BYKdb

Dataset for cluster orphancd of phylum chloroflexi

[Download (right click)] [Edit] [Sequences] [Repertoires]

81 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7C4LA78      ---------------MEI-QEYLAPLRRWWWLVVVSVAIATASAYFFTR-DLPSVYLART
A0A1Y6K3L6      ---------------MDF-RQFVNIAKRWIWLALVGALVAGGLGYYISS-QETPLFQAST
A0A7C3NDS4      ---------------MTFLKTYLAPVTKWWWLIMTAPIIAAVSAAIFVR-QLPPVYQARA
A0A0M8JPC7      ---------------MDI-RPYLAPIFKWWWLLLAAAALATGTAYFILR-DQPAVYTART
A0A1F8PQP8      ---------------MEL-RTYFRPLLKWWWLLLAAGLVAAVSSFVVMG-RRPLIYQSRT
A0A7C4K8H9      ---------------MEL-KSYFRPLIKWWWLVVAAVVVAAISSFIVMR-RQPLLYQSRA
A0A1F8QKW6      ---------------MEI-KQYLEPLIKWWKLILVACLLAGISSFLIIS-RQPPTYQTRV
A0A356DVN8      -------------------YSYLN------------------------------------
A0A7C1YUD4      -------------MNTPV-GRYVVILKKWWWLFAIGVLVPAIIIRLLLS-MQPGMYQARA
A0A1F3AZM3      -----------------Y-YAYLD------------------------------------
A0A7C3PVB7      ---------------MDI-NAYIKPIIKWWRLLAVTTILALVSSAISTV-FQPKLYVSRT
A0A350FYF2      ---------------MEI-NTYLRPLIRWWRLIVIVTMLAVIASAVSAL-LQPAAYVSRT
A0A363U3C3      ---------------MDI-SVYLRPLLRWWRLIMIVTVLAVVASAVSTM-FQPEIYVSRT
A0A3M1MN85      -------------MNLKF-LDYFSPIFRWWWLLIVCALVAGGVGYALVN-PLPPVYQSGI
A0A5N9DUL0      ------MNQNQQEQSIDF-KKYIGLAISYSWLIILLPTIVGTGAYFYSQ-QQTKLYEAKA
A0A2W6B4S3      --------MELRDLIRVA-KRWVPI-------ALIVALTLAIASYAFTKFTVKKVYTATV
A0A2E6YFL8      MQNSNITMPQLNDINTTF-RRYVGIFLNYWWVFLILPAILGIGTYFYSS-SQDTMYEATS
A0A5N9B1G6      MQNSNITMPQLNDINTTF-RRYVGIFLNYWWVFLILPAILGIGTYFYSS-SQDTMYEATS
A0A0S7BVT9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A7C2CD94      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      --------------------------------------------------MGEMTIKELS
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A351G432      --------------------------------------------------MFQKKICKPK
A0A7C5PWI6      --------------------------------------------------ERAVAIADEI
A0A353H3Y9      ------------------------------------------------------------
A0A7C4N822      ------------------------------------------------------------
                                                                            

A0A7C4LA78      TLLVGNAIFERNPTGNEFGLSQTLA-RAYANLALREPVAV----ATMAELGL--------
A0A1Y6K3L6      RFVILRAATTGYDYYA--YIDYQQQIQTYSELLTTDALLN----QASEELGYSAQDVTA-
A0A7C3NDS4      TLLIGRAFQDPNPSSSEFYLSYQLA-GEYANVALREPVRN----STKEALGI---DKLP-
A0A0M8JPC7      TLMIGRTLLEANPSSNDFWLNQQLS-SLYSDMAYREPVQE----GVKKALGM---TWLP-
A0A1F8PQP8      TLVVGSSVYEANPQTGDFFLNEQLA-GFYADLVQRTPIQL----ETMKALNL---EWLP-
A0A7C4K8H9      TLVVGRAVYEANPTGADFYLNQQLA-SFYADLAMREPVRN----AAAQALGV---EWLP-
A0A1F8QKW6      SLVIGRAVYEPNPSGGEMGLAQQLA-AYYANIAEREVIRN----ATMTALNL---RWLP-
A0A356DVN8      --------------------NQDIV-DTYAQLLTTEELLF----QASEALG------FP-
A0A7C1YUD4      TLMIGTSLQNPEPDPWQLTVANNLA-NAYARLAREGPVME----AVITRLGL---NRQPE
A0A1F3AZM3      --------------------SQQLL-QTYIQLLTTEKVLN----AASEKLG------YP-
A0A7C3PVB7      TLMIGTTISNPNPDSGQIYIAAQLA-TIYADIAKREPIQA----ATMEALGI---DWLP-
A0A350FYF2      TLVIGTTILDPNPDSGQIYIAQQLA-GIYADIAEREPIQQ----ATMDSLGI---DWLP-
A0A363U3C3      TLVIGTTILDPNPDSGQIYIAQQLA-SIYADMARREPIQQ----ATMEALGI---GWLP-
A0A3M1MN85      TLLVGNALDTPNPSSLEVEIPRRLT-DAYAAMALREPVRD----GVKKALGLDE------
A0A5N9DUL0      TLLVEQRSSGLSTSISDYSLSARLS-KTYAKLITADPFLD----QVRETNGFER------
A0A2W6B4S3      TMEVQAGVTG--QSVPDPTISNLIV-PTEAQVAAQGPTVDQAMRRVQSTPGIAITPGEIA
A0A2E6YFL8      TLLVEQRRTGGVAGVSDFTLSEDLA-RMYMKQILSTPFIS----RVVEEPDVKY---NVD
A0A5N9B1G6      TLLVEQRRTGGVAGVSDFTLSEDLA-RMYMKQILSTPFIS----RVVEEPDVKY---NVD
A0A0S7BVT9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A7C2CD94      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      SSYPDLQEISSAELLAKVSVNSPVD-SLLIE----------------------LTVIDAD
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      --------------------MGRVS-ESKAS-------------------------LERE
A0A351G432      WQMLKXALETREETRPYQPTPTLAP-ETLSQIQENRLDLQQKQGMLNLYQELYFNLLSSD
A0A7C5PWI6      AYQLILQSPTSPENVDRSERTEFVQ-EQLDS-------------------------LESR
A0A353H3Y9      -RYIDLRTNLETELANTDKQISSIN-ARLAA-------------------------IPTD
A0A7C4N822      -GWI-------TQWGPTVECLALSA-ARPDR-------------------------LVFG
                                                                            

A0A7C4LA78      QELPEYSARALPDGQFLEITVTDSNRELAQLVANELARQLIRQSPSGALTEEEIERQNFV
A0A1Y6K3L6      ------SASQIADTQFMRLTVTHPDPVKAAEIANVLVKVLIDQNERLQSVRYE-ATERNM
A0A7C3NDS4      ------EYEATPRGAFLEISVIHTDPVFAQAVANTLAEKLIE----LSPASVQ-AANQED
A0A0M8JPC7      KY----VVKTFGNGQFIEIDVIDTSPERAMHVASELANQLILVSPGSKEVNS--NNEAFI
A0A1F8PQP8      SY----SASTIPNTPLIEILVNDTDPSRAQAVANELATQLIKQTPTNDPVNT--ERRGFI
A0A7C4K8H9      QY----MARALPNSLLIEIVVADTDPKWAQLVAQELANQLIKQTPTNDPNSS--TRREFI
A0A1F8QKW6      AY----ASQAVPNSQIIEITVTDTDPVRAQAVANELANQLIKQSPSNPDLKEQ-KRQEFI
A0A356DVN8      VRKGQATAKQVDDTKFVVLTVKDPDPFKAATIANGLVSIMISQNENLQSVQFA-AAEKNL
A0A7C1YUD4      QLAAQITTRVYPEAQLLVLEVVDADPRAAALIANALASELVQRSP-MSQEEQA-QRQAFI
A0A1F3AZM3      VYAGQASAQQVPDTQFVRLTVTNTDPQRAADIANVLVMVLIDQNEELQAVRYL-TSEQNL
A0A7C3PVB7      SY----NVRVVPNTQLIEIAVTDTSPQRAQIIANELANQLILQSPATNESETG-QRQEFI
A0A350FYF2      LY----QSKVVPNTQMVEISVTDTNPKRAQIIADELARQLMLQSPAIGGTETG-DRQEFI
A0A363U3C3      QY----QAKVVPNTQMVEITVSDTVPKRAQIIANELANQLMLQSPAIGGTETG-ERQDFI
A0A3M1MN85      --LPKYTAYTIPGSTMVRIEVTDTNPRRAQAVATELGRQLMAQSPGGTTRDS--ETQAFL
A0A5N9DUL0      --LGSVQTRTQENPPLIEIYVRDSDRVLVGEVANAISLNFI----------D--YVIERR
A0A2W6B4S3      AIKASIQCKPNPDTSLFSCSASAHQAEVAALVANQLATVFT----------Q--GEQAFD
A0A2E6YFL8      ELKLMLTADAHINPPTLDVIIRNSDKTEAADVANKIAATFI----------N--YTVELR
A0A5N9B1G6      ELKLMLTADAHINPPTLDVIIRNSDKTEAADVANKIAATFI----------N--YTVELR
A0A0S7BVT9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A7C2CD94      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      PARAADIANTLGIVFANENERQQLSESDQPIKLLESRLLDLDGELANIGTQIIEIGEPDT
A0A2M8PN31      -------------------------------------------------------MKKPN
A0A2N2PFW9      ITSVEADITRTQDALNAVTDDNQRMRLETSLAQYRSTYSSLLSSYQQI--RLAEAQATDN
A0A351G432      SSGNPILTSGAGSNQY-----------QSTLALYQQIYANLLSDYEAV--RLSRMENTTT
A0A7C5PWI6      IRSSTAQLKELEAELDTALSARQIQSLQTEIASLESLITTWQANYTELLNFLEGGASPNY
A0A353H3Y9      TAGNAINPNDVATRAQ----------LETSLSQYEQARSYLVSDYQQL--MLSEVLSTST
A0A7C4N822      TSGHVFLTDDAGATWQ--------------------------QRYCRP--FPDGLFAGNG
                                                                            

A0A7C4LA78      RQQLADLQTKINSTNQEMTEKQAALAD---LSSASEIAAAQADLRALEERLSVLQGN---
A0A1Y6K3L6      QQRADQALEQIEILQAQIDQLSTASVQEQLTQVESEINELQEQIFALETQIVELETK---
A0A7C3NDS4      QKFIQEQLKDLQV---------------NIEKTKQQISENQEKLSTLESALEIAKTE---
A0A0M8JPC7      QEQLQKLQEQIVATEKELVARQDSLGG---LTSAHEIEQAKAELRTLEDKLSLLRTN---
A0A1F8PQP8      ENQLNLFEADIVQTQIDINDKTASLDS---LTSARQIAETQDDIRSLEQKLASLRSS---
A0A7C4K8H9      ENQLNLFEVDITRIQGEIDKKTLELAN---LTSARQIAQAQQEISALEQKLSSLRSD---
A0A1F8QKW6      RQQLELLETQIQDTQEQIAQQENEMGT---LNSARQIAEAQADLTAQRQKLTTLQTN---
A0A356DVN8      QDRIDQAEEQIATLETQISQISDEMLQSQIESVQLQMDDVQAQVNNLKTDMAQIYPGSLA
A0A7C1YUD4      RDRLDGLEERIERLDQEIADLEASLVA---LTSATELDAARSRLRELEAVRMEYQAT---
A0A1F3AZM3      QSQIDQVQSQITTMQTQINDISEATVQDQLVQVKAQIEPLQTQVTTLETEIADLQKNRYP
A0A7C3PVB7      RQQLSSLETQIDDTKKKIEELQTRLTV---VNSSSETASVEKEITDLTVKLNGLYEN---
A0A350FYF2      REQLSSLQIQIQETETKIEELQTSLVD---LNSASQIANIETEIRDHTQKLNSLRES---
A0A363U3C3      KQQLDSLKVQIQDTEKNIEELQKSLIG---INSASQIANIEKQINEQTQRLNSFREN---
A0A3M1MN85      EEQLHKIADAISETEQDIAAKQEEMAT---AEGASAILSLQADLDALNNKLATLQEN---
A0A5N9DUL0      LTEIARL---------------QAAAS---AQGLSDVQS---------------------
A0A2W6B4S3      QQRYQTVLTNIRSSEAIARKNGDAALL---SRLQGSEIS---------------------
A0A2E6YFL8      LAEIAKI---------------QTAAL---SQGLPNVQE---------------------
A0A5N9B1G6      LAEIAKI---------------QTAAL---SQGLPNVQE---------------------
A0A0S7BVT9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A7C2CD94      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      VAKQTQFDRLTRELEEARTTYNSTFQLKLDYELNIASKINTFFSIEDAQPIFAPISP---
A0A2M8PN31      AR-----------------------------------------IVDRAVPPMFPSSP---
A0A2N2PFW9      IA-----------------------------------------IAKPARVPEEPIRP---
A0A351G432      VV-----------------------------------------SVEPATPKMQPIRP---
A0A7C5PWI6      LT-----------------------------------------VIEPAQLPYQPISP---
A0A353H3Y9      VV-----------------------------------------QKDPAVANPLPIQP---
A0A7C4N822      LE-----------------------------------------VTCFNSVIPDPSDP---
                                                                            

