BYKdb

Dataset for cluster orphancd of phylum candidatus-cloacimonetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2A5AMW6      MAMKNSELEMYQLKQFFIDVFYKEFFLIILLFFASISAGSYIIYVKTSINYKSSTILNLK
A0A496ZQC0      ------------------------------------------------------------
                                                                            

A0A2A5AMW6      SSFVGEKALFPWIKESSGFKPNYIKKKLRDSDILKDVMLETKTKISVGMILKKLKIKNYS
A0A496ZQC0      ------------------------------------------------------------
                                                                            

A0A2A5AMW6      DDSNERQRVLGTVDIGKSSSSNIFTLEFSLGGTLKNDLPLILKLLISKFVKNENDEIHLS
A0A496ZQC0      ------------------------------------------------------------
                                                                            

A0A2A5AMW6      LEKKLSIFAFQREEIRKKLSELILKKSSYQEKNNSLDIQAEMDSIILFINKNMGVLDRLD
A0A496ZQC0      --------------------DNQLRTAKGETKKNLLIAKHQMEAKLI-------------
                                    :  *..:. : *:* *  : :*:: ::             

A0A2A5AMW6      GETLVLSQRKIEVSKELKNRLKESIDLSLFDKSYGELRNQLLELEADKSVLEETYIKGHP
A0A496ZQC0      ------------------------------------------------------------
                                                                            

A0A2A5AMW6      KLRSIGSKIKVLRTRANELNDRFNNGSGRMSLDPVARSLNQEIRGLGFKVAALIQQRKSI
A0A496ZQC0      ------------------------------------------------------------
                                                                            

A0A2A5AMW6      SEITKKEKKNYKSLNEAQSQILSLVNLEKDLRNEESDLTKLIEIGGLNSKTIFLDFEYVK
A0A496ZQC0      ------------------------------------------------------------
                                                                            

A0A2A5AMW6      EVSDAVKFNNQFRNFGPILVFILALISVALVLYTKYFFSGKFMRSSDVSRVLPQPVYGMI
A0A496ZQC0      ------------TNYSP-------------------------------------------
                             *:.*                                           

A0A2A5AMW6      TNSKILNGDEIVCIENKTPAAESFRKLRANLSFHFD--DLKTITISSAERGDGKSFVAVN
A0A496ZQC0      ----------------KSSSAEAFRILRTNIVTKKKPGESLTILITSSGPGEGKSTIHSN
                                *:.:**:** **:*:  : .  :  ** *:*:  *:*** :  *

A0A2A5AMW6      LAASMAMMGKKVLLIDGDVRLPRDHLMLGLENLLGFVDLMDD--CSLDDVIQETKVNNLD
A0A496ZQC0      LATTLAQMDAKVILVDLDLRRPMIHKLVDLDKEHGISDFLVDKTSQLETFIKRSHIPHLD
                **:::* *. **:*:* *:* *  * ::.*::  *: *:: *  ..*: .*: ::: :**

A0A2A5AMW6      FMSSGITSQNSADFLHSSRFGTIFTMLEERYDFILFDTPPVAYATDAFIYAKRTSVTLFV
A0A496ZQC0      VITSGFVPPNPSELLASRRMDEALDILKSKYDYILLDSPPVIAVTDTMVMARKSDMLTLV
                .::**:.. *.:::* * *:.  : :*:..**:**:*:***  .**::: *..:.:  :*

A0A2A5AMW6      LSIDKTKVVNVEKYLSELENLGIDTMGLVINRVSEAELFGARSYKYYY------------
A0A496ZQC0      VRVGQADKNVIKRAKELLENINISLAGAVINGIHPQKYYSTYEYNYYYYYYYGKKEDNKR
                : :.::.   ::.  . ***:.*.  * *** :   : :.: .*:***            

A0A2A5AMW6      ------------
A0A496ZQC0      SSKLFGKNKSIS
                            

© 1998-2020Legal notice