BYKdb

Dataset for cluster orphancd of phylum candidatus-cloacimonetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

3 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2A5AMW6      MAMKNSELEMYQLKQFFIDVFYKEFFLIILLFFASISAGSYIIYVKTSINYKSSTILNLK
A0A496ZQC0      ------------------------------------------------------------
A0A7C5HW13      ---PDTEIELARLQRNF------------------------------EINDKIYSML---
                                                                            

A0A2A5AMW6      SSFVGEKALFPWIKESSGFKPNYIKKKLRDSDILKDVMLETKTKISVGMILKKLKIKNYS
A0A496ZQC0      ------------------------------------------------------------
A0A7C5HW13      ------------------------------TEKYEDAKIAEKSKIGNVRIVEEAQIPTKP
                                                                            

A0A2A5AMW6      DDSNERQRVLGTVDIGKSSSSNIFTLEFSLGGTLKN--------DLPLILKLLISKFVKN
A0A496ZQC0      ------------------------------DNQLRT------------------------
A0A7C5HW13      IKPNKKLNLMISIVLGMALGVGMALLMHALDSKIRTFDDVRKFVALPLLGTIPFIHVYES
                                              .. :..                        

A0A2A5AMW6      ENDEIHLSLEKKLSIFAFQREEIRKKLSELILKKSSYQEKNNSLDIQAEMDSIILFINKN
A0A496ZQC0      ----------------------------------AKGETKKNLLIAKHQMEAKLI-----
A0A7C5HW13      DIDHI-----------------------EKMMTDSEDTDEDKLKIIRQQIESRLI-----
                                                  :.   :.:    . :::: ::     

A0A2A5AMW6      MGVLDRLDGETLVLSQRKIEVSKELKNRLKESIDLSLFDKSYGELRNQLLELEADKSVLE
A0A496ZQC0      ------------------------------------------------------------
A0A7C5HW13      ------------------------------------------------------------
                                                                            

A0A2A5AMW6      ETYIKGHPKLRSIGSKIKVLRTRANELNDRFNNGSGRMSLDPVARSLNQEIRGLGFKVAA
A0A496ZQC0      ------------------------------------------------------------
A0A7C5HW13      ------------------------------------------------------------
                                                                            

A0A2A5AMW6      LIQQRKSISEITKKEKKNYKSLNEAQSQILSLVNLEKDLRNEESDLTKLIEIGGLNSKTI
A0A496ZQC0      ------------------------------------------------------------
A0A7C5HW13      ------------------------------------------------------------
                                                                            

A0A2A5AMW6      FLDFEYVKEVSDAVKFNNQFRNFGPILVFILALISVALVLYTKYFFSGKFMRSSDVSRVL
A0A496ZQC0      --------------------TNYSP-----------------------------------
A0A7C5HW13      --------------------THYAP-----------------------------------
                                     ::.*                                   

A0A2A5AMW6      PQPVYGMITNSKILNGDEIVCIENKTPAAESFRKLRANLSFHFDDLK--TITISSAERGD
A0A496ZQC0      ------------------------KSSSAEAFRILRTNIVTKKKPGESLTILITSSGPGE
A0A7C5HW13      ------------------------KSSVSESFRILRTNIVAKRKEKKPMTILITSSGPKE
                                        *:. :*:** **:*:  : .  :  ** *:*:   :

A0A2A5AMW6      GKSFVAVNLAASMAMMGKKVLLIDGDVRLPRDHLMLGLENLLGFVDLMDD--CSLDDVIQ
A0A496ZQC0      GKSTIHSNLATTLAQMDAKVILVDLDLRRPMIHKLVDLDKEHGISDFLVDKTSQLETFIK
A0A7C5HW13      GKSTALSNLAIALAQMDEKVILVDLDLRRPVVHTLFGQDKEMGVSDFLVDKSTKIERFIK
                ***    *** ::* *. **:*:* *:* *  * :.. ::  *. *:: *   .:: .*:

A0A2A5AMW6      ETKVNNLDFMSSGITSQNSADFLHSSRFGTIFTMLEERYDFILFDTPPVAYATDAFIYAK
A0A496ZQC0      RSHIPHLDVITSGFVPPNPSELLASRRMDEALDILKSKYDYILLDSPPVIAVTDTMVMAR
A0A7C5HW13      KSRVPSLDLITSGYIPPNPSELLASHRMDEVLDILKEKYDWILLDSPPAIAVTDTMILAN
                 :.:  **.::**  . *.:::* * *:.  : :*:..**:**:*:**.  .**::: *.

A0A2A5AMW6      RTSVTLFVLSIDKTKVVNVEKYLSELENLGIDTMGLVINRVSEAELFGARSYKYYY----
A0A496ZQC0      KSDMLTLVVRVGQADKNVIKRAKELLENINISLAGAVINGIHPQKYYSTYEYNYYYYYYY
A0A7C5HW13      KVDILLLVVRVSMADKQVIKRAKELLTNIDVNITGAIINGVQPHKYYSSYEYNYYYYYYY
                . .:  :*: :. :.   ::.  . * *:.:.  * :** :   : :.: .*:***    

A0A2A5AMW6      ---------------------
A0A496ZQC0      GK-KEDNKRSSKLFGKNKSIS
A0A7C5HW13      GREEEESKRMPKISRKNKSIS
                                     

© 1998-2021Legal notice