A0A7C4LA78      ------------------------------------------------------------
A0A1Y6K3L6      -ISEFNPLFATEEQKAQHEANRTRAAELEAEVKQLTPILALYQQIFTNLTVLGRVPDSST
A0A7C3NDS4      -------------------------RELTALEDKLTKLQSLYTGLYSG------------
A0A0M8JPC7      ------------------------------------------------------------
A0A1F8PQP8      ------------------------------------------------------------
A0A7C4K8H9      ------------------------------------------------------------
A0A1F8QKW6      ------------------------------------------------------------
A0A356DVN8      VENIADLKSLTEDLESLTEEEIAQLTAYQTKLDEITPILELYQEIYTELVVLGQTTGASN
A0A7C1YUD4      ------------------------------------------------------------
A0A1F3AZM3      -----------------TEEENAQLAEKEATLAQVKPILTLYQQLYTNLVVLGQPVDTGT
A0A7C3PVB7      ------------------------------------------------------------
A0A350FYF2      ------------------------------------------------------------
A0A363U3C3      ------------------------------------------------------------
A0A3M1MN85      ------------------------------------------------------------
A0A5N9DUL0      ------------------------------------------------------------
A0A2W6B4S3      ------------------------------------------------------------
A0A2E6YFL8      ------------------------------------------------------------
A0A5N9B1G6      ------------------------------------------------------------
A0A0S7BVT9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A7C2CD94      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A351G432      ------------------------------------------------------------
A0A7C5PWI6      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A7C4N822      ------------------------------------------------------------
                                                                            

A0A7C4LA78      ---------------YATLLANTEQGATNT----------LTVFEPAALPVVPVGPRRTL
A0A1Y6K3L6      NTSIEISQLQTNLNLYQQIYINSISSLENLNLTRAQNTPNVIQVEPARIPKKPISPKPMQ
A0A7C3NDS4      --------------------------------TREAAFNTLSIFEPAALPVIPVGPNKLL
A0A0M8JPC7      ---------------YANLLSSSKENITNI----------LQVIEPASLPVRPTGPNRYL
A0A1F8PQP8      ---------------YAALLASSDRGAGNT----------LRLIEPANLPGRPISPNTFT
A0A7C4K8H9      ---------------YAALLASSDRGAGNT----------LTLIEPANLPTRPTGPNTMT
A0A1F8QKW6      ---------------YATMLGTSLGRASNS----------LNIIETAALPTRPIGPNRGT
A0A356DVN8      QNPTDLDRLKTTLNLYQQIYISSINNLETLKLAKAQNTPTVMQVETAAKPTVPISPKPTE
A0A7C1YUD4      ---------------YASLLESYRTSAPNV----------VSVFEPAVEPTAALARRDNL
A0A1F3AZM3      NTSTRLQQLQTTLSLYQGIYVNLLNSLENVRFARVQNTPNVVQVEPAVASTSPISPRPFQ
A0A7C3PVB7      ---------------YASFLANSQEGALNI----------LRVVEPANLPTTSVGTSKVL
A0A350FYF2      ---------------YANFLVNSQEGALNI----------LSIVEPANLPTRSVGTSKLI
A0A363U3C3      ---------------YASLLANSQEGALNI----------LSVVEPANLPSNPVGTNRFF
A0A3M1MN85      ---------------YARLLASSQSNAINT----------LRVVEEATLPTRPIGPNKVL
A0A5N9DUL0      -------------------LVNAQFTALDS----------LYLLEPVSTPTTPISPDVQQ
A0A2W6B4S3      -------------------VLVDAAQRASI----------VRITQQAQRPTSPSSPHPTL
A0A2E6YFL8      -------------------LVASNFTTLDS----------LSLLEPAAPPKSPAFPRTKR
A0A5N9B1G6      -------------------LVASNFTTLDS----------LSLLEPAAPPKSPAFPRTKR
A0A0S7BVT9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A7C2CD94      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A7C4KGM4      ---------------------------------------------------SLPVRPTGP
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------MADLLQ
A0A7C3GC16      ----------------------------------------RTKTNVILATIIGTLLTL--
A0A2M8PN31      ----------------------------------------RHVLNIGLGFIGGIGLGL--
A0A2N2PFW9      ----------------------------------------RTMTNTLLAAVVGAMIAV--
A0A351G432      ----------------------------------------KPVTNTLLGSVAGLMLAS--
A0A7C5PWI6      ----------------------------------------KVMVNVLLAAVVGFTLAL--
A0A353H3Y9      ----------------------------------------QPMRSALLAAVVGFMIAA--
A0A7C4N822      ----------------------------------------QRLYFGYMD--IGLLISADG
                                                                            

A0A7C4LA78      IILAAALAGLVLSTGAAYLIEFLDDTLRTPEDVSR-LLPYPIIGYISDMP------RTKT
A0A1Y6K3L6      DAALYASVGFLLMAGIAFLMEYLDDTIKTPEDVKQ-ILGLPVIGLVADMETGRSKHKGQS
A0A7C3NDS4      IILLAAVSGLIFAVGAAYVIEFLDDTVKTAEDISR-VISAPVIGTIAEMP--------EQ
A0A0M8JPC7      IIALCGMAGLVLGAGCAYLLEYLDEAIQNPEELAR-LIDAPIVGYISDLG------RKAN
A0A1F8PQP8      MVMLSTVIALALAAAAAYLIEYLDDTLKSPDEVTK-LLDIPVVGFISEVE------RGKS
A0A7C4K8H9      MVLLAAVVAGAIAALAAYVIEYLDDTLKSPEDINR-LLELPVIGFISEVE------KGKS
A0A1F8QKW6      IILMSIAIAFMISAGAAYLIEYLDDSIETPEEINR-VMKLPVIGFIPEID------NDVH
A0A356DVN8      TALLGAAIGLLITAAIVFLIEFLDDTLKTPDEIKA-ILEVPVIGFIGELK----QSSKKG
A0A7C1YUD4      AMAVAGISGLMLTIAGALLIEYLDDSVRWEEEMKQSVAGLPVLGALPKT-------AVGD
A0A1F3AZM3      STALAAAVGLMLAAGIAFLIEYLDDTLKTMEDIER-VMQLPVVGYIAEIQ----YESGSD
A0A7C3PVB7      IIGLAGMVGLVLATGAAYLIEFLDRTIKSTSDVER-VFSFPVIGYLSVMS------ENGN
A0A350FYF2      IIALAGLVGFSLGSGAAYLLEFLDRTIKTTSDVER-IFNLPVIGYISEIY------ENGN
A0A363U3C3      IIALAGLVGFSLGTGAAYLLEYLDKTVKTASDVER-IFGLPVIGYISAIT------DDED
A0A3M1MN85      DVAAATLGGLILATLGAYGIEYLDDRLKTETHIQH-LVHYSLTGYIPTIY----TQEN--
A0A5N9DUL0      NITFGIMIGLALALGLTFLISNLRDTVRNPDDIRT-KFGVSVLGMVFEWS----SKEVNE
A0A2W6B4S3      NAALAFLAALLLVLGVGFVSDRLDDSVRGEEEIKE-LTGLPLLGIVPSID----MLKDRA
A0A2E6YFL8      NTAIGVMLGFLLATFLSVLLSSITSTIKDVENIYN-QFGVPTLGNIFRWG----SQNDQ-
A0A5N9B1G6      NTAIGVMLGFLLATFLSVLLSSITSTIKDVENIYN-QFGVPTLGNIFRWG----SQNDQ-
A0A0S7BVT9      ----------------------------------MLTM-----DRKLLTNFFRKNQKIND
A0A521JNM5      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A521JGZ9      -----------------------------------------------------------M
A0A3N5NV84      -------MAAAIGLVLAVGGALLIEFLDDTVKTPDDLQ-----RTAQLTTLGTISRVAGG
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      -------------------------------------------MTSSSGAPVPSGPESAV
A0A3B9YZ03      -------------------------------------------MTSSSGAPVPSGPESAV
A0A3L7X1Q5      -------------------------------------------MTSSSGAPVPSGPESAV
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      -----------------------------------------------MSWFATPSPNGRS
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      --------------------------------------------------------MRLN
A0A7C5LK09      ---------------------------------------------------MLLKEIDVS
A0A3L7VU47      -----------------------------------------------------MTNPVAA
A0A2W4MA80      -----------------------------------------------------MSLSNGT
A0A2A6RLU6      ------------------------------------------------------MSSNGS
A0A2H3KNY1      ------------------------------------------------------MGANGS
A0A532U8U9      --------------------------------------------------------MAVN
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A3M1EV88      ---------------------------------------------------------MAV
A0A7C2CD94      ---------------------------------------------------MRTPNGRPN
A0A3D0CW09      ---------------------------------------------------------MTI
A0A7C3BAP7      ---------------------------------------------------------MAL
A0A524ATQ3      ---------------------------------------------------------MTD
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      -------------------------------------------------------MIMAN
A0A535ICD6      ---------------------------------------------------------MLN
A0A3M1DIE1      -----------------------------------------------------------M
A0A7C6XTW0      -----------------------------------------------------------M
A0A1F8N3P4      -----------------------------------------------------------M
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ---------------------------------------------------------MSV
A0A7C6XJL5      -----------------------------------------------------------M
A0A3M1M4P3      -----------------------------------------------------------M
A0A7C1YQY8      ------------------------------------------------------------
A0A426U8Y8      -----------------------------------------------------------M
A0A7L5YKW9      ---------------------------------------------------------MPT
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ---------------------------------------------------------MNK
A0A1V5YJ40      --------------------------------------------------------MTDK
A0A7C3A115      ----------------------------------------------------------MA
A0A7C4US90      ----------------------------------------------------------MT
A0A2N5K785      ------------------------------------------------------MTNKAT
A0A7C3H8P7      ----------------------------------------------------------MN
A0A2N2MQC3      ----------------MGKMFDVLQKLEREKTADQKKE-----E------PAIVSDPDNQ
A0A7C4KGM4      NRYLIIALCGMAGLVLGGGCAYLLEYLDEAIQNPDELA-----RLIDAPIVGYISDLGRK
A0A3N5RU86      MELITVALAMAVGLSLSGSVAYVLEYMDGAIKSQDEIE-----VLLNTPVVGNIFEVKQG
A0A536AN01      LSTLATIPNFSLARRRSGSKPLVIGTPGGNGKGNGN--------------GNGAGSSESG
A0A7C3GC16      --------------GIILLLDFLDDTVKTPDEAAKVTG-----ASTLASIGFIKGDK---
A0A2M8PN31      --------------VCVFGLAFIDDRVKSTVDVENSLN-----INLICLIPKVARKN---
A0A2N2PFW9      --------------GAVFLIEYLDDTIKTPDDVARVSG-----LSTLGAIA---------
A0A351G432      --------------GLVFLIEYLDDTVKSPDELSRFSS-----IPIIGYLPSLNQSKLNG
A0A7C5PWI6      --------------GAALLLEYLDDTIKSTDDLNAALN-----LTTLGSIPYIMGKAY--
A0A353H3Y9      --------------GVIFLITFLEDTIRDPEEVTRKWG-----VPVLGVISRYGSTA---
A0A7C4N822      GASYRAAHQGMKYQGNCFTVAI------DPADPSKLWAGTGEWGSNHGDLCRSADRG---
                                                                            

