BYKdb

Dataset for cluster orphancd of phylum chloroflexi

[Download (right click)] [Edit] [Sequences] [Repertoires]

56 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3M1MN85      -------------MNLKFLDYFSPIFRWWWLLIVCALVAGGVGYALVN-PLPPVYQSGIT
A0A5N9DUL0      ------MNQNQQEQSIDFKKYIGLAISYSWLIILLPTIVGTGAYFYSQ-QQTKLYEAKAT
A0A2W6B4S3      --------MELRDLIRVAKRWVPI-------ALIVALTLAIASYAFTKFTVKKVYTATVT
A0A2E6YFL8      MQNSNITMPQLNDINTTFRRYVGIFLNYWWVFLILPAILGIGTYFYSS-SQDTMYEATST
A0A5N9B1G6      MQNSNITMPQLNDINTTFRRYVGIFLNYWWVFLILPAILGIGTYFYSS-SQDTMYEATST
A0A1Y6K3L6      ---------------MDFRQFVNIAKRWIWLALVGALVAGGLGYYISS-QETPLFQASTR
A0A1F8QKW6      ---------------MEIKQYLEPLIKWWKLILVACLLAGISSFLIIS-RQPPTYQTRVS
A0A356DVN8      ------------------YSYLN-------------------------------------
A0A1F3AZM3      -----------------YYAYLD-------------------------------------
A0A350FYF2      ---------------MEINTYLRPLIRWWRLIVIVTMLAVIASAVSAL-LQPAAYVSRTT
A0A363U3C3      ---------------MDISVYLRPLLRWWRLIMIVTVLAVVASAVSTM-FQPEIYVSRTT
A0A0M8JPC7      ---------------MDIRPYLAPIFKWWWLLLAAAALATGTAYFILR-DQPAVYTARTT
A0A1F8PQP8      ---------------MELRTYFRPLLKWWWLLLAAGLVAAVSSFVVMG-RRPLIYQSRTT
A0A0S7BVT9      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A351G432      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
                                                                            

A0A3M1MN85      LLVGNALDTPNPSSLEVEIPRRLTDAYAAMALREPVRD----GVKKALGLDE--------
A0A5N9DUL0      LLVEQRSSGLSTSISDYSLSARLSKTYAKLITADPFLD----QVRETNGFER--------
A0A2W6B4S3      MEVQAGVTG--QSVPDPTISNLIVPTEAQVAAQGPTVDQAMRRVQSTPGIAITPGEIAAI
A0A2E6YFL8      LLVEQRRTGGVAGVSDFTLSEDLARMYMKQILSTPFIS----RVVEEPDVKY---NVDEL
A0A5N9B1G6      LLVEQRRTGGVAGVSDFTLSEDLARMYMKQILSTPFIS----RVVEEPDVKY---NVDEL
A0A1Y6K3L6      FVILRAATTGYDYYAYIDYQQQI-QTYSELLTTDALLN----QASEELG-------YSAQ
A0A1F8QKW6      LVIGRAVYEPNPSGGEMGLAQQLAAYYANIAEREVIRN----ATMTALNLRW----LPAY
A0A356DVN8      -------------------NQDIVDTYAQLLTTEELLF----QASEALG-------FPVR
A0A1F3AZM3      -------------------SQQLLQTYIQLLTTEKVLN----AASEKLG-------YPVY
A0A350FYF2      LVIGTTILDPNPDSGQIYIAQQLAGIYADIAEREPIQQ----ATMDSLGIDW----LPLY
A0A363U3C3      LVIGTTILDPNPDSGQIYIAQQLASIYADMARREPIQQ----ATMEALGIGW----LPQY
A0A0M8JPC7      LMIGRTLLEANPSSNDFWLNQQLSSLYSDMAYREPVQE----GVKKALGMTW----LPKY
A0A1F8PQP8      LVVGSSVYEANPQTGDFFLNEQLAGFYADLVQRTPIQL----ETMKALNLEW----LPSY
A0A0S7BVT9      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A351G432      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
                                                                            

A0A3M1MN85      LPKYTAYTIPGSTMVRIEVTDTNPRRAQAVATELGRQLMAQSPGGTTRDS-ETQAFLEEQ
A0A5N9DUL0      LGSVQTRTQENPPLIEIYVRDSDRVLVGEVANAISLNFI----------D-YVIERRLTE
A0A2W6B4S3      KASIQCKPNPDTSLFSCSASAHQAEVAALVANQLATVFT----------Q-GEQAFDQQR
A0A2E6YFL8      KLMLTADAHINPPTLDVIIRNSDKTEAADVANKIAATFI----------N-YTVELRLAE
A0A5N9B1G6      KLMLTADAHINPPTLDVIIRNSDKTEAADVANKIAATFI----------N-YTVELRLAE
A0A1Y6K3L6      DVTASASQIADTQFMRLTVTHPDPVKAAEIANVLVKVLIDQNERLQSVRYEATERNMQQR
A0A1F8QKW6      ----ASQAVPNSQIIEITVTDTDPVRAQAVANELANQLIKQSPSNPDLKEQKRQEFIRQQ
A0A356DVN8      KGQATAKQVDDTKFVVLTVKDPDPFKAATIANGLVSIMISQNENLQSVQFAAAEKNLQDR
A0A1F3AZM3      AGQASAQQVPDTQFVRLTVTNTDPQRAADIANVLVMVLIDQNEELQAVRYLTSEQNLQSQ
A0A350FYF2      ----QSKVVPNTQMVEISVTDTNPKRAQIIADELARQLMLQSPAIGGTETGDRQEFIREQ
A0A363U3C3      ----QAKVVPNTQMVEITVSDTVPKRAQIIANELANQLMLQSPAIGGTETGERQDFIKQQ
A0A0M8JPC7      ----VVKTFGNGQFIEIDVIDTSPERAMHVASELANQLILVSPGSKEVNS-NNEAFIQEQ
A0A1F8PQP8      ----SASTIPNTPLIEILVNDTDPSRAQAVANELATQLIKQTPTNDPVNT-ERRGFIENQ
A0A0S7BVT9      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A351G432      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
                                                                            

A0A3M1MN85      LHKIADAISETEQDIAAK-----QEEMATAEG-----ASAILSLQADLDA----------
A0A5N9DUL0      IARL--------------------QAAASAQG-----LSDVQS-----------------
A0A2W6B4S3      YQTVLTNIRSSEAIARKN-----GDAALLSRL-----QGSEIS-----------------
A0A2E6YFL8      IAKI--------------------QTAALSQG-----LPNVQE-----------------
A0A5N9B1G6      IAKI--------------------QTAALSQG-----LPNVQE-----------------
A0A1Y6K3L6      ADQALEQIEILQAQIDQLSTASVQEQLTQVESEINELQEQIFALETQIVELETKISE---
A0A1F8QKW6      LELLETQIQDTQEQIAQQ-----ENEMGTLNS-----ARQIAEAQADLTA----------
A0A356DVN8      IDQAEEQIATLETQISQISDEMLQSQIESVQLQMDDVQAQVNNLKTDMAQIYPGSLAVEN
A0A1F3AZM3      IDQVQSQITTMQTQINDISEATVQDQLVQVKAQIEPLQTQVTTLETEIADLQKNRYP---
A0A350FYF2      LSSLQIQIQETETKIEEL-----QTSLVDLNS-----ASQIANIETEIRD----------
A0A363U3C3      LDSLKVQIQDTEKNIEEL-----QKSLIGINS-----ASQIANIEKQINE----------
A0A0M8JPC7      LQKLQEQIVATEKELVAR-----QDSLGGLTS-----AHEIEQAKAELRT----------
A0A1F8PQP8      LNLFEADIVQTQIDINDK-----TASLDSLTS-----ARQIAETQDDIRS----------
A0A0S7BVT9      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A351G432      -----------------------------------------MFQKKICKPKWQMLKXALE
A0A353H3Y9      --------------------------------------------------RYIDLRTNLE
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------MGRVSESKASLE
                                                                            

