BYKdb

Dataset for cluster tadcd of phylum chloroflexi

[Download (right click)] [Edit] [Sequences] [Repertoires]

125 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7X1PB30      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A6L7WZR1      --------------------------------------MPRQRPDATQIHHEPQLTGGAQ
A0A847FV42      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      --------------------------------------MQSLVPEGDARPSADLSERPFV
A0A7C5A5U0      -------------------------------------------------------MEAIA
A0A0P6WSP2      -----------------------------------------------------------M
A0A7Y4RFU7      ----------------------------------------------------MENNRTQD
A0A5C7JWY1      ------------------------------------------------MVKGESVNGKTV
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------MTLSNLPAPLVPPPVTAPGLPQRGVAAFDS
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------MSRVMSEHPPNDARVTSGSIVDRG----EL
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A7C1G8J6      ------------------------------------------------------------
A0A3D1U3H5      --------------------------------MGSLNRRQEFDSVGIALNPATQALDAEQ
A0A0M8KAF3      --------------------------------------------------MNTPLVPPDM
A0A523V9H6      --------------------------------------------MSGSTVAGQAVGLSEG
A0A2U2S5W9      ------------------------------------------------------------
A0A7C3W344      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A7V2VGP5      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A7C0TV81      ----------------------------------------------------MRQTKRTN
A0A3D1JCW0      ---------------------------------------------------MEHFDGEES
A0A2N2MJJ0      -------------------------------------------------MEENNDNDTLE
A0A7C3QTG6      ------------------------------------------------------------
A0A7C2TGF5      ----------------------------------------------------------MD
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ----------------------------------------------------------MD
E8N5M1          -------------------------------------MLYLDTGGMLPIRGNFSMEDFAE
A0A7X1U027      ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A7NIZ1          -------------------------------------------------------MRQVD
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3D0UNQ0      -----------------------------------------------------------M
A0A7W1A7Y8      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A7C5QIC8      MLPGPDRFTVSLASPRCYTCTTAAAQPAVRPHHPAEMAGLPPGLLRPVQAWSPERREGME
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A7V7XFT9      -----------------------------------------------------------M
A0A497ASN6      -----------------------------------------------------MEELEKK
A0A3D1TRD4      ----------------------MALIAPPMRYTDAGSVTWPAGLSQYSASDTSSADQFNR
A0A7V9AZN2      ------------------------------------------------------------
A0A7C5IJ97      -------------------------------------------MIVEIPCRVSLIERRIV
A0A7C3FJ85      ----------------------------------------------------------MQ
A0A3M1ZZ81      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A3C0XJG2      --------------------------------------------------------MDDS
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A847FKN0      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7V3K428      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A7W0KC11      ------------------------------------------------------------
A0A838GDL6      ------------------------------------------------------------
A0A7W0AAE0      ------------------------------------------------------------
A0A7W1TGR0      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ----------------------------------------------------------ML
A0A7C7DWW4      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A8B5XE16      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7W1THS1      ------------------------------------------------------------
A0A7C4K810      -----------------------------------------------------------M
A0A7V2PIU4      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A7V5BPS1      ------------------------------------------------------------
A0A7C5MIR7      ----------------------------------------------------------MD
A0A7L5YLH3      ------------------------------------------------------------
A0A800D757      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A2E5F6N9      -------------------------------------------------------MVEQN
A0A2E6J6X7      ---------------------------------------------------------MNQ
                                                                            

A0A7X1PB30      ------MDLRTYAQIVRRRW--------WLLLLGPLLAAGIAFAISK-QMTPIYTTSSTL
A0A1F8RRT9      ------MQLARYL-RLAGRWW-------WFIALAALIGGGSAYSISQ-LITPIYRADATL
A0A3M1EAN8      ------MELKQYLLILWKRV--------WLLIAAPLLAGAISYAASL-RMVPVYRASATL
A0A6I1QLV0      ------MELRRYFSVLARRW--------WMILLGPLIAGVCAFVVSG-LLTPVYSASSTL
A0A535FRM3      ----MQSSLNRYI-LLAKRWL-------WIIVLGVVVCGGMTYIASK-ITRPTYQASTQL
A0A401ZA55      ----MRSTLSRYI-LLAKRWA-------WVIILGMVICGGTTYLVTKLLMQPVYEAQTRI
A0A4P6JS79      ----MRSSLSRYT-LIVKRWA-------WVIVLGVVICGSVTYGITK-LMQPVYQATAQV
A0A535QK16      -----------MVAVELIRYWRVVRRLAWLIVLCPVVAALAAGIISL-QLPKIYEAKASL
A0A6L7WZR1      LFPKGCGVEPRWLTAVVMRWW-------WVLLIGMAAGGGSAWGVSR-AIDPTYRATATI
A0A847FV42      --------------MAIKKWW-------WLLVASTLVATVAGYVSVS-RMPRIYQATTTV
A0A3A4VPK9      -MEDETIDLRQYGLLLK-RWS-------WLLVLSLVIGAATGLIVSLL-STPIFQSTAKV
A0A3D0CW53      ------MELKEYASVLW-KWL-------WLIIVAMLIAAVSSYWASLR-MQPIYQTSTTL
A0A535RWE5      PPRRALLAGERLLRAIR-RWA-------GLVGIAMIVGAVVSFGVSRV-IPPEYRATAQL
A0A7C5A5U0      YPQEEEIDVRHLLSLIR-HGA-------WLLILSAVLAAGAAFGFSRF-QTPIYEARTQV
A0A0P6WSP2      LSNREAVGLKWLANWNS-PSL-------RIVLGCVLIATLIACLVILL-IPPTYKSSTLL
A0A7Y4RFU7      LEAFETLDIKRFVDSLR-RGI-------FWIILGLALGIGTAFLVSKL-QTPIYAASTQV
A0A5C7JWY1      IMDEAEYTISEYATACW-RHR-------WLILLVVGCFGIGAAVWSFL-QVPVYQAKATV
A0A1F8QGH2      MTNNANTDLRRIFSVIR-RWL-------WLILGCTLVGGVIAFSVTSL-LPPVYKATATL
A0A1Q7TTL6      DHSESGVDWRRILSAVL-RFK-------WLIATMTLVGTVAGIGATRF-IKPEYSAQTKI
A0A0S8KFR9      ------MELRAYLEILI-RRK-------WVVILTTLATVAAVVLVTSR-QQPVYSAAARV
A0A535SLQ0      EAPVSTVRLDDLFAVVR-RHI-------RLVLGVTAAVVAAAGYVAYV-TGSVYRAVAVI
A0A1F8SS27      --MNDYIELHRLFTMVL-RKW-------WLLIMVTAFAAALGYTFGHR-QAPVYEARATL
A0A2E0L5X9      -----------MLRAIL-RWW-------WLIVLSVSLGVGVGYIVRSQ-QPDLYFSEATV
A0A3A0AXU8      ------MELLTYWKILR-KRL-------LLIVLLILVAEFGAVYYVVS-RVPLYSTTTTM
A0A359HML3      ------MDIAELIYPLR-RWW-------WLIVLATVIAAGASFAVARQ-QPPTYQSRATL
A0A3M1EJ46      MINEDQMELRHYLAVLW-TWV-------WLLLLAPLLAAGISLAVSMH-IQPVYRASATL
A0A7C1G8J6      ------MTLKYYLSLIG-RWW-------WVWLISLALALASGYLYTQR-QPRIYMSRTTL
A0A3D1U3H5      SSGDRAALLRWYYHLVR-RWI-------WLIVLVTIAAGVTGYSVTTLFIKPTYVATATL
A0A0M8KAF3      LTDEDTIDLRQYWLLIR-RWW-------WAFVLALLLGAVAAYIASQF-QQPIYRAEARI
A0A523V9H6      SALGEEQDLRVYLAVLR-RWL-------WLVVVCTILGAASAFLVSSN-MAPVYEASATL
A0A2U2S5W9      ------MTLRQYFAVIW-RWL-------WLIVLAGAVAGGAAYASSQS-MPRVYQSTTTL
A0A7C3W344      ------MTLRQYFTVVW-RWL-------WLIVLAGTVAGGSAYVSSRS-MPRVYQSTTTL
A0A2N2MEK3      ------MEIKHYLGMLQ-RWA-------WLLALGLILGGVGSYLFSVN-QSPVYQSSTKL
A0A3B9J9U6      ------MEIKHYLGMLQ-RWA-------WLLALGLILGGTASYLFSVN-QSSVYQSSTKL
A0A661VSD8      ----MEIDLRRYLMVIK-RWW-------WLLIIGAIIPAIISSYFTAK-QPALYQARVTL
A0A1W9UQ51      ----MNKQVAQYVRLLG-KWW-------WLFVISVIIPAVISYYFTAQ-QPALYQAKATI
A0A497B563      ----MNKQVAQYVRLLG-KWW-------WLFVISVIIPAVISYYFTAQ-QPALYQAKATI
A0A7V2VGP5      ----MNKQVAQYVRLLG-KWW-------WLFVISVIIPAVISYYFTAQ-QPALYQAKATI
A0A497C1E5      ----MNKQVTQYVRLIK-RWW-------WLLLVSVIIPAVISYYFTTR-QPDLYQAKATI
A0A7C0TV81      QSKMGGNTVRYYLKLIF-HWW-------WLLIIGALIPGGVSYQLTSQ-KQDFYQAAATV
A0A3D1JCW0      TLNTGDTDLRKYLWLLW-QWA-------WLIGLATLLAAGAAFIVSEL-QTPVYQASTTI
A0A2N2MJJ0      FDLIDAASLRRMGGLLW-RNA-------WIIALAGLLLGLAAFIFGRM-QAPVYEARTQV
A0A7C3QTG6      ------MELKDYFSMAR-RWA-------WLLTLGLILGAMGGLLGSIF-QTPIYEASTRI
A0A7C2TGF5      IRMNDFVELRRVMSIVRRRWI-------WLFVF-VLLCGGGGWLFGRS-QTPVYQATATM
A5V160          ------MTLQRYLTLFW-RWL-------WLMLLMTLIAGGAAYLVSRQ-MTPIYEASTTL
A0A2A6REI6      ----MDNELLRYLFIIR-RWA-------WLIIIGTVLSASAAFLVSRE-MTPVYQASTTL
A0A426TTK3      ----MDNELLRYLFIVR-RWA-------WLIVMGTLLSAGAAFLVSRE-MTPVYQASTTL
A0A3M1LAM5      --MSMTFSWRLVWRLVK-QWW-------WLLVVGAVLAGGTGYYFASK-KPNIYAARTTL
A0A536BZ00      ------MDLRRQLAVLR-SRS-------RLIIGSVLLAAIASALVSLA-LPKVYQSRVTL
A0A7C5LUL4      EDTTGTIEIQQYVALLR-RWL-------WLIVLATLLGAGAAYLASRL-STPIYEASTTL
E8N5M1          PVQQPSTDLRQYLWLLW-QWG-------WFIALAGVLAASGALILSLL-QTPIYAASTTI
A0A7X1U027      ------MELKVYLAFIS-RRW-------WLLLLGPLLVGLAAYFVTQQ-MTPVYKATSTL
A0A1F8U7F0      ------MEIKRYFSLVR-RWA-------WLGILGLVLGAAGGYFSSAN-QTPVYQASTRF
A7NIZ1          EQSEHRMILQRYLTLFW-RWL-------WLMLLMTLLAGGAAYLVSNR-MTPVYEASTTL
A0A0P6XM68      ------MEIKEYLQIAR-RWA-------WLLILGLLLGAVSAFFFANS-QTRIYESSIRV
A0A2N2MEG3      ------MEIKHYYMIAQ-RWA-------WLLILGLLLGGGGAYIFSSL-QEPVYQTTTRV
A0A353RQ31      ------MDIKHFFNIAK-RWL-------WLVIAGVIIGAAVGYFVSSR-QTPIYEASSKF
A0A3B9KNR2      ------MDIKHFFSIAK-RWL-------WLVIAGVIIGAAVGYFVSSR-QTPIYEASSKF
A0A0P6XME1      ------MQPRDYLVLIR-RWL-------WLLGVGIFVGALGGLVFSLL-QKPIYQASTKV
A0A3B9Q1T8      ------MDIRRILYLLK-RWS-------WLLIIVTLISGVAGYYFSSQ-QTPMYRASTRF
A0A363SX22      ------MELISFLKIFL-KRW-------WIIVLIFLVTVGSTAIFTW-RQNPTYSVTTTF
A0A326UPN3      ----MRISLSRYILLAK-KWV-------WLVVVGVVICGVGTFAVSKLFIKPTYKASASI
A0A455STY5      ----MRISLSRYILLAK-KWA-------WLVVVGVVICGVGTFAVSKLFIKPTYKASASI
A0A3D0UNQ0      DELNDFVEIRHYISIFL-RRW-------WLVLLTALVAAGIGYVVSQ-SQDRVYRATTSV
A0A7W1A7Y8      ------MEFRRYFLALR-RWV-------WLLILAPLLSGAAGYLVSN-QGAPVYESSVRV
A0A2G6GG97      ------MELKNYFLLIW-RWV-------WLIILGVVIAAIAAFLISK-NTAPVYQSTSRL
A0A7C5QIC8      NEQAVDIDLRHYARVVW-RWL-------WLIVLASAIAGGGAFLASG-LMTPIYEASTTL
A0A1F8PTW9      ------MELKKYIFPLR-KWW-------WLLLASTLVAVVLSYLYIL-RQPKIYQTHTTL
A0A1F8QH26      ------MEFKRYLFPLR-RWW-------WLILASTLVAAVLSYLYLY-QQPKIYQTHTTL
A0A535D584      --MERSFDLIQLLKLVR-RWA-------PVVAFMTLLAGGLAFVVAR-AAVPSYQSCGLL
A0A521TS25      -MTLQFARVWSLWARYG-HWL-------WLIAVVTVVSGGVSYAVSR-SIPPEYRAVATL
A0A7C3TYQ9      ------MEIRQYFALMW-KWA-------WLIALCVLLAAGSAYVVST-RQPATYQATVTL
A9B6E3          -----MNIIRRYITGLR-RWL-------WLLVLGPVVAAGAAYGISS-QQTPRYASSTRV
A0A3M1H759      ---MAEL---RRYRNIV-RWW-------WLVLLSTVIAAGASYYISD-QQPRIYASTTTL
A0A7C3J9I4      ----MELDIGQYFKAIL-KWW-------WLIILSTVLGAGGSYYVSM-QQPRIYQTTTTL
A0A7V7XFT9      LESRQQNELLLYFRTIR-KWL-------WLIVLIAVASGVVALLVTL-TRPASYESTSKI
A0A497ASN6      SWVEEEIDIREYARVLQ-RWL-------WLIALCSIIAAVSAYIISACFIQPVYKAEAVL
A0A3D1TRD4      RYGESMLPNIDYLVWVR-RWL-------WLVLLGTLLGGGIAFGIAA-TTAPTYQSSATL
A0A7V9AZN2      ----MEIDLRHAVRIAR-RWW-------WLLLLAPLVAGTSAYIAGD-RQQDVYSATAML
A0A7C5IJ97      EEQSQSSAVRRYLAVIQ-RWL-------WLIVLTTLVAAAAAYVASR-LSTPIYEASSIL
A0A7C3FJ85      DELTMDIDLRMYWQLIR-RWL-------WLIVLAALLAGGTAYIISKWMVEPVYHAAVRI
A0A3M1ZZ81      ------MEIRQYIRLIW-RWL-------WLIILGAIIAGGTAYVISK-NTVPIYRASSRL
A0A7C2TBJ3      ------MKLGDIFYPLW-KWW-------WMLAVTTLIAILSSFYIVR-LQPPIYETRTTL
A0A3C0XJG2      SRGVPGFARARVLFMFR-RWG-------PLIALATVVAGGTAFAVSE-VLPKEYSATSQL
A0A7C3NE64      ------MELQRYFKSVL-RWW-------WLLLLSTTIAAGANYYASM-QQPRIYQATATL
A0A7C4V0A1      ---MEEVELRRYWWILR-KWL-------LLVLLLPIVCGAVAYVISI-RSTPVYSASATL
A0A847FKN0      ------MQIRQYWNLFK-KWI-------WLLAVGALLAGGIAYAVNR-NTTPVYQAGSTL
A0A6J4UI39      ----MNLDLRTLLRYAR-RWW-------WLLLLGPIIAGGSAYWTSS-QQQPMYSATSTL
A0A521IC37      ------MELRRYLSLLK-KWG-------WLILLITGLAAAGSYFYSR-TIPPTYRTTAVL
A0A7C1K503      ------MDLRKYWTVLW-RWS-------WLIALGTLLGAGAAFIVSR-NMTPVYSASATL
A0A535IMD1      -----MMELKRYLSTIL-KWW-------WLIALSTAVAAAFSYYASA-QSPRIYQTATTL
A0A7V3K428      ------MQLHYIGATIR-KRL-------WIVLLTVLVGTGLSLWYSL-AKPLMYRAEATL
A0A5C7JS64      ----MDLTLHNLAAMAR-RWW-------WLLVLAPLVAGVVAFAQVS-RQQELYSASSTV
A0A3A0B2P8      ---MEELNLRLLLRPLL-KWW-------WLIAACTLLAGVSSGLYTL-RQPRTYLSRTTI
A0A497AF06      ------MELREILRVIQ-RRL-------WLIVLGTLLISIVVFAVSK-NMKPVYRAKVTM
A0A661W444      ------MELREILRVIQ-RRL-------WLIVLGTLLISIVVFAVSK-NMKPVYRAKVTM
A0A7W0KC11      ---MEELDLRQLMRIAR-RRA-------WLVVLLMAVAGGAAWVNST-RETPIYAASATM
A0A838GDL6      --------MRQLVRIGR-RWW-------WLLLLAPLIAGATAYVVSD-RQQPLYSASVVL
A0A7W0AAE0      ----MELDLRQLARIAR-RWW-------WLLLLAPAISGATAYVAAE-RQEPLFSASMVL
A0A7W1TGR0      --MLSRSILGDYFAMLR-HWA-------WLLVTIAVIFGTTAYVVSD-HQPRVYQASTTI
A0A497BNC7      --------LRQYIAIIR-KYW-------WLILLTTVLATGAAFYVSV-AAPPVYRATTTL
A0A7C6DKX5      ------MDLQQCLRALW-KWA-------WLIGVAALLSGAVSYFASI-RATPVYQTTTTL
A0A521UD91      RKEGRVVELRQYATLVQ-KWW-------WLVLLGFVVAGAGSYYVSK-SQVPVYRASVTL
A0A7C7DWW4      ---MNHRELQIYLRPLL-RWW-------WLILLSALLAGVSAFIFVR-LRPPVYIASGTV
I0I8T2          ---MNQRELQAYLRPIL-RWW-------WLILLAMALAGTSAYIFAR-MRPDVYIASGTV
A0A8B5XE16      ------MTIPEILKALR-QWW-------WILLLCPIIAAGTAYFVSS-SMTPIYEAEATM
I4EI06          ----MDMTIADMLKLGR-RWW-------WVFVACPLLAAGAAYLVSS-LLTPIYEANLML
A0A522N7L9      ------MDLRRQLTIVR-AHW-------RLIVACALLAGVAAFAVSS-ILPKSYHSEATL
A0A535W4H1      ------MDLRRQLHIVR-TRL-------WLILLVTIAFGGAGLLAAT-LAPRQYEARATI
A0A3D0D4X6      ------MELRQYARIVW-KWL-------WLIVICTAVSGAIAYVVSI-NTAPVYQATASL
D1C8M3          -------MTSSILARGL-RWW-------WIVLVGALAAAALAYLVSA-AMTPIYQAQLTL
D1CAL1          ---MRDLTFIEILGLIR-RWW-------WVFIVCPLLAAAAAYGVSR-ALTPIYRAEATL
A0A7W1THS1      --MEARQALRQRIAIVL-RWS-------RLLILCSVIAGTTAWGINQ-HQTPIYQAATTI
A0A7C4K810      DTSTVSDELRRYLALFW-HFA-------WILLATTILAATIALLVSL-RMTPTYQAVTRV
A0A7V2PIU4      ------MELRQYWELLR-KWL-------WLIILTTVVAGAASYIFSI-QQTPIYQASTRL
A0A7C3FPG2      ------MELRQYWDLFK-KWL-------WLIALTTIIAGGVAFFVSS-RQTPIYRASVRL
A0A7V5BPS1      ------MELRQYWDLFK-KWL-------WLIALTTIIAGAAAYFFSS-QQTPIYRASVRL
A0A7C5MIR7      TQESETAMARLYLVILQ-RWL-------WLIVLAMLLGASIAYLLSR-SSQPVYEAVTTL
A0A7L5YLH3      ------MELRQYTSILR-RWI-------WLILLGTLLVGALTYVISR-NMTPVYRASATV
A0A800D757      ------MELRQYFAVIR-KWL-------WLIVLGTLLCGSTAYLVSR-NMTPIYRASTTL
A0A7C5ARI8      --MEQEIDLRAYGRLLQ-HWL-------WLIVLAAFVAGATSFGVSKWVTQPVYRARTRL
A0A1J4ZRV4      ------MELRQYALLLR-KWL-------WLVVICTVVAGGTAYGVSK-NSTPIYQASATL
A0A1V5RXW5      ------MELREYMALLR-KWL-------GLILACMILAGGVAFFVSR-QSIPIYQASATV
A0A2E5F6N9      FDEESSLDLRQYVDALI-RWS-------WVAIIVAVLAGAAAYFYTQ-SRTPVYQASSLV
A0A2E6J6X7      NEQEQSIDFKKYIGLAI-SYS-------WLIILLPTIVGTGAYFYSQ-QQTKLYEAKATL
                                                                     :     .

A0A7X1PB30      LVNQTQNPGVVQYN-D----------------ILTSERLTN--TYAQLIERQPVLAEVTR
A0A1F8RRT9      LVNQTQTPGVIAYN-D----------------ILTSERLTM--TYRELISKRPVLEDVTE
A0A3M1EAN8      LVSPSGESAALNYS-S----------------LLASERVAK--TYAELLTKRPLLEQVIA
A0A6I1QLV0      LVNQVQSEGPIQYN-D----------------ILTSERLTN--TYAELIRQRPVLQTVID
A0A535FRM3      VLAISTSQSP--YE-N----------------ASAALELLP--TYARLVANPQVLQPVAT
A0A401ZA55      LITL-AGTSQ--ND-S----------------TLAAIAQQS--TYSQLVTNPNVLAPVAA
A0A4P6JS79      ILTIGTNQSP--YE-S----------------TNAVIALQP--TYAQLVTTPQVLQPVAA
A0A535QK16      LVRPAQPLSVDPGV-A----------------ALTTDQILR--TYARLMTERPLLEQVIS
A0A6L7WZR1      LVNQSAAPGTVTYS-D----------------ALLSQQLVK--TYARMATQRMVLEQVAQ
A0A847FV42      IVGQGLQSSNPNSQ-D----------------LYISQQLAQ--TYREMVSRTPILRGAAE
A0A3A4VPK9      MITRAGQDQSSDVT-A----------------YLTTNQQTQ--TYLQLLQTESILNIVSE
A0A3D0CW53      MVGQFIQNPNPTDQ-D----------------LRISQQLAQ--SYARLLRRQMILQTTID
A0A535RWE5      YLAPAPNA--TASV-D----------------IVGGQNLAR--SYAQLANSSVVLRAAMD
A0A7C5A5U0      MVGRSSSP--AQIN-D------V----TQ---LLNVQQLAQ--TYAELLSQDWVRNVVAS
A0A0P6WSP2      LIEPSPGL--VTDD-Y-----------SS---IIAGEQLAF--TYSQLMVEKQILETAIR
A0A7Y4RFU7      MVARSNTQ--SPVT-D------I----TQ---QLSSQQVAQ--TYVELLLQDWVRDIVTA
A0A5C7JWY1      VIDNPTPG--GLDK-D-----------KS---FYPDNSPEYFQTHFELMKSHFVLQRTAR
A0A1F8QGH2      LVEPSQES--SPND-Y-----------ST---LMAGERLAL--TYSQMLKGPLILEKVIT
A0A1Q7TTL6      WIDVEGRG--QDRG-P------------T---PIRSAQLLDAESWVDLLLSYVVLDQVVR
A0A0S8KFR9      RVAQASSG--SIEY-V------------D---YMYAERLMN--TYIEMLKSSSILEEVIK
A0A535SLQ0      RLSDPRRA--FTGG-VVDDPALG----AD---GRYADPLLS--Q-VELLKSHAVAGGVVD
A0A1F8SS27      LVGQIFES---ANL-E------K----QD---LQTSELVAQ--TYSDLTRRQPILQSVVD
A0A2E0L5X9      IVGADSNNPVPTGV-D------S----TV----------LD--AYSVLIGRNSLLQPVID
A0A3A0AXU8      IITPSAMG---SLL-S------Y----QV---NLTLGPLAN--TYIQYMGTRSFGEMVAA
A0A359HML3      MIGRTI-E--NPNP-T------S----VQ---FSLEEQLAV--SYANIANREPLRDATME
A0A3M1EJ46      LISQA--S--GPSL-D------S----NSYNSLLTSERVAK--TYAQLLTKRPLLEQVIS
A0A7C1G8J6      MVGQSI-A--NPNP-D------P----QY---IGLARSLAQ--IYGDLAKRLPVTQPVIE
A0A3D1U3H5      QVDAGQ-L--SSDV-N------G----TG---VIASQQLAD--TEARLVVTQPVAVKAYK
A0A0M8KAF3      LVSQSSSS--DLND-I------Y----RD---IVIGERLVK--TYAEIMKSDAVLDLVAE
A0A523V9H6      LVHQ------APSA-G------V----SDYTAILTSERLAR--TYSEMITGRPVLDAVID
A0A2U2S5W9      MVGQKVMR--DPNV-T------A----QD---LYVSQQLAQ--TYIQMATRQPILQATIE
A0A7C3W344      MVGQKAIR--DPNV-T------A----QD---LYVSQQLAQ--TYVQMATRQPILQATIE
A0A2N2MEK3      LVIRAP-Q--GQNS-D------L----AY---LA-SQQLAQ--TFIQLLKTKPVLDSASA
A0A3B9J9U6      LVIRAP-Q--GQNS-D------L----AY---LA-SQQLAQ--TFIQLLKTKPVLDSASA
A0A661VSD8      MVGTTL-Q--SSNP-D------T----RA---MQTSNSLAQ--AYAELVRYRPITEAVIQ
A0A1W9UQ51      MVGASIFQ--DPNP-D------Q----TA---IRLGNTLAA--AYAELLRQGPVVEAVIE
A0A497B563      MVGASIFQ--DPNP-D------Q----TA---IRLGNTLAA--AYAELLRQGPVVEAVIE
A0A7V2VGP5      MVGASIFQ--DPNP-D------Q----TA---IRLGNTLAA--AYAELLRQGPVVEAVIE
A0A497C1E5      MVGASL-Q--NPDP-D------P----GQ---MNLSNTLAT--AYAELVKQGPITEAVIE
A0A7C0TV81      MVGSGL-Q--NPDP-D------L----WQ---LNLSNTLAA--AYAELVRQGPVTSAVIE
A0A3D1JCW0      LVNEAPST--QSSN-Y------S----AI---YLTSQQLTK--TYAEMLTKKPLLDKVRQ
A0A2N2MJJ0      LVSRPSMQ--SQIV-D------I----TQ---SMNSQQITQ--TYVEMFKLASVRQAAAE
A0A7C3QTG6      LVMRAPQE----KT-T------D----YT---YLSDQQLVQ--TYIQLLTTRPVLESVSV
A0A7C2TGF5      LVGQ-IMQ--STSL-S------R----ED---VQMSVAFAQ--TYSDIAVRQPVLKGVVE
A5V160          LINQAPAG--SSSP-D------Y----QA---VLTAERLAR--TYAELLVKRPVLEDVVR
A0A2A6REI6      LINQASAS--NANA-D------Y----NA---ILSSERLAR--TYASLMLTRPILEEVIA
A0A426TTK3      LISQASAN--NANA-D------Y----NA---ILSSERLAR--TYASLMLTRPMLEAVIA
A0A3M1LAM5      MVGA-NIR--NPDP-N------S----RD---FGLTVTLAQ--IYGEMAKRRPITQAVVD
A0A536BZ00      VVGQ-SLA--AVNP-D------I----NQ---LLVSQKLSE--TYAEVARTDPVLQAVSN
A0A7C5LUL4      LITE-GQK--ATGQ-D------Y----NS---ILMSERVAK--TYAQMLKGSPVLSEARA
E8N5M1          LVNEARSG--QYYD-S------T----AI---ILTNEKLTR--TYAEMMTKRPLLVKVAQ
A0A7X1U027      LVNRTAIP---GTI-A------Y----DD---ILTSERLTN--TFSKLVERPAVLDEIIR
A0A1F8U7F0      VILRAAQT---TAA-D------Y----YA---YLDSQQLLQ--TYIQLLTTEKVLNAASE
A7NIZ1          LINQAPAS--SASP-D------Y----NA---VLTAERLAR--TYAELLIKRPVLEEVVR
A0A0P6XM68      QIVSAVKT--VPNM-D------Y----NS---YVEQNQLAQ--TYVQTLRSRPVLDAVAE
A0A2N2MEG3      QVVSASRVGGAGTD-A------Y----SN---FYIENQLAQ--TYVQTLKSHSIVDMVAE
A0A353RQ31      VILRAPQT----TY-D------Y----YA---YLDNQQLIS--TYVQLLSTESVLQKASD
A0A3B9KNR2      VILRAPQT----TY-D------Y----YA---YLDNQQLIA--TYVQLLSTESVLQQASE
A0A0P6XME1      MVLGVPQS----NL-S------D----IL---NQNSELLSQ--TFTELLVTRPVLEAASE
A0A3B9Q1T8      VIMQPAST----DS-D------N----LS---LVEIQQQIT--TYSQLISSTDLINQVST
A0A363SX22      VVSPSSTI--FSDPRS------FLSGLDV---LGGRVSVAN--TYSDIATSRRIKNDTID
A0A326UPN3      VVTLQTSS--SPSD--------------N---ATAALTLLP--TYIELVTNPTVLQPVVS
A0A455STY5      VVTLQTSS--SPSD--------------N---ATAALTLLP--TYIELVTNPTVLQPVVS
A0A3D0UNQ0      IVGQSIQA---TQL-D------S----RD---IQTSERLAL--TYADIARRQPVLEAVIV
A0A7W1A7Y8      IVGQTLQS---VNP-D------Y----GS---LVASERLVS--TYVQLAQSRSVAQGVES
A0A2G6GG97      LIDQAPGA--GSGN-D------Y----TQ---ILVEERLAQ--TYVELLKTDPILEETIS
A0A7C5QIC8      LIREGQNE---AGL-D------Y----NS---VLMSERLAR--TYSQLLKDAPVLEEVIN
A0A1F8PTW9      MIGTTISD---PNP-S------S----NE---FALGQQLAS--AYANIANRQMVRNATMN
A0A1F8QH26      MIGAAITN---PNP-S------Y----ND---FVLGQQLAD--AYANLTNLQLIREATMN
A0A535D584      RVAVQAPS--GSQA-------------------ASASDITQ--TDAVLMTQNGVLSEVIR
A0A521TS25      LVNQVQGS--GGGA-S------Y----TD---IMTSERLAR--TYGELMRKRPVLEKTIT
A0A7C3TYQ9      LINQASST--TQ---D------Y----NA---ILTGERLAR--TYAQMLTKRPVMEETAR
A9B6E3          IVGQTLKN---SNP-D------Y----GS---LVASERLVA--TYAQIAQSRTTMQAVEQ
A0A3M1H759      MVGQAIAK---ANP-S------D----QD---LYLADQLAN--VYAQMAEREPILQATID
A0A7C3J9I4      LVGQVIQE---SNP-S------G----SD---FSTTQQLAE--SYAQIAIRQPILQATVE
A0A7V7XFT9      IIGSAVLG--NPQSVS------Q----SD---VAVWEQLTR--TYAELFQTRPVLENTSL
A0A497ASN6      MVEPSAGV--SSSI-R------Y----QD---VLAGERIAR--TYAEILESRPLLEKTLI
A0A3D1TRD4      LINASSTP---NAL-T------Y----TD---VLLSQQLTL--TYSKIAVQDPVLAQVIQ
A0A7V9AZN2      RVSPGAGG--TS---D------F----NA---IQASQSLTE--TYRLLIQTEPVLQRVID
A0A7C5IJ97      LVNGGETA---AGP-D------Y----NG---VLMSERLVG--TYSQLLKGPPIYEGIRA
A0A7C3FJ85      IVQPSSSL---TGS-D------Y----AD---IMAGQRAAQ--TYAEMLNSRPLQEAALL
A0A3M1ZZ81      LIDEAPGS--GSNN-E------Y----AE---LLVEQRLTQ--TYLQILSTRPVMEETIT
A0A7C2TBJ3      LVGRAIAE---PNP-N------N----NE---FFLSQQLAG--AYATMVMRDPVRSRTME
A0A3C0XJG2      YVAPAANP--TA---A------L----QD---AVLGQNLAP--SYVQLAQSEVVLRRARD
A0A7C3NE64      LVGQVIQE---INP-T------S----QD---FLTVGQLAQ--SYAQIGRRQPVLQATID
A0A7C4V0A1      LVYRTPSG---DIT-D------Y----NA---IVTSERLAR--TYSTMIPRRPVLEAVIQ
A0A847FKN0      MITPGSAP---SLD-N------Y----NA---LYAAERLAR--TYAELLSSGPVMEETQR
A0A6J4UI39      LISQSDPS--QQ---D------L----SG---LQAGERLGS--TYQQLVNTDPVLQAVID
A0A521IC37      LVGQEQQS---ANP-T------P----SE---IYVSNNLAQ--AYALLVNQPSVLQAAAK
A0A7C1K503      LVNQAPRS---GLT-D------Y----SS---ILTSQQLAK--TYSELLHKRPVLEAAIE
A0A535IMD1      MVGQALQS---PNP-D------N----IQ---VYAATQLAQ--TYVQIVRRQPVMQAVVD
A0A7V3K428      VLNPLVTQ---ENQ-A------Y----SP---VELAEDLAP--TYISYLKTETFLKALNE
A0A5C7JS64      EINPPSMG-------T------D----QF---TYYDSSIVA--TYQALITTSAVLDPVIE
A0A3A0B2P8      MVGSSLLE---PNP-N------S----ND---LYLAGQLAS--AYADIVQRSTVRDATQA
A0A497AF06      MIKQSSSM---PLA-D------Y----TS---ILTGENLAL--TYSALLKTRPLLEIVIA
A0A661W444      MIKQSSSM---PLA-D------Y----TS---ILTGENLAL--TYSALLKTRPLLEIVIA
A0A7W0KC11      LITPGQGI---SAT-D------Y----NS---IIAGQTLAE--TYRALADSSPVLDRVIA
A0A838GDL6      RINPPVS----GTL-D------V----NA---VRLSQELGE--TYRSLITFTPVLDQTIA
A0A7W0AAE0      RINPPPTS--AM---D------I----NA---FGLSQDLSE--TYRSLITFTPVMDRVVE
A0A7W1TGR0      LVDEAKAN--A----D------Y----QS---TLLDERRAQ--TYAQLLTTEQLLTTVIQ
A0A497BNC7      EIDLGTNP--LSDPYT------V----SN---ARTVESVAA--IFAAKIQFPLFLQQVKE
A0A7C6DKX5      RVGQFLDN---PDP-L------G----SE---ITTSQALAQ--SYALAAKRQPILQATLD
A0A521UD91      LVDQAQDA---SGP-N------Y----DA---ILASERLTN--TYGELIRKTPVLSATIE
A0A7C7DWW4      MVGTAIQE---RNP-D------S----QQ---LSLTQGLAQ--TYVKIAQRPSIREATRQ
I0I8T2          MVGTALQE---RNP-D------S----QQ---LSLTQGLAQ--TYARIMQRPSIKKATME
A0A8B5XE16      LLEHNIGA--GAGA-D------L----QS---IQAAERRTQ--TFNQLVNTRSVLAPTIE
I4EI06          LINQSRVP---GVI-N------Y----DD---ILAAQQRTQ--TYSRLVTTRPVLEETIR
A0A522N7L9      IVGQGLTS---TDP-N------Y----NE---LLASQQLTQ--TYVSVATQRKQLEGVIA
A0A535W4H1      LIGQSLSS---VNP-D------Y----NQ---LLTSQRLTL--TYASLATRRPILDAVIS
A0A3D0D4X6      LIREGKDP---EST-T------Y----TD---LLTSERLAR--TYSERLQSRPVLEETAR
D1C8M3          LIEESQGT---GAG-D------Y----ND---ILAAERRTR--TFSRLVAQRPVLEETIR
D1CAL1          FIDQRETT---GSL-N------V----GD---IQAAQELAA--TYSRLVTARPVLEQTIN
A0A7W1THS1      LIDAAPGT--KPTS-D------Y----QS---ILGSERQAQ--TYGQLLISEPLLENVIQ
A0A7C4K810      LINEAPAT---KSS-D------Y----AS---ILTSERLAL--TYSELLTTEKVLSGVIS
A0A7V2PIU4      LVSQSVSN--SASL-Q------Y----AD---ILAAERLSS--TYAQMLTARPVVQSALE
A0A7C3FPG2      LVSQSVSN--SASL-Q------Y----AD---ILAAERLSS--TYAQMLTARPMLVAAIA
A0A7V5BPS1      LVSQSVSN--STSM-Q------Y----AD---ILAAERLSS--TYAQMLTARPMIEAAIA
A0A7C5MIR7      LVSEGQKI---GGT-D------Y----DV---LLMDERLAR--TYGELLKGSLLLKQVSA
A0A7L5YLH3      FVDQATNT---NES-S------Y----GI---IIASERLAQ--TYAQLMLTRPVVDAVAV
A0A800D757      LIHQARSP---TAT-D------Y----SS---ILTSERLAK--TYAERLTKRPVLEEVAN
A0A7C5ARI8      LV-QPSTS--MAAV-N------Y----SD---ILAGERIAQ--TYAELLGSANLQEEALE
A0A1J4ZRV4      LVNQASNP--VSGA-G------Y----QD---ILTSERLAK--TYASLLTGWPMLDETAR
A0A1V5RXW5      MINQASSP--SAAA-V------Y----AD---ILTAERLSR--TYANLLMSRPVVDQTAE
A0A2E5F6N9      QIQQTQGS---ALP-T------F----SD---LQLSRALAS--TYKELITTTDILSAVTK
A0A2E6J6X7      LVEQRSSG---LST-S------I----SD---YSLSARLSK--TYAKLITADPFLDQVRE
                 :                                                          