A0A7C4LA78      G---ILSVADQPRSPLA--EAFRSLRTNLEF---TSVDRQLKTILITSPTPGDGKSSIAF
A0A1Y6K3L6      K---GVFVADQPRSPIS--EAFRSMRTSLEF---YSVDQQLQMLIVTSSGPEEGKTTIAS
A0A7C3NDS4      K---TAYVLDSPRSQIA--DAFRSLRTNLEF---SSVDHPIKKLVLTSAEASEGKSTVAI
A0A0M8JPC7      A---SLYVARHPRSLMA--EAFRTLRANIEL---QNLDNGPLALLITSPDTGDGKTSVAA
A0A1F8PQP8      L---EYYITNQPRSLIA--EAFRSLRTDLEF---SSVDKPLKTIYVTGTEVEAGKTSIAI
A0A7C4K8H9      L---EAYLTSQPRSGIA--EAFRSLRTDLEF---SGVDKPLKTIYVASSEMDAGKTSIAL
A0A1F8QKW6      K---ATIVAEKPRSVVA--ESFRAVKVSLDF---GQVDVPAKSFLVASVSKTEGKSMIAS
A0A356DVN8      EDALGVYVAKNPRSPVA--EAFRSLRTNLEY---SSVDNPVKTVLVTSSRESEGKSTIAA
A0A7C1YUD4      G---SIVEVIDPLSPGA--EMARALRTNIIL---AAGERSPEVLLLTSPTLQDGKTRTVA
A0A1F3AZM3      E---SLYVTRQPRSPVS--EAFRLLRTNLEF---AGVDRPIRRLLVTSAGPGEGKTTIAV
A0A7C3PVB7      N---ATYVLNHPTSLVT--ESFRLLQSNLEF---FQAYNSAKTILITSPTQGNGKTTIAV
A0A350FYF2      N---AAYVYENPNSIIA--ENFRLIRSNIEF---FQISNPITTILITSPNQGNGKTTVAS
A0A363U3C3      S---GTYVEKNPDSILA--ENFRLLHSNIEF---FRVSNPIRTILVTSPNQGNGKTTVAS
A0A3M1MN85      ---PVTYLRKRPRSPAA--DAFRSIRNALGY----LADAPYRTLLVSSAAAGEGKSTVAA
A0A5N9DUL0      ---NDLIVDTSPKSSFA--EAFKQIRTNLQF---AATKSESRVYLTSSPGPGDGKSTLIS
A0A2W6B4S3      LSPNSLLFFTGKRSPEA--ESFRVVRTGIAF---SRIDDPPRCLLVTSTVQAEGKSTFAS
A0A2E6YFL8      ---NEVLTHTDPSSPYS--EAFRHIRANFQF---ATANKQPPLFLITSPGPGEGKSTIIS
A0A5N9B1G6      ---NEVLTHTDPSSPYS--EAFRHIRANFQF---ATANKQPPLFLITSPGPGEGKSTIIS
A0A0S7BVT9      QNIRSLKKITDENSPFQFVEAYKSLRTNIDF---VSVNKRYQTIEITSAIPKEGKSGIAI
A0A521JNM5      MLQVNFQNLPKLSFRVN--EAYKSLRTNIQF-----CGSGVKMICITSCLPNEGKSNVSF
A0A7C4N8X2      ------------------------------------------------AGPDEGKTLVAA
A0A521JGZ9      VENRVRIHRDKLDFRTN--EAYKALRTNIQF-----CGDDIKVISLTSCTPNEGKTSVSF
A0A3N5NV84      EDKYRLIPAEEPLSHVA--EAYRALRTNIRL---SSVDEPIRTLIVTSPSPREGKSTTAA
A0A3M1E8I5      ---------------------------NIQF---MAVDHPTKTLLVTSPSLGEGKSTTAA
A0A4P5V2S0      KGTPDVIVYTDPRSPAA--EAYRTLRTNVRALIRPAGGAPLRQILMTSAGADEGKSEAIA
A0A3B9YZ03      KGTPDVIVYTDPRSPAA--EAYRTLRTNVRALIRPAGGAPLRQILMTSAGADEGKSEAIA
A0A3L7X1Q5      KGTPDVIVYTDPRSPAA--EAYRTLRTNVRALIRPAGGAPLRQILMTSAGADEGKSEAIA
A0A2M8PT60      MANAKLITLTDPRSPAS--EAFRTLRTNIMF---SSVENPITTLTVSSPAQGEGKSTLIA
A0A3M1QI99      MANAKLITLTDPRSPAS--EAFRTLRTNIMF---SSVENPITTLTVSSPAQGEGKSTLIA
A0A3M1YX52      MGNTKLITLTDPRSEAA--EAFRTLRTNLMF---SSVENPIHTLLITSVAQSEGKSEVLA
A0A536CYF7      LATGALIMLADPLSPAA--EAYRSLAANLQF---AYADRQLQTIGITSAAPGEGKSTTVA
A0A3N5PDS6      -------------------------------------DRPLRCLVVTSALAAEGKTTTVA
A0A7C3HD02      GKSPGVFALDDPKSLVS--EAFRTLRTNLQF---SSLDAPLRSLVVSSTLAAEGKTTTAA
A0A7C5LK09      GDLKSLITFSDPNSPVS--EAYRALRTNLAF---AGLDRQLRTVMFSSPGPEEGKSTVLA
A0A3L7VU47      SPTSTLIALSAPQSAAA--EAFRSLRTNIQF---ASLDHTLQLITITSAGVDEGKSLVAA
A0A2W4MA80      SP---LIAIRDPRSPAA--EAYRTLRTNIQF---TSLDRPLRTLLATSTAPDEGKSTTLA
A0A2A6RLU6      TAETTLVTLRDPGSPAA--EAYRTLRTNILF---SSLDRPLRTLLVTSTAPNEGKSTTLA
A0A2H3KNY1      SPETTLITLRDPGSPAA--EAFRTLRTNLLF---SSLDRPLHTLLVTSTAPDEGKSTTLA
A0A532U8U9      NRSDSLVTLTTPRSPIS--EAYRTLRTNLEF---SSLDKPIKTIVVTSPGPEEGKSTTLA
A0A160T936      ---MALVTISDPRSPAS--EAYRSLRTNLSF---YSLDAPLRTLVVTSPAAGEGKSSTVA
A0A3D0US14      ---MSLITLTDPRSPVS--EAYRTLRTNLSF---TGLDEPIRTLVVTSPAPDEGKTTTIA
A0A6L3EZ29      ---MDLITLTDPRSPVS--EAYRTLRTNLSF---YSLDNPIRTLVVTSAATDEGKSTTIA
A0A7C3DHD1      ---MDLITITDPRSPAS--EAYRTLRTNLSF---YSLDHPLRSLVVTSPAKEEGKSTAIA
A0A3M1EV88      EEQAKLVTLSDPRSPVA--EAYRSLRTNLEF---SSLDEPLRTMVVTSPAPEAGKSTTLA
A0A7C2CD94      GHDTKLVTMLAPRSPVA--EAYRTLRTNIQF---SSLDVPLRTLLATSSGPDEGKSTTIA
A0A3D0CW09      QGRAALITLTDPRSPVS--EAYRSLRTNLEF---ASLTGPLRSLVITSPGPGEGKSTMLA
A0A7C3BAP7      D----LITVTDPRSPVA--EAYRSLRTNLEF---SSLDHPLHTLLVTSPGPDEGKSTTLA
A0A524ATQ3      NQLDHLITVADPRSPVS--EAYRTLRTNLDF---SSLDKPIKTMLVTSTGPDEGKSTVLA
A0A399ZSS8      -MTNSLITISNPRSPIA--EAYRTLRTNLEF---SNLDKTLRTLLVTSAGAEEGKSTMLA
A0A521ID76      -MSNTLITISNPRSPIA--EAYRTLRTNLEF---SNLDKSLRSLLVTSAGAEEGKSTTLA
A0A3C0ZZ70      NRQESLITISNPRSPIS--EAYRTLRTNLEF---SSLDKPLRTMVVTSAGPEEGKSTTLA
A0A535ICD6      NRPSALVTLTNPRSPIS--EAYRTLRTNIEF---SSFEKKLHTLVVTSASPEEGKSTTLA
A0A3M1DIE1      TQKPRLITLTDPRSPAA--EAYRTLRTNLTF---AGLDQPLEALVVTSPAMEEGKSLAVA
A0A7C6XTW0      AQDSGLITIIDPIAPAS--EAYRTLRMNLQF---ASLDKKLNSLLITSPGPGEGKSTTLA
A0A1F8N3P4      SDNPDLVTLSDPLSPIS--EAYRTLRMNLQF---AALDSPLRSLLITSATPGEGKSTTLA
A0A7C3R144      -MAEELITISEPLSPIS--EAYRTLRMNLQY---ASLDRALRSLLITSPGPGEGKSTTLA
A0A524AMJ5      ADDLGLVTITDPLSPIS--EAYRTLRINLQF---ATLGVQLRTLLVTSAGAGEGKSTTLA
A0A7C6XJL5      PTDLDLVTITDPISPAS--EAYRTLRLNLQY---ASLDAPLHTLLITSASPEEGKSTTLA
A0A3M1M4P3      KREIPLVTLTHPRSSAA--EAYRTLRTNLTF---ASLDKPIRSLIVTSAAPGEGKSTTLA
A0A7C1YQY8      -MSHRLITLTDPRSPAA--EAYRALRTNLTF---AALDKPLETLVITSATPGEGKSTTLA
A0A426U8Y8      TTETTLVTLRDPGSAAA--EAYRTLRTNILF---SSLDRPLRTLLVTSTAPNEGKSTTLA
A0A7L5YKW9      QPPALLITVTDPRSXVA--EAYRSLRTNLSF---ANLDQKLRTILVTSAAPEEGKSTVLA
A0A7C3GM47      ---MSLITLTDPRSPVS--EAYRKLRTNLSF---YSLDDPIKTLVVTSAEPNEGKSTTVA
A0A2E0ZA41      ---MDLVTITNPRSPLS--EAFRTLRTNLSF---YSLESPLRSLVVTSPVMGEGKSSTVA
A0A3M1ZY58      EAEKYLITLSDPRSPVS--EAYRTLRTNLSF---YSLDNPLRTLVVTSPAADDGKSTTVA
A0A1V5YJ40      TASDLLVTLSDPRSPIS--EAYRTLRTNLQF---VSLDKPLRTILVTSAGPDEGKSTLIA
A0A7C3A115      NGLDQLVTITHPRSPVA--EAYRALRTSILF---SSLDSPVRSLLVTSTAAEEGKSTTLA
A0A7C4US90      ESHTQLITVQDPRSPIA--EAYRTLRTNLEF---SSLDNPLRTLVVTSAGPEEGKSTTLA
A0A2N5K785      PNLSQLVALRDPRSPAA--EAYRALRTNIQF---SSLDKPLRTILTTSTAPDEGKSTTVA
A0A7C3H8P7      KEQNTLITIAEPRSPIS--EAYRTLRTNLDF---AGLDRSLKTLVVTSAGVGEGKTTTLA
A0A2N2MQC3      VLDNKIVSFFAPSSMVT--EQFRRLRTHIIQ---PNQPNSPKTIVITSTLSGEGKSLIAI
A0A7C4KGM4      ANA-SLYVARHPRSLMA--EAFRTLRANIEL---QNLDNGPLALLITSPDTGDGKTSVAA
A0A3N5RU86      KNKQPFSIADNPRHPVT--EAFRNLRTFIEF---TNRD-KLHTILVTSAGSNDGKTWIAA
A0A536AN01      SRAEDLVVLHEPRSVVA--EAFRSLRTAVLF---SAPGAPPRVILLTSAGVGEGKTFTSL
A0A7C3GC16      -PSDRLITQTAPRAPIS--EAYRVLRTNLSF---SAIDTELRSVLVTSSSPGEGKSTCSA
A0A2M8PN31      SFDKARIVQNNMEPRAA--ESFRSLYSSIRI---SDVGRHSQVILTTSTLPSEGKSFVAT
A0A2N2PFW9      -----------------------------RL---KETGGTRQL--------SEGKSTTAA
A0A351G432      KNQSNVYVQENPRSPAA--EAYRSLRTNIEF---AGIANQTKTIMITSASPQEGKSTTAV
A0A7C5PWI6      --KDKLAVAHTPFSPIA--EAYRLVRTNIQF---MAVDGDARTIMVTSSNLSEGKSTTAA
A0A353H3Y9      ---TPIITVSQPRAPVS--ESFRSLRTNLQF---ASVAAPLKTILVTSPSPEDGKTSVVA
A0A7C4N822      ---ATWTVVGNPASGLP--DG--QTRHVVVD---PTSPPGRRTLLVTSASPAEGKSTVAA
                                                                     **:    

