BYKdb

Dataset for cluster orphancd of phylum chloroflexi

[Download (right click)] [Edit] [Sequences] [Repertoires]

98 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A0S7BVT9      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A7V3M975      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7V5PAD5      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7V3K2D4      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A847FV46      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A7V5YX91      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A7Z9Y601      ------------------------------------------------------------
A0A7V4ZCT4      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A7V2PIG6      ------------------------------------------------------------
A0A7W1TGY7      ------------------------------------------------------------
A0A7W0WA74      ------------------------------------------------------------
A0A7Y2SPK2      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A800D7V8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A7V2QGZ9      ------------------------------------------------------------
A0A800DAF5      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7V8CYM7      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A7W1NW91      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      ------------------------------------------------------------
A0A7C4LA78      ---------------MEI-QEYLAPLRRWWWLVVVSVAIATASAYFFTR-DLPSVYLART
A0A1Y6K3L6      ---------------MDF-RQFVNIAKRWIWLALVGALVAGGLGYYISS-QETPLFQAST
A0A7C3NDS4      ---------------MTFLKTYLAPVTKWWWLIMTAPIIAAVSAAIFVR-QLPPVYQARA
A0A0M8JPC7      ---------------MDI-RPYLAPIFKWWWLLLAAAALATGTAYFILR-DQPAVYTART
A0A1F8PQP8      ---------------MEL-RTYFRPLLKWWWLLLAAGLVAAVSSFVVMG-RRPLIYQSRT
A0A7C4K8H9      ---------------MEL-KSYFRPLIKWWWLVVAAVVVAAISSFIVMR-RQPLLYQSRA
A0A1F8QKW6      ---------------MEI-KQYLEPLIKWWKLILVACLLAGISSFLIIS-RQPPTYQTRV
A0A356DVN8      -------------------YSYLN------------------------------------
A0A7C1YUD4      -------------MNTPV-GRYVVILKKWWWLFAIGVLVPAIIIRLLLS-MQPGMYQARA
A0A1F3AZM3      -----------------Y-YAYLD------------------------------------
A0A7C3PVB7      ---------------MDI-NAYIKPIIKWWRLLAVTTILALVSSAISTV-FQPKLYVSRT
A0A363U3C3      ---------------MDI-SVYLRPLLRWWRLIMIVTVLAVVASAVSTM-FQPEIYVSRT
A0A350FYF2      ---------------MEI-NTYLRPLIRWWRLIVIVTMLAVIASAVSAL-LQPAAYVSRT
A0A850BWC8      ---------------MEI-NAYLRPLVRWWRLVVIVTMLAVIASGISTM-FQPDVYVSKT
A0A3M1MN85      -------------MNLKF-LDYFSPIFRWWWLLIVCALVAGGVGYALVN-PLPPVYQSGI
A0A7Y5F2P3      ---------------------------------LILSTVAAAGASYLATRGEPIVYQART
A0A5N9DUL0      ------MNQNQQEQSIDF-KKYIGLAISYSWLIILLPTIVGTGAYFYSQ-QQTKLYEAKA
A0A2W6B4S3      --------MELRDLIRVA-KRWVPI-------ALIVALTLAIASYAFTKFTVKKVYTATV
A0A2E6YFL8      MQNSNITMPQLNDINTTF-RRYVGIFLNYWWVFLILPAILGIGTYFYSS-SQDTMYEATS
A0A5N9B1G6      MQNSNITMPQLNDINTTF-RRYVGIFLNYWWVFLILPAILGIGTYFYSS-SQDTMYEATS
A0A351G432      ------------------------------------------------------------
A0A7C5PWI6      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A7C4N822      ------------------------------------------------------------
                                                                            

A0A0S7BVT9      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A7V3M975      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7V5PAD5      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7V3K2D4      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A847FV46      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A7V5YX91      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A7Z9Y601      ------------------------------------------------------------
A0A7V4ZCT4      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A7V2PIG6      ------------------------------------------------------------
A0A7W1TGY7      ------------------------------------------------------------
A0A7W0WA74      ------------------------------------------------------------
A0A7Y2SPK2      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A800D7V8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A7V2QGZ9      ------------------------------------------------------------
A0A800DAF5      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7V8CYM7      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A7W1NW91      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      --------------MGEMTI-KELS-SSYPDLQEISSAEL--------------------
A0A7C4LA78      TLLVGNAIFERNPTGNEFGLSQTLA-RAYANLALREPVAV----ATMAELGL--------
A0A1Y6K3L6      RFVILRAATTGYDYYA--YIDYQQQIQTYSELLTTDALLN----QASEELGY-------S
A0A7C3NDS4      TLLIGRAFQDPNPSSSEFYLSYQLA-GEYANVALREPVRN----STKEALGI--------
A0A0M8JPC7      TLMIGRTLLEANPSSNDFWLNQQLS-SLYSDMAYREPVQE----GVKKALGM--------
A0A1F8PQP8      TLVVGSSVYEANPQTGDFFLNEQLA-GFYADLVQRTPIQL----ETMKALNL--------
A0A7C4K8H9      TLVVGRAVYEANPTGADFYLNQQLA-SFYADLAMREPVRN----AAAQALGV--------
A0A1F8QKW6      SLVIGRAVYEPNPSGGEMGLAQQLA-AYYANIAEREVIRN----ATMTALNL--------
A0A356DVN8      --------------------NQDIV-DTYAQLLTTEELLF----QASEALGF-------P
A0A7C1YUD4      TLMIGTSLQNPEPDPWQLTVANNLA-NAYARLAREGPVME----AVITRLGLNR---QPE
A0A1F3AZM3      --------------------SQQLL-QTYIQLLTTEKVLN----AASEKLGY-------P
A0A7C3PVB7      TLMIGTTISNPNPDSGQIYIAAQLA-TIYADIAKREPIQA----ATMEALGI-------D
A0A363U3C3      TLVIGTTILDPNPDSGQIYIAQQLA-SIYADMARREPIQQ----ATMEALGI-------G
A0A350FYF2      TLVIGTTILDPNPDSGQIYIAQQLA-GIYADIAEREPIQQ----ATMDSLGI-------D
A0A850BWC8      TLVIGTTILDPNPDSGQIYIAQQLA-QIYADMAKREPIQQ----ATMEALRI-------D
A0A3M1MN85      TLLVGNALDTPNPSSLEVEIPRRLT-DAYAAMALREPVRD----GVKKALGLDE------
A0A7Y5F2P3      TLMIGGTINDPNPSTSEFALGEQLA-AAYADIASRELVRQ----ATMAKLGVTR------
A0A5N9DUL0      TLLVEQRSSGLSTSISDYSLSARLS-KTYAKLITADPFLD----QVRETNGFER------
A0A2W6B4S3      TMEVQAGVTG--QSVPDPTISNLIV-PTEAQVAAQGPTVDQAMRRVQSTPGIAITPGEIA
A0A2E6YFL8      TLLVEQRRTGGVAGVSDFTLSEDLA-RMYMKQILSTPFIS----RVVEEPDVKY---NVD
A0A5N9B1G6      TLLVEQRRTGGVAGVSDFTLSEDLA-RMYMKQILSTPFIS----RVVEEPDVKY---NVD
A0A351G432      ------------------------------------------------------------
A0A7C5PWI6      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A7C4N822      ------------------------------------------------------------
                                                                            

A0A0S7BVT9      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A7V3M975      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7V5PAD5      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7V3K2D4      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A847FV46      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A7V5YX91      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A7Z9Y601      ------------------------------------------------------------
A0A7V4ZCT4      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A7V2PIG6      ------------------------------------------------------------
A0A7W1TGY7      ------------------------------------------------------------
A0A7W0WA74      ------------------------------------------------------------
A0A7Y2SPK2      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A800D7V8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A7V2QGZ9      ------------------------------------------------------------
A0A800DAF5      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7V8CYM7      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A7W1NW91      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      --LAKVSVNSPVDSLLIELTVIDADPARAADIANTLGIVFAN------------ENERQQ
A0A7C4LA78      QELPEYSARALPDGQFLEITVTDSNRELAQLVANELARQLIR----QSPSGALTEEEIER
A0A1Y6K3L6      AQDVTASASQIADTQFMRLTVTHPDPVKAAEIANVLVKVLIDQNERLQSVRYEATER-NM
A0A7C3NDS4      --DKLPEYEATPRGAFLEISVIHTDPVFAQAVANTLAEKLIE----LSPASVQAANQ-ED
A0A0M8JPC7      TWLPKYVVKTFGNGQFIEIDVIDTSPERAMHVASELANQLIL----VSPGSKEVNS--NN
A0A1F8PQP8      EWLPSYSASTIPNTPLIEILVNDTDPSRAQAVANELATQLIK----QTPTNDPVNT--ER
A0A7C4K8H9      EWLPQYMARALPNSLLIEIVVADTDPKWAQLVAQELANQLIK----QTPTNDPNSS--TR
A0A1F8QKW6      RWLPAYASQAVPNSQIIEITVTDTDPVRAQAVANELANQLIK----QSPSNPDLKEQ-KR
A0A356DVN8      VRKGQATAKQVDDTKFVVLTVKDPDPFKAATIANGLVSIMIS----QNENLQSVQFA-AA
A0A7C1YUD4      QLAAQITTRVYPEAQLLVLEVVDADPRAAALIANALASELVQ----RSP-MSQEEQA-QR
A0A1F3AZM3      VYAGQASAQQVPDTQFVRLTVTNTDPQRAADIANVLVMVLID----QNEELQAVRYL-TS
A0A7C3PVB7      -WLPSYNVRVVPNTQLIEIAVTDTSPQRAQIIANELANQLIL----QSPATNESETG-QR
A0A363U3C3      -WLPQYQAKVVPNTQMVEITVSDTVPKRAQIIANELANQLML----QSPAIGGTETG-ER
A0A350FYF2      -WLPLYQSKVVPNTQMVEISVTDTNPKRAQIIADELARQLML----QSPAIGGTETG-DR
A0A850BWC8      -WLPQYQSKVVPQTQMVEISVTDTNPERAQIIANELARQLIK----QSPAIGDTETG-IR
A0A3M1MN85      --LPKYTAYTIPGSTMVRIEVTDTNPRRAQAVATELGRQLMA----QS-PGGTTRDS-ET
A0A7Y5F2P3      --LPDYIARALPKTQIMEIIVSDRDPSRAQQVANELAAQLIQ----LSPTNLDPEEE-SR
A0A5N9DUL0      --LGSVQTRTQENPPLIEIYVRDSDRVLVGEVANAISLNFID----YV------------
A0A2W6B4S3      AIKASIQCKPNPDTSLFSCSASAHQAEVAALVANQLATVFTQ----GE------------
A0A2E6YFL8      ELKLMLTADAHINPPTLDVIIRNSDKTEAADVANKIAATFIN----YT------------
A0A5N9B1G6      ELKLMLTADAHINPPTLDVIIRNSDKTEAADVANKIAATFIN----YT------------
A0A351G432      --------------------------MFQKKICKPKWQMLKX----ALETREETRPYQPT
A0A7C5PWI6      --------------------------ERAVAIADEIAYQLIL----QSPTSPENVDRSER
A0A353H3Y9      -------------------------------------RYIDL----RTNLETELANTDKQ
A0A7C4N822      -------------------------------------GWI-----------TQWGPTVEC
                                                                            

A0A0S7BVT9      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A7V3M975      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7V5PAD5      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7V3K2D4      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A847FV46      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A7V5YX91      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A7Z9Y601      ------------------------------------------------------------
A0A7V4ZCT4      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A7V2PIG6      ------------------------------------------------------------
A0A7W1TGY7      ------------------------------------------------------------
A0A7W0WA74      ------------------------------------------------------------
A0A7Y2SPK2      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A800D7V8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A7V2QGZ9      ------------------------------------------------------------
A0A800DAF5      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7V8CYM7      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A7W1NW91      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      LSESDQPIKL-------------------------LES---------------RLLDLDG
A0A7C4LA78      QNFVRQQLAD-------------------------LQT---------------KINSTNQ
A0A1Y6K3L6      QQRADQALEQ-------------------------IEILQAQIDQLSTASVQEQLTQVES
A0A7C3NDS4      QKFIQEQLKD-------------------------LQV---------------NIEKTKQ
A0A0M8JPC7      EAFIQEQLQK-------------------------LQE---------------QIVATEK
A0A1F8PQP8      RGFIENQLNL-------------------------FEA---------------DIVQTQI
A0A7C4K8H9      REFIENQLNL-------------------------FEV---------------DITRIQG
A0A1F8QKW6      QEFIRQQLEL-------------------------LET---------------QIQDTQE
A0A356DVN8      EKNLQDRIDQ-------------------------AEE---------------QIATLET
A0A7C1YUD4      QAFIRDRLDG-------------------------LEE---------------RIERLDQ
A0A1F3AZM3      EQNLQSQIDQ-------------------------VQS---------------QITTMQT
A0A7C3PVB7      QEFIRQQLSS-------------------------LET---------------QIDDTKK
A0A363U3C3      QDFIKQQLDS-------------------------LKV---------------QIQDTEK
A0A350FYF2      QEFIREQLSS-------------------------LQI---------------QIQETET
A0A850BWC8      QEFIRQQLSN-------------------------LQL---------------QIQETER
A0A3M1MN85      QAFLEEQLHK-------------------------IAD---------------AISETEQ
A0A7Y5F2P3      LEFVNQQLDV-------------------------IES---------------RLDETES
A0A5N9DUL0      ---------------------------------------------------------IER
A0A2W6B4S3      ---------------------------------------------------------QAF
A0A2E6YFL8      ---------------------------------------------------------VEL
A0A5N9B1G6      ---------------------------------------------------------VEL
A0A351G432      PTLAPETLSQIQENRLDLQQKQGMLNLYQELYFNLLSS---------------DSSGNPI
A0A7C5PWI6      TEFVQEQLDS-------------------------LES---------------RIRSSTA
A0A353H3Y9      ISSINARLAA-------------------------IPT---------------DTAGNAI
A0A7C4N822      LALSAARPDR-------------------------LVF---------------GTSGHVF
                                                                            