A0A3M1MN85      ------------------------------------------------------------
A0A5N9DUL0      ------------------------------------------------------------
A0A2W6B4S3      ------------------------------------------------------------
A0A2E6YFL8      ------------------------------------------------------------
A0A5N9B1G6      ------------------------------------------------------------
A0A1Y6K3L6      -FNPLFATEEQKAQHEANRTRAAELEAEVKQLTPILALYQQIFTNLTVLGRVPDSSTNTS
A0A1F8QKW6      ------------------------------------------------------------
A0A356DVN8      IADLKSLTEDLESLTEEEIAQLTAYQTKLDEITPILELYQEIYTELVVLGQTTGASNQNP
A0A1F3AZM3      --------------TEEENAQLAEKEATLAQVKPILTLYQQLYTNLVVLGQPVDTGTNTS
A0A350FYF2      ------------------------------------------------------------
A0A363U3C3      ------------------------------------------------------------
A0A0M8JPC7      ------------------------------------------------------------
A0A1F8PQP8      ------------------------------------------------------------
A0A0S7BVT9      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A351G432      TREETRPYQPTPTLAPETLSQIQENRLDLQQKQGMLNLYQELYFNLLSSDSSGNPILTSG
A0A353H3Y9      T--------------------------ELANTDKQISSINARLAAIPTDTAGNAINPNDV
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      R--------------------------EITSVEADITRTQDALNAVTDDN----------
                                                                            

A0A3M1MN85      -LNNKLATLQENYARLLASSQSNAINT----------LRVVEEATLPTRPIGPNKVLDVA
A0A5N9DUL0      ----------------LVNAQFTALDS----------LYLLEPVSTPTTPISPDVQQNIT
A0A2W6B4S3      ----------------VLVDAAQRASI----------VRITQQAQRPTSPSSPHPTLNAA
A0A2E6YFL8      ----------------LVASNFTTLDS----------LSLLEPAAPPKSPAFPRTKRNTA
A0A5N9B1G6      ----------------LVASNFTTLDS----------LSLLEPAAPPKSPAFPRTKRNTA
A0A1Y6K3L6      IEISQLQTNLNLYQQIYINSISSLENLNLTRAQNTPNVIQVEPARIPKKPISPKPMQDAA
A0A1F8QKW6      -QRQKLTTLQTNYATMLGTSLGRASNS----------LNIIETAALPTRPIGPNRGTIIL
A0A356DVN8      TDLDRLKTTLNLYQQIYISSINNLETLKLAKAQNTPTVMQVETAAKPTVPISPKPTETAL
A0A1F3AZM3      TRLQQLQTTLSLYQGIYVNLLNSLENVRFARVQNTPNVVQVEPAVASTSPISPRPFQSTA
A0A350FYF2      -HTQKLNSLRESYANFLVNSQEGALNI----------LSIVEPANLPTRSVGTSKLIIIA
A0A363U3C3      -QTQRLNSFRENYASLLANSQEGALNI----------LSVVEPANLPSNPVGTNRFFIIA
A0A0M8JPC7      -LEDKLSLLRTNYANLLSSSKENITNI----------LQVIEPASLPVRPTGPNRYLIIA
A0A1F8PQP8      -LEQKLASLRSSYAALLASSDRGAGNT----------LRLIEPANLPGRPISPNTFTMVM
A0A0S7BVT9      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A3N5RU86      ---------------------------------------------------------MEL
A0A536AN01      ---------------------------------------------------MADLLQLST
A0A3N5NV84      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A351G432      AGSNQYQSTLALYQQIYANLLSDYEAVRLSRMENTTTVVSVEPATPKMQPIRPKPVTNTL
A0A353H3Y9      ATRAQLETSLSQYEQARSYLVSDYQQLMLSEVLSTSTVVQKDPAVANPLPIQPQPMRSAL
A0A2M8PN31      --------------------------------MKKPNARIVDRAVPPMFPSSPRHVLNIG
A0A2N2PFW9      -QRMRLETSLAQYRSTYSSLLSSYQQIRLAEAQATDNIAIAKPARVPEEPIRPRTMTNTL
                                                                            

A0A3M1MN85      AATLGGLILATLGAYGIEYLDDRLKTETHIQHLVHYSLTGYIPTIYTQEN------PVTY
A0A5N9DUL0      FGIMIGLALALGLTFLISNLRDTVRNPDDIRTKFGVSVLGMVFEWSSKEVNE----NDLI
A0A2W6B4S3      LAFLAALLLVLGVGFVSDRLDDSVRGEEEIKELTGLPLLGIVPSIDMLKDRAL-SPNSLL
A0A2E6YFL8      IGVMLGFLLATFLSVLLSSITSTIKDVENIYNQFGVPTLGNIFRWGSQNDQ-----NEVL
A0A5N9B1G6      IGVMLGFLLATFLSVLLSSITSTIKDVENIYNQFGVPTLGNIFRWGSQNDQ-----NEVL
A0A1Y6K3L6      LYASVGFLLMAGIAFLMEYLDDTIKTPEDVKQILGLPVIGLVADMETGRSKHKGQSKGVF
A0A1F8QKW6      MSIAIAFMISAGAAYLIEYLDDSIETPEEINRVMKLPVIGFIPEID--NDVHK----ATI
A0A356DVN8      LGAAIGLLITAAIVFLIEFLDDTLKTPDEIKAILEVPVIGFIGELKQSSKKGE-DALGVY
A0A1F3AZM3      LAAAVGLMLAAGIAFLIEYLDDTLKTMEDIERVMQLPVVGYIAEIQYESGSDE----SLY
A0A350FYF2      LAGLVGFSLGSGAAYLLEFLDRTIKTTSDVERIFNLPVIGYISEIY--ENGNN----AAY
A0A363U3C3      LAGLVGFSLGTGAAYLLEYLDKTVKTASDVERIFGLPVIGYISAIT--DDEDS----GTY
A0A0M8JPC7      LCGMAGLVLGAGCAYLLEYLDEAIQNPEELARLIDAPIVGYISDLG--RKANA----SLY
A0A1F8PQP8      LSTVIALALAAAAAYLIEYLDDTLKSPDEVTKLLDIPVVGFISEVE--RGKSL----EYY
A0A0S7BVT9      -------------------------------MLTMDRKLLTNFFRKNQKINDQ-NIRSLK
A0A2N2MQC3      -------------------MGKMFDVLQKLEREKTADQKKEEPAIVSDPDNQV-LDNKIV
A0A3N5RU86      ITVALAMAVGLSLSGSVAYVLEYMDGAIKSQDEIEVLLNTPVVGNIFEVKQGK-NKQPFS
A0A536AN01      LATIPNFSLARRRSGSKPLVIGTPGGNGKGNGN---------GNGAGSSESGS-RAEDLV
A0A3N5NV84      ----MAAAIGLVLAVGGALLIEFLDDTVKTPDDLQRTAQLTTLGTISRVAGGE-DKYRLI
A0A4P5V2S0      -----------------------------------MTSSSGAPVPSGPESAVK-GTPDVI
A0A3B9YZ03      -----------------------------------MTSSSGAPVPSGPESAVK-GTPDVI
A0A3L7X1Q5      -----------------------------------MTSSSGAPVPSGPESAVK-GTPDVI
A0A521JGZ9      ---------------------------------------------------MV-ENRVRI
A0A521JNM5      ----------------------------------------------------M-LQVNFQ
A0A3M1E8I5      ------------------------------------------------------------
A0A160T936      --------------------------------------------------------MALV
A0A3D0US14      --------------------------------------------------------MSLI
A0A3D0CW09      -------------------------------------------------MTIQ-GRAALI
A0A3M1DIE1      ---------------------------------------------------MT-QKPRLI
A0A524ATQ3      -------------------------------------------------MTDN-QLDHLI
A0A399ZSS8      ------------------------------------------------------MTNSLI
A0A521ID76      ------------------------------------------------------MSNTLI
A0A3C0ZZ70      -----------------------------------------------MIMANN-RQESLI
A0A535ICD6      -------------------------------------------------MLNN-RPSALV
A0A3M1M4P3      ---------------------------------------------------MK-REIPLV
A0A1F8N3P4      ---------------------------------------------------MS-DNPDLV
A0A524AMJ5      -------------------------------------------------MSVA-DDLGLV
A0A3L7VU47      ---------------------------------------------MTNPVAAS-PTSTLI
A0A426U8Y8      ---------------------------------------------------MT-TETTLV
A0A3M1EV88      -------------------------------------------------MAVE-EQAKLV
A0A2E0ZA41      --------------------------------------------------------MDLV
A0A3M1ZY58      -------------------------------------------------MNKE-AEKYLI
A0A2M8PT60      ----------------------------------------------------M-ANAKLI
A0A3M1QI99      ----------------------------------------------------M-ANAKLI
A0A3M1YX52      ----------------------------------------------------M-GNTKLI
A0A3N5PDS6      ------------------------------------------------------------
A0A536CYF7      ---------------------------------------MSWFATPSPNGRSL-ATGALI
A0A2W4MA80      ---------------------------------------------MSLSNGTS-P---LI
A0A2A6RLU6      ----------------------------------------------MSSNGST-AETTLV
A0A2H3KNY1      ----------------------------------------------MGANGSS-PETTLI
A0A532U8U9      ----------------------------------------------MAVNNRS-DS--LV
A0A1V5YJ40      ----------------------------------------------MTDKTAS-DL--LV
A0A2N5K785      ----------------------------------------------MTNKATP-NLSQLV
A0A351G432      LGSVAGLMLASGLVFLIEYLDDTVKSPDELSRFSSIPIIGYLPSLNQSKLNGK-NQSNVY
A0A353H3Y9      LAAVVGFMIAAGVIFLITFLEDTIRDPEEVTRKWGVPVLGVIS---R---YGS-TATPII
A0A2M8PN31      LGFIGGIGLGLVCVFGLAFIDDRVKSTVDVENSLNINLICLIPKVAR---KNS-FDKARI
A0A2N2PFW9      LAAVVGAMIAVGAVFLIEYLDDTIKTPDDVARVSGLSTLGAIA-----------------
                                                                            