A0A7C4LA78      NLGLIMA-QGGKRVVLLDADLRRPSLHRILGIPNR-DGLSDLFRG----HLQAADVT---
A0A1Y6K3L6      NLAVIIA-GSNKKVLLLDADLRRPNVHQRLMIPNR-VGLSDLIRG----RLEINDVI---
A0A7C3NDS4      NLALVLT-QAEKRVILMDADLRAPSIHYYLDIPEN-RGLSDVFLN----RISPLDGL---
A0A0M8JPC7      NLAVSFS-QGGKRVILVDGDLRKPSLHEFFDISDR-RGLTDVLQG----KLSVEKAL---
A0A1F8PQP8      NLAIVIA-QSGKRVILMDADMRRPNVHRVLSLTNQ-KGLSDVFRG----TIDIYNAT---
A0A7C4K8H9      NLAIVIA-QSGKRVILVDADLRRPSIHRYLGITNQ-RGLSDVFRG----NLDIYNAT---
A0A1F8QKW6      NLAMTYA-LSGKKVFLLDADLRRPSLHTYLDLPNA-KGLTTLLLH----PEKSIQQC---
A0A356DVN8      NLAIVEA-QSGKAVVIVDADMRRPKVHLQFSKPNR-MGLSDVVTG----KLGIDDVL---
A0A7C1YUD4      QLGLAFV-GGGRRVIMVDADLRKPSLHTLFDLPDP-FGLAELLAG----DVPLDGSAWPR
A0A1F3AZM3      NLAAIMA-QGGKRVVLVDADLRRPKIHRFLGLSNK-VGLSDLFRG----VVAVRMVS---
A0A7C3PVB7      NLALSLA-LSGQKTILIDSDLRRPAVHAALGVEKE-PGLSDVIRN----KMKPADVV---
A0A350FYF2      NLAISIS-HGEQDVVLVDADLRRPAIHNVLNITKN-PGLSDVIRN----KTDIDSVV---
A0A363U3C3      NLALSIS-HEEQDIIIVDADLRRPAIHNALKVPKN-PGLSDILRN----KADVKSVV---
A0A3M1MN85      GLAISLA-QAGYRVILVDADLRAPSLHTMLGLPQK-PGLSDVLQG----KIPLAESI---
A0A5N9DUL0      NLAVAIA-QTGKKVLIVDGDLRRPTLHRRFKNITRDTGLSNYLSD----NTETLGAV---
A0A2W6B4S3      NLACAFA-ESGKSVILVDLDLRRPSLSKIVNTPMR--GLTNVLLD----QASSLESY---
A0A2E6YFL8      NLGASLA-QNGKKVIILDADLRKPTIHRRFNLKKREPGLSTFLSD----KDLTPSEI---
A0A5N9B1G6      NLGASLA-QNGKKVIILDADLRKPTIHRRFNLKKREPGLSTFLSD----KDLTPSEI---
A0A0S7BVT9      NLSISFV-EIGKKVILIDADLRKPMLSSYLGENPADAKGLSTVLT----GCDLYASI---
A0A521JNM5      NLATSLA-ECGKKVIFIDADLRRSVIIGRYKPDQAVVGLTHYLSG----QNK-IDEI---
A0A7C4N8X2      NLAIVME-QAGREVILLDADLRRPRVHRLFRQ-TDHTSLAEVLLG----DCERWPCA---
A0A521JGZ9      NMATSFV-DNGKRVVLIDADLRKSVLIGRYKVGKVENGLTHYLSG----QNE-LEDI---
A0A3N5NV84      NLGVVVA-QAGKSVILVDADLRRSSLHRFFAL-PSKEGLTNVLVQ----DELAVDGW---
A0A3M1E8I5      NLGVIMA-QADLRTIVVDADLRRPSLHKIFQV-PNAGGLTDLLRS----PEMELADQ---
A0A4P5V2S0      CLGIAFA-QAGMRVVIVDADLRRPAQHLRFNL-PNGDGLSNLFSG----ATP-RTPT---
A0A3B9YZ03      CLGIAFA-QAGMRVVIVDADLRRPAQHLRFNL-PNSDGLSNLFGG----ATP-RTPT---
A0A3L7X1Q5      CLGIAFA-QAGMRVVIVDADLRRPAQHLRFNL-PNSDGLSNLFGG----ATP-RTPT---
A0A2M8PT60      NMAVTFA-QGGNKTILVDCDLRRPSQHEIWDV-ENERGLTTMILE----DAAISSPP---
A0A3M1QI99      NMAVTFA-QGGNKTILVDCDLRRPSQHEIWDV-ENERGLTTMILE----DAAISSPP---
A0A3M1YX52      NLAVTFA-QAGHKTIIVDSDLRKPAQHEIWGV-ANERGLTSMMLE----DTALAEPP---
A0A536CYF7      NLAIALA-QGGRRVIVVDADLRRPGQHTLFGLESQQEGLANVLLG----EYPHLP-----
A0A3N5PDS6      NLAVVIA-QGGKRVVLVDADLRRPAVHRLFGM-PNRGGLTDALVE----EPAALNSF---
A0A7C3HD02      NLAVVWA-QAGKRVILIDADLRRPAVHKMFGL-PNRKGLTTLLVA----ESGPLSSH---
A0A7C5LK09      NLAVSIA-QTERRVLVVDADLRRPSLHEIFGL-PNDRGLTTLLGA----PDALANPP---
A0A3L7VU47      NLAITMA-QAEQRVILVDCDLRRPALHSLFGV-SNDTGLTSMLFA----NAG-DAPP---
A0A2W4MA80      NLAVTIA-QAEQRVILVDCDLRRPSLHTLFDL-SNESGLTNMILA----SED-TPPP---
A0A2A6RLU6      NLAVTMA-QAEQRVLVVDCDLRRPSLHTLFGL-PNEQGLTSAILA----QND-DLPP---
A0A2H3KNY1      NLAVTMA-QAEQRVLMVDCDLRRPSLHTIFGV-PNERGLTSAVLA----QDD-GPLP---
A0A532U8U9      NLAVTLA-RAEKEVILVDCDLRRPSQHEIFGV-HNGVGLTTMVVD----DEAMADPP---
A0A160T936      NLAVTMA-QSGRRTVLVDCDLRRPTLHELFGL-AMTPGLTSLALD----ETV--DLP---
A0A3D0US14      NLAVTIA-QGGRKTILVDCDLRRPTLHTLFDL-KPEPGLTNLLLE----ENG--QPA---
A0A6L3EZ29      NLAVTMA-QGGNRTILVDCDLRRPSLHALFNL-QPEPGFTNAILE----ENG--RPS---
A0A7C3DHD1      NLAVTMA-QSGRKTVLVDCDLRRPSLHTIFGL-NQEPGLTNMALE----DMD--KPP---
A0A3M1EV88      NLAVTMA-QAGKQVILVDCDLRRPSLHEIFGV-SNTTGLTSVILD----DTT-SAPP---
A0A7C2CD94      NLAVAMA-QAEQRVILVDCDLRRPVQHELFGL-ANRAGLTNLFLE----EGD-PQPL---
A0A3D0CW09      NLAVTMA-QAGKKTIVVDTDLRRPSQHELFGL-DQEPGVTTMFMD----PALQSAPP---
A0A7C3BAP7      NLAVTTA-QTGRRVIVVDCDLRRPRQHEIFGV-SNGTGLTTMVRD----EAALTRPP---
A0A524ATQ3      NLAVATA-QTGRKVILVDCDLRRPALHNVFNL-KKDVGLTTMVVD----DAAMESPP---
A0A399ZSS8      NLAVTIA-QSGKRVILVDADLRRPTQRQIFGL-KDNAGLTDMARD----DAARAQPP---
A0A521ID76      NLAVTIA-QSGKRVILVDADLRRPTLHQIFGL-KNNAGLTDMVRD----DAALANPP---
A0A3C0ZZ70      NLAVTLA-QAEKKVILVDCDLRRPSQHEIFEV-ENGVGLTTMVVD----EEAFKNPP---
A0A535ICD6      NLAVTMA-QAGKRVILVDCDLRKPSQHLAFGL-RNERGLTSLMVP----DADLNNPP---
A0A3M1DIE1      NLAVTMA-QGERRTILVDADLRRPRLHAIFGV-SNDRGLTTMFVE----PAAMANPP---
A0A7C6XTW0      NLAVTMA-QVDQRVIMVDCDLRRPHLHDVFGL-SNDMGLTTMMLE----DSALDNPP---
A0A1F8N3P4      NLAVTMA-QVDQRVIMVDCDLRRPCLHTFFGL-PNNVGLTNMMLE----DQALDDPP---
A0A7C3R144      NLAVTMA-EAEQRVIMVDADLRKPCLHQFFGL-SNNVGLTTMMVD----EQALGTPP---
A0A524AMJ5      NLAVIVA-QTEQSVVVVDCDLRRPGLHKLFGL-SNELGLTTMMAD----DHALDEPP---
A0A7C6XJL5      NLAVTMA-QAEQRIIMVDCDLRRPHLHELFRQ-HNDVGLTTMMLE----DEALSDPP---
A0A3M1M4P3      NLAVTMA-QGDRRTILVDADLRRPSLHRIFGL-PNEPGLTTMFVD----EASRTDPP---
A0A7C1YQY8      NLAVTMA-QGERRTIMVDADLRRPSLHEIFGV-SNGRGLTTMFVE----PEALENPP---
A0A426U8Y8      NLAVTMA-QAEQRVLLVDCDLRRPSLHTLFGL-SNEQGLTNAILA----Q-GDELPP---
A0A7L5YKW9      NLAIVEA-QAGRQVIIVDADLRRPRQHELFGL-VNSQGLTTMLAE----ENGLQQPP---
A0A7C3GM47      NLAVTMA-QAGNKTIVVDCDLRKPSLHTLFDL-PNDKGFTDLMLS----DAD-ELPL---
A0A2E0ZA41      NLAVTMA-QSGRKTVLVDCDLRRPSLHTLFDR-QVEPGFTDAILH----NDE---PV---
A0A3M1ZY58      NLAVTMA-QSGRKTILVDCDLRRPSLHTFFGL-PAEPGLTNMLLD----DDE---PP---
A0A1V5YJ40      NLAIAMA-QGERKVILVDCDLRRPSLHKLFGL-GSREGLTSMMVA----EGGSAEPP---
A0A7C3A115      NLGVTFA-QAGHEVILVDSDLRRPSLHRLFDL-PNEYGLTTALLS----ET--AGPV---
A0A7C4US90      NLAVTMA-EAGRQTILVDCDLRRPRLHTFFGL-DNSRGLTTMMVD----EGAMKDPP---
A0A2N5K785      NLAITIA-QSEQRVILVDCDLRRPTLHTLFGL-PNEEGLTSLMLQ----EG--GRVP---
A0A7C3H8P7      NLAVVSA-QAGRRVILVDADLRRPTLHQLFGL-PNETGLTTMMRD----EEVLAAPP---
A0A2N2MQC3      NLAIIIAVEMQSHALLVDCDIRNPSIARLFGL-KDTKGLSNYLLG----EAE-IPDL---
A0A7C4KGM4      NLAVSFS-QGGKKVILVDGDLRKPSLHEFFEI-SDRRGLTDILQG----KLS-VEKA---
A0A3N5RU86      NLAISMA-REGKRVVLIDADLRNPSLHQFFHE-ERENGLTDLFQG----KQA-VTDV---
A0A536AN01      NLATTLA-DSGSRVLLIDADLRRAGCHRAFGI-VNERGLSSFLSG----QVT-LAEA---
A0A7C3GC16      NTAVVMA-QTGHKVILIDADLRKPTQHRIFET-NNNHGLTTALLD----SSTPVAAH---
A0A2M8PN31      NLAYTFA-SHGERTLLIDGDLRMPAIAQSLQM-EDEVKAHGGGLVGYFEGSTSWENM---
A0A2N2PFW9      NLAVVMA-QTGQRVVLVDTDLRRPVMHKVFGA-ANNTGLTSALLNG---DQVVLDGH---
A0A351G432      NLASILV-QGGKKVVLLDADLRRPFIHRFYKF-SNRVGLSEYFRG----EVSLESTF---
A0A7C5PWI6      NLAIVMA-QAELKTILIDADLRRPSVHKVFQL-PNAQGLTDLLRS----PQYEIGDQ---
A0A353H3Y9      NLANVVS-QNNRKVLVIDGDLRKPRIHKIFQL-PNRIGLTDYFLH----AQERLNGV---
A0A7C4N822      NLAVVMA-QAGLKVVLVDCDLRRPTVNKQFDM-PNRFGLTDLMLQ----DPGQWNGV---
                  .           ..:* *:* .                                    