A0A0S7BVT9      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A7V3M975      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7V5PAD5      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7V3K2D4      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A847FV46      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A7V5YX91      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A7Z9Y601      ------------------------------------------------------------
A0A7V4ZCT4      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A7V2PIG6      ------------------------------------------------------------
A0A7W1TGY7      ------------------------------------------------------------
A0A7W0WA74      ------------------------------------------------------------
A0A7Y2SPK2      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A800D7V8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A7V2QGZ9      ------------------------------------------------------------
A0A800DAF5      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7V8CYM7      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      --------------MGRVSESKASLEREITSVEADITRTQDALNAVTDDNQRMRLETSLA
A0A7W1NW91      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      ELANIGTQIIE---IGEPDTVAKQT-------------------------QFDRLTRELE
A0A7C4LA78      EMTEKQAALAD---LSSASEIAAAQ------------------------ADLRALEERLS
A0A1Y6K3L6      EINELQEQIFA---LETQIVELETKISEFNPLFATEEQKAQHEANRTRAAELEAEVKQLT
A0A7C3NDS4      QISENQEKLST---LESALEIAKTE------------------------RELTALEDKLT
A0A0M8JPC7      ELVARQDSLGG---LTSAHEIEQAK------------------------AELRTLEDKLS
A0A1F8PQP8      DINDKTASLDS---LTSARQIAETQ------------------------DDIRSLEQKLA
A0A7C4K8H9      EIDKKTLELAN---LTSARQIAQAQ------------------------QEISALEQKLS
A0A1F8QKW6      QIAQQENEMGT---LNSARQIAEAQ------------------------ADLTAQRQKLT
A0A356DVN8      QISQISDEMLQSQIESVQLQMDDVQ------------------------AQVNNLKTDMA
A0A7C1YUD4      EIADLEASLVA---LTSATELDAAR------------------------SRLRELEAVRM
A0A1F3AZM3      QINDISEATVQDQLVQVKAQIEPLQ------------------------TQVTTLETEIA
A0A7C3PVB7      KIEELQTRLTV---VNSSSETASVE------------------------KEITDLTVKLN
A0A363U3C3      NIEELQKSLIG---INSASQIANIE------------------------KQINEQTQRLN
A0A350FYF2      KIEELQTSLVD---LNSASQIANIE------------------------TEIRDHTQKLN
A0A850BWC8      TIAELQSSLVG---LNSASQIANIE------------------------QAIREQTQKLT
A0A3M1MN85      DIAAKQEEMAT---AEGASAILSLQ------------------------ADLDALNNKLA
A0A7Y5F2P3      QIEALKIQLGE---LDSVQEITNAQ------------------------NQISALQTVLN
A0A5N9DUL0      RLTEIARL------------------------------------------QAAASAQGLS
A0A2W6B4S3      DQQRYQTVLTN---IRSSEAIARKN------------------------GDAALLSRLQG
A0A2E6YFL8      RLAEIAKI------------------------------------------QTAALSQGLP
A0A5N9B1G6      RLAEIAKI------------------------------------------QTAALSQGLP
A0A351G432      LTSGAGSNQY--------------Q------------------------STLALYQQIYA
A0A7C5PWI6      QLKELEAELDT---ALSARQIQSLQ------------------------TEIASLESLIT
A0A353H3Y9      NPNDVATRAQ-------------LE------------------------TSLSQYEQARS
A0A7C4N822      LTDDAGATWQ--------------------------------------------------
                                                                            

A0A0S7BVT9      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A7V3M975      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7V5PAD5      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7V3K2D4      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A847FV46      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A7V5YX91      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A7Z9Y601      ------------------------------------------------------------
A0A7V4ZCT4      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A7V2PIG6      ------------------------------------------------------------
A0A7W1TGY7      ------------------------------------------------------------
A0A7W0WA74      ------------------------------------------------------------
A0A7Y2SPK2      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A800D7V8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A7V2QGZ9      ------------------------------------------------------------
A0A800DAF5      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7V8CYM7      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      QYRST-------------------------------------------------------
A0A7W1NW91      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      EARTT-------------------------------------------------------
A0A7C4LA78      VLQGN-------------------------------------------------------
A0A1Y6K3L6      PILAL--------------------------------------------YQQIFTNLTVL
A0A7C3NDS4      KLQSL--------------------------------------------YTGLYSG----
A0A0M8JPC7      LLRTN-------------------------------------------------------
A0A1F8PQP8      SLRSS-------------------------------------------------------
A0A7C4K8H9      SLRSD-------------------------------------------------------
A0A1F8QKW6      TLQTN-------------------------------------------------------
A0A356DVN8      QIYPGSLAVENIADLKSLTEDLESLTEEEIAQLTAYQTKLDEITPILELYQEIYTELVVL
A0A7C1YUD4      EYQAT-------------------------------------------------------
A0A1F3AZM3      DLQKNRYP-----------------TEEENAQLAEKEATLAQVKPILTLYQQLYTNLVVL
A0A7C3PVB7      GLYEN-------------------------------------------------------
A0A363U3C3      SFREN-------------------------------------------------------
A0A350FYF2      SLRES-------------------------------------------------------
A0A850BWC8      SLRES-------------------------------------------------------
A0A3M1MN85      TLQEN-------------------------------------------------------
A0A7Y5F2P3      TLHNT-------------------------------------------------------
A0A5N9DUL0      DVQS--------------------------------------------------------
A0A2W6B4S3      SEIS--------------------------------------------------------
A0A2E6YFL8      NVQE--------------------------------------------------------
A0A5N9B1G6      NVQE--------------------------------------------------------
A0A351G432      NLLSD-------------------------------------------------------
A0A7C5PWI6      TWQAN-------------------------------------------------------
A0A353H3Y9      YLVSD-------------------------------------------------------
A0A7C4N822      ---QR-------------------------------------------------------
                                                                            

A0A0S7BVT9      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A7V3M975      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7V5PAD5      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7V3K2D4      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A847FV46      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A7V5YX91      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A7Z9Y601      ------------------------------------------------------------
A0A7V4ZCT4      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A7V2PIG6      ------------------------------------------------------------
A0A7W1TGY7      ------------------------------------------------------------
A0A7W0WA74      ------------------------------------------------------------
A0A7Y2SPK2      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A800D7V8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A7V2QGZ9      ------------------------------------------------------------
A0A800DAF5      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7V8CYM7      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A2M8PN31      ---------------------------------------------MKKPNARIVDRAVPP
A0A2N2PFW9      -----------------------------YSSLLSSYQQIRLAEAQATDNIAIAKPARVP
A0A7W1NW91      ------------------------------------------------------------
A0A7C4KGM4      ---------------------------------------------------------SLP
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      -----------------------YNST--FQLKLDYELNI----ASKINTFFSIEDAQPI
A0A7C4LA78      -----------------------YATL--LANTEQGATNT----------LTVFEPAALP
A0A1Y6K3L6      GRVPDSSTNTSIEISQLQTNLNLYQQI--YINSISSLENLNLTRAQNTPNVIQVEPARIP
A0A7C3NDS4      ------------------------------------------TREAAFNTLSIFEPAALP
A0A0M8JPC7      -----------------------YANL--LSSSKENITNI----------LQVIEPASLP
A0A1F8PQP8      -----------------------YAAL--LASSDRGAGNT----------LRLIEPANLP
A0A7C4K8H9      -----------------------YAAL--LASSDRGAGNT----------LTLIEPANLP
A0A1F8QKW6      -----------------------YATM--LGTSLGRASNS----------LNIIETAALP
A0A356DVN8      GQTTGASNQNPTDLDRLKTTLNLYQQI--YISSINNLETLKLAKAQNTPTVMQVETAAKP
A0A7C1YUD4      -----------------------YASL--LESYRTSAPNV----------VSVFEPAVEP
A0A1F3AZM3      GQPVDTGTNTSTRLQQLQTTLSLYQGI--YVNLLNSLENVRFARVQNTPNVVQVEPAVAS
A0A7C3PVB7      -----------------------YASF--LANSQEGALNI----------LRVVEPANLP
A0A363U3C3      -----------------------YASL--LANSQEGALNI----------LSVVEPANLP
A0A350FYF2      -----------------------YANF--LVNSQEGALNI----------LSIVEPANLP
A0A850BWC8      -----------------------YASF--LANSQQGALNI----------LSVVEPANLP
A0A3M1MN85      -----------------------YARL--LASSQSNAINT----------LRVVEEATLP
A0A7Y5F2P3      -----------------------YANL--LASTNQEAINS----------LTVIEPAALP
A0A5N9DUL0      -----------------------------LVNAQFTALDS----------LYLLEPVSTP
A0A2W6B4S3      -----------------------------VLVDAAQRASI----------VRITQQAQRP
A0A2E6YFL8      -----------------------------LVASNFTTLDS----------LSLLEPAAPP
A0A5N9B1G6      -----------------------------LVASNFTTLDS----------LSLLEPAAPP
A0A351G432      -----------------------YEAV--RLSRMENTTT-----------VVSVEPATPK
A0A7C5PWI6      -----------------------YTELLNFLEGGASPNY-----------LTVIEPAQLP
A0A353H3Y9      -----------------------YQQL--MLSEVLSTST-----------VVQKDPAVAN
A0A7C4N822      -----------------------YCRP--FPDGLFAGNG-----------LEVTCFNSVI
                                                                            

A0A0S7BVT9      ----------------------------------------------------------ML
A0A521JGZ9      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A7V3M975      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7V5PAD5      ------------------------------------------------------------
A0A3N5NV84      --------------MAAAIGLVLA----------------VGGALLIEFLDD-TVKTPDD
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7V3K2D4      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A847FV46      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A7V5YX91      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A7Z9Y601      ------------------------------------------------------------
A0A7V4ZCT4      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A7V2PIG6      ------------------------------------------------------------
A0A7W1TGY7      ------------------------------------------------------------
A0A7W0WA74      ------------------------------------------------------------
A0A7Y2SPK2      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A800D7V8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A7V2QGZ9      ------------------------------------------------------------
A0A800DAF5      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7V8CYM7      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2N2MQC3      ---------------------------------------------MGKMFDV-LQKLERE
A0A2M8PN31      MFPSSPRHVLNIGLGFIGGIGLGL----------------VCVFGLAFIDDR-VKSTVDV
A0A2N2PFW9      EEPIRPRTMTNTLLAAVVGAMIAV----------------GAVFLIEYLDDT-IKTPDDV
A0A7W1NW91      ------------------------------------------------------------
A0A7C4KGM4      VRPTGPNRYLIIALCGMAGLVLGG----------------GCAYLLEYLDEA-IQNPDEL
A0A3N5RU86      ------MELITVALAMAVGLSLSG----------------SVAYVLEYMDGA-IKSQDEI
A0A536AN01      MADLLQLSTLATIPNFSLARRRSG----------------SKPLVIGTPGGN-GKGNGN-
A0A7C3GC16      FAPISPRTKTNVILATIIGTLLTL----------------GIILLLDFLDDT-VKTPDEA
A0A7C4LA78      VVPVGPRRTLIILAAALAGLVLST----------------GAAYLIEFLDDT-LRTPEDV
A0A1Y6K3L6      KKPISPKPMQDAALYASVGFLLMA----------------GIAFLMEYLDDT-IKTPEDV
A0A7C3NDS4      VIPVGPNKLLIILLAAVSGLIFAV----------------GAAYVIEFLDDT-VKTAEDI
A0A0M8JPC7      VRPTGPNRYLIIALCGMAGLVLGA----------------GCAYLLEYLDEA-IQNPEEL
A0A1F8PQP8      GRPISPNTFTMVMLSTVIALALAA----------------AAAYLIEYLDDT-LKSPDEV
A0A7C4K8H9      TRPTGPNTMTMVLLAAVVAGAIAA----------------LAAYVIEYLDDT-LKSPEDI
A0A1F8QKW6      TRPIGPNRGTIILMSIAIAFMISA----------------GAAYLIEYLDDS-IETPEEI
A0A356DVN8      TVPISPKPTETALLGAAIGLLITA----------------AIVFLIEFLDDT-LKTPDEI
A0A7C1YUD4      TAALARRDNLAMAVAGISGLMLTI----------------AGALLIEYLDDS-VRWEEEM
A0A1F3AZM3      TSPISPRPFQSTALAAAVGLMLAA----------------GIAFLIEYLDDT-LKTMEDI
A0A7C3PVB7      TTSVGTSKVLIIGLAGMVGLVLAT----------------GAAYLIEFLDRT-IKSTSDV
A0A363U3C3      SNPVGTNRFFIIALAGLVGFSLGT----------------GAAYLLEYLDKT-VKTASDV
A0A350FYF2      TRSVGTSKLIIIALAGLVGFSLGS----------------GAAYLLEFLDRT-IKTTSDV
A0A850BWC8      TRSVGTNKFIIIGLAGIVGLSLGA----------------GAAYLLDFLDRT-VKTTSDV
A0A3M1MN85      TRPIGPNKVLDVAAATLGGLILAT----------------LGAYGIEYLDDR-LKTETHI
A0A7Y5F2P3      SRPIGTNQTITILISAAVGFALAI----------------SAAYLLEYILDTSLKFPDEV
A0A5N9DUL0      TTPISPDVQQNITFGIMIGLALAL----------------GLTFLISNLRDT-VRNPDDI
A0A2W6B4S3      TSPSSPHPTLNAALAFLAALLLVL----------------GVGFVSDRLDDS-VRGEEEI
A0A2E6YFL8      KSPAFPRTKRNTAIGVMLGFLLAT----------------FLSVLLSSITST-IKDVENI
A0A5N9B1G6      KSPAFPRTKRNTAIGVMLGFLLAT----------------FLSVLLSSITST-IKDVENI
A0A351G432      MQPIRPKPVTNTLLGSVAGLMLAS----------------GLVFLIEYLDDT-VKSPDEL
A0A7C5PWI6      YQPISPKVMVNVLLAAVVGFTLAL----------------GAALLLEYLDDT-IKSTDDL
A0A353H3Y9      PLPIQPQPMRSALLAAVVGFMIAA----------------GVIFLITFLEDT-IRDPEEV
A0A7C4N822      PDPSDPQRLYFGYMD--IGLLISADGGASYRAAHQGMKYQGNCFTVAI-------DPADP
                                                                            

A0A0S7BVT9      TM---------DRKLLTNFFRK----NQKINDQNIRSLKKITDENSPFQFVEAYKSLRTN
A0A521JGZ9      -------------------------------MVENRVRIHRDKLDFRTN--EAYKALRTN
A0A7C4N8X2      ------------------------------------------------------------
A0A7V3M975      ----------------MGSIFE----FEPNPGDSENPSIAMEHQRSPTA--ESFRVLRSN
A0A521JNM5      --------------------------------MLQVNFQNLPKLSFRVN--EAYKSLRTN
A0A7V5PAD5      ----------------------------------MERLVARNYPRSPIA--EAFRTLRTN
A0A3N5NV84      LQ---------RTAQLTTLGTI----SRVAGGEDKYRLIPAEEPLSHVA--EAYRALRTN
A0A3M1E8I5      -----------------------------------------------------------N
A0A4P5V2S0      -----------MTSSSGAPVPS----GPESAVKGTPDVIVYTDPRSPAA--EAYRTLRTN
A0A3B9YZ03      -----------MTSSSGAPVPS----GPESAVKGTPDVIVYTDPRSPAA--EAYRTLRTN
A0A3L7X1Q5      -----------MTSSSGAPVPS----GPESAVKGTPDVIVYTDPRSPAA--EAYRTLRTN
A0A2M8PT60      --------------------------------MANAKLITLTDPRSPAS--EAFRTLRTN
A0A3M1QI99      --------------------------------MANAKLITLTDPRSPAS--EAFRTLRTN
A0A3M1YX52      --------------------------------MGNTKLITLTDPRSEAA--EAFRTLRTN
A0A536CYF7      ---------------MSWFATP----SPNGRSLATGALIMLADPLSPAA--EAYRSLAAN
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ----------------------------MRLNGKSPGVFALDDPKSLVS--EAFRTLRTN
A0A532U8U9      ----------------------------MAVNNRSDSLVTLTTPRSPIS--EAYRTLRTN
A0A1V5YJ40      ----------------------------MTDKTASDLLVTLSDPRSPIS--EAYRTLRTN
A0A7C3A115      ------------------------------MANGLDQLVTITHPRSPVA--EAYRALRTS
A0A7V3K2D4      ----------------------------------MTRLITLADPRSPVA--EAYRSLRTN
A0A7C4US90      ------------------------------MTESHTQLITVQDPRSPIA--EAYRTLRTN
A0A2N5K785      --------------------------MTNKATPNLSQLVALRDPRSPAA--EAYRALRTN
A0A7C3H8P7      ------------------------------MNKEQNTLITIAEPRSPIS--EAYRTLRTN
A0A847FV46      ------------------------------MTEKINELITVAEPRSAIS--EAYRTLRTN
A0A7C5LK09      -------------------MLL----KEIDVSGDLKSLITFSDPNSPVS--EAYRALRTN
A0A7V5YX91      ---------------------M----KETHVSGDLKSLVTFSDPNAPAS--EAYRALRTN
A0A160T936      -----------------------------------MALVTISDPRSPAS--EAYRSLRTN
A0A3D0US14      -----------------------------------MSLITLTDPRSPVS--EAYRTLRTN
A0A6L3EZ29      -----------------------------------MDLITLTDPRSPVS--EAYRTLRTN
A0A7C3DHD1      -----------------------------------MDLITITDPRSPAS--EAYRTLRTN
A0A7Z9Y601      -----------------------------------MDLITITDPRSPAS--EAYRTLRTN
A0A7V4ZCT4      -----------------------------MSEKTLQNLITIAQPRSAIS--EAYRTLLTS
A0A2W4MA80      ---------------------M----SLSNGTSP---LIAIRDPRSPAA--EAYRTLRTN
A0A2A6RLU6      --------------------------MSSNGSTAETTLVTLRDPGSPAA--EAYRTLRTN
A0A2H3KNY1      --------------------------MGANGSSPETTLITLRDPGSPAA--EAFRTLRTN
A0A3D0CW09      -----------------------------MTIQGRAALITLTDPRSPVS--EAYRSLRTN
A0A7C3BAP7      -----------------------------MALD----LITVTDPRSPVA--EAYRSLRTN
A0A7V2PIG6      ---------------------------------MTIDLITLTDARSPRA--EAYRSLRTN
A0A7W1TGY7      -------------------------------MPNASDLVTIREPRSAAA--EAYRALRTN
A0A7W0WA74      -----------------------------MRLFVAIDLITLRDPRAPAA--EAYRTLRTN
A0A7Y2SPK2      ---------------------------MSTPASPERTLITLRDPGSAAA--EAYRTLRTN
A0A524ATQ3      -----------------------------MTDNQLDHLITVADPRSPVS--EAYRTLRTN
A0A399ZSS8      ---------------------------------MTNSLITISNPRSPIA--EAYRTLRTN
A0A521ID76      ---------------------------------MSNTLITISNPRSPIA--EAYRTLRTN
A0A535ICD6      -----------------------------MLNNRPSALVTLTNPRSPIS--EAYRTLRTN
A0A3C0ZZ70      ---------------------------MIMANNRQESLITISNPRSPIS--EAYRTLRTN
A0A800D7V8      -----------------------------MADDRRDALIVLTSPRSPIA--EAYRSLRTN
A0A3M1DIE1      -------------------------------MTQKPRLITLTDPRSPAA--EAYRTLRTN
A0A3M1M4P3      -------------------------------MKREIPLVTLTHPRSSAA--EAYRTLRTN
A0A7C1YQY8      -------------------------------MSHR--LITLTDPRSPAA--EAYRALRTN
A0A7V2QGZ9      -------------------------------MSPKPDLITLTDPRSPAA--EAYRTLRTN
A0A800DAF5      -------------------------------MSPKLDLITLTDPRSPAA--EAYRTLRTN
A0A7C6XTW0      -------------------------------MAQDSGLITIIDPIAPAS--EAYRTLRMN
A0A1F8N3P4      -------------------------------MSDNPDLVTLSDPLSPIS--EAYRTLRMN
A0A7C3R144      ---------------------------------MAEELITISEPLSPIS--EAYRTLRMN
A0A524AMJ5      -----------------------------MSVADDLGLVTITDPLSPIS--EAYRTLRIN
A0A7C6XJL5      -------------------------------MPTDLDLVTITDPISPAS--EAYRTLRLN
A0A3M1EV88      -----------------------------MAVEEQAKLVTLSDPRSPVA--EAYRSLRTN
A0A3L7VU47      ---------------------M----TNPVAASPTSTLIALSAPQSAAA--EAFRSLRTN
A0A7L5YKW9      -----------------------------MPTQPPALLITVTDPRSXVA--EAYRSLRTN
A0A426U8Y8      -------------------------------MTTETTLVTLRDPGSAAA--EAYRTLRTN
A0A7V8CYM7      -------------------------------MTATNQLITLRDPRSQAA--EAYRTLRTN
A0A7C3GM47      -----------------------------------MSLITLTDPRSPVS--EAYRKLRTN
A0A2E0ZA41      -----------------------------------MDLVTITNPRSPLS--EAFRTLRTN
A0A3M1ZY58      -----------------------------MNKEAEKYLITLSDPRSPVS--EAYRTLRTN
A0A2N2MQC3      KT---------ADQKKEEPAIV----SDPDNQVLDNKIVSFFAPSSMVT--EQFRRLRTH
A0A2M8PN31      EN---------SLNINLICLIP----KVARKNSFDKARIVQNNMEPRAA--ESFRSLYSS
A0A2N2PFW9      AR---------VSGLSTLGAIA--------------------------------------
A0A7W1NW91      ------------------------------------------------------------
A0A7C4KGM4      AR---------LIDAPIVGYIS-----DLGRKANA-SLYVARHPRSLMA--EAFRTLRAN
A0A3N5RU86      EV---------LLNTPVVGNIF-----EVKQGKNKQPFSIADNPRHPVT--EAFRNLRTF
A0A536AN01      -----------------GNGAG-----SSESGSRAEDLVVLHEPRSVVA--EAFRSLRTA
A0A7C3GC16      AK-VTG-----ASTLASIGFIK--------GDKPSDRLITQTAPRAPIS--EAYRVLRTN
A0A7C4LA78      SR-LLP-----YPIIGYISDMP------RTKTG---ILSVADQPRSPLA--EAFRSLRTN
A0A1Y6K3L6      KQ-ILG-----LPVIGLVADMETGRSKHKGQSK---GVFVADQPRSPIS--EAFRSMRTS
A0A7C3NDS4      SR-VIS-----APVIGTIAEMP--------EQK---TAYVLDSPRSQIA--DAFRSLRTN
A0A0M8JPC7      AR-LID-----APIVGYISDLG------RKANA---SLYVARHPRSLMA--EAFRTLRAN
A0A1F8PQP8      TK-LLD-----IPVVGFISEVE------RGKSL---EYYITNQPRSLIA--EAFRSLRTD
A0A7C4K8H9      NR-LLE-----LPVIGFISEVE------KGKSL---EAYLTSQPRSGIA--EAFRSLRTD
A0A1F8QKW6      NR-VMK-----LPVIGFIPEID------NDVHK---ATIVAEKPRSVVA--ESFRAVKVS
A0A356DVN8      KA-ILE-----VPVIGFIGELK----QSSKKGEDALGVYVAKNPRSPVA--EAFRSLRTN
A0A7C1YUD4      KQSVAG-----LPVLGALPKT-------AVGDG---SIVEVIDPLSPGA--EMARALRTN
A0A1F3AZM3      ER-VMQ-----LPVVGYIAEIQ----YESGSDE---SLYVTRQPRSPVS--EAFRLLRTN
A0A7C3PVB7      ER-VFS-----FPVIGYLSVMS------ENGNN---ATYVLNHPTSLVT--ESFRLLQSN
A0A363U3C3      ER-IFG-----LPVIGYISAIT------DDEDS---GTYVEKNPDSILA--ENFRLLHSN
A0A350FYF2      ER-IFN-----LPVIGYISEIY------ENGNN---AAYVYENPNSIIA--ENFRLIRSN
A0A850BWC8      ER-IFS-----LPVIGYISFLL------EKSNN---ATYVADNPNSILA--ENFRLLRSN
A0A3M1MN85      QH-LVH-----YSLTGYIPTIY----TQEN-----PVTYLRKRPRSPAA--DAFRSIRNA
A0A7Y5F2P3      ER-AFN-----SEIIGHFFTPS----WLTRKK---PPVLLTDDAPHPSA--EAYRSLKTN
A0A5N9DUL0      RT-KFG-----VSVLGMVFEWS----SKEVNE---NDLIVDTSPKSSFA--EAFKQIRTN
A0A2W6B4S3      KE-LTG-----LPLLGIVPSID----MLKDRALSPNSLLFFTGKRSPEA--ESFRVVRTG
A0A2E6YFL8      YN-QFG-----VPTLGNIFRWG----SQNDQ----NEVLTHTDPSSPYS--EAFRHIRAN
A0A5N9B1G6      YN-QFG-----VPTLGNIFRWG----SQNDQ----NEVLTHTDPSSPYS--EAFRHIRAN
A0A351G432      SR-FSS-----IPIIGYLPSLN----QSKLNGKNQSNVYVQENPRSPAA--EAYRSLRTN
A0A7C5PWI6      NA-ALN-----LTTLGSIPYIM----GKAY----KDKLAVAHTPFSPIA--EAYRLVRTN
A0A353H3Y9      TR-KWG-----VPVLGVISRYG----STA------TPIITVSQPRAPVS--ESFRSLRTN
A0A7C4N822      SK-LWAGTGEWGSNHGDLCRSA----DRG------ATWTVVGNPASGLP--DG--QTRHV
                                                                            

A0A0S7BVT9      IDF---VSVNKRYQTIEITSAIPKEGKSGIAINLSISFV-EIGKKVILIDADLRKPMLSS
A0A521JGZ9      IQF-----CGDDIKVISLTSCTPNEGKTSVSFNMATSFV-DNGKRVVLIDADLRKSVLIG
A0A7C4N8X2      --------------------AGPDEGKTLVAANLAIVME-QAGREVILLDADLRRPRVHR
A0A7V3M975      LEF---ISVDKPVQVLGVTSPGPEEGKTFVALNLGLAIA-QGGKRVVLVDADLRRPKVHK
A0A521JNM5      IQF-----CGSGVKMICITSCLPNEGKSNVSFNLATSLA-ECGKKVIFIDADLRRSVIIG
A0A7V5PAD5      IRF---ARPDRPRGSLLITSTQPGEGKTLVAANLAVAIA-QEGRRAIVVDADLRRPSLHR
A0A3N5NV84      IRL---SSVDEPIRTLIVTSPSPREGKSTTAANLGVVVA-QAGKSVILVDADLRRSSLHR
A0A3M1E8I5      IQF---MAVDHPTKTLLVTSPSLGEGKSTTAANLGVIMA-QADLRTIVVDADLRRPSLHK
A0A4P5V2S0      VRALIRPAGGAPLRQILMTSAGADEGKSEAIACLGIAFA-QAGMRVVIVDADLRRPAQHL
A0A3B9YZ03      VRALIRPAGGAPLRQILMTSAGADEGKSEAIACLGIAFA-QAGMRVVIVDADLRRPAQHL
A0A3L7X1Q5      VRALIRPAGGAPLRQILMTSAGADEGKSEAIACLGIAFA-QAGMRVVIVDADLRRPAQHL
A0A2M8PT60      IMF---SSVENPITTLTVSSPAQGEGKSTLIANMAVTFA-QGGNKTILVDCDLRRPSQHE
A0A3M1QI99      IMF---SSVENPITTLTVSSPAQGEGKSTLIANMAVTFA-QGGNKTILVDCDLRRPSQHE
A0A3M1YX52      LMF---SSVENPIHTLLITSVAQSEGKSEVLANLAVTFA-QAGHKTIIVDSDLRKPAQHE
A0A536CYF7      LQF---AYADRQLQTIGITSAAPGEGKSTTVANLAIALA-QGGRRVIVVDADLRRPGQHT
A0A3N5PDS6      ---------DRPLRCLVVTSALAAEGKTTTVANLAVVIA-QGGKRVVLVDADLRRPAVHR
A0A7C3HD02      LQF---SSLDAPLRSLVVSSTLAAEGKTTTAANLAVVWA-QAGKRVILIDADLRRPAVHK
A0A532U8U9      LEF---SSLDKPIKTIVVTSPGPEEGKSTTLANLAVTLA-RAEKEVILVDCDLRRPSQHE
A0A1V5YJ40      LQF---VSLDKPLRTILVTSAGPDEGKSTLIANLAIAMA-QGERKVILVDCDLRRPSLHK
A0A7C3A115      ILF---SSLDSPVRSLLVTSTAAEEGKSTTLANLGVTFA-QAGHEVILVDSDLRRPSLHR
A0A7V3K2D4      LEF---ASLDRPLRSLVVTSPGPEEGKSTALANLAVVTA-EANKRVILVDCDLRRPRQHE
A0A7C4US90      LEF---SSLDNPLRTLVVTSAGPEEGKSTTLANLAVTMA-EAGRQTILVDCDLRRPRLHT
A0A2N5K785      IQF---SSLDKPLRTILTTSTAPDEGKSTTVANLAITIA-QSEQRVILVDCDLRRPTLHT
A0A7C3H8P7      LDF---AGLDRSLKTLVVTSAGVGEGKTTTLANLAVVSA-QAGRRVILVDADLRRPTLHQ
A0A847FV46      LDF---ASLDRAVKTLVITSAGVGEGKSTTLANLAVVSA-QAGRKVILVDADLRRPTLHQ
A0A7C5LK09      LAF---AGLDRQLRTVMFSSPGPEEGKSTVLANLAVSIA-QTERRVLVVDADLRRPSLHE
A0A7V5YX91      LAF---AGLDRQLRTVMFSSPGPDEGKSTVLANLAVSVA-QTEQRVLVVDADLRRPSLHE
A0A160T936      LSF---YSLDAPLRTLVVTSPAAGEGKSSTVANLAVTMA-QSGRRTVLVDCDLRRPTLHE
A0A3D0US14      LSF---TGLDEPIRTLVVTSPAPDEGKTTTIANLAVTIA-QGGRKTILVDCDLRRPTLHT
A0A6L3EZ29      LSF---YSLDNPIRTLVVTSAATDEGKSTTIANLAVTMA-QGGNRTILVDCDLRRPSLHA
A0A7C3DHD1      LSF---YSLDHPLRSLVVTSPAKEEGKSTAIANLAVTMA-QSGRKTVLVDCDLRRPSLHT
A0A7Z9Y601      LSF---YSLDHPLRSLVVTSPAKEEGKSTTIANLAVTLA-QSGRKTILVDCDLRRPSLHT
A0A7V4ZCT4      IDF---AGLDRPIRALMLTSASPEEGKSSTLANLAVVAA-QEGRRVIVVDCDLRRPSLHS
A0A2W4MA80      IQF---TSLDRPLRTLLATSTAPDEGKSTTLANLAVTIA-QAEQRVILVDCDLRRPSLHT
A0A2A6RLU6      ILF---SSLDRPLRTLLVTSTAPNEGKSTTLANLAVTMA-QAEQRVLVVDCDLRRPSLHT
A0A2H3KNY1      LLF---SSLDRPLHTLLVTSTAPDEGKSTTLANLAVTMA-QAEQRVLMVDCDLRRPSLHT
A0A3D0CW09      LEF---ASLTGPLRSLVITSPGPGEGKSTMLANLAVTMA-QAGKKTIVVDTDLRRPSQHE
A0A7C3BAP7      LEF---SSLDHPLHTLLVTSPGPDEGKSTTLANLAVTTA-QTGRRVIVVDCDLRRPRQHE
A0A7V2PIG6      LEF---SSLDKPLHSLLLSSAAPNEGKSTTLANLGVISA-QAGKRVILLDCDLRRPQLHE
A0A7W1TGY7      IQF---ASLDKPLRTLLATSTAPNEGKSTTLANLAVTIA-QGEQRVILVDCDLRRPTLHT
A0A7W0WA74      IQF---SSLERTLHTLLVTSSAPDEGKSTTLANLAVTMA-QAELRVILVDCDLRRPALHS
A0A7Y2SPK2      IQF---SSIDRPLKTLLITSTAPDEGKSISLANLAVTMA-QAEQRVLMVDCDLRRPSLHS
A0A524ATQ3      LDF---SSLDKPIKTMLVTSTGPDEGKSTVLANLAVATA-QTGRKVILVDCDLRRPALHN
A0A399ZSS8      LEF---SNLDKTLRTLLVTSAGAEEGKSTMLANLAVTIA-QSGKRVILVDADLRRPTQRQ
A0A521ID76      LEF---SNLDKSLRSLLVTSAGAEEGKSTTLANLAVTIA-QSGKRVILVDADLRRPTLHQ
A0A535ICD6      IEF---SSFEKKLHTLVVTSASPEEGKSTTLANLAVTMA-QAGKRVILVDCDLRKPSQHL
A0A3C0ZZ70      LEF---SSLDKPLRTMVVTSAGPEEGKSTTLANLAVTLA-QAEKKVILVDCDLRRPSQHE
A0A800D7V8      LEF---SSLDHPLKTLIVTSAAPGEGKSTVLANLAITMA-QADKEVILVDCDLRRPSQHR
A0A3M1DIE1      LTF---AGLDQPLEALVVTSPAMEEGKSLAVANLAVTMA-QGERRTILVDADLRRPRLHA
A0A3M1M4P3      LTF---ASLDKPIRSLIVTSAAPGEGKSTTLANLAVTMA-QGDRRTILVDADLRRPSLHR
A0A7C1YQY8      LTF---AALDKPLETLVITSATPGEGKSTTLANLAVTMA-QGERRTIMVDADLRRPSLHE
A0A7V2QGZ9      LTF---AGLDKPIETLVVTSAAPGEGKSTTLANLAVTMA-QGERRTILVDADLRRPSLHE
A0A800DAF5      LTF---AGLDKPIETLVVTSAAPGEGKSTTLANLAVTMA-QGERRTILVDADLRRPSLHE
A0A7C6XTW0      LQF---ASLDKKLNSLLITSPGPGEGKSTTLANLAVTMA-QVDQRVIMVDCDLRRPHLHD
A0A1F8N3P4      LQF---AALDSPLRSLLITSATPGEGKSTTLANLAVTMA-QVDQRVIMVDCDLRRPCLHT
A0A7C3R144      LQY---ASLDRALRSLLITSPGPGEGKSTTLANLAVTMA-EAEQRVIMVDADLRKPCLHQ
A0A524AMJ5      LQF---ATLGVQLRTLLVTSAGAGEGKSTTLANLAVIVA-QTEQSVVVVDCDLRRPGLHK
A0A7C6XJL5      LQY---ASLDAPLHTLLITSASPEEGKSTTLANLAVTMA-QAEQRIIMVDCDLRRPHLHE
A0A3M1EV88      LEF---SSLDEPLRTMVVTSPAPEAGKSTTLANLAVTMA-QAGKQVILVDCDLRRPSLHE
A0A3L7VU47      IQF---ASLDHTLQLITITSAGVDEGKSLVAANLAITMA-QAEQRVILVDCDLRRPALHS
A0A7L5YKW9      LSF---ANLDQKLRTILVTSAAPEEGKSTVLANLAIVEA-QAGRQVIIVDADLRRPRQHE
A0A426U8Y8      ILF---SSLDRPLRTLLVTSTAPNEGKSTTLANLAVTMA-QAEQRVLLVDCDLRRPSLHT
A0A7V8CYM7      IQF---SSLDRQITTLLATSTSPDEGKSTTVANLAVAMA-QSEQRVILVDCDLRRPSLHT
A0A7C3GM47      LSF---YSLDDPIKTLVVTSAEPNEGKSTTVANLAVTMA-QAGNKTIVVDCDLRKPSLHT
A0A2E0ZA41      LSF---YSLESPLRSLVVTSPVMGEGKSSTVANLAVTMA-QSGRKTVLVDCDLRRPSLHT
A0A3M1ZY58      LSF---YSLDNPLRTLVVTSPAADDGKSTTVANLAVTMA-QSGRKTILVDCDLRRPSLHT
A0A2N2MQC3      IIQ---PNQPNSPKTIVITSTLSGEGKSLIAINLAIIIAVEMQSHALLVDCDIRNPSIAR
A0A2M8PN31      IRI---SDVGRHSQVILTTSTLPSEGKSFVATNLAYTFA-SHGERTLLIDGDLRMPAIAQ
A0A2N2PFW9      -RL---KETGGTRQL--------SEGKSTTAANLAVVMA-QTGQRVVLVDTDLRRPVMHK
A0A7W1NW91      -----------------ITSFDSGDGKSVTSANLALVTA-ESGLRTLLIDGDIRKGNLHE
A0A7C4KGM4      IEL---QNLDNGPLALLITSPDTGDGKTSVAANLAVSFS-QGGKKVILVDGDLRKPSLHE
A0A3N5RU86      IEF---TNRD-KLHTILVTSAGSNDGKTWIAANLAISMA-REGKRVVLIDADLRNPSLHQ
A0A536AN01      VLF---SAPGAPPRVILLTSAGVGEGKTFTSLNLATTLA-DSGSRVLLIDADLRRAGCHR
A0A7C3GC16      LSF---SAIDTELRSVLVTSSSPGEGKSTCSANTAVVMA-QTGHKVILIDADLRKPTQHR
A0A7C4LA78      LEF---TSVDRQLKTILITSPTPGDGKSSIAFNLGLIMA-QGGKRVVLLDADLRRPSLHR
A0A1Y6K3L6      LEF---YSVDQQLQMLIVTSSGPEEGKTTIASNLAVIIA-GSNKKVLLLDADLRRPNVHQ
A0A7C3NDS4      LEF---SSVDHPIKKLVLTSAEASEGKSTVAINLALVLT-QAEKRVILMDADLRAPSIHY
A0A0M8JPC7      IEL---QNLDNGPLALLITSPDTGDGKTSVAANLAVSFS-QGGKRVILVDGDLRKPSLHE
A0A1F8PQP8      LEF---SSVDKPLKTIYVTGTEVEAGKTSIAINLAIVIA-QSGKRVILMDADMRRPNVHR
A0A7C4K8H9      LEF---SGVDKPLKTIYVASSEMDAGKTSIALNLAIVIA-QSGKRVILVDADLRRPSIHR
A0A1F8QKW6      LDF---GQVDVPAKSFLVASVSKTEGKSMIASNLAMTYA-LSGKKVFLLDADLRRPSLHT
A0A356DVN8      LEY---SSVDNPVKTVLVTSSRESEGKSTIAANLAIVEA-QSGKAVVIVDADMRRPKVHL
A0A7C1YUD4      IIL---AAGERSPEVLLLTSPTLQDGKTRTVAQLGLAFV-GGGRRVIMVDADLRKPSLHT
A0A1F3AZM3      LEF---AGVDRPIRRLLVTSAGPGEGKTTIAVNLAAIMA-QGGKRVVLVDADLRRPKIHR
A0A7C3PVB7      LEF---FQAYNSAKTILITSPTQGNGKTTIAVNLALSLA-LSGQKTILIDSDLRRPAVHA
A0A363U3C3      IEF---FRVSNPIRTILVTSPNQGNGKTTVASNLALSIS-HEEQDIIIVDADLRRPAIHN
A0A350FYF2      IEF---FQISNPITTILITSPNQGNGKTTVASNLAISIS-HGEQDVVLVDADLRRPAIHN
A0A850BWC8      IEF---FQISKPIKTILVTSPNQGNGKTTIAANLALSIS-QGEQEVVLVDADLRRPAVHK
A0A3M1MN85      LGY---L-ADAPYRTLLVSSAAAGEGKSTVAAGLAISLA-QAGYRVILVDADLRAPSLHT
A0A7Y5F2P3      LLL---MDKNAGLKTILVASPEKQKGKTQLAINLALSLA-SGDRKVVLVDADLRLPSVHT
A0A5N9DUL0      LQF---AATKSESRVYLTSSPGPGDGKSTLISNLAVAIA-QTGKKVLIVDGDLRRPTLHR
A0A2W6B4S3      IAF---SRIDDPPRCLLVTSTVQAEGKSTFASNLACAFA-ESGKSVILVDLDLRRPSLSK
A0A2E6YFL8      FQF---ATANKQPPLFLITSPGPGEGKSTIISNLGASLA-QNGKKVIILDADLRKPTIHR
A0A5N9B1G6      FQF---ATANKQPPLFLITSPGPGEGKSTIISNLGASLA-QNGKKVIILDADLRKPTIHR
A0A351G432      IEF---AGIANQTKTIMITSASPQEGKSTTAVNLASILV-QGGKKVVLLDADLRRPFIHR
A0A7C5PWI6      IQF---MAVDGDARTIMVTSSNLSEGKSTTAANLAIVMA-QAELKTILIDADLRRPSVHK
A0A353H3Y9      LQF---ASVAAPLKTILVTSPSPEDGKTSVVANLANVVS-QNNRKVLVIDGDLRKPRIHK
A0A7C4N822      VVD---PTSPPGRRTLLVTSASPAEGKSTVAANLAVVMA-QAGLKVVLVDCDLRRPTVNK
                                         **:      .           ..:* *:*      

A0A0S7BVT9      YLGENPADAKGLSTVLTGC----DLYASILHT----KF--HFDFLPAGLIPPNPVELLGS
A0A521JGZ9      RYKV-GKVENGLTHYLSGQ----NELEDIIYQ----TDIQNMDIVFCGSYSPNPAELLSN
A0A7C4N8X2      LFRQ-TDHTSLAEVLLGDC----ERWPCALMP----TALERLMTVPAGCPPPNPSELLGA
A0A7V3M975      ILGF-PQSPGLSEALID---------KPYLNK----FGKDNLMVLTAGRSAPNPADLLAS
A0A521JNM5      RYKPDQAVVGLTHYLSGQN----K-IDEILYE----TNIDNLDIIFTGPVPPNPSELLAS
A0A7V5PAD5      FFGL-PNRLGFTSLIMDET----LAIKDVIQE----TDVPGLRVITSGPLPPNPLDMLAS
A0A3N5NV84      FFAL-PSKEGLTNVLVQDE----LAVDGWLQE----TGIDNLRVLTSGPLPPDPADLLGS
A0A3M1E8I5      IFQV-PNAGGLTDLLRSPE----MELADQLKR----TEFENLQIITSGPLPPNAAELLGS
A0A4P5V2S0      RFNL-PNGDGLSNLFSGAT----P-RTPTLQP----TAVPNLHVLTSGTEPESPADILAS
A0A3B9YZ03      RFNL-PNSDGLSNLFGGAT----P-RTPTLQP----TAVPNLHVLTSGTEPESPADILAS
A0A3L7X1Q5      RFNL-PNSDGLSNLFGGAT----P-RTPTLQP----TAVPNLHVLTSGTEPESPADILAS
A0A2M8PT60      IWDV-ENERGLTTMILEDA----AISSPPLVE----TEVDNLQLLPSGPVPSNPADIISS
A0A3M1QI99      IWDV-ENERGLTTMILEDA----AISSPPLVE----TEVDNLQLLPSGPVPSNPADIISS
A0A3M1YX52      IWGV-ANERGLTSMMLEDT----ALAEPPLIK----TEVEHLQVLPSGPLPPNPADLLSS
A0A536CYF7      LFGLESQQEGLANVLLGEY----PHLP--LQD----TAAPGVRLLTSGTATADPLEALGS
A0A3N5PDS6      LFGM-PNRGGLTDALVEEP----AALNSFLRD----TAVENLRVLTSGPIPPNPQELLGS
A0A7C3HD02      MFGL-PNRKGLTTLLVAES----GPLSSHLQK----TSLSTLQLLTSGPIPPNPQELLGS
A0A532U8U9      IFGV-HNGVGLTTMVVDDE----AMADPPLQE----TSVSGLWLLPSGPLPPNPSELVGS
A0A1V5YJ40      LFGL-GSREGLTSMMVAEG----GSAEPPLQE----TGVPGLTLLASGPLPPSPSDLLGS
A0A7C3A115      LFDL-PNEYGLTTALLSET----A--GPVLQP----TPVERLRVLTSGPLPPNPAELLSS
A0A7V3K2D4      IFGL-PNDQGLTNMVVDEK----ALEEPPFRD----VGVAGLRVLTSGPLPPNPAELLAS
A0A7C4US90      FFGL-DNSRGLTTMMVDEG----AMKDPPLLA----TGVENLWLLPSGALPPNPADMLAT
A0A2N5K785      LFGL-PNEEGLTSLMLQEG------GRVPLQK----TEVPGLMVLTSGPLPPRPADILGS
A0A7C3H8P7      LFGL-PNETGLTTMMRDEE----VLAAPPLQA----TGVEGLSVLTSGPLPPNPADLMGS
A0A847FV46      ILGA-SNELGLTSMVVDEA----RLTSPPLQE----TGIPGLSLLSSGPLPPNPAELLGS
A0A7C5LK09      IFGL-PNDRGLTTLLGAPD----ALANPPFQA----TPVAGLSVLTSGPLPPRPADLISS
A0A7V5YX91      IFGL-PNDRGLTTLLADPD----ARANPPIQA----TPVAGLSVLTSGPLPPRPADLISS
A0A160T936      LFGL-AMTPGLTSLALDET----V--DLPLQE----TSVENLWLLSSGPKPPNPADLLGA
A0A3D0US14      LFDL-KPEPGLTNLLLEEN----G--QPALQP----TMVDGLQLLSSGPLPPNPADLLGS
A0A6L3EZ29      LFNL-QPEPGFTNAILEEN----G--RPSLQQ----TSIDNLSLLSAGTLPPNPADLLGS
A0A7C3DHD1      IFGL-NQEPGLTNMALEDM----D--KPPLQE----TEVENLWLLAAGKQPPNPADLLGS
A0A7Z9Y601      IFGL-PQEPGLTNMVLENV----D--KPPLQE----TEVENLWLLAAGKQPPNPADLLGS
A0A7V4ZCT4      IFGL-PNGEGLTTALMNAE----TLKEPPLRS----VGVNGLSVLTSGPIPPNPLELLGS
A0A2W4MA80      LFDL-SNESGLTNMILASE----D-TPPPLQE----TGVPGLSLLASGPLPPRPADILGS
A0A2A6RLU6      LFGL-PNEQGLTSAILAQN----D-DLPPAQA----TVVPGLKVLTSGPLPPRPADLLGS
A0A2H3KNY1      IFGV-PNERGLTSAVLAQD----D-GPLPIQP----TSVPGLHVLTSGPLPPRPADLLGS
A0A3D0CW09      LFGL-DQEPGVTTMFMDPA----LQSAPPLQA----TEIEGLWLLASGPKPPNPAELLAA
A0A7C3BAP7      IFGV-SNGTGLTTMVRDEA----ALTRPPLQK----TQVAGLWVLPSGPLPPNPAELLAS
A0A7V2PIG6      LLGL-SNNEGVSTALLEQD----AI--PPLQD----TEVDNLQVMTSGPLPPNPADLLAS
A0A7W1TGY7      IFNL-PNEQGLTTMMLRED----A--GLLAQK----TDIPGLVVLPSGPTPPRPADILGS
A0A7W0WA74      IFGL-PNDAGFTNLLLDAA----A--PIPFQA----TEVEGLRLLTSGPLPPQPADLLGS
A0A7Y2SPK2      IFGL-SNEQGLTSAILEGE----G--ALPIQA----TAVPGLSLLASGPLPPRPADLLGS
A0A524ATQ3      VFNL-KKDVGLTTMVVDDA----AMESPPLQD----TGVEGLQIVSSGPLPPNPSELLGS
A0A399ZSS8      IFGL-KDNAGLTDMARDDA----ARAQPPLQD----SGVPNLQVLTSGQLPPNPAEILGS
A0A521ID76      IFGL-KNNAGLTDMVRDDA----ALANPPLQE----TTVANLQVLTSGQQPPNPAEILGS
A0A535ICD6      AFGL-RNERGLTSLMVPDA----DLNNPPLQT----TAQDSLLLLTAGPLPPNPSEMIGS
A0A3C0ZZ70      IFEV-ENGVGLTTMVVDEE----AFKNPPLQE----TPVPNLKLLPSGPLPPNPSELLGS
A0A800D7V8      LFGV-PNETGLTTMIRDDR----AMENPPLRE----TGVPHLHLLPSGPLPPNPSELLGS
A0A3M1DIE1      IFGV-SNDRGLTTMFVEPA----AMANPPLVD----VGVENLWLLPSGPLPPNPADLLGS
A0A3M1M4P3      IFGL-PNEPGLTTMFVDEA----SRTDPPLLE----TGVEHLWLLPSGPLPPNPADLLGS
A0A7C1YQY8      IFGV-SNGRGLTTMFVEPE----ALENPPLAE----TGVEGLLLLPSGPLPPNPADLLGS
A0A7V2QGZ9      IFEI-PNNRGLTTMFVEQE----ALEEPPLME----TGVENLLLLPSGPTPPNPADLLGS
A0A800DAF5      IFGV-SNSRGLTTMFVEQG----ALEEPPLVA----TEVDNLFLLPSGPTPPNPADLLGS
A0A7C6XTW0      VFGL-SNDMGLTTMMLEDS----ALDNPPLQE----TSIKGLRLLASGALPPRPSDLLGS
A0A1F8N3P4      FFGL-PNNVGLTNMMLEDQ----ALDDPPLQS----TRVPGLHLLASGNLPPRPPDLLGS
A0A7C3R144      FFGL-SNNVGLTTMMVDEQ----ALGTPPLQA----TPIKGLQLLASGPLPPRPADLLGS
A0A524AMJ5      LFGL-SNELGLTTMMADDH----ALDEPPLQP----TEVDGLRLLASGPLPARPPDLLGS
A0A7C6XJL5      LFRQ-HNDVGLTTMMLEDE----ALSDPPLLE----TPVPGLRLLASGPLPPRPADLLGS
A0A3M1EV88      IFGV-SNTTGLTSVILDDT----T-SAPPLRE----TGVPGLKLLTSGPLPPNPAELLGS
A0A3L7VU47      LFGV-SNDTGLTSMLFANA----G-DAPPLQA----TSVPGLQLLASGPLPPRPADILGS
A0A7L5YKW9      LFGL-VNSQGLTTMLAEEN----GLQQPPLQA----TAVPGLQVLTSGXQPPLPAEMLAS
A0A426U8Y8      LFGL-SNEQGLTNAILAQG----D-ELPPLQA----TAVPGLSVLTSGPLPPRPADLLGS
A0A7V8CYM7      LFGV-DNDSGLTSVILASE----E-EALPLVA----TEVPGLHLLPSGPLPPRPADILGS
A0A7C3GM47      LFDL-PNDKGFTDLMLSDA----D-ELPLQKI----AAVDNLFVLTSGEIPPNPADILGS
A0A2E0ZA41      LFDR-QVEPGFTDAILHND----E---PVLQE----TAVENLWLLTAGTKPPNPADILGT
A0A3M1ZY58      FFGL-PAEPGLTNMLLDDD----E---PPLQE----TGVENLWLLASGPKPPNPADLLGA
A0A2N2MQC3      LFGL-KDTKGLSN-YLLGE----AEIPDLLIK----TSVDKLSLIAGGPLQENPVELIGS
A0A2M8PN31      SLQM-EDEVKAHGGGLVGYFEGSTSWENMIVN----EIAHNLDMLASVKNASVPSEIANS
A0A2N2PFW9      VFGA-ANNTGLTSALLNG---DQVVLDGHLQG----TEVENLSLLTSGPIPPNPSELLGS
A0A7W1NW91      FFGL-PNVMGLSD-ILAGRDDLGVLLSRSLLD----SKYDNLTLLTAGRASINPAVLLSK
A0A7C4KGM4      FFEI-SDRRGLTD-ILQGK----LSVEKALRQ----WDGGGLRLITVGDEAVLPDLLLTA
A0A3N5RU86      FFHE-ERENGLTD-LFQGK----QAVTDVLKY----NNKERVGLITAGELPQNTYELMNI
A0A536AN01      AFGI-VNERGLSS-FLSGQ----VTLAEAIRV----LDAPKLSFIPAGPTPPNPAELVGS
A0A7C3GC16      IFETN-NNHGLTTALLDSS----TPVAAHLQA----TRTPGLRLMASGPLPPNPAELLNS
A0A7C4LA78      ILGIP-NRDGLSDLFRGHL----QAADVTRPW-----RKDNVTAVTSGTLPPNPTELLGS
A0A1Y6K3L6      RLMIP-NRVGLSDLIRGRL----EINDVIQFS----TEIPYLNLITSGSLPPNPAELLGT
A0A7C3NDS4      YLDIP-ENRGLSDVFLNRI----SPLDGLVTW----DKDPNLRILPAGSIPPNSAELLGS
A0A0M8JPC7      FFDIS-DRRGLTDVLQGKL----SVEKALRTW-----DGGGLRLITVGDEAVLPDLLLTA
A0A1F8PQP8      VLSLT-NQKGLSDVFRGTI----DIYNATIPY-----KEGNIFIVPSGSPPPNPAELLSS
A0A7C4K8H9      YLGIT-NQRGLSDVFRGNL----DIYNATVPY-----KEGNIFVIPSGTPPPNPSELLGS
A0A1F8QKW6      YLDLP-NAKGLTTLLLHPE----KSIQQCAQS----LPIGNLSVITAGNSVENPSDLIGS
A0A356DVN8      QFSKP-NRMGLSDVVTGKL----GIDDVLKTY----DQVENLSIITCGTIPPNPAELLGS
A0A7C1YUD4      LFDLP-DPFGLAELLAGDV----PLDGSAWPRGVQETGVEGLYLLPAGKPPLDPSRLLTS
A0A1F3AZM3      FLGLS-NKVGLSDLFRGVV----AVRMVSQQV----QDVETVSVLTSGSLPPNPTELLAS
A0A7C3PVB7      ALGVE-KEPGLSDVIRNKM----KPADVVKSM----N-GSKIDVITAGNVPPNVTEVVGS
A0A363U3C3      ALKVP-KNPGLSDILRNKA----DVKSVVKSW----KDDDGIKVLTAGNIPPNVTEVVGS
A0A350FYF2      VLNIT-KNPGLSDVIRNKT----DIDSVVRYW----K-EDGLKVITAGDIPPNITEVVGS
A0A850BWC8      ALNMP-KEPGLSELIRNKA----DINEVVRPW----T-ENGLKVITCGNIPPNITEVVGS
A0A3M1MN85      MLGLP-QKPGLSDVLQGKI----PLAESIIML----ENL-GIDLLTSGDIPDQSTELLAS
A0A7Y5F2P3      VLALP-NEKGLGDILTDQA-----TLESVIHS----LKDGKLSVITAGMTPHDLVERLDT
A0A5N9DUL0      RFKNITRDTGLSNYLSDNT----ETLGAVTQT----SGVSGVDVITSGPIPPNPSELLDS
A0A2W6B4S3      IVNTPMR--GLTNVLLDQA----SSLESYLVA----GALPNLRVLPSGPTPPSPAELISS
A0A2E6YFL8      RFNLKKREPGLSTFLSDKD----LTPSEIIMN----PGIPNLDIIPSGPVPPNPSELLGT
A0A5N9B1G6      RFNLKKREPGLSTFLSDKD----LTPSEIIMN----PGIPNLDIIPSGPVPPNPSELLGT
A0A351G432      FYKFS-NRVGLSEYFRGEV----SLESTFNYV----DPSRRLIAIPSGKLPPNPAELLGT
A0A7C5PWI6      VFQLP-NAQGLTDLLRSPQ----YEIGDQLKR----TEFENLQVITSGPLPPNPSEMLGS
A0A353H3Y9      IFQLP-NRIGLTDYFLHAQ----ERLNGVIKK----TEIKSLFVITSGNLPPNPSELLGS
A0A7C4N822      QFDMP-NRFGLTDLMLQDP----GQWNGVLQP----SGLNNLHVVFSGSVPPNPSELLGS
                                                         .  :               

A0A0S7BVT9      RQMGEILCELRNE--YD--FIVIDTPPVSLLTDAVTLCQFVDGIIFVIRQKTASIDQIKF
A0A521JGZ9      VRFENMINKLREK--YD--YVIIDTPPLGSVIDSAIVARVVDGVIIVIEANAISYRFAQN
A0A7C4N8X2      RRMREFIQFLTQR--GD--IVIIDSPPLLPVTDALVLAPEVDGVLLVVRHGHTHLKSAQL
A0A7V3M975      QQMGKLIAKLKET--AD--VIIVDIPPILSCADAVSLGKWVDGFLVVAEWGRTDRSAFAE
A0A521JNM5      DNFSDLIKIFRKV--YD--YIIIDTPPIGSVIDSAIVAQKCDGVVLVIESNTVSYKFAQR
A0A7V5PAD5      RRADQLITEMKAM--CD--TLLLDSPPVLSVTDPLLLGTHADGALLVTAAKSTRRNLVVK
A0A3N5NV84      KRMHHLIECLEHE--AD--LIIFDTPPTIPVSDATVLALEADAVLLVVEAGRTRRGAIRR
A0A3M1E8I5      QRMGHILKQLTGM--AD--IVIFDTPPVLSVTDATVLAGRVDGVVLVIQAKRTRRDAARH
A0A4P5V2S0      SDLDRIMDHAGRD--AD--LVLIDCPPICAVADASVLSTRVDGVIVVVGAGVVKRDLARH
A0A3B9YZ03      SDLDHIMDHAGRD--AD--LVLIDCPPICAVADASVLSTRVDGVIVVVGAGVVKRDLARH
A0A3L7X1Q5      SDLDRIMDHAGRD--AD--LVLIDCPPICAVADASVLSTRVDGVIVVVGAGVVKRDLARH
A0A2M8PT60      QRMNEVIGVLKAR--AN--YVLFDSPPVLAATDAALLASKTDGVLLVIRAGHTRRDQAAR
A0A3M1QI99      QRMNEVIGVLKAR--AN--YVLFDSPPVLAATDAALLASKTDGVLLVIRAGHTRRDQAAR
A0A3M1YX52      QRMQEVIGILKAR--AA--YVLFDSPPVLAATDAAVLGVKLDGALLVVQAGNTRRDHTAR
A0A536CYF7      RRFDHVLALARAQ--AD--FVLVDTPPAGALADAAVLAPRLEGMLLVVSAGRTKRDMARR
A0A3N5PDS6      QRMEDLLQRLQGE--AD--VVLVDTPPSLVVADANVLAARTDGVLLVVNADRTRRVAVQQ
A0A7C3HD02      QRMEDLLRVLERR--AD--IVILDTPPCLVVADANVLASRTDGVLLVVDTGHTRRAAIYQ
A0A532U8U9      RRMKEIIAVLSQR--AD--IVLFDAPPIIAVTDAAVLSSEVDGVLMVINAGGTKRDHAQK
A0A1V5YJ40      RRMDAVLATLKER--AD--VVLLDSPPVVAVSDAAVLATKVDGVLLVVSAGHTRREGVQA
A0A7C3A115      RRCARLIAELRDR--AE--FVFFDCPPIVAVTDAAILARQVDGVVLVVSAGRTRREHAAR
A0A7V3K2D4      RRMDDILRFLTEQ--AD--LVLFDVPPVIAVTDAAILASKVDGTLLLIGAGSTRREHAQR
A0A7C4US90      RRMVEVIEALKAR--AD--MVLFDAPPVIAVTDAAILATRVDGVLLVVSAGITKRDYVLQ
A0A2N5K785      RRMEAVIAQLREH--AD--IVLFDTPPVNAVTDAAVLATKVDGVLLVFRAGATRRDRAGE
A0A7C3H8P7      RRMEEVIAALAER--AD--QVLFDTPPVVAVTDAAVLTTKVDGVLLVIGAGKTRRDQARA
A0A847FV46      RRMAEVIATLTEE--AD--QVFFDTPPIVAVTDAAVLATRVDGVLLVIGAGKTRREYARM
A0A7C5LK09      RRMEEMVAWLAEQ--AD--LVLFDAPPINVVADGLVLATRTDGVLLVVRERRTQREAVRQ
A0A7V5YX91      RRMGEVMLWLAEQ--AD--LVLFDAPPINVVSDGVMLATRVDGVLLVVRERRTQREAVRQ
A0A160T936      ARMGRLIDQLLER--AD--FVLFDAPPVMAAADAAILGAKVDGVLLVIQAGKTRRDHSER
A0A3D0US14      HKIDQIIATLLER--AD--IILFDAPPVIAVTDATVLGAKVDGVLLVISAGKTRREHAER
A0A6L3EZ29      KKVDQIINTLAEQ--AD--IVLFDAPPVIAVTDAAVLGAKVDGVLLIINAGKTKRDHAER
A0A7C3DHD1      QKVDQIIAALQET--AD--ILLFDAPPVIAVADAVILGAKVDGVLLIIQAGKTRREHAER
A0A7Z9Y601      QKVDQIIAALQEK--AD--ILLFDAPPVIAVADTVILGAKVDGVLLVIQAGKTRREHAER
A0A7V4ZCT4      RRMEELLAALRER--AD--IVLVDAPPVVAVADAAILASKVDAVLLVVQAGRAKRDYVER
A0A2W4MA80      RRMEQIIARLSGM--AD--MVLFDTPPVIAVTDAAVLATRVDGVLLVFQAGKTSRDRARR
A0A2A6RLU6      RRMAAMIERMSAN--AD--IVLFDTPPVVAVTDAAALAPRVDGVLLVLHAGHTRRDRARE
A0A2H3KNY1      RRMGALIERMRSE--AE--IVLFDTPPVVAVTDAATLAPRVDGVLLVLHAGQTRRDRARE
A0A3D0CW09      PQLRTIIEALTAR--AD--IVLFDAPPVVVVTDAAVLASQVDGVLLVIQAGKTKRDQAAQ
A0A7C3BAP7      QRMSQVIERLMQS--AD--LVLFDAPPVIAVTDAAVLASKLDGVLLVINAGSTKRQYALR
A0A7V2PIG6      KRMDALLAQLLKQ--AD--LVLLDAPPVTAATDAALLASKVDGVLLVVSAGHTKREHAER
A0A7W1TGY7      KRMKEIILKLREY--AD--MVLFDTPPINAVTDAAVLATAVDGVLLVFRAGDTKRDRARE
A0A7W0WA74      RRMDAAIERLKAE--AD--IVLFDAPPIIAVTDAAVLATKLDGVLLVAKSGRTRRDRARE
A0A7Y2SPK2      RRMVALIERLRAS--AD--IVLFDTPPVVAVTDAAVLAPQVDGVLLVLQAGHTRRDRARE
A0A524ATQ3      RRMEEIIAALLER--AD--VVLFDAPPVVAVTDAAVLATKVDGVLLVINAGGTKRDYARV
A0A399ZSS8      KRMSEILAALLEQ--SD--IVLLDAPPVLAVTDAAVLSGKVDGVLLVVSAGKTKRENAKK
A0A521ID76      KRMSEILTALLER--TD--MVLFDAPPVLVVTDAAVLSSKVDGVLLVISAGKTKRENARK
A0A535ICD6      KRMQEVINALKSR--AE--MVIFDAPPILAVTDAAVLASKVDGVILVVNAGGTKREHMQK
A0A3C0ZZ70      RRMEEIIATLRER--AD--LVLFDAPPIIAVTDAAVLASKVDGVLLVINAGTTKRDHAQR
A0A800D7V8      RRMGEIINALLER--AD--IVLFDAPPVIAVTDAQVLASRVDGVLLVLSAGKTKREHAQR
A0A3M1DIE1      RRMDEVLAALRAR--AD--ILLFDAPPVIEVTDAAVLGRKADGILLVMTTGRTRRDHALR
A0A3M1M4P3      RPMEEIIASLLER--AD--FLLFDAPPVIAVTDAVVLSTRVDGVLLVVQAGRSRREHVQQ
A0A7C1YQY8      RRMEEVIATLRKR--AD--ILLLDAPPVVAVTDSAVLGTKVDGVLLVVSSGRTRRDHAQR
A0A7V2QGZ9      HRMEEVIGVLRER--AD--LVLFDAPPVIAVTDAAVLGTKVDGVLLVVRAGHTRREHAQR
A0A800DAF5      RRMEEVINVLREQ--AD--LVLFDAPPVIAVTDAAVLGTKVDGVLLVVRAGHTRREHARR
A0A7C6XTW0      QRMEKVLQRLLDD--AD--ILLLDAPPLLAVTDAVVLSAKVDGVLLVVSAGETRREHVQQ
A0A1F8N3P4      ERLERVIERLLAE--AD--ILIFDAPPVIAVPDAVVLSTKVDGVVLVLNAGETKREHAQH
A0A7C3R144      KRMEKVIERLLAE--AD--VLLFDAPPVILVTDAVVLATKVSGVLLVVSAGETKREHAQQ
A0A524AMJ5      RRMDRVIEKLLGE--AD--LVILDAPPIMAATDALVLSTKVDGVLLVASAGTTKREQAQR
A0A7C6XJL5      QRMERVLERLTAE--AD--MVLLDAPPLMTVTDAVVLATKVDGVLLVVSAGTTKREHAQR
A0A3M1EV88      RRMADLIRALREQ--AD--IVLFDAPPVIAVTDAAILASQVDGVLLVLNAGVTRREHAQR
A0A3L7VU47      RRMGEILQALRGL--AD--VIIIDTPPVLAVSDAVVLAPRIDGVILVMQAGRTRREPAKQ
A0A7L5YKW9      ERMGRAIAALAAR---D--LVLFDAPPVVAVTDAAILASQVDGVLLVIHADRXRREHAQR
A0A426U8Y8      RRMAALIERLSAN--VD--MLLFDTPPVVAVTDAAALAPRVDGVLLVLHAGHTRRDRARE
A0A7V8CYM7      RRMEALIARLRAQ--AD--IVLFDTPPVVAVTDAAVLATRVDGVLLVLQAHKTSRERARQ
A0A7C3GM47      KKVTGIIERLVNS--AD--IVLFDAPPVIAVTDAVVLGTKVDGVLLVLQAGKSRRDHAER
A0A2E0ZA41      PQVDQLIARLQEK--AD--IILFDAPPVNAVTDAAVLGAKVDGVLLVLSAGKTRREHAER
A0A3M1ZY58      RKVDRVIERLKEM--AD--VILFDAPPVVAVTDAAVLGAKVDGVLLVISAGKTRREHAER
A0A2N2MQC3      ERMKNLIQELKTR--YKDRYIILDCSPLLATTEPTVLTEMADGILMVIKSGKTPRESVQQ
A0A2M8PN31      SHFIDIINVLRQT--YD--RIIVDTPPIGVVSDAMALVPAVDACLYVVKHKGVKMRSIRD
A0A2N2PFW9      HRMARLVEKLVGQ--AD--LVIFDSPPVLAVTDAAVMGRQVDGVLLVVDAGQTREQVVAQ
A0A7W1NW91      PRLGELIELLKGK--FD--AIVMDSVPSIGGPDSAFLAEHSDGVVIVVHGQRGTRRSLRH
A0A7C4KGM4      EKVENLLGELKPL--AD--IILIDSSPFL-VSDAMIFAAKVDGVITVIRPGYTSREMARV
A0A3N5RU86      KMMERILMELMDA--VD--TVIIDSPPFF-IADSVLLSSLVDSVLAVVRPNHTLKQSALA
A0A536AN01      SRMRDTLEQLRDE--YD--FVIIDSPPTLPVTDAVVLAREADGIVLVVKGHDTPRELVRR
A0A7C3GC16      KRMRDVLAELLED--AD--FVIVDTPPVLTVADAAILAPKVDGCILVAEVGKTKYDILKE
A0A7C4LA78      KRMDQILADLKEI--AD--VVIIDAPPFFVT-DAWVLASKVDGVLLVIQANHARRNIVRS
A0A1Y6K3L6      QKMLSILEDLRAK--FD--MIVIDTPPAIVT-DAQILASKTDGVIYVIRPGKTRSLVART
A0A7C3NDS4      RKMDQILDELSAE--AD--ILVIDGPPAFVV-DSLVLSAKADGVLIVVNSGETHRSALAT
A0A0M8JPC7      EKVENLLCELKPL--AD--IILIDSSPFLVS-DAMIFAAKVDGVITVIRPGYTSREMARV
A0A1F8PQP8      KKMDQILESLKKV--AD--VVIVDGPPFLVT-DAQILASKVDGVLLVVRYGFSRKNAAIS
A0A7C4K8H9      KKMDQIFEALKKV--AD--IVVVDGPPFLVT-DATILANKVDGVLLVVRYGFTRKNAALN
A0A1F8QKW6      QRMKDILLELSER--SD--YLIVDGPPVLVT-DSTILSTAVDEVLIVVGYGLTRRSEAAV
A0A356DVN8      ERMSQTLKDLKMR--FD--VIILDTPPMIVS-DAQILSSKVDGLVYVVIPGQTRAITAMR
A0A7C1YUD4      PRLHELLDFLKRQ--AD--VIVIDSPPELAAPDASVLASVADGTVLVVSAGKTSLGKIQK
A0A1F3AZM3      VRMEQILQEAEQD--AD--IVIIDSPPSLVA-DVQVLAGKVDGVILIIHPGHTQEDASLA
A0A7C3PVB7      KRIAEILNGMKDD--FE--TIIVDAPPLVIS-DSYTLASKVDGVILVLEPGQTREEQAKV
A0A363U3C3      KRIAMILSGLEKE--YE--LVIVDAPPLIIS-DAYNLASKVDGVILVMEPGQTTEAQART
A0A350FYF2      KRIASILEELKEK--HE--IVVIDAPPLIIA-DSYNLASKVDGVILIMEPGQTSEEQAMT
A0A850BWC8      KRIGSILGELREQ--FE--LVIVDAPPLIIA-DAYNLASRVDGVILVMEPGQTSEEQART
A0A3M1MN85      RAMQTTMAQLGQS--YD--VVVLDGPPFA-VPDAVVLARRVEGMLWVIRVGYSRRTAVKY
A0A7Y5F2P3      PKMDEILYQLREMA--D--IIILDAPPFY-VADTSILASKVDGLVAVIRPGFSKKAAAIN
A0A5N9DUL0      PRMKDGIEKAKDI--YD--IILVDCPPVLMVADTPIISTVVDMAILVVDSFTTKTSSFGA
A0A2W6B4S3      LRMAQVIQRLQTMA--D--IIIIDSPPILAAADAAITAGLCDSAVLLVRPDRITRRGLTR
A0A2E6YFL8      ERMKNLCNDLHSKLNYD--YVLLDSPPILVVADGSVLASIATAGILIVDGFSTKIGSLQS
A0A5N9B1G6      ERMKNLCNDLHSKLNYD--YVLLDSPPILVVADGSVLASIATAGILIVDGFSTKIGSLQS
A0A351G432      EQMSALLQQLELI--SD--YIIIDSPPLV-VTDPVILATKVDGVLLVIQPGVTRISSVRA
A0A7C5PWI6      QRMADLLQQLQEI--AD--VVIFDTPPVLAVSDAAVLANRVDGVIFVIKAKQTRRKEAQE
A0A353H3Y9      ERMQEVVETLSSH--FD--PIFIDTPPLLAVTDALVLAPRVDGVILVIDPAKTKRAALQH
A0A7C4N822      KRMHQLIEHLHHQ--AD--VVILDAPPLLPVTDALVLSSLADGVVMVIDYGVTRIGEAVQ
                                    :..*  *     :           : :             

A0A0S7BVT9      AMKKLE-SVKA---NVIGAILNDYV-VPKDSSQSKNYYNNYSDYYQHK------------
A0A521JGZ9      VKEQLE-KADC---RILGVVMNKVP--MDKKKYYGKYYGKYYGKYYGTYGEEH-------
A0A7C4N8X2      ALTQLQ-QAGA---RVLGVVLNQVP--IGQRS-YGYHYGYYYRSYYTDNSPDDRGGGAGR
A0A7V3M975      AVNLAR-QSGL---RVLGAVLNKVK--PQSKSYYYHYYYYYDSSEKKPWWKRLFRKRKKR
A0A521JNM5      AIRQLE-KSQS---KILGAVLNKYE----NEGRLYGYESKKSKKYIDYYLEN--------
A0A7V5PAD5      AYQTLR-RSGV---DVIGAVLNKVR-----QSDLGYYYSHYYYGYYYGSPNEVPEEIPLV
A0A3N5NV84      TMEDLQ-RAGA---HVLGAVLNRVT----SRPSKGYYYYE--------------------
A0A3M1E8I5      AVQRLQ-QVGA---TILGAVLNQSG----KGSGYYYSYYTQTGARPVKQPRRAPQRRWWQ
A0A4P5V2S0      ARAQLD-AVRA---NVIGLVVTNAP---YNERTFASYYEESPGRSAS-------------
A0A3B9YZ03      ARAQLD-AVRA---NVIGLVVTNAP---YNERTFASYYEESPGRSAS-------------
A0A3L7X1Q5      ARAQLD-AVRA---NVIGLVVTNAP---YNERTFASYYEESPGRSAS-------------
A0A2M8PT60      ARQALE-RVHV---RIVGAVLSNAP-----REDSGEYYGL--------------------
A0A3M1QI99      ARQALE-RVHV---RIVGAVLSNAP-----REDSGEYYGL--------------------
A0A3M1YX52      ARDALE-RVHV---RLIGAVLTNAD-----RETAGSYYG---------------------
A0A536CYF7      AREQLE-RVNA---NLLGVVLTDV-----RGDDKLYRY----------------------
A0A3N5PDS6      AAEGLR-QVGA---NLVGGVLNMVDIRRGRGAGYYSYYGYYSHYYGEEEGERHRGPRGWW
A0A7C3HD02      AVEGLQ-NVNA---RILGAVLNMVDTRRGRG---YYYYSYYAHYY--QEDGRDGRPRKWP
A0A532U8U9      AKALLD-KVNA---HLVGAVLNNVK----IDTSLHRYYAEQKGG----------------
A0A1V5YJ40      AKAKLE-KVNA---NLLGAVLTNAT----MDTSLSRYYDAREEVSG--------------
A0A7C3A115      ARQLLE-RVQA---RVLGVVLTNVT----VDASLYQYYE---------------------
A0A7V3K2D4      AKEVLE-RVNA---RLVGAVLMGVP----FDESLHRYYAR--------------------
A0A7C4US90      AKELLE-RVNA---RVVGVVLTNVS----FDATLHRYYGEG-------------------
A0A2N5K785      ARRLLD-KVNA---NIVGVVLTDVK----QE---DGYSYYGS------------------
A0A7C3H8P7      AVQRLE-QVNA---RLVGAVLTNAE----MGATFKGYVYTGP------------------
A0A847FV46      AIQRLE-QINA---RLVGTVLTNVE----AGGGFTGYY----------------------
A0A7C5LK09      AMASLS-RVNA---RVLGAVLSGVS----LDRTLAQYYTRHAPARAARRSGTEAGAGASS
A0A7V5YX91      AMASLA-RVNA---RVLGAVLSGVS----PDRSAARYYSQRAPAKATRGSGAEAGAGATG
A0A160T936      ARELLE-KANV---RIIGATLTNAP----QDRSMREYYG---------------------
A0A3D0US14      AKEMLE-KANV---RIFGAALTNAP----KDSSIGGYYD---------------------
A0A6L3EZ29      AKDTLE-KAKV---RIVGATLTNAQ----RDSVVGGYYS---------------------
A0A7C3DHD1      AKATLE-TANV---RIVGAALTNAP----KDQAMGSYYD---------------------
A0A7Z9Y601      AKTTLE-TANV---RIVGAALTNAP----KDQAMGSYYS---------------------
A0A7V4ZCT4      AKALLE-KANA---RIIGAALTNVQ----ADTLLTRYYAAEGSR----------------
A0A2W4MA80      TREVLE-KVKA---NIVGVVLNGAE----LEQG-YGYYS---------------------
A0A2A6RLU6      ARQLLE-KVKA---NIVGVVLNGAK----QERG-YTY-----------------------
A0A2H3KNY1      ARRLLE-QVKA---NIVGVVLNGAK----VERG-YAY-----------------------
A0A3D0CW09      AKTLLD-QVRA---RLVGTALTNVK----LDPKLQGYY----------------------
A0A7C3BAP7      AKEILE-RVNA---RLIGAVLNNVV----LDKTLHTYYT---------------------
A0A7V2PIG6      AKDLLE-KVNA---NVVGAVLTNAA----VDPSAYGSYGQS-------------------
A0A7W1TGY7      AHQLLD-KVNA---NVVGVVLTNVK----GDQAQYSYYGT--------------------
A0A7W0WA74      AVQLLQ-KVNA---RVLGVVLTNAK----LEKDGYGSYS---------------------
A0A7Y2SPK2      ARQILE-KVKA---HIIGVVLNNAR----LE----GGYSY--------------------
A0A524ATQ3      AKARLE-KVNA---NLLGAVLNNVR----FDVSLHRYYAAQM------------------
A0A399ZSS8      AQAQLE-KINA---RIIGVVVNNVQ----AEKGASYYYAESN------------------
A0A521ID76      AQSQLE-KINA---RVIGAVLNNVK----AESGASYYYAEGNS-----------------
A0A535ICD6      AHALLK-KVNA---PLIGAVLNNVK----FDNSLHKYYGTES------------------
A0A3C0ZZ70      AKALLE-KVNA---RLVGAVLNNVR----MDISLHRYYAEQKQA----------------
A0A800D7V8      AKALLE-KVNA---RLVGTVLNNVK----LDMALYRYYSGEEEV----------------
A0A3M1DIE1      AKEVLE-RAHV---RLVGVVLTDVS----VSRA-HRYY----------------------
A0A3M1M4P3      AKQLLE-RVQA---RLVGAVLTNAP----SDSVMGAYYTDEW------------------
A0A7C1YQY8      ARELLE-RVHV---RVVGAVLTNAP----LDVSLGGYYR---------------------
A0A7V2QGZ9      AKELLE-RVHV---RVVGAVLTNAP----VDVTLGGYYR---------------------
A0A800DAF5      AKELLE-RVRV---RVIGAVLTNAP----VDITLGGYYR---------------------
A0A7C6XTW0      GIERLT-KVNA---NILGSVLNNAP----LNSALHSYYT---------------------
A0A1F8N3P4      AVERLN-RVNV---RIVGAVLNNVP----LDATLHRYYR---------------------
A0A7C3R144      AVERLN-RVNA---HIAGVVLNNVP----LDATLHRYYRR--------------------
A0A524AMJ5      AVERLN-KVNA---RLVGAVLTNVP----LDATVRAYYA---------------------
A0A7C6XJL5      AVERLR-KVNA---HLVGSVLNNAP----VDATLHGYYR---------------------
A0A3M1EV88      AKAALE-KVNA---RLIGTVLNNVK----LDTSLYGYYSAQ-------------------
A0A3L7VU47      ARIVLE-KAKA---HIVGVVLNDAE----MTQSS-GYYG---------------------
A0A7L5YKW9      AQQLLE-KVNA---HIIGSVLNNAX----PDSGLRGYYK---------------------
A0A426U8Y8      ARQLLE-KVKA---NIVGVVLNGAK----LERGY-AY-----------------------
A0A7V8CYM7      ARQILE-KVKA---NILGVVLNDAE----IEQGY-GYYS---------------------
A0A7C3GM47      AKQLLE-QAKV---RIVGATLTNAP----KDDAVSSYYG---------------------
A0A2E0ZA41      AKEILE-KARV---NIVGATLTNAP----VDSSMEAYYG---------------------
A0A3M1ZY58      AKELLQ-KAHV---RLVGVTLTNAP----KDDAISGYYG---------------------
A0A2N2MQC3      ALRLLN-KD-----KIMGVVLNGME----YRTKALIQRHFGTNRYYHDYHYSKTHPEPDN
A0A2M8PN31      SIRRLR-DVHM---PILGAVMNQVD------KVGSGYYHNYTDKNYHKYYGAYTPQKTQN
A0A2N2PFW9      AAAELQ-KTGA---NLLGVVLNRLD------SRRGGYY----------YYYYYYSEEEGG
A0A7W1NW91      TLQTLR-QGTNRTVNIYGIVFNRIA----LQLTSTYNQPYYRRNLAINPEKLDQEMLNAG
A0A7C4KGM4      MKERIA-MAGG---KIIGVVLNRIP------LKRIGYYGGYRYYLPYGYYEKKKKREEDE
A0A3N5RU86      MIEQIH-RSGG---NLTGVVINRIP------FRQLKYYLKYPYNSLEKYHLASERMQKEP
A0A536AN01      ARDQLV-NAGA---HILGALVNNVD----LGWGDLYYYNRY-YGTYYGRPEAREGLEQHA
A0A7C3GC16      SSTRLR-ATNA---ALFGLVLNRSK----AGRAGYY-QNYYNERYYSYEYGAGTPKASKK
A0A7C4LA78      MLEQIR-RVNA---PIIGAVINRMA----HTRGAYSRYSYLSYYYYSRDEAQAEGGAAGQ
A0A1Y6K3L6      PLEEFE-RLGA---NVIGVVMNRIP----HNRGYYY-GGFEYYS----------------
A0A7C3NDS4      VSEQLK-RLGA---NLVGVVLNRVP----RSAAYYG-AYYNSYYSKDGTKKEKRRKTGTR
A0A0M8JPC7      MKERIA-MAGG---KIIGVVLNRIP----LKRIGYY-GGYRYY--LPYGYY---------
A0A1F8PQP8      AVQQLK-RADA---RAIGVVMNRIP----RTASGYY-GYGMYH--SYPGYY---------
A0A7C4K8H9      AVKQMR-RIGA---RAIGVVLNRIP----RSTSGYY-GYGPYH--YYPGYY---------
A0A1F8QKW6      ALKRLE-SAGA---KIGGVILNRIP----RNNRAYY-RLYHYD-----------YGMPAE
A0A356DVN8      PLEELR-RIES---KVLGVVANKIP----RNRDYYY-GGYNYYSPYSNHY----------
A0A7C1YUD4      TRERLESREGV---KLLGVTFNQVK--------------------VNGDYYSAYGRVSRR
A0A1F3AZM3      TLEMLN-RAGA---RTLGVVLNRIP----RGRSDYY-GGYRH---YSP-YYSGYHYYHSM
A0A7C3PVB7      IKEQLN-RAGA---RVIGVVFNRVT----ETNAKSY-GDYQYLSMYAPHHYNDYVSGSAR
A0A363U3C3      IKEQLD-RSGA---RVLGIVFNKVT----EEMAHSY-YDYRYQSLYSPKYYGDYISTASR
A0A350FYF2      IKEQLD-RSNA---HLLGIVFNKIS----EQSAHSS-YDYQYRSLYSPKYYGDYISKSTN
A0A850BWC8      IKEQLD-RSNA---HLLGIVFNKIS----EQSAHSY-YDYQYRSLYSPKYYGDYISKSSR
A0A3M1MN85      MQEQIE-QTLV---NVLGVVINCGR----GPRA-----------HYYQVYGYHGYYQDGN
A0A7Y5F2P3      MAEQIN-RSHA---KLLGITLNNIP----S-----------WGGAYYAKISNNHYSAT--
A0A5N9DUL0      TVETLN-NSGV---EIAGVIMNKLK----KPKFGYG-YGYNYGYYYNYYYYNYKYSLEDT
A0A2W6B4S3      AVETLN-GVGV---RVIGMVVNGVP----RTDA-----------DYYGYGNYYDYQAPAA
A0A2E6YFL8      AVNTLN-GTAI---ETLGIIVNKLK----NSRFSYG-YRYPYYYNYYYYQSYYQYNEAGE
A0A5N9B1G6      AVNTLN-GTAI---ETLGIIVNKLK----NSRFSYG-YRYPYYYNYYYYQSYYQYNEAGE
A0A351G432      SIDQLE-RAQA---RILGIALNNIT------RQNAYYYASYYQQEYY-------------
A0A7C5PWI6      AHKRLQ-QGNT---TVLGSVLNQAS----GKEGGYYYTYYA-------------------
A0A353H3Y9      SIEQLK-QVNA---NLLGVVLNNVK----ISRS-----HYYYNRDYYYGKPYGK------
A0A7C4N822      GKNQLD-QAGA---RVLGVVMNKIP----TGRRGYSYYYYYYNRTYYEGEGTGKRRRGRR
                                 *                                          

A0A0S7BVT9      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A7C4N8X2      GNGSGRGHSRGHGREGSSGATTHRPDGRSVSRAPAPDRA---------------------
A0A7V3M975      RVKKEAPSENPEE-----------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7V5PAD5      GRMQDKGKAPEKV-----------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      IGSTR-------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      RRLRRGKEAGSPRDGVSPAA----------------------------------------
A0A7C3HD02      RLGRRSDRRGKRSVVKSQSAGR--------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7V3K2D4      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A847FV46      ------------------------------------------------------------
A0A7C5LK09      R-----------------------------------------------------------
A0A7V5YX91      H-----------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A7Z9Y601      ------------------------------------------------------------
A0A7V4ZCT4      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A7V2PIG6      ------------------------------------------------------------
A0A7W1TGY7      ------------------------------------------------------------
A0A7W0WA74      ------------------------------------------------------------
A0A7Y2SPK2      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A800D7V8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A7V2QGZ9      ------------------------------------------------------------
A0A800DAF5      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7V8CYM7      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2N2MQC3      WEKAALILKDIKMLLLKLIPHKKGER----------------------------------
A0A2M8PN31      PKRVSKPKKK--------------------------------------------------
A0A2N2PFW9      QRRRSASR----------------------------------------------------
A0A7W1NW91      KRTAFPGRNSNVMIDPSGIRLYSFAAASVQLGVTKETMQEWVRTGFIKSEKRNHRDWISE
A0A7C4KGM4      DKKVTKKNELNLLRK---------------------------------------------
A0A3N5RU86      R-----------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      GIFGRLSNPTGN------------------------------------------------
A0A7C4LA78      LPAARPQRALQSVLRSLQKVSGRGPDGADESAAVEGPTNGHVHRVEVLPPASSDPPDSER
A0A1Y6K3L6      ----PNVYGSEKYYVDSHNDQP--------FIPIQDIETEPKK-----------------
A0A7C3NDS4      IWAFPNLSRIGKVFSFRRKPKAKGYLLTDELIPSDGLQGEPESCPDGQPLGSDEALELQG
A0A0M8JPC7      ------------------------------------------------------------
A0A1F8PQP8      -------------------------IAEEDG-ATQPSITD--------------------
A0A7C4K8H9      -------------------------LYEEEEVAAEKESTD--------------------
A0A1F8QKW6      DTRSIKLGKFHFPMKFNRPVNKKKKPASHDTSDLGDQVAS--------------------
A0A356DVN8      -------------------SYHTESIVPNSEIDMDSKKVT--------------------
A0A7C1YUD4      H-----KGGLWYLLRRRLPFIGRGAEGEEEGFVLSLAEMADYL-----------------
A0A1F3AZM3      DGQDLKPSRMRRLFGKLSPFNHNGHKKVEAGVVEENVIEK--------------------
A0A7C3PVB7      EKELRPPSPTKKLLA----FFERGEVPPDLTESLEGAFNK--------------------
A0A363U3C3      E--PNTGSRSRQLMD----FFEHGKVPADVAVEVEHAITA--------------------
A0A350FYF2      E--PNTGSRSKKIMD----FFEHGQLPPDMAESVELTITA--------------------
A0A850BWC8      EQQPPKGSRGKKLIS----FLEHGEMPPEVSEGVENAITA--------------------
A0A3M1MN85      GRERRKP--AFRRLVENLRRTK--------------------------------------
A0A7Y5F2P3      ------------------------------------------------------------
A0A5N9DUL0      NPESKSSKNPFRIFRSIF--NR--------------------------------------
A0A2W6B4S3      RGDGAKPVAITTDKKNAA--GQ--------------------------------------
A0A2E6YFL8      KTEKQEKRSTKSTIKKLFRWSK--------------------------------------
A0A5N9B1G6      KTEKQEKRSTKSTIKKLFRWSK--------------------------------------
A0A351G432      -APDEEEARSLN------------------------------------------------
A0A7C5PWI6      -QTGNAAENTVRSKLRRLWRRLPLVRG---------------------------------
A0A353H3Y9      -AAEESGGSGADTDTTELELQKPALRD---------------------------------
A0A7C4N822      SRAQSAPGPATSLADSKLEPSNPTGQ----------------------------------
                                                                            

A0A0S7BVT9      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A7V3M975      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7V5PAD5      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7V3K2D4      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A847FV46      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A7V5YX91      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A7Z9Y601      ------------------------------------------------------------
A0A7V4ZCT4      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A7V2PIG6      ------------------------------------------------------------
A0A7W1TGY7      ------------------------------------------------------------
A0A7W0WA74      ------------------------------------------------------------
A0A7Y2SPK2      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A800D7V8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A7V2QGZ9      ------------------------------------------------------------
A0A800DAF5      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7V8CYM7      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A7W1NW91      TEISQMLEHLPRHEIVTNNPQVVLPTKNSTGKLSSGKLRDLLGNQRDALLASARDVNPTD
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      ------------------------------------------------------------
A0A7C4LA78      TRVSLDLLYAISRELATQLDLRELMQRILQMTLDSVGATSGSMIVLDERGEALEGVLIYE
A0A1Y6K3L6      ------------------------------------------------------------
A0A7C3NDS4      NGYGAVAEAEEATLTSLAEIQETAPSEEFAGAIADQKDGSESEEEKLPAAEPSKGAKKSR
A0A0M8JPC7      ---------------------------------------------------EKKKKREED
A0A1F8PQP8      --------------------------------------------------RLKPPRKSRP
A0A7C4K8H9      --------------------------------------------------KLKRPRKLPP
A0A1F8QKW6      ------------------------------------------------------------
A0A356DVN8      --------------------------------------------------------PLGS
A0A7C1YUD4      --------------------------GVSRATARRWCKSGRLPAFRSWFGWRIREEDLRA
A0A1F3AZM3      --------------------------------------------------P---------
A0A7C3PVB7      --------------------------------------------------FQKQRQALRD
A0A363U3C3      --------------------------------------------------IKTQPRKTME
A0A350FYF2      --------------------------------------------------IKTQPKQIVE
A0A850BWC8      --------------------------------------------------IKTKPRSMME
A0A3M1MN85      ------------------------------------------------------------
A0A7Y5F2P3      ------------------------------------------------------------
A0A5N9DUL0      ------------------------------------------------------------
A0A2W6B4S3      ------------------------------------------------------------
A0A2E6YFL8      ------------------------------------------------------------
A0A5N9B1G6      ------------------------------------------------------------
A0A351G432      ------------------------------------------------------------
A0A7C5PWI6      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A7C4N822      ------------------------------------------------------------
                                                                            

A0A0S7BVT9      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A7V3M975      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7V5PAD5      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7V3K2D4      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A847FV46      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A7V5YX91      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A7Z9Y601      ------------------------------------------------------------
A0A7V4ZCT4      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A7V2PIG6      ------------------------------------------------------------
A0A7W1TGY7      ------------------------------------------------------------
A0A7W0WA74      ------------------------------------------------------------
A0A7Y2SPK2      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A800D7V8      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A7V2QGZ9      ------------------------------------------------------------
A0A800DAF5      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7V8CYM7      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A7W1NW91      DADS--------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      ------------------------------------------------------------
A0A7C4LA78      GKTTVQTAEQLADVVERGLAGWVIENRRPVVLDNTHDDPRWLRRDWDENGAKTPRSAISV
A0A1Y6K3L6      ------------------------------------------------------------
A0A7C3NDS4      SGRPRKRAVVIAEEAIEK------------------------------------------
A0A0M8JPC7      EDKKVPKKSELTFSGK--------------------------------------------
A0A1F8PQP8      KDKSTGDALNLEKTES--------------------------------------------
A0A7C4K8H9      TAEPSPESIGLGKTKG--------------------------------------------
A0A1F8QKW6      ------------RVDKTI------------------------------------------
A0A356DVN8      VFEKYQRRDADKQN----------------------------------------------
A0A7C1YUD4      AMPQIMRNARV-------------------------------------------------
A0A1F3AZM3      ------------------------------------------------------------
A0A7C3PVB7      RFRKVPKQP---KE----------------------------------------------
A0A363U3C3      RLRKSKKSGTGRKNGKNG------------------------------------------
A0A350FYF2      RLRKSKKNG---KNGKDG------------------------------------------
A0A850BWC8      RLRRSKKNG---RNGK--------------------------------------------
A0A3M1MN85      ------------------------------------------------------------
A0A7Y5F2P3      ------------------------------------------------------------
A0A5N9DUL0      ------------------------------------------------------------
A0A2W6B4S3      ------------------------------------------------------------
A0A2E6YFL8      ------------------------------------------------------------
A0A5N9B1G6      ------------------------------------------------------------
A0A351G432      ------------------------------------------------------------
A0A7C5PWI6      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A7C4N822      ------------------------------------------------------------
                                                                            

A0A0S7BVT9      ----------------------------------------------
A0A521JGZ9      ----------------------------------------------
A0A7C4N8X2      ----------------------------------------------
A0A7V3M975      ----------------------------------------------
A0A521JNM5      ----------------------------------------------
A0A7V5PAD5      ----------------------------------------------
A0A3N5NV84      ----------------------------------------------
A0A3M1E8I5      ----------------------------------------------
A0A4P5V2S0      ----------------------------------------------
A0A3B9YZ03      ----------------------------------------------
A0A3L7X1Q5      ----------------------------------------------
A0A2M8PT60      ----------------------------------------------
A0A3M1QI99      ----------------------------------------------
A0A3M1YX52      ----------------------------------------------
A0A536CYF7      ----------------------------------------------
A0A3N5PDS6      ----------------------------------------------
A0A7C3HD02      ----------------------------------------------
A0A532U8U9      ----------------------------------------------
A0A1V5YJ40      ----------------------------------------------
A0A7C3A115      ----------------------------------------------
A0A7V3K2D4      ----------------------------------------------
A0A7C4US90      ----------------------------------------------
A0A2N5K785      ----------------------------------------------
A0A7C3H8P7      ----------------------------------------------
A0A847FV46      ----------------------------------------------
A0A7C5LK09      ----------------------------------------------
A0A7V5YX91      ----------------------------------------------
A0A160T936      ----------------------------------------------
A0A3D0US14      ----------------------------------------------
A0A6L3EZ29      ----------------------------------------------
A0A7C3DHD1      ----------------------------------------------
A0A7Z9Y601      ----------------------------------------------
A0A7V4ZCT4      ----------------------------------------------
A0A2W4MA80      ----------------------------------------------
A0A2A6RLU6      ----------------------------------------------
A0A2H3KNY1      ----------------------------------------------
A0A3D0CW09      ----------------------------------------------
A0A7C3BAP7      ----------------------------------------------
A0A7V2PIG6      ----------------------------------------------
A0A7W1TGY7      ----------------------------------------------
A0A7W0WA74      ----------------------------------------------
A0A7Y2SPK2      ----------------------------------------------
A0A524ATQ3      ----------------------------------------------
A0A399ZSS8      ----------------------------------------------
A0A521ID76      ----------------------------------------------
A0A535ICD6      ----------------------------------------------
A0A3C0ZZ70      ----------------------------------------------
A0A800D7V8      ----------------------------------------------
A0A3M1DIE1      ----------------------------------------------
A0A3M1M4P3      ----------------------------------------------
A0A7C1YQY8      ----------------------------------------------
A0A7V2QGZ9      ----------------------------------------------
A0A800DAF5      ----------------------------------------------
A0A7C6XTW0      ----------------------------------------------
A0A1F8N3P4      ----------------------------------------------
A0A7C3R144      ----------------------------------------------
A0A524AMJ5      ----------------------------------------------
A0A7C6XJL5      ----------------------------------------------
A0A3M1EV88      ----------------------------------------------
A0A3L7VU47      ----------------------------------------------
A0A7L5YKW9      ----------------------------------------------
A0A426U8Y8      ----------------------------------------------
A0A7V8CYM7      ----------------------------------------------
A0A7C3GM47      ----------------------------------------------
A0A2E0ZA41      ----------------------------------------------
A0A3M1ZY58      ----------------------------------------------
A0A2N2MQC3      ----------------------------------------------
A0A2M8PN31      ----------------------------------------------
A0A2N2PFW9      ----------------------------------------------
A0A7W1NW91      ----------------------------------------------
A0A7C4KGM4      ----------------------------------------------
A0A3N5RU86      ----------------------------------------------
A0A536AN01      ----------------------------------------------
A0A7C3GC16      ----------------------------------------------
A0A7C4LA78      PLMANDRVVGVLTLVHPHAGHFTRDDLSMLTAIAVGISFSSQVYPN
A0A1Y6K3L6      ----------------------------------------------
A0A7C3NDS4      ----------------------------------------------
A0A0M8JPC7      ----------------------------------------------
A0A1F8PQP8      ----------------------------------------------
A0A7C4K8H9      ----------------------------------------------
A0A1F8QKW6      ----------------------------------------------
A0A356DVN8      ----------------------------------------------
A0A7C1YUD4      ----------------------------------------------
A0A1F3AZM3      ----------------------------------------------
A0A7C3PVB7      ----------------------------------------------
A0A363U3C3      ----------------------------------------------
A0A350FYF2      ----------------------------------------------
A0A850BWC8      ----------------------------------------------
A0A3M1MN85      ----------------------------------------------
A0A7Y5F2P3      ----------------------------------------------
A0A5N9DUL0      ----------------------------------------------
A0A2W6B4S3      ----------------------------------------------
A0A2E6YFL8      ----------------------------------------------
A0A5N9B1G6      ----------------------------------------------
A0A351G432      ----------------------------------------------
A0A7C5PWI6      ----------------------------------------------
A0A353H3Y9      ----------------------------------------------
A0A7C4N822      ----------------------------------------------
                                                              

© 1998-2022Legal notice