A0A7X1PB30      LL----S-----LPM--TEDGLADKISVATVRNTQLLRITVEDPDPQLASMIANSTAQAF
A0A1F8RRT9      DL----E-----LPM--SPDELGALIDVEAIEDTQLLRLSVEHEDPDQARWLANATAQAF
A0A3M1EAN8      NL----H-----LSL--TPRQLAGKINVAQPADTQLLELQVEDSNPQLAVAIANNIADTF
A0A6I1QLV0      RL----D-----LEM--SIDDLQDRVSVSTVQDTQLLRASVRDEDPALAADIANTLASAF
A0A535FRM3      KY----K-----LT----VKQLTEMITVKPQSNTQIIEIYVESSNPVVATSIANDVAQNF
A0A401ZA55      KH----N-----ME----LKQLTGMVKTQSATNSPIIDILVDSSNPQLAATLSKEVAQSF
A0A4P6JS79      RH----G-----LT----LKGLSNLVVVNAPSNTPIIKISVNNSDPRFAAQLANEVAASF
A0A535QK16      DL----N-----LKT--DPATLSKQITVTPAPNTAILDVAMRDTDPVRAKDTANTLVNDF
A0A6L7WZR1      EL----E-----LAI--SPADLDDMLSGVAIAQTQLLEVRAETTHPELARGLANAVARVF
A0A847FV42      MI----G-----LPY--VPRAED--VSAWLVTGTQLMGIAVRDTDPERARALADAIVQQL
A0A3A4VPK9      RL----G-----FE------LDEDAIDTKAIIDTQIIEINVEDPDPQRAALTADMLVEVL
A0A3D0CW53      AL----G-----LQ--IPWQALAGRVSAASAPGSQLIQINVVDGDPQRARLLADEIAHQL
A0A535RWE5      DV----G------W--TDLKTFRDLANSAWVRDTSIITVSFKHGNADFAARAANAIANAF
A0A7C5A5U0      RV----G-----------EEITPRQVSVKVVTNTSLINITVQHTDPQRASFIADTFVQVL
A0A0P6WSP2      RL----E-----LD--LEPEDLARRVSAEPVSNTQLIRLSVRDSSPQNAALLAETIADEF
A0A7Y4RFU7      RV----G----------GERIGANQIDVNAATNTQIIRINVEDADPARAVLISNTLVEVL
A0A5C7JWY1      IL----D-----LA--ERPEYQPKPSVIKQFMKSFLPDSVLAFVRPAPKKEHADSADD--
A0A1F8QGH2      RL----G-----LD--ETPEDLSEKIVAEPVANTQLIRLTIRESSPEKVTLLANTIAEIF
A0A1Q7TTL6      DQ----RLF---VE--PGTPADGQAVEKLSVADQYQPGVYRFTVDHSGQGYTLASADGVE
A0A0S8KFR9      EL----D-----LS--SSPKDLAKQIEADVVPDTELLSITVTDHDPARAKDIANALATLL
A0A535SLQ0      SM----PMLRVVLR--KSSRSLLERVLRRRLSPGLLGDVAVAADAPA---------DSLP
A0A1F8SS27      VL----G-----LN--KTWQQLRKQVSVGLVEGTQLIQITAEADSPDTAQMIADEVAHQL
A0A2E0L5X9      DL----G-----LN--ISVLDLMELMSLETNRSASLITIGITDTDPERAAAIANRIVDEL
A0A3A0AXU8      RM----P-----VE--ISSAEVLRSIQAEFVRDTQIFRITATHRNPEVAQMLANTTAQML
A0A359HML3      AL----G-----LD-------WLPEYSVTAVPNTQLIEIVVVDTDPQRAQIVASEIANQL
A0A3M1EJ46      DL----H-----LK--LTPYQLAGKIEVIQPANTQLLELYVEDSDPEQAVAIANGIATLF
A0A7C1G8J6      KL----G-----LK--LTPDELAKRMETRVLFDAQLLEITVYDTDPQWAATIANAVAEEL
A0A3D1U3H5      AL----H-----LHLPLTPSTLLGGATASSDVNSQLVTLSVSSHDRVFAARAANALA---
A0A0M8KAF3      TV----G----------EEALEEAKISVSPGQDTQLLVVAVEHPDPELAATIANEVVRVF
A0A523V9H6      QL----E-----LG--QTAEELAETVEVELVRDTQLIRLSVEHNDAARAATIANALSDAF
A0A2U2S5W9      AL----G-----LK--EDWTSLRGRVNASPVQGTALLQVSVLDTSPEWAVAIADEIARQM
A0A7C3W344      AL----G-----LK--EDWTTLRGRVNASLVQGTALLQVSALDTSPEWAAAIADELARQM
A0A2N2MEK3      EL----G-----YH--ISSGQIKAEQ----LRDTQVITLTVEDNDAGHAAAIANTLVGVL
A0A3B9J9U6      EL----G-----YR--ISSNQIKAEQ----LRDTQVITLTVEDNDAGRAAAIANTLVGVL
A0A661VSD8      RL----G-----LE--RSHEALASQIVAWVRPNANLLEIRVTDTNPKAAMMIANALAEEL
A0A1W9UQ51      RL----G-----LE--RTPEQLAAQIGTGFYSGAQLLEIQVTDTNPEAAALIANALADEL
A0A497B563      RL----G-----LE--RTPEQLAAQIGTGFYSGAQLLEIQVTDTNPEAAALIANALADEL
A0A7V2VGP5      RL----G-----LE--RTPEQLAAQIGTGFYSGAQLLEIQVTDTNPEAAALIANALADEL
A0A497C1E5      RL----G-----LE--RTPERLAEQISARVQWGVYLLEIEVTDTNPEAAALIANALADEL
A0A7C0TV81      RL----G-----LE--RSPEQLAEQIGTRIYSGAQLLEIQVTDTDPEAAALIANALADEL
A0A3D1JCW0      NL----G-----LS--ENVE---FDVKVNFIRDTQLVQLLVEHTDPFLAANVANEMVAVF
A0A2N2MJJ0      HL----Q-----IE--IKP----GQVSVSALTNTQIVEIVVEDTNPALAGEIADTLVDVL
A0A7C3QTG6      RL----G-----SM--VDS----GQVDVEQIRDTQAIQLTVEDETPQRAADIANILVQVL
A0A7C2TGF5      KL----E-----LI--ESWQKLRKRVRVSPVEGTQLISIVVEYDSPEMARKIADEVANQL
A5V160          EL----N-----LS--IAPSLLAERVRVRPIRDTQLIVVTVEDIDPQRAADIANRIVAVF
A0A2A6REI6      EL----E-----LV--TTPSALADRITTTPVRDTQLIRVTVEGEDPAQVAAIANRLVTVF
A0A426TTK3      DL----D-----LT--TSPDALARRITTTPVRDTQLIRVTVEGEDPLQVAAIANRLVEVF
A0A3M1LAM5      RL----D-----LP--MEWWDLAGRIETRVNPTAQLLEITVFDTDPQVAALLANAVAEEL
A0A536BZ00      QL----G-----LG--VSPDNLRGRVSTDAPRDITLLRITATDGDPNQAARIANEVANQL
A0A7C5LUL4      RL----G-----VQ--VDAAS----ITVTPVADTQLLTLRVRHADPQLAAQLANTIPQVF
E8N5M1          KL----N-----LP--YVI----DTVKVTPVRDTQLMQVIVEDINPVYASDFANELVNAF
A0A7X1U027      RL----E-----LT--VTRSDLDKKIEVAAVKETQLLEISVADPVPAFAATLANTTAQAF
A0A1F8U7F0      KL----G-----YP--VYA----GQASAQQVPDTQFVRLTVTNTDPQRAADIANVLVMVL
A7NIZ1          EL----S-----LP--FAPSMLAERIRVRPIRDTQLIVVTVEDIDPQRAADIANHIVAVF
A0A0P6XM68      RI----N-----TA--ITP----EQIRAQIVQNTQLIDIFVTDTDPQRAASIANTLVEVF
A0A2N2MEG3      RI----G-----GS--VSP----DQVQVQIVQGTQLIDITVEDTDPERTALIANTLVDVF
A0A353RQ31      EL----G-----FP--IYK----GQATASPITDTQFVVLTVRHTEPEKAALIANGLINVL
A0A3B9KNR2      EL----G-----FP--VLK----GQATARAITDTQFVELTVRHTDPEKAALIANSLIDIL
A0A0P6XME1      RL----G-----YY--INS----SQVRVQQVRGAQLIQIIVEDSIPEKAAEIANTLVTVF
A0A3B9Q1T8      EL----G-----FP--VDQ----KQLEVEQIGDSQFVRLTVTNEDPFKTAVIANALIDAL
A0A363SX22      AL----G-----LN---PVQAETLDVGSKILAGTNVIYITVEGPDPSLITTFANKLGETT
A0A326UPN3      KY----H-----MQ---SANELASKISVKQIGGTQVIEVTVSDEDPKMATNITNDVAQNF
A0A455STY5      KY----H-----MQ---SANELASKISVKQIGGTQVIEVTVSDEDPKMATNITNDVAQNF
A0A3D0UNQ0      SL----D-----LDY--AWQNLRNRVRVDLVPDTQLLEISVDASSREEAISIADELAQQL
A0A7W1A7Y8      QLGTPGL-----LSH--------ARIIARPVPETEFLDIAVEANNPQQAADIANAIAAQL
A0A2G6GG97      QL----E-----LPM--SVPTLKKMISVSAPQETQIIIIQVEDTNKDRAALIANTLGQVF
A0A7C5QIC8      RL----K-----LGI--SPEALARMITVDNLRDTLLISLKVRSPNAEQAAAIANTVVEVF
A0A1F8PTW9      AL----D-----MNE-------LPEYTAWALPNTQLIEISVTDIDPKRAQAVANELATQL
A0A1F8QH26      AL----N-----IDQ-------LPEYKARVEPSTQLVVITVNDTDPNRAQAVANELAAQL
A0A535D584      DL----H-----LRI--SSDQLRAHLVARPGPSSELITVCSSGASGTQQAAIVNAVMSVY
A0A521TS25      EL----Q-----LAT--TNEQLARTIEVRPVRDTQLVTVSVENRDPRLAADIANTVVRTF
A0A7C3TYQ9      QL----G-----LNI--SPEELAAKVKVNLVRDTQLITLQVVDEDPSVAMRVANKIPEVF
A9B6E3          RL----N-----L----SDMASSAIITTRPVQETEFLDIAVEANDPQQAADIANAIADQL
A0A3M1H759      AL----A-----LDV--EWDVLGGQVSAFHPSQSQFLSVTVQDTSPERAAVIADEIARQL
A0A7C3J9I4      KL----D-----LSM--TWLALRDLVNVSPVPETQLLAITVQDTSPERAVAIADEIAYQL
A0A7V7XFT9      AL----N-----LNL--DIEDLEEKIDVRPITGTQLIEVVVTDGNPERAQAINTQLFAEV
A0A497ASN6      KL----G-----YPPDLSDKELPFNVSVQAVRETQLIRISVESKDPQLAAKAANTLAETF
A0A3D1TRD4      EG----H-----LPF--TVIQLQKMVSAAPVLQTQLITITANTHDAKQAATIANLVANVF
A0A7V9AZN2      ER----N-----LSY--SVDELQDFVTVSTIQDTQLIEVSVSSPDPAQAALIANTIATEF
A0A7C5IJ97      LL----K-----LNF--SDAQMDRMIIVEPVRDTQLITLKVRSADAGLAARIANTAPQVL
A0A7C3FJ85      RL----G-----YA---EEQLIPYELTITPVRDTQVLQISVESIDAQLTADLANMLAQVF
A0A3M1ZZ81      RL----N-----LPY--TPEQLAAKVSASSPQDTQIIIISVEDPNPELAAQIANTLGEVF
A0A7C2TBJ3      TL----Q-----LEE-------LPEYKAQIVPNSQFIEIVVIDISPLRAQVVANELANQL
A0A3C0XJG2      KV----S-----WP---DSKSFRERTQVAQVRNTSIIAVSFRDRDPQRAAEIADLIANSF
A0A7C3NE64      SL----G-----LEI--NWQSLKGHVNIQQIAGTQLLEISVLDNSPERAKIIADEIAHQL
A0A7C4V0A1      RM----G-----LNE--SPASLAKRMRVNLIQDTQLIQLDVEDADPQRAADIANAIAEEF
A0A847FKN0      RLNEMAA-----ADPALADQGLAFQASAQPLRDTQLLGLQVTGTDPERIAAAANLLLEVF
A0A6J4UI39      RL----Q-----LPL--TIADLRGSVSASVVTGTQLLRVSVSDSDPARAARIADAVAEEF
A0A521IC37      EL----N-----WEG--SWESLYFVVTANAPQGGQTFNVSATAGTPQRAQEIANEIARQV
A0A7C1K503      KLYGLGG-----AGPVPDPAELARAVSVDLIRDTQLIVLNVENTSPERAAALANTIAEVF
A0A535IMD1      DL----K-----LTV--SWEQVAAQTSVALIQGTQLIEIKFVDTNPQRAKLIADAIAQQV
A0A7V3K428      QF----R-----LDV--TLQELRESVQAELVPRTQFFKIAAISSSPDRAQALANAVADVF
A0A5C7JS64      SL----G-----LPM--TEDQLRAKITTSPVANTRLMRISVSDPNPETAAILANAIAEQF
A0A3A0B2P8      AL----G-----LGW-------LPYYTARLVPNTQLIELSVVDTDPVRAQAVAAELVNQL
A0A497AF06      NL----G-----LDI-SPDELIEHRLGTNLIPDTQLLELTVEDTDAQRASNIANEIALTF
A0A661W444      NL----G-----LDI-SPDELIEHRLGTNLIPDTQLLELTVEDTDAQRASNIANEIALTF
A0A7W0KC11      DL----G-----LPL--DFRDLEKMITTSVVGDTQLVQISVEDTDSQRAAAIANEVVDEF
A0A838GDL6      AL----D-----LPY--STEELRAKVTASTIQDTQLVRVSVSDPDPDDAARMATTIGSEF
A0A7W0AAE0      AL----A-----LPY--SADDLREKVTATSVTDTQLVRVSVSDPDPNRAVAIADTIASEF
A0A7W1TGR0      KL----G-----LHM--TTRQLGSMVAVKVVRDTQLIMLQVRDTDPQRAARLANTLATTL
A0A497BNC7      RL----G-----LPA---DVKVDDMISVQQIGSTQLIHVSAENNDPVLAQALADTIARVL
A0A7C6DKX5      AL----K-----LDW--EWQALANNVNATVV-GSQFLQITVQDSHPQRVKAIADEIARQM
A0A521UD91      RV----E-----LPY--TPAQLAKLIQVQVVRNTQLLVVSVDDIDPLRAQETANTLAQTF
A0A7C7DWW4      AL----G-----MDW-------LPEYSVRVVPDSQLIEVNVTDVDPQRAYAVATELINQL
I0I8T2          AL----G-----MDW-------LPQYTVRT--ESQLIEINVTDVDPQRAYAVATELINQL
A0A8B5XE16      SL----D-----LDI--SLGELRENVSVSHQRDTQLVSVAVQHEDPDTAALIANEITGQF
I4EI06          KL----N-----LSV--TPEQLLKKVDVSPVRDTQLFTVAVSDPSPEQAATIANTIGQVF
A0A522N7L9      KL----R-----LAT--TPEDLAKTVNAQAAATSTLITISADDPDPQRAAAVANALAQAL
A0A535W4H1      TL----G-----LKT--TADDLLPRIDAEPSQTTAFLTIVVRGRDAAETAAIANEVANQV
A0A3D0D4X6      AL----G-----LQQ--DLGTLKVKITVQPVRDTQLIRLTVEHTDPALAQAIANTIPQVF
D1C8M3          RL----S-----LRM--TPEELMAVIEVTPIRDTQLVTLAVSDPSPARAAAIANTVAEVF
D1CAL1          RL----S-----LDT--TPEDLVENISVTRIGSTQLVEIAVEDPDPRQAAQIANTLAQVF
A0A7W1THS1      KL----S-----LPR--QADDLRRSIDVSVVRDTQLIHVQVRDPNAQLAADIANTLVSTF
A0A7C4K810      AL----D-----LDM--SPGALKRAIQVEPVRDTQLIELRVEDTDPIRATRIVNTLVTVF
A0A7V2PIU4      KA----G-----YPD-LDPRAV--GISVQPVRDTQLIDLKVEHPNPQVAANIANALPLVF
A0A7C3FPG2      KA----G-----LEGVVDPEDLEEAISVQRVRDTQLIDLHVEYPDPIIAAKLANAIPEVF
A0A7V5BPS1      KA----G-----LEGIIDPEALENAISVQPVRDTQLIDLHVEHPDPQIAAKLANTLPEVF
A0A7C5MIR7      QV----S-----PSV--NSDDLRKMIIVDTVRDTQLITLRVRHTDPKLAARIANAIPQVF
A0A7L5YLH3      QL----G-----LAE--RN----LTVEVEPLPDTQLIQVDVEDSDRDLATLIANTLPAVF
A0A800D757      RL----G-----LEM--EDGKFPAKLEVRPVRDTQLIELSVEHSDPLLAMQIANTLPEVF
A0A7C5ARI8      RL----G-----IAG--NG--F--SVRVQRPRDTQLLDLQVDSTDPVLAARLANTIAQVF
A0A1J4ZRV4      RL----G-----VDA--KD--LEKTVTVSSVRDTQLLEIQVEGPNPQLIVQIANTLPEVF
A0A1V5RXW5      QL----G-----IEP--RS--IERSIDVTPVRDTQLLKITVEGPNPWLIARVANTLPEVF
A0A2E5F6N9      EL----G-----LSA--STGGLRKNISVSILRDTSILRILAMNEDPALAASIANAVAQQF
A0A2E6J6X7      TN----G-----FER--LG-----SVQTRTQENPPLIEIYVRDSDKVLVGEVANAISLNF
                                                                            

A0A7X1PB30      I------DDNSRSLGRP--GT---------------------------------------
A0A1F8RRT9      I-----DSNEQDGLTRP--GT---------------------------------------
A0A3M1EAN8      V------AQHEKRRDDL--AV---------------------------------------
A0A6I1QLV0      I------TQNAEELGRP--GT---------------------------------------
A0A535FRM3      A------QYSRNGLNGM--AQ---------------------------------------
A0A401ZA55      T------SYATSHLASQ--AN---------------------------------------
A0A4P6JS79      A------QYTNTSMGGQ--VQ---------------------------------------
A0A535QK16      I------AKIKDIQRTE--AKAPT------------------------------------
A0A6L7WZR1      I------ERQQPFLPAG--REAQV------------------------------------
A0A847FV42      I------LQTPNAIAED--RDRRAFVQTQLTNLEESIRATEAEIVA--------------
A0A3A4VPK9      IE----QNEL-ISSERY--DLMEES----------------LSAQK---AQIESQIADLQ
A0A3D0CW53      IL----HSPTTPEKEQ---EQYRQF----------------VNQQL---LTLQTRIEDAQ
A0A535RWE5      IV----QSRSLQ-------SS---------------------------------------
A0A7C5A5U0      VE----QNEETQ-------SQRYA------------EAEQSLSNQI---GDMEKQIAALQ
A0A0P6WSP2      VQ----HVRLLE-------REKFG--------ESISGLQAEMESQT---TLISANQARVD
A0A7Y4RFU7      SE----QNESIQ-------STRYN------------DTEASLELQI---KELEGKISEIQ
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      TD----HIQALQ-------TDRFT-DLLQSLQDQMSAASTQMNETE---STMDGISARMI
A0A1Q7TTL6      LE----RGTLGD-------SVGTRYGLRWAPDASTVAPGRAVQFNL---TTLRDAATALS
A0A0S8KFR9      VE----RSRNLY-------FGGTR-SAREILQ----QQLDEVEAKL---EQVRTELQTLV
A0A535SLQ0      LT----FDRDGF-------VVGAP-PERRRVAYDTLVKVDGVRFTV---RRRPDAARALL
A0A1F8SS27      IL----FSPGRSNTSNS--IMVRQF----------------IQQQL---GNLQARIENGQ
A0A2E0L5X9      IR----QTSDRAT------LLDLEF----------------INSQI---EDMQNQINNLQ
A0A3A0AXU8      ID----ANTERQLSQQEARLAAQRSPEALARQKQMNDLIAVLQDEL---NYYDDQIRTLD
A0A359HML3      IL----GS-PTSTNQAD--VERQAF----------------ISQQL---DTLQKQITDTQ
A0A3M1EJ46      MQ----QN-ARRQGDSSGLTGYEEM----------------LAKQI---AEVERDIQALE
A0A7C1G8J6      IR----QS-----PSVD--TENERF----------------VRQQL---DDLQSQIEKAD
A0A3D1U3H5      ---------YAAQQSEQ--QHQMSR----------------FSAAI---DAIDRQISSYQ
A0A0M8KAF3      SA----YM-RRVQTERF--AESKAN----------------LQAQM---ERVQAEIEQLQ
A0A523V9H6      IA----YN-AGLQEARY--SGSLTS----------------VEEQI---GQVSALIEQTE
A0A2U2S5W9      IL----QSPTAPEEAQR--AKHRAF----------------VEQQI---ADLQAKIEAAQ
A0A7C3W344      IL----QSPTAPEEAQR--TKHRAF----------------VEQQI---ADLQAKIEAAQ
A0A2N2MEK3      VA----QN-DSLQSSRY--LTSEEG----------------LQAQV---EQVGAQIDQLQ
A0A3B9J9U6      VA----QN-DSLQSSRY--LTSEEG----------------LQAQV---GQVGGQIDQLQ
A0A661VSD8      IR----QS-PGSRQGQR--QQQQEF----------------IKQQL---DELEEKIEKKK
A0A1W9UQ51      IR----RS-PAS-GGSD--PEQQEF----------------IRRQL---EELEAKVGNVG
A0A497B563      IR----RS-PAS-GGSD--PEQQEF----------------IRRQL---EELEAKVGNVG
A0A7V2VGP5      IR----RS-PAS-GGSD--PEQQEF----------------IRRQL---EELEAKVGNVG
A0A497C1E5      IR----RS-PAS-GGSD--PEQQEF----------------IRGQL---EELQIKIKDIS
A0A7C0TV81      IR----RS-PAS-GGSD--PAQQEF----------------IRRQL---EELQMKVTDVN
A0A3D1JCW0      SE----DIRN-LQQSKY--AASKEN----------------LKAQL---DYLDQQIVENQ
A0A2N2MJJ0      IE----KNDA-IQSERY--TNSEQS----------------LSTQI---ADVEGQIADLQ
A0A7C3QTG6      ID----QNEL-IQASRY--TQTEQS----------------IQAQI---TQIESQIAQMG
A0A7C2TGF5      IL----LSPTKSNAGED--SFVNSF----------------IQQQI---VDSQERILNSQ
A5V160          SE----QNRE-LQSERF--AESKRS----------------LMNEI---AKLQADIDATQ
A0A2A6REI6      VE----RNEA-LQGERF--VATRAS----------------LEQEL---EKLQLEIDTTQ
A0A426TTK3      VQ----GNEA-LQGERF--VATRAS----------------LELEL---EKLQSEIDATQ
A0A3M1LAM5      VR----QSPA-SQE-----GVERDF----------------VLKEL---NDTQAKIEEAQ
A0A536BZ00      IK----LSPT-LQG-RN--PAIEQS----------------IASNL---TALQQVIEDTQ
A0A7C5LUL4      IE----QTDK-ARAQRI--ADSQAN----------------VTREM---QALQSELEGTQ
E8N5M1          AE----QLQE-MQISRF--KASKEN----------------LQNQL---SYLEQQIQE--
A0A7X1U027      AD----DNA---------------------------------------------------
A0A1F8U7F0      ID----QNEE-LQAVRY--LTSEQN----------------LQSQI---DQVQSQITTMQ
A7NIZ1          SE----QNRE-LQSERF--AESKRS----------------LAG----------------
A0A0P6XM68      IE----RNSR-MQAERF--NESERS----------------LEAQI---AQIDAQIEALQ
A0A2N2MEG3      IA----RNVQ-MQFERF--ATSEQS----------------LEAQI---EQVDAQIETLK
A0A353RQ31      ID----ENEQ-LQAIRY--ISAEQN----------------LQNRI---DETQQQISLLE
A0A3B9KNR2      IE----QNEQ-LQAIRY--IAAEQN----------------LQNRI---DETQQQISLLE
A0A0P6XME1      LE----QNAK-IQSSRF--SASEES----------------LQAQI---QQVEAQIADLQ
A0A3B9Q1T8      IQ----NNER-LQSLRF--ESTEAN----------------LQRRA---EDALQQMEELQ
A0A363SX22      V-----------------------------------------------------------
A0A326UPN3      A------------------------------------------------QYQNTQLG---
A0A455STY5      A------------------------------------------------QYQNTQLG---
A0A3D0UNQ0      IL----ISPTSLQSPED--ENARLF----------------VQERL---QDLQKKIEASQ
A0A7W1A7Y8      I-----LLSPSGPQSAE--AQILAE----------------VQAQI---STLKQQINEAD
A0A2G6GG97      I-----FENQKRESLRY--ADPINN----------------WEERL---QEIGDQIETIE
A0A7C5QIC8      A-----EQHAQIASTSY--SSSMQS----------------LDREM---QQLQSQIQATQ
A0A1F8PTW9      I-----LMSPSNAQPEE--QGRQEF----------------INQRL---NILEVQINETE
A0A1F8QH26      I-----LLSPTTEHTED--QVRQEF----------------INERL---SVLETQINDTE
A0A535D584      A-----AQATAQSERDI--DQAGAA----------------LQSEI---QKVEASLLQEN
A0A521TS25      I-----AQVVDEQLGQT--TSTKQV----------------LQQQI---AEMERQIRGAT
A0A7C3TYQ9      S-----IQNEQMQLSRY--SSSNEN----------------LQKQM---EAVNLDIAAAE
A9B6E3          I-----LTSPAGPQSAE--AKLLDE----------------VNRQI---ATLNEEITRTD
A0A3M1H759      IL----QSPTSPQNKAR--QERAGF----------------VQAQL---DDLERRIQDAQ
A0A7C3J9I4      IL----QSPTSPENEAR--QERSQF----------------VQKEL---DDMEAKIETAR
A0A7V7XFT9      LRLAPGSSLDEEQIAFI--EGELAA----------------LAEDI---NTLRQEIDDID
A0A497ASN6      I-----EERAQGQARRF--GSLKTS----------------IETQL---ANIDEEIAKLD
A0A3D1TRD4      I------------------------------------------------TQQHDRMAKGD
A0A7V9AZN2      E-----SYVAEVAAAEI--SQTRGA----------------IEQEI---RQTGDELAQAD
A0A7C5IJ97      I-----------------------------------------QQNF--------------
A0A7C3FJ85      M-----EENRERQTARF--QDALAR----------------LQKQI---DALEQDIGEYR
A0A3M1ZZ81      I-----EQNRERESLRY--AEPIQN----------------WETRL---DEIGNEIQAIE
A0A7C2TBJ3      I-----MQSPTSSRQLS--SERQAF----------------VDQQL---AEMEASILATE
A0A3C0XJG2      V-----EQVRALQSSLQ--STTATQ----------------LDEEI---SSVEADRQRID
A0A7C3NE64      IL----QSPTSPENQER--RERRQF----------------VQNQL---DDLEQRIQTTQ
A0A7C4V0A1      I-----RQNSALQEARF--AESLEN----------------IKAQI---SELSGLMEQTQ
A0A847FKN0      G-----EWLNDIQQSRY--SDSKVS----------------LEAEM---ARAQASIQEVE
A0A6J4UI39      S-----VVISQRSTQLS--SGSREA----------------LQTQI---TGTQQQIADLT
A0A521IC37      IL----QSPISQQQKAS--DDQRAF----------------ITEQQ---ALMQSQIVVGQ
A0A7C1K503      I-----AQNAAQQTSRF--ASSKES----------------LSKEI---AAVQASLAQTQ
A0A535IMD1      I-----AQSPTPSEKQQ--EEHRQF----------------VDAQL---KDLQDRIDQAK
A0A7V3K428      I-----LETTRQQQERL--ASRRQA----------------DEDTLRLRQQLEEELRFYD
A0A5C7JS64      Q-----TFAQERTQELT--GPYREA----------------LNVQI---AETQANIRTTQ
A0A3A0B2P8      LQIGPGMQEGSEYQAFI--ADQLDQ----------------MEKGI---TETTAEIERVK
A0A497AF06      IS----LHNTEQQLQNI--AVLEQD----------------VVKQM---ANLKEAIEYNQ
A0A661W444      IS----LHNTEQQLQNI--AVLEQD----------------VVKQM---ANLKEAIEYNQ
A0A7W0KC11      S-----SYVTDQADARA--EATQGD----------------IDAQI---EALEARIIELD
A0A838GDL6      I-----AYVNQEAQDQL--EVQVSG----------------VEDRI---LEIEAERIDLV
A0A7W0AAE0      T-----LYVIEESQAQV--QNQVSG----------------INTSI---ADQDVQLELVE
A0A7W1TGR0      A-----DQTQNTRASRF--GISKDS----------------LQQQM---SGLDKQIHQTE
A0A497BNC7      I-----EQETSQQQARF--QTGLSE----------------LETQI---KTLETSIAETQ
A0A7C6DKX5      IL----QSPTAQQESER--ARRSGF----------------VERQL---DSLQGQIQSAE
A0A521UD91      I-----DQRHEDQIGQL--SASRGV----------------LRQQI---ADLEKQLKDTS
A0A7C7DWW4      ILLSPGGQERQQREVFI--QEQLRK----------------LEQGM---RDTEAEIVRKQ
I0I8T2          ILLSPGGQERQQREQFV--QEQLRK----------------LEQSM---RSTEEEISRRQ
A0A8B5XE16      S-----TYIREVQAEVS--TVGRQG----------------IVDAL---TEVDDQIAVTQ
I4EI06          I-----DQTRDQNVAAT--GTSREA----------------LQKEI---DAAKQQIDDLT
A0A522N7L9      L-----TVSPAIQ-GTG--SASEQF----------------IQAQL---QATQSQIQQLQ
A0A535W4H1      I-----AASPTVS-GQQ--VDFAKA----------------IDEDL---QATRTEIESAS
A0A3D0D4X6      A-----NRNAEQQSERF--AASKES----------------LQRQL---DTLAGDIEDAQ
D1C8M3          I-----EQTQQRQAEIA--GPGADQ----------------VQQNI---EAIQRQIDEAN
D1CAL1          I-----EETHAQEDAAT--WSGRDE----------------LRRQI---EEVQQRIEDTS
A0A7W1THS1      T-----AQTHEMQTARY--ASSQQR----------------LEQQM---AVLDKQTQQMS
A0A7C4K810      I-----NENTALQEMRF--ETIKKS----------------LTEQL---NELQGRIDEIN
A0A7V2PIU4      I-----EFNNAQQTARY--QESKLS----------------LQQQL---EQLNKDVRNTE
A0A7C3FPG2      V-----EFTNQQQTARY--QELKQS----------------LQDQL---QQLSEEIQATD
A0A7V5BPS1      V-----EFTNQQQTARY--QELKES----------------LQSQL---EEISQEIQTTD
A0A7C5MIR7      M-----KQNAEQQAARL--DSSKQI----------------IKQQM---QSSQAEIVSTQ
A0A7L5YLH3      I-----QQHNERQLXRS--SRNRAS----------------LDKEI---RSLSSNISQVQ
A0A800D757      I-----ERNEAMQLSRF--ASSKEN----------------LAKQL---AAIEKDIEATQ
A0A7C5ARI8      I-----EQSRERQTARF--AASKQA----------------LEQQI---AEVEQEIAQLQ
A0A1J4ZRV4      I-----AQNQELQMGRV--SESKAS----------------LEREI---TSVEADITRTQ
A0A1V5RXW5      I-----EQNQELLLGRL--SQSRAN----------------LEQEI---ANTEADIARTT
A0A2E5F6N9      Q-----SQTREKHLADI--AEFMGV----------------AQSQG--------------
A0A2E6J6X7      I-----DYVIERRLTEI--ARLQAA----------------ASAQG--------------
                                                                            

A0A7X1PB30      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A847FV42      ------------------------------------------------------------
A0A3A4VPK9      NQINHASIKTIEEQEQWIQEQINVLQQESETLPVEISQMGNPATPEERDALEQKKARLEQ
A0A3D0CW53      KQVDELEKQLALESSARAI-----------------------------------------
A0A535RWE5      ------------------------------------------------------------
A0A7C5A5U0      AQIEKEKQAAYQQALTSAQQKIQDTQQMIDNALAEIARLKALGSAANAQYRLNVAQRQEE
A0A0P6WSP2      SLSSQSIAHGSKMVHLQSQIDLDRGDYQF-LQQSYFVAQSQADQIAEKIQIVEDAVVKEA
A0A7Y4RFU7      TDLGKATTKALTEQLANAKTNIDLTEENIDAIEAEIARLQAVGNTARAQTLLVTNQNRQD
A0A5C7JWY1      ---AEEALIKQFSQDIEIMPIRGARLAHVTANAIEPELAAEIANTLVSVYIERNQELSAN
A0A1F8QGH2      EEETKLVRLQTFVAELRADLQT--------LQQNQEELQSTIDEAANSVMIVEDAQVLTQ
A0A1Q7TTL6      E-------------ALDARMDVDGSFLRVELRGHDPKRTTAIVNALAQRYVQVYADLKRQ
A0A0S8KFR9      DSVARENA---RVDALKARIRSEEEVYASLLSQYEQARVAEAARENSVTIVAPAVKPAAR
A0A535SLQ0      QVLSRDAAISQLLTELRVRPRMRTDIVDVAYSAPDPSRAQQVVNRVVDVFRAASAEAAQR
A0A1F8SS27      SRLAEI------------------------------------------------------
A0A2E0L5X9      SQYNQL------------------------------------------------------
A0A3A0AXU8      NEIRNL------------------------------------------------------
A0A359HML3      AELEDL------------------------------------------------------
A0A3M1EJ46      AERAQI----------------------NRGGSNSRSLPT--------------------
A0A7C1G8J6      ADIKSL------------------------------------------------------
A0A3D1U3H5      KDMASA------------------------------------------------------
A0A0M8KAF3      QQLDAL------------------------------------------------------
A0A523V9H6      EAIDDL------------------------------------------------------
A0A2U2S5W9      QQVAEL------------------------------------------------------
A0A7C3W344      KQVADL------------------------------------------------------
A0A2N2MEK3      EQINRLTMENVEEQIGQAETKIAELQSEIASLENDIFYTT--------------------
A0A3B9J9U6      EQINRLTMENVEEQIVQAEAKIAQLQSEIASLENDIYYTT--------------------
A0A661VSD8      AEIADL------------------------------------------------------
A0A1W9UQ51      GQIEEL------------------------------------------------------
A0A497B563      GQIEEL------------------------------------------------------
A0A7V2VGP5      GQIEEL------------------------------------------------------
A0A497C1E5      GQISEL------------------------------------------------------
A0A7C0TV81      ERINAL------------------------------------------------------
A0A3D1JCW0      NALDAI----IQNNLKQLQSSGENVEAQPTAALLERARML--------------------
A0A2N2MJJ0      EKITVRSAEVLEEQKTNFESQISDTRAQIAELESEIASLP--------------------
A0A7C3QTG6      TEIDNVSAETVLQQQQQVEAQIATLQVEVSQLEAEIQELS--------------------
A0A7C2TGF5      QRVREIDAAME-------------------------------------------------
A5V160          AEIAVLRG----------------------------------------------------
A0A2A6REI6      AQLNEATG----------------------------------------------------
A0A426TTK3      AQLDQATG----------------------------------------------------
A0A3M1LAM5      AQIDQLRDKML-------------------------------------------------
A0A536BZ00      TRITALLN----------------------------------------------------
A0A7C5LUL4      RALDVARD----------------------------------------------------
E8N5M1          ------NSSALEKILQENISEVKRTNPDAANGTLSNATIE--------------------
A0A7X1U027      ------------------------------------------------------------
A0A1F8U7F0      TQINDISEATVQDQLTQVKAQIEPLQTQVTTLETEIADLQ------------------KN
A7NIZ1          -------------EIAKLQSDIDTTQAELAALRGIDDPVR--------------------
A0A0P6XM68      SRSTAATTEQSEQQIEKAKSELDRLQTEILAIRTALDTLR---------SPKAEAGWYST
A0A2N2MEG3      TRSEAVSSAEAQEAIAKTQTEIERLQGEILALQNELDLVK---------SPGRLPNSLST
A0A353RQ31      KQINELSTATVESQLESVQKQILETQSQMTALNVEVAKIN-------------------P
A0A3B9KNR2      KQINELSTATVESQLESVQKQILETQSQMTALNAEVAKIN-------------------P
A0A0P6XME1      RQLAQTSEQSNEKRIQDVTNIISGLQSEINQLQADIVRIEAERDPILGVNSLGQPARVTP
A0A3B9Q1T8      NRIDQVTEKNVQEQLITVQSEIETLQSQVTDLELNIASID-------------------P
A0A363SX22      KYVEELYG----------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3D0UNQ0      ARLDELASAMDVAPT--PEEK---------------------------------------
A0A7W1A7Y8      ADITALKQ--------QVEEI---------------------------------------
A0A2G6GG97      TEINTLNA-------QGKEIT---------------------------------------
A0A7C5QIC8      QALDAERA-----------KA---------------------------------------
A0A1F8PTW9      DEIKKLQEDLGNMIS--AQQI---------------------------------------
A0A1F8QH26      EEIKQLQEELGSIIS--AQQI---------------------------------------
A0A535D584      QQLAALQR----------------------------------------------------
A0A521TS25      DGMERERR----------AGG---------------------------------------
A0A7C3TYQ9      KTLESLKA-----------AS---------------------------------------
A9B6E3          EEIKTLKA--------EIEQI---------------------------------------
A0A3M1H759      AEVKKLEAELETAFS--ARQI---------------------------------------
A0A7C3J9I4      GRIAELEAEVSAAVS--ASQI---------------------------------------
A0A7V7XFT9      AELRADIP---------SERR---------------------------------------
A0A497ASN6      KQRGKAQT----------------------------------------------------
A0A3D1TRD4      A-----------------------------------------------------------
A0A7V9AZN2      EQLGVLEA-----AA--DAND---------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      VRLDSVSD----------------------------------------------------
A0A3M1ZZ81      TEINALGT----------PET---------------------------------------
A0A7C2TBJ3      NEISTTQEELAKLTS--AIQI---------------------------------------
A0A3C0XJG2      DELSRLRAALAALPAFPQGPP---------------------------------------
A0A7C3NE64      TRMEELKAELVTALS--ARQI---------------------------------------
A0A7C4V0A1      RQLEALKA----------AGA---------------------------------------
A0A847FKN0      AAIREVQA----------RQD---------------------------------------
A0A6J4UI39      LQIQQLEA-----AE--AAGA---------------------------------------
A0A521IC37      KQLTEL-------SQ--QAAL---------------------------------------
A0A7C1K503      AALDALGE----------PDT---------------------------------------
A0A535IMD1      ADIGELEKSIVNEVS--ARRI---------------------------------------
A0A7V3K428      EQSAYVRSRIAELRV--QGAS---------------------------------------
A0A5C7JS64      QMIDDLVK-----TK--DVTS---------------------------------------
A0A3A0B2P8      TELTGM-------FS--ARQI---------------------------------------
A0A497AF06      SAMDQSRI----------SSG---------------------------------------
A0A661W444      SAMDQSRI----------SSG---------------------------------------
A0A7W0KC11      SRLAQLGN----------GQD---------------------------------------
A0A838GDL6      AELETLQE----------AGA---------------------------------------
A0A7W0AAE0      SELADLDR-----PE--NDDN---------------------------------------
A0A7W1TGR0      ASLAQAQT----------------------------------------------------
A0A497BNC7      AEIAALGA-----PE--SAPS---------------------------------------
A0A7C6DKX5      RKIAELQAKLPEQTS--ATAI---------------------------------------
A0A521UD91      QALEAAKA-----AF--YPN----------------------------------------
A0A7C7DWW4      DELSTMLS-----AR--QIGQ---------------------------------------
I0I8T2          TELSAALS-----AR--QIRQ---------------------------------------
A0A8B5XE16      ERIDQLES-----LD--GLGA---------------------------------------
I4EI06          TQVANLRG-----RP--DAST---------------------------------------
A0A522N7L9      GQISALTA-----VA--DRTP---------------------------------------
A0A535W4H1      MEAARLQA-----IT--SPTP---------------------------------------
A0A3D0D4X6      GRLTRERA-----AN--PRN----------------------------------------
D1C8M3          ARIAELQA-----QP--NAGD---------------------------------------
D1CAL1          SRIAELQQ-----SG--ASGT---------------------------------------
A0A7W1THS1      SQLGGLKD-----IP---------------------------------------------
A0A7C4K810      SQLSRLGD-----SS---------------------------------------------
A0A7V2PIU4      AAIEEISG-----EG--ADA----------------------------------------
A0A7C3FPG2      ARLQAL-G-----DA--TDA----------------------------------------
A0A7V5BPS1      ERLQAL-G-----DA--TDP----------------------------------------
A0A7C5MIR7      QSIDAERV-----KA--T------------------------------------------
A0A7L5YLH3      TKITELEA-----ST--SRTA---------------------------------------
A0A800D757      QTINTLQS-----SG--S------------------------------------------
A0A7C5ARI8      QEAAQA------------------------------------------------------
A0A1J4ZRV4      DALNAV------------------------------------------------------
A0A1V5RXW5      DELSRA------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A7X1PB30      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A847FV42      ------------------------------------------------------------
A0A3A4VPK9      VELLL-------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      ------------------------------------------------------------
A0A7C5A5U0      QLKALLENQQNELEELRTWDELRRHHW-------------------------------GE
A0A0P6WSP2      AGSRGFSAYLTLLVDPSLIIGQGTYSTVTNSARVASAYGEIWTG--------------ES
A0A7Y4RFU7      QNQNLLAQQLADYQTLQDKLATD-------------------------------------
A0A5C7JWY1      SKELAAQWFTTHLEELRQKVQNSQQALYLFRAK-------------------------HG
A0A1F8QGH2      EDSFFYEATVTLLVDQVHERSGDNYAAILANERLAQTYGEILAG--------------RK
A0A1Q7TTL6      KLVELTKILGEQLQHSQDNLRSAEADLQRFREQTITLPSDRPPTVGSGSVAGAAGGGGAA
A0A0S8KFR9      DGPQVSYLATATVRVTQPYSAFPGYAEYGYVERLMNTYVELLKT--------------QP
A0A535SLQ0      QSRLRREFLDAQLKVNDSVVADAQQALTAFRRRAHS-------D--------------GS
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      -----AQNADTDTSSLE-------------------------------------------
A0A7C1G8J6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A7C3W344      ------------------------------------------------------------
A0A2N2MEK3      -----NRGRNPDLAPTE-------------------------------------------
A0A3B9J9U6      -----NRGRTPDLAPTE-------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A7V2VGP5      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A7C0TV81      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ----AESTSLAAEKRSQ-------------------------------------------
A0A7C3QTG6      -ASPSADQTLLADRQAR-------------------------------------------
A0A7C2TGF5      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A7X1U027      ------------------------------------------------------------
A0A1F8U7F0      RYPTEEENAQLAEKEAT-------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      PTPSPEIRAEINQKELE-------------------------------------------
A0A2N2MEG3      PTPSPETRSQINEGTLR-------------------------------------------
A0A353RQ31      ATATEEEKARLAEYQAQ-------------------------------------------
A0A3B9KNR2      ATATAEELTRLAEYQAQ-------------------------------------------
A0A0P6XME1      TLTVDQQIEL-TQKRSR-------------------------------------------
A0A3B9Q1T8      LYATDEELQQRIQFQAE-------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A7W1A7Y8      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A7V7XFT9      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A7V9AZN2      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A847FKN0      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7V3K428      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A7W0KC11      ------------------------------------------------------------
A0A838GDL6      ------------------------------------------------------------
A0A7W0AAE0      ------------------------------------------------------------
A0A7W1TGR0      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A8B5XE16      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7W1THS1      ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7V2PIU4      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A7V5BPS1      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7L5YLH3      ------------------------------------------------------------
A0A800D757      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A7X1PB30      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A847FV42      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      ------------------------------------------------------------
A0A7C5A5U0      FGLENAGEVAAKQARLEELSQLVDQTQQQLDEVEQTIA----------------------
A0A0P6WSP2      YMQAVIDELGLDRDADDLANDVYFEPIPSTQLVRLRVDDPSAAQAKTLVEVIGRNIVQTT
A0A7Y4RFU7      --PQVQQDASLAAAIQSQMAELGVAINGTRDQISSLADEIT-------------------
A0A5C7JWY1      LLTGEERKSVAAHTLAELNSQLVKTEMAKAEAQSRFQQIRSVLNPQGAGTAGLGWSKLDS
A0A1F8QGH2      VMEAAISRIKSDESPDDLMNKVKVETVSGTQLIRLSVEDTNANQAKLLADAIAGAFLDEI
A0A1Q7TTL6      GAPDGARDPVFGGFFEMQITR--EEARRDRDALERVLAQYGDSGLSAEALAVVG------
A0A0S8KFR9      ILEEVLQKLDLPELPSALLQQIVIEVLPDTELLRITVEDRSPERARDIANALAGL-----
A0A535SLQ0      AQSSGREQTELPGL-ELQRQQLLAERRTDEDLLAALQESSTSRKAVQTALSTPGVAPSPA
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A7C1G8J6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A7C3W344      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A7V2VGP5      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A7C0TV81      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A7C3QTG6      ------------------------------------------------------------
A0A7C2TGF5      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A7X1U027      ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A7W1A7Y8      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A7V7XFT9      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A7V9AZN2      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A847FKN0      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7V3K428      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A7W0KC11      ------------------------------------------------------------
A0A838GDL6      ------------------------------------------------------------
A0A7W0AAE0      ------------------------------------------------------------
A0A7W1TGR0      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A8B5XE16      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7W1THS1      ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7V2PIU4      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A7V5BPS1      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7L5YLH3      ------------------------------------------------------------
A0A800D757      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A7X1PB30      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A847FV42      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      ----LQGTAVQQ---------------------------------------LDEQIKQLQ
A0A7C5A5U0      ----WLTPLVEA-------------------------------------GAISKAIAQQE
A0A0P6WSP2      QTQ-LARPYTDR------------------------------------MQALQKQMDELS
A0A7Y4RFU7      ----WLTSLAET-------------------------------------GVFDKTLDDKE
A0A5C7JWY1      QIQVLNSPLIQT---LRAQEITVSAQVAELSEKYGPLHPKLAHMKAELQDLRQRTQQEVQ
A0A1F8QGH2      QVL-LTEPYVTR------------------------------------LEALQTHIDDLY
A0A1Q7TTL6      SVQ-LNGELSQALKELTDKQAQLRAYRYKYSDEYPPVQRLIGDIATLQRQTIPRLARVLA
A0A0S8KFR9      LVE-QGQTLYSG--------D-----------------------TKSAREILQQRLSAVE
A0A535SLQ0      VVQ-LNTQLFQY--------EMARDSLASLSTSHPDLPRLNVLISATEGKLLRAVQAGIQ
A0A1F8SS27      -----EVEMVQV------------------------------------------------
A0A2E0L5X9      -----VQEAATI------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      -----SQLLGEL------------------------------------------------
A0A3M1EJ46      ----ASAKDGRQ------------------------------------------------
A0A7C1G8J6      -----RSAILNM------------------------------------------------
A0A3D1U3H5      -----TKKQAQA------------------------------------------------
A0A0M8KAF3      -----G------------------------------------------------------
A0A523V9H6      -----D------------------------------------------------------
A0A2U2S5W9      -----EKQLGGA------------------------------------------------
A0A7C3W344      -----EKQLGEA------------------------------------------------
A0A2N2MEK3      ----WTARLAQL------------------------------------------------
A0A3B9J9U6      ----WTARLAQL------------------------------------------------
A0A661VSD8      -----NDSLADL------------------------------------------------
A0A1W9UQ51      -----TASLSEL------------------------------------------------
A0A497B563      -----TASLSEL------------------------------------------------
A0A7V2VGP5      -----TASLSEL------------------------------------------------
A0A497C1E5      -----TASLSEL------------------------------------------------
A0A7C0TV81      -----TTSLADL------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ----VEQLQSLL------------------------------------------------
A0A7C3QTG6      ----LGQVQPLL------------------------------------------------
A0A7C2TGF5      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A7X1U027      ------------------------------------------------------------
A0A1F8U7F0      ----LAQVKPIL------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ----LKELETTY------------------------------------------------
A0A2N2MEG3      ----LRQLQSTY------------------------------------------------
A0A353RQ31      ----LDQLSSVL------------------------------------------------
A0A3B9KNR2      ----LDQLSSVL------------------------------------------------
A0A0P6XME1      ----LDELRSLL------------------------------------------------
A0A3B9Q1T8      ----LGQTQSIL------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A7W1A7Y8      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A7V7XFT9      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A7V9AZN2      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A847FKN0      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7V3K428      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A7W0KC11      ------------------------------------------------------------
A0A838GDL6      ------------------------------------------------------------
A0A7W0AAE0      ------------------------------------------------------------
A0A7W1TGR0      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A8B5XE16      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7W1THS1      ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7V2PIU4      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A7V5BPS1      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7L5YLH3      ------------------------------------------------------------
A0A800D757      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A7X1PB30      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A847FV42      ------------------------------------EQARLDAANSARAIQQYLANIAAL
A0A3A4VPK9      --------------PLYEQSYTDLIVYGKQVDGAN-TSAGSQLTLLNTTQSLYQQIYVSV
A0A3D0CW53      ------------------------------------QDIQGQIGALQQTITTWQATYASL
A0A535RWE5      DDIK----------GLDVQIAATAQQAQK--------------VQLDSQRQTKQQTLAQL
A0A7C5A5U0      KIAS----------EQQSLLAAYQDSYGRLLASSVESTTSTEIANLEKQLGLYQQIYLSL
A0A0P6WSP2      AQIE----------SAQAEIMTISAQKAQ--IEADLIKEESAKTKLSQD-------YQVL
A0A7Y4RFU7      HELV----------SQQELLVSYQEIYTRYLVTGKVDGTTDEITSLEKNLNLYQQIYLNA
A0A5C7JWY1      KIYDSVKHQYDMAVAQDKAVKEAITRYNT--DKIRLEQNEIEHSMLERDADTSQHLYDVF
A0A1F8QGH2      EGIE----------ATQAEIESLSAEKIR--AETELA-------RLESRLVEDRNDYRAL
A0A1Q7TTL6      GQLA----------AKETELGRRVDADAR--ALRQIPARAIEEARLRRDANLAENLYTTL
A0A0S8KFR9      GNLE----------QDREALQDLLDSSAR--ENARID-------ALEMRIRSEEEVYLSL
A0A535SLQ0      GAIA----------SLDGRIAAINDLRAR--RAGNLQ-RDAEEARLTERVDNARKVTDEL
A0A1F8SS27      --------------KSAEQL----------------SELQRELNTLASLITSWENTYTQY
A0A2E0L5X9      --------------TSAFEL----------------NQNIEDRGEIEKSIQELRTLLLSL
A0A3A0AXU8      ------------------------------EQGPQSVETTQRTLELRDRILQYRTERIGV
A0A359HML3      --------------NSAREI----------------SDTQNQISSLKNSLASLQLNYANL
A0A3M1EJ46      --------------QALAEE----------------SARLAEVASLDAALQEARGSYARL
A0A7C1G8J6      --------------TSATEI----------------NEAQSRIRELEQLKRDNQSTYSQL
A0A3D1U3H5      --------------GGAGNA--------------QTQDLTREIDQDRTAINNLQTQLVTL
A0A0M8KAF3      ----------------TPET----------------EAEQTRQQQLQTLLTQQQAAYTTL
A0A523V9H6      ----------------APET----------------TEGLAELARLQTILAGYRNTYATL
A0A2U2S5W9      --------------FSARQI----------------QDLQGQINVLQNQINTWQANYAQL
A0A7C3W344      --------------FSARQI----------------QDLQGQINVLQNQINTWQANYAQL
A0A2N2MEK3      --------------KSTLELYQQIYANLLVLGKPTSSGASDRLTHLQKTLELYQQIYLQL
A0A3B9J9U6      --------------KSTLELYQQIYANLLVLGKPTSSGASDRLTHLQKTLELYQQIYLQL
A0A661VSD8      --------------TSAAEI----------------ADTMARIDALEQVASTYRTQYAAL
A0A1W9UQ51      --------------TSAAEI----------------QDVQDRIAALEEVKSTYQSTYADL
A0A497B563      --------------TSAAEI----------------QDVQDRIAALEEVKSTYQSTYADL
A0A7V2VGP5      --------------TSAAEI----------------QDVQDRIAALEEVKSTYQSTYADL
A0A497C1E5      --------------TSAAEI----------------QDVQDRIAALEDVKSTYQTTYANL
A0A7C0TV81      --------------TSAAEI----------------QDAQDRIAALEEVKNRYQMTYANL
A0A3D1JCW0      --------------------------------------NAAEIDRLETRISQYRQLYASI
A0A2N2MJJ0      --------------RSYESAYNTLMVQKKIL-----AADDEELTQLEKTFNLYQQIYLNL
A0A7C3QTG6      --------------ELYQQIYTDLVVLGKPVTSGDETS---RLSQLQTTMQLYQEIYINL
A0A7C2TGF5      ----------------------------GSLSPTEMAELQVEKTTLEGLIADYVKNYVEL
A5V160          ------------------------------------IDDPTRRARLEEALVQYRSSYATV
A0A2A6REI6      ------------------------------------AANAAERSRLQELLAMYRTSYASL
A0A426TTK3      ------------------------------------AANAIERSRLQELLAMYRTSYASL
A0A3M1LAM5      ----------------------------GMTSAVELSEAQARLAELEQLKSNYRADYVRL
A0A536BZ00      -------------------------------NTSRTNAEDQELADLQSRLVTLRQTYVTL
A0A7C5LUL4      -------------------------------GTTPNTA---EVARLEALLAQQRSTHASL
E8N5M1          --------------------------------NLARQINQAEIDRLETRLAQYRQIYASV
A0A7X1U027      ------------------------------------------------------------
A0A1F8U7F0      --------------TLYQQLYTNLVVLGQPVDTGTNTSTRLQ--QLQTTLSLYQGIYVNL
A7NIZ1          ------------------------------------------RARLEEALVQYRSSYATV
A0A0P6XM68      --------------DLYQQIYTNLVVLGESRNENSANVEQE---QMQSTLALYRQIHANL
A0A2N2MEG3      --------------DLYQQIYTNLVVLGQNRAVGEADTEQE---QMQSTLALYRQIRANL
A0A353RQ31      --------------SLYQQIYTNLVVLKTPAESGTTTATSAQLTQLQTTLNLYQQIYLSS
A0A3B9KNR2      --------------SLYQQIYTNLVVLKTPAESGTTTATSAQLTQLQTTLNLYQQIYLSS
A0A0P6XME1      --------------SIYQQIYVNLTF--SPSNQGNSNSTNS---QLQAALVLYQQIYANL
A0A3B9Q1T8      --------------DLYQELYTQLVVLGKPIDQENPSSRQSD--RLERTLSLYEQIYFST
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------SQIQAEMNDLEGILVEWENTYARF
A0A7W1A7Y8      ------------------------------------GADKPEVAGLISRLQLNQQLQSEN
A0A2G6GG97      ------------------------------------PEESATLSRLETNLNEAQIRYTET
A0A7C5QIC8      ------------------------------------IPSSAEIARLETLAAQYRSTYADL
A0A1F8PTW9      ------------------------------------DETQIQISSLQSKLSTMQDNYGTL
A0A1F8QH26      ------------------------------------EEVRSQISSLQSKLSDMQNTYATL
A0A535D584      --------------------------------------GHQDTMALAGQIQADTATLTQL
A0A521TS25      ------------------------------------EQSASRIAVLQSDLGQFQATFAQL
A0A7C3TYQ9      ------------------------------------EPDQLEISRLTEQLLQYRTTYANL
A9B6E3          ------------------------------------GADKPAAESLIANLQLKQQSQNQN
A0A3M1H759      ------------------------------------RDLQSDIASWQSLINEWQRTYTNL
A0A7C3J9I4      ------------------------------------QSLQDEITNLDNLIRGWQRNYTEL
A0A7V7XFT9      ------------------------------------SELEASRFQKQSTLNTWQTSYTTF
A0A497ASN6      ---------------------------------------QEDVKVIEQQLVNLRDMRTRL
A0A3D1TRD4      ------------------------------------------------------------
A0A7V9AZN2      ------------------------------------PAVRRQITSLTADRERLAREWTEL
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ---------------------------------------SAERSELESQITRLQDSLSRL
A0A3M1ZZ81      ------------------------------------PEEEAELSRKDTKLKELQIQYTEA
A0A7C2TBJ3      ------------------------------------ADTQQRLAALQEKLSLLRNNYANL
A0A3C0XJG2      ------------------------------------ADLRSQISQLESTGTARQDTLAQL
A0A7C3NE64      ------------------------------------QELQTEITSLEELINNWQANYAEL
A0A7C4V0A1      ------------------------------------SSDQAEVARLEGILAGYRNTYSEL
A0A847FKN0      ------------------------------------EADANELARLQDQLGQYRSSYTTL
A0A6J4UI39      ------------------------------------TDVSSQLGSLRVTLTQAQIVYGDL
A0A521IC37      ------------------------------------ETDQAKLDNLNTRISALQTKIENW
A0A7C1K503      ------------------------------------PEEQAQKTQLETSLAQYRSSYANL
A0A535IMD1      ------------------------------------QDVQSQIAAKQSQINQWQATYAQL
A0A7V3K428      ------------------------------------PERDEELMRLQTYLVNLEDLRIKA
A0A5C7JS64      ------------------------------------PEVAAQIETLRTQLADYQSTYREL
A0A3A0B2P8      ------------------------------------QDARSQITALEAKLATLQANFANL
A0A497AF06      ------------------------------------MLTEEETNLIQTTLSNQQLAYASL
A0A661W444      ------------------------------------MLTEEETNLIQTTLSNQQLAYASL
A0A7W0KC11      ------------------------------------AATQQQIADLSAERTLVNESLMEL
A0A838GDL6      ------------------------------------SENGTRIDEIEIRIAQLDSQVETL
A0A7W0AAE0      ------------------------------------DEVQAQIRELETERTELESLLNSL
A0A7W1TGR0      ------------------------------------NNDKAKQDQLQASLTQYRSIYANL
A0A497BNC7      ------------------------------------EFAQLERTRLESQMTRDQTRLVVL
A0A7C6DKX5      ------------------------------------KEIQDQITSLQLQITTWQATYANL
A0A521UD91      ---------------------------------------TAEITRLQNVLSTAQVTYSQL
A0A7C7DWW4      ------------------------------------T--ETQIAALEAKLATLQSTYVGL
I0I8T2          ------------------------------------L--EDQIAALEAKMASLQSTYVNL
A0A8B5XE16      ------------------------------------LGQTAELAQWQALLTQLEQSRESL
I4EI06          ------------------------------------AAVQAQIADLEARLGQQQSSYDGL
A0A522N7L9      ------------------------------------SQ-DQELQALNGQLGTARSTYATL
A0A535W4H1      ------------------------------------RD-QADLFALQDRLASLRSTYASL
A0A3D0D4X6      ---------------------------------------EDEIDRLESRVTQLRNTQSSL
D1C8M3          ------------------------------------PAVQEEIRNLQAQLAQFTETHSAL
D1CAL1          ------------------------------------AV-QTELRTLQTQLSQDQALYASL
A0A7W1THS1      ------------------------------------EN-KGEHDRLDTTLAQYHQSYANL
A0A7C4K810      ------------------------------------RD-EAERSRLQTILAQYRQIHSSL
A0A7V2PIU4      ------------------------------------E---GRRTLLEDRLAQYRSSFGNV
A0A7C3FPG2      ------------------------------------ET-NSRRAILEDRLAQYRSTYGNV
A0A7V5BPS1      ------------------------------------ET-ASRRTILEDRLAQYRSTYGNL
A0A7C5MIR7      ------------------------------------PD-PNTLAHLETLLAQSRAAYQEL
A0A7L5YLH3      ------------------------------------AQ-DADLARLRDNLQQYRASYANL
A0A800D757      ------------------------------------AD-QAELARLQTALTQYQNSYASL
A0A7C5ARI8      ------------------------------------QG-E-KRNGLETRLTQLRDILARL
A0A1J4ZRV4      ------------------------------------TD-DNQRMRLETSLAQYRSTYSSL
A0A1V5RXW5      ------------------------------------TD-DAQKTRLETSLAQYRSTYSTL
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A7X1PB30      ------------------------VTIAEEARV--PKSPSKPDTRLNTMLAGMLGLMVVG
A0A1F8RRT9      ------------------------VSIVEPAST--PASPVRPRTTLNSIIGALAAVFIAG
A0A3M1EAN8      -----------------------YIEVVEPASM--PAYKLRPRPYFNTFVGALSAFLLAV
A0A6I1QLV0      ------------------------VSIAEEARI--PDDPVEPRTTLNTVIAVVLGLLLAA
A0A535FRM3      ------------------------IQIL-PALE--PTTPLRPRPLQDASIGSLVGLGLAL
A0A401ZA55      ------------------------FNTI-DPVV--PTDPVRPRPSQDSLIGALIGLGLAL
A0A4P6JS79      ------------------------PIIV-QALP--PTDPSQPKPSLDAGIGALVGLGLAL
A0A535QK16      ------------------ASSADNLVIWTPAIV--PVDPVSPKPLLNIGLGILAGLVVGL
A0A6L7WZR1      ------------------------LRVAQPAAL--PTVPIAPRPIVNTLVGIAFGLLAAV
A0A847FV42      QERLASYRATHSSYLDSVEGRTNYISVFEPAVR--PTRPVSPSVVSTVGMAAVIGLVLAV
A0A3A4VPK9      LNNLESVR------LAKL-QNMPNVVQIQPAIV--PDDPVRPRTMLNSVLGGIIALILSA
A0A3D0CW53      LD------------FSKG-SRTNYLSVVEPAVV--PTTPISPNIQRNVSLATAIAFVLAA
A0A535RWE5      LMTRDDIS------LAAA-RAQNTVSLWEAAVA--PAEPDSPHVGLNTALGAIVAGLLVI
A0A7C5A5U0      LNNRETVR------LERM-QNMPNVVQITPALP--SDKPVRPRTLLNTVLGGIGGFVLAL
A0A0P6WSP2      YDQMEQLR------KNAN-QASNSVMVVAQPSI--PDRPTQDRLLY-VLLAALLGGTVGI
A0A7Y4RFU7      LNNREALR------LARM-QNVTNIVQLNPALA--SETPVRPRVLFNMILGGMAGLILSI
A0A5C7JWY1      LKATKETD------LSSG-VRANNVYLADPAAP--SSMPSKPRTKLNIMLGLLAGLMSGV
A0A1F8QGH2      KQDYEQLQ------LTAN-DASQAVSIVEPAQL--PESPEEDRVLY-IGLAALTCAVVAI
A0A1Q7TTL6      QQKYDEAR------LAEA-SSLADVRVLDYAVV--PRRPVKNTRRRVVLLAFFGSFAMAV
A0A0S8KFR9      LRQYEEVR------VAEA-SRESSASIVAQAGQ--PDAPSKPRVKFNLALGTLVGAVGGI
A0A535SLQ0      RTEYQKAG------IAQA-VTVGQVEIVDHATL--PTKPAGIGLPEQLVLGLLVGLMLGT
A0A1F8SS27      LG------------FLQAKESPGTLTIIESAQV--SPKPINPQVQLIAFLATGLGFLLAL
A0A2E0L5X9      IEN----------------APRSEIQVFEPADP--NYFPLTANSVRDLLIAGVAGGVLAL
A0A3A0AXU8      LTSLAETQNALSSAFEEPSSDVDTIVVVDPALL--PVVARQRDFLQPMVAALVAALALGF
A0A359HML3      LSNTEK-------------GAINTLTIIEQPHV--PTSPVGSKMLVTVGLSAAVGFTLAA
A0A3M1EJ46      LESYLQVK------SAT--GGSVVISIVEPAAM--PARKVKPRVYFNTFVAGVVGLILAI
A0A7C1G8J6      LLSLNT-------------NRPNTLRVMEPAIV--PDQPVGPKLTLNVAIAGAIGLMLAV
A0A3D1U3H5      QSTEA--------------QTSANLDVRVPAQV--PHFPSSPHPVRSAAIAAFLALLAAT
A0A0M8KAF3      LRSYEEVR------LAEA-QAVDSIVVIDPATP--PERPVRPRVLLNTLLGGVLALVAVG
A0A523V9H6      LQGYEEMR------LTAA-QSTDNVIVAEAAEV--PDEPVRPRVLMNTALAGVVGAMLAV
A0A2U2S5W9      LN------------FIEG-GSPNYLAVIEPAQL--PTEPVSPRTSMNVLLAASIGVLLAL
A0A7C3W344      LN------------FMEG-GSPNYLAVIEPAQV--PTEPVSPRTTMNVLLAAGIGILLAL
A0A2N2MEK3      LGSLEEVR------LARLQNTPSIVQIEEAAVPGSPVRPLPFKTAML---GAAVGLMLGF
A0A3B9J9U6      LGSLEEVR------LARLQNTPSIVQIEEAAVPGSPVRPLPFQTAML---GAAVGLMLAF
A0A661VSD8      LQSYMG-------------DSVNVLSIVEPAVE--PRRPIGGKAKLIVAMSAGAGLALAL
A0A1W9UQ51      FNSYRA-------------ESPNALALFEPAVT--PQWPIPSKAKLIVAVAGAAGLVLAL
A0A497B563      FNSYRA-------------ESPNALALFEPAVT--PQWPIPSKAKLIVAVAGAAGLVLAL
A0A7V2VGP5      FNSYRA-------------ESPNALALFEPAVT--PQWPIPSKAKLIVAVAGAAGLVLAL
A0A497C1E5      LTSYSA-------------ESPNVLSFFEPAVA--PQWPVPSKTKLVVAVAGAAGLGLAL
A0A7C0TV81      LDSYQA-------------ESPNVLSLFEPAVP--PQWPIASKTKLIVAIASMAGVGLAL
A0A3D1JCW0      LSSYEQIR------LAEA-QTTTSFIQVEPATP--PEKPIRPRTLLNTALAAVVGLMLAI
A0A2N2MJJ0      LNNREALR------LARL-QNTLTVAKIDAAQV--NPAPIRPRTTLNTLLGGLAGLILAV
A0A7C3QTG6      LNNLEAIR------LARL-QNTPNVVQIESATV--PSSPVRPRPLMNIALAGTVGLMLAA
A0A7C2TGF5      LNY-----------AGQE-RKPNSLSVIESAQV--GEDPIRPKVQLFGLLGGGVGVALAL
A5V160          LRSLEEVR------LAEA-QLTNSVNVVETAVP--VTTPVRPRIVTNTAMAAVAGLLLAV
A0A2A6REI6      LKSIEEVR------MAEV-QQTNSVHTVEAAAV--PEYPVRPRIVQNTALAALVGLLLMV
A0A426TTK3      LKSIEEVR------MAEV-QQTNSVHTVERAVV--PDVPVRPRVMQNTALAALVGLLFMV
A0A3M1LAM5      AN------------LLNT-QSPNTLTIMEPASP--SRRPIAPNPKKSAAIAAVAGLILAV
A0A536BZ00      LG------------ISTG-SAANFLTVVEPARA--PTDPASPRLPINTGIGALMGLLVAV
A0A7C5LUL4      LQSYEEIR------LSEL-RAADTISIFEPAQV--PGVPVLPRTMTNVLLAAVVGAMLAV
E8N5M1          LASYEQIR------LAEA-QNITSIIQVEPATP--PDKPVRPQTLRNTAIAALVGIFLAI
A0A7X1U027      ---------------SQL-SSPGTVTIAKPAEA--PEQPTSPKLAFNLAFAIALGLIMAT
A0A1F8U7F0      LNSLENVR------FARV-QNTPNVVQVEPAVA--STSPISPRPFQSTALAAAVGLMLAA
A7NIZ1          LRSLEEVR------LAEA-QLTNSVNVVESAAP--VYTPVRPQIATNTGMAAVAGLLLAI
A0A0P6XM68      LSSYENIR------LARL-SSTSNIVSIEPAIP--PEEPLSPKPVRTGLLGGTVGLLLAA
A0A2N2MEG3      LSSYESIR------LARL-SSTSNIVAIDLAQV--PSSPIRPQPLSTAGLGAAVGLMLAA
A0A353RQ31      INSLEALR------LSRA-QNTPNVVQVEEAQI--PSVPISPKPGQTALLAGAVGLILTA
A0A3B9KNR2      INSLEALR------LSRA-QNTPNVVQVEKAHP--PSVPISPNPVQSATLSAAIGLILTS
A0A0P6XME1      LSNYEAIR------LARL-QSTPEVVQVEEARV--PSRPVRPQTTTNVLLGGILGLVLAA
A0A3B9Q1T8      LNSLEALN------LARD-QNKPTVAQIEAAAV--PVEPFFPRPIETGLLYGAVGLFAVG
A0A363SX22      ---------------------VYDLKILDLAEI--PVFPIKPNWKLNLALAAVLSLAVGM
A0A326UPN3      ---------------------GVSQLRVVPAIE--PTRPSKPQPTQDAIVGALVGFGLAI
A0A455STY5      ---------------------GVSQLRVVPAIE--PTRPSKPQPTQDAIVGALVGFGLAI
A0A3D0UNQ0      LQFIGGEE------S------ANYIAVVDKAHA--RLNPVRPTIRLNTLVAGLVGFILAL
A0A7W1A7Y8      RQILSTLY------STVLGNRSNTISVIEPAIA--QPTPIAPYPVQSGILAGLVGLMLSL
A0A2G6GG97      FNNLNDLQ------IKQAKE-TSNLIQIEEAKP--HEIPIRPRTETNVLLAAAVGGMIAV
A0A7C5QIC8      LQSYEGMR------VAAASS-SEALILTKPAKV--PAQPILPRKELNTALAGAIGALLGL
A0A1F8PTW9      LSNTQQGA-------------INSLTLIEPAAL--PSSPIGPKIGLTALLAAALGLMLAV
A0A1F8QH26      LSNTNQGA-------------INSFTVVEPAAL--PVKPIGPWLGLSVLLASLAGCALAV
A0A535D584      SANYSAFR------AQQGVD-VAHVSVAAAAVA--PAAPISRNLYTDAGIGAVAGLLIGT
A0A521TS25      LRSQQEMT------LSETRA-MNAVRLAEAAIE--PALPVRPQVGLNTIVAAIVGLILAA
A0A7C3TYQ9      LRSYEEIR------VAEAKT-LDTVTVVEPADL--PTAPVGPKTMTNTVLAGMVGAMLAV
A9B6E3          RQTLSTLY------STALGNRANSISVVEAATV--NPTPIAPRPIRSAILAGILGFALVF
A0A3M1H759      LDFLQGGD------S------PNYLSVVEPAVV--PDTPISPNIPQNVMLAAATGFLLAL
A0A7C3J9I4      LSFLEGEG------S------PNYLTVIEPAQL--PTVAVSPNIAVNVVVAAAIGFILAL
A0A7V7XFT9      LEQISD---------------PGAIEIVEAASV---GKQVSRNVSLYTILAVLVGAMLST
A0A497ASN6      LTSLYDIQ------LAEAQH-TELITQLEKADV--PDKPVRPRKLMNALIAGVLGGMLAV
A0A3D1TRD4      ---------------------SNAVSVVAPAQV--PASPVSPRVKLDTVLGMVVGLLAAV
A0A7V9AZN2      QLIDRSIV------VDIAGK-QTKVAVAERAVL--PEVPYAPRVRRSAALGVAAGLLIAL
A0A7C5IJ97      ----------------QASARLASIIVAQPAKT--PTVPVLPRTLLNTLLAAFSGMVIGV
A0A7C3FJ85      TTAYQSIQ------LAELQA-ADLVSIIEPARY--PEGPIRPRKAMNALLAAVVGSMVAV
A0A3M1ZZ81      FNNLNQLR------VSQAKE-SSNIVPIEPAQP--PQRPIRPRTFTNTIMATIIGGMVAL
A0A7C2TBJ3      LSN------------TGGGA-INTLSVIEPASL--PTRPIGPNKPGIVALSAAIGLALAA
A0A3C0XJG2      MRTRDDLR------LVAARA-ENTVTVWEPAVA--PTDPESPRVALNTILGAIAGGLLTL
A0A7C3NE64      LSFLDGRD------S------PNYLTVIEPAQV--PTSSISPNVRLNILLAAAVGFGLAL
A0A7C4V0A1      VQTYEKMR------LSAAQT-MDSVTLFEPAQP--PSAPVRPKPLNTAAVAATAGLVAAI
A0A847FKN0      LNSYSSIS------LAEASS-GDTVTVVSRAEV--PRAPIRPQVMRNSLLAALAGVLFAA
A0A6J4UI39      LSQQGEME------LAEASL-QSRVSVWEQARV--PTAPYEPRTLLYTLLAVIAGLIIAA
A0A521IC37      QRTYLSMG------TLLNQSTGKYLTVIAPAPL--PAAPVSPNILQNVLLAAAVGLVLAV
A0A7C1K503      LQSYENIR------AAEAQE-LNNVSVVEPAVP--PRAPIRPRVELNTLLAGLVGMVLAG
A0A535IMD1      LTFYKGG--------------TNVLSVIEPASV--PVAPIAPRTDLNVMIAAAIGCLLAV
A0A7V3K428      MEFLGRLE------PASTEAGPATAVVVDYATR--PERPLPRGILPTAAVALGISLVAGL
A0A5C7JS64      LISANRMD------LQEAGA-QTGVVVVQEASP--PGAPYAPNVRLYTLLALMAGLCIGI
A0A3A0B2P8      LAN------------SRQGA-INTIHVLEPANL--PTTPMSRGLKTNVAVAAALGFALAA
A0A497AF06      LETYLNIR------LTQSQL-LD-VTVVEPAVA--PTEPIRPNIVIYTFLGTFVGFVLSA
A0A661W444      LETYLNIR------LTQSQL-LD-VTVVEPAVA--PTEPIRPNIVIYTFLGTFVGFVLSA
A0A7W0KC11      NNTTLALT------SQMMAS-SSQVEPAVPARI--PDSPVSPRPILAMLIGLLAGFMVGV
A0A838GDL6      QLQIENVA------GGVAST-RVQVTVSDPATP--PADPYAPRVAFYTLLGAFVGLLIAL
A0A7W0AAE0      QQQSQAVA------SAVGTS-QVQVSVSDPAST--PEDPYAPRVAFYALLGVFIGLLIAV
A0A7W1TGR0      LQNDVQLQ------LAEAQS-SSSISQADPAIA--DTRPVAPRIAYNALIAAILGVVLAA
A0A497BNC7      LSSAEEFR------LAMARY-TDTITIYAPAEL--PSAPVNSRTLQNTLLGAVTGLMIGV
A0A7C6DKX5      LSH------------NAGSS-TNYLTVFEPASV--PRQPVSPNVPRNVLLATLIGLTLAA
A0A521UD91      IKDDSQMR------LEEART-LNAVRLAEPAQT--PLQPISPKVLQNTLLAAVVGLFLAL
A0A7C7DWW4      LAS------------TDQGS-ANTINVLDPPVV--PTEPVNDRWYLLVLVAAVIGAAVAI
I0I8T2          LAN------------TDQGS-TNTINILDPPAV--PTQPVPNRWWLLVAVAALIGAGVAV
A0A8B5XE16      QSIRDTLG------VVEGGA-GSQVFVVEPAVP--SSGPVSPRIMLNTALATILGLLLGG
I4EI06          RATQQQID------LANAQA-NSQIRVAEPAVA--PTKFVKPRIVVNTALSGVLGLLIAA
A0A522N7L9      LS------------ASSNNA-ANLLSIIQPAVA--PVDPASPRPLLNTLLALIVGALIAI
A0A535W4H1      LG------------FQSTTA-SNLLTLIEPAVA--PTSPSAPSRFLLTILAGILGLLLAT
A0A3D0D4X6      VQSFEQVR------LAEATS-LNSIIVDEPAAL--PTKPVRPRPLTNTLLAAVVGAMIGL
D1C8M3          IEAQQRIL------ASAAAS-GPRIRVTADAIP--PDAPIRPRTTLNTALGGVLGTLLGL
D1CAL1          LEAQQRME------LAAAQS-ATQIRVVEQAVP--PTKFVKPRILVNTALAGALGIVLAA
A0A7W1THS1      LQSYEQVR------MAEAQT-IASVVQVEPAIT--SQRPVAPRVLFNTLATAAVALLLAI
A0A7C4K810      LLSYEQVR------LAQAQT-ENNLVQVEEAAP--PSRPIRPNTVTNVVVAGLVGFLLGA
A0A7V2PIU4      LAQLESIR------LAEANA-TDTIIVVEPAVP--PLRPVRPRVLMNTLLAAIVGAMIGL
A0A7C3FPG2      LAQLENIR------LAEANA-LDTITVVEPATP--PERPVRPRVLMNTLLAMIVGGMMGL
A0A7V5BPS1      LAQLENIR------LAEANA-LDTVTVVEPAVP--PTHPVRPRVLMNTLLAMIIGGMIGL
A0A7C5MIR7      QQQYQSIQ------LAQTEA-SQTLTVSEPAQV--PQQPILPRTPLNIVVGALLGLMGGI
A0A7L5YLH3      LQSFENLR------LTEARS-SDTITIVEPAEV--PRLPVRPRAXLNTLLGLMVGLVLSV
A0A800D757      LKSYEEIR------LAEAQT-MDNIIVDEPAEL--PLHPVKPRTLLNTLLASVVGCMLAV
A0A7C5ARI8      QSSYESVR------LAEAQS-VDLITVVEAAQV--PVAPIRPQILKNTLLAAVVGAMLGV
A0A1J4ZRV4      LSSYQQIR------LAEAQA-TDNVAIAKPARV--PELPIRPRTMTNTLLAAVVGAMIAV
A0A1V5RXW5      VANYQQAR------LAEAQT-LDSIVLSEPAIA--PERPVRPRTLTNTALAAVVGALLAL
A0A2E5F6N9      IRIQDDLL------VSQMSS-LSSVSIVEPAIV--PTAPIYPRVRFTVLVATFLATVSTI
A0A2E6J6X7      LSDVQSLV------NAQFTA-LDSLYLLEPVST--PTTPISPDVQQNITFGIMIGLALAL
                                                                            

A0A7X1PB30      GIALLLEYLDDTIKASEE--TEPAI-GLPTLGTVQRMKRV------KGTAVAL-----LE
A0A1F8RRT9      TVVLIYEYLDDTIKTAED--VETAA-RLPTLGGVARFPRR------VSSRSGLVVASTER
A0A3M1EAN8      VFIFFMHHLDESLTYTE---AEEVL-QIPTLATIPPLPAKS-PLHRRRARSLPLSMLEPL
A0A6I1QLV0      GLVAVLEYLDDTVKRPED--VEERA-GATTLALVPRFRQP------RNRGRAPVTEEWPH
A0A535FRM3      ALIVAFEWIDDRLTNPEE--IRKLT-GQDALAVLPELSRK------QGGCNIK-----DN
A0A401ZA55      AIIVIFEWIDDRLTAPEE--VNKLL-GIDALTIIPELSRK------QRSRNAE-----DT
A0A4P6JS79      ALIVVFEWLDDRLKGPEE--AQRLL-GVETLTVIPELSRK------QRIKNAE-----DT
A0A535QK16      GLAFLLDYLDQSVRSDEI--LRERV-GLVPLGHIAFVLAK------PERRGELVALG-GD
A0A6L7WZR1      AIAGLLEYRDDTVKSPDD--VA-AT-GLASLGIVGVLNG--------GESHTPGAGN-LA
A0A847FV42      GGAFLIEFLDDTVKTPDD--LQRAA-QLTALGTISRVAGN------DGKYRLMAAEE-PM
A0A3A4VPK9      GFLILKENLDTTMKTSAQ--VEELL-KLNVIGYIAEMQN------SNGETIGLYTTNQPR
A0A3D0CW53      MAALLLEYLDDTLKSDED--VDRIL-KLPTLGATTRIPK------IQQPSDHLVTVHSPR
A0A535RWE5      LAIGMLGYVEDRITDFDA--MHEKL-GITPLAEVY--RA----GPSETAAGMLFVRDAPM
A0A7C5A5U0      AFVIVRDALDVSVKSSED--VERIT-GLPILAYVPWIKA----NGEGIGP---YVEKHPR
A0A0P6WSP2      GAAFVLDQLDETVRIRQD--VTSKM-GLNLLGCID---------AQKNGDSGLEMDVHPR
A0A7Y4RFU7      SAILLMNSLDTTIKTRED--VERTL-NMPVLGYSLHMDA----KDNSRPGPHVISFP--R
A0A5C7JWY1      GLAIFVEGRSKKLMAPAD--VERYLPNVSLLGVVPRL-------SKAVAQKKALAPPNAL
A0A1F8QGH2      GIAFLWEYLDDTIRTPDD--ISDLT-GTSTLAII---------GQLPQGEDELVVLAKPR
A0A1Q7TTL6      VGAVLIDRVDPRVRYPDQ--VSREM-GLTILGAVPHIRA----GARPERSGRRVRPPEEV
A0A0S8KFR9      ALAFLFEYLDPTLHSTDD--LEAAA-GASVMGVIP--GF----APHAVSRGKILLSSDGR
A0A535SLQ0      GGAFVAERVGSSIARRVE--VE-HL-GLSVLGIVP--RC----GRETDQKG-----PGSA
A0A1F8SS27      GFIFLLGHFDDTLKTAEE--ITQVS-GLPVLGMIRKLSR------FKNTSDSVYVSKNPR
A0A2E0L5X9      LTIVLFTYFDDRLQWDEESSAETIL-GMRILGPLGII---------PRNKLPLYVESMPQ
A0A3A0AXU8      GLAWLLEYLDYTVKTPEE--LDELF-GMPTQGAIAGVGG-G--NGDQGRGLALVTATDPR
A0A359HML3      AAAYLLEFLDKTIKTVDE--VKRLI-KAPILGYIPEI--------PRKEDRWHFVTNHPR
A0A3M1EJ46      GFIFLLDHLDDTLSRPEG--VEQAL-RIPTLAAIPAVRM------RTSKNGNPFAANHPT
A0A7C1G8J6      ATIVFLEYMDDTIRWDGQ-IHSKVM-GMPVLGAMPRL---------SSKDERLIAWSAPH
A0A3D1U3H5      GLLFAREYFAGTLRNPEE-FQALMS-GAPVLGVVGDLN-------RETKRPGLSVTENRR
A0A0M8KAF3      AVVVLIEVLDDRVRSPEV--IERLT-GLPMIGAIAHIE-------GTNGDGVLVAREQPR
A0A523V9H6      GAAFLVEYLDDTIKTSDD--ISREL-GLGTLGAVARLR-------NG--DDVLVTLTEPL
A0A2U2S5W9      GAAFLLDYLDDTIKSPDD--LVTTA-GLTPLGAITRMR-------GEGYENKLVTMRHPR
A0A7C3W344      GAAFLLEYLDDTVKSPDD--LVSAA-GLTPLGAVARMR-------GEGYENKLVTARHPR
A0A2N2MEK3      GIAFAIEYLDDSLRSPMD--VDQVL-GLPVLGYIADMK-------PANGPRQLHVAAFPR
A0A3B9J9U6      GIAFAIEYLDESLRSPMD--VDQVL-GLPVLGYIADMK-------PAEGPRQLHVAAFPR
A0A661VSD8      GAAFLIEYLDDTVHWEDG-RQQAVA-GLSILGAVPRM---------SSRRKTWAAIDRFR
A0A1W9UQ51      GAILLIEFLDTSLRWEGD-GVQSVL-GLPVLGAVPQV---------S--RKNALSSDNP-
A0A497B563      GAILLIEFLDTSLRWEGD-GVQSVL-GLPVLGAVPQV---------S--RKNALSSDNPL
A0A7V2VGP5      GAILLIEFLDTSLRWEGD-GVQSVL-GLPVLGAVPQV---------S--RKNALSSDNPL
A0A497C1E5      GAIFLIEFLDTSLRWEEG-GVQSIL-DLPVLGVIPQV---------S--RKDVLSSRNPL
A0A7C0TV81      GAIFLMEYLDTSLRWEEA-GTQSIL-EMPVLGVIPQQ---------T--SRKASLIFNPL
A0A3D1JCW0      GGVFAIDFLDDTLHDPES--ITTLS-GLPILASISEHEV---------EDGGPITQAHPR
A0A2N2MJJ0      SIIFLRDFLDDTIKSRED--VKRMF-GLTTLGQIPE--------HGAAKETGLFIASQPR
A0A7C3QTG6      GIAFLIEYVDDTIRTPDD--IERIL-NLPVIGYIGDMSD------GQDVVDDLHVVRRPR
A0A7C2TGF5      GLIFLLEMLDDTFRSLDD--IHQFA-DLNILGAVGRI-------KGRKFSEKIIAHLEPY
A5V160          GLALLIEYLSDRVSSAED--VTAAT-HVGMLAAIGRI-------DGAEPSDKLVMLRDPF
A0A2A6REI6      GVALLLEFLNDRVTSSQQ--VAELL-DTSVLAAVGEI-------DGQRSMDKLVTLISPH
A0A426TTK3      GVALLLEFLNDRVTSSPQ--VAELL-DTSVLAAVSEI-------EGQRPMDKLVTLISPH
A0A3M1LAM5      GAVILLEFFDDTIYWYGE--QESIV-GARLLGTIGRF---------PAKSDKVIVRRAPR
A0A536BZ00      GLALLIDHMDDTVKTAEI--AGEVT-GLPTLGTIVRMRL-A--TGREKFYSLPTLLY-PR
A0A7C5LUL4      GAAFLVEYLDDTVKTPAD--VQRLA-RLPTFATILRF------AGDEADAERPLMVSRPS
E8N5M1          GIVFALDFLDDTIKSPDW--ITTQT-KLPVIGTIHTFDP---------KAGDPVALSSPR
A0A7X1U027      GLGLLLDYLDDTVKSTED--VETIA-GLPTLGQIGRFKP----------ESGPAFATDIH
A0A1F8U7F0      GIAFLIEYLDDTLKTMED--IERVM-QLPVVGYIAEIQY------ESGSDESLYVTRQPR
A7NIZ1          GVALLIEYLSDRVNSAED--VATTA-RVGMLAAIGRIDG-------AAPSDKLVMLKDPF
A0A0P6XM68      GIVFLIEYLDDTVKSAEQ--AEAAL-GVPVIGFIAELEH---------DQDKAYVAENPR
A0A2N2MEG3      AIVFLIEYLDDTIRSADQ--AVEAL-GLPVIGYIAELEH---------DQDKAYVSENPR
A0A353RQ31      GAAFLIEYLDDTIKTPDE--VKEIL-NIPVIGLIGELHK-----KNKDDKLGNYVVYHQR
A0A3B9KNR2      GIAFLVEYLDDTLKTPDE--VKELL-NLPVIGLVGELRK-----KSNNDKFGSYVISNPR
A0A0P6XME1      GIVFVVEYLDDSIRNGET--VTRVL-ELPVLGYINEING-----KTPYEDYPPHVIAQPR
A0A3B9Q1T8      GLVFLIEYLDDTIRTPDE--AEQIL-GQPVIGTIGDINSSL--LKRGGKKSGVHVANQPR
A0A363SX22      GISFLVEYMDDTLREPDE--ISQLF-QAPLIGFIPVMSKAA--------AHSLYMVKLPQ
A0A326UPN3      ALIVVFEWLDDRVPNPEE--MQKLL-EADALTIIPELSKNQQGKNAEDTPE---------
A0A455STY5      ALIVVFEWLDDRVPNPEE--MQKLL-EADALTIIPELSKNQQGKNAEDTPE---------
A0A3D0UNQ0      GVIFILDYLDDTVKTVDD--ISQDL-NLTPLGTIGQYGNGK-------FQGRMIVSEDPR
A0A7W1A7Y8      GFIVGLEYLDDTIKSPDE--AVDAV-GAPLLAAIIKQPKVT------QAPLRLMTKLEPR
A0A2G6GG97      GIIFLIEYLDDTIKTPDQ--VLEKT-NLATLGAIAIIKDHT-------IGSGLITQNAPR
A0A7C5QIC8      AAAFLIEHLDDTIKTEGD--VQRVT-QVPTLATIPRFSRSQ------SASKAPLMAAHPE
A0A1F8PTW9      GEAYLLEYLDDTLKTADD--VARLF-SAPIIGHIFEQKNGK-------KQHHLYDTADLR
A0A1F8QH26      GEAYLLEYLNNTLKSSED--VVRLF-SAPVIGHIFEYKDGK-------TGNHLVDLTDLQ
A0A535D584      AIAVVLQLLDQGLRTEED--VRQKV-GVPVLGVIPSYSRDP------KSGTQMRTAV---
A0A521TS25      GFAVLVEYIDDTVRTPEA--VESAT-GLHTLGAVALVPETD--SIPGSDRLRLVADTEAK
A0A7C3TYQ9      GVAFLVEYLDDTVKTDAD--VASFL-GLPTLGGV---VDLG------ENDGAAIAVEQPK
A9B6E3          GLALLIEYFDDSVQTPDE--GVDLV-NAPLLAAI-----VKQETKVTKASQRLVSRLDPR
A0A3M1H759      GAAFMLEYIDSTIKTSDD--LSPSL-GLTPLGSI---ARIK----GKGYADRLVTLHNPF
A0A7C3J9I4      MAALLLEYLDDTIKSIDN--LSASL-DVTALGSI---SRIK----GKNYREQLVTAHTSF
A0A7V7XFT9      GAVFLVEYIDDTIRNPDQ--INMQI-RLNTLATI---ARIK----GEDRREKLVSLSQPR
A0A497ASN6      MGAFATEYLDTTIKSPEQ--IEQIA-GLPVLGNIFEFEANP------GSNSNLITLEQPR
A0A3D1TRD4      GFIALVTYFDDTIKSHND--VDRAL-QLPVLGLV-----------QRNVGQAVVTVGADS
A0A7V9AZN2      GAVGLITYLDTSVKVDSD--FVVLT-GAPLLAAIATDPKLR------TGKEQLFASSRPN
A0A7C5IJ97      GSAFLFEYADDTIKSPSD--VERIS-HLPTLASVLRSAHMG------AQGEEPLVALRGK
A0A7C3FJ85      GGVFLQEYLDTSVKSANE--AERLV-EAPVLGRIWHEAEMD---KLNGSGEHGVIINHPL
A0A3M1ZZ81      GFVFLMEYLDDTIKTPDD--VLADT-NLPTLGAI---AFIK----GSAPNQRLITHHTPR
A0A7C2TBJ3      SAAHLLEYLNNTLESPQE--ISRVL-GLPILGYI---AEVK-----DSKGVWFYVHKHPR
A0A3C0XJG2      TGIAVFTYMVDRITDVDE--VSERL-GVPALGEIPFANEQT------LGAHGLFVRDAPA
A0A7C3NE64      ATAFLLEYIDDTVKSVDE--LSESL-GLMILGGI---SKIK----AKDHKDKLIAPKDPF
A0A7C4V0A1      ALAFLVEYLDDTVKTPDE--VRDSL-GLGTLGAI---PAMN------ENGNELIVIDDPS
A0A847FKN0      GIAFLVEYLDDTVKTPDD--AQEV--GLGILATV-----QRAAGNGKKRPQELFALNQTR
A0A6J4UI39      ASVFLLEYLDNTVKNEED--VVELA-GVPMLSEIRVVPKLA------QGRDQLFVLNRPT
A0A521IC37      GVVLLLEYLDDTIKSSED--VERVL-QQTTLASVARISPIR------KPGDNLITLLHPR
A0A7C1K503      AVAYVFEYLDDTLKSPED--ISQRL-GLWTLAAI---GRIE----GKTAQDRLVTLSAPR
A0A535IMD1      GGAFLLEYLDDTIKTPED--AQRVA-NVSALGVIARVSDIK------SPRDALVTATRPN
A0A7V3K428      LLAFVPDLIDFTVRTPED--LDLVL-NTSTLGAI---GIIEYGEDDEDKVEHLVTEHYPR
A0A5C7JS64      GAVFLLEYLDNTTKVDSP--FNELI-GAPLMTTLPIVPSME------KLPHQLFILDQPM
A0A3A0B2P8      AAAYTMYYLDNTLQNEDD--IQDHL-ALPALGLV---PKNH-----AAEGRAGLEGDDER
A0A497AF06      GVAFLVEYLNRSFETSEE--IKQIL-PLPTLGTI---PRLQ----GKERNGRLVTLAMPV
A0A661W444      GVAFLVEYLNRSFETSEE--IKQIL-PLPTLGTI---PRLQ----GKERNGRLVTLAMPV
A0A7W0KC11      GVVALLEFLDNTVKPEQN--LEALA-GGPVLATVSALNKLK------PGGAQVFSLTQPR
A0A838GDL6      GAVALLEYMDNSVKADSD--FQDLT-GTPLLTTIGAIPNLR------PGGNQVYVVSEPR
A0A7W0AAE0      GAVALLEYMDNSVKGDTD--YPALT-GTPVLTTIGAIPNLR------PGGNQVYVVSEPR
A0A7W1TGR0      GSVLLKESLDDSVKNPEA--LSVAL-GLPILGLIARIDRTK--------RSGLIVVEQPR
A0A497BNC7      GVAFLLEYLDDTIKSPQD--VKQTL-PVGVLGAL---PRLK----EMDGQIALVVAEYPL
A0A7C6DKX5      GAALLMEYLDDTVKNRDD--LARLL-GRPVLGSI---GRIS---GPPSVPDHLVTLQDPM
A0A521UD91      AAAFLIEYLDDTVKSGTD--IERVT-KLPTLGVVGRIPSIK----NGTTAPRVLDDIAAR
A0A7C7DWW4      AGAYLLEFLDDRLVDIEQ--IQQVT-GLTTLGTI---PDVK----LDAASQGLVMLQNPH
I0I8T2          AGAYLLELLDDRLENVEQ--IQRVT-GLTTLGVL---PESN----VDSSERPLIMLSAPH
A0A8B5XE16      GLIVGITILDDNVKTEEG--VRELT-DRPVIGLI---PRGD-------LPEQFDYMHSGK
I4EI06          GLVALAGYLDDTVKTSGD--VRRLT-GKAPLGSI---PVLV-------SADGVESLRAPH
A0A522N7L9      GVAFLLDYLDDSLKTSEA--VEETL-GLPTLGAI---VQMR-ASGPRSEIYHLVALLYPR
A0A535W4H1      AILFAAEYLNDSLKRPED--VEEVL-GLPTLGSI---GRLR-GDRSVNEVYRLVTLVNPR
A0A3D0D4X6      GTAFLIEYLDERVRDPAM--VESLV-GLPILGQITELPHEH-----STPAQAVILANAPR
D1C8M3          GVVLVLVYLDDTVKDAED--VRRLT-GRPALGWI---PRFR-------GPSGIALVTAPR
D1CAL1          GLVLVAGYLDDTVKTSED--VQRLT-GRGALGLI---PELR-------SPESIEAIAHPD
A0A7W1THS1      GFALLYDLLDDRVKSPDE--VSQQL-GLPILGFINHAADIS--------PARPLVDADPH
A0A7C4K810      GIIFLIDVFDDTLKGPDD--VTRHL-GLPVLGLI---ARHE-------KDVKVITVSQPR
A0A7V2PIU4      GAAFLIEYLDDTVKNPDD--VGRVT-GLSTLGVI---ARQK----NEGAERGLVTVENPR
A0A7C3FPG2      GAAFLIEYLDDTVKTPDD--ISRIT-TLSTLGII---AKSK------GNDGKLIALEDPR
A0A7V5BPS1      GAAFLIEYLDDTVKTPDD--LARIT-PVSTLGII---AKSK------YGDEGLITLEDPR
A0A7C5MIR7      AVASLITYVDNTIRNADD--VERAT-RQAVLGSI---LRIK----GKGDAQKPILATLPN
A0A7L5YLH3      GAVLLIEYLDDTIKNPDD--VTRG--GVSTLGAI---PRSRGDTPNNGEGRPLVTHLSPK
A0A800D757      GMAFLIEYLDDTIKSSED--VSQTL-GLATLGTI---TRFH----SAEDEGSLIVAAHPR
A0A7C5ARI8      GVAFLIEYLDTSVHTPEQ--AEAAT-QAPILGQIWASPALT----GVSSNGNRFFVEQAR
A0A1J4ZRV4      GAAFLIEYLDDTIKTPDD--VARVS-GLSTLGAI---ARLK----ETGGTRQLVAWLQTK
A0A1V5RXW5      GIAFLIEYLDDTIKTPDD--IERVT-GLSTLGAI---ARLK----DAGSARERIAWLRTS
A0A2E5F6N9      LAIIVVEFFNDKAKSSEE--IERRT-GLTRIATILRWTPKE------IGAKEVTLLSQPR
A0A2E6J6X7      GLTFLISNLRDTVRNPDD--IRTKF-GVSVLGMVFEWSSKE------VNENDLIVDTSPK
                                                                            

A0A7X1PB30      PG----WSDAYLQLRTNIHF---AGV--GTR--LKSILVTSCSPGEGKSTTASGLAAVLA
A0A1F8RRT9      SA----AAEAYRVLRTNLQF---STL--DA----QALLVSSANPGEGKTTTVANLAVAIA
A0A3M1EAN8      SA----YAEAYRTLRTNLRF---AGN--GSP--PGALLITSALPGEGKTTVAANLGTVMA
A0A6I1QLV0      SA----LAETFRVMRTNLQF---ASM--DLQ--VKSLLVTSAHPGEGKTTTCANLAVAIA
A0A535FRM3      PV----LAESYRILSAHTSI---MQT--NHP--FKLLMVTSAVAGEGKSTLATNLATFLA
A0A401ZA55      PE----LAEGCRILCANLNM---AQM--MRP--FKLVMVTSPMAGEGKSTIAANMASFLA
A0A4P6JS79      PA----LAEGCRILCANLNR---VQG--AHP--FKLVMITSALAGEGKSTIAANLASFLA
A0A535QK16      SP----VVEAYKALRTNLLF---SSV--DKE--VKTVVITSAVPDEGKSRTAANLAIVLA
A0A6L7WZR1      PP----AAEAYRKIRTGIDL---WGL--AHP--IH-LLVTSAGQGEGKSTTAANLATTFG
A0A847FV42      SH----IAEAYRALRTNIRI---SSV--DEP--IRTLIVTSPNPREGKSTTAASLGVVVA
A0A3A4VPK9      SP----IAEAFRSLRTNIEF---SSI--DKP--IRTILVTSPEVSTGKTIISTNLAAIYA
A0A3D0CW53      DP----ITEEYRVLRTNIQF---TGL--SNR--STTLLITSAALGEGKTTIAANLAVIMA
A0A535RWE5      SP----DAEAFRGLRTNILF---ASP--DRR--PRTILVTSALPLEGKSVVSANLALAFA
A0A7C5A5U0      SP----FAEAFRSLRTNLEF---LAL--QTP--MQVIQITSPEQGEGKSTIALNLAAIIA
A0A0P6WSP2      SK----VAEDFRTLAINLCS---VNA--QNP--IRTLLISSPGMAEGKSVVTANLALALA
A0A7Y4RFU7      SP----AAEAFRSLRTNLDY---IAV--DKP--LKSILISSSGASEGKTTVAANLAAIIA
A0A5C7JWY1      TP----VAESFRIIRTSLLL---SNP--DML--PSRILITSPGENEGKTTLAVNLAMAMA
A0A1F8QGH2      SP----YAEAFRMLAANIRF---SSL--DKP--LQSLLVTSPSSQEGKSIVLANLAAAMA
A0A1Q7TTL6      AV----VVEALRGVCLNLVY---AHG--AVA--PMVVTLTSPGAGDGKSFLAANLGHTFA
A0A0S8KFR9      SP----EAEAFRMLRGNLLS---VAS--TRP--LKTLLITSAEPGAGKSTVLVNLAAAMA
A0A535SLQ0      DA----AVEAFRGIRLNVLN---GHG--APG--PVVVAVTSPGSGDGKSFVSSNLALAFA
A0A1F8SS27      SP----AAEDFRILRANLEL---LST--DQP--LKTILVTSCDKATGKSFISTNLAMILA
A0A2E0L5X9      SI----ETEAMRQLRARIAL---AAG--GDM--PHILTVVSYDSGEGKTLTTANLALESA
A0A3A0AXU8      SP----VAEAFRALRTSVRM---AGV--DGP--VHSLMVTSAGPGEGKTFVASNLAVVFA
A0A359HML3      SP----ISDAFRNLRINVDL---LGV--ET----KTIMISGSAISEGKSTIALNYAQIAT
A0A3M1EJ46      SP----FAEAHRTLRTNVQF---SSG--DVT--AETLLITSALPRAGKTTTVANLGVVMA
A0A7C1G8J6      SG----AAELVRQLRTNIFL---ARP--GGT--TRVLLVTSPASHDGKTLIAGNLAVSIA
A0A3D1U3H5      SL----GAEMYRMVRTNLLF---SGA--DAA--NKVILMTSCGEGEGKTTTSMNVAMVMA
A0A0M8KAF3      AP----VSEAYRVVRTNLQF---AEV--QSP--LHSLVVTSSEPGEGKTTTAANLALVMA
A0A523V9H6      SP----PSEAFQVLRTNLRF---SAL--DKP--LRTLQFTSAGPEEGKSLVLANLAVAMA
A0A2U2S5W9      SS----VAEAYRTLRTNIQF---STL--DKP--ARTLLVTSPSALEGKSVTSANLAVSMA
A0A7C3W344      SS----IAEAYRTLRTNIQF---STL--DKP--ARTLLVTSPGALEGKSVTSANLAVSMA
A0A2N2MEK3      SP----AAEAFRNLRSSIEF---SGE--DRP--PKTLLVTSSRPGEGKTTVASNLAAIFA
A0A3B9J9U6      SP----AAEAFRNLRSSIEF---SGE--DQP--PRTLLVTSSRPGEGKTTVASNLAAIFA
A0A661VSD8      YP----EIEAIRNLRTNIFL---STP--GTS--LDTILVTSPEIGDGKSFTVANLGLTIA
A0A1W9UQ51      -------------------------P--DQP--YKVLLLTSPGASEGKSFVIANLAVVLA
A0A497B563      SP----VAEGVRAVRASVFL---MRP--DQP--YKVLLLTSPGASEGKSFVIANLAVVLA
A0A7V2VGP5      SP----VAEGVRAVRASVFL---MRP--DQP--YKVLLLTSPGASEGKSFVIANLAVVLA
A0A497C1E5      SP----VAEGARAVRASIFL---MRP--DQP--YRVLLLTSPGAAEGKSFIIANLAVVLA
A0A7C0TV81      SP----VSEGVRTIQANIFL---MRP--DHP--FKTLLLTSPGISEGKSFVLANLAVVLA
A0A3D1JCW0      SP----VSEAFRSLRTNVQY---SSV--DRP--LRRIIVTSPTPEDGKTTIVANLAVVLA
A0A2N2MJJ0      SP----VSETYRALRTNLEF---ASV--DNP--LKTILVTSAGPGEGKSTVACNLAGALA
A0A7C3QTG6      SP----ISEAFRSLRTNLEF---TNV--DRT--LNKILVTSSGPGEGKTTISANLAAIIA
A0A7C2TGF5      SP----TMEAYRMVRNKLQF---GSV--FSP--SKSIVVTSPASGEGKSITAANLGVIMA
A5V160          SQ----VAEAYQMLRVKLEI---ARF--EKP--LHTLLVTSSSPGEGKSTTAANLALAIA
A0A2A6REI6      SK----FSEAYQMMRVRLEI---ARY--GHA--FKTVLVTSGNQGEGKSITAANLAVVLA
A0A426TTK3      AK----VSEAYQMMRVRLEI---ARY--GQP--LRTILVTSGNQGEGKSITAANLAVVLA
A0A3M1LAM5      SP----AAEMVRQLRSKILL---AQP--GRT--FRTLLVTSAAPQDGKTVAVANLGAAMA
A0A536BZ00      SR----GAEAFRTLRTNLDF---AHV--DGP--VKTILVSSAGQSEGKTTVSANLAIALG
A0A7C5LUL4      SA----AGEAYRVLRTNLQF---ATLGMGNS--AVAVLVTSAGPQEGKSTTVVNLGISLA
E8N5M1          SP----VTESFRSLRTNVRY---ASV--DHP--LRVLLVTSPTPEDGKTTVAINLAVVIA
A0A7X1U027      SR----SAEAYRQLRTNVHF---TAL--GSQ--LKTIVITSANPEEGKSTTAANLATVLA
A0A1F8U7F0      SP----VSEAFRLLRTNLEF---AGV--DRP--IRRLLVTSAGPGEGKTTIAVNLAAIMA
A7NIZ1          SQ----VAEAYQMLRVKLEI---ARF--EKP--LHTLLVTSSNPGEGKSTTAANLALAIA
A0A0P6XM68      SP----VSEAFRTLRTNLEF---AGV--DRP--IRSILVVSAHPGEGKSTVATNLAITMA
A0A2N2MEG3      SP----AAEAFRTLRTNLEF---ASV--DKP--IKTLLVVSAHPGEGKTTVATNLAVTIA
A0A353RQ31      SP----VAEAFRALRTNLEF---SSL--DFS--LKSILVTSSGETEGKTTVACNLAIILA
A0A3B9KNR2      SP----VAEAFRALRTNLEF---AGI--DSP--LKSILVTSSGETEGKTTVACNLAVILA
A0A0P6XME1      SL----ITEAFRSIRTNLEF---VEI--DRP--LKTLLVGSPSPDEGKTTIAVNLAIVIA
A0A3B9Q1T8      SP----IAEAFRSLRTKLEF---YNI--DQP--LKVLLVTSAGLEEGKTTVAANLAAIMA
A0A363SX22      SV----VAEAFRSLRTNLEF---ASV--DKP--LKTILVTSNGSSDGKSSIATNLAVAFA
A0A326UPN3      ------LAEGCRVLCSNIAT---AQT--QQP--FKLIMLTSALAGEGKSTIAANLATFLA
A0A455STY5      ------LAEGCRVLCSNIAT---AQT--QQP--FKLIMLTSALAGEGKSTIAANLATFLA
A0A3D0UNQ0      SP----VAESYRIIRSNIQF---MFI--DNP--GRAILVTSAVPGDGKSTTAVNLAIAMA
A0A7W1A7Y8      SP----AAESFRTLRTNMQF---SNI--DAK--TRTIIVTSAQPEEGKSTVVANLAWTLS
A0A2G6GG97      DP----ISEAYRIIRTNLSF---STV--DKE--LKSYLVTSASPGEGKSTTAANLAVVLA
A0A7C5QIC8      SA----EAEAYRLLRANFQF---ATL--GMGNSAITVVVSSAQPQEGKTTVAVNLSLSLA
A0A1F8PTW9      HP----IAEAFRILRTNIEV---AEA--NQP--LKTILVTSADIGDGKTSVATNLALFVA
A0A1F8QH26      QP----LSEAFRVLRTNIEL---SGS--DRP--LKTILVTSADASDGKTFVAANLAMFMA
A0A535D584      ------ADEAYRSLRTSLLF---AGV--DRT--LRSVVVTSARVGEGKTRTAANLSAVLG
A0A521TS25      SP----VAESFRILRTNVEF---AQV--DRA--CRKLMITSPSQGEGKSTIAVNFAAVVA
A0A7C3TYQ9      SV----AVEAYRALRTNIQF---SSP--DRP--PRTLLVTSPLSEEGKTTTVANLGAVFA
A9B6E3          SP----TAETFRTLRTNLQF---SNV--DTK--ARTLIVTSSQPEEGKSTVAANLAWVLA
A0A3M1H759      SA----ASEAYRVLRSNIQF---MAG--EQP--PKTIMLTSTTPEEGKSLTAANLSVVMA
A0A7C3J9I4      SP----LTEAYRGLRTNIQF---MGV--DQP--AKSILITSSNPREGKSLTVANLGVAMA
A0A7V7XFT9      SP----IAEAFRILRSNILF---AAP--DEAP-LRTVMLTSSGPSEGKSLTAANLAVVLA
A0A497ASN6      SH----TTESFMVLRANLEF---LNV--DTP--LQVLGITSPGVGEGKSNVAANLALVMA
A0A3D1TRD4      VAQDRHSAEVFRVVRANLGF---ATA--SYR--SKILLVTSTQKAEGKTTTIAKLAVALA
A0A7V9AZN2      SP----PAEAVRLLRTNMEF---ANA--AKR--INTLVITSPGHAEGKSTVTANLGIAMA
A0A7C5IJ97      SP----LAEGYRELRTNMQFLTKSDV--KAG--GQVLMITSSQPLEGKTTTLANLGVSLA
A0A7C3FJ85      SL----GAEAYRLLRTNLQF---TSV--DEP--LKAILVTSPSPGEGKSTVALNLALALE
A0A3M1ZZ81      DP----ISEAYRVLRTNLTF---SAV--DSE--LHSLLITSSSPGEGKSTTTANLAVVMA
A0A7C2TBJ3      SP----ISEAFRSLRANLDF---ASL--DYP--LKSIFIASPDTAEGKTTVAINLAVTMG
A0A3C0XJG2      SP----EAEAFRAVRANLVL---AAL--DRP--PRTIMVTSALSDEGKSLVAANLALAFA
A0A7C3NE64      SP----TTEAFRRVRSNIQY---MAV--DRP--IKSILITSPEPNVGKSTVVANLAVVMA
A0A7C4V0A1      SP----IMEAFRKVRTNLWF---ASV--DHP--LHTILVTSPSPVEGKSFISANLAAAIA
A0A847FKN0      SP----VTEAYRTLRTNLQF---SSL--DRP--VHCLVVTSAMAAEGKTTTVANLAVVMA
A0A6J4UI39      SA----ASEAVRLLRTNLEF---AAA--SKE--ITVLLVSSAGPSEGKSTVTANLAAAIA
A0A521IC37      SP----IAEEYRSLRTNLRY---SGI--ENP--GGALLVTSANPSEGKTTTAANLAVAMA
A0A7C1K503      SP----IAEAYRLLRTNFQF---AAV--DRP--LRRIVVTSPGPGDGKSTTAANLAVVFA
A0A535IMD1      DP----VSEAYRLLRTNLQF---SGV--KNP--AGSVLITSSSPGEGKSMTAANLAVSMA
A0A7V3K428      SS----AAEAFRTLRTNLRF---ARP--DRD--IRSLLVTSARPGEGKSLVAANLAVAIA
A0A5C7JS64      SP----ESEAVRLLRANVEF---AIA--NTE--EKTLAVTSAGPGEGKSTIVANLAVAMA
A0A3A0B2P8      AA----LNDAFSALRLNIQA---ALG--GDV--PKTLLVGSPAVGDGKSSVAANLALAFV
A0A497AF06      SP----ASEAYRALRTNIRF---ASV--DEP--LKTLLITSAEPKAGKTTVAANLGVVCA
A0A661W444      SP----ASEAYRALRTNIRF---ASV--DEP--LKTLLITSAEPKAGKTTVAANLGVVCA
A0A7W0KC11      SS----ASEALRLLRTNLEF---ASA--SGE--IHSLTVTSPGPGEGKSTITANLGVVMA
A0A838GDL6      SP----SAEAIRMLRANLEF---AAA--GQA--IASLAITSSSPGEGKSTVSANLAVVMA
A0A7W0AAE0      SP----SAEAIRMLRTNLEF---AAA--GKP--IKSLTISSSGPGEGKSTISANLAVVMA
A0A7W1TGR0      SP----VSEAFRVLRTNFQF---TGV--DRP--IRTLLVTSPSQDEGKSTLCANIAAVLA
A0A497BNC7      QP----IAEAFRSLRTSIQF---SSV--DHP--AKTLLVTSPLPTEGKTFTSANLAAVMA
A0A7C6DKX5      SS----LSEAFRVLRTNLLF---MSV--GNN--ADCVLVTSAVLGEGKTTVACNLAAAMA
A0A521UD91      SS----LGESYRIVRANVDF---AWA--GQP--GQLVMFTSTNPGEGKSTTLGNLATVFA
A0A7C7DWW4      ST----DAEAIRVLRTNLLF---ASV--DHK--LSSLLVTSPTPGEGKSFISSNLAVAFA
I0I8T2          TS----DAEAFRVLRTNLLF---ASV--DRG--LGALVVTSPTPGEGKSFVSSNLAIAFA
A0A8B5XE16      SI----SGEIFRGLRTNLQF---AMI--DRS--IKSIVVTSAAPGEGKTTIAANLAIVLA
I4EI06          SP----AAERYRSLRTALQF---ATL--GQP--IRSLVITSPRPGDGKTATATNLGAVLA
A0A522N7L9      SP----VTEAYRTLRTNVEF---ASV--DAP--VRTLLVTSSVPGEGKTTTAANLAVTFA
A0A535W4H1      SP----AAEAYRSIRANVDF---TSV--DRP--IRTLLVASATASEGKTVTAGNLALVFA
A0A3D0D4X6      SP----LAEAYRMLRTNLQF---AMV--DRP--LHILVVTSPGPREGKSVTSANLAVAVA
D1C8M3          SP----VSEGYRSLRTNLQF---ATL--GQE--VRSILVTSARPGDGKTTTVVNLGAVLA
D1CAL1          SV----GSEAYRTARTNLQF---VAV--GQS--LRSFVVTSPRPGDGKTTTAVNLAAVLA
A0A7W1THS1      SS----FAEAFRSLRSNLQF---ATA--ARP--VRTLLITSPTESDGKSTLVANLASVLA
A0A7C4K810      SP----ISEAYRSLRTNLQF---ASV--DRP--LNTLVVTSPSPGEGKSSVVANLGVVMA
A0A7V2PIU4      SP----VAEAYRTIRTSIQF---SSI--DKP--IYSLVVTSAGPSEGKSTTAANLAVVMA
A0A7C3FPG2      SP----IVEAYRTVRTGIQF---AGI--DKP--LRTLVVTSAEPGEGKSTVAANLAIVMA
A0A7V5BPS1      SP----IAEAYRTVRTGIQF---ASI--DKP--IRTLVVTSAGPGEGKSTTAANLAVVIA
A0A7C5MIR7      SA----AAESYRVLSTNLEF---AVL--GAGGLPALLLVTSTQPMEGKTTTLANLGVSLA
A0A7L5YLH3      AP----TSEAYRVLRTNIQF---SSL--DRP--IHTLLVTSANPGEGKSTTASNLAAVMA
A0A800D757      SP----ISEAYRTLRTNIQF---STL--DRP--VKTLLVTSANPLEGKSTTVANLGVAMA
A0A7C5ARI8      SP----TAEAFRTLRANLYY---SSV--DQP--LRRLLITSPLPEEGKTIVAVNLAVALA
A0A1J4ZRV4      AP----ESEAYRTLRTNIQF---SSV--DKP--VRSLLVTSAGPSEGKSTTAANLAVVMA
A0A1V5RXW5      AP----ESEAYRTLRTNIQF---SSV--DNP--VRRLLVTSSSPGEGKSTTAANLGVVLA
A0A2E5F6N9      SS----HAEAFRQAKVNVQF---LSL--TPP--PKRYLVTSPGPGVGKTTFSVHLATAIA
A0A2E6J6X7      SS----FAEAFKQIRTNLQF---AAT--KSE--SRVYLTSSPGPGDGKSTLISNLAVAIA
                                                        .     **:      .    

A0A7X1PB30      Q-AGERVILVDTDLRRPTLHTVF-GLPNSF----GLTGLLLSDAYDP--APAL--VESGL
A0A1F8RRT9      Q-TGLRVIVIDSDLRRPALHRIF-GLSNGA----GLTNALLSRQPEI--QRFL--QPTAF
A0A3M1EAN8      Q-AGRKVLLVDADLRHPDLHRLF-DVPNRR----GVADLLLNGQLPD--ETWL--VETSQ
A0A6I1QLV0      Q-TGRRVIVVDSDLRRPSLHLLF-SQPNRQ----GLTNQLLLGEGGI--TRFL--RATEV
A0A535FRM3      L-SDKRVLLVDADLRRSVLDQHF-QLDNHH----GLADTLLTPWEQI--KTALEGQLTEV
A0A401ZA55      M-SGKRVLLVDADLRHPVLDQHF-QLNNQK----GLSNAFLGIWNQV--ETELDGQPTEI
A0A4P6JS79      M-SGKRVLLVDADLRHPVLDQHF-QLDNRQ----GLSNAFLEMWTQV--QPQMEGQPTEL
A0A535QK16      Q-AGHPTLLVDADFRRPSQHRMF-GKVRNV----GLSNLIVQDMPES--ALFV--PDEQV
A0A6L7WZR1      Q-LDRRVVLVDADLRRPQLHQFF-GLRNTR----GLSSLLVNPKADT--AATL--RPTAF
A0A847FV42      Q-SGTSVILVDADLRRASLHRYF-SLPSKE----GLTNALVQDDLSV--DGWL--QQTEV
A0A3A4VPK9      Q-KGEKVLLLDADLRRPRVHKTM-GITNHI----GLTDLLRGSHDLQDVIQKMDGAE---
A0A3D0CW53      M-AGKRVILVDGDLRRPSVHRFF-GIPNRL----GLTNLLVDEALALETVLMETPVA---
A0A535RWE5      Q-AGSPTVLIDADLRRPSQHRLF-GLDSSK----GLTTLLTADDPLGR-LDAFSVAP---
A0A7C5A5U0      Q-GGKRALVLDADLRRPNLHRLC-GISNRV----GISDLFRHTMDAKSAIRPWDGNE---
A0A0P6WSP2      R-LGLKILVVDADLRLPSLHRIF-GVDQEN----GLSEALVSGKGTDH-LKTTK-EA---
A0A7Y4RFU7      Q-SGKRVVLLDADLRRPRLHHEF-GLINRT----GLSDIFLEKTPLQNALQVWD-DP---
A0A5C7JWY1      QLEDTQVVLIDVDFRNKQIHPLY-DVGSSEEPPKGLGHLLRGEANLADVVHQTF-VS---
A0A1F8QGH2      G-SGQRIVVVDADLRLPRLHQVF-KLDGKE----GLTDSLIN-SSLDGNLQATK-MD---
A0A1Q7TTL6      E-AGHRTLLIDGDLRRGVLHRRL-GARRRP----GVSDFLRGEVPLEAIVQATP-YP---
A0A0S8KFR9      Q-AGQKVVVVDGDLRYPCLHEVF-ELPNDM----GLSNVLSDLRRMSTALQETN-IE---
A0A535SLQ0      H-ANHRTLLVDADLRRGALHRAL-QLRREP----GLTDLLVAKASPEQVLQATT-HP---
A0A1F8SS27      H-SDREIILLDADLRNSNIHKMM-SIPNEY----GLSDILRNGMNVSQALRNYDGV----
A0A2E0L5X9      Q-TGLRTLIIDGDMRRGDMHEIF-QLPNMY----GLGDILQSN-EPLANLLPNVLLDSGY
A0A3A0AXU8      Q-EGRRTILVDLDLRKPQVGARF-GLRREP----GFSNLVVDR----ELAVEHCLQATAI
A0A359HML3      Q-ANKKVVFVDGDLRKSKMKEAL-KLEQDT----GLSTLLNSPAKLKDVVFTLDQ-----
A0A3M1EJ46      Q-AGMKVLLIDTDLRAGNLHQVF-GVPDRP----GLTDLLLSNAVPDESMLLKTEVL---
A0A7C1G8J6      S-AGMRVVLVDTDLRIPMLHELF-DLPNTR----GLTELLSADQPDPFALEEV-LLPTHV
A0A3D1U3H5      E-IGRKVLLIDADLRRPHIHQVA-GIENRG----GLTALLLG---MDGGDIMTSTVQSEA
A0A0M8KAF3      Q-AGRKVVLVDADLRKPLVHRLF-QLSNAQ----GLTSALMHP-EIAVDRFLQRVDAGGG
A0A523V9H6      Q-AGLKVILVDGDLRRPRQHALF-GLHLLG----GLTSSLLQ---GSTDGRLQPAEQ--V
A0A2U2S5W9      Q-AGFKTVLVDADLRRPVQHKIF-GLSNQQ----GLTNALLQPGEPSADGHLQSTE---I
A0A7C3W344      Q-AGFKTVLVDADLRRPAQHKIF-GLPNQQ----GLTNALLQPGEPTADGHLQATE---I
A0A2N2MEK3      Q-SGKRVVLVDADLRRPSVHRAL-GIPNRL----GLTTLFRDSLK----LESVWKHSNGI
A0A3B9J9U6      Q-SGKRVVLVDADLRRPSVHRAL-GIPNRL----GLTTLFRDSLK----LESVWKHSNGI
A0A661VSD8      V-TGMRVVLVDADLRNPTLHEMF-DRPNVM----GLSELLSGDSPISESRPPMELQPTGV
A0A1W9UQ51      A-AGNRVIVVDADMRRPSLHELF-DRPNVT----GLADVLSDHKVDDEGLLSVPLLETDF
A0A497B563      A-AGNRVIVVDADMRRPSLHELF-DRPNVT----GLADVLSDHKVDDEGLLSVPLLETDF
A0A7V2VGP5      A-AGNRVIVVDADMRRPSLHELF-DRPNVT----GLADVLSDHKVDDEGLLSVPLLETDF
A0A497C1E5      S-AGNRVIVVDADMRRPSLHELF-DQPNVI----GLADVLGDHKVDND-FSSIPLQETGF
A0A7C0TV81      A-AGNRVIVVDSDMRRPTLHEYL-DRPNAI----GLADVL-RHANTVD-AQVIPLQETDY
A0A3D1JCW0      Q-GGINTLLLDADLRRPRLHKIF-KCENKL----GLSSLFVQP---MDGLEKVIVHSQRT
A0A2N2MJJ0      Q-AGKKVLLIDTDLRRPRIHQYL-GLGNRF----GLSDLFLSH--GKLADVTQVYEGPNN
A0A7C3QTG6      Q-SGKSVLLIDADMRRPRIHSLF-GLSNRV----GLSA-LFRG---NTSVRSVMKPVDGV
A0A7C2TGF5      Q-ADRKTIIVDADFRRPTLHQVF-NVNRES----GLGDMLISK----RSEFDGYLKGTRI
A5V160          R-SGKRVILVDTDLRRPSLHRFF-RHANLR----GVTTALVRD---PSDSLYNHMIATGL
A0A2A6REI6      R-AGKRVLLVDADLRRPTTHTYF-AHHNLR----GLTTALVRE---GDTPVDFHLHSTKL
A0A426TTK3      R-AGKRVLLVDADLRRPTIHTYF-AHHNLR----GLTTALVRE---GDTPVDFHLHSTKL
A0A3M1LAM5      S-AGMRTVVVDADFRAPSLHESF-DLPNVL----GLAELLSAGRDEYQALLDKALLETNV
A0A536BZ00      Q-AGRSTILVDADLRVPELHDYF-QLTNDQ----GLTSLLRDE----TLPVSAVARETEE
A0A7C5LUL4      Q-AGKRVLLVDTDLRRPTLHKQF-GLPNDV----GLTSLYLSE-----MPLEEAVRQTEI
E8N5M1          Q-SGNRSVLIDADLRRPRIHKVL-GLDNRQ----GLSG-LFIQ---NPTMLNGALQQTRL
A0A7X1U027      Q-AGDRVILVDTDLRRSSLRGTF-DGPNSF----GLTG-LLLN---DVHDPSIALVNTRW
A0A1F8U7F0      Q-GGKRVVLVDADLRRPKIHRFL-GLSNKV----GLSD-LFRG---VVAVRMVSQQVQDV
A7NIZ1          R-SGKRVILVDTDLRRPSLHRFF-RHANLR----GVTTALVRD---PSDSLYNHMIAAGE
A0A0P6XM68      Q-GGKKTLLIDADLRRPRVHQYL-NLPNRV----GLSN-LFRD---AKSLHEVMGQWKE-
A0A2N2MEG3      Q-GGKRVLLIDADLRRPRVHHHL-GLNNRV----GLSN-LFRD---SIAIGDVAHAWQD-
A0A353RQ31      Q-GGNRVLLMDTDMRRPNVHVQF-NLHNRI----GLSD-LVRG---KLSLHEVVRSIPEV
A0A3B9KNR2      Q-GGKKVLLLDTDMRRPNVHTQF-NLHNRV----GLSD-LVRG---RLTLEEVVRTIPEV
A0A0P6XME1      Q-AGKRVLLIDTDMRRPQIHERL-RLPNRF----GLSD-ILRE---HGSLDESLHHLAT-
A0A3B9Q1T8      N-NNKNVLLIDADMRKPKIHTHL-GLSNRY----GLSD-LILG---RSA-SVVQRAGSN-
A0A363SX22      Q-SGKKVVLLDADLRRPSLHGFF-SIPNQT----GISDII----RGQVSLEEAIYRSA-K
A0A326UPN3      M-SGKRVLLVDADLRNPVLDKHF-HINNQN----GLAQILMGV-WGNNEMALDGIPTE-I
A0A455STY5      M-SGKRVLLVDADLRNPVLDKHF-HINNQN----GLAQILMGV-WGNNEMALDGIPTE-I
A0A3D0UNQ0      H-NEKRTVIVDADLRNSELHEIF-GVSNSN----GLTEQLRQP-ESQ--KKIHLFDTK-V
A0A7W1A7Y8      Q-SGQRVILIDADLRKPMIHRIF-ELSNEY----GLTNLLTNA-DDAAMASLAIRQIT--
A0A2G6GG97      Q-TGKKVVLIDADLRRPIQHKIF-NLPNNM----GLTTSILDG-RTP--VTAHLQQTK-I
A0A7C5QIC8      R-IGKQVLLVDTDLRRPTLHSQF-GLPNDA----GLTSLFLEE-DPH--PEEFIRDTG-V
A0A1F8PTW9      Q-RNKKVVLLDADLRSPNIHKYF-NLANDR----GLVDLISNG-AT---SNDVLRVIE-D
A0A1F8QH26      Q-RRKKVVLVDADMRRPTIHEYF-NLDNDK----GLTDFFSKN-AS---ISDVLRIGE-N
A0A535D584      A-AGSRVLLLDADMRRPGQHRLF-NHSAEP----GLSELLLTVATTGQPPNLSGAQKTRF
A0A521TS25      Q-AGKRVLLVDCDLRRPSLHRTF-RWENQQ----GLTNLLVRG-TID--WHAVTRQSA-I
A0A7C3TYQ9      R-AGASTVIVDADLRKPRQHRVF-KVDNRL----GLTTMLVSEDITR--MNGSLKESG-I
A9B6E3          Q-AGQKVVLIDADLRKPMMHRVF-EVSSEY----GLTNLLTNN-EDPTIRERTVLSVA--
A0A3M1H759      Q-ADFKTILVDADLRKPSIHKIF-EISNSQ----GLSDLISNP-DME--PEAVLQDTT-V
A0A7C3J9I4      Q-AFLKTILVDTDLRQPSLHKIF-GLSNQK----GITDLICTP-ELQ--VEDCLQDTG-I
A0A7V7XFT9      Q-AGYRVILVDADLRRPDLHHYF-GVDNRA----GLTSEFIKT-RDS--NNLGLQNTG-V
A0A497ASN6      R-GGKRVILIDADLRRPMIHSLT-GLAQSP----GLSEALVEK-EIP--LEEYLQTIG-I
A0A3D1TRD4      E-AGKRVVLVDADLRLSSLHRMF-KLDNRR----GLSNLLVDPVASPAELLPYLQQTP-L
A0A7V9AZN2      Q-AGFATVIIDADLRRPSQHHYF-GLREGP----GLTTLLTHP-HYS--WDRGAVRLT-I
A0A7C5IJ97      R-IGRQVILVDADLRRPALHRPF-GLRNQM----GLTTLLMKR-KAD--PNEAIQETS-V
A0A7C3FJ85      A-TGKRVILIDADMRRPKLCKYA-QVEREP----GLSETLASP-EMD--WQRYLQPLPMQ
A0A3M1ZZ81      Q-TGKQVILVDADLRRPTQHKIF-QLSNNQ----GLTTAILDS-LTP--VSYHLQKTR-V
A0A7C2TBJ3      Q-VGKKVILVDADLRKPTVYKYP-GATTKI----GLKNVLVDD-LD---LREALRPLG-D
A0A3C0XJG2      E-SGSLTVLVDADMRKPMQHLLY-GLDSTV----GLADLLRET-VP---LADIRKFEV-M
A0A7C3NE64      Q-ANLRTIVIDADLRRPAIHKFF-NMSNLE----GLTDLLCLP-AIE--INGELRETG-I
A0A7C4V0A1      Q-SGKRVILVDADLRRPRLHRLF-KIRPES----GLTQSLLDG-N----LQHHLLESP-V
A0A847FKN0      Q-AGKRVLLVDADLRRPAVHRLF-GLNNRS----GLTDALVGE-PAA--LNSFLRETD-V
A0A6J4UI39      G-SGLVTVVVDADLRRPTQHRIF-DIPNDR----GLTSLLTHP-QQP--WNWAAAEVI-P
A0A521IC37      Q-SGKRVILLDADLRRPGIHPLF-GLSNQM----GLMTLFWEE-TPR--VEEVMQTTD-V
A0A7C1K503      Q-SGKSVILVDADLRRPQQHRIF-QRTASY----GLSTALVDA-ATP--VTSFLQPTD-V
A0A535IMD1      Q-SQKRIILVDTDLRRPSQHKIF-GMTNKR----GVTSLMLDE-TLA--LDDVLQTTD-L
A0A7V3K428      Q-EGKKVILVDGDLRRPSIHKFF-GLPNRA----GLTNFILDT-EDD--IDRYLQETE-T
A0A5C7JS64      Q-AGYSVIVIDADMRRPAQHEAF-NLSNER----GLSTLLARS-DVD--WNSVARSNA-E
A0A3A0B2P8      E-AGYRALLVDADLRRPSLHRQF-NLPNQR----GLTTLLLGE-EHN--LELLIQQPA-Q
A0A497AF06      Q-AGLRVVLIDTDLRFPNLHQLF-DLNNHT----GLTDLLVGN-ARS--VKECMMETG-I
A0A661W444      Q-AGLRVVLIDTDLRFPNLHQLF-DLNNHT----GLTDLLVGN-ARS--VKECMMETG-I
A0A7W0KC11      Q-AGLSVVIIDADLRKPTQHSVF-SIANDR----GLTTLLTHP-EEN--WRSAAAKVA-L
A0A838GDL6      Q-AGLRTIMIDADLRKPTQHRIF-SIPNDK----GLTRLLTHP-NDR--WQDSATRVA-V
A0A7W0AAE0      Q-AGLRTVLLDADLRKPSLHKIF-GVSSDN----GLTRLLTHP-DER--WQDASIRVA-V
A0A7W1TGR0      Q-SGQQVMLVDGDLRRPTQHKLF-ELTNRS----GLSELFKQP-LSE--LENVIRRTS-I
A0A497BNC7      Q-GGQSVILVDADLRHPRVHRAF-DVSREP----GLTAALLSP-DG---WEQALRPTE-I
A0A7C6DKX5      L-AGKQVILVDADLRRPNVHGFF-GVGNDV----GLCSLLLDD-ALT--VDEAATQTT-L
A0A521UD91      K-DSRTIIMVDCDLRRPSLHRAF-AMQGDR----GLTNLLADH-RAK--LDDYLVPTK-Q
A0A7C7DWW4      Q-TGKRVILLDADLRKPTLHRVF-GLVNNI----GVTSALVSD-GAD--VEAALQTTA-T
I0I8T2          Q-TGQRVILVDADLRKPTLHRAF-GLVNNV----GVTSALVSN-LDE--FTAALQQTI-V
A0A8B5XE16      Q-GGQRVILVDADMRRPRVHTLFNRVRNDR----GLGNLLLQP-KVA--LEDMLQRTA-I
I4EI06          Q-AGQRVILVDADLRKPQLHTHFAGVKNRA----GLTNLLLAQ-PGDGLADALLQPTE-I
A0A522N7L9      Q-AGRRVLLVDADLRKPGLHRIL-DLPNQH----GLTTLLGTD-QVG--LESLIQGTE-Q
A0A535W4H1      Q-AGRRVLLIDADLRRPGVHTIF-RATNAR----GVTSLVLDP-NLD--PARVVQMTE-Q
A0A3D0D4X6      Q-TGARVILVDADLRRPSQHTLF-TLPNQT----GLTSAIVSD-EVD--LQALLKPTT-M
D1C8M3          Q-GGQQVIVVDADLRRPRLHAALGNVPNRF----GLTNLLLAD-DEVD-LAALLQETD-V
D1CAL1          Q-GGQRVILVDADLRRPQVHRYFAGLNTRS----GLSNLLLSE-WDVK-LTPTLRQTT-I
A0A7W1THS1      H-TGKHVIVIDADLRHPRLHRRF-DLRNSS----GLSDLLVQP-ELQL---DMLRSTA-V
A0A7C4K810      Q-SGKRVVLVDADLRRPYLHRLL-DLNNRK----GISTLIVQP-KLN--LDGSLLQTA-V
A0A7V2PIU4      Q-TGKKTVLIDADLRKPTQHKRF-GLPNTV----GLTGALLLE-DEFEGIEYLLTPSG-V
A0A7C3FPG2      Q-AGSKVVLIDADLRKPTQHKRW-GLPNTV----GLTGALLMD-ELSENMESLLTPTL-V
A0A7V5BPS1      Q-AGKKVVLIDADLRKPTQHKRW-KLPNTV----GLTGALLMD-ELSENLDYLLSPTQ-V
A0A7C5MIR7      K-AGQRVLLVDGDLRHPALHKQF-DLPNNV----GLTSLLLHP-TMD--LQESIQDTG-I
A0A7L5YLH3      Q-TGQRVVLVDTDLRRPVIHRVF-GVPNAV----GLTTALLVN-PDTEMLEGLLQPTQ-V
A0A800D757      Q-AGLSVIVVDSDLRRPSLHKIF-GVSNSK----GLTNALLQN-SPNP--DSFLQTTE-V
A0A7C5ARI8      L-TGRRVILVDADLRKPAVGRYT-GRSRER----GLSEALFDD-LER--LPSYLQPVEGV
A0A1J4ZRV4      Q-TGQRVVLVDTDLRRPVMHKVF-GVANNT----GLTSALLNG-EQVV-LDGHLQGTE-V
A0A1V5RXW5      Q-TGQRVILVDTDLRRPTLHKVF-GIPNNT----GLTTALLAS-QDTP-IMEQLQPTE-V
A0A2E5F6N9      Q-EGKNVILIDSDFRRPGVPPYF-SLSNQM----GLSSLLANP-ELQ--LEDLLQSTA-I
A0A2E6J6X7      Q-TGKKVLIVDGDLRRPTLHRRFKNITRDT----GLSNYLSDN-TET--LGAVTQTSG-V
                       :.:* *:*                   *.                        

A0A7X1PB30      K-NLQVLPSGPL-----PANPADLLMSDNMARIIT---NLQQRA--D--YVIFDSPPVLA
A0A1F8RRT9      E-GLSVLTSGPL-----PPNPSELLSSRRMDAIVD---AARKEA--E--ILLFDSPPALA
A0A3M1EAN8      P-RLYLLPGGPFTADPRSPTPAELFDATRLQALLD---HLRFLA--E--VIIVDSSPVLE
A0A6I1QLV0      E-GITFLPAGLL-----PPNPAELLGSPRMGRLLD-ELTATGAM------VLLDSPPLLS
A0A535FRM3      P-ALRVLTSGAY-----SSNPAELLQSPLAQELFNKHFREMDQF--D--YIIFDTPPLLP
A0A401ZA55      P-SLRVLTAGVL-----PSNPSELLQSQLASQLFN-HFRNSQKF--D--YIIFDTPPLLP
A0A4P6JS79      P-SLRVLTAGVL-----PSNPSELLQSPLAQQLFK-HFRESKQF--D--YIIFDTPPLLP
A0A535QK16      K-DLVILASGAT-----PPNPSEVLGSAHMKALLA---RFRKGF--D--YVVIDTPPVNA
A0A6L7WZR1      P-NVSLVAAGAS-----PPNAAELLASARTREVLA---ELGDLA--D--VVIVDSPPVLG
A0A847FV42      E-NLRVMTSGPL-----PPDPADLLGSKKMHHLIE---CLEQEA--D--LIIFDTPPTLA
A0A3A4VPK9      --NLTIVSSGSL-----PPNPAELLGSARMEQILL---ELGNKY--N--IIVIDSPPSI-
A0A3D0CW53      --GLKIIPSGPV-----PPNPAELLSSERMKQRGN---EMKELA--D--VIIFDSPPALV
A0A535RWE5      --NLHVVPSGPL-----PPDPAEFLSSARMSTLLE---LLAKRAPNA--TVIVDTSPTLA
A0A7C5A5U0      --KLLLLTSGSL-----PPNPTELLGSSKMKDILT---DLCQQV--N--VVIVDSPPNI-
A0A0P6WSP2      --GVKIMTSGSL-----PPNPSELLNSKKLTILLE---KLSQQA--D--LVLVDSPPILS
A0A7Y4RFU7      --YLSVITSGGI-----PPNPAELLASEKMRKILD---ELESMF--D--FVVVDSTPTI-
A0A5C7JWY1      --NLSVIPHGGR-----PTNPTELLHSKSMTQLLN---WGTTNR--Y--HIILDCPPVLP
A0A1F8QGH2      --GLKVITSGKL-----PSNPVEVIGSAHMRIFLK---EFEEKT--D--LVIIDSPPVLP
A0A1Q7TTL6      --SFSLIGCGTR-----AYNAPELLGSQAMSQLFT---TLRPNY--D--VILVDSPPLSA
A0A0S8KFR9      --GVRVLTSGPV-----PPNPAEPPPLSKLPQLLG---KLAKEA--D--LVLLDSPPILA
A0A535SLQ0      --SLDFLASGSR-----RGDAPELLGSARMADFMT---RLRSSY--G--VIVVDTPPLGA
A0A1F8SS27      --NGGVITGGTV-----APNPFELLGSKKMDEILA---KLKK-S--D--YVIIDSPPLF-
A0A2E0L5X9      E-NLNIIPAGRS-----EADPAALLGRTRLNNLID---LLSKRY--D--AIFIDAVPTIG
A0A3A0AXU8      P-HLLVIAAGTI-----PPHPSELLGSVRAGEVIE---QIKALA--D--MVIFDTAPAAT
A0A359HML3      --RLTIIPSGSC-----PPNPTELLGSEKMDRILT---HIKGMA--D--LIVVDSPPLF-
A0A3M1EJ46      --NLYLLPSGPL-----PPTPSELLSSDRMVSLIE---HFRGRV--D--VLLMDSPPVLA
A0A7C1G8J6      P-NLMLLPAGRP-----PLDPMTLLASPRLPALLD---GLRERA--D--LIILDSPPVAT
A0A3D1U3H5      DPHLYFLPSGPI-----PPNPTALLSSQRMRDLLH---AFKQSF--D--TIIVDSPPLLA
A0A0M8KAF3      Q-TLWVLPSGPL-----PPNPAEVVGSRRMQELLD---ELMTFA--D--IVILDTPPVLV
A0A523V9H6      E-GLSLLSAGKS-----PPNPAQILSSQRLRELID---ELAQKA--D--VVLVDSPPVLP
A0A2U2S5W9      E-NLRVLTSGPI-----PPNPSELLGSAKMQALLQ---RLKEEY--E--VVIFDSPPALV
A0A7C3W344      E-NLRVLTSGPI-----PPNPSELLGSARMQALLQ---RLKEEN--D--VVIFDSPPALV
A0A2N2MEK3      SRGMLVITSGSL-----PANPSELLGSEKMLHILA---ELRQKA--D--IIIFDGPPMM-
A0A3B9J9U6      SRGMLVITSGSL-----PANPSELLGSEKMLHILA---ELRQKA--D--VIIFDGPPMM-
A0A661VSD8      D-NLFLLSSGRP-----PTDPAALLVSPRLPALLD---TLEKFA--D--VVILDSPPALI
A0A1W9UQ51      D-NLYLLPAGRP-----PADPATLLTSPRLFALLD---SLGSQM--D--MVLIDSPPVLG
A0A497B563      D-NLYLLPAGRP-----PADPATLLTSPRLFALLD---SLGSQM--D--MVLIDSPPVLG
A0A7V2VGP5      D-NLYLLPAGRP-----PADPATLLTSPRLFALLD---SLGSQM--D--MVLIDSPPVLG
A0A497C1E5      D-NLLLLPAGRP-----PVDPATLLTSPRFPALLQ---FLKGQG--D--VLLIDSPPVLG
A0A7C0TV81      D-GLMLLTAGRP-----PVDPATLLTSPRFQNLLA---VLSQQS--D--VVLVDSPPVIG
A0A3D1JCW0      E-GLHLITSGGT-----PPNPAELLGSQKMKEILN---RLSQSF--D--TLLLDTPPVLT
A0A2N2MJJ0      T-HFEVVTTGAI-----PPNPGELLSSERMKTLLA---EAVKNS--E--IVILDSAPSL-
A0A7C3QTG6      D-GVYVITSGTL-----PPNPTELLASGRMDQILQ---EASREV--D--MIIVDSPPSL-
A0A7C2TGF5      E-NLQIITNGRP-----LLNSSELLGSGRMSGIIK---YLEGIA--D--VIIFDSPPALL
A5V160          E-NLLVLPSGPV-----PSDPAVMVSSKKMLDLID---ELKRMA--D--VVVFDSPPILA
A0A2A6REI6      N-NLLLMPSGPL-----PSDPAAMLSSPQLVELIE---ELKTQV--D--VLVFDSPPLLQ
A0A426TTK3      S-NLLLMPSGPL-----PSDPAAVLSSPKLVELVE---ALKAKV--D--ILVFDSPPLLQ
A0A3M1LAM5      E-RLTLLPAGRP-----PLDPTMLLTSPRFPELLD---LLLERF--D--AIVMDSPPVLL
A0A536BZ00      P-RLRVVTSGPV-----PPNPAELLGSQRMRGVIE---RLKNAA--D--VIVFDSPPLSA
A0A7C5LUL4      P-GLRVLTSGPI-----PANPAEVLSFPQTEQFLQ---RLRASA--D--YLLLDSPPVLS
E8N5M1          E-TLKVLPSGGT-----PPTPSELLGSRKMKEILD---SVASEA--E--MIVVDTPPVLS
A0A7X1U027      K-NLRLLPAGML-----PPNPSELLTSTRMVRVIE---ALRELA--D--YVIFDTPPVLA
A0A1F8U7F0      E-TVSVLTSGSL-----PPNPTELLASVRMEQILQ---EAEQDA--D--IVIIDSPPSL-
A7NIZ1          E-NLLVLPSGPV-----PSDPAVMVSSKRMLDLID---ELKRIA--D--VVVFDSPPILA
A0A0P6XM68      T-TLQVITSGGL-----PPNPTDLLASDRMAAVLQ---SALEEA--D--VVVVDAPPFL-
A0A2N2MEG3      S-NLSVITSGGV-----PPNPADLLASERMAAILE---SANKLF--D--MVIVDAPPFL-
A0A353RQ31      K-NMDIITSGSL-----PPNPAELLASERMRNLLD---ELKKSY--D--VIVLDSPPLI-
A0A3B9KNR2      K-SMDIITSGSL-----PPNPAELLASERMRKLLE---ELKSHY--D--VIVMDSPPLV-
A0A0P6XME1      E-GIDVITSGIL-----PPNPAEVLSSERMAKLME---EVAQRY--D--KVILDGPPFL-
A0A3B9Q1T8      K-KFSVVTSGSI-----PPNPSELLASEKFTRIID---KVSQQF--D--MVVIDSPPGF-
A0A363SX22      G-GVALILAGPL-----PPNPAEMLGSKKMENILA---SLEEIA--D--VVILDSAPLL-
A0A326UPN3      P-TLRLMPAGTR-----PQNPAELLISDTARRLFK---HYQDTN--RFDYVIFDTPPLLP
A0A455STY5      P-TLRLMPAGTR-----PQNPAELLISDTARRLFK---HYQDTN--RFDYVIFDTPPLLP
A0A3D0UNQ0      E-GLQLLTAGEP-----PPNPSELLGSQRMVKLVD---TLNSEA--D--VVIFDSPPAAY
A0A7W1A7Y8      P-TLWVVPSGPQ-----PPNPSELLSSKRMEMLIW---LFQQEY--D--WVLFDTPPVLT
A0A2G6GG97      S-NLGLLTSGPI-----PPNPSELLNSRRMQDVLK---ELEDNS--D--LVIFDTPPVLT
A0A7C5QIC8      T-GLRLLTSGPI-----PANPAELLEYPHFATILA---RLQKLA--D--YLILDSPPVLS
A0A1F8PTW9      G-KLTILTSGNT-----PPNPTELLSSNKMDQLLS---KLKEIY--D--IVIIDSPPFI-
A0A1F8QH26      R-KLGVITAGKP-----NPHPAEFLSSNKMNQFLS---KLKTVV--D--YIIIDSPPFI-
A0A535D584      T-NLSLMTAGMT-----PPNPSELLASRAAELTLR---WLEHSY--D--IVVIDTPPVDA
A0A521TS25      P-NLSVILSGPV-----PPNPSELLGSSRFASVID---ELASEF--D--LVILDTPPTIA
A0A7C3TYQ9      P-NLKVLASGPR-----PPNPSELLSSERMEAMIA---QLRKAA--D--IVLLDTPPCLA
A9B6E3          E-NLWLIPSGPL-----PPNPSELLSSKRMEMLIW---LLQQEY--D--WILFDTPPILT
A0A3M1H759      K-NLRVLTSGPL-----PPNPAEKLSSQRMSQLVH---LLEETA--D--VVIFDTTPVMA
A0A7C3J9I4      E-NLYVITSGPL-----PPNPSEMLGSRRMVTLLQ---QLKERA--D--VVIFDSPPVLA
A0A7V7XFT9      P-GLVLMPSGPL-----PYNPVELIGSARMREVIE---NLKEIA--D--FVILDSPPVYA
A0A497ASN6      E-NLRILTSGRR-----PPNPADLLASRRMGELIA---HFKSLC--D--MVIVDSPPLLA
A0A3D1TRD4      P-TLRVLTAGVM-----PPNPTELLQSENMATLLA---MLAELA--D--VVLIDSPPVLA
A0A7V9AZN2      P-NLTLVPSGPL-----PPNPADLLSLDRLSDLLA---EIAKEA--D--IILIDTPPVLA
A0A7C5IJ97      K-GLRVLTAGPI-----PANPAELLDSPETPAIIE---ELRGLA--D--YVLIDTPPALS
A0A7C3FJ85      P-EIQLLPPGHS-----PPNPTELLGSRRMEELLA---HFRERE--D-VIVIVDSPPVLV
A0A3M1ZZ81      P-GLRVMTSGPI-----PPNPAELLNSHRMKQVLE---ALQQEA--D--LIIFDTPPVLT
A0A7C2TBJ3      H-NISILPSGNR-----TARSAELLSSEKMDQVLI---SLEGLC--D--ALIIDGPPFF-
A0A3C0XJG2      P-NLIVLPTGRP-----PLNPAEPLSSTKMLSLIL---SLSQLA--DAATVVIDTSPVLA
A0A7C3NE64      D-NLRIITSGPL-----PPNPSELLGSQKMAHLLQ---HLEEIA--D--VIIFDSPPTLA
A0A7C4V0A1      E-NLLLLPAGPL-----PPNPTELLASQRMADALD---ELGRLA--D--VVVVDTVPVLP
A0A847FKN0      K-NLRVLTSGPV-----PPNPQELLGSQRMEDLLQ---RLRREA--D--LILIDTPPSLV
A0A6J4UI39      G-RLFVVPSGPQ-----PPNPSDLLSTERMRRLLA---DMRSTA--D--LVIVDTPPLLA
A0A521IC37      P-GLRVIAAGEP-----PPNPAEILDSKRMTEILV---ELRSQA--D--MVVVDSPPLLV
A0A7C1K503      P-GLRLLTSGPI-----PPNPAELLGSQRMAQLLQ---VLSQEA--E--MVILDSPPVLS
A0A535IMD1      E-NLRVLTSGPL-----PPNPAEVLNSTQMLSIIN---QLKDCS--D--MVIFDSPPVLA
A0A7V3K428      E-NLRVLTSGPL-----PPNPLDMVASRRADQAIQ---ALLERC--E--VLIVDSPPVLT
A0A5C7JS64      L-KLQVITSGPI-----PPNPGDLLKSPRFGALLE---TLSSEA--D--LVIVDTPPALA
A0A3A0B2P8      Q-RLSLLTSGPL-----PPNPTRLLSRKELRGVLA---EMAQKF--D--IVLLDTPPLTA
A0A497AF06      D-NLRVITSGPI-----PPNPSELLGSKRMEAVLA---EVKQSA--E--LVILDTPPMLA
A0A661W444      D-NLRVITSGPI-----PPNPSELLGSKRMEAVLA---EVKQSA--E--LVILDTPPMLA
A0A7W0KC11      P-GLLLVPSGPI-----PPNPSDLVSGGRFAQVIE---RIKADV--D--LVILDSPPLLS
A0A838GDL6      P-NLWLIPSGPV-----PPNPADLLSIDAFPQLLK---RIGADA--D--IVILDTPPVLA
A0A7W0AAE0      P-NLSLIPSGPV-----PPNPSDLLSIDAFPQLLA---RITDDV--D--IIIVDTPPVLA
A0A7W1TGR0      K-GVSLVTAGAI-----PPNPAELIGSEKMRGILQ---QLQTQA--D--IVLIDTPPVTP
A0A497BNC7      A-GLQIVTSGSS-----PPNPAELLASERMREFVS---WLAEQA--D--VVILDSPPVLA
A0A7C6DKX5      S-GLRILPSGPL-----PPNPGELLASARMKTRLE---QIRASA--Q--IVIVDGPPALL
A0A521UD91      P-NLWLLPSGPI-----PPNPSELLGSNRMLAILD---ELRQRA--D--MVFIDTPPLLA
A0A7C7DWW4      P-ELRVMTSGPL-----PPNPSELLSSHKMQELLL---HLQSLC--D--LVIIDSPPVLV
I0I8T2          P-ELRVMTSGPL-----PPNPSELLSSRRMQELLD---RLRSDC--D--LLVIDSPPVTV
A0A8B5XE16      N-NLLVLATGPL-----PPNPADLIGSLRMKAIVT---LLEEEA--D--IVVFDSPP-VA
I4EI06          P-GLRVLTTGPL-----PPNPADVLNLPRMREILT---SLEDAA--D--VVLVDAPP-MA
A0A522N7L9      D-GLAVLTTGPL-----PANPAELLASQRMRAILE---HLTGLA--D--LVIIDSPPLQA
A0A535W4H1      G-HLTILTSGPL-----PPNPAEILGSHRFGAILE---QLAADF--D--LIVIDTPPLQA
A0A3D0D4X6      S-GLSVMTSGPI-----PPNPAELLNSERMSHLLQ---ELAAQA--E--LVILDTPPTLA
D1C8M3          P-GLRVLTTGPL-----PPNPTDVLDSPRMHELIA---GLERMA--D--MVLVDAPP-VP
D1CAL1          A-GLTVLPAGPL-----PPNPLDLLSSPRMREVLD---WLAEQA--D--VVIFDAPP-LA
A0A7W1THS1      N-GVRLLTAGAS-----PHNPAELLASDRLADVLA---HVQPHA--D--FVLIDSPPLLA
A0A7C4K810      S-NLWMLPAGDV-----PPNPSELLGSAKMYEIIS---RVSDHA--D--LVILDTPPVMA
A0A7V2PIU4      D-NLWVITSGQL-----PHNPSELLGSQKLHQFAE---RLLQDY--D--FLIFDSPPALA
A0A7C3FPG2      D-NLWLLTSGQL-----PHNPSELLGSHKLKELVE---FLLNDH--D--LLIFDSPPALA
A0A7V5BPS1      E-NLWLLTSGQL-----PHNPSELLGSHKLQELTD---YLLGKY--D--LLLFDSPPALA
A0A7C5MIR7      E-RLRVLTAGPV-----PANPGEVVRLAQTRALLS---QCKALA--D--YVLVDSPPVLA
A0A7L5YLH3      K-GLXVLTSGPL-----PPNPSELLGSHRMSELIE---SLTTIA--D--LVIFDSPPVLA
A0A800D757      E-NLRVLTSGPL-----PPNPSELLGSRRMEGLIE---QLKEEA--D--VILFDSPPILA
A0A7C5ARI8      E-NLRVLPAGSI-----PPNPNELLGSRRLAELLD---ALDGMA--D--ILVLDSPPALA
A0A1J4ZRV4      E-NLSLLTSGPI-----PPNPSELLGSHRMARLVE---KLAGQA--D--LVIFDSPPVLA
A0A1V5RXW5      P-DLHILTSGPI-----PPNPSELLGSQRMAYLIE---MLAEIA--D--IIIFDSPPVLA
A0A2E5F6N9      P-TLKVLTAGPN-----PPNSVELLGSSRMEAIMD---EVAARG--D--ILVIDSAPIMA
A0A2E6J6X7      S-GVDVITSGPI-----PPNPSELLNSPRMKDGIE---KAKDIY--D--IILVDCPPVLM
                     .:  *          .                             :..*  *   

A0A7X1PB30      VTDASILASRTDGTILVAEAGSTRTHSVVHAIQDL---SKSQARLVGLVVN--KARTHRA
A0A1F8RRT9      VADASILAGKVDGAILVVDTGRTRAHALQRASEAL---ALSKTKVLGAVLN--KLTGRGQ
A0A3M1EAN8      VPDGLELAALVDGVLLAMQNGRSGRYEVQDAVRRL---QYARAELLGTVLT--RCQGRGG
A0A6I1QLV0      VADAAILAAQTDGVILVVDAGKTRHEAVRRARATL---DRAGARILGAVLN--RVTGRRE
A0A535FRM3      VADAQIMASYMDATLLVIDATIASRKQILQAVNIL---RKSGTNLIGTALN--KSQWPEY
A0A401ZA55      IADAQIMAAYMQVTIMVVNASRTPRKAMVRAKQAL---ARTGTRILGVALN--KSYWPEY
A0A4P6JS79      IADAQILASYVDVSVLVVDASKTARSLLTRTKEVL---TKAGTEFIGVVLN--KSQWSEY
A0A535QK16      VTDASVLAAGVDAAILVIDTNKATYPAVQHAKQAL---ERVGGNVLGSVMN--KMKAAGG
A0A6L7WZR1      VSDPVILAAQGGAVLLVALAGVTRPGALLRARDAL---LKTDAVLLGAVIN--AARPQVT
A0A847FV42      VSDATVLALEADAVLLVIDAGHTRSVSVRRAMEDL---ERAGAHVLGAVLN------RVA
A0A3A4VPK9      VADSQILSSKVDAVLLVIQPGKTSKEAAKATEDLI---KRAGGHIIGVVFN--RIPRDRV
A0A3D0CW53      VTDATILGTLSSGIVYVVNAGRTRSGVVRRGKETL---DQVGLKILGVVLN--NSTSHRA
A0A535RWE5      VTDAIALSAKVDACLVVVDAARTRTGSAIRTVESL---RRVRARIVGGVVN--KVRSTPA
A0A7C5A5U0      VADSAVLASAVDGVILVVTLGRTRQDALRLAVEQL---QRAHARVLGVVLN--LTRSSSS
A0A0P6WSP2      VADSIILAGELDGTMLVARSGMTTRKMLREAEENL---RQVRGNLIGVVLN--GVPRDQ-
A0A7Y4RFU7      VTDSQLIAARVGGVLLVLSPGATPAEAARTTVEQY---RRVGAHLLGVVMN--NVQDNQS
A0A5C7JWY1      IADAAVLASKVDGVLLVVSAGETTRDACHLAIQRI---KQAGGRLLGVVMQ--KAPVSES
A0A1F8QGH2      VADAAILTSLVDRVILVLRAGQTRHRAAQQAVKSL---QQAGAQQIWVVLN--AVPHHMD
A0A1Q7TTL6      GVDPLILGTLTGHLVVVLRTGFSHRDVAAAKLEVL---QRLPVRLLGAILN----AVPAG
A0A0S8KFR9      IADAATMASMVDGVLLVAAKDQATGRRVQRALQQM---ARVGAKPLGVVFN--RASAADG
A0A535SLQ0      GVDAFVLASLAGCLLMVLRLGKTDRELAEVKIDLL---RQSPVRVLGAVLN----DVREG
A0A1F8SS27      VSDSMVLSPKVDGVLLVAELSQTKKKQIRRTVEQL---NRTGAQVIGVVLN--RATGESL
A0A2E0L5X9      GSDSVFLGEISDGVIIIVNARRTRLSSLRRSKDEL--MAAPNVNILGVVFN--RVRLQVT
A0A3A0AXU8      VTDALLVVPHMDGALQVVDAGSTRRDLALRCKALL---ERAGARLLGPVLN--RVEAGDL
A0A359HML3      VTDAAVLAKKVDGILLVVQLGKSRRDTVKEMMVQI---ERTGTSVLGVIIN--KIS-SGS
A0A3M1EJ46      VTDAAILASLVDGVLLVIESGRTSKGEAQRALHTL---QAVGGRVLGAVLT--RSKAEGI
A0A7C1G8J6      MPDALILDALADATLLVVTAGGTSRRLLQAARNRL--MEREGGRLPGLVFN--YVSSGGL
A0A3D1U3H5      VTDSAVLSTMADRVVLVADPRKATRHTLLRAKDVL---ERVGSRVSGVVLN--RVGEESS
A0A0M8KAF3      VADPALLARMSDGVLLVTRMNVTHRQALQRAIEQL---RYAEARILGVVVN--DLTARDG
A0A523V9H6      VADAAALAQAVDGVVLVVDAGATRRGAAQQAVENL---RQVGANVIGAVLN--NVPMTRR
A0A2U2S5W9      VTDASVLATRVDGVVIVTDSGHTRRDTVVRAREAL---RKVGANLLGGVVN--RLSPRSG
A0A7C3W344      VTDASVLATRVDGVVMVTDSGRTRRDMVVRARDAL---RKVGANLLGGVVN--RLSARSG
A0A2N2MEK3      VADAQILASLMDGVLLVLQPG---KSPADEAKSTLAQLKRSGAKVIGTVFN--RVPKNGG
A0A3B9J9U6      VSDAQILASLMDGVLLVLQPG---KSPADEAKSTLAQLKRSGAKVIGTVFN--RVPKNGS
A0A661VSD8      APDAAILASIADGTLLVVSEGQTSNGAAAKAQALL--SSRSGVNLLGVAFN--RVKLVET
A0A1W9UQ51      PPDAMILATLVEGTVLVVSAGVTRRETIQQAKERLLGFDQREVNLLGLTVN--RAKLDGS
A0A497B563      PPDAMILATLVEGTVLVVSAGVTRRETIQQAKERLLGFDQREVNLLGLTVN--RAKLDSS
A0A7V2VGP5      PPDAMILATLVEGTVLVVSAGVTRRETIQQAKERLLGFDQREVNLLGLTVN--RAKLDGS
A0A497C1E5      PPDATVMATLVEGTILVASVGLTRREAVRQARDRLLGLGQQGVTLLGLAVN--RAKLDGS
A0A7C0TV81      PPDATVIATLVEGTILVASVGQSRRELIEQARDRL--LRQPGVHLLGITVN--RVKSDGN
A0A3D1JCW0      VTDTVALSKAVDGILIVVRLGKTKRGEFLQAIEHL---RQVNANLVGVVIN--GVSPRHA
A0A2N2MJJ0      VADSQSVSASADGIIIVVEAGGTRAEPVRAMLESL---RRTHTRILGLVIN--RMKAHHG
A0A7C3QTG6      VADFQVLATKLDGVVLVIQPGHTHADAAFATLDQL---RRVNARTLGVVLN--KIPRNT-
A0A7C2TGF5      AADATILSNLADGVILVIRAGKSRCKAIRQTLSDL---QKANANLLGCICN--HMVKETS
A5V160          VADAIPLAHICDATLLVVLAGATRTSQLRRACDQL---LQAGVEPQGVVLN--RVTKEQG
A0A2A6REI6      VADASMLMQLCDTVVLVATDGKTRTSALRHSMQLL---EQSGVKLAGVVLN--RVRKSRY
A0A426TTK3      VADAALLMQLCDTVVLVATDGKTRTSALRHSAHLL---AQSGVKLAGVVLN--RVRKSRY
A0A3M1LAM5      APDAVILATRADGTVMVVSAEHTSRQAARRAIKVL--RDQEGVNFLGVVVN--RIPL---
A0A536BZ00      VTDAAILASAVDGTLLVVDAHRTRRDLARGGANAL---KRVGARVLGVVLN--RVSGGTL
A0A7C5LUL4      VADASILAQRVDGVVVVAEMGRTRAGAFKDVTEAL---EGVRARLLGVVLN--KVREGRS
E8N5M1          VTDAAVLSPLVDGVLLVVKMGTTKQSALLQAVEQL---QQVNARILGVVVN--GVNPKKS
A0A7X1U027      VTDAIILAARTDGTIVVAQADRTRTEALKLAIQSL---RQANIHLVGVVLN--KAKVRHG
A0A1F8U7F0      VADVQVLAGKVDGVILIIHPGHTQEDASLATLEML---NRAGARTLGVVLN--RIP-RGR
A7NIZ1          VADAMPLAHVCDATLLVVLAGVTRTSQLRRACDQL---LQAGVEPQGVVLN--RVT-REQ
A0A0P6XM68      VADASILASRVDGVLFVIHPGRTPVDAAQATLEQM---RRVGANVLGLVLN--RIP-RNR
A0A2N2MEG3      VADASILAARADGVVLVIRPGKTPLDAAMTTLEQM---KRAGANILGVVLN--RIP-RNR
A0A353RQ31      VSDSQILATRVEGVLYVIVPGSTRIESAKRPLEEL---ERINAHLLGVVMN--RIP-HNR
A0A3B9KNR2      VSDSQILSTRVEGVLYVIIPGFTRIDSARRPLEEL---ERINAHILGVVMN--RIP-QNR
A0A0P6XME1      ISDAIVLASRVDGVLLVLRARNTSQSVALEVLDQL---DRVKARVVGAVLN--RVQDTTS
A0A3B9Q1T8      VTDAQILGTKVDGVIFVIRAGKTRANIARMSLDEF---NRVGAKVVGLVMN--RVP-RNQ
A0A363SX22      VADAWALSAKVDGVVLVVEPGRLKRKTAQAIMDRI---QLSRVRIVGLVLN--RVKKGSE
A0A326UPN3      VADAQIVASYAEVSVLVVAASRSPRRLLNRAMQIL---RRTGTRVLGLAIN--RSQWPEY
A0A455STY5      VADAQIVASYAEVSVLVVAASRSPRRLLNRAMQIL---RRTGTRVLGLAIN--RSQWPEY
A0A3D0UNQ0      VTDAAILSRLVDGVVLVISAGKTRRDEARQAIFNL---EQAGANILGVVLN--GMAEKRG
A0A7W1A7Y8      VTDPLALAPRTDGVLLVAEGKRTRRDMLVRSRLAL---ETVGAKIIGIAVN--KLDQRAE
A0A2G6GG97      VADASIIGPQVNGVLLVINTGRTRQEAFINAVDRL---RRTGTHIFGAIFN--RVKLDRS
A0A7C5QIC8      VADAGILARKAGAVLLVAQPGKTRSDALKESVLNL---ERVRVRVLGVVLN--KAGHRPG
A0A1F8PTW9      IADTMILASKVDGVLLVVRPGHTRQPLAQVTTEQI---NLVGARLVGVVLN--RIPLHGA
A0A1F8QH26      ISDAMILAAKVDGLLLVVRPGHTRQPLAKVTKEQI---GQIGANLIGVVLN--RIPLRNA
A0A535D584      VTDALPLAAEASATVVVIEAGATGARQLQRALEVL---KGSGANVIGVVLN--KSRRDPP
A0A521TS25      VSDPMVMAPVADGVIVVVDAGRTSADLLRRTRDSL---QRAGANVLGVVLN--KLTERSG
A0A7C3TYQ9      VSDAAVLASKVDGILLVLEAGKTRREAAIRAKEAL---EQVGGRILGVVLT--KIPRKRR
A9B6E3          VTDPIALIPRVDGVVLVAEAKRTRRDMLAKCRAAV---QTVGGRVIGLVFNKLDPRSEGY
A0A3M1H759      VTDAAVLANRVDGVILVIRSGRIPRATLKKAVARL---KQIRANILGAIVN--QTPGK--
A0A7C3J9I4      VTDAVAFSKQVDSVILVIQAKRTRRSMAHQAVKRL---RQVGANLMGAVLN--QASRGES
A0A7V7XFT9      LADAPVLSTQVDAVIFVIEAGKTGFRHARRSLDQL---QSVGANVLGVVLN--RVKDQVA
A0A497ASN6      VADTIFLGKWLDGILVIAEWGRTDRSAFVESVERA---RQSGLRVLGAVLN--KVKPPSR
A0A3D1TRD4      VADAMTIAPNVQGILFIIESGSIRLGRLNEALGRL---RRSGTPILGVILN--KVKADTE
A0A7V9AZN2      VSDPLAVARKTDGVMLVCRAGHTRTEALTDAARAF---QQGDIRVIGVVLN--QLRRNEG
A0A7C5IJ97      VTDASILAQKVDGVLLVAEMGRVRSDVFWHAVAAL---EKVRAPIIGVVLN--KVRARPG
A0A7C3FJ85      AADATILSAKVDGVLLVVEVGSTARQAIAYTVEQV---RRSGARLLGTVLN--KVPMDGR
A0A3M1ZZ81      VADAAILAPRVNGCVVVAEAGSTRRPLFLQAIERL---ARTGTNLYGVVMN--RSKPGRA
A0A7C2TBJ3      ISDAVILSAKVDGVLIVIRPGHTREDVARSMMEQM---DRAGARVLGIVLN--RISRKNA
A0A3C0XJG2      VADAHALSTMVDGCVVVVDSARTPARASRRAVDVL---NAVHARILGVVLN--KVPAIQL
A0A7C3NE64      VTDAAALATQVDGVILVTRAGRTRRSSAQQAVKSL---LQIRAKILGGVLN--GIFNKSH
A0A7C4V0A1      LADALVLAPKADGVVLVMEAGKTRRAAARQAVESL---AHAGANLVGAVLN--KTPGRGS
A0A847FKN0      VADANVLAARTDGVLLVVNADRTRRMAVQQATEGL---RQVGASVLGGVLNMVDIRRGGG
A0A6J4UI39      AADALVLAPHTDGVVLLCRAGATRREALKRAVGKL---QHGSIRVIGTVLN--GQRSSSE
A0A521IC37      VADANILASRCSGAIIVMDSGRTRTDAARKVVETL---TRSKVKILGIVLN--RVSGRRG
A0A7C1K503      VADAAILANAADGVVLVADASRTRREMARRAKESL---ERAGANLLGMVLN--RMTRQTS
A0A535IMD1      VADALILSGKLNSTLLVVDSGKTRADAVRRSIETL---NKVNAKVVGVVLN--KMRRRHA
A0A7V3K428      VADAMVLATKVKAAILVIQAGTTRRDVIIRAYRTL---QKAGVDVLGPVLN--RVRLSDL
A0A5C7JS64      VSDALVVADVAKDVLLVCRANETRVDRLQAAVGAL---PET-ARVIGVALN--YQKRGKA
A0A3A0B2P8      TVDASILATHVEAMLLVVAAGRTQRTPTQRVVKSL---RHLQVNLLGVVLN--AVPVSQT
A0A497AF06      VTDAVVLASKASGVILLIEAKRTSHEAARRAYESL---QRVGATILGAVLT--KAKPERK
A0A661W444      VTDAVVLASKASGVILLIEAKRTSHEAARRAYESL---QRVGATILGAVLT--KAKPERK
A0A7W0KC11      ASDALAIAARTDGVMLVCRSHHTRIDALRHAAHSV---HQGGIRLIGLVVN--RQQGQRG
A0A838GDL6      VSDPLVVARNTDAVLLVARSGQTRRDALRHSAEAL---RQGSMRVLGIVLN--QQRSKDG
A0A7W0AAE0      VSDPLVVGRHTDAVLLVAKSGQTRRDALRHSAEAL---QQGSMRLLGIVLN--QQKSKDG
A0A7W1TGR0      VTDAVVLAQRVDGVVLVVRSDVTKMSACQQAVAQL---QHVGANVIGLVIN--DISPRRA
A0A497BNC7      VTDAAVLSTLADGTMLVFDCGETRKPAAVQAFERL---VSVGGQVLGVVLN--RLAPSGD
A0A7C6DKX5      LADASVLGRLCDGLVFVARAGRTRAEGVRQARAAL---EQVGVRLLGGVLN--DAASTSA
A0A521UD91      VADPALLATRADGVILIVEAGGARVQSIVRANEVL---SRTSARVLGVVLN--KLSRRSS
A0A7C7DWW4      VSDTAVLASHADGVLLAFTRDKLRRDPARNTIGAL---RQVQARILGVVLN--RVEGSQH
I0I8T2          VSDTAALASRTDGVLLVFSREKMNRDLAHKTMGAL---RQVNASVLGIVLN--RVTSGEH
A0A8B5XE16      ISDSLLLSSLTGGVIFVTLAGKLRKSELVQSMDSL---TQTGAPILGVVLN--GVRAEST
I4EI06          VSDPLIIAGLVDGVLLIMTGGRTRSGELTQVVQEL---TRTSTPLIGAVIN--R--VDVK
A0A522N7L9      VTDAAILAAMVDGALLVVDGSRTRRGAVQMGREAL---AKADAHVLGVVLN--RLSERVY
A0A535W4H1      VADAAILSARVDGTIIVVDAGKSRRESVVRARDTL---VRAGAQILGVVLN--RVARDVD
A0A3D0D4X6      ATDAAILAAKADGTLLVIDTNLTKRTELVHTTEQL---QRVGATLLGATLN--RLRRHNL
D1C8M3          VSDALVLAGLVDRVLLVAYSGRTRSAELARAVEEL---TRAGTPLLGVLLN--R--AEAG
D1CAL1          VSDALVLSRLTNGVILVSETGRVRTAEIADAVQQI---QQSGSTLLGIILN--RFPLEKS
A0A7W1THS1      VADAAILAQHVDGVILVVRVAATKLPACKQAAEQL---HRANAHLLGVVLN--DIPQGQA
A0A7C4K810      VTDSAVLAPRADGVLLVVKPGYTNLAAAKQAVEQL---RRVGAKLLGVVLN--EVDIQGS
A0A7V2PIU4      VTDPAVLGQAMDGVLLVVDSGNTREPALMQTMREM---EKVQAHVIGVALN--RFKARGD
A0A7C3FPG2      VTDPVVLGRSMDGVIVVIDAGTTREPALVHVLTEM---EKVNANVIGIVLN--RYRRGHG
A0A7V5BPS1      VTDPVVLGRNMDGVIVVVDAGSTREPALVHVLSEM---EKVNANIIGIVLN--RYRRGRS
A0A7C5MIR7      AADASLLAQHANTVLLVTEVGRTRADALRHAVGAL---TQVGAHIAGVVLN--KVVAQQN
A0A7L5YLH3      VTDAAVLSRQLDGAVLVVDAGETRXALARRAVEEL---TKVGGRVLGVTLN--RL-SPNN
A0A800D757      VTDAAVLATRVDGVLLVVDAGTLRRDAAMLAKENM---TRVGANLLGAALN--KL-SPRG
A0A7C5ARI8      VADAAVLAERADGVLLVLEAGRTDRQAAATAAEQL---RRTGCRLLGTVLN--KVPLPGE
A0A1J4ZRV4      VTDAAVMGRQVDGVVLVVDAGQTREQVLAQAAAEL---QQTGANLLGVVLN--R--LDSR
A0A1V5RXW5      VTDAAVLGRQMDGVLLVVDTGTTREQVLGNAVAEL---QKTGVNILGVALN--R--LDTR
A0A2E5F6N9      VTDSSILASKQIETVLLVDP-NTRMGWLKDCIGAL---RKADATVLGYIHN--RINARRF
A0A2E6J6X7      VADTPIISTVVDMAILVVDSFTTKTSSFGATVETL---NNSGVEIAGVIMN--KLKKPKF
                  *   .       :                                             

A0A7X1PB30      GYYGN-Y-----------------------------------------------------
A0A1F8RRT9      GYYYYSY-----------------------------------------------------
A0A3M1EAN8      ------Y-----------------------------------------------------
A0A6I1QLV0      GYYYDGY-----------------------------------------------------
A0A535FRM3      NHVQE-Y-----------------------------------------------------
A0A401ZA55      GEVHD-Y-----------------------------------------------------
A0A4P6JS79      GFILE-Y-----------------------------------------------------
A0A535QK16      NYYYYAY-----------------------------------------------------
A0A6L7WZR1      AEYDGDY-----------------------------------------------------
A0A847FV42      TRPSKGY-----------------------------------------------------
A0A3A4VPK9      DYYSGNYQYQ--------------------------------------------------
A0A3D0CW53      RGYYYQRYYY--------------------------------------------------
A0A535RWE5      GY-----YGY--------------------------------------------------
A0A7C5A5U0      SY-----YYH--------------------------------------------------
A0A0P6WSP2      -------HSA--------------------------------------------------
A0A7Y4RFU7      YYNGYAPYSN--------------------------------------------------
A0A5C7JWY1      SY-----Y----------------------------------------------------
A0A1F8QGH2      GY-----NSY--------------------------------------------------
A0A1Q7TTL6      EA-----YRY--------------------------------------------------
A0A0S8KFR9      DY-----YYP--------------------------------------------------
A0A535SLQ0      SE-----YHA--------------------------------------------------
A0A1F8SS27      KYYGAKQYVG--------------------------------------------------
A0A2E0L5X9      -------SKY--------------------------------------------------
A0A3A0AXU8      GYYANY-YSY--------------------------------------------------
A0A359HML3      NYYSKYYGSY--------------------------------------------------
A0A3M1EJ46      G--------Y--------------------------------------------------
A0A7C1G8J6      GGYGYTYRYY--------------------------------------------------
A0A3D1U3H5      GYYGYY---Y--------------------------------------------------
A0A0M8KAF3      GYYYYAYSQY--------------------------------------------------
A0A523V9H6      GGYYYYY--Y--------------------------------------------------
A0A2U2S5W9      G-YYYYY--Y--------------------------------------------------
A0A7C3W344      GYYYYYY--Y--------------------------------------------------
A0A2N2MEK3      QHYGGYR--Y--------------------------------------------------
A0A3B9J9U6      QHYGGYR--Y--------------------------------------------------
A0A661VSD8      -----YA--Y--------------------------------------------------
A0A1W9UQ51      -----Y---H--------------------------------------------------
A0A497B563      -----Y---H--------------------------------------------------
A0A7V2VGP5      -----Y---H--------------------------------------------------
A0A497C1E5      -----YG--Y--------------------------------------------------
A0A7C0TV81      -----YR--Y--------------------------------------------------
A0A3D1JCW0      R------YHYYYRNYYYYQY----------------------------------------
A0A2N2MJJ0      EYGHYSNSYY--------------------------------------------------
A0A7C3QTG6      -------YSY--------------------------------------------------
A0A7C2TGF5      M-------------EYYKGYGYIPERTLIKNIKGL-----------FTRSANHHEKIETP
A5V160          G------YDH-----YYYYYGQNRKRSR---RGVL--------SRLFKRRRRRNAVPGVV
A0A2A6REI6      G------YGYGYGYGYGYGYGYEPEPEKLTWRRRL--------RRMWRRLLGRKAAPQ-P
A0A426TTK3      G------YGYGYGYGYGYGYGYEAEPEKLNWWRKF--------RRALRHLRGGKTRAH-P
A0A3M1LAM5      -------HHY----AYYLPPQVTGEAAAVSLPRRVWRRLTGFLKPIRRRLGLGRERIHED
A0A536BZ00      D------VYG----PSYYD-----------EDRAA--------RPKSRSGAGSRSREPKP
A0A7C5LUL4      G------YYY----HYYYHYYYSSDGKRVRRRRRV--------LPGGRRNAQAQAAADSP
E8N5M1          H------YYY--------------------------------------------------
A0A7X1U027      G------DYY----YRDDKSQAIEIEPAQVQPAQQRIEAAETLFSATPPAAAPRAIEQPK
A0A1F8U7F0      S------DYY--------------------------------------------------
A7NIZ1          VGYEHYYYYY--------------------------------------------------
A0A0P6XM68      P------NYY--------------------------------------------------
A0A2N2MEG3      P------NYY--------------------------------------------------
A0A353RQ31      S------YYY--------------------------------------------------
A0A3B9KNR2      S------YYY--------------------------------------------------
A0A0P6XME1      N------HYY--------------------------------------------------
A0A3B9Q1T8      R------YYY--------------------------------------------------
A0A363SX22      SDYYSGY-----------------------------------------------------
A0A326UPN3      GDIHDYRGSV--------------------------------------------------
A0A455STY5      GDIHDYRGSV--------------------------------------------------
A0A3D0UNQ0      GYYYRYGSSP--------------------------------------------------
A0A7W1A7Y8      GYYAY-------------------------------------------------------
A0A2G6GG97      SYGYYYY-----------------------------------------------------
A0A7C5QIC8      YYYS--------------------------------------------------------
A0A1F8PTW9      DYYTGKN-----------------------------------------------------
A0A1F8QH26      VYYTGEG-----------------------------------------------------
A0A535D584      REYLDYY-----------------------------------------------------
A0A521TS25      AYYYRY------------------------------------------------------
A0A7C3TYQ9      GYGYYYY-----------------------------------------------------
A9B6E3          GVYYTYY-----------------------------------------------------
A0A3M1H759      ----GDG-----------------------------------------------------
A0A7C3J9I4      HYYYAQN-----------------------------------------------------
A0A7V7XFT9      TYAE--------------------------------------------------------
A0A497ASN6      GYYYYYY-----------------------------------------------------
A0A3D1TRD4      GYYYYA------------------------------------------------------
A0A7V9AZN2      PGHHY-------------------------------------------------------
A0A7C5IJ97      SYGYYHYG----------------------------------------------------
A0A7C3FJ85      GSYY--------------------------------------------------------
A0A3M1ZZ81      SYYDDYY-----------------------------------------------------
A0A7C2TBJ3      VAYGSYRYYS--------------------------------------------------
A0A3C0XJG2      DYYQSYA-----------------------------------------------------
A0A7C3NE64      DYYYYHH-----------------------------------------------------
A0A7C4V0A1      GYYYYYYYY---------------------------------------------------
A0A847FKN0      AGYYSYYGHS--------------------------------------------------
A0A6J4UI39      AGYY--------------------------------------------------------
A0A521IC37      GYYNNYY-----------------------------------------------------
A0A7C1K503      GYYYYYY-----------------------------------------------------
A0A535IMD1      EAYSY-------------------------------------------------------
A0A7V3K428      GYYYSYY-----------------------------------------------------
A0A5C7JS64      ESYYYYY-----------------------------------------------------
A0A3A0B2P8      VYHAGYG-----------------------------------------------------
A0A497AF06      AYYY--------------------------------------------------------
A0A661W444      AYYY--------------------------------------------------------
A0A7W0KC11      AS-Y--------------------------------------------------------
A0A838GDL6      MGYY--------------------------------------------------------
A0A7W0AAE0      VGYY--------------------------------------------------------
A0A7W1TGR0      RYEYAYRGY---------------------------------------------------
A0A497BNC7      GYYYYYS-----------------------------------------------------
A0A7C6DKX5      EYYRQHY-----------------------------------------------------
A0A521UD91      EYYYRNY-----------------------------------------------------
A0A7C7DWW4      GYYYSYHKSY--------------------------------------------------
I0I8T2          GYYYSYHKSY--------------------------------------------------
A0A8B5XE16      SAHRV-------------------------------------------------------
I4EI06          GDGFYAH-----------------------------------------------------
A0A522N7L9      ADYYHYY-----------------------------------------------------
A0A535W4H1      GAAYITY-----------------------------------------------------
A0A3D0D4X6      AGYYYYY-----------------------------------------------------
D1C8M3          AGGYDLY-----------------------------------------------------
D1CAL1          GGYYTYY-----------------------------------------------------
A0A7W1THS1      ALAYGYSGYE--------------------------------------------------
A0A7C4K810      RYRYYRYK----------------------------------------------------
A0A7V2PIU4      AGYYYYY-----------------------------------------------------
A0A7C3FPG2      AGYYYYY-----------------------------------------------------
A0A7V5BPS1      SGYYYYY-----------------------------------------------------
A0A7C5MIR7      SRYYGGY-----------------------------------------------------
A0A7L5YLH3      SGGYYYY-----------------------------------------------------
A0A800D757      AGGYYYY-----------------------------------------------------
A0A7C5ARI8      RGAYYHYKYS--------------------------------------------------
A0A1J4ZRV4      RGGYYYY-----------------------------------------------------
A0A1V5RXW5      RNGYYYY-----------------------------------------------------
A0A2E5F6N9      GYGYT-------------------------------------------------------
A0A2E6J6X7      GYGYGYNYGY--------------------------------------------------
                                                                            

A0A7X1PB30      ---------------------------------------------------HYGYGKAKA
A0A1F8RRT9      ---------------------------------------------------HYYSSSDDG
A0A3M1EAN8      ---------------------------------------------------TYTV--HPA
A0A6I1QLV0      ---------------------------------------------------YSAP--AQD
A0A535FRM3      ---------------------------------------------------LATLHAQRT
A0A401ZA55      ---------------------------------------------------LSNI--QSR
A0A4P6JS79      ---------------------------------------------------LGSV--QQR
A0A535QK16      ---------------------------------------------------DYNY-----
A0A6L7WZR1      ---------------------------------------------------VYGD-----
A0A847FV42      ---------------------------------------------------YYHE-----
A0A3A4VPK9      -----------------------------------------------YYSKD--------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      -----------------------------------------------YGPGDARKNASRA
A0A7C5A5U0      -----------------------------------------------YAYSSYTKSGYSS
A0A0P6WSP2      -----------------------------------------------YRYESGEEERPSA
A0A7Y4RFU7      -----------------------------------------------YAYYQSGSGNSAS
A0A5C7JWY1      -----------------------------------------------YGAYQQQR-----
A0A1F8QGH2      -----------------------------------------------YTNEHEDKNSGGS
A0A1Q7TTL6      -----------------------------------------------YSYYLPGYEAVDE
A0A0S8KFR9      -----------------------------------------------YGRGIIG---GAE
A0A535SLQ0      -----------------------------------------------YGYYMDGYELTGE
A0A1F8SS27      -----------------------------------------------YGLEEA-------
A0A2E0L5X9      -----------------------------------------------NNTYYRQTPALTP
A0A3A0AXU8      -----------------------------------------------GGYYHEEAEEAKG
A0A359HML3      -----------------------------------------------YNIPDS-------
A0A3M1EJ46      -----------------------------------------------RYDRRG-------
A0A7C1G8J6      -----------------------------------------------YYRPRERRRFGWF
A0A3D1U3H5      -----------------------------------------------YGGYSA-------
A0A0M8KAF3      -----------------------------------------------YHHDDG-------
A0A523V9H6      -----------------------------------------------YYHQHY-------
A0A2U2S5W9      -----------------------------------------------YYYAAD-------
A0A7C3W344      -----------------------------------------------YYYSAD-------
A0A2N2MEK3      -----------------------------------------------YSTDSY-------
A0A3B9J9U6      -----------------------------------------------YSTDS--------
A0A661VSD8      -----------------------------------------------YSRYHD-------
A0A1W9UQ51      -----------------------------------------------YSSDQE-------
A0A497B563      -----------------------------------------------YSSDQE-------
A0A7V2VGP5      -----------------------------------------------YSSDQE-------
A0A497C1E5      -----------------------------------------------YSSGLE-------
A0A7C0TV81      -----------------------------------------------YGGATE-------
A0A3D1JCW0      -----------------------------------------------SAYYGEGEKRKPS
A0A2N2MJJ0      -----------------------------------------------------------Q
A0A7C3QTG6      -----------------------------------------------GGYYYYYPYKRGA
A0A7C2TGF5      SGI-----------------------------------------FRAKAIPEIFQKKYVI
A5V160          DTL--------------------------------------------------------D
A0A2A6REI6      STA--------------------------------------------------------S
A0A426TTK3      RPV--------------------------------------------------------P
A0A3M1LAM5      GRV-LLSLAEAAHLLGVRKETARRWCASGRLPAVKRGLRWWVEEEALQAMLNVQLGWDPD
A0A536BZ00      GTP-----------------RVARAPGAATSPAPAQAAAGSPVAA--GSIASSVARPPST
A0A7C5LUL4      GAPNPLLQTRAALIEQEERNRRLKYAGLGTAGLAALLAVGMAAAELLGALVPGAAEPAAS
E8N5M1          -----------------------------------------------RNYGYY------Q
A0A7X1U027      VQAPAAQKAQVAPDPAREKMLRARLAALRAHQPASPPEPVIGKAAQQDGHAYSNGHSNGN
A0A1F8U7F0      -----------------------------------------------GGYRHY------S
A7NIZ1          -----------------------------------------------GGERKRSSRSALS
A0A0P6XM68      -----------------------------------------------GGYRYY------S
A0A2N2MEG3      -----------------------------------------------GGYRHY------S
A0A353RQ31      -----------------------------------------------GGYDYY------S
A0A3B9KNR2      -----------------------------------------------GGHDYY------S
A0A0P6XME1      -----------------------------------------------RSLKSY-------
A0A3B9Q1T8      -----------------------------------------------GGYQYYGLKGEVN
A0A363SX22      ---------------------------------------------------LADASKYDS
A0A326UPN3      -----------------------------------------------QTQGAPLLKAAPA
A0A455STY5      -----------------------------------------------QTQGAPLLKAAPA
A0A3D0UNQ0      -----------------------------------------------HDQSLIGNRIRAG
A0A7W1A7Y8      ---------------------------------------------------YTYYYDQRA
A0A2G6GG97      ---------------------------------------------------SSYEYNAKS
A0A7C5QIC8      ---------------------------------------------------YEQHGRARS
A0A1F8PTW9      ---------------------------------------------------YLYTYYLSN
A0A1F8QH26      ---------------------------------------------------YLYTHYMSG
A0A535D584      ---------------------------------------------------FSQAAASQP
A0A521TS25      ---------------------------------------------------YYAYYGEDQ
A0A7C3TYQ9      ---------------------------------------------------YPEYYHRGG
A9B6E3          ---------------------------------------------------YDQHHTSNR
A0A3M1H759      ---------------------------------------------------YAEYFTPLA
A0A7C3J9I4      ---------------------------------------------------YGYHDSLLT
A0A7V7XFT9      ---------------------------------------------------YSTYPKRT-
A0A497ASN6      ---------------------------------------------------YESSDGKKP
A0A3D1TRD4      ---------------------------------------------------YDGYYSSSG
A0A7V9AZN2      ---------------------------------------------------YSDTYPEKA
A0A7C5IJ97      ---------------------------------------------------YGASEEPAA
A0A7C3FJ85      ---------------------------------------------------HYGYYSEEE
A0A3M1ZZ81      ---------------------------------------------------YYATYEYVE
A0A7C2TBJ3      -----------------------------------------------THYADSPYFEGEG
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ---------------------------------------------------YTPNNGK--
A0A7C4V0A1      ---------------------------------------------------YDDTYYNGN
A0A847FKN0      ---------------------------------------------------YSHYYGDGE
A0A6J4UI39      ---------------------------------------------------YAEYYSTEP
A0A521IC37      ---------------------------------------------------YYASPKSNG
A0A7C1K503      ---------------------------------------------------YDQSGERSK
A0A535IMD1      ---------------------------------------------------YYQYYTPGG
A0A7V3K428      ---------------------------------------------------YYGYYYEEA
A0A5C7JS64      -------------------------------------------------------SSDDS
A0A3A0B2P8      ---------------------------------------------------YAVPRAADA
A0A497AF06      ---------------------------------------------------YAERARPTR
A0A661W444      ---------------------------------------------------YAERARPTR
A0A7W0KC11      ---------------------------------------------------YGQYYGSTA
A0A838GDL6      ---------------------------------------------------YYEGYGPTA
A0A7W0AAE0      ---------------------------------------------------YYEGYGPPA
A0A7W1TGR0      ---------------------------------------------------YNAYYGSHN
A0A497BNC7      ---------------------------------------------------YYSHADGGA
A0A7C6DKX5      ---------------------------------------------------YTARTEPGQ
A0A521UD91      ---------------------------------------------------HRYYAASPV
A0A7C7DWW4      -----------------------------------------------GNRYYTTHYSQRK
I0I8T2          -----------------------------------------------SSRYYSGYYAPRR
A0A8B5XE16      ---------------------------------------------------YQQYYPIVG
I4EI06          ---------------------------------------------------YASYYGAGS
A0A522N7L9      ---------------------------------------------------GASGYHEAQ
A0A535W4H1      ---------------------------------------------------AAAAPDEDR
A0A3D0D4X6      ---------------------------------------------------YDVSSDHNE
D1C8M3          ---------------------------------------------------YAEYYSAEP
D1CAL1          ---------------------------------------------------RSQEDDAGG
A0A7W1THS1      -----------------------------------------------HDERYASRSIRSR
A0A7C4K810      ---------------------------------------------------GYYYYHGDY
A0A7V2PIU4      ---------------------------------------------------YNRYYSHDE
A0A7C3FPG2      ---------------------------------------------------YDRYYSHED
A0A7V5BPS1      ---------------------------------------------------YDRYYSQDD
A0A7C5MIR7      ---------------------------------------------------DYGYYAPER
A0A7L5YLH3      ---------------------------------------------------YYHHYYTDG
A0A800D757      ---------------------------------------------------YY--YSEEG
A0A7C5ARI8      -----------------------------------------------YYYRYYHYYASED
A0A1J4ZRV4      ---------------------------------------------------Y--YYYSEE
A0A1V5RXW5      ---------------------------------------------------YYHYYYQED
A0A2E5F6N9      -----------------------------------------------YYNYYNY-YKSYN
A0A2E6J6X7      -----------------------------------------------YYNYYYYNYKYSL
                                                                            

A0A7X1PB30      LDMDNSSRITKPKQVA--------------------------------------------
A0A1F8RRT9      KNGHRKGRLFRGKRSQPAEETRTHA-----------------------------------
A0A3M1EAN8      PAPHTPKVVPLVAPPDGKETLFPPEQHPG-------------------------------
A0A6I1QLV0      AAAGRSGAQPAGAAARSQAVRRPMVDK---------------------------------
A0A535FRM3      KKVDIVPVTPAYQPIADEQIPDDTLSLKQLP-----------------------------
A0A401ZA55      PRADIAMAMPPNTPAINHAIDATNTAILPSTNNKR-------------------------
A0A4P6JS79      PRADISMSIPPTTASSNGSVDGDTSITASLRKGSD-------------------------
A0A535QK16      -------GHPNGKAPIETAKPSPAEKETPVAGSKG-------------------------
A0A6L7WZR1      -------GPPDSE---DTGALDPSERD---------------------------------
A0A847FV42      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      SHESTGERRGRRLRAGAVSHRFAVNGQGTGQLKSSTTDHPTTSEDDVR------------
A0A535RWE5      SGIRLPFSSRWLLVPLIGIVVLGAGALFARAGQTVVPEAPRKTVSLERAIEELAAARAAW
A0A7C5A5U0      EEG---------------------------------------------------------
A0A0P6WSP2      QRWFDVLQYWVKTPWFKKK-----------------------------------------
A0A7Y4RFU7      NGRKAGSKGKFKLPWQRN------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      TLQVSLEGEEKNASPTLD------------------------------------------
A0A1Q7TTL6      EAERA---SGGKGQPFVI------------------------------------------
A0A0S8KFR9      PVLPSFL-GNFVGRFSIIRRIWERAPGLDEDRSPEDQ-----------------------
A0A535SLQ0      PLFRPLVDGTKRGRPPVTARK---------------------------------------
A0A1F8SS27      --------------------DEKLPNVKSYLNAVRAIPNYIARRFSRSNEAKLEKK----
A0A2E0L5X9      EKLSREMARSGSGLFGMRRHIITTGRGERLFSVSACAARLGVKRRTVQGWIETGHLQAES
A0A3A0AXU8      GFWRGRGGRRAAPVRESALPAAPQPARPAVASRMAGAREKGGRVSDGG------------
A0A359HML3      ---------------------EQNDADISETEIENNPQEPGVETDATSEPPKDEMKPDPE
A0A3M1EJ46      ------------------------------VTPSQLADMVSMLTPSGKGLS---------
A0A7C1G8J6      RRQPAPATNGASSNNGAAGSTELAADRDGFVELEAAAAYLGISPATARRWCESGRLPATK
A0A3D1U3H5      ----YVTDG----------------------------QKVSSGSRNGKRAAK--------
A0A0M8KAF3      ----SGGDG---------------------------------TRPERKRRRADASRKGVM
A0A523V9H6      ----GEEEG---------------------------------KKSRGGR------RKGFL
A0A2U2S5W9      ----GNGEQ---------------------------------KRKRKKKHTNHSEQGGFL
A0A7C3W344      ----GDGEQ---------------------------------KRKRKKKHAEHSEKNGFL
A0A2N2MEK3      ----NTYEQ------------------------KKPATPIRVMAPVPAAFEPTTRPNGHH
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ----DGHGPVAKLRGLVTRWRRQESEDRPLVGLDEAAERLGISKGMARRWCKEGRLPAHK
A0A1W9UQ51      ----GGEQK-----------QKGTSRDGAWLTLGEAAARLGVSKDQARRWCKSGRLPATK
A0A497B563      ----GGEQK-----------QKGTSRDGAWLTLGEAAARLGVSKDQARRWCKSGRLPATK
A0A7V2VGP5      ----GGEQK-----------QKGTSRDGAWLTLGEAAARLGVSKDQARRWCKSGRLPATK
A0A497C1E5      ----AVGSS-----------QKRVEGDSVWLTLGEAAEQLGISRDQARRWCKSGRLPAVR
A0A7C0TV81      ----KIAEG-----------Q----GDG-WLTLKEAAQQLGVSKEQARRWRKSGRLPAVR
A0A3D1JCW0      SNGSRSNGKHAPVPHPAGESAPREPL----------------------------------
A0A2N2MJJ0      DDIEGNNGKKSRLRLPWAKKVQQD------------------------------------
A0A7C3QTG6      SYYQHDEPQPQLQEQPAPMLPPSRQTHVYYPPQNDVEEQYFVKENTRQRVARYENEPSQN
A0A7C2TGF5      TLSNKDREYLYQITGTDKLKGYRYKRAMIILKADEGKTDTQIMAELAVSRSCVKRVRKLY
A5V160          TVMSGSGQTLYGAPDVVEATVHRRAPDMTTHPDAQPAVTATTAVQGLDERRNGRAPHQ--
A0A2A6REI6      GVAGGDWEDLTAIEQMETTHANGQNGH-NGHNGQNSQPQPVQQKSDTGRQQSSRSRGRRR
A0A426TTK3      SGSPEDWEDLVALEQMEGVSGNGHNGNGNGKEHARPGDSATPTGNASSRQSSSRPRSRRR
A0A3M1LAM5      GWRQVVREQARGVTGHRGAEAPGQP------GDAAPAMEPVAVDSNLVREEDADGPA---
A0A536BZ00      SMQPAA---PRAATSPPPFSLPAAPVARSSAAAQSPAPQPVSPRPVPPRLARLPRPPQRL
A0A7C5LUL4      TSAHASLGVPATATEVPPATEPATPVASTHVAAPAAAPSPTA----LPTLAPTTRPP---
E8N5M1          YYYYGDNGNLKKKRK---------------------------------------------
A0A7X1U027      GHSSNDSGYSNGNGNGHSSNGNGHSNGNGLAAKSETDHVNGNGHSNGHSNGSVRSMTPEQ
A0A1F8U7F0      PYYSGYHYYHSMDGQ---------------------------------DLKPSRMRRLFG
A7NIZ1          RLFKRRRRRQSGMPGMVDTVDAGVTGIASGTRPDRGAPIDIVMDGFYATPTPETIDRHPV
A0A0P6XM68      GYYKGEYSY--------------YDDEARGNGKKH-------------------------
A0A2N2MEG3      GYYKGEYSYHNYYDEGSSSNQRAYRGNGNGNGKSK-------------------------
A0A353RQ31      PYSSRDKYRHSYGSE---------------------------------------------
A0A3B9KNR2      PYSARDKYRHSYGSE---------------------------------------------
A0A0P6XME1      ----------TYVSK---------------------------------------------
A0A3B9Q1T8      AAYDQGDPSENTVDL---------------------------------------------
A0A363SX22      QASNKRKANLQDIQSTSGLGLSLIPKKTPGNSHRFRNAQKQNKPTPINEPNSGEINRNIS
A0A326UPN3      AQQRVPQQASPVANQPQMQPAQMQPMQQMQPGHQMAPNSPSMMPNAPSMAPGSAPMMPPL
A0A455STY5      AQQRVPQQASPVANQPQMQPAQMQPMQQMQPGHQMAPNSPSMMPNAPSMAPGSAPMMPPL
A0A3D0UNQ0      LQQARNTLTSAYERLRKKEDVIQDSTQLPDEGKEMTHNIP--------------------
A0A7W1A7Y8      SEASPRRWWTLWSRNKVSVTPVSGKSHTNGSGIGHHSNGNGADAEQIQVADGVLPDDRAE
A0A2G6GG97      KKRRSRRLSKSSRIPSWITSIIKRS-----------------------------------
A0A7C5QIC8      GVQAHWPRR---------------------------------------------------
A0A1F8PTW9      YGAERDDLIIDD------------------------------------------------
A0A1F8QH26      YGAAKKTNNNGEGGEVGEGGEVGEGGEGGEGGEGGEGE----------------------
A0A535D584      DSANAEKPARRPAVQSPVASAR--------------------------------------
A0A521TS25      HGGKKSRRRRPKILRALGIGGR--------------------------------------
A0A7C3TYQ9      DEQE--------------------------------------------------------
A9B6E3          GRRFWNRKDDHQPVPSMSEPAPLDLHDPALDRSEAAYEMASHERSK--------------
A0A3M1H759      QIQTETAKRPWW-KPSFLR-----------------------------------------
A0A7C3J9I4      DQPVSAKVRRWWQRLPALK-----------------------------------------
A0A7V7XFT9      ------------------------------------------------------------
A0A497ASN6      WWKRLFKKHKKRSVRKQG------------------------------------------
A0A3D1TRD4      KPATEHVNGVIEVVEHGAAPVGDGKSGSRRQG----------------------------
A0A7V9AZN2      TPSTRSKAAQPALRRVGVTDNGTE------------------------------------
A0A7C5IJ97      EKPPSLGKRISSVTTAAGSTARKPATPAQATTQSAGKREQK-------------------
A0A7C3FJ85      EKRSSWPWAKKKRRHAKSH-----------------------------------------
A0A3M1ZZ81      GRRKKRRRRSRSLLPGWITAIIKR------------------------------------
A0A7C2TBJ3      LKPAGGAWRRILSPLVGRRAKSSGKTSKPNLGPQSRS-----------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      GKGRKERRRRRKEHRSTKAPLPSIPGNTHPQ-----------------------------
A0A847FKN0      GRRRRGPRDWWRRLTRRKRAGLGRDMVDPATEHRG-------------------------
A0A6J4UI39      PAASPRPDAPAREHAPQA------------------------------------------
A0A521IC37      KAKGTPALSVKGNGHANGNGHTNGNGAGKTETPSEKSKM---------------------
A0A7C1K503      RRRRQLPWWQVWRRLRKRLRRQPGEATEATETLVGANRA---------------------
A0A535IMD1      EPARKKGLFSRRHRTSAKKNEAVQ------------------------------------
A0A7V3K428      DMAGEVMPLVARMKRTASPLVDRVRSKISPGRAPQPEAQEQRRGHQR-------------
A0A5C7JS64      SGGSKPPSQNGSGRNFGQKVRELVPGGASKL-----------------------------
A0A3A0B2P8      EGTRRGALQIQANGQAGAHTLPALQEGIKPASNPLYQALRKR------------------
A0A497AF06      HPLWKRWLKAYPKSAGSSGFNRLGND----------------------------------
A0A661W444      HPLWKRWLGGFVKSR---------------------------------------------
A0A7W0KC11      TQGD--------------------------------------------------------
A0A838GDL6      IPPQDPPKSE--------------------------------------------------
A0A7W0AAE0      NRESAPAPGAMHVPSNRTTVGTRAFGDGPRHE----------------------------
A0A7W1TGR0      KRRLQLPSWLSRKHQQTGTQVQVQPISALRDSPLKGKSSQHQ------------------
A0A497BNC7      AGGRRPRSWIARLLKPGRSRRRRGAEVQGGGRTGAQR-----------------------
A0A7C6DKX5      G-----------------------------------------------------------
A0A521UD91      SPNGSKKEPALIGGRHSNGGHRL-------------------------------------
A0A7C7DWW4      PKAARRTESM---PLSVNQPGANGAGATRTTERTSQKRT---------------------
I0I8T2          HAKAAAETTMVVSPQPVPHRSINN-GAPLEPESVGQPKSVK-------------------
A0A8B5XE16      SDESLPGPKSRLGRLFNRS-----------------------------------------
I4EI06          DRVGDGNPVASLGTDLDGRHASPDRPVRRVGDPGD-------------------------
A0A522N7L9      SGHDGASDAPATHREPRPTLRVP-------------------------------------
A0A535W4H1      ATSSKPG-----------------------------------------------------
A0A3D0D4X6      SGPAPAQRRKRKGFLGSARHTAE-------------------------------------
D1C8M3          DTGDQDGSGPGASTRLSQRLGTLVSGRAVDATQRGNQ-----------------------
D1CAL1          ARRGESPSVIPHWADGAGDRVVIRRSLRPTISKPADSET---------------------
A0A7W1THS1      SPSAIPISSVGQHQPAESDRLLHLEGD-SVAQPPQ-------------------------
A0A7C4K810      YREGSEKNGRGDKKRAEAGVRNGAPTVNGEKQNRS-------------------------
A0A7V2PIU4      DE---------QSPGDTPGRKH------PPASRPATGGLGQRIARSVRRS----------
A0A7C3FPG2      GASGEA-GDRGKGKGHSSARGR------KSRREGE-SWLCRQFSRFGR------------
A0A7V5BPS1      GASTDGKGGRGEGDGKRASRRR------KSRRQAERGWLSRQFSRFSR------------
A0A7C5MIR7      TATKRARPSLAQAVSKPRKKAARA----QGVERSS-------------------------
A0A7L5YLH3      DGKDSPGGPGDGGA--------------PHERRTP-------------------------
A0A800D757      EKRRRRHTGLDEAARRLAGKIKGWVASLPTVGQGA-------------------------
A0A7C5ARI8      ESQRRLPRWWPFGKKKRHRRRTARPDT-GATERRD-------------------------
A0A1J4ZRV4      EGGQRRRSISPHGADEEGAPARGRARF-PWPRLRA-------------------------
A0A1V5RXW5      ESGERRKHSSRRGTGV-------RFRL-PWPRKAA-------------------------
A0A2E5F6N9      EGGSDDARAPSFIGRIRNKLFSS-------------------------------------
A0A2E6J6X7      EDTNPESKSSKNPFRIFRSIFNR-------------------------------------
                                                                            

A0A7X1PB30      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A847FV42      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      EGDLHDASSARSRLESADAYLADATAAGADATRVSSVAQDVARLRATLDAAPAKSALVVN
A0A7C5A5U0      ------------------------------------------------------------
A0A0P6WSP2      ------------------------------------------------------------
A0A7Y4RFU7      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      RFMRQWIPESAIDMVLSQRITTVEPPTPASGVSEESPDSSNGTHGTPGDLRAQREAILDF
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      IILNEQNREISSHSEDVPQGRNPKLRGLLTFG----------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A7C1G8J6      QG-RRWKVRRADLETMGRGG----------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A0M8KAF3      ARLLSFVNVKS-------------------------------------------------
A0A523V9H6      AGLRRRRAKR-----GEEREAAGEG-----------------------------------
A0A2U2S5W9      RGLFGRSQEHTGSSGEGRTENVQHS-----------------------------------
A0A7C3W344      RGWFGRSRER---EPESEGEQAREG-----------------------------------
A0A2N2MEK3      SVELVN------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      SR-LRWWVKREDLENLVESLRNGDAEIIRET-----------------------------
A0A1W9UQ51      KWQLWWRIDPGGLERMLEDTWELKAKV---------------------------------
A0A497B563      KWQLWWRIDPGGLERMLEDTWELKAKV---------------------------------
A0A7V2VGP5      KWQLWWRIDPGGLERMLEDTWELKAKV---------------------------------
A0A497C1E5      KW-FWWRVESDGLDRMLEDTWEIKRSG---------------------------------
A0A7C0TV81      KG-LRWLVDPADVTRMLEDTLEIKV-----------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A7C3QTG6      EITQPRPRTVPQQKNPETADRVQVIEILPPLTFTPYKDEDKDYFIKDE------------
A0A7C2TGF5      ATKGLERVLYGNIQSGETRHKNGMVEFTHPFEV---------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      SGD---------------------------------------------------------
A0A426TTK3      SGD---------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      PPWPPHRWARRRLGQHRGGYHRPRARRRIPRLSACRE-----------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          --TAISEPGSQPVTSINPPSKPTSR-----------------------------------
A0A7X1U027      EALPLSAAMNELLSRMDDTVGMIRSLKPGNSKGSDAL-----------------------
A0A1F8U7F0      KLSPFNHNGHKKVEAGVVEENVIEKP----------------------------------
A7NIZ1          SAGAVVATRTDERRNGMTPHQMNQTK----------------------------------
A0A0P6XM68      ---STFRWRTRKNQTQEEKTAESGQE----------------------------------
A0A2N2MEG3      ---MTSWFGRAKKAPGEAPAQEQEKQ----------------------------------
A0A353RQ31      --------ESTEVALTEQKGNKVLHH----------------------------------
A0A3B9KNR2      --------ENIDLAFTEQKGT---------------------------------------
A0A0P6XME1      --------ETDELTLLEN------------------------------------------
A0A3B9Q1T8      --------QKEGIQRMDN------------------------------------------
A0A363SX22      NKLL--------------------------------------------------------
A0A326UPN3      NGSRGLLSQQQPQQNNQRR-----------------------------------------
A0A455STY5      NGSRGLLSQQQPQQNNQRR-----------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A7W1A7Y8      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A7V7XFT9      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A7V9AZN2      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A847FKN0      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7V3K428      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A7W0KC11      ------------------------------------------------------------
A0A838GDL6      ------------------------------------------------------------
A0A7W0AAE0      ------------------------------------------------------------
A0A7W1TGR0      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A8B5XE16      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7W1THS1      ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7V2PIU4      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A7V5BPS1      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7L5YLH3      ------------------------------------------------------------
A0A800D757      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A7X1PB30      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A847FV42      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      LAKLDKAAMPTQIVIAGVTYALDSGTQKIWRIDTDGSATAVIQKGLAGIGSPQRMAVAGD
A0A7C5A5U0      ------------------------------------------------------------
A0A0P6WSP2      ------------------------------------------------------------
A0A7Y4RFU7      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      VSRPNKSDSEN-------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A7C1G8J6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A7C3W344      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A7V2VGP5      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A7C0TV81      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A7C3QTG6      ------------------------------------------------------------
A0A7C2TGF5      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A7X1U027      ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A7W1A7Y8      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A7V7XFT9      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A7V9AZN2      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A847FKN0      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7V3K428      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A7W0KC11      ------------------------------------------------------------
A0A838GDL6      ------------------------------------------------------------
A0A7W0AAE0      ------------------------------------------------------------
A0A7W1TGR0      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A8B5XE16      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7W1THS1      ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7V2PIU4      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A7V5BPS1      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7L5YLH3      ------------------------------------------------------------
A0A800D757      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A7X1PB30      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A847FV42      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      VLYVLDDGGKIFKWQRETLTPLSVADRRYKDVAQFVVVANSMYVLDKTSAQVWRYQLVVG
A0A7C5A5U0      ------------------------------------------------------------
A0A0P6WSP2      ------------------------------------------------------------
A0A7Y4RFU7      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A7C1G8J6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A7C3W344      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A7V2VGP5      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A7C0TV81      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A7C3QTG6      ------------------------------------------------------------
A0A7C2TGF5      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A7X1U027      ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A7W1A7Y8      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A7V7XFT9      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A7V9AZN2      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A847FKN0      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7V3K428      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A7W0KC11      ------------------------------------------------------------
A0A838GDL6      ------------------------------------------------------------
A0A7W0AAE0      ------------------------------------------------------------
A0A7W1TGR0      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A8B5XE16      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7W1THS1      ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7V2PIU4      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A7V5BPS1      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7L5YLH3      ------------------------------------------------------------
A0A800D757      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A7X1PB30      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A847FV42      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      GFAAPVALLDQPVPGTPRSLAVDSDIWIVTTDAQVLRYHINAGATTASRVPFDIHWTADA
A0A7C5A5U0      ------------------------------------------------------------
A0A0P6WSP2      ------------------------------------------------------------
A0A7Y4RFU7      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A7C1G8J6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A7C3W344      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A7V2VGP5      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A7C0TV81      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A7C3QTG6      ------------------------------------------------------------
A0A7C2TGF5      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A7X1U027      ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A7W1A7Y8      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A7V7XFT9      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A7V9AZN2      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A847FKN0      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7V3K428      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A7W0KC11      ------------------------------------------------------------
A0A838GDL6      ------------------------------------------------------------
A0A7W0AAE0      ------------------------------------------------------------
A0A7W1TGR0      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A8B5XE16      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7W1THS1      ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7V2PIU4      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A7V5BPS1      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7L5YLH3      ------------------------------------------------------------
A0A800D757      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A7X1PB30      ------------------------------------------------------------
A0A1F8RRT9      ------------------------------------------------------------
A0A3M1EAN8      ------------------------------------------------------------
A0A6I1QLV0      ------------------------------------------------------------
A0A535FRM3      ------------------------------------------------------------
A0A401ZA55      ------------------------------------------------------------
A0A4P6JS79      ------------------------------------------------------------
A0A535QK16      ------------------------------------------------------------
A0A6L7WZR1      ------------------------------------------------------------
A0A847FV42      ------------------------------------------------------------
A0A3A4VPK9      ------------------------------------------------------------
A0A3D0CW53      ------------------------------------------------------------
A0A535RWE5      ALPIDLQVRDGDSRLFLLDDRARRFIVVDRDGREIARIATAPELPRPIAFAISGDGILSA
A0A7C5A5U0      ------------------------------------------------------------
A0A0P6WSP2      ------------------------------------------------------------
A0A7Y4RFU7      ------------------------------------------------------------
A0A5C7JWY1      ------------------------------------------------------------
A0A1F8QGH2      ------------------------------------------------------------
A0A1Q7TTL6      ------------------------------------------------------------
A0A0S8KFR9      ------------------------------------------------------------
A0A535SLQ0      ------------------------------------------------------------
A0A1F8SS27      ------------------------------------------------------------
A0A2E0L5X9      ------------------------------------------------------------
A0A3A0AXU8      ------------------------------------------------------------
A0A359HML3      ------------------------------------------------------------
A0A3M1EJ46      ------------------------------------------------------------
A0A7C1G8J6      ------------------------------------------------------------
A0A3D1U3H5      ------------------------------------------------------------
A0A0M8KAF3      ------------------------------------------------------------
A0A523V9H6      ------------------------------------------------------------
A0A2U2S5W9      ------------------------------------------------------------
A0A7C3W344      ------------------------------------------------------------
A0A2N2MEK3      ------------------------------------------------------------
A0A3B9J9U6      ------------------------------------------------------------
A0A661VSD8      ------------------------------------------------------------
A0A1W9UQ51      ------------------------------------------------------------
A0A497B563      ------------------------------------------------------------
A0A7V2VGP5      ------------------------------------------------------------
A0A497C1E5      ------------------------------------------------------------
A0A7C0TV81      ------------------------------------------------------------
A0A3D1JCW0      ------------------------------------------------------------
A0A2N2MJJ0      ------------------------------------------------------------
A0A7C3QTG6      ------------------------------------------------------------
A0A7C2TGF5      ------------------------------------------------------------
A5V160          ------------------------------------------------------------
A0A2A6REI6      ------------------------------------------------------------
A0A426TTK3      ------------------------------------------------------------
A0A3M1LAM5      ------------------------------------------------------------
A0A536BZ00      ------------------------------------------------------------
A0A7C5LUL4      ------------------------------------------------------------
E8N5M1          ------------------------------------------------------------
A0A7X1U027      ------------------------------------------------------------
A0A1F8U7F0      ------------------------------------------------------------
A7NIZ1          ------------------------------------------------------------
A0A0P6XM68      ------------------------------------------------------------
A0A2N2MEG3      ------------------------------------------------------------
A0A353RQ31      ------------------------------------------------------------
A0A3B9KNR2      ------------------------------------------------------------
A0A0P6XME1      ------------------------------------------------------------
A0A3B9Q1T8      ------------------------------------------------------------
A0A363SX22      ------------------------------------------------------------
A0A326UPN3      ------------------------------------------------------------
A0A455STY5      ------------------------------------------------------------
A0A3D0UNQ0      ------------------------------------------------------------
A0A7W1A7Y8      ------------------------------------------------------------
A0A2G6GG97      ------------------------------------------------------------
A0A7C5QIC8      ------------------------------------------------------------
A0A1F8PTW9      ------------------------------------------------------------
A0A1F8QH26      ------------------------------------------------------------
A0A535D584      ------------------------------------------------------------
A0A521TS25      ------------------------------------------------------------
A0A7C3TYQ9      ------------------------------------------------------------
A9B6E3          ------------------------------------------------------------
A0A3M1H759      ------------------------------------------------------------
A0A7C3J9I4      ------------------------------------------------------------
A0A7V7XFT9      ------------------------------------------------------------
A0A497ASN6      ------------------------------------------------------------
A0A3D1TRD4      ------------------------------------------------------------
A0A7V9AZN2      ------------------------------------------------------------
A0A7C5IJ97      ------------------------------------------------------------
A0A7C3FJ85      ------------------------------------------------------------
A0A3M1ZZ81      ------------------------------------------------------------
A0A7C2TBJ3      ------------------------------------------------------------
A0A3C0XJG2      ------------------------------------------------------------
A0A7C3NE64      ------------------------------------------------------------
A0A7C4V0A1      ------------------------------------------------------------
A0A847FKN0      ------------------------------------------------------------
A0A6J4UI39      ------------------------------------------------------------
A0A521IC37      ------------------------------------------------------------
A0A7C1K503      ------------------------------------------------------------
A0A535IMD1      ------------------------------------------------------------
A0A7V3K428      ------------------------------------------------------------
A0A5C7JS64      ------------------------------------------------------------
A0A3A0B2P8      ------------------------------------------------------------
A0A497AF06      ------------------------------------------------------------
A0A661W444      ------------------------------------------------------------
A0A7W0KC11      ------------------------------------------------------------
A0A838GDL6      ------------------------------------------------------------
A0A7W0AAE0      ------------------------------------------------------------
A0A7W1TGR0      ------------------------------------------------------------
A0A497BNC7      ------------------------------------------------------------
A0A7C6DKX5      ------------------------------------------------------------
A0A521UD91      ------------------------------------------------------------
A0A7C7DWW4      ------------------------------------------------------------
I0I8T2          ------------------------------------------------------------
A0A8B5XE16      ------------------------------------------------------------
I4EI06          ------------------------------------------------------------
A0A522N7L9      ------------------------------------------------------------
A0A535W4H1      ------------------------------------------------------------
A0A3D0D4X6      ------------------------------------------------------------
D1C8M3          ------------------------------------------------------------
D1CAL1          ------------------------------------------------------------
A0A7W1THS1      ------------------------------------------------------------
A0A7C4K810      ------------------------------------------------------------
A0A7V2PIU4      ------------------------------------------------------------
A0A7C3FPG2      ------------------------------------------------------------
A0A7V5BPS1      ------------------------------------------------------------
A0A7C5MIR7      ------------------------------------------------------------
A0A7L5YLH3      ------------------------------------------------------------
A0A800D757      ------------------------------------------------------------
A0A7C5ARI8      ------------------------------------------------------------
A0A1J4ZRV4      ------------------------------------------------------------
A0A1V5RXW5      ------------------------------------------------------------
A0A2E5F6N9      ------------------------------------------------------------
A0A2E6J6X7      ------------------------------------------------------------
                                                                            

A0A7X1PB30      ------------
A0A1F8RRT9      ------------
A0A3M1EAN8      ------------
A0A6I1QLV0      ------------
A0A535FRM3      ------------
A0A401ZA55      ------------
A0A4P6JS79      ------------
A0A535QK16      ------------
A0A6L7WZR1      ------------
A0A847FV42      ------------
A0A3A4VPK9      ------------
A0A3D0CW53      ------------
A0A535RWE5      NEGTIQRTPIPK
A0A7C5A5U0      ------------
A0A0P6WSP2      ------------
A0A7Y4RFU7      ------------
A0A5C7JWY1      ------------
A0A1F8QGH2      ------------
A0A1Q7TTL6      ------------
A0A0S8KFR9      ------------
A0A535SLQ0      ------------
A0A1F8SS27      ------------
A0A2E0L5X9      ------------
A0A3A0AXU8      ------------
A0A359HML3      ------------
A0A3M1EJ46      ------------
A0A7C1G8J6      ------------
A0A3D1U3H5      ------------
A0A0M8KAF3      ------------
A0A523V9H6      ------------
A0A2U2S5W9      ------------
A0A7C3W344      ------------
A0A2N2MEK3      ------------
A0A3B9J9U6      ------------
A0A661VSD8      ------------
A0A1W9UQ51      ------------
A0A497B563      ------------
A0A7V2VGP5      ------------
A0A497C1E5      ------------
A0A7C0TV81      ------------
A0A3D1JCW0      ------------
A0A2N2MJJ0      ------------
A0A7C3QTG6      ------------
A0A7C2TGF5      ------------
A5V160          ------------
A0A2A6REI6      ------------
A0A426TTK3      ------------
A0A3M1LAM5      ------------
A0A536BZ00      ------------
A0A7C5LUL4      ------------
E8N5M1          ------------
A0A7X1U027      ------------
A0A1F8U7F0      ------------
A7NIZ1          ------------
A0A0P6XM68      ------------
A0A2N2MEG3      ------------
A0A353RQ31      ------------
A0A3B9KNR2      ------------
A0A0P6XME1      ------------
A0A3B9Q1T8      ------------
A0A363SX22      ------------
A0A326UPN3      ------------
A0A455STY5      ------------
A0A3D0UNQ0      ------------
A0A7W1A7Y8      ------------
A0A2G6GG97      ------------
A0A7C5QIC8      ------------
A0A1F8PTW9      ------------
A0A1F8QH26      ------------
A0A535D584      ------------
A0A521TS25      ------------
A0A7C3TYQ9      ------------
A9B6E3          ------------
A0A3M1H759      ------------
A0A7C3J9I4      ------------
A0A7V7XFT9      ------------
A0A497ASN6      ------------
A0A3D1TRD4      ------------
A0A7V9AZN2      ------------
A0A7C5IJ97      ------------
A0A7C3FJ85      ------------
A0A3M1ZZ81      ------------
A0A7C2TBJ3      ------------
A0A3C0XJG2      ------------
A0A7C3NE64      ------------
A0A7C4V0A1      ------------
A0A847FKN0      ------------
A0A6J4UI39      ------------
A0A521IC37      ------------
A0A7C1K503      ------------
A0A535IMD1      ------------
A0A7V3K428      ------------
A0A5C7JS64      ------------
A0A3A0B2P8      ------------
A0A497AF06      ------------
A0A661W444      ------------
A0A7W0KC11      ------------
A0A838GDL6      ------------
A0A7W0AAE0      ------------
A0A7W1TGR0      ------------
A0A497BNC7      ------------
A0A7C6DKX5      ------------
A0A521UD91      ------------
A0A7C7DWW4      ------------
I0I8T2          ------------
A0A8B5XE16      ------------
I4EI06          ------------
A0A522N7L9      ------------
A0A535W4H1      ------------
A0A3D0D4X6      ------------
D1C8M3          ------------
D1CAL1          ------------
A0A7W1THS1      ------------
A0A7C4K810      ------------
A0A7V2PIU4      ------------
A0A7C3FPG2      ------------
A0A7V5BPS1      ------------
A0A7C5MIR7      ------------
A0A7L5YLH3      ------------
A0A800D757      ------------
A0A7C5ARI8      ------------
A0A1J4ZRV4      ------------
A0A1V5RXW5      ------------
A0A2E5F6N9      ------------
A0A2E6J6X7      ------------
                            

© 1998-2022Legal notice