BYKdb

Dataset for cluster orphancd of phylum candidate-division-ksb1

[Download (right click)] [Edit] [Sequences] [Repertoires]

16 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1W9SG21      -----------------------------------------------WAYYLKKQPPVYE
A0A3N9NJI9      --------MPPNTNAQHGKEWNLEDYLDLVLRRKVIILVVFIVVFVIVLAYALTRPDIYS
A0A1F4QQE0      MPYQDQSYFDS--DQQDVPQIDFKKYLRGIWKRKWLPLILILVFAFPFYRSTQNQIPIYS
A0A3N9N7Z2      MGMEEIESFDQPFEKEPANQLDISKFLKGIWKRKWIILFLCGISAVPFYFIAKNQIPIYK
A0A3N9P469      MAMEDFETFEEPIDKELSSQIDFAKFFRGIWRRKWLIISLSLVFAIPFYFIAKNQVPRYR
A0A660YSB0      ------------------------------------------------------------
A0A496T222      ------------------------------------------------------------
A0A3A0BWH6      ------------------------------------------------------------
A0A496TXM2      ------------------------------------------------------------
A0A661X1B4      ------------------------------------------------------------
A0A3N9NL50      ------------------------------------------------------------
A0A496T4Z1      ------------------------------------------------------------
A0A660YR51      ------------------------------------------------------------
A0A496THL7      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
                                                                            

A0A1W9SG21      SSCRIRFRNLASGAEYIIDDSRIIELTSRSFAERVVAQLGLTLQIEEDEYVTR-QRFFEE
A0A3N9NJI9      SRVTFSTEQTQDG--------------------------GLGS-----------GMPYYY
A0A1F4QQE0      AAVLIKTNAFAATEDKILSVERQLELLSRTFLERVAARMGLAIEVESSSATMYRESIFSE
A0A3N9N7Z2      CKVVIQSKKLGENENPIFDGETQAEIRSQSFTERVASVLGLAFANSDSVYTNF-EDVFLE
A0A3N9P469      CRVVIQSKKVGTDEYNIFDGDTQAEIRSQSFTERMAAVLGLAFVNLDSVYKDF-DEVFLE
A0A660YSB0      ------------------------------------------------------------
A0A496T222      ------------------------------------------------------------
A0A3A0BWH6      ------------------------------------------------------------
A0A496TXM2      ------------------------------------------------------------
A0A661X1B4      ------------------------------------------------------------
A0A3N9NL50      ------------------------------------------------------------
A0A496T4Z1      ------------------------------------------------------------
A0A660YR51      ------------------------------------------------------------
A0A496THL7      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
                                                                            

A0A1W9SG21      FTTTITPVKGDYVFKWDRDGTYKIYRIIESERELVDEGQLIDAISSLHETANGFSFKLSS
A0A3N9NJI9      YYQMQKPIE--YYQAVMNSG---LFRDKVTKAALHDSILLANGGLS-TEEIYGLLGR---
A0A1F4QQE0      VYTTEEPTAGDYEIEINEFGQYFLSMIKSGKKVGLDSANVWDAVEK-PRSVNGVTFRLNS
A0A3N9N7Z2      YQTTTNPVESRYKIVIDNLGNYYLYQKYGTQKTMVDSANVWDAVDT-PRNVNGISFRLNP
A0A3N9P469      YHTTTNPVEAQYKIVIDKLGTYYLYRKDSDMATPVDSADVWEAVDT-PRSINGISYRLNP
A0A660YSB0      ------------------------------------------------------------
A0A496T222      ------------------------------------------------------------
A0A3A0BWH6      ------------------------------------------------------------
A0A496TXM2      ------------------------------------------------------------
A0A661X1B4      ------------------------------------------------------------
A0A3N9NL50      ------------------------------------------------------------
A0A496T4Z1      ------------------------------------------------------------
A0A660YR51      ------------------------------------------------------------
A0A496THL7      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
                                                                            

A0A1W9SG21      EITSMPKEIFFRINKLRNTVKSFQSNINVRRTGGGGILLLSMTDANPVLVAQKINRLAEI
A0A3N9NJI9      --------------------------IGLSKEEYSDLMYMSITAFDPIVAYRIVDIASIA
A0A1F4QQE0      EFVQNASRVKFKILPFGYAVSYLKSKVNLEISRSGATMKLSMTGTNPDVLPAELNRIAET
A0A3N9N7Z2      GFCATAGEFHFRIRPFIKGFKFLEYDIQKKFSNSGKFMVLELRGEDPDLIPKQLNRVAEV
A0A3N9P469      NFSYKPGEFHFRIRPFIKGFKFLYYSVEKTFNRAGNFLVIELEDENPDLIPKLLNRIAEA
A0A660YSB0      ------------------------------------------------------------
A0A496T222      ------------------------ALSQETQEMVKQLVEFESLYQEAVTDRKTYEKRLEY
A0A3A0BWH6      ------------------------------------------------------------
A0A496TXM2      ------------------------------------------------------------
A0A661X1B4      ------------------------------------------------------------
A0A3N9NL50      ------------------------------------------------------------
A0A496T4Z1      ------------------------------------------------------------
A0A660YR51      ------------------------------------------------------------
A0A496THL7      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
                                                                            

A0A1W9SG21      FVNESKLLKRNSIENYKRTVKEQLQFSEKELEITDQRLKDFKSRHKVSLGAETQEVVSDL
A0A3N9NJI9      YKDRSREIQEEQARATVEYVNRQVALAEENLENAERKLEEFKSKTKFTAVNVNDGIIQRL
A0A1F4QQE0      YVEETKKLKRRDLDNQKKLLMQRMAAAEEQVKKAEEDLKDFNTRYPLSLNAEKQAILGKL
A0A3N9N7Z2      YLQEIKKLKNIDSEDYRTMLQRTLSAAEENMKNSEEALRRFYTQYPLSLETEKNTMTSRL
A0A3N9P469      YLLEIKRLKLMDSDTYRDMLSRNLSAAEENMKNSEEGLHRFYSQYPLSLDAEKKSLMNRL
A0A660YSB0      ----------------------------QQLADLESQRDQLLTR-VTESHQDVVEINAQI
A0A496T222      LKSQLGELRRTLETDLADISHPLILELRQKIAESEAKLVNFKAQGIPESYPDFKKENERL
A0A3A0BWH6      ------------------------------------------------------------
A0A496TXM2      -----------------------ILELRQKIAESEAKLVNFKAQGIPESYPDFKKENERL
A0A661X1B4      ------------------------------------------------------------
A0A3N9NL50      ------------------------------------------------------------
A0A496T4Z1      ------------------------------------------------------------
A0A660YR51      ------------------------------------------------------------
A0A496THL7      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
                                                                            

A0A1W9SG21      DQVEEGLERYIKDKSDLAELLKQVSGQTAEESGE--LKYVYQQITELQTFQFNPKMGILQ
A0A3N9NJI9      NEIENKITELSTQRELAQANLDVYNERLSQFKDQ---------NAASLWDNESEEIVWMR
A0A1F4QQE0      HSTQTYLRDLPLQRQKLTDLLDEVDKEKEGVDTDKYRRLIIRTIANFAVFNDEPQMAILR
A0A3N9N7Z2      SANEQILRDLPYQRRQLSELLMKVDNPEDGYEMD-YRRVVVHKIADFEVMADEPELTIYK
A0A3N9P469      AANESALRDLPHQRRMLSNLLMKLENPEDGYERE-YRRVVVHQLASFGAMTQEPELIIYR
A0A660YSB0      KFIQLQIKDLAKKRL-------------EQLYEE--------------------------
A0A496T222      ASLKRTLTEETKKVLLARYPVHDPLKPYQEILEK--------------------------
A0A3A0BWH6      ------------------------------------------------------------
A0A496TXM2      ASLKRTLTEETKKVLLARYPVHDPLKPYQEILEK--------------------------
A0A661X1B4      ------------------------------------------------------------
A0A3N9NL50      ------------------------------------------------------------
A0A496T4Z1      ------------------------------------------------------------
A0A660YR51      ------------------------------------------------------------
A0A496THL7      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
                                                                            

A0A1W9SG21      KQLKDLESNYNSVVSNFSETHADATQLEEQIKNVQNSIRIEARNHLDDLTAKIAE-----
A0A3N9NJI9      QEIEQLQNQKNALEENNAS--------SRQIQQLANEIDERKQQLRNAVLKRSAENPSAQ
A0A1F4QQE0      QTLEEQETRYNDLVKNFSENWEPVIDLKRQIKDTEEKIIKFASKYRNTLAQQETD-----
A0A3N9N7Z2      QNLENLERRYDELYSKYSAEHEDVLECANRIKETQDKIIEFASNYRNILAAKETK-----
A0A3N9P469      QNLENLEKEYDRLYSEFSAEHKDVINYAKRIQETQDKIIEFASNYRNILAEQESA-----
A0A660YSB0      --------------------------------------LATAERTASNLR----------
A0A496T222      --------------------------------------IITAETEVEALQAKEDA-----
A0A3A0BWH6      ------------------------------------------------------------
A0A496TXM2      --------------------------------------IITAETEVEALQAKEDA-----
A0A661X1B4      ------------------------------------------------------------
A0A3N9NL50      ------------------------------------------------------------
A0A496T4Z1      ------------------------------------------------------------
A0A660YR51      ------------------------------------------------------------
A0A496THL7      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
                                                                            

A0A1W9SG21      -----------MKTEKSTLEYKLGRLPEEQY---------------------QLTELERE
A0A3N9NJI9      GAIGDEQELAVYQERKIEEELNLFTLKNQERYYTSLRDTYRKQHPNMLEHSIELAKLQRA
A0A1F4QQE0      -----------YRKMYADIQAQLKNLPRDEY---------------------QLMELQRN
A0A3N9N7Z2      -----------HEKIKTELEAQLRALPDEEG---------------------RLLELERN
A0A3N9P469      -----------QRKEKVELEAKLHTLPSDER---------------------RLMELERK
A0A660YSB0      --------------------YKLKMLPSEQL---------------------KLAELTQK
A0A496T222      -----------LKKIVDQHLLKLDTLPEKSL---------------------KLARLERA
A0A3A0BWH6      -------------------------LPEKSL---------------------RLARLERA
A0A496TXM2      -----------LKKIVDQHLLKLDTLPEKSL---------------------KLARLERA
A0A661X1B4      ------------------------------------------------------------
A0A3N9NL50      ------------------------------------------------------------
A0A496T4Z1      ------------------------------------------------------------
A0A660YR51      ------------------------------------------------------------
A0A496THL7      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
                                                                            

A0A1W9SG21      LDAKEKIHRELLAKSQLAQLTEAVETEYVDILDPAIVPDEPMSRDKKKKALMGVFFAFFL
A0A3N9NJI9      KTVNATLYNFLIQKGEEAKIKAATGTGGVKVISPPAIPERPIPKNTMRDIFVGVILGLGL
A0A1F4QQE0      KDVADGFYNSLYSQLTKTNISEIAETDEIAILDRAVRPGKPINPSTKRSVLLGSSLGFLL
A0A3N9N7Z2      KRFDEELFNSLYVEMKKLQVSDASLDPGIRILDHASRPTKPINPSRKSQVMMGSAFGLML
A0A3N9P469      KQVDEELFTTFYVEMKRLQVSGTGSDAGIRILDRAARPTTPVNPSKKRQVMLGSGLGLLF
A0A660YSB0      VKVNEDIYSSLLAKYQEAQISEAVRTEEISILDPALPPEYPVNRDKKQKAVIGGFFSLFF
A0A496T222      KKLNENLYMMMKEKYEESRITRAGQIGKIRIVDPAVPPEFPISPKKKLNLILATLVGLGL
A0A3A0BWH6      ATVDEKIYLMMQEKYEETRITEVGQLGQVRIIDTAQAPKEPVKPRKKLYLVLGALIGFGL
A0A496TXM2      KKLNENLYMMMKEKYEESRITRAGQIGKIRIVDPAVPPEFPISPKKKLNLILATLVGLGL
A0A661X1B4      -----------------------------------------------MNLLLGVLLGLGL
A0A3N9NL50      ------------------------------------------------------------
A0A496T4Z1      ------------------------------------------------------------
A0A660YR51      ------------------------------------------------------------
A0A496THL7      ------------------------------------------------------------
A0A3A0DU25      ------------------------------------------------------------
A0A3A0DZV2      ------------------------------------------------------------
                                                                            

A0A1W9SG21      GVGLAFTLEFLDKAIKSVEDIKRYLKLQVLGTIPNIDF--------NEVSDYQDSE--KI
A0A3N9NJI9      GVGLAFGLDLMDQSIHTPEDVEKHLALSTIGTIPHIDYVTKKADRDKRIPVLQDRR--NG
A0A1F4QQE0      GIILSVIWELTDKTMRTVEDVERSLRLPVIGAIPVMDF--------KDVPEFHDFE--KV
A0A3N9N7Z2      GLLLSIGIDIADRSLHTLKDVERHLNVPVLGTIPTVRF--------KDIPDFRDDQ--KA
A0A3N9P469      GLFLSIGLDIADRSLYTLRDVERYLNLPVLGTIPVVSF--------KDIPDFRDDQ--KA
A0A660YSB0      SIFVGVFLEFLDKTLKTPDDIKRYLKLNVIGSIPKIEFDHEYEL----------KDADKI
A0A496T222      GIGVVFFLEYLDNSVRTVEDVER-LQLPLLGSIPDIEPEKQNGLWRALPKKKGSED--EV
A0A3A0BWH6      GLGLTFLFEYIDNSVRSIEDVEH-IGLTVLGSIPVIKEDEALKRLKVLPGMNGNLDTLES
A0A496TXM2      GIGVVFFLEYLDNSVRTVEDVER-LQLPLLGSIPDIEPEKQNGLWRALPKKKGSED--EV
A0A661X1B4      GIGLVFLLEYLDVSIRTPEDLKK-KGWQPLSIIPSMDSQLLSQSKVQDSNLKLDEH--LV
A0A3N9NL50      ------------------------------------------------------------
A0A496T4Z1      -----------------------------------------------MQSRYNGKS--IV
A0A660YR51      -----------------------------------------------MQSRYNGKS--IV
A0A496THL7      -----------------------------------------------MQSRYNGKS--IV
A0A3A0DU25      ----------------------------------------------------MQKS--LT
A0A3A0DZV2      ----------------------------------------------------MKTS--VA
                                                                            

A0A1W9SG21      KQIDQQLVTYDY-------SPTPIGEAYRSLRTNLVYSKTTGRMQSFVVTSAAPGDGKSF
A0A3N9NJI9      KPAKDGVNERIFQLLPMLGSKNPLVESYRNLRTDLQFVNVDEPIKSIMFTSATPGEGKSL
A0A1F4QQE0      RQIDKQLVTDDY-------SATPVGEAYRALRTHLMFSKNTGKFQSLLITSISPEDGKSF
A0A3N9N7Z2      LQIDRQLVTHDY-------SPTPVGEAYRALRTQLLFARGAEQIRTLLITSISPEEGKSF
A0A3N9P469      LQIDRQLVTHDY-------SPTPVGEAYRALRTQLLFARGSERIRTLLITSISPEEGKSF
A0A660YSB0      KQIDAQLVTYDY-------SPTPVSEAYRALRTKIMFSKQTGNIRTLVITSFAPYDGKSF
A0A496T222      GRLATRLVTHLK-------PKSPYSEAYRSLRTQIQYARSEKPVQTILVSSPGPGEGKST
A0A3A0BWH6      KKMAARLITHFA-------PKSPISEAYRTFRTNLQYTKLDRELKAILVTSPGPGEGKST
A0A496TXM2      GRLATRLVTHLK-------PKSPYSEAYRSLRTQIQYARSEKPVQTILVSSPGPGEGKST
A0A661X1B4      AY--------LN-------PRSSVAEGYRRLRTNLQYARLDKPLKSFVVTSPNPKEGKST
A0A3N9NL50      -----------------------MIEAYRSLQLNLSFLNPDNKLKTILITSAAPGEGKTL
A0A496T4Z1      EY--------YS-------EESPEATEFRRLYSKIRHLNPDRNMKNFLITSATVGEGKST
A0A660YR51      EY--------YS-------EESPEATEFRRLYSKIRHLNPDRNMKNFLITSATVGEGKST
A0A496THL7      EY--------YS-------EESPEATEFRRLYSKIRHLNPDRNMKNFLITSATVGEGKST
A0A3A0DU25      NSIVSV----FS-------DETPEANEFRRLYSKLKNLYAADEMKNFLVTSAKMNEGKST
A0A3A0DZV2      KFKKSAKPLGYY-------LETPELNEFKRLFNRLHTEKQKHGTKIFMITSAMMSEGKST
                                           :. :   :         . ::.:*    :**: 

A0A1W9SG21      TSANIAISMAQ-HKSNTLIIDADLRRGVLHNTFGVPKEPGLTNYLTGMVS-FQHLVN---
A0A3N9NJI9      NTANLAISFAE-LGKKVLIVDCDMRKPVQSKIFQVEKSPGVSDYLARELT-VDEIIQ---
A0A1F4QQE0      TSSNLAIIVAQ-QKTNTLLVDADLRRGVLHNTFGLPKDPGFTNYLTNKIT-LLEAIQ---
A0A3N9N7Z2      TASNLAIIMAQ-QRTNTLLVDADLRRGVLHNTFSTTKEPGLTNYLSNNAT-LASLIQ---
A0A3N9P469      TASNLAIIMAQ-QRTNTLLVDADLRRGVQHNTFSTSKDPGLTNYLSNKAT-LVