQRVILVDADLRKPTLHRAF-GLVNN
A0A3C0LJ76      HK--LSSLLVTSPTPGEGKSFISSNLAVAFAQ-TGKRVILVDADLRKPTLHRVF-GLVNN
A0A7C7DWW4      HK--LSSLLVTSPTPGEGKSFISSNLAVAFAQ-TGKRVILLDADLRKPTLHRVF-GLVNN
I4EI06          QP--IRSLVITSPRPGDGKTATATNLGAVLAQ-AGQRVILVDADLRKPQLHTHFAGVKNR
A0A522N7L9      AP--VRTLLVTSSVPGEGKTTTAANLAVTFAQ-AGRRVLLVDADLRKPGLHRIL-DLPNQ
A0A535W4H1      RP--IRTLLVASATASEGKTVTAGNLALVFAQ-AGRRVLLIDADLRRPGVHTIF-RATNA
A0A3D0D4X6      RP--LHILVVTSPGPREGKSVTSANLAVAVAQ-TGARVILVDADLRRPSQHTLF-TLPNQ
D1C8M3          QE--VRSILVTSARPGDGKTTTVVNLGAVLAQ-GGQQVIVVDADLRRPRLHAALGNVPNR
D1CAL1          QS--LRSFVVTSPRPGDGKTTTAVNLAAVLAQ-GGQRVILVDADLRRPQVHRYFAGLNTR
A0A7C4K810      RP--LNTLVVTSPSPGEGKSSVVANLGVVMAQ-SGKRVVLVDADLRRPYLHRLL-DLNNR
A0A7C5MIR7      AGGLPALLLVTSTQPMEGKTTTLANLGVSLAK-AGQRVLLVDGDLRHPALHKQF-DLPNN
A0A7C5ARI8      QP--LRRLLITSPLPEEGKTIVAVNLAVALAL-TGRRVILVDADLRKPAVGRYT-GRSRE
A0A7D6GA99      RP--IHTLLVTSANPGEGKSTTASNLAAVMAQ-TGQRVVLVDTDLRRPVIHRVF-GVPNA
A0A1J4ZRV4      KP--VRSLLVTSAGPSEGKSTTAANLAVVMAQ-TGQRVVLVDTDLRRPVMHKVF-GVANN
A0A1V5RXW5      NP--VRRLLVTSSSPGEGKSTTAANLGVVLAQ-TGQRVILVDTDLRRPTLHKVF-GIPNN
                           .     **:    : .           :.:* *:*              

A0A3A4VPK9      I----GLTDLLRGS-----HDLQDVIQKMDGAENLTIVSSGSL-----PPNPAELLGSAR
A0A3D0CW53      L----GLTNLLVDE----ALALETVLMETPV-AGLKIIPSGPV-----PPNPAELLSSER
A0A535RWE5      K----GLTTLLTA------DDPLGRLDAFSVAPNLHVVPSGPL-----PPDPAEFLSSAR
A0A7C5A5U0      V----GISDLFRHT-----MDAKSAIRPWDGNEKLLLLTSGSL-----PPNPTELLGSSK
A0A0P6WSP2      N----GLSEALVS------GKGTDHLKT-TKEAGVKIMTSGSL-----PPNPSELLNSKK
A0A5C7JWY1      EEPPKGLGHLLRGE-----ANLADVVHQ-TFVSNLSVIPHGGR-----PTNPTELLHSKS
A0A1F8QGH2      E----GLTDSLIN------SSLDGNLQA-TKMDGLKVITSGKL-----PSNPVEVIGSAH
A0A1Q7TTL6      P----GVSDFLRGE-----VPLEAIVQA-TPYPSFSLIGCGTR-----AYNAPELLGSQA
A0A0S8KFR9      M----GLSNVLSDL-----RRMSTALQE-TNIEGVRVLTSGPV-----PPNPAEPPPLSK
A0A535SLQ0      P----GLTDLLVAK-----ASPEQVLQA-TTHPSLDFLASGSR-----RGDAPELLGSAR
A0A1F8SS27      Y----GLSDILRNGMNVSQALRNYDGVNGGV------ITGGTV-----APNPFELLGSKK
A0A2E0L5X9      Y----GLGDILQSNEPLANLLPNVLLDSGYE--NLNIIPAGRS-----EADPAALLGRTR
A0A3A0AXU8      P----GFSNLVVDR----ELAVEHCLQATAI-PHLLVIAAGTI-----PPHPSELLGSVR
A0A359HML3      T----GLSTLLNSPAKLKDVVFTLDQ-------RLTIIPSGSC-----PPNPTELLGSEK
A0A3M1EJ46      P----GLTDLLLSNAVPDESMLLKTEVL-----NLYLLPSGPL-----PPTPSELLSSDR
A0A0M8KAF3      Q----GLTSALMHP-EIAVDRFLQRVDAGGGQ-TLWVLPSGPL-----PPNPAEVVGSRR
A0A523V9H6      G----GLTSSLLQ---GSTDGRLQPAEQ--VE-GLSLLSAGKS-----PPNPAQILSSQR
A0A2U2S5W9      Q----GLTNALLQPGEPSADGHLQSTE---IE-NLRVLTSGPI-----PPNPSELLGSAK
A0A7C3W344      Q----GLTNALLQPGEPTADGHLQATE---IE-NLRVLTSGPI-----PPNPSELLGSAR
A0A7C1G8J6      R----GLTELLSADQPDPFALEEV-LLPTHVP-NLMLLPAGRP-----PLDPMTLLASPR
A0A3D1U3H5      G----GLTALLLGMDGGDIMTSTV---QSEADPHLYFLPSGPI-----PPNPTALLSSQR
A0A2N2MEK3      L----GLTTLFRDSLK----LESVWKHSNGISRGMLVITSGSL-----PANPSELLGSEK
A0A3B9J9U6      L----GLTTLFRDSLK----LESVWKHSNGISRGMLVITSGSL-----PANPSELLGSEK
A0A661VSD8      M----GLSELLSGDSPISESRPPMELQPTGVD-NLFLLSSGRP-----PTDPAALLVSPR
A0A1W9UQ51      T----GLADVLSDHKVDDEGLLSVPLLETDFD-NLYLLPAGRP-----PADPATLLTSPR
A0A497B563      T----GLADVLSDHKVDDEGLLSVPLLETDFD-NLYLLPAGRP-----PADPATLLTSPR
A0A497C1E5      I----GLADVLGDHKVDND-FSSIPLQETGFD-NLLLLPAGRP-----PVDPATLLTSPR
A0A7C0TV81      I----GLADVL-RHANTVD-AQVIPLQETDYD-GLMLLTAGRP-----PVDPATLLTSPR
A0A3D1JCW0      L----GLSSLFVQP----MDGLEKVIVHSQRTEGLHLITSGGT-----PPNPAELLGSQK
A0A2N2MJJ0      F----GLSDLFLSH---GKLADVTQVYEGPNNTHFEVVTTGAI-----PPNPGELLSSER
A0A7C3QTG6      V----GLSA-LFRG----NTSVRSVMKPVDGVDGVYVITSGTL-----PPNPTELLASGR
A0A7C2TGF5      S----GLGDMLISK----RSEFDGYLKGTRI-ENLQIITNGRP-----LLNSSELLGSGR
A5V160          R----GVTTALVRD---PSDSLYNHMIATGL-ENLLVLPSGPV-----PSDPAVMVSSKK
A0A2A6REI6      R----GLTTALVRE---GDTPVDFHLHSTKL-NNLLLMPSGPL-----PSDPAAMLSSPQ
A0A426TTK3      R----GLTTALVRE---GDTPVDFHLHSTKL-SNLLLMPSGPL-----PSDPAAVLSSPK
A0A3M1LAM5      L----GLAELLSAGRDEYQALLDKALLETNV-ERLTLLPAGRP-----PLDPTMLLTSPR
A0A536BZ00      Q----GLTSLLRDE----TLPVSAVARETEE-PRLRVVTSGPV-----PPNPAELLGSQR
A0A7C5LUL4      V----GLTSLYLSE-----MPLEEAVRQTEI-PGLRVLTSGPI-----PANPAEVLSFPQ
E8N5M1          Q----GLSGLFIQN----PTMLNGALQQTRL-ETLKVLPSGGT-----PPTPSELLGSRK
A0A1F8U7F0      V----GLSD-LFRG----VVAVRMVSQQVQDVETVSVLTSGSL-----PPNPTELLASVR
A7NIZ1          R----GVTTALVRD----PSDSLYNHMIAAGEENLLVLPSGPV-----PSDPAVMVSSKR
A0A0P6XM68      V----GLSN-LFRD----AKSLHEVMGQWKE-TTLQVITSGGL-----PPNPTDLLASDR
A0A2N2MEG3      V----GLSN-LFRD----SIAIGDVAHAWQD-SNLSVITSGGV-----PPNPADLLASER
A0A353RQ31      I----GLSD-LVRG----KLSLHEVVRSIPEVKNMDIITSGSL-----PPNPAELLASER
A0A3B9KNR2      V----GLSD-LVRG----RLTLEEVVRTIPEVKSMDIITSGSL-----PPNPAELLASER
A0A0P6XME1      F----GLSD-ILRE----HGSLDESLHHLAT-EGIDVITSGIL-----PPNPAEVLSSER
A0A3B9Q1T8      Y----GLSD-LILG----RSA-SVVQRAGSN-KKFSVVTSGSI-----PPNPSELLASEK
A0A2E5F6N9      M----GLSSLLANP--ELQ--LEDLLQSTA-IPTLKVLTAGPN-----PPNSVELLGSSR
A0A2E6J6X7      T----GLSNYLSDN--TET--LGAVTQTSG-VSGVDVITSGPI-----PPNPSELLNSPR
A0A1F8RRT9      A----GLTNALLSR--QPE--IQRFLQPTA-FEGLSVLTSGPL-----PPNPSELLSSRR
A0A3M1EAN8      R----GVADLLLNG--QLP--DETWLVETS-QPRLYLLPGGPFTADPRSPTPAELFDATR
A0A363SX22      T----GISDII-----RGQVSLEEAIYRSA-KGGVALILAGPL-----PPNPAEMLGSKK
A0A6I1QLV0      Q----GLTNQLLLG--EGGITRFL--RATE-VEGITFLPAGLL-----PPNPAELLGSPR
A0A535FRM3      H----GLADTLLTP--WEQIKTALEGQLTE-VPALRVLTSGAY-----SSNPAELLQSPL
A0A401ZA55      K----GLSNAFLGI--WNQVETELDGQPTE-IPSLRVLTAGVL-----PSNPSELLQSQL
A0A4P6JS79      Q----GLSNAFLEM--WTQVQPQMEGQPTE-LPSLRVLTAGVL-----PSNPSELLQSPL
A0A326UPN3      N----GLAQILMGV--WGNNEMALDGIPTE-IPTLRLMPAGTR-----PQNPAELLISDT
A0A455STY5      N----GLAQILMGV--WGNNEMALDGIPTE-IPTLRLMPAGTR-----PQNPAELLISDT
A0A535QK16      V----GLSNLIVQD-MPES----ALFVPDEQVKDLVILASGAT-----PPNPSEVLGSAH
A0A3D0UNQ0      N----GLTEQLRQP--ESQ--KKIHLFDTK-VEGLQLLTAGEP-----PPNPSELLGSQR
A0A2G6GG97      M----GLTTSILDG--RTP--VTAHLQQTK-ISNLGLLTSGPI-----PPNPSELLNSRR
A0A6L7WZR1      R----GLSSLLVNP--KAD--TAATLRPTA-FPNVSLVAAGAS-----PPNAAELLASAR
A0A7C5QIC8      A----GLTSLFLEE--DPH--PEEFIRDTG-VTGLRLLTSGPI-----PANPAELLEYPH
A0A1F8PTW9      R----GLVDLISNG-AT----SNDVLRVIE-DGKLTILTSGNT-----PPNPTELLSSNK
A0A1F8QH26      K----GLTDFFSKN-AS----ISDVLRIGE-NRKLGVITAGKP-----NPHPAEFLSSNK
A0A535D584      P----GLSELLLTV-ATTGQPPNLSGAQKTRFTNLSLMTAGMT-----PPNPSELLASRA
A0A521TS25      Q----GLTNLLVRG--TID--WHAVTRQSA-IPNLSVILSGPV-----PPNPSELLGSSR
A0A7C2TBJ3      I----GLKNVLVDD-LD----LREALRPLG-DHNISILPSGNR-----TARSAELLSSEK
A0A7C3TYQ9      L----GLTTMLVSE-DITR--MNGSLKESG-IPNLKVLASGPR-----PPNPSELLSSER
A9B6E3          Y----GLTNLLTNN--EDPTIRERTVLSVA--ENLWLIPSGPL-----PPNPSELLSSKR
A0A3M1H759      Q----GLSDLISNP--DME--PEAVLQDTT-VKNLRVLTSGPL-----PPNPAEKLSSQR
A0A7C3J9I4      K----GITDLICTP--ELQ--VEDCLQDTG-IENLYVITSGPL-----PPNPSEMLGSRR
A0A497ASN6      P----GLSEALVEK--EIP--LEEYLQTIG-IENLRILTSGRR-----PPNPADLLASRR
A0A3D1TRD4      R----GLSNLLVDP-VASPAELLPYLQQTP-LPTLRVLTAGVM-----PPNPTELLQSEN
A0A5C7JS64      R----GLSTLLARS--DVD--WNSVARSNA-ELKLQVITSGPI-----PPNPGDLLKSPR
A0A7C5IJ97      M----GLTTLLMKR--KAD--PNEAIQETS-VKGLRVLTAGPI-----PANPAELLDSPE
A0A7C3FJ85      P----GLSETLASP--EMD--WQRYLQPLPMQPEIQLLPPGHS-----PPNPTELLGSRR
A0A3M1ZZ81      Q----GLTTAILDS--LTP--VSYHLQKTR-VPGLRVMTSGPI-----PPNPAELLNSHR
A0A3C0XJG2      V----GLADLLRET--VPL----ADIRKFEVMPNLIVLPTGRP-----PLNPAEPLSSTK
A0A7C3NE64      E----GLTDLLCLP--AIE--INGELRETG-IDNLRIITSGPL-----PPNPSELLGSQK
A0A7C4V0A1      S----GLTQSLLDG--N----LQHHLLESP-VENLLLLPAGPL-----PPNPTELLASQR
A0A6J4UI39      R----GLTSLLTHP--QQP--WNWAAAEVI-PGRLFVVPSGPQ-----PPNPSDLLSTER
A0A521IC37      M----GLMTLFWEE--TPR--VEEVMQTTD-VPGLRVIAAGEP-----PPNPAEILDSKR
A0A7C1K503      Y----GLSTALVDA--ATP--VTSFLQPTD-VPGLRLLTSGPI-----PPNPAELLGSQR
A0A535IMD1      R----GVTSLMLDE--TLA--LDDVLQTTD-LENLRVLTSGPL-----PPNPAEVLNSTQ
A0A7C3FPG2      V----GLTGALLMD--ELSENMESLLTPTL-VDNLWLLTSGQL-----PHNPSELLGSHK
A0A3A0B2P8      R----GLTTLLLGE--EHN--LELLIQQPA-QQRLSLLTSGPL-----PPNPTRLLSRKE
A0A497AF06      T----GLTDLLVGN--ARS--VKECMMETG-IDNLRVITSGPI-----PPNPSELLGSKR
A0A661W444      T----GLTDLLVGN--ARS--VKECMMETG-IDNLRVITSGPI-----PPNPSELLGSKR
A0A497BNC7      P----GLTAALLSP--DG---WEQALRPTE-IAGLQIVTSGSS-----PPNPAELLASER
A0A7C6DKX5      V----GLCSLLLDD--ALT--VDEAATQTT-LSGLRILPSGPL-----PPNPGELLASAR
A0A521UD91      R----GLTNLLADH--RAK--LDDYLVPTK-QPNLWLLPSGPI-----PPNPSELLGSNR
I0I8T2          V----GVTSALVSN--LDE--FTAALQQTI-VPELRVMTSGPL-----PPNPSELLSSRR
A0A3C0LJ76      I----GVTSALVSD--AAD--VEAALQATA-TPELRVMTSGPL-----PPNPSELLSSHK
A0A7C7DWW4      I----GVTSALVSD--GAD--VEAALQTTA-TPELRVMTSGPL-----PPNPSELLSSHK
I4EI06          A----GLTNLLLAQ--PGDGLADALLQPTE-IPGLRVLTTGPL-----PPNPADVLNLPR
A0A522N7L9      H----GLTTLLGTD--QVG--LESLIQGTE-QDGLAVLTTGPL-----PANPAELLASQR
A0A535W4H1      R----GVTSLVLDP--NLD--PARVVQMTE-QGHLTILTSGPL-----PPNPAEILGSHR
A0A3D0D4X6      T----GLTSAIVSD--EVD--LQALLKPTT-MSGLSVMTSGPI-----PPNPAELLNSER
D1C8M3          F----GLTNLLLAD--DEV-DLAALLQETD-VPGLRVLTTGPL-----PPNPTDVLDSPR
D1CAL1          S----GLSNLLLSE--WDV-KLTPTLRQTT-IAGLTVLPAGPL-----PPNPLDLLSSPR
A0A7C4K810      K----GISTLIVQP--KLN--LDGSLLQTA-VSNLWMLPAGDV-----PPNPSELLGSAK
A0A7C5MIR7      V----GLTSLLLHP--TMD--LQESIQDTG-IERLRVLTAGPV-----PANPGEVVRLAQ
A0A7C5ARI8      R----GLSEALFDD--LER--LPSYLQPVEGVENLRVLPAGSI-----PPNPNELLGSRR
A0A7D6GA99      V----GLTTALLVN--PDTEMLEGLLQPTQ-VKGLXVLTSGPL-----PPNPSELLGSHR
A0A1J4ZRV4      T----GLTSALLNG--EQV-VLDGHLQGTE-VENLSLLTSGPI-----PPNPSELLGSHR
A0A1V5RXW5      T----GLTTALLAS--QDT-PIMEQLQPTE-VPDLHILTSGPI-----PPNPSELLGSQR
                     *.                              :  *          .        

A0A3A4VPK9      MEQILL-ELGNKY--N--IIVIDSPPSI-VADSQILSSKVDAVLLVIQPGKTSKEAAKAT
A0A3D0CW53      MKQRGN-EMKELA--D--VIIFDSPPALVVTDATILGTLSSGIVYVVNAGRTRSGVVRRG
A0A535RWE5      MSTLLE-LLAKRAPNA--TVIVDTSPTLAVTDAIALSAKVDACLVVVDAARTRTGSAIRT
A0A7C5A5U0      MKDILT-DLCQQV--N--VVIVDSPPNI-VADSAVLASAVDGVILVVTLGRTRQDALRLA
A0A0P6WSP2      LTILLE-KLSQQA--D--LVLVDSPPILSVADSIILAGELDGTMLVARSGMTTRKMLREA
A0A5C7JWY1      MTQLLN-WGTTNR--Y--HIILDCPPVLPIADAAVLASKVDGVLLVVSAGETTRDACHLA
A0A1F8QGH2      MRIFLK-EFEEKT--D--LVIIDSPPVLPVADAAILTSLVDRVILVLRAGQTRHRAAQQA
A0A1Q7TTL6      MSQLFT-TLRPNY--D--VILVDSPPLSAGVDPLILGTLTGHLVVVLRTGFSHRDVAAAK
A0A0S8KFR9      LPQLLG-KLAKEA--D--LVLLDSPPILAIADAATMASMVDGVLLVAAKDQATGRRVQRA
A0A535SLQ0      MADFMT-RLRSSY--G--VIVVDTPPLGAGVDAFVLASLAGCLLMVLRLGKTDRELAEVK
A0A1F8SS27      MDEILA-KLKK-S--D--YVIIDSPPLF-VSDSMVLSPKVDGVLLVAELSQTKKKQIRRT
A0A2E0L5X9      LNNLID-LLSKRY--D--AIFIDAVPTIGGSDSVFLGEISDGVIIIVNARRTRLSSLRRS
A0A3A0AXU8      AGEVIE-QIKALA--D--MVIFDTAPAATVTDALLVVPHMDGALQVVDAGSTRRDLALRC
A0A359HML3      MDRILT-HIKGMA--D--LIVVDSPPLFVT-DAAVLAKKVDGILLVVQLGKSRRDTVKEM
A0A3M1EJ46      MVSLIE-HFRGRV--D--VLLMDSPPVLAVTDAAILASLVDGVLLVIESGRTSKGEAQRA
A0A0M8KAF3      MQELLD-ELMTFA--D--IVILDTPPVLVVADPALLARMSDGVLLVTRMNVTHRQALQRA
A0A523V9H6      LRELID-ELAQKA--D--VVLVDSPPVLPVADAAALAQAVDGVVLVVDAGATRRGAAQQA
A0A2U2S5W9      MQALLQ-RLKEEY--E--VVIFDSPPALVVTDASVLATRVDGVVIVTDSGHTRRDTVVRA
A0A7C3W344      MQALLQ-RLKEEN--D--VVIFDSPPALVVTDASVLATRVDGVVMVTDSGRTRRDMVVRA
A0A7C1G8J6      LPALLD-GLRERA--D--LIILDSPPVATMPDALILDALADATLLVVTAGGTSRRLLQAA
A0A3D1U3H5      MRDLLH-AFKQSF--D--TIIVDSPPLLAVTDSAVLSTMADRVVLVADPRKATRHTLLRA
A0A2N2MEK3      MLHILA-ELRQKA--D--IIIFDGPPMMVA-DAQILASLMDGVLLVLQPG---KSPADEA
A0A3B9J9U6      MLHILA-ELRQKA--D--VIIFDGPPMMVS-DAQILASLMDGVLLVLQPG---KSPADEA
A0A661VSD8      LPALLD-TLEKFA--D--VVILDSPPALIAPDAAILASIADGTLLVVSEGQTSNGAAAKA
A0A1W9UQ51      LFALLD-SLGSQM--D--MVLIDSPPVLGPPDAMILATLVEGTVLVVSAGVTRRETIQQA
A0A497B563      LFALLD-SLGSQM--D--MVLIDSPPVLGPPDAMILATLVEGTVLVVSAGVTRRETIQQA
A0A497C1E5      FPALLQ-FLKGQG--D--VLLIDSPPVLGPPDATVMATLVEGTILVASVGLTRREAVRQA
A0A7C0TV81      FQNLLA-VLSQQS--D--VVLVDSPPVIGPPDATVIATLVEGTILVASVGQSRRELIEQA
A0A3D1JCW0      MKEILN-RLSQSF--D--TLLLDTPPVLTVTDTVALSKAVDGILIVVRLGKTKRGEFLQA
A0A2N2MJJ0      MKTLLA-EAVKNS--E--IVILDSAPSL-VADSQSVSASADGIIIVVEAGGTRAEPVRAM
A0A7C3QTG6      MDQILQ-EASREV--D--MIIVDSPPSL-VADFQVLATKLDGVVLVIQPGHTHADAAFAT
A0A7C2TGF5      MSGIIK-YLEGIA--D--VIIFDSPPALLAADATILSNLADGVILVIRAGKSRCKAIRQT
A5V160          MLDLID-ELKRMA--D--VVVFDSPPILAVADAIPLAHICDATLLVVLAGATRTSQLRRA
A0A2A6REI6      LVELIE-ELKTQV--D--VLVFDSPPLLQVADASMLMQLCDTVVLVATDGKTRTSALRHS
A0A426TTK3      LVELVE-ALKAKV--D--ILVFDSPPLLQVADAALLMQLCDTVVLVATDGKTRTSALRHS
A0A3M1LAM5      FPELLD-LLLERF--D--AIVMDSPPVLLAPDAVILATRADGTVMVVSAEHTSRQAARRA
A0A536BZ00      MRGVIE-RLKNAA--D--VIVFDSPPLSAVTDAAILASAVDGTLLVVDAHRTRRDLARGG
A0A7C5LUL4      TEQFLQ-RLRASA--D--YLLLDSPPVLSVADASILAQRVDGVVVVAEMGRTRAGAFKDV
E8N5M1          MKEILD-SVASEA--E--MIVVDTPPVLSVTDAAVLSPLVDGVLLVVKMGTTKQSALLQA
A0A1F8U7F0      MEQILQ-EAEQDA--D--IVIIDSPPSL-VADVQVLAGKVDGVILIIHPGHTQEDASLAT
A7NIZ1          MLDLID-ELKRIA--D--VVVFDSPPILAVADAMPLAHVCDATLLVVLAGVTRTSQLRRA
A0A0P6XM68      MAAVLQ-SALEEA--D--VVVVDAPPFL-VADASILASRVDGVLFVIHPGRTPVDAAQAT
A0A2N2MEG3      MAAILE-SANKLF--D--MVIVDAPPFL-VADASILAARADGVVLVIRPGKTPLDAAMTT
A0A353RQ31      MRNLLD-ELKKSY--D--VIVLDSPPLI-VSDSQILATRVEGVLYVIVPGSTRIESAKRP
A0A3B9KNR2      MRKLLE-ELKSHY--D--VIVMDSPPLV-VSDSQILSTRVEGVLYVIIPGFTRIDSARRP
A0A0P6XME1      MAKLME-EVAQRY--D--KVILDGPPFL-ISDAIVLASRVDGVLLVLRARNTSQSVALEV
A0A3B9Q1T8      FTRIID-KVSQQF--D--MVVIDSPPGF-VTDAQILGTKVDGVIFVIRAGKTRANIARMS
A0A2E5F6N9      MEAIMD-EVAARG--D--ILVIDSAPIMAVTDSSILASKQIETVLLVDP-NTRMGWLKDC
A0A2E6J6X7      MKDGIE-KAKDIY--D--IILVDCPPVLMVADTPIISTVVDMAILVVDSFTTKTSSFGAT
A0A1F8RRT9      MDAIVD-AARKEA--E--ILLFDSPPALAVADASILAGKVDGAILVVDTGRTRAHALQRA
A0A3M1EAN8      LQALLD-HLRFLA--E--VIIVDSSPVLEVPDGLELAALVDGVLLAMQNGRSGRYEVQDA
A0A363SX22      MENILA-SLEEIA--D--VVILDSAPLL-VADAWALSAKVDGVVLVVEPGRLKRKTAQAI
A0A6I1QLV0      MGRLLD-ELTATG--AM--VLLDSPPLLSVADAAILAAQTDGVILVVDAGKTRHEAVRRA
A0A535FRM3      AQELFNKHFREMD--QFDYIIFDTPPLLPVADAQIMASYMDATLLVIDATIASRKQILQA
A0A401ZA55      ASQLFN-HFRNSQ--KFDYIIFDTPPLLPIADAQIMAAYMQVTIMVVNASRTPRKAMVRA
A0A4P6JS79      AQQLFK-HFRESK--QFDYIIFDTPPLLPIADAQILASYVDVSVLVVDASKTARSLLTRT
A0A326UPN3      ARRLFK-HYQDTN--RFDYVIFDTPPLLPVADAQIVASYAEVSVLVVAASRSPRRLLNRA
A0A455STY5      ARRLFK-HYQDTN--RFDYVIFDTPPLLPVADAQIVASYAEVSVLVVAASRSPRRLLNRA
A0A535QK16      MKALLA-RFRKGF--D--YVVIDTPPVNAVTDASVLAAGVDAAILVIDTNKATYPAVQHA
A0A3D0UNQ0      MVKLVD-TLNSEA--D--VVIFDSPPAAYVTDAAILSRLVDGVVLVISAGKTRRDEARQA
A0A2G6GG97      MQDVLK-ELEDNS--D--LVIFDTPPVLTVADASIIGPQVNGVLLVINTGRTRQEAFINA
A0A6L7WZR1      TREVLA-ELGDLA--D--VVIVDSPPVLGVSDPVILAAQGGAVLLVALAGVTRPGALLRA
A0A7C5QIC8      FATILA-RLQKLA--D--YLILDSPPVLSVADAGILARKAGAVLLVAQPGKTRSDALKES
A0A1F8PTW9      MDQLLS-KLKEIY--D--IVIIDSPPFI-IADTMILASKVDGVLLVVRPGHTRQPLAQVT
A0A1F8QH26      MNQFLS-KLKTVV--D--YIIIDSPPFI-ISDAMILAAKVDGLLLVVRPGHTRQPLAKVT
A0A535D584      AELTLR-WLEHSY--D--IVVIDTPPVDAVTDALPLAAEASATVVVIEAGATGARQLQRA
A0A521TS25      FASVID-ELASEF--D--LVILDTPPTIAVSDPMVMAPVADGVIVVVDAGRTSADLLRRT
A0A7C2TBJ3      MDQVLI-SLEGLC--D--ALIIDGPPFF-ISDAVILSAKVDGVLIVIRPGHTREDVARSM
A0A7C3TYQ9      MEAMIA-QLRKAA--D--IVLLDTPPCLAVSDAAVLASKVDGILLVLEAGKTRREAAIRA
A9B6E3          MEMLIW-LLQQEY--D--WILFDTPPILTVTDPIALIPRVDGVVLVAEAKRTRRDMLAKC
A0A3M1H759      MSQLVH-LLEETA--D--VVIFDTTPVMAVTDAAVLANRVDGVILVIRSGRIPRATLKKA
A0A7C3J9I4      MVTLLQ-QLKERA--D--VVIFDSPPVLAVTDAVAFSKQVDSVILVIQAKRTRRSMAHQA
A0A497ASN6      MGELIA-HFKSLC--D--MVIVDSPPLLAVADTIFLGKWLDGILVIAEWGRTDRSAFVES
A0A3D1TRD4      MATLLA-MLAELA--D--VVLIDSPPVLAVADAMTIAPNVQGILFIIESGSIRLGRLNEA
A0A5C7JS64      FGALLE-TLSSEA--D--LVIVDTPPALAVSDALVVADVAKDVLLVCRANETRVDRLQAA
A0A7C5IJ97      TPAIIE-ELRGLA--D--YVLIDTPPALSVTDASILAQKVDGVLLVAEMGRVRSDVFWHA
A0A7C3FJ85      MEELLA-HFRERE--D-VIVIVDSPPVLVAADATILSAKVDGVLLVVEVGSTARQAIAYT
A0A3M1ZZ81      MKQVLE-ALQQEA--D--LIIFDTPPVLTVADAAILAPRVNGCVVVAEAGSTRRPLFLQA
A0A3C0XJG2      MLSLIL-SLSQLA--DAATVVIDTSPVLAVADAHALSTMVDGCVVVVDSARTPARASRRA
A0A7C3NE64      MAHLLQ-HLEEIA--D--VIIFDSPPTLAVTDAAALATQVDGVILVTRAGRTRRSSAQQA
A0A7C4V0A1      MADALD-ELGRLA--D--VVVVDTVPVLPLADALVLAPKADGVVLVMEAGKTRRAAARQA
A0A6J4UI39      MRRLLA-DMRSTA--D--LVIVDTPPLLAAADALVLAPHTDGVVLLCRAGATRREALKRA
A0A521IC37      MTEILV-ELRSQA--D--MVVVDSPPLLVVADANILASRCSGAIIVMDSGRTRTDAARKV
A0A7C1K503      MAQLLQ-VLSQEA--E--MVILDSPPVLSVADAAILANAADGVVLVADASRTRREMARRA
A0A535IMD1      MLSIIN-QLKDCS--D--MVIFDSPPVLAVADALILSGKLNSTLLVVDSGKTRADAVRRS
A0A7C3FPG2      LKELVE-FLLNDH--D--LLIFDSPPALAVTDPVVLGRSMDGVIVVIDAGTTREPALVHV
A0A3A0B2P8      LRGVLA-EMAQKF--D--IVLLDTPPLTATVDASILATHVEAMLLVVAAGRTQRTPTQRV
A0A497AF06      MEAVLA-EVKQSA--E--LVILDTPPMLAVTDAVVLASKASGVILLIEAKRTSHEAARRA
A0A661W444      MEAVLA-EVKQSA--E--LVILDTPPMLAVTDAVVLASKASGVILLIEAKRTSHEAARRA
A0A497BNC7      MREFVS-WLAEQA--D--VVILDSPPVLAVTDAAVLSTLADGTMLVFDCGETRKPAAVQA
A0A7C6DKX5      MKTRLE-QIRASA--Q--IVIVDGPPALLLADASVLGRLCDGLVFVARAGRTRAEGVRQA
A0A521UD91      MLAILD-ELRQRA--D--MVFIDTPPLLAVADPALLATRADGVILIVEAGGARVQSIVRA
I0I8T2          MQELLD-RLRSDC--D--LLVIDSPPVTVVSDTAALASRTDGVLLVFSREKMNRDLAHKT
A0A3C0LJ76      MQELLT-HLQSLC--D--VVIIDSPPVLVVSDTAVLASRADGVLLAFTHEKLRRDPARNT
A0A7C7DWW4      MQELLL-HLQSLC--D--LVIIDSPPVLVVSDTAVLASHADGVLLAFTRDKLRRDPARNT
I4EI06          MREILT-SLEDAA--D--VVLVDAPP-MAVSDPLIIAGLVDGVLLIMTGGRTRSGELTQV
A0A522N7L9      MRAILE-HLTGLA--D--LVIIDSPPLQAVTDAAILAAMVDGALLVVDGSRTRRGAVQMG
A0A535W4H1      FGAILE-QLAADF--D--LIVIDTPPLQAVADAAILSARVDGTIIVVDAGKSRRESVVRA
A0A3D0D4X6      MSHLLQ-ELAAQA--E--LVILDTPPTLAATDAAILAAKADGTLLVIDTNLTKRTELVHT
D1C8M3          MHELIA-GLERMA--D--MVLVDAPP-VPVSDALVLAGLVDRVLLVAYSGRTRSAELARA
D1CAL1          MREVLD-WLAEQA--D--VVIFDAPP-LAVSDALVLSRLTNGVILVSETGRVRTAEIADA
A0A7C4K810      MYEIIS-RVSDHA--D--LVILDTPPVMAVTDSAVLAPRADGVLLVVKPGYTNLAAAKQA
A0A7C5MIR7      TRALLS-QCKALA--D--YVLVDSPPVLAAADASLLAQHANTVLLVTEVGRTRADALRHA
A0A7C5ARI8      LAELLD-ALDGMA--D--ILVLDSPPALAVADAAVLAERADGVLLVLEAGRTDRQAAATA
A0A7D6GA99      MSELIE-SLTTIA--D--LVIFDSPPVLAVTDAAVLSRQLDGAVLVVDAGETRXALARRA
A0A1J4ZRV4      MARLVE-KLAGQA--D--LVIFDSPPVLAVTDAAVMGRQVDGVVLVVDAGQTREQVLAQA
A0A1V5RXW5      MAYLIE-MLAEIA--D--IIIFDSPPVLAVTDAAVLGRQMDGVLLVVDTGTTREQVLGNA
                                   :..*  *     *   .       :                

A0A3A4VPK9      EDLI---KRAGGHIIGVVFNRIPRDRVD------YYSGNYQYQYYSKD------------
A0A3D0CW53      KETL---DQVGLKILGVVLNNSTSHRAR--------------GYYYQR------------
A0A535RWE5      VESL---RRVRARIVGGVVNKVRSTPAG--------------YYGYYGPGDARKNASRAS
A0A7C5A5U0      VEQL---QRAHARVLGVVLNLTRSSSSS--------------YYYHYA------------
A0A0P6WSP2      EENL---RQVRGNLIGVVLNGVPRDQHS--------------AYRY--------------
A0A5C7JWY1      IQRI---KQAGGRLLGVVMQKAPVSESS--------------YY--YG------------
A0A1F8QGH2      VKSL---QQAGAQQIWVVLNAVPHHMDG--------------YNSYYT------------
A0A1Q7TTL6      LEVL---QRLPVRLLGAILN--AVPAGE--------------AYRYYS------------
A0A0S8KFR9      LQQM---ARVGAKPLGVVFNRASAADGD--------------YYYPYG------------
A0A535SLQ0      IDLL---RQSPVRVLGAVLN--DVREGS--------------EYHAYG------------
A0A1F8SS27      VEQL---NRTGAQVIGVVLNRATGESLKYYGAKQYVGYGL--------------------
A0A2E0L5X9      KDEL--MAAPNVNILGVVFNRVRLQVTS----------KYNNTYYRQT------------
A0A3A0AXU8      KALL---ERAGARLLGPVLNRVEAGDLG------YYANYYSYGGYYHE------------
A0A359HML3      MVQI---ERTGTSVLGVIINKIS-SGSN------YYSKYYGSYYNIPD------------
A0A3M1EJ46      LHTL---QAVGGRVLGAVLTRSKAEGIG--------------YRY---------------
A0A0M8KAF3      IEQL---RYAEARILGVVVNDLTARDGG------YYYYAYSQYYH---------------
A0A523V9H6      VENL---RQVGANVIGAVLNNVPMTRRG------GYYYYY--YYY---------------
A0A2U2S5W9      REAL---RKVGANLLGGVVNRLSPRSGG-------YYYYY--YYY---------------
A0A7C3W344      RDAL---RKVGANLLGGVVNRLSARSGG------YYYYYY--YYY---------------
A0A7C1G8J6      RNRL--MEREGGRLPGLVFNYVSSGGLG------GYGYTY--RYYYYR------------
A0A3D1U3H5      KDVL---ERVGSRVSGVVLNRVGEESSG------YYG--Y--YYY---------------
A0A2N2MEK3      KSTLAQLKRSGAKVIGTVFNRVPKNGGQ------HYG-GY--RYY---------------
A0A3B9J9U6      KSTLAQLKRSGAKVIGTVFNRVPKNGSQ------HYG-GY--RYY---------------
A0A661VSD8      QALL--SSRSGVNLLGVAFNRVKLVET------------Y--AYY---------------
A0A1W9UQ51      KERLLGFDQREVNLLGLTVNRAKLDGS------------Y---HY---------------
A0A497B563      KERLLGFDQREVNLLGLTVNRAKLDSS------------Y---HY---------------
A0A497C1E5      RDRLLGLGQQGVTLLGLAVNRAKLDGS------------Y--GYY---------------
A0A7C0TV81      RDRL--LRQPGVHLLGITVNRVKSDGN------------Y--RYY---------------
A0A3D1JCW0      IEHL---RQVNANLVGVVINGVSPRHAR------YHYYYR--NYYYYQ------------
A0A2N2MJJ0      LESL---RRTHTRILGLVINRMK-----------AHHGEY--GHYSNS------------
A0A7C3QTG6      LDQL---RRVNARTLGVVLNKIPRNT--------YSYGGY--YYYYPY------------
A0A7C2TGF5      LSDL---QKANANLLGCICNHMVKETSM---------------EYYKG------------
A5V160          CDQL---LQAGVEPQGVVLNRVTKEQGG------YDH-------YYYY------------
A0A2A6REI6      MQLL---EQSGVKLAGVVLNRVRKSRYG------YGYGYG--YGYGYG------------
A0A426TTK3      AHLL---AQSGVKLAGVVLNRVRKSRYG------YGYGYG--YGYGYG------------
A0A3M1LAM5      IKVL--RDQEGVNFLGVVVNRIPL----------HHY------AYYLP------------
A0A536BZ00      ANAL---KRVGARVLGVVLNRVSGGTLD------VYG------PSYYD------------
A0A7C5LUL4      TEAL---EGVRARLLGVVLNKVREGRSG------YYY------HYYYH------------
E8N5M1          VEQL---QQVNARILGVVVNGVNPKKSH------YYYRNY--GYY---------------
A0A1F8U7F0      LEML---NRAGARTLGVVLNRIP-RGRS------DYYGGY--RHY---------------
A7NIZ1          CDQL---LQAGVEPQGVVLNRVT-REQVGYEHYYYYYGGE--RKRSSR------------
A0A0P6XM68      LEQM---RRVGANVLGLVLNRIP-RNRP------NYYGGY--RYY---------------
A0A2N2MEG3      LEQM---KRAGANILGVVLNRIP-RNRP------NYYGGY--RHY---------------
A0A353RQ31      LEEL---ERINAHLLGVVMNRIP-HNRS------YYYGGY--DYY---------------
A0A3B9KNR2      LEEL---ERINAHILGVVMNRIP-QNRS------YYYGGH--DYY---------------
A0A0P6XME1      LDQL---DRVKARVVGAVLNRVQDTTSN------HYYRSL--KSY---------------
A0A3B9Q1T8      LDEF---NRVGAKVVGLVMNRVP-RNQR------YYYGGY--QYYGLK------------
A0A2E5F6N9      IGAL---RKADATVLGYIHNRINARRFG------YGYT-----YYNYY------------
A0A2E6J6X7      VETL---NNSGVEIAGVIMNKLKKPKFG------YGYGYNYGYYYNYY------------
A0A1F8RRT9      SEAL---ALSKTKVLGAVLNKLTGRGQG------Y--------YYYSY------------
A0A3M1EAN8      VRRL---QYARAELLGTVLTRCQGRGG----------------YTYTV------------
A0A363SX22      MDRI---QLSRVRIVGLVLNRVKKGSES------D--------YYSGY------------
A0A6I1QLV0      RATL---DRAGARILGAVLNRVTGRREG------Y--------YYDGY------------
A0A535FRM3      VNIL---RKSGTNLIGTALNKSQWPEYN------H--------VQE-Y------------
A0A401ZA55      KQAL---ARTGTRILGVALNKSYWPEYG------E--------VHD-Y------------
A0A4P6JS79      KEVL---TKAGTEFIGVVLNKSQWSEYG------F--------ILE-Y------------
A0A326UPN3      MQIL---RRTGTRVLGLAINRSQWPEYG------D--------IHDYR------------
A0A455STY5      MQIL---RRTGTRVLGLAINRSQWPEYG------D--------IHDYR------------
A0A535QK16      KQAL---ERVGGNVLGSVMNKMKAAGGN------Y--------YYYAY------------
A0A3D0UNQ0      IFNL---EQAGANILGVVLNGMAEKRGG---------------YYYRY------------
A0A2G6GG97      VDRL---RRTGTHIFGAIFNRVKLDRSS---------------YGYYY------------
A0A6L7WZR1      RDAL---LKTDAVLLGAVINAARPQVTA------E--------YDGDY------------
A0A7C5QIC8      VLNL---ERVRVRVLGVVLNKAGHRPG----------------YYYSY------------
A0A1F8PTW9      TEQI---NLVGARLVGVVLNRIPLHGAD------YYTGKN---YLYTY------------
A0A1F8QH26      KEQI---GQIGANLIGVVLNRIPLRNAV------YYTGEG---YLYTH------------
A0A535D584      LEVL---KGSGANVIGVVLNKSRRDPPR------E--------YLDYY------------
A0A521TS25      RDSL---QRAGANVLGVVLNKLTERSGA------Y--------YYRYY------------
A0A7C2TBJ3      MEQM---DRAGARVLGIVLNRISRKNAV------AYGS-----YRYYS------------
A0A7C3TYQ9      KEAL---EQVGGRILGVVLTKIPRKRRG------YG-------YYYYY------------
A9B6E3          RAAV---QTVGGRVIGLVFNKLDPRSEG------YGV------YYTYY------------
A0A3M1H759      VARL---KQIRANILGAIVNQTPGK--------------------GDG------------
A0A7C3J9I4      VKRL---RQVGANLMGAVLNQASRGESH------Y--------YYAQN------------
A0A497ASN6      VERA---RQSGLRVLGAVLNKVKPPSRG------Y--------YYYYY------------
A0A3D1TRD4      LGRL---RRSGTPILGVILNKVKADTEG------Y--------YYYAY------------
A0A5C7JS64      VGAL---PET-ARVIGVALNYQKRGKAE------S--------YYYYY------------
A0A7C5IJ97      VAAL---EKVRAPIIGVVLNKVRARPGS---------------YGYYH------------
A0A7C3FJ85      VEQV---RRSGARLLGTVLNKVPMDGRG------S--------YYHYG------------
A0A3M1ZZ81      IERL---ARTGTNLYGVVMNRSKPGRAS---------------YYDDY------------
A0A3C0XJG2      VDVL---NAVHARILGVVLNKVPAIQLD---------------YYQSY------------
A0A7C3NE64      VKSL---LQIRAKILGGVLNGIFNKSHD---------------YYYYH------------
A0A7C4V0A1      VESL---AHAGANLVGAVLNKTPGRGSG---------------YYYYY------------
A0A6J4UI39      VGKL---QHGSIRVIGTVLNGQRSSSEA------G--------YYYAE------------
A0A521IC37      VETL---TRSKVKILGIVLNRVSGRRGG------Y--------YNNYY------------
A0A7C1K503      KESL---ERAGANLLGMVLNRMTRQTSG---------------YYYYY------------
A0A535IMD1      IETL---NKVNAKVVGVVLNKMRRRHAE------A--------YSYYY------------
A0A7C3FPG2      LTEM---EKVNANVIGIVLNRYRRGHGA------G--------YYYYY------------
A0A3A0B2P8      VKSL---RHLQVNLLGVVLNAVPVSQT----------------VYHAG------------
A0A497AF06      YESL---QRVGATILGAVLTKAKPERKA---------------YYYYA------------
A0A661W444      YESL---QRVGATILGAVLTKAKPERKA---------------YYYYA------------
A0A497BNC7      FERL---VSVGGQVLGVVLNRLAPSGDG------Y--------YYYYS------------
A0A7C6DKX5      RAAL---EQVGVRLLGGVLNDAASTSAE---------------YYRQH------------
A0A521UD91      NEVL---SRTSARVLGVVLNKLSRRSSE------Y--------YYRNY------------
I0I8T2          MGAL---RQVNASVLGIVLNRVTSGEHG---------------YYYSY------------
A0A3C0LJ76      IGAL---RQVQARILGVVLNRVEGSQHG---------------YYYSY------------
A0A7C7DWW4      IGAL---RQVQARILGVVLNRVEGSQHG---------------YYYSY------------
I4EI06          VQEL---TRTSTPLIGAVINRVDVKGDG------F--------YAHYA------------
A0A522N7L9      REAL---AKADAHVLGVVLNRLSERVYA------D--------YYHYY------------
A0A535W4H1      RDTL---VRAGAQILGVVLNRVARDVDG------A--------AYITY------------
A0A3D0D4X6      TEQL---QRVGATLLGATLNRLRRHNLA------G--------YYYYY------------
D1C8M3          VEEL---TRAGTPLLGVLLNRAE-AGAG------G--------YDLYY------------
D1CAL1          VQQI---QQSGSTLLGIILNRFPLEKSG------G-----------YY------------
A0A7C4K810      VEQL---RRVGAKLLGVVLNEVDIQGSR------YRYYRYKGYYYYHG------------
A0A7C5MIR7      VGAL---TQVGAHIAGVVLNKVVAQQNS------R--------YYGGY------------
A0A7C5ARI8      AEQL---RRTGCRLLGTVLNKVPLPGER------GAYYHYKYSYYYRY------------
A0A7D6GA99      VEEL---TKVGGRVLGVTLNRLSPNNSG------G--------YYYYY------------
A0A1J4ZRV4      AAEL---QQTGANLLGVVLNRLD-SRRG------G--------YYYYY------------
A0A1V5RXW5      VAEL---QKTGVNILGVALNRLD-TRRN------G--------YYYYY------------
                                                                            

A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      --------------------------YYYSHESTGERRGRRLRAGAVSHRFAVNGQGTGQ
A0A535RWE5      GIRLPFSSRWLLVPLIGIVVLGAGALFARAGQTVVPEAPRKTVSLERAIEELAAARAAWE
A0A7C5A5U0      --------------------------YSSYTKSGYSSEEG--------------------
A0A0P6WSP2      ---------------------------------------------ESGEEERPSAQRWFD
A0A5C7JWY1      --------------------------AYQQQR----------------------------
A0A1F8QGH2      --------------------------NEHEDKNSGGSTLQVSLEGEEKNASPTLD-----
A0A1Q7TTL6      --------------------------YYLPGYEAVDEEAERA---SGGKGQPFVI-----
A0A0S8KFR9      --------------------------RGIIG---GAEPVLPSFL-GNFVGRFSIIRRIWE
A0A535SLQ0      --------------------------YYMDGYELTGEPLFRPLVDGTKRGRPPVTARK--
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      --------------------------PALTPEKLSREMARSGSGLFGMRRHIITTG----
A0A3A0AXU8      --------------------------EAEEAKGGFWRGRGGRRAAPVRES----------
A0A359HML3      --------------------------SEQNDADISETEIENNPQEPGVETDATSEP----
A0A3M1EJ46      ------------------------------------------------------------
A0A0M8KAF3      ----------------------------------------------HDDGSGGDGT----
A0A523V9H6      ----------------------------------------------HQHYGEEEGK----
A0A2U2S5W9      ----------------------------------------------YAADGNGEQK----
A0A7C3W344      ----------------------------------------------YSADGDGEQK----
A0A7C1G8J6      --------------------------PRERRRFGWFRRQPAPATNGASSNNGAAGS----
A0A3D1U3H5      ----------------------------------------------GGYSAYVTDG----
A0A2N2MEK3      ----------------------------------------------STDSYNTYEQ----
A0A3B9J9U6      ----------------------------------------------STDS----------
A0A661VSD8      ----------------------------------------------SRYHDDGHGPVAKL
A0A1W9UQ51      ----------------------------------------------SSDQEGGEQK----
A0A497B563      ----------------------------------------------SSDQEGGEQK----
A0A497C1E5      ----------------------------------------------SSGLEAVGSS----
A0A7C0TV81      ----------------------------------------------GGATEKIAEG----
A0A3D1JCW0      --------------------------Y--SAYYGEGEKRKPSSNGSRSNGKHAPVPHPAG
A0A2N2MJJ0      --------------------------YYQDDIEGNNGKKSRLRLPWAKKVQQD-------
A0A7C3QTG6      --------------------------KRGASYYQHDEPQPQLQEQPAPMLPPSRQTHVYY
A0A7C2TGF5      --------------------------YGYIPERTLIKNIKGL-----------FTRSANH
A5V160          --------------------------YGQNRKRSR---RGVL--------SRLFKRRRRR
A0A2A6REI6      --------------------------YGYEPEPEKLTWRRRL--------RRMWRRLLGR
A0A426TTK3      --------------------------YGYEAEPEKLNWWRKF--------RRALRHLRGG
A0A3M1LAM5      --------------------------PQVTGEAAAVSLPRRVWRRLTGFLKPIRRRLGLG
A0A536BZ00      -------------------------------------EDRAA--------RPKSRSGAGS
A0A7C5LUL4      --------------------------YYYSSDGKRVRRRRRV--------LPGGRRNAQA
E8N5M1          -----------------------------QYYYYGDNGNLKKKRK---------------
A0A1F8U7F0      -----------------------------SPYYSGYHYYHSMDGQ---------------
A7NIZ1          --------------------------SALSRLFKRRRRRQSGMPGMVDTVDAGVTGIASG
A0A0P6XM68      -----------------------------SGYYKGEYSY--------------YDDEARG
A0A2N2MEG3      -----------------------------SGYYKGEYSYHNYYDEGSSSNQRAYRGNGNG
A0A353RQ31      -----------------------------SPYSSRDKYRHSYGSE---------------
A0A3B9KNR2      -----------------------------SPYSARDKYRHSYGSE---------------
A0A0P6XME1      ----------------------------------------TYVSK---------------
A0A3B9Q1T8      --------------------------GEVNAAYDQGDPSENTVDL---------------
A0A2E5F6N9      --------------------------NY-YKSYNEGGSDDARAPSFIGRIRNKLFSS---
A0A2E6J6X7      --------------------------YYNYKYSLEDTNPESKSSKNPFRIFRSIFNR---
A0A1F8RRT9      --------------------------HYYSSSDDGKNGHRKGRLFRGKRSQPAEETRTHA
A0A3M1EAN8      --------------------------HPAPAPHTPKVVPLVAPPDGKETLFPPEQHPG--
A0A363SX22      --------------------------LADASKYDSQASNKRKANLQDIQSTSGLGLSLIP
A0A6I1QLV0      --------------------------YSAP--AQDAAAGRSGAQPAGAAARSQAVRRPMV
A0A535FRM3      --------------------------LATLHAQRTKKVDIVPVTPAYQPIADEQIPDDTL
A0A401ZA55      --------------------------LSNI--QSRPRADIAMAMPPNTPAINHAIDATNT
A0A4P6JS79      --------------------------LGSV--QQRPRADISMSIPPTTASSNGSVDGDTS
A0A326UPN3      --------------------------GSVQTQGAPLLKAAPAAQQRVPQQASPVANQPQM
A0A455STY5      --------------------------GSVQTQGAPLLKAAPAAQQRVPQQASPVANQPQM
A0A535QK16      --------------------------DYNYGHPNGKAPIETAKPSPAEKETPVAGSKG--
A0A3D0UNQ0      --------------------------GSSPHDQSLIGNRIRAGLQQARNTLTSAYERLRK
A0A2G6GG97      --------------------------YSSYEYNAKSKKRRSRRLSKSSRIPSWITSIIKR
A0A6L7WZR1      --------------------------VYGDGPPDSEDTGALDPSERD-------------
A0A7C5QIC8      --------------------------EQHGRARSGVQAHWPRR-----------------
A0A1F8PTW9      --------------------------YLSNYGAERDDLIIDD------------------
A0A1F8QH26      --------------------------YMSGYGAAKKTNNNGEGGEVGEGGEVGEGGEGGE
A0A535D584      --------------------------FSQAAASQPDSANAEKPARRPAVQSPVASAR---
A0A521TS25      --------------------------YAYYGEDQHGGKKSRRRRPKILRALGIGGR----
A0A7C2TBJ3      --------------------------THYADSPYFEGEGLKPAGGAWRRILSPLVGRRAK
A0A7C3TYQ9      --------------------------PEYYHRGGDEQE----------------------
A9B6E3          --------------------------YDQHHTSNRGRRFWNRKDDHQPVPSMSEPAPLDL
A0A3M1H759      --------------------------YAEYFTPLAQIQTETAKRPWW-KPSFLR------
A0A7C3J9I4      --------------------------YGYHDSLLTDQPVSAKVRRWWQRLPALK------
A0A497ASN6      --------------------------YESSDGKKPWWKRLFKKHKKRSVRKQG-------
A0A3D1TRD4      --------------------------DGYYSSSGKPATEHVNGVIEVVEHGAAPVGDGKS
A0A5C7JS64      --------------------------SSDDSSGGSKPPSQNGSGRNFGQKVRELVPGGAS
A0A7C5IJ97      --------------------------YGYGASEEPAAEKPPSLGKRISSVTTAAGSTARK
A0A7C3FJ85      --------------------------YYSEEEEKRSSWPWAKKKRRHAKSH---------
A0A3M1ZZ81      --------------------------YYYATYEYVEGRRKKRRRRSRSLLPGWITAIIKR
A0A3C0XJG2      --------------------------A---------------------------------
A0A7C3NE64      --------------------------HYTPNNGK--------------------------
A0A7C4V0A1      --------------------------YYYYDDTYYNGNGKGRKERRRRRKEHRSTKAPLP
A0A6J4UI39      --------------------------YYSTEPPAASPRPDAPAREHAPQA----------
A0A521IC37      --------------------------YYASPKSNGKAKGTPALSVKGNGHANGNGHTNGN
A0A7C1K503      --------------------------YYDQSGERSKRRRRQLPWWQVWRRLRKRLRRQPG
A0A535IMD1      --------------------------QYYTPGGEPARKKGLFSRRHRTSAKKNEAVQ---
A0A7C3FPG2      --------------------------YDRYYSHEDGASGEAGDRGKGKGHSSARGRKSRR
A0A3A0B2P8      --------------------------YGYAVPRAADAEGTRRGALQIQANGQAGAHTLPA
A0A497AF06      --------------------------ERARPTRHPLWKRWLKAYPKSAGSSGFNRLGND-
A0A661W444      --------------------------ERARPTRHPLWKRWLGGFVKSR------------
A0A497BNC7      --------------------------YYSHADGGAAGGRRPRSWIARLLKPGRSRRRRGA
A0A7C6DKX5      --------------------------YYTARTEPGQG-----------------------
A0A521UD91      --------------------------HRYYAASPVSPNGSKKEPALIGGRHSNGGHRL--
I0I8T2          --------------------------HKSYSSRYYSGYYAPRRHAKAAAETTMVVSPQPV
A0A3C0LJ76      --------------------------HKSYGNRYYTTPYSQHKPKSGKRSAPT---ARTV
A0A7C7DWW4      --------------------------HKSYGNRYYTTHYSQRKPKAARRTESM---PLSV
I4EI06          --------------------------SYYGAGSDRVGDGNPVASLGTDLDGRHASPDRPV
A0A522N7L9      --------------------------GASGYHEAQSGHDGASDAPATHREPRPTLRVP--
A0A535W4H1      --------------------------AAAAPDEDRATSSKPG------------------
A0A3D0D4X6      --------------------------YDVSSDHNESGPAPAQRRKRKGFLGSARHTAE--
D1C8M3          --------------------------AEYYSAEPDTGD------QDGSGPGASTRLSQRL
D1CAL1          --------------------------TYYRSQEDDAGGARRGESPSVIPHWADGAGDRVV
A0A7C4K810      --------------------------DYYREGSEKNGRGDKKRAEAGVRNGAPTVNGEKQ
A0A7C5MIR7      --------------------------DYGYYAPERTATKRAR--PSLAQAVSKPRKKAAR
A0A7C5ARI8      --------------------------YHYYASEDESQRRLPRWWPFGKKKRHRRRTARPD
A0A7D6GA99      --------------------------YHHYYTDGDGKD-----SPGGPGDGGA-------
A0A1J4ZRV4      ----------------------------YYYSEEEGGQRRRSISPHGADEEGAPARGRAR
A0A1V5RXW5      --------------------------YHYYYQEDESGERRKHSSRRGTGV-------RFR
                                                                            

A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      LKSSTTDHPTTSEDDVR-------------------------------------------
A0A535RWE5      GDLHDASSARSRLESADAYLADATAAGADATRVSSVAQDVARLRATLDAAPAKSALVVNL
A0A7C5A5U0      ------------------------------------------------------------
A0A0P6WSP2      VLQYWVKTPWFKKK----------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      RAPGLDEDRSPEDQ----------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      -------PKD--------------------------------------------------
A0A3M1EJ46      -------DRR--------------------------------------------------
A0A0M8KAF3      -------RPE--------------------------------------------------
A0A523V9H6      -------KSR--------------------------------------------------
A0A2U2S5W9      -------RKR--------------------------------------------------
A0A7C3W344      -------RKR--------------------------------------------------
A0A7C1G8J6      -------TEL--------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      -------KKP--------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      RGLVTRWRRQ--------------------------------------------------
A0A1W9UQ51      -------QKG--------------------------------------------------
A0A497B563      -------QKG--------------------------------------------------
A0A497C1E5      -------QKR--------------------------------------------------
A0A7C0TV81      -------Q----------------------------------------------------
A0A3D1JCW0      ESAPREPL----------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A7C3QTG6      PPQNDVEEQY--------------------------------------------------
A0A7C2TGF5      HEKIETPSGI-----------------------------------------FRAKAIPEI
A5V160          NAVPGVVDTL--------------------------------------------------
A0A2A6REI6      KAAPQ-PSTA--------------------------------------------------
A0A426TTK3      KTRAH-PRPV--------------------------------------------------
A0A3M1LAM5      RERIHEDGRV-LLSLAEAAHLLGVRKETARRWCASGRLPAVKRGLRWWVEEEALQAMLNV
A0A536BZ00      RSREPKPGTP-----------------RVARAPGAATSPAPAQAAAGSPVAA--GSIASS
A0A7C5LUL4      QAAADSPGAPNPLLQTRAALIEQEERNRRLKYAGLGTAGLAALLAVGMAAAELLGALVPG
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A7NIZ1          TRPDRGAPID--------------------------------------------------
A0A0P6XM68      NGKKH-------------------------------------------------------
A0A2N2MEG3      NGKSK-------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A363SX22      KKTPGNSHRFRNAQKQNKPTPINEPNSGEINRNISNKLL---------------------
A0A6I1QLV0      DK----------------------------------------------------------
A0A535FRM3      SLKQLP------------------------------------------------------
A0A401ZA55      AILPSTNNKR--------------------------------------------------
A0A4P6JS79      ITASLRKGSD--------------------------------------------------
A0A326UPN3      QPAQMQPMQQMQPGHQMAPNSPSMMPNAPSMAPGSAPMMPPLNGSRGLLSQQQPQQNNQR
A0A455STY5      QPAQMQPMQQMQPGHQMAPNSPSMMPNAPSMAPGSAPMMPPLNGSRGLLSQQQPQQNNQR
A0A535QK16      ------------------------------------------------------------
A0A3D0UNQ0      KEDVIQDSTQLPDEGKEMTHNIP-------------------------------------
A0A2G6GG97      S-----------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      GGEGGEGE----------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C2TBJ3      SSGKTSKPNLGPQSRS--------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          HDPALDRSEAAYEMASHERSK---------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      GSRRQG------------------------------------------------------
A0A5C7JS64      KL----------------------------------------------------------
A0A7C5IJ97      PATPAQATTQSAGKREQK------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      SIPGNTHPQ---------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      GAGKTETPSEKSKM----------------------------------------------
A0A7C1K503      EATEATETLVGANRA---------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7C3FPG2      EGESWLCRQFSRFGR---------------------------------------------
A0A3A0B2P8      LQEGIKPASNPLYQALRKR-----------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A497BNC7      EVQGGGRTGAQR------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
I0I8T2          PHRSINNGAPLEPESVGQPKSVK-------------------------------------
A0A3C0LJ76      SQPGANGAGATHVTEAAPSKKRA-------------------------------------
A0A7C7DWW4      NQPGANGAGATRTTERT-SQKRT-------------------------------------
I4EI06          RRVGDPGD----------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          GTLVSGRAVDATQRGNQ-------------------------------------------
D1CAL1          IRRSLRPTISKPADSET-------------------------------------------
A0A7C4K810      NRS---------------------------------------------------------
A0A7C5MIR7      AQGVERSS----------------------------------------------------
A0A7C5ARI8      TGATERRD----------------------------------------------------
A0A7D6GA99      -PHERRTP----------------------------------------------------
A0A1J4ZRV4      FPWPRLRA----------------------------------------------------
A0A1V5RXW5      LPWPRKAA----------------------------------------------------
                                                                            

A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      AKLDKAAMPTQIVIAGVTYALDSGTQKIWRIDTDGSATAVIQKGLAGIGSPQRMAVAGDV
A0A7C5A5U0      ------------------------------------------------------------
A0A0P6WSP2      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------EEADEKLPNVKSYLNAVRAIPNYI
A0A2E0L5X9      --------------------------------------RGERLFSVSACAARLGVKRRTV
A0A3A0AXU8      ------------------------------------ALPAAPQPARPAVASRMAGAREKG
A0A359HML3      ------------------------------------EMKPDPEIILNEQNREISSHSEDV
A0A3M1EJ46      ------------------------------------GVTPSQLADMVSMLTPSGKGLS--
A0A0M8KAF3      ------------------------------------RKRRRADASRKGVMARLLSFVNVK
A0A523V9H6      ------------------------------------GGR------RKGFLAGLRRRRAKR
A0A2U2S5W9      ------------------------------------KKKHTNHSEQGGFLRGLFGRSQEH
A0A7C3W344      ------------------------------------KKKHAEHSEKNGFLRGWFGRSRER
A0A7C1G8J6      ------------------------------------AADRDGFVELEAAAAYLGISPATA
A0A3D1U3H5      --------------------------------------------------QKVSSGSRNG
A0A2N2MEK3      ------------------------------------ATPIRVMAPVPAAFEPTTRPNG--
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------ESEDRPLVGLDEAAERLGISKGMA
A0A1W9UQ51      ------------------------------------TSRDGAWLTLGEAAARLGVSKDQA
A0A497B563      ------------------------------------TSRDGAWLTLGEAAARLGVSKDQA
A0A497C1E5      ------------------------------------VEGDSVWLTLGEAAEQLGISRDQA
A0A7C0TV81      --------------------------------------GDG-WLTLKEAAQQLGVSKEQA
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A7C3QTG6      ------------------------------------FVKENTRQRVARYENEPSQNEITQ
A0A7C2TGF5      FQKKYVITLSNKDREYLYQITGTDKLKGYRYKRAMIILKADEGKTDTQIMAELAVSRSCV
A5V160          ------DTVMSGSGQTLYGAPDVVEATVHRRAPDMTTHPDAQPAVTATTAVQGLDERRNG
A0A2A6REI6      ------SGVAGGDWEDLTAIEQMETTHANGQNGH-NGHNGQNSQPQPVQQKSDTGRQQSS
A0A426TTK3      ------PSGSPEDWEDLVALEQMEGVSGNGHNGNGNGKEHARPGDSATPTGNASSRQSSS
A0A3M1LAM5      QLGWDPDGWRQVVREQARGVTGHRGAEAPGQP------GDAAPAMEPVAVDSNLVREEDA
A0A536BZ00      VARPPSTSMQPAA---PRAATSPPPFSLPAAPVARSSAAAQSPAPQPVSPRPVPPRLARL
A0A7C5LUL4      AAEPAASTSAHASLGVPATATEVPPATEPATPVASTHVAAPAAAPSPTA----LPTLAPT
E8N5M1          -----------------------------------------------TAISEPGSQPVTS
A0A1F8U7F0      --------------------------------DLKPSRMRRLFGKLSPFNHNGHKKVEAG
A7NIZ1          ------------------------IVMDGFYATPTPETIDRHPVSAGAVVATRTDERRNG
A0A0P6XM68      -----------------------------------------------STFRWRTRKNQTQ
A0A2N2MEG3      -----------------------------------------------MTSWFGRAKKAPG
A0A353RQ31      ----------------------------------------------------ESTEVALT
A0A3B9KNR2      ----------------------------------------------------ENIDLAFT
A0A0P6XME1      ----------------------------------------------------ETDELTLL
A0A3B9Q1T8      ----------------------------------------------------QKEGIQRM
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A326UPN3      R-----------------------------------------------------------
A0A455STY5      R-----------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A7D6GA99      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
                                                                            

A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      LYVLDDGGKIFKWQRETLTPLSVADRRYKDVAQFVVVANSMYVLDKTSAQVWRYQLVVGG
A0A7C5A5U0      ------------------------------------------------------------
A0A0P6WSP2      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A1F8SS27      ARRFSRSNEAKLEKK---------------------------------------------
A0A2E0L5X9      QGWIETGHLQAESRFMRQWIPESAIDMVLSQRITTVEPPTPASGVSEESPDSSNGTHGTP
A0A3A0AXU8      GRVSDGG-----------------------------------------------------
A0A359HML3      PQGRNPKLRGLLTFG---------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A0M8KAF3      S-----------------------------------------------------------
A0A523V9H6      -----GEEREAAGEG---------------------------------------------
A0A2U2S5W9      TGSSGEGRTENVQHS---------------------------------------------
A0A7C3W344      ---EPESEGEQAREG---------------------------------------------
A0A7C1G8J6      RRWCESGRLPATKQG-RRWKVRRADLETMGRGG---------------------------
A0A3D1U3H5      KRAAK-------------------------------------------------------
A0A2N2MEK3      ------------------------------------HHSVELVN----------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      RRWCKEGRLPAHKSR-LRWWVKREDLENLVESLRNGDAEIIRET----------------
A0A1W9UQ51      RRWCKSGRLPATKKWQLWWRIDPGGLERMLED----TWELKAKV----------------
A0A497B563      RRWCKSGRLPATKKWQLWWRIDPGGLERMLED----TWELKAKV----------------
A0A497C1E5      RRWCKSGRLPAVRKW-FWWRVESDGLDRMLED----TWEIKRSG----------------
A0A7C0TV81      RRWRKSGRLPAVRKG-LRWLVDPADVTRMLED----TLEIKV------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A7C3QTG6      PRPRTVPQQKNPETADRVQVIEILPPLTFTPYKDEDKDYFIKDE----------------
A0A7C2TGF5      KRVRKLYATKGLERVLYGNIQSGETRHKNGMVEFTHPFEV--------------------
A5V160          RAPHQ-------------------------------------------------------
A0A2A6REI6      RSRGRRRSGD--------------------------------------------------
A0A426TTK3      RPRSRRRSGD--------------------------------------------------
A0A3M1LAM5      DGPA--------------------------------------------------------
A0A536BZ00      PRPPQRLPPWPPHRWARRRLGQHRGGYHRPRARRRIPRLSACRE----------------
A0A7C5LUL4      TRPP--------------------------------------------------------
E8N5M1          INPPSKPTSR--------------------------------------------------
A0A1F8U7F0      VVEENVIEKP--------------------------------------------------
A7NIZ1          MTPHQMNQTK--------------------------------------------------
A0A0P6XM68      EEKTAESGQE--------------------------------------------------
A0A2N2MEG3      EAPAQEQEKQ--------------------------------------------------
A0A353RQ31      EQKGNKVLHH--------------------------------------------------
A0A3B9KNR2      EQKGT-------------------------------------------------------
A0A0P6XME1      EN----------------------------------------------------------
A0A3B9Q1T8      DN----------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A7D6GA99      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
                                                                            

A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      FAAPVALLDQPVPGTPRSLAVDSDIWIVTTDAQVLRYHINAGATTASRVPFDIHWTADAA
A0A7C5A5U0      ------------------------------------------------------------
A0A0P6WSP2      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      GDLRAQREAILDFVSRPNKSDSEN------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A7C3W344      ------------------------------------------------------------
A0A7C1G8J6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A7C0TV81      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A7C3QTG6      ------------------------------------------------------------
A0A7C2TGF5      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A7D6GA99      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
                                                                            

A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      LPIDLQVRDGDSRLFLLDDRARRFIVVDRDGREIARIATAPELPRPIAFAISGDGILSAN
A0A7C5A5U0      ------------------------------------------------------------
A0A0P6WSP2      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A7C3W344      ------------------------------------------------------------
A0A7C1G8J6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A7C0TV81      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A7C3QTG6      ------------------------------------------------------------
A0A7C2TGF5      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A3C0LJ76      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A7D6GA99      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
                                                                            

A0A3A4VPK9      -----------
A0A3D0CW53      -----------
A0A535RWE5      EGTIQRTPIPK
A0A7C5A5U0      -----------
A0A0P6WSP2      -----------
A0A5C7JWY1      -----------
A0A1F8QGH2      -----------
A0A1Q7TTL6      -----------
A0A0S8KFR9      -----------
A0A535SLQ0      -----------
A0A1F8SS27      -----------
A0A2E0L5X9      -----------
A0A3A0AXU8      -----------
A0A359HML3      -----------
A0A3M1EJ46      -----------
A0A0M8KAF3      -----------
A0A523V9H6      -----------
A0A2U2S5W9      -----------
A0A7C3W344      -----------
A0A7C1G8J6      -----------
A0A3D1U3H5      -----------
A0A2N2MEK3      -----------
A0A3B9J9U6      -----------
A0A661VSD8      -----------
A0A1W9UQ51      -----------
A0A497B563      -----------
A0A497C1E5      -----------
A0A7C0TV81      -----------
A0A3D1JCW0      -----------
A0A2N2MJJ0      -----------
A0A7C3QTG6      -----------
A0A7C2TGF5      -----------
A5V160          -----------
A0A2A6REI6      -----------
A0A426TTK3      -----------
A0A3M1LAM5      -----------
A0A536BZ00      -----------
A0A7C5LUL4      -----------
E8N5M1          -----------
A0A1F8U7F0      -----------
A7NIZ1          -----------
A0A0P6XM68      -----------
A0A2N2MEG3      -----------
A0A353RQ31      -----------
A0A3B9KNR2      -----------
A0A0P6XME1      -----------
A0A3B9Q1T8      -----------
A0A2E5F6N9      -----------
A0A2E6J6X7      -----------
A0A1F8RRT9      -----------
A0A3M1EAN8      -----------
A0A363SX22      -----------
A0A6I1QLV0      -----------
A0A535FRM3      -----------
A0A401ZA55      -----------
A0A4P6JS79      -----------
A0A326UPN3      -----------
A0A455STY5      -----------
A0A535QK16      -----------
A0A3D0UNQ0      -----------
A0A2G6GG97      -----------
A0A6L7WZR1      -----------
A0A7C5QIC8      -----------
A0A1F8PTW9      -----------
A0A1F8QH26      -----------
A0A535D584      -----------
A0A521TS25      -----------
A0A7C2TBJ3      -----------
A0A7C3TYQ9      -----------
A9B6E3          -----------
A0A3M1H759      -----------
A0A7C3J9I4      -----------
A0A497ASN6      -----------
A0A3D1TRD4      -----------
A0A5C7JS64      -----------
A0A7C5IJ97      -----------
A0A7C3FJ85      -----------
A0A3M1ZZ81      -----------
A0A3C0XJG2      -----------
A0A7C3NE64      -----------
A0A7C4V0A1      -----------
A0A6J4UI39      -----------
A0A521IC37      -----------
A0A7C1K503      -----------
A0A535IMD1      -----------
A0A7C3FPG2      -----------
A0A3A0B2P8      -----------
A0A497AF06      -----------
A0A661W444      -----------
A0A497BNC7      -----------
A0A7C6DKX5      -----------
A0A521UD91      -----------
I0I8T2          -----------
A0A3C0LJ76      -----------
A0A7C7DWW4      -----------
I4EI06          -----------
A0A522N7L9      -----------
A0A535W4H1      -----------
A0A3D0D4X6      -----------
D1C8M3          -----------
D1CAL1          -----------
A0A7C4K810      -----------
A0A7C5MIR7      -----------
A0A7C5ARI8      -----------
A0A7D6GA99      -----------
A0A1J4ZRV4      -----------
A0A1V5RXW5      -----------
                           

© 1998-2021Legal notice