A0A3M1MN85      LRKRPRSPAA--DAFRSIRNALGY----LADAPYRTLLVSSAAAGEGKSTVAAGLAISLA
A0A5N9DUL0      VDTSPKSSFA--EAFKQIRTNLQF---AATKSESRVYLTSSPGPGDGKSTLISNLAVAIA
A0A2W6B4S3      FFTGKRSPEA--ESFRVVRTGIAF---SRIDDPPRCLLVTSTVQAEGKSTFASNLACAFA
A0A2E6YFL8      THTDPSSPYS--EAFRHIRANFQF---ATANKQPPLFLITSPGPGEGKSTIISNLGASLA
A0A5N9B1G6      THTDPSSPYS--EAFRHIRANFQF---ATANKQPPLFLITSPGPGEGKSTIISNLGASLA
A0A1Y6K3L6      VADQPRSPIS--EAFRSMRTSLEF---YSVDQQLQMLIVTSSGPEEGKTTIASNLAVIIA
A0A1F8QKW6      VAEKPRSVVA--ESFRAVKVSLDF---GQVDVPAKSFLVASVSKTEGKSMIASNLAMTYA
A0A356DVN8      VAKNPRSPVA--EAFRSLRTNLEY---SSVDNPVKTVLVTSSRESEGKSTIAANLAIVEA
A0A1F3AZM3      VTRQPRSPVS--EAFRLLRTNLEF---AGVDRPIRRLLVTSAGPGEGKTTIAVNLAAIMA
A0A350FYF2      VYENPNSIIA--ENFRLIRSNIEF---FQISNPITTILITSPNQGNGKTTVASNLAISIS
A0A363U3C3      VEKNPDSILA--ENFRLLHSNIEF---FRVSNPIRTILVTSPNQGNGKTTVASNLALSIS
A0A0M8JPC7      VARHPRSLMA--EAFRTLRANIEL---QNLDNGPLALLITSPDTGDGKTSVAANLAVSFS
A0A1F8PQP8      ITNQPRSLIA--EAFRSLRTDLEF---SSVDKPLKTIYVTGTEVEAGKTSIAINLAIVIA
A0A0S7BVT9      KITDENSPFQFVEAYKSLRTNIDF---VSVNKRYQTIEITSAIPKEGKSGIAINLSISFV
A0A2N2MQC3      SFFAPSSMVT--EQFRRLRTHIIQ---PNQPNSPKTIVITSTLSGEGKSLIAINLAIIIA
A0A3N5RU86      IADNPRHPVT--EAFRNLRTFIEF---TNRD-KLHTILVTSAGSNDGKTWIAANLAISMA
A0A536AN01      VLHEPRSVVA--EAFRSLRTAVLF---SAPGAPPRVILLTSAGVGEGKTFTSLNLATTLA
A0A3N5NV84      PAEEPLSHVA--EAYRALRTNIRL---SSVDEPIRTLIVTSPSPREGKSTTAANLGVVVA
A0A4P5V2S0      VYTDPRSPAA--EAYRTLRTNVRALIRPAGGAPLRQILMTSAGADEGKSEAIACLGIAFA
A0A3B9YZ03      VYTDPRSPAA--EAYRTLRTNVRALIRPAGGAPLRQILMTSAGADEGKSEAIACLGIAFA
A0A3L7X1Q5      VYTDPRSPAA--EAYRTLRTNVRALIRPAGGAPLRQILMTSAGADEGKSEAIACLGIAFA
A0A521JGZ9      HRDKLDFRTN--EAYKALRTNIQF---CGDD--IKVISLTSCTPNEGKTSVSFNMATSFV
A0A521JNM5      NLPKLSFRVN--EAYKSLRTNIQF---CG--SGVKMICITSCLPNEGKSNVSFNLATSLA
A0A3M1E8I5      --------------------NIQF---MAVDHPTKTLLVTSPSLGEGKSTTAANLGVIMA
A0A160T936      TISDPRSPAS--EAYRSLRTNLSF---YSLDAPLRTLVVTSPAAGEGKSSTVANLAVTMA
A0A3D0US14      TLTDPRSPVS--EAYRTLRTNLSF---TGLDEPIRTLVVTSPAPDEGKTTTIANLAVTIA
A0A3D0CW09      TLTDPRSPVS--EAYRSLRTNLEF---ASLTGPLRSLVITSPGPGEGKSTMLANLAVTMA
A0A3M1DIE1      TLTDPRSPAA--EAYRTLRTNLTF---AGLDQPLEALVVTSPAMEEGKSLAVANLAVTMA
A0A524ATQ3      TVADPRSPVS--EAYRTLRTNLDF---SSLDKPIKTMLVTSTGPDEGKSTVLANLAVATA
A0A399ZSS8      TISNPRSPIA--EAYRTLRTNLEF---SNLDKTLRTLLVTSAGAEEGKSTMLANLAVTIA
A0A521ID76      TISNPRSPIA--EAYRTLRTNLEF---SNLDKSLRSLLVTSAGAEEGKSTTLANLAVTIA
A0A3C0ZZ70      TISNPRSPIS--EAYRTLRTNLEF---SSLDKPLRTMVVTSAGPEEGKSTTLANLAVTLA
A0A535ICD6      TLTNPRSPIS--EAYRTLRTNIEF---SSFEKKLHTLVVTSASPEEGKSTTLANLAVTMA
A0A3M1M4P3      TLTHPRSSAA--EAYRTLRTNLTF---ASLDKPIRSLIVTSAAPGEGKSTTLANLAVTMA
A0A1F8N3P4      TLSDPLSPIS--EAYRTLRMNLQF---AALDSPLRSLLITSATPGEGKSTTLANLAVTMA
A0A524AMJ5      TITDPLSPIS--EAYRTLRINLQF---ATLGVQLRTLLVTSAGAGEGKSTTLANLAVIVA
A0A3L7VU47      ALSAPQSAAA--EAFRSLRTNIQF---ASLDHTLQLITITSAGVDEGKSLVAANLAITMA
A0A426U8Y8      TLRDPGSAAA--EAYRTLRTNILF---SSLDRPLRTLLVTSTAPNEGKSTTLANLAVTMA
A0A3M1EV88      TLSDPRSPVA--EAYRSLRTNLEF---SSLDEPLRTMVVTSPAPEAGKSTTLANLAVTMA
A0A2E0ZA41      TITNPRSPLS--EAFRTLRTNLSF---YSLESPLRSLVVTSPVMGEGKSSTVANLAVTMA
A0A3M1ZY58      TLSDPRSPVS--EAYRTLRTNLSF---YSLDNPLRTLVVTSPAADDGKSTTVANLAVTMA
A0A2M8PT60      TLTDPRSPAS--EAFRTLRTNIMF---SSVENPITTLTVSSPAQGEGKSTLIANMAVTFA
A0A3M1QI99      TLTDPRSPAS--EAFRTLRTNIMF---SSVENPITTLTVSSPAQGEGKSTLIANMAVTFA
A0A3M1YX52      TLTDPRSEAA--EAFRTLRTNLMF---SSVENPIHTLLITSVAQSEGKSEVLANLAVTFA
A0A3N5PDS6      ------------------------------DRPLRCLVVTSALAAEGKTTTVANLAVVIA
A0A536CYF7      MLADPLSPAA--EAYRSLAANLQF---AYADRQLQTIGITSAAPGEGKSTTVANLAIALA
A0A2W4MA80      AIRDPRSPAA--EAYRTLRTNIQF---TSLDRPLRTLLATSTAPDEGKSTTLANLAVTIA
A0A2A6RLU6      TLRDPGSPAA--EAYRTLRTNILF---SSLDRPLRTLLVTSTAPNEGKSTTLANLAVTMA
A0A2H3KNY1      TLRDPGSPAA--EAFRTLRTNLLF---SSLDRPLHTLLVTSTAPDEGKSTTLANLAVTMA
A0A532U8U9      TLTTPRSPIS--EAYRTLRTNLEF---SSLDKPIKTIVVTSPGPEEGKSTTLANLAVTLA
A0A1V5YJ40      TLSDPRSPIS--EAYRTLRTNLQF---VSLDKPLRTILVTSAGPDEGKSTLIANLAIAMA
A0A2N5K785      ALRDPRSPAA--EAYRALRTNIQF---SSLDKPLRTILTTSTAPDEGKSTTVANLAITIA
A0A351G432      VQENPRSPAA--EAYRSLRTNIEF---AGIANQTKTIMITSASPQEGKSTTAVNLASILV
A0A353H3Y9      TVSQPRAPVS--ESFRSLRTNLQF---ASVAAPLKTILVTSPSPEDGKTSVVANLANVVS
A0A2M8PN31      VQNNMEPRAA--ESFRSLYSSIRI---SDVGRHSQVILTTSTLPSEGKSFVATNLAYTFA
A0A2N2PFW9      ----------------------RL---KETGGTRQL--------SEGKSTTAANLAVVMA
                                                              **:     :.    