A0A7C4LA78      -RPWR-KDNVTAVTSGTLPPNPTELLGSKRMDQILADLKEI--AD--VVIIDAPPFFVT-
A0A1Y6K3L6      -QFSTEIPYLNLITSGSLPPNPAELLGTQKMLSILEDLRAK--FD--MIVIDTPPAIVT-
A0A7C3NDS4      -VTWDKDPNLRILPAGSIPPNSAELLGSRKMDQILDELSAE--AD--ILVIDGPPAFVV-
A0A0M8JPC7      -RTWD-GGGLRLITVGDEAVLPDLLLTAEKVENLLCELKPL--AD--IILIDSSPFLVS-
A0A1F8PQP8      -IPYK-EGNIFIVPSGSPPPNPAELLSSKKMDQILESLKKV--AD--VVIVDGPPFLVT-
A0A7C4K8H9      -VPYK-EGNIFVIPSGTPPPNPSELLGSKKMDQIFEALKKV--AD--IVVVDGPPFLVT-
A0A1F8QKW6      -AQSLPIGNLSVITAGNSVENPSDLIGSQRMKDILLELSER--SD--YLIVDGPPVLVT-
A0A356DVN8      -KTYDQVENLSIITCGTIPPNPAELLGSERMSQTLKDLKMR--FD--VIILDTPPMIVS-
A0A7C1YUD4      GVQETGVEGLYLLPAGKPPLDPSRLLTSPRLHELLDFLKRQ--AD--VIVIDSPPELAAP
A0A1F3AZM3      -QQVQDVETVSVLTSGSLPPNPTELLASVRMEQILQEAEQD--AD--IVIIDSPPSLVA-
A0A7C3PVB7      -KSMN-GSKIDVITAGNVPPNVTEVVGSKRIAEILNGMKDD--FE--TIIVDAPPLVIS-
A0A350FYF2      -RYWK-EDGLKVITAGDIPPNITEVVGSKRIASILEELKEK--HE--IVVIDAPPLIIA-
A0A363U3C3      -KSWKDDDGIKVLTAGNIPPNVTEVVGSKRIAMILSGLEKE--YE--LVIVDAPPLIIS-
A0A3M1MN85      -IMLENL-GIDLLTSGDIPDQSTELLASRAMQTTMAQLGQS--YD--VVVLDGPP-FAVP
A0A5N9DUL0      -TQTSGVSGVDVITSGPIPPNPSELLDSPRMKDGIEKAKDI--YD--IILVDCPPVLMVA
A0A2W6B4S3      -LVAGALPNLRVLPSGPTPPSPAELISSLRMAQVIQRLQTMA--D--IIIIDSPPILAAA
A0A2E6YFL8      -IMNPGIPNLDIIPSGPVPPNPSELLGTERMKNLCNDLHSKLNYD--YVLLDSPPILVVA
A0A5N9B1G6      -IMNPGIPNLDIIPSGPVPPNPSELLGTERMKNLCNDLHSKLNYD--YVLLDSPPILVVA
A0A0S7BVT9      -LHTKF--HFDFLPAGLIPPNPVELLGSRQMGEILCELRNE--YD--FIVIDTPPVSLLT
A0A521JNM5      -LYETNIDNLDIIFTGPVPPNPSELLASDNFSDLIKIFRKV--YD--YIIIDTPPIGSVI
A0A7C4N8X2      -LMPTALERLMTVPAGCPPPNPSELLGARRMREFIQFLTQR--GD--IVIIDSPPLLPVT
A0A521JGZ9      -IYQTDIQNMDIVFCGSYSPNPAELLSNVRFENMINKLREK--YD--YVIIDTPPLGSVI
A0A3N5NV84      -LQETGIDNLRVLTSGPLPPDPADLLGSKRMHHLIECLEHE--AD--LIIFDTPPTIPVS
A0A3M1E8I5      -LKRTEFENLQIITSGPLPPNAAELLGSQRMGHILKQLTGM--AD--IVIFDTPPVLSVT
A0A4P5V2S0      -LQPTAVPNLHVLTSGTEPESPADILASSDLDRIMDHAGRD--AD--LVLIDCPPICAVA
A0A3B9YZ03      -LQPTAVPNLHVLTSGTEPESPADILASSDLDHIMDHAGRD--AD--LVLIDCPPICAVA
A0A3L7X1Q5      -LQPTAVPNLHVLTSGTEPESPADILASSDLDRIMDHAGRD--AD--LVLIDCPPICAVA
A0A2M8PT60      -LVETEVDNLQLLPSGPVPSNPADIISSQRMNEVIGVLKAR--AN--YVLFDSPPVLAAT
A0A3M1QI99      -LVETEVDNLQLLPSGPVPSNPADIISSQRMNEVIGVLKAR--AN--YVLFDSPPVLAAT
A0A3M1YX52      -LIKTEVEHLQVLPSGPLPPNPADLLSSQRMQEVIGILKAR--AA--YVLFDSPPVLAAT
A0A536CYF7      -LQDTAAPGVRLLTSGTATADPLEALGSRRFDHVLALARAQ--AD--FVLVDTPPAGALA
A0A3N5PDS6      -LRDTAVENLRVLTSGPIPPNPQELLGSQRMEDLLQRLQGE--AD--VVLVDTPPSLVVA
A0A7C3HD02      -LQKTSLSTLQLLTSGPIPPNPQELLGSQRMEDLLRVLERR--AD--IVILDTPPCLVVA
A0A7C5LK09      -FQATPVAGLSVLTSGPLPPRPADLISSRRMEEMVAWLAEQ--AD--LVLFDAPPINVVA
A0A3L7VU47      -LQATSVPGLQLLASGPLPPRPADILGSRRMGEILQALRGL--AD--VIIIDTPPVLAVS
A0A2W4MA80      -LQETGVPGLSLLASGPLPPRPADILGSRRMEQIIARLSGM--AD--MVLFDTPPVIAVT
A0A2A6RLU6      -AQATVVPGLKVLTSGPLPPRPADLLGSRRMAAMIERMSAN--AD--IVLFDTPPVVAVT
A0A2H3KNY1      -IQPTSVPGLHVLTSGPLPPRPADLLGSRRMGALIERMRSE--AE--IVLFDTPPVVAVT
A0A532U8U9      -LQETSVSGLWLLPSGPLPPNPSELVGSRRMKEIIAVLSQR--AD--IVLFDAPPIIAVT
A0A160T936      -LQETSVENLWLLSSGPKPPNPADLLGAARMGRLIDQLLER--AD--FVLFDAPPVMAAA
A0A3D0US14      -LQPTMVDGLQLLSSGPLPPNPADLLGSHKIDQIIATLLER--AD--IILFDAPPVIAVT
A0A6L3EZ29      -LQQTSIDNLSLLSAGTLPPNPADLLGSKKVDQIINTLAEQ--AD--IVLFDAPPVIAVT
A0A7C3DHD1      -LQETEVENLWLLAAGKQPPNPADLLGSQKVDQIIAALQET--AD--ILLFDAPPVIAVA
A0A3M1EV88      -LRETGVPGLKLLTSGPLPPNPAELLGSRRMADLIRALREQ--AD--IVLFDAPPVIAVT
A0A7C2CD94      -LQETPQPGLWVLTSGPLPPNPAELVGSRKMERIIEALKSS--AD--IVLFDTPPVLAVT
A0A3D0CW09      -LQATEIEGLWLLASGPKPPNPAELLAAPQLRTIIEALTAR--AD--IVLFDAPPVVVVT
A0A7C3BAP7      -LQKTQVAGLWVLPSGPLPPNPAELLASQRMSQVIERLMQS--AD--LVLFDAPPVIAVT
A0A524ATQ3      -LQDTGVEGLQIVSSGPLPPNPSELLGSRRMEEIIAALLER--AD--VVLFDAPPVVAVT
A0A399ZSS8      -LQDSGVPNLQVLTSGQLPPNPAEILGSKRMSEILAALLEQ--SD--IVLLDAPPVLAVT
A0A521ID76      -LQETTVANLQVLTSGQQPPNPAEILGSKRMSEILTALLER--TD--MVLFDAPPVLVVT
A0A3C0ZZ70      -LQETPVPNLKLLPSGPLPPNPSELLGSRRMEEIIATLRER--AD--LVLFDAPPIIAVT
A0A535ICD6      -LQTTAQDSLLLLTAGPLPPNPSEMIGSKRMQEVINALKSR--AE--MVIFDAPPILAVT
A0A3M1DIE1      -LVDVGVENLWLLPSGPLPPNPADLLGSRRMDEVLAALRAR--AD--ILLFDAPPVIEVT
A0A7C6XTW0      -LQETSIKGLRLLASGALPPRPSDLLGSQRMEKVLQRLLDD--AD--ILLLDAPPLLAVT
A0A1F8N3P4      -LQSTRVPGLHLLASGNLPPRPPDLLGSERLERVIERLLAE--AD--ILIFDAPPVIAVP
A0A7C3R144      -LQATPIKGLQLLASGPLPPRPADLLGSKRMEKVIERLLAE--AD--VLLFDAPPVILVT
A0A524AMJ5      -LQPTEVDGLRLLASGPLPARPPDLLGSRRMDRVIEKLLGE--AD--LVILDAPPIMAAT
A0A7C6XJL5      -LLETPVPGLRLLASGPLPPRPADLLGSQRMERVLERLTAE--AD--MVLLDAPPLMTVT
A0A3M1M4P3      -LLETGVEHLWLLPSGPLPPNPADLLGSRPMEEIIASLLER--AD--FLLFDAPPVIAVT
A0A7C1YQY8      -LAETGVEGLLLLPSGPLPPNPADLLGSRRMEEVIATLRKR--AD--ILLLDAPPVVAVT
A0A426U8Y8      -LQATAVPGLSVLTSGPLPPRPADLLGSRRMAALIERLSAN--VD--MLLFDTPPVVAVT
A0A7L5YKW9      -LQATAVPGLQVLTSGXQPPLPAEMLASERMGRAIAALAAR---D--LVLFDAPPVVAVT
A0A7C3GM47      -QKIAAVDNLFVLTSGEIPPNPADILGSKKVTGIIERLVNS--AD--IVLFDAPPVIAVT
A0A2E0ZA41      -LQETAVENLWLLTAGTKPPNPADILGTPQVDQLIARLQEK--AD--IILFDAPPVNAVT
A0A3M1ZY58      -LQETGVENLWLLASGPKPPNPADLLGARKVDRVIERLKEM--AD--VILFDAPPVVAVT
A0A1V5YJ40      -LQETGVPGLTLLASGPLPPSPSDLLGSRRMDAVLATLKER--AD--VVLLDSPPVVAVS
A0A7C3A115      -LQPTPVERLRVLTSGPLPPNPAELLSSRRCARLIAELRDR--AE--FVFFDCPPIVAVT
A0A7C4US90      -LLATGVENLWLLPSGALPPNPADMLATRRMVEVIEALKAR--AD--MVLFDAPPVIAVT
A0A2N5K785      -LQKTEVPGLMVLTSGPLPPRPADILGSRRMEAVIAQLREH--AD--IVLFDTPPVNAVT
A0A7C3H8P7      -LQATGVEGLSVLTSGPLPPNPADLMGSRRMEEVIAALAER--AD--QVLFDTPPVVAVT
A0A2N2MQC3      -LIKTSVDKLSLIAGGPLQENPVELIGSERMKNLIQELKTR--YKDRYIILDCSPLLATT
A0A7C4KGM4      -LRQWDGGGLRLITVGDEAVLPDLLLTAEKVENLLGELKPL--AD--IILIDSSPFL-VS
A0A3N5RU86      -LKYNNKERVGLITAGELPQNTYELMNIKMMERILMELMDA--VD--TVIIDSPPFF-IA
A0A536AN01      -IRVLDAPKLSFIPAGPTPPNPAELVGSSRMRDTLEQLRDE--YD--FVIIDSPPTLPVT
A0A7C3GC16      -LQATRTPGLRLMASGPLPPNPAELLNSKRMRDVLAELLED--AD--FVIVDTPPVLTVA
A0A2M8PN31      -IVNEIAHNLDMLASVKNASVPSEIANSSHFIDIINVLRQT--YD--RIIVDTPPIGVVS
A0A2N2PFW9      -LQGTEVENLSLLTSGPIPPNPSELLGSHRMARLVEKLVGQ--AD--LVIFDSPPVLAVT
A0A351G432      -NYVDPSRRLIAIPSGKLPPNPAELLGTEQMSALLQQLELI--SD--YIIIDSPPLV-VT
A0A7C5PWI6      -LKRTEFENLQVITSGPLPPNPSEMLGSQRMADLLQQLQEI--AD--VVIFDTPPVLAVS
A0A353H3Y9      -IKKTEIKSLFVITSGNLPPNPSELLGSERMQEVVETLSSH--FD--PIFIDTPPLLAVT
A0A7C4N822      -LQPSGLNNLHVVFSGSVPPNPSELLGSKRMHQLIEHLHHQ--AD--VVILDAPPLLPVT
                         .  :                                   :..* .*     

