BYKdb

Dataset for cluster orphancd of phylum candidate-division-wor-3

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7C0VB03      ---------------------------LKTKLDNIKENLSSQIVEVTGRYI---------
A0A7C6A9Y5      VREFIEAQLQTQVLRLDSAERALQSFKQKHKIFSLADAATAQINQLAAYETMLQQTIMER
A0A7C2P0I9      ------------------------------------------------------------
A0A7C4S1E9      ------------------------------------------------------------
                                                                            

A0A7C0VB03      -------------------------NDLRDKLVSLERDLTLYEIEGLPQNHPKIVEIKKD
A0A7C6A9Y5      KTAEEQLNHLLAESILPKAANQFASGNLFNTLQRLEIERTNLLLQGFEKTHPRILELERQ
A0A7C2P0I9      ------------------------------------------------------------
A0A7C4S1E9      ------------------------------------------------------------
                                                                            

A0A7C0VB03      IEDLKKKLKDEISNFTADTLGLSDPISITGNLIDRIMETEIDLLVLKTRKEVLESMREKY
A0A7C6A9Y5      IQ-----LLQATCDLPQSNLPLDGSIR---QVVQTISDLQMEHYRLKTREEFISNLVSNY
A0A7C2P0I9      ------------------------------------------------------------
A0A7C4S1E9      ------------------------------------------------------------
                                                                            

A0A7C0VB03      LKKIKALPEKETRLAELQREYDMASDIYKLLTEKYEEFKIEEARKVGNVRVIEYAETPSF
A0A7C6A9Y5      ETKLTQLPERERELAKLIRQVEVNRSVYLTLSQRYEEAKIAEASRMSQVRIIGLAEK-SV
A0A7C2P0I9      ------------------------------------------------------------
A0A7C4S1E9      ---------------KLMRDIEVLQKIYSLLREKNEEAKINEAGRISGITLVETFTP-AK
                                                                            

A0A7C0VB03      PVKPKKKLSFALAFIGGIILGIIGITLVELIDTTVKDEADIEEITDIPVIGIIPHL----
A0A7C6A9Y5      KVKPNLPLNISLGFILATILAIAGGLGIEYFDNTLKTRDDVEKI--LPVLATIPKLLQPA
A0A7C2P0I9      ------------------------------------------------------------
A0A7C4S1E9      KIKPSLSFNLISALFLGIFFSFSAAFLMDYLNNTIKSISDIEKM-NISVLTTIPNL----
                                                                            

A0A7C0VB03      -----ENHKKGNGVLSITEKLIVHYKPQSSISEAYKTLRANLDFIG--------TPDKGE
A0A7C6A9Y5      CALPPESAHREKGTI------------RPETHEAFFVLRTALLYSQLSVEEDSMKDSESE
A0A7C2P0I9      ------------------SKLILHKNPLSPEAEAFKKLKFNID-IL----------TKEF
A0A7C4S1E9      -----NGNERKKGTK---RYIIPFSDEKTTCAESYRLLKTSLSWLF----------LEEN
                                            .   *::  *.  :               :  

A0A7C0VB03      GHTYLITSAIPQEGKSTISANLAISTAQTDNKTLIIDTDLRYPMIHRIFEMEHTEGLSEY
A0A7C6A9Y5      GKILLITSPGSGEGKSTIATNLAIVLASANYKTLLIDADLRKPTLHTIFSGKNYPGFTDV
A0A7C2P0I9      PKIIAVTSIIENEGKSTIVANLAIAYSLAGYKTLIIDGDLRKPSLHKIFETPNEHGFTEL
A0A7C4S1E9      KKIILITSPSQNEGKSTIAANLSYVFAQTGLKTLLIDLDLRKPTIHSIFSVERKPGFTDL
                 :   :**    ****** :**:   : :. ***:** *** * :* **.  .  *::: 

A0A7C0VB03      LIGKLSIEKVIRDCDIKNLWILPSGTVPPNPAELLAKDKFKKLINTLMKRFDYIFIDSPP
A0A7C6A9Y5      VVR--SLDDAIRQTPVSNLWLLTSGTLPPSPADILNSKGCSELLIRLKQTYDFIIIDTPP
A0A7C2P0I9      VTK--NILKPY-PSRFQNLFILPAGEDSLNVLKILDAFDLRKIRELLTENFDVVILDTPP
A0A7C4S1E9      ILN--NVNGNIKKSAFENLYIIPAGSLVPSPADLLEKKNVDEWLKKLKEEYGVIIIDAPP
                :    .:        ..**:::.:*    .  .:*      :    * : :. :::*:**

A0A7C0VB03      VIF-SDTRYLVSHIKNVLLVTRAGLAKKEIVIKALNTLENIGSPPEGIVLNDVEYRGTHY
A0A7C6A9Y5      VLVAADASILAAKVDGVLLTVKANQTTKETLLHSQKVLLYSRANILGAVVNYVKTSKRYG
A0A7C2P0I9      VLPVAEVNTLADFAGHLLLVVRADYTPKKLLFEFETSIPE-NIRLIGFVLNFYKRAESHY
A0A7C4S1E9      ALIAADVSILAKKVDGILLVCGFMKTELPMLEETIKMLNNGEKKIIGCVLNFYQPLKKYH
                .:  ::.  *.     :**.     :    :    . :        * *:*  :    : 

A0A7C0VB03      HYY-YPYYGYSKREEKQ-------------
A0A7C6A9Y5      YYY-YDRYKYQSRLHKAGTSF---------
A0A7C2P0I9      RYYKYYHHETEKENNSLSNLLKKLKIVKED
A0A7C4S1E9      NYY-YYHYKYQKKG----------------
                 ** *  :  ..                  

© 1998-2021Legal notice