A0A3M1MN85      -QAGYRVILVDADLRAPSLHTMLGLPQK-PGLSDVLQGK----IPLAESIIMLEN-L-GI
A0A5N9DUL0      -QTGKKVLIVDGDLRRPTLHRRFKNITRDTGLSNYLSDN----TETLGAVTQTSG-VSGV
A0A2W6B4S3      -ESGKSVILVDLDLRRPSLSKIVNTPMR--GLTNVLLDQ----ASSLESYLVAGA-LPNL
A0A2E6YFL8      -QNGKKVIILDADLRKPTIHRRFNLKKREPGLSTFLSDK----DLTPSEIIMNPG-IPNL
A0A5N9B1G6      -QNGKKVIILDADLRKPTIHRRFNLKKREPGLSTFLSDK----DLTPSEIIMNPG-IPNL
A0A1Y6K3L6      -GSNKKVLLLDADLRRPNVHQRLMIPNR-VGLSDLIRGR----LEINDVIQFSTE-IPYL
A0A1F8QKW6      -LSGKKVFLLDADLRRPSLHTYLDLPNA-KGLTTLLLHP----EKSIQQCAQSLP-IGNL
A0A356DVN8      -QSGKAVVIVDADMRRPKVHLQFSKPNR-MGLSDVVTGK----LGIDDVLKTYDQ-VENL
A0A1F3AZM3      -QGGKRVVLVDADLRRPKIHRFLGLSNK-VGLSDLFRGV----VAVRMVSQQVQD-VETV
A0A350FYF2      -HGEQDVVLVDADLRRPAIHNVLNITKN-PGLSDVIRNK----TDIDSVVRYWK--EDGL
A0A363U3C3      -HEEQDIIIVDADLRRPAIHNALKVPKN-PGLSDILRNK----ADVKSVVKSWKD-DDGI
A0A0M8JPC7      -QGGKRVILVDGDLRKPSLHEFFDISDR-RGLTDVLQGK----LSVEKALRTWD--GGGL
A0A1F8PQP8      -QSGKRVILMDADMRRPNVHRVLSLTNQ-KGLSDVFRGT----IDIYNATIPYK--EGNI
A0A0S7BVT9      -EIGKKVILIDADLRKPMLSSYLGENPADAKGLSTVLTG----CDLYASILHTKF---HF
A0A2N2MQC3      VEMQSHALLVDCDIRNPSIARLFGL-KDTKGLSNYLLGE----AE-IPDLLIKTS-VDKL
A0A3N5RU86      -REGKRVVLIDADLRNPSLHQFFHE-ERENGLTDLFQGK----QA-VTDVLKYNN-KERV
A0A536AN01      -DSGSRVLLIDADLRRAGCHRAFGI-VNERGLSSFLSGQ----VT-LAEAIRVLD-APKL
A0A3N5NV84      -QAGKSVILVDADLRRSSLHRFFAL-PSKEGLTNVLVQD----ELAVDGWLQETG-IDNL
A0A4P5V2S0      -QAGMRVVIVDADLRRPAQHLRFNL-PNGDGLSNLFSGA----TP-RTPTLQPTA-VPNL
A0A3B9YZ03      -QAGMRVVIVDADLRRPAQHLRFNL-PNSDGLSNLFGGA----TP-RTPTLQPTA-VPNL
A0A3L7X1Q5      -QAGMRVVIVDADLRRPAQHLRFNL-PNSDGLSNLFGGA----TP-RTPTLQPTA-VPNL
A0A521JGZ9      -DNGKRVVLIDADLRKSVLIGRYKVGKVENGLTHYLSGQ----NE-LEDIIYQTD-IQNM
A0A521JNM5      -ECGKKVIFIDADLRRSVIIGRYKPDQAVVGLTHYLSGQ----NK-IDEILYETN-IDNL
A0A3M1E8I5      -QADLRTIVVDADLRRPSLHKIFQV-PNAGGLTDLLRSP----EMELADQLKRTE-FENL
A0A160T936      -QSGRRTVLVDCDLRRPTLHELFGL-AMTPGLTSLALDE----TV--DLPLQETS-VENL
A0A3D0US14      -QGGRKTILVDCDLRRPTLHTLFDL-KPEPGLTNLLLEE----NG--QPALQPTM-VDGL
A0A3D0CW09      -QAGKKTIVVDTDLRRPSQHELFGL-DQEPGVTTMFMDP----ALQSAPPLQATE-IEGL
A0A3M1DIE1      -QGERRTILVDADLRRPRLHAIFGV-SNDRGLTTMFVEP----AAMANPPLVDVG-VENL
A0A524ATQ3      -QTGRKVILVDCDLRRPALHNVFNL-KKDVGLTTMVVDD----AAMESPPLQDTG-VEGL
A0A399ZSS8      -QSGKRVILVDADLRRPTQRQIFGL-KDNAGLTDMARDD----AARAQPPLQDSG-VPNL
A0A521ID76      -QSGKRVILVDADLRRPTLHQIFGL-KNNAGLTDMVRDD----AALANPPLQETT-VANL
A0A3C0ZZ70      -QAEKKVILVDCDLRRPSQHEIFEV-ENGVGLTTMVVDE----EAFKNPPLQETP-VPNL
A0A535ICD6      -QAGKRVILVDCDLRKPSQHLAFGL-RNERGLTSLMVPD----ADLNNPPLQTTA-QDSL
A0A3M1M4P3      -QGDRRTILVDADLRRPSLHRIFGL-PNEPGLTTMFVDE----ASRTDPPLLETG-VEHL
A0A1F8N3P4      -QVDQRVIMVDCDLRRPCLHTFFGL-PNNVGLTNMMLED----QALDDPPLQSTR-VPGL
A0A524AMJ5      -QTEQSVVVVDCDLRRPGLHKLFGL-SNELGLTTMMADD----HALDEPPLQPTE-VDGL
A0A3L7VU47      -QAEQRVILVDCDLRRPALHSLFGV-SNDTGLTSMLFAN----AG-DAPPLQATS-VPGL
A0A426U8Y8      -QAEQRVLLVDCDLRRPSLHTLFGL-SNEQGLTNAILAQ----GD-ELPPLQATA-VPGL
A0A3M1EV88      -QAGKQVILVDCDLRRPSLHEIFGV-SNTTGLTSVILDD----TT-SAPPLRETG-VPGL
A0A2E0ZA41      -QSGRKTVLVDCDLRRPSLHTLFDR-QVEPGFTDAILHN-------DEPVLQETA-VENL
A0A3M1ZY58      -QSGRKTILVDCDLRRPSLHTFFGL-PAEPGLTNMLLDD-------DEPPLQETG-VENL
A0A2M8PT60      -QGGNKTILVDCDLRRPSQHEIWDV-ENERGLTTMILED----AAISSPPLVETE-VDNL
A0A3M1QI99      -QGGNKTILVDCDLRRPSQHEIWDV-ENERGLTTMILED----AAISSPPLVETE-VDNL
A0A3M1YX52      -QAGHKTIIVDSDLRKPAQHEIWGV-ANERGLTSMMLED----TALAEPPLIKTE-VEHL
A0A3N5PDS6      -QGGKRVVLVDADLRRPAVHRLFGM-PNRGGLTDALVEE----PAALNSFLRDTA-VENL
A0A536CYF7      -QGGRRVIVVDADLRRPGQHTLFGLESQQEGLANVLLGE----YPHLP--LQDTA-APGV
A0A2W4MA80      -QAEQRVILVDCDLRRPSLHTLFDL-SNESGLTNMILAS----EDTP-PPLQETG-VPGL
A0A2A6RLU6      -QAEQRVLVVDCDLRRPSLHTLFGL-PNEQGLTSAILAQ----NDDL-PPAQATV-VPGL
A0A2H3KNY1      -QAEQRVLMVDCDLRRPSLHTIFGV-PNERGLTSAVLAQ----DDGP-LPIQPTS-VPGL
A0A532U8U9      -RAEKEVILVDCDLRRPSQHEIFGV-HNGVGLTTMVVDD----EAMADPPLQETS-VSGL
A0A1V5YJ40      -QGERKVILVDCDLRRPSLHKLFGL-GSREGLTSMMVAE----GGSAEPPLQETG-VPGL
A0A2N5K785      -QSEQRVILVDCDLRRPTLHTLFGL-PNEEGLTSLMLQE----GGRV--PLQKTE-VPGL
A0A351G432      -QGGKKVVLLDADLRRPFIHRFYKF-SNRVGLSE-----YFRGEVSLESTFNYVDPSRRL
A0A353H3Y9      -QNNRKVLVIDGDLRKPRIHKIFQL-PNRIGLTDYFLHA----QERLNGVIKKTE-IKSL
A0A2M8PN31      -SHGERTLLIDGDLRMPAIAQSLQM-EDEVKAHGGGLVGYFEGSTSWENMIVNEI-AHNL
A0A2N2PFW9      -QTGQRVVLVDTDLRRPVMHKVFGA-ANNTGLTSALLNG---DQVVLDGHLQGTE-VENL
                       ..:* *:* .                                          .

A0A3M1MN85      DLLTSGDIPDQSTELLASRAMQTTMAQLGQS--YD--VVVLDGPP-FAVPDAVVLARRVE
A0A5N9DUL0      DVITSGPIPPNPSELLDSPRMKDGIEKAKDI--YD--IILVDCPPVLMVADTPIISTVVD
A0A2W6B4S3      RVLPSGPTPPSPAELISSLRMAQVIQRLQTMA--D--IIIIDSPPILAAADAAITAGLCD
A0A2E6YFL8      DIIPSGPVPPNPSELLGTERMKNLCNDLHSKLNYD--YVLLDSPPILVVADGSVLASIAT
A0A5N9B1G6      DIIPSGPVPPNPSELLGTERMKNLCNDLHSKLNYD--YVLLDSPPILVVADGSVLASIAT
A0A1Y6K3L6      NLITSGSLPPNPAELLGTQKMLSILEDLRAK--FD--MIVIDTPP-AIVTDAQILASKTD
A0A1F8QKW6      SVITAGNSVENPSDLIGSQRMKDILLELSER--SD--YLIVDGPP-VLVTDSTILSTAVD
A0A356DVN8      SIITCGTIPPNPAELLGSERMSQTLKDLKMR--FD--VIILDTPP-MIVSDAQILSSKVD
A0A1F3AZM3      SVLTSGSLPPNPTELLASVRMEQILQEAEQD--AD--IVIIDSPP-SLVADVQVLAGKVD
A0A350FYF2      KVITAGDIPPNITEVVGSKRIASILEELKEK--HE--IVVIDAPP-LIIADSYNLASKVD
A0A363U3C3      KVLTAGNIPPNVTEVVGSKRIAMILSGLEKE--YE--LVIVDAPP-LIISDAYNLASKVD
A0A0M8JPC7      RLITVGDEAVLPDLLLTAEKVENLLCELKPL--AD--IILIDSSP-FLVSDAMIFAAKVD
A0A1F8PQP8      FIVPSGSPPPNPAELLSSKKMDQILESLKKV--AD--VVIVDGPP-FLVTDAQILASKVD
A0A0S7BVT9      DFLPAGLIPPNPVELLGSRQMGEILCELRNE--YD--FIVIDTPPVSLLTDAVTLCQFVD
A0A2N2MQC3      SLIAGGPLQENPVELIGSERMKNLIQELKTR--YKDRYIILDCSPLLATTEPTVLTEMAD
A0A3N5RU86      GLITAGELPQNTYELMNIKMMERILMELMDA--VD--TVIIDSPPFF-IADSVLLSSLVD
A0A536AN01      SFIPAGPTPPNPAELVGSSRMRDTLEQLRDE--YD--FVIIDSPPTLPVTDAVVLAREAD
A0A3N5NV84      RVLTSGPLPPDPADLLGSKRMHHLIECLEHE--AD--LIIFDTPPTIPVSDATVLALEAD
A0A4P5V2S0      HVLTSGTEPESPADILASSDLDRIMDHAGRD--AD--LVLIDCPPICAVADASVLSTRVD
A0A3B9YZ03      HVLTSGTEPESPADILASSDLDHIMDHAGRD--AD--LVLIDCPPICAVADASVLSTRVD
A0A3L7X1Q5      HVLTSGTEPESPADILASSDLDRIMDHAGRD--AD--LVLIDCPPICAVADASVLSTRVD
A0A521JGZ9      DIVFCGSYSPNPAELLSNVRFENMINKLREK--YD--YVIIDTPPLGSVIDSAIVARVVD
A0A521JNM5      DIIFTGPVPPNPSELLASDNFSDLIKIFRKV--YD--YIIIDTPPIGSVIDSAIVAQKCD
A0A3M1E8I5      QIITSGPLPPNAAELLGSQRMGHILKQLTGM--AD--IVIFDTPPVLSVTDATVLAGRVD
A0A160T936      WLLSSGPKPPNPADLLGAARMGRLIDQLLER--AD--FVLFDAPPVMAAADAAILGAKVD
A0A3D0US14      QLLSSGPLPPNPADLLGSHKIDQIIATLLER--AD--IILFDAPPVIAVTDATVLGAKVD
A0A3D0CW09      WLLASGPKPPNPAELLAAPQLRTIIEALTAR--AD--IVLFDAPPVVVVTDAAVLASQVD
A0A3M1DIE1      WLLPSGPLPPNPADLLGSRRMDEVLAALRAR--AD--ILLFDAPPVIEVTDAAVLGRKAD
A0A524ATQ3      QIVSSGPLPPNPSELLGSRRMEEIIAALLER--AD--VVLFDAPPVVAVTDAAVLATKVD
A0A399ZSS8      QVLTSGQLPPNPAEILGSKRMSEILAALLEQ--SD--IVLLDAPPVLAVTDAAVLSGKVD
A0A521ID76      QVLTSGQQPPNPAEILGSKRMSEILTALLER--TD--MVLFDAPPVLVVTDAAVLSSKVD
A0A3C0ZZ70      KLLPSGPLPPNPSELLGSRRMEEIIATLRER--AD--LVLFDAPPIIAVTDAAVLASKVD
A0A535ICD6      LLLTAGPLPPNPSEMIGSKRMQEVINALKSR--AE--MVIFDAPPILAVTDAAVLASKVD
A0A3M1M4P3      WLLPSGPLPPNPADLLGSRPMEEIIASLLER--AD--FLLFDAPPVIAVTDAVVLSTRVD
A0A1F8N3P4      HLLASGNLPPRPPDLLGSERLERVIERLLAE--AD--ILIFDAPPVIAVPDAVVLSTKVD
A0A524AMJ5      RLLASGPLPARPPDLLGSRRMDRVIEKLLGE--AD--LVILDAPPIMAATDALVLSTKVD
A0A3L7VU47      QLLASGPLPPRPADILGSRRMGEILQALRGL--AD--VIIIDTPPVLAVSDAVVLAPRID
A0A426U8Y8      SVLTSGPLPPRPADLLGSRRMAALIERLSAN--VD--MLLFDTPPVVAVTDAAALAPRVD
A0A3M1EV88      KLLTSGPLPPNPAELLGSRRMADLIRALREQ--AD--IVLFDAPPVIAVTDAAILASQVD
A0A2E0ZA41      WLLTAGTKPPNPADILGTPQVDQLIARLQEK--AD--IILFDAPPVNAVTDAAVLGAKVD
A0A3M1ZY58      WLLASGPKPPNPADLLGARKVDRVIERLKEM--AD--VILFDAPPVVAVTDAAVLGAKVD
A0A2M8PT60      QLLPSGPVPSNPADIISSQRMNEVIGVLKAR--AN--YVLFDSPPVLAATDAALLASKTD
A0A3M1QI99      QLLPSGPVPSNPADIISSQRMNEVIGVLKAR--AN--YVLFDSPPVLAATDAALLASKTD
A0A3M1YX52      QVLPSGPLPPNPADLLSSQRMQEVIGILKAR--AA--YVLFDSPPVLAATDAAVLGVKLD
A0A3N5PDS6      RVLTSGPIPPNPQELLGSQRMEDLLQRLQGE--AD--VVLVDTPPSLVVADANVLAARTD
A0A536CYF7      RLLTSGTATADPLEALGSRRFDHVLALARAQ--AD--FVLVDTPPAGALADAAVLAPRLE
A0A2W4MA80      SLLASGPLPPRPADILGSRRMEQIIARLSGM--AD--MVLFDTPPVIAVTDAAVLATRVD
A0A2A6RLU6      KVLTSGPLPPRPADLLGSRRMAAMIERMSAN--AD--IVLFDTPPVVAVTDAAALAPRVD
A0A2H3KNY1      HVLTSGPLPPRPADLLGSRRMGALIERMRSE--AE--IVLFDTPPVVAVTDAATLAPRVD
A0A532U8U9      WLLPSGPLPPNPSELVGSRRMKEIIAVLSQR--AD--IVLFDAPPIIAVTDAAVLSSEVD
A0A1V5YJ40      TLLASGPLPPSPSDLLGSRRMDAVLATLKER--AD--VVLLDSPPVVAVSDAAVLATKVD
A0A2N5K785      MVLTSGPLPPRPADILGSRRMEAVIAQLREH--AD--IVLFDTPPVNAVTDAAVLATKVD
A0A351G432      IAIPSGKLPPNPAELLGTEQMSALLQQLELI--SD--YIIIDSPPL-VVTDPVILATKVD
A0A353H3Y9      FVITSGNLPPNPSELLGSERMQEVVETLSSH--FD--PIFIDTPPLLAVTDALVLAPRVD
A0A2M8PN31      DMLASVKNASVPSEIANSSHFIDIINVLRQT--YD--RIIVDTPPIGVVSDAMALVPAVD
A0A2N2PFW9      SLLTSGPIPPNPSELLGSHRMARLVEKLVGQ--AD--LVIFDSPPVLAVTDAAVMGRQVD
                  :                 .                 :..* .*     :         

A0A3M1MN85      GMLWVIRVGYSRRTAVKYMQEQIEQTLVNVLGVVINCG----------------------
A0A5N9DUL0      MAILVVDSFTTKTSSFGATVETLNNSGVEIAGVIMNKL----------------------
A0A2W6B4S3      SAVLLVRPDRITRRGLTRAVETLNGVGVRVIGMVVNGV----------------------
A0A2E6YFL8      AGILIVDGFSTKIGSLQSAVNTLNGTAIETLGIIVNKL----------------------
A0A5N9B1G6      AGILIVDGFSTKIGSLQSAVNTLNGTAIETLGIIVNKL----------------------
A0A1Y6K3L6      GVIYVIRPGKTRSLVARTPLEEFERLGANVIGVVMNRI----------------------
A0A1F8QKW6      EVLIVVGYGLTRRSEAAVALKRLESAGAKIGGVILNRI----------------------
A0A356DVN8      GLVYVVIPGQTRAITAMRPLEELRRIESKVLGVVANKI----------------------
A0A1F3AZM3      GVILIIHPGHTQEDASLATLEMLNRAGARTLGVVLNRI----------------------
A0A350FYF2      GVILIMEPGQTSEEQAMTIKEQLDRSNAHLLGIVFNKI----------------------
A0A363U3C3      GVILVMEPGQTTEAQARTIKEQLDRSGARVLGIVFNKV----------------------
A0A0M8JPC7      GVITVIRPGYTSREMARVMKERIAMAGGKIIGVVLNRI----------------------
A0A1F8PQP8      GVLLVVRYGFSRKNAAISAVQQLKRADARAIGVVMNRI----------------------
A0A0S7BVT9      GIIFVIRQKTASIDQIKFAMKKLESVKANVIGAILNDY----------------------
A0A2N2MQC3      GILMVIKSGKTPRESVQQALRLLNK--DKIMGVVLNGM----------------------
A0A3N5RU86      SVLAVVRPNHTLKQSALAMIEQIHRSGGNLTGVVINRI----------------------
A0A536AN01      GIVLVVKGHDTPRELVRRARDQLVNAGAHILGALVNNV----------------------
A0A3N5NV84      AVLLVVEAGRTRRGAIRRTMEDLQRAGAHVLGAVLNRV----------------------
A0A4P5V2S0      GVIVVVGAGVVKRDLARHARAQLDAVRANVIGLVVTNA----------------------
A0A3B9YZ03      GVIVVVGAGVVKRDLARHARAQLDAVRANVIGLVVTNA----------------------
A0A3L7X1Q5      GVIVVVGAGVVKRDLARHARAQLDAVRANVIGLVVTNA----------------------
A0A521JGZ9      GVIIVIEANAISYRFAQNVKEQLEKADCRILGVVMNKV----------------------
A0A521JNM5      GVVLVIESNTVSYKFAQRAIRQLEKSQSKILGAVLNKY----------------------
A0A3M1E8I5      GVVLVIQAKRTRRDAARHAVQRLQQVGATILGAVLNQS----------------------
A0A160T936      GVLLVIQAGKTRRDHSERARELLEKANVRIIGATLTNA----------------------
A0A3D0US14      GVLLVISAGKTRREHAERAKEMLEKANVRIFGAALTNA----------------------
A0A3D0CW09      GVLLVIQAGKTKRDQAAQAKTLLDQVRARLVGTALTNV----------------------
A0A3M1DIE1      GILLVMTTGRTRRDHALRAKEVLERAHVRLVGVVLTDV----------------------
A0A524ATQ3      GVLLVINAGGTKRDYARVAKARLEKVNANLLGAVLNNV----------------------
A0A399ZSS8      GVLLVVSAGKTKRENAKKAQAQLEKINARIIGVVVNNV----------------------
A0A521ID76      GVLLVISAGKTKRENARKAQSQLEKINARVIGAVLNNV----------------------
A0A3C0ZZ70      GVLLVINAGTTKRDHAQRAKALLEKVNARLVGAVLNNV----------------------
A0A535ICD6      GVILVVNAGGTKREHMQKAHALLKKVNAPLIGAVLNNV----------------------
A0A3M1M4P3      GVLLVVQAGRSRREHVQQAKQLLERVQARLVGAVLTNA----------------------
A0A1F8N3P4      GVVLVLNAGETKREHAQHAVERLNRVNVRIVGAVLNNV----------------------
A0A524AMJ5      GVLLVASAGTTKREQAQRAVERLNKVNARLVGAVLTNV----------------------
A0A3L7VU47      GVILVMQAGRTRREPAKQARIVLEKAKAHIVGVVLNDA----------------------
A0A426U8Y8      GVLLVLHAGHTRRDRAREARQLLEKVKANIVGVVLNGA----------------------
A0A3M1EV88      GVLLVLNAGVTRREHAQRAKAALEKVNARLIGTVLNNV----------------------
A0A2E0ZA41      GVLLVLSAGKTRREHAERAKEILEKARVNIVGATLTNA----------------------
A0A3M1ZY58      GVLLVISAGKTRREHAERAKELLQKAHVRLVGVTLTNA----------------------
A0A2M8PT60      GVLLVIRAGHTRRDQAARARQALERVHVRIVGAVLSNA----------------------
A0A3M1QI99      GVLLVIRAGHTRRDQAARARQALERVHVRIVGAVLSNA----------------------
A0A3M1YX52      GALLVVQAGNTRRDHTARARDALERVHVRLIGAVLTNA----------------------
A0A3N5PDS6      GVLLVVNADRTRRVAVQQAAEGLRQVGANLVGGVLNMVDIRRGRGAGYYSYYGYYSHYYG
A0A536CYF7      GMLLVVSAGRTKRDMARRAREQLERVNANLLGVVLTDV----------------------
A0A2W4MA80      GVLLVFQAGKTSRDRARRTREVLEKVKANIVGVVLNGA----------------------
A0A2A6RLU6      GVLLVLHAGHTRRDRAREARQLLEKVKANIVGVVLNGA----------------------
A0A2H3KNY1      GVLLVLHAGQTRRDRAREARRLLEQVKANIVGVVLNGA----------------------
A0A532U8U9      GVLMVINAGGTKRDHAQKAKALLDKVNAHLVGAVLNNV----------------------
A0A1V5YJ40      GVLLVVSAGHTRREGVQAAKAKLEKVNANLLGAVLTNA----------------------
A0A2N5K785      GVLLVFRAGATRRDRAGEARRLLDKVNANIVGVVLTDV----------------------
A0A351G432      GVLLVIQPGVTRISSVRASIDQLERAQARILGIALNNI----------------------
A0A353H3Y9      GVILVIDPAKTKRAALQHSIEQLKQVNANLLGVVLNNV----------------------
A0A2M8PN31      ACLYVVKHKGVKMRSIRDSIRRLRDVHMPILGAVMNQV----------------------
A0A2N2PFW9      GVLLVVDAGQTREQVVAQAAAELQKTGANLLGVVLNRL----------------------
                  : :                 :        *   .                        

A0A3M1MN85      -------RGPRA-------HYYQVYGYHGYYQ-----DGNGRERRKPAFRRLVENLRRTK
A0A5N9DUL0      -------KKPKFGYGYGYNYGYYYNYYYYNYKYSLEDTNPESKSSKNPFRIFRSIF--NR
A0A2W6B4S3      -------PRTDA----------DYYGYGNYYDYQAPAARGDGAKPVAITTDKKNAA--GQ
A0A2E6YFL8      -------KNSRFSYGYRYPYYYNYYYYQSYYQYNEAGEKTEKQEKRSTKSTIKKLFRWSK
A0A5N9B1G6      -------KNSRFSYGYRYPYYYNYYYYQSYYQYNEAGEKTEKQEKRSTKSTIKKLFRWSK
A0A1Y6K3L6      -------PHNRGYYYGGFEYYSPNVY--GSEKYYVDSHNDQPF-----------------
A0A1F8QKW6      -------PRNNRAYYRLYHY--------DY---------GMPAEDTRSIKLGKFHFPMKF
A0A356DVN8      -------PRNRDYYYGGYNYYSPYSNHYSYHTESIVPNSEIDMDSKKVTPLGSVFEKYQR
A0A1F3AZM3      -------PRGRSDYYGGYRHYSPYYS--GYH--YYHSMDGQDLKPSRMRRLFGKLSPFNH
A0A350FYF2      -------SEQSAHSSYDYQYRSLYSP--KYYGDYISKSTNEPNTGSRSKKIMDFFEHGQL
A0A363U3C3      -------TEEMAHSYYDYRYQSLYSP--KYYGDYISTASREPNTGSRSRQLMDFFEHGKV
A0A0M8JPC7      -------PLKRIGYYGGYRYYLPY----GYY---------------EKKKKREEDEDKKV
A0A1F8PQP8      -------PRTASGYYGYGMYHSYP----GYYIAEEDGATQPSITDRLKPPRKSRPKDKST
A0A0S7BVT9      ---VVPKDSSQSKNYYNNYSDYYQHK----------------------------------
A0A2N2MQC3      -----EYRTKALIQRHFGTNRYYHDYHYSKTHPEPDNWEKAALILKDIKMLLLKLIPHKK
A0A3N5RU86      -------P--FR------QLKYYLKYPYNSLEKYHLASERMQKEPR--------------
A0A536AN01      -------DLGWG------DLYYYNRY-YGTYYGRPEAREGLEQHA---------------
A0A3N5NV84      -------TSRPS------KGYYYYE-----------------------------------
A0A4P5V2S0      -------PYNERT-----FASYYEESPGRSAS----------------------------
A0A3B9YZ03      -------PYNERT-----FASYYEESPGRSAS----------------------------
A0A3L7X1Q5      -------PYNERT-----FASYYEESPGRSAS----------------------------
A0A521JGZ9      -------PMDKKKYYGKYYGKYYGKYYGTYGEEH--------------------------
A0A521JNM5      -------ENEGR------LYGYESKKSKKYIDYYLEN-----------------------
A0A3M1E8I5      ---------GKG------SGYYYSYYTQTGARPVKQPRRAPQRRWWQIGSTR--------
A0A160T936      -------PQDRS------MREYYG------------------------------------
A0A3D0US14      -------PKDSS------IGGYYD------------------------------------
A0A3D0CW09      -------KLDPK------LQGYY-------------------------------------
A0A3M1DIE1      -------SVSRA------HRYY--------------------------------------
A0A524ATQ3      -------RFDVS------LHRYYAAQM---------------------------------
A0A399ZSS8      -------QAEKG------ASYYYAESN---------------------------------
A0A521ID76      -------KAESG------ASYYYAEGNS--------------------------------
A0A3C0ZZ70      -------RMDIS------LHRYYAEQKQA-------------------------------
A0A535ICD6      -------KFDNS------LHKYYGTES---------------------------------
A0A3M1M4P3      -------PSDSV------MGAYYTDEW---------------------------------
A0A1F8N3P4      -------PLDAT------LHRYYR------------------------------------
A0A524AMJ5      -------PLDAT------VRAYYA------------------------------------
A0A3L7VU47      -------EMTQS------S-GYYG------------------------------------
A0A426U8Y8      -------KLER---------GYAY------------------------------------
A0A3M1EV88      -------KLDTS------LYGYYSAQ----------------------------------
A0A2E0ZA41      -------PVDSS------MEAYYG------------------------------------
A0A3M1ZY58      -------PKDDA------ISGYYG------------------------------------
A0A2M8PT60      -------PREDS------GEYYGL------------------------------------
A0A3M1QI99      -------PREDS------GEYYGL------------------------------------
A0A3M1YX52      -------DRETA------GSYYG-------------------------------------
A0A3N5PDS6      EEEGERHRGPRG------WWRRLRRGKEAGSPRDGVSPAA--------------------
A0A536CYF7      -------RGDDK------LYRY--------------------------------------
A0A2W4MA80      -------ELEQG------YGYYS-------------------------------------
A0A2A6RLU6      -------KQERG------YTY---------------------------------------
A0A2H3KNY1      -------KVERG------YAY---------------------------------------
A0A532U8U9      -------KIDTS------LHRYYA--EQKGG-----------------------------
A0A1V5YJ40      -------TMDTS------LSRYYDAREEVSG-----------------------------
A0A2N5K785      -------KQEDG------YSYYGS------------------------------------
A0A351G432      -------TRQNA--------YYYASY-------YQQEYYAPDEEEARSLN----------
A0A353H3Y9      -------KISRS--------HYYYNRDY-----YYGKPYGKAAEESGGSGADTDTTELEL
A0A2M8PN31      -------DKVGS--------GYYHNYTDKNYHKYYGAYTPQKTQNPKRVSKPKKK-----
A0A2N2PFW9      -------DSRRG--------GYY----------YYYYYYSEEEGGQRRRSASR-------
                                                                            

A0A3M1MN85      ------------------------------------------
A0A5N9DUL0      ------------------------------------------
A0A2W6B4S3      ------------------------------------------
A0A2E6YFL8      ------------------------------------------
A0A5N9B1G6      ------------------------------------------
A0A1Y6K3L6      ---------IPIQDIETEPKK---------------------
A0A1F8QKW6      NRPVNKKKKPASHDTSDLGDQVASRVDKTI------------
A0A356DVN8      RDADKQN-----------------------------------
A0A1F3AZM3      NGHKKVEAGVVEENVIEKP-----------------------
A0A350FYF2      PPDMAESVELTITAIKTQPKQIVERLRKSKKNG---KNGKDG
A0A363U3C3      PADVAVEVEHAITAIKTQPRKTMERLRKSKKSGTGRKNGKNG
A0A0M8JPC7      PKKSELTFSGK-------------------------------
A0A1F8PQP8      GDALNLEKTES-------------------------------
A0A0S7BVT9      ------------------------------------------
A0A2N2MQC3      GER---------------------------------------
A0A3N5RU86      ------------------------------------------
A0A536AN01      ------------------------------------------
A0A3N5NV84      ------------------------------------------
A0A4P5V2S0      ------------------------------------------
A0A3B9YZ03      ------------------------------------------
A0A3L7X1Q5      ------------------------------------------
A0A521JGZ9      ------------------------------------------
A0A521JNM5      ------------------------------------------
A0A3M1E8I5      ------------------------------------------
A0A160T936      ------------------------------------------
A0A3D0US14      ------------------------------------------
A0A3D0CW09      ------------------------------------------
A0A3M1DIE1      ------------------------------------------
A0A524ATQ3      ------------------------------------------
A0A399ZSS8      ------------------------------------------
A0A521ID76      ------------------------------------------
A0A3C0ZZ70      ------------------------------------------
A0A535ICD6      ------------------------------------------
A0A3M1M4P3      ------------------------------------------
A0A1F8N3P4      ------------------------------------------
A0A524AMJ5      ------------------------------------------
A0A3L7VU47      ------------------------------------------
A0A426U8Y8      ------------------------------------------
A0A3M1EV88      ------------------------------------------
A0A2E0ZA41      ------------------------------------------
A0A3M1ZY58      ------------------------------------------
A0A2M8PT60      ------------------------------------------
A0A3M1QI99      ------------------------------------------
A0A3M1YX52      ------------------------------------------
A0A3N5PDS6      ------------------------------------------
A0A536CYF7      ------------------------------------------
A0A2W4MA80      ------------------------------------------
A0A2A6RLU6      ------------------------------------------
A0A2H3KNY1      ------------------------------------------
A0A532U8U9      ------------------------------------------
A0A1V5YJ40      ------------------------------------------
A0A2N5K785      ------------------------------------------
A0A351G432      ------------------------------------------
A0A353H3Y9      QKPALRD-----------------------------------
A0A2M8PN31      ------------------------------------------
A0A2N2PFW9      ------------------------------------------
                                                          

© 1998-2020Legal notice