A0A7C4LA78      DAWVLASKVDGVLLVIQANHARRNIVRSMLEQIR-RVNAPIIGAVINRMA----HTRGAY
A0A1Y6K3L6      DAQILASKTDGVIYVIRPGKTRSLVARTPLEEFE-RLGANVIGVVMNRIP----HNRGYY
A0A7C3NDS4      DSLVLSAKADGVLIVVNSGETHRSALATVSEQLK-RLGANLVGVVLNRVP----RSAAYY
A0A0M8JPC7      DAMIFAAKVDGVITVIRPGYTSREMARVMKERIA-MAGGKIIGVVLNRIP----LKRIGY
A0A1F8PQP8      DAQILASKVDGVLLVVRYGFSRKNAAISAVQQLK-RADARAIGVVMNRIP----RTASGY
A0A7C4K8H9      DATILANKVDGVLLVVRYGFTRKNAALNAVKQMR-RIGARAIGVVLNRIP----RSTSGY
A0A1F8QKW6      DSTILSTAVDEVLIVVGYGLTRRSEAAVALKRLE-SAGAKIGGVILNRIP----RNNRAY
A0A356DVN8      DAQILSSKVDGLVYVVIPGQTRAITAMRPLEELR-RIESKVLGVVANKIP----RNRDYY
A0A7C1YUD4      DASVLASVADGTVLVVSAGKTSLGKIQKTRERLESREGVKLLGVTFNQVK----------
A0A1F3AZM3      DVQVLAGKVDGVILIIHPGHTQEDASLATLEMLN-RAGARTLGVVLNRIP----RGRSDY
A0A7C3PVB7      DSYTLASKVDGVILVLEPGQTREEQAKVIKEQLN-RAGARVIGVVFNRVT----ETNAKS
A0A350FYF2      DSYNLASKVDGVILIMEPGQTSEEQAMTIKEQLD-RSNAHLLGIVFNKIS----EQSAHS
A0A363U3C3      DAYNLASKVDGVILVMEPGQTTEAQARTIKEQLD-RSGARVLGIVFNKVT----EEMAHS
A0A3M1MN85      DAVVLARRVEGMLWVIRVGYSRRTAVKYMQEQIE-QTLVNVLGVVINCGR----GPRA--
A0A5N9DUL0      DTPIISTVVDMAILVVDSFTTKTSSFGATVETLN-NSGVEIAGVIMNKLK----KPKFGY
A0A2W6B4S3      DAAITAGLCDSAVLLVRPDRITRRGLTRAVETLN-GVGVRVIGMVVNGVP----RTDA--
A0A2E6YFL8      DGSVLASIATAGILIVDGFSTKIGSLQSAVNTLN-GTAIETLGIIVNKLK----NSRFSY
A0A5N9B1G6      DGSVLASIATAGILIVDGFSTKIGSLQSAVNTLN-GTAIETLGIIVNKLK----NSRFSY
A0A0S7BVT9      DAVTLCQFVDGIIFVIRQKTASIDQIKFAMKKLE-SVKANVIGAILNDYVVPK-DSSQSK
A0A521JNM5      DSAIVAQKCDGVVLVIESNTVSYKFAQRAIRQLE-KSQSKILGAVLNKYE----NEGRLY
A0A7C4N8X2      DALVLAPEVDGVLLVVRHGHTHLKSAQLALTQLQ-QAGARVLGVVLNQVPIGQRSYGYHY
A0A521JGZ9      DSAIVARVVDGVIIVIEANAISYRFAQNVKEQLE-KADCRILGVVMNKVPMD--KKKYYG
A0A3N5NV84      DATVLALEADAVLLVVEAGRTRRGAIRRTMEDLQ-RAGAHVLGAVLNRVT----SRPSKG
A0A3M1E8I5      DATVLAGRVDGVVLVIQAKRTRRDAARHAVQRLQ-QVGATILGAVLNQSG----KGSGYY
A0A4P5V2S0      DASVLSTRVDGVIVVVGAGVVKRDLARHARAQLD-AVRANVIGLVVTNAPY---NERTFA
A0A3B9YZ03      DASVLSTRVDGVIVVVGAGVVKRDLARHARAQLD-AVRANVIGLVVTNAPY---NERTFA
A0A3L7X1Q5      DASVLSTRVDGVIVVVGAGVVKRDLARHARAQLD-AVRANVIGLVVTNAPY---NERTFA
A0A2M8PT60      DAALLASKTDGVLLVIRAGHTRRDQAARARQALE-RVHVRIVGAVLSNAP----REDS-G
A0A3M1QI99      DAALLASKTDGVLLVIRAGHTRRDQAARARQALE-RVHVRIVGAVLSNAP----REDS-G
A0A3M1YX52      DAAVLGVKLDGALLVVQAGNTRRDHTARARDALE-RVHVRLIGAVLTNAD----RETA-G
A0A536CYF7      DAAVLAPRLEGMLLVVSAGRTKRDMARRAREQLE-RVNANLLGVVLTDV-----RGDDKL
A0A3N5PDS6      DANVLAARTDGVLLVVNADRTRRVAVQQAAEGLR-QVGANLVGGVLNMVDIRRGRGAGYY
A0A7C3HD02      DANVLASRTDGVLLVVDTGHTRRAAIYQAVEGLQ-NVNARILGAVLNMVDTRRGRG---Y
A0A7C5LK09      DGLVLATRTDGVLLVVRERRTQREAVRQAMASLS-RVNARVLGAVLSGVS----LDRTLA
A0A3L7VU47      DAVVLAPRIDGVILVMQAGRTRREPAKQARIVLE-KAKAHIVGVVLNDAE----MTQS-S
A0A2W4MA80      DAAVLATRVDGVLLVFQAGKTSRDRARRTREVLE-KVKANIVGVVLNGAE----LEQG-Y
A0A2A6RLU6      DAAALAPRVDGVLLVLHAGHTRRDRAREARQLLE-KVKANIVGVVLNGAK----QERG-Y
A0A2H3KNY1      DAATLAPRVDGVLLVLHAGQTRRDRAREARRLLE-QVKANIVGVVLNGAK----VERG-Y
A0A532U8U9      DAAVLSSEVDGVLMVINAGGTKRDHAQKAKALLD-KVNAHLVGAVLNNVK----IDTSLH
A0A160T936      DAAILGAKVDGVLLVIQAGKTRRDHSERARELLE-KANVRIIGATLTNAP----QDRSMR
A0A3D0US14      DATVLGAKVDGVLLVISAGKTRREHAERAKEMLE-KANVRIFGAALTNAP----KDSSIG
A0A6L3EZ29      DAAVLGAKVDGVLLIINAGKTKRDHAERAKDTLE-KAKVRIVGATLTNAQ----RDSVVG
A0A7C3DHD1      DAVILGAKVDGVLLIIQAGKTRREHAERAKATLE-TANVRIVGAALTNAP----KDQAMG
A0A3M1EV88      DAAILASQVDGVLLVLNAGVTRREHAQRAKAALE-KVNARLIGTVLNNVK----LDTSLY
A0A7C2CD94      DAAVLATKLDAAILVVRAGKSKRDLARKARDTLL-KVNARLLGVVLNDVP----FDTAIF
A0A3D0CW09      DAAVLASQVDGVLLVIQAGKTKRDQAAQAKTLLD-QVRARLVGTALTNVK----LDPKLQ
A0A7C3BAP7      DAAVLASKLDGVLLVINAGSTKRQYALRAKEILE-RVNARLIGAVLNNVV----LDKTLH
A0A524ATQ3      DAAVLATKVDGVLLVINAGGTKRDYARVAKARLE-KVNANLLGAVLNNVR----FDVSLH
A0A399ZSS8      DAAVLSGKVDGVLLVVSAGKTKRENAKKAQAQLE-KINARIIGVVVNNVQ----AEKGAS
A0A521ID76      DAAVLSSKVDGVLLVISAGKTKRENARKAQSQLE-KINARVIGAVLNNVK----AESGAS
A0A3C0ZZ70      DAAVLASKVDGVLLVINAGTTKRDHAQRAKALLE-KVNARLVGAVLNNVR----MDISLH
A0A535ICD6      DAAVLASKVDGVILVVNAGGTKREHMQKAHALLK-KVNAPLIGAVLNNVK----FDNSLH
A0A3M1DIE1      DAAVLGRKADGILLVMTTGRTRRDHALRAKEVLE-RAHVRLVGVVLTDVS----VSRA-H
A0A7C6XTW0      DAVVLSAKVDGVLLVVSAGETRREHVQQGIERLT-KVNANILGSVLNNAP----LNSALH
A0A1F8N3P4      DAVVLSTKVDGVVLVLNAGETKREHAQHAVERLN-RVNVRIVGAVLNNVP----LDATLH
A0A7C3R144      DAVVLATKVSGVLLVVSAGETKREHAQQAVERLN-RVNAHIAGVVLNNVP----LDATLH
A0A524AMJ5      DALVLSTKVDGVLLVASAGTTKREQAQRAVERLN-KVNARLVGAVLTNVP----LDATVR
A0A7C6XJL5      DAVVLATKVDGVLLVVSAGTTKREHAQRAVERLR-KVNAHLVGSVLNNAP----VDATLH
A0A3M1M4P3      DAVVLSTRVDGVLLVVQAGRSRREHVQQAKQLLE-RVQARLVGAVLTNAP----SDSVMG
A0A7C1YQY8      DSAVLGTKVDGVLLVVSSGRTRRDHAQRARELLE-RVHVRVVGAVLTNAP----LDVSLG
A0A426U8Y8      DAAALAPRVDGVLLVLHAGHTRRDRAREARQLLE-KVKANIVGVVLNGAK----LE---R
A0A7L5YKW9      DAAILASQVDGVLLVIHADRXRREHAQRAQQLLE-KVNAHIIGSVLNNAX----PDSGLR
A0A7C3GM47      DAVVLGTKVDGVLLVLQAGKSRRDHAERAKQLLE-QAKVRIVGATLTNAP----KDDAVS
A0A2E0ZA41      DAAVLGAKVDGVLLVLSAGKTRREHAERAKEILE-KARVNIVGATLTNAP----VDSSME
A0A3M1ZY58      DAAVLGAKVDGVLLVISAGKTRREHAERAKELLQ-KAHVRLVGVTLTNAP----KDDAIS
A0A1V5YJ40      DAAVLATKVDGVLLVVSAGHTRREGVQAAKAKLE-KVNANLLGAVLTNAT----MDTSLS
A0A7C3A115      DAAILARQVDGVVLVVSAGRTRREHAARARQLLE-RVQARVLGVVLTNVT----VDASLY
A0A7C4US90      DAAILATRVDGVLLVVSAGITKRDYVLQAKELLE-RVNARVVGVVLTNVS----FDATLH
A0A2N5K785      DAAVLATKVDGVLLVFRAGATRRDRAGEARRLLD-KVNANIVGVVLTDVK----QE---D
A0A7C3H8P7      DAAVLTTKVDGVLLVIGAGKTRRDQARAAVQRLE-QVNARLVGAVLTNAE----MGATFK
A0A2N2MQC3      EPTVLTEMADGILMVIKSGKTPRESVQQALRLLN-KD--KIMGVVLNGMEYR--TKALIQ
A0A7C4KGM4      DAMIFAAKVDGVITVIRPGYTSREMARVMKERIA-MAGGKIIGVVLNRIP----LKRI--
A0A3N5RU86      DSVLLSSLVDSVLAVVRPNHTLKQSALAMIEQIH-RSGGNLTGVVINRIP----FRQL--
A0A536AN01      DAVVLAREADGIVLVVKGHDTPRELVRRARDQLV-NAGAHILGALVNNVDLG--WGDL--
A0A7C3GC16      DAAILAPKVDGCILVAEVGKTKYDILKESSTRLR-ATNAALFGLVLNRSK----AGRAG-
A0A2M8PN31      DAMALVPAVDACLYVVKHKGVKMRSIRDSIRRLR-DVHMPILGAVMNQVD----KVGSGY
A0A2N2PFW9      DAAVMGRQVDGVLLVVDAGQTREQVVAQAAAELQ-KTGANLLGVVLNRLD----SRRGGY
A0A351G432      DPVILATKVDGVLLVIQPGVTRISSVRASIDQLE-RAQARILGIALNNIT------RQNA
A0A7C5PWI6      DAAVLANRVDGVIFVIKAKQTRRKEAQEAHKRLQ-QGNTTVLGSVLNQAS----GKEGGY
A0A353H3Y9      DALVLAPRVDGVILVIDPAKTKRAALQHSIEQLK-QVNANLLGVVLNNVK----ISRS--
A0A7C4N822      DALVLSSLADGVVMVIDYGVTRIGEAVQGKNQLD-QAGARVLGVVMNKIP----TGRRGY
                :           : :                 :         *   .             

A0A7C4LA78      SRYS-----------------------------YLSYYYYSRDEAQAEGGAAGQLPAARP
A0A1Y6K3L6      YGGFEYYS--------------------PNVYGSEKYYVDSHNDQP--------------
A0A7C3NDS4      GAYYNSYYSKDGTKKEKRRKTGTRIWAFPNLSRIGKVFSFRRKPKAKGY------LLTDE
A0A0M8JPC7      YGGYRYY--------------------------LPYGYY---------------------
A0A1F8PQP8      YGYGMYH--------------------------SYPGYYIAEEDG-ATQ------PS---
A0A7C4K8H9      YGYGPYH--------------------------YYPGYYLYEEEEVAAE------KE---
A0A1F8QKW6      YRLYHYDY------------------------GMPA-----------------------E
A0A356DVN8      YGGYNYYS------------------------PYSNHYSYHTESIVPNS------EIDMD
A0A7C1YUD4      ---------------------------------VNGDYYSAYGRVSRRH------KG---
A0A1F3AZM3      YGGYRH---------------------------YSP-YYSGYHYYHSMD------GQDLK
A0A7C3PVB7      YGDYQYLS------------------------MYAPHHYNDYVSGSARE------KELRP
A0A350FYF2      SYDYQYRS------------------------LYSPKYYGDYISKSTNE------PN--T
A0A363U3C3      YYDYRYQS------------------------LYSPKYYGDYISTASRE------PN--T
A0A3M1MN85      -----HY--------------------------YQVYGYHGYYQ-----------DGNGR
A0A5N9DUL0      GYGYNYG--------------------------YYYNYYYYNYKYSLED------TNPES
A0A2W6B4S3      ----------------------------------DYYGYGNYYDYQAPA------ARGDG
A0A2E6YFL8      GYRYPYY--------------------------YNYYYYQSYYQYNEAG------EKTEK
A0A5N9B1G6      GYRYPYY--------------------------YNYYYYQSYYQYNEAG------EKTEK
A0A0S7BVT9      N------------------------------------YYNNYSDYYQHK-----------
A0A521JNM5      G------------------------------------YESKKSKKYIDYYLEN-------
A0A7C4N8X2      G------------------------------------YYYRSYYTDNSPDDRGGGAGRGN
A0A521JGZ9      K------------------------------------YYGKYYGKYYGTYGEEH------
A0A3N5NV84      Y------------------------------------YYYE-------------------
A0A3M1E8I5      Y------------------------------------SYYTQTGARPVKQPRRAPQRRWW
A0A4P5V2S0      S------------------------------------YYEESPGRSAS------------
A0A3B9YZ03      S------------------------------------YYEESPGRSAS------------
A0A3L7X1Q5      S------------------------------------YYEESPGRSAS------------
A0A2M8PT60      E------------------------------------YYGL-------------------
A0A3M1QI99      E------------------------------------YYGL-------------------
A0A3M1YX52      S------------------------------------YYG--------------------
A0A536CYF7      Y------------------------------------RY---------------------
A0A3N5PDS6      S------------------------------------YYGYYSHYYGEEEGERHRGPRGW
A0A7C3HD02      Y------------------------------------YYSYYAHYY--QEDGRDGRPRKW
A0A7C5LK09      Q------------------------------------YYTRHAPARAARRSGTEAGAGAS
A0A3L7VU47      G------------------------------------YYG--------------------
A0A2W4MA80      G------------------------------------YYS--------------------
A0A2A6RLU6      T------------------------------------Y----------------------
A0A2H3KNY1      A------------------------------------Y----------------------
A0A532U8U9      R------------------------------------YYAEQKGG---------------
A0A160T936      E------------------------------------YYG--------------------
A0A3D0US14      G------------------------------------YYD--------------------
A0A6L3EZ29      G------------------------------------YYS--------------------
A0A7C3DHD1      S------------------------------------YYD--------------------
A0A3M1EV88      G------------------------------------YYSAQ------------------
A0A7C2CD94      R------------------------------------EYYADRR----------------
A0A3D0CW09      G------------------------------------YY---------------------
A0A7C3BAP7      T------------------------------------YYT--------------------
A0A524ATQ3      R------------------------------------YYAAQM-----------------
A0A399ZSS8      Y------------------------------------YYAESN-----------------
A0A521ID76      Y------------------------------------YYAEGNS----------------
A0A3C0ZZ70      R------------------------------------YYAEQKQA---------------
A0A535ICD6      K------------------------------------YYGTES-----------------
A0A3M1DIE1      R------------------------------------YY---------------------
A0A7C6XTW0      S------------------------------------YYT--------------------
A0A1F8N3P4      R------------------------------------YYR--------------------
A0A7C3R144      R------------------------------------YYRR-------------------
A0A524AMJ5      A------------------------------------YYA--------------------
A0A7C6XJL5      G------------------------------------YYR--------------------
A0A3M1M4P3      A------------------------------------YYTDEW-----------------
A0A7C1YQY8      G------------------------------------YYR--------------------
A0A426U8Y8      G------------------------------------YAY--------------------
A0A7L5YKW9      G------------------------------------YYK--------------------
A0A7C3GM47      S------------------------------------YYG--------------------
A0A2E0ZA41      A------------------------------------YYG--------------------
A0A3M1ZY58      G------------------------------------YYG--------------------
A0A1V5YJ40      R------------------------------------YYDAREEVSG-------------
A0A7C3A115      Q------------------------------------YYE--------------------
A0A7C4US90      R------------------------------------YYGEG------------------
A0A2N5K785      G------------------------------------YSYYGS-----------------
A0A7C3H8P7      G------------------------------------YVYTGP-----------------
A0A2N2MQC3      R------------------------------------HFGTNRYYHDYHYSKTHPEPDNW
A0A7C4KGM4      G------------------------------------YYGGYRYYLPYGYYEKKKKREED
A0A3N5RU86      K------------------------------------YYLKYPYNSLEKYHLASERMQKE
A0A536AN01      Y------------------------------------YYNRY-YGTYYGRPEAREGLEQH
A0A7C3GC16      -------------------------------------YYQNYYNERYY------------
A0A2M8PN31      YHNYTDK--------------------------NYHKYYGAY------------------
A0A2N2PFW9      Y------------------------------------YYYYY------------------
A0A351G432      Y------------------------------------YYASYYQQEYY------------
A0A7C5PWI6      Y------------------------------------YTYYA------------------
A0A353H3Y9      ---------------------------------------HYYYNRDYYYGKPYGK-----
A0A7C4N822      S------------------------------------YYYYYYNRTYYEGEGTGKRRRGR
                                                                            

A0A7C4LA78      QRALQSVLRSLQKVSGRGPDGADESAAVEGPTNGHVHRVEVLPPASSDPPDSERTRVSLD
A0A1Y6K3L6      FIPIQDIETEPKK-----------------------------------------------
A0A7C3NDS4      LIPSDGLQGEPESCPDGQPLGSDEALELQGNGYGAVAEAEEATLTSLAEIQETAPSEEFA
A0A0M8JPC7      ------------------------------------------------------------
A0A1F8PQP8      ----------------------------------------------------------IT
A0A7C4K8H9      ----------------------------------------------------------ST
A0A1F8QKW6      DTRSIKLGKFHFPMK-------------------------------------------FN
A0A356DVN8      SKKVTPLGSVFEKYQRRDADKQN-------------------------------------
A0A7C1YUD4      --GLWYLLRRRLPFIGRGAEGEEEGFVLSLAEMADYLGVSRATARRWCKSGRLPAFRSWF
A0A1F3AZM3      PSRMRRLFGKLSPFNHNGHKKVEAGVVEENV---------------------------IE
A0A7C3PVB7      PSPTKKLLA----FFERGEVPPDLTESLEGA---------------------------FN
A0A350FYF2      GSRSKKIMD----FFEHGQLPPDMAESVELT---------------------------IT
A0A363U3C3      GSRSRQLMD----FFEHGKVPADVAVEVEHA---------------------------IT
A0A3M1MN85      ERRKPAFRRLVENLRRTK------------------------------------------
A0A5N9DUL0      KSSKNPFRIFRSIF--NR------------------------------------------
A0A2W6B4S3      AKPVAITTDKKNAA--GQ------------------------------------------
A0A2E6YFL8      QEKRSTKSTIKKLFRWSK------------------------------------------
A0A5N9B1G6      QEKRSTKSTIKKLFRWSK------------------------------------------
A0A0S7BVT9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7C4N8X2      GSGRGHSRGHGREGSSGATTHRPDGRSVSRAPAPDRA-----------------------
A0A521JGZ9      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      QIGSTR------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      WRRLRRGKEAGSPRDGVSPAA---------------------------------------
A0A7C3HD02      PRLGRRSDRRGKRSVVKSQSAGR-------------------------------------
A0A7C5LK09      SR----------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A7C2CD94      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A2N2MQC3      EKAALILKDIKMLLLKLIPHKKGER-----------------------------------
A0A7C4KGM4      EDKKVTKKNELNLLRK--------------------------------------------
A0A3N5RU86      PR----------------------------------------------------------
A0A536AN01      A-----------------------------------------------------------
A0A7C3GC16      --SYEYGAGTPKASKKGIFGRLSNPTGN--------------------------------
A0A2M8PN31      --TPQKTQNPKRVSKPKKK-----------------------------------------
A0A2N2PFW9      --YSEEEGGQRRRSASR-------------------------------------------
A0A351G432      --APDEEEARSLN-----------------------------------------------
A0A7C5PWI6      --QTGNAAENTVRSKLRRLWRRLPLVRG--------------------------------
A0A353H3Y9      --AAEESGGSGADTDTTELELQKPALRD--------------------------------
A0A7C4N822      RSRAQSAPGPATSLADSKLEPSNPTGQ---------------------------------
                                                                            

A0A7C4LA78      LLYAISRELATQLDLRELMQRILQMTLDSVGATSGSMIVLDERGEALEGVLIYEGKTTVQ
A0A1Y6K3L6      ------------------------------------------------------------
A0A7C3NDS4      GAIADQKDGSESEEEKLPAAEPSKGAKKSRSGRPRKRAVVIAEEAIEK------------
A0A0M8JPC7      --EKKKKREEDEDKKVPKKSELTFSGK---------------------------------
A0A1F8PQP8      DRLKPPRKSRPKDKSTGDALNLEKTES---------------------------------
A0A7C4K8H9      DKLKRPRKLPPTAEPSPESIGLGKTKG---------------------------------
A0A1F8QKW6      RPVNKKKKPASHDTSDLGDQVASRVDKTI-------------------------------
A0A356DVN8      ------------------------------------------------------------
A0A7C1YUD4      GWRIREEDLRAAMPQIMRNARV--------------------------------------
A0A1F3AZM3      KP----------------------------------------------------------
A0A7C3PVB7      KFQKQRQALRDRFRKVPKQPKE--------------------------------------
A0A350FYF2      AIKTQPKQIVERLRKSKKNG---KNGKDG-------------------------------
A0A363U3C3      AIKTQPRKTMERLRKSKKSGTGRKNGKNG-------------------------------
A0A3M1MN85      ------------------------------------------------------------
A0A5N9DUL0      ------------------------------------------------------------
A0A2W6B4S3      ------------------------------------------------------------
A0A2E6YFL8      ------------------------------------------------------------
A0A5N9B1G6      ------------------------------------------------------------
A0A0S7BVT9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A7C2CD94      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A351G432      ------------------------------------------------------------
A0A7C5PWI6      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A7C4N822      ------------------------------------------------------------
                                                                            

A0A7C4LA78      TAEQLADVVERGLAGWVIENRRPVVLDNTHDDPRWLRRDWDENGAKTPRSAISVPLMAND
A0A1Y6K3L6      ------------------------------------------------------------
A0A7C3NDS4      ------------------------------------------------------------
A0A0M8JPC7      ------------------------------------------------------------
A0A1F8PQP8      ------------------------------------------------------------
A0A7C4K8H9      ------------------------------------------------------------
A0A1F8QKW6      ------------------------------------------------------------
A0A356DVN8      ------------------------------------------------------------
A0A7C1YUD4      ------------------------------------------------------------
A0A1F3AZM3      ------------------------------------------------------------
A0A7C3PVB7      ------------------------------------------------------------
A0A350FYF2      ------------------------------------------------------------
A0A363U3C3      ------------------------------------------------------------
A0A3M1MN85      ------------------------------------------------------------
A0A5N9DUL0      ------------------------------------------------------------
A0A2W6B4S3      ------------------------------------------------------------
A0A2E6YFL8      ------------------------------------------------------------
A0A5N9B1G6      ------------------------------------------------------------
A0A0S7BVT9      ------------------------------------------------------------
A0A521JNM5      ------------------------------------------------------------
A0A7C4N8X2      ------------------------------------------------------------
A0A521JGZ9      ------------------------------------------------------------
A0A3N5NV84      ------------------------------------------------------------
A0A3M1E8I5      ------------------------------------------------------------
A0A4P5V2S0      ------------------------------------------------------------
A0A3B9YZ03      ------------------------------------------------------------
A0A3L7X1Q5      ------------------------------------------------------------
A0A2M8PT60      ------------------------------------------------------------
A0A3M1QI99      ------------------------------------------------------------
A0A3M1YX52      ------------------------------------------------------------
A0A536CYF7      ------------------------------------------------------------
A0A3N5PDS6      ------------------------------------------------------------
A0A7C3HD02      ------------------------------------------------------------
A0A7C5LK09      ------------------------------------------------------------
A0A3L7VU47      ------------------------------------------------------------
A0A2W4MA80      ------------------------------------------------------------
A0A2A6RLU6      ------------------------------------------------------------
A0A2H3KNY1      ------------------------------------------------------------
A0A532U8U9      ------------------------------------------------------------
A0A160T936      ------------------------------------------------------------
A0A3D0US14      ------------------------------------------------------------
A0A6L3EZ29      ------------------------------------------------------------
A0A7C3DHD1      ------------------------------------------------------------
A0A3M1EV88      ------------------------------------------------------------
A0A7C2CD94      ------------------------------------------------------------
A0A3D0CW09      ------------------------------------------------------------
A0A7C3BAP7      ------------------------------------------------------------
A0A524ATQ3      ------------------------------------------------------------
A0A399ZSS8      ------------------------------------------------------------
A0A521ID76      ------------------------------------------------------------
A0A3C0ZZ70      ------------------------------------------------------------
A0A535ICD6      ------------------------------------------------------------
A0A3M1DIE1      ------------------------------------------------------------
A0A7C6XTW0      ------------------------------------------------------------
A0A1F8N3P4      ------------------------------------------------------------
A0A7C3R144      ------------------------------------------------------------
A0A524AMJ5      ------------------------------------------------------------
A0A7C6XJL5      ------------------------------------------------------------
A0A3M1M4P3      ------------------------------------------------------------
A0A7C1YQY8      ------------------------------------------------------------
A0A426U8Y8      ------------------------------------------------------------
A0A7L5YKW9      ------------------------------------------------------------
A0A7C3GM47      ------------------------------------------------------------
A0A2E0ZA41      ------------------------------------------------------------
A0A3M1ZY58      ------------------------------------------------------------
A0A1V5YJ40      ------------------------------------------------------------
A0A7C3A115      ------------------------------------------------------------
A0A7C4US90      ------------------------------------------------------------
A0A2N5K785      ------------------------------------------------------------
A0A7C3H8P7      ------------------------------------------------------------
A0A2N2MQC3      ------------------------------------------------------------
A0A7C4KGM4      ------------------------------------------------------------
A0A3N5RU86      ------------------------------------------------------------
A0A536AN01      ------------------------------------------------------------
A0A7C3GC16      ------------------------------------------------------------
A0A2M8PN31      ------------------------------------------------------------
A0A2N2PFW9      ------------------------------------------------------------
A0A351G432      ------------------------------------------------------------
A0A7C5PWI6      ------------------------------------------------------------
A0A353H3Y9      ------------------------------------------------------------
A0A7C4N822      ------------------------------------------------------------
                                                                            

A0A7C4LA78      RVVGVLTLVHPHAGHFTRDDLSMLTAIAVGISFSSQVYPN
A0A1Y6K3L6      ----------------------------------------
A0A7C3NDS4      ----------------------------------------
A0A0M8JPC7      ----------------------------------------
A0A1F8PQP8      ----------------------------------------
A0A7C4K8H9      ----------------------------------------
A0A1F8QKW6      ----------------------------------------
A0A356DVN8      ----------------------------------------
A0A7C1YUD4      ----------------------------------------
A0A1F3AZM3      ----------------------------------------
A0A7C3PVB7      ----------------------------------------
A0A350FYF2      ----------------------------------------
A0A363U3C3      ----------------------------------------
A0A3M1MN85      ----------------------------------------
A0A5N9DUL0      ----------------------------------------
A0A2W6B4S3      ----------------------------------------
A0A2E6YFL8      ----------------------------------------
A0A5N9B1G6      ----------------------------------------
A0A0S7BVT9      ----------------------------------------
A0A521JNM5      ----------------------------------------
A0A7C4N8X2      ----------------------------------------
A0A521JGZ9      ----------------------------------------
A0A3N5NV84      ----------------------------------------
A0A3M1E8I5      ----------------------------------------
A0A4P5V2S0      ----------------------------------------
A0A3B9YZ03      ----------------------------------------
A0A3L7X1Q5      ----------------------------------------
A0A2M8PT60      ----------------------------------------
A0A3M1QI99      ----------------------------------------
A0A3M1YX52      ----------------------------------------
A0A536CYF7      ----------------------------------------
A0A3N5PDS6      ----------------------------------------
A0A7C3HD02      ----------------------------------------
A0A7C5LK09      ----------------------------------------
A0A3L7VU47      ----------------------------------------
A0A2W4MA80      ----------------------------------------
A0A2A6RLU6      ----------------------------------------
A0A2H3KNY1      ----------------------------------------
A0A532U8U9      ----------------------------------------
A0A160T936      ----------------------------------------
A0A3D0US14      ----------------------------------------
A0A6L3EZ29      ----------------------------------------
A0A7C3DHD1      ----------------------------------------
A0A3M1EV88      ----------------------------------------
A0A7C2CD94      ----------------------------------------
A0A3D0CW09      ----------------------------------------
A0A7C3BAP7      ----------------------------------------
A0A524ATQ3      ----------------------------------------
A0A399ZSS8      ----------------------------------------
A0A521ID76      ----------------------------------------
A0A3C0ZZ70      ----------------------------------------
A0A535ICD6      ----------------------------------------
A0A3M1DIE1      ----------------------------------------
A0A7C6XTW0      ----------------------------------------
A0A1F8N3P4      ----------------------------------------
A0A7C3R144      ----------------------------------------
A0A524AMJ5      ----------------------------------------
A0A7C6XJL5      ----------------------------------------
A0A3M1M4P3      ----------------------------------------
A0A7C1YQY8      ----------------------------------------
A0A426U8Y8      ----------------------------------------
A0A7L5YKW9      ----------------------------------------
A0A7C3GM47      ----------------------------------------
A0A2E0ZA41      ----------------------------------------
A0A3M1ZY58      ----------------------------------------
A0A1V5YJ40      ----------------------------------------
A0A7C3A115      ----------------------------------------
A0A7C4US90      ----------------------------------------
A0A2N5K785      ----------------------------------------
A0A7C3H8P7      ----------------------------------------
A0A2N2MQC3      ----------------------------------------
A0A7C4KGM4      ----------------------------------------
A0A3N5RU86      ----------------------------------------
A0A536AN01      ----------------------------------------
A0A7C3GC16      ----------------------------------------
A0A2M8PN31      ----------------------------------------
A0A2N2PFW9      ----------------------------------------
A0A351G432      ----------------------------------------
A0A7C5PWI6      ----------------------------------------
A0A353H3Y9      ----------------------------------------
A0A7C4N822      ----------------------------------------
                                                        

© 1998-2021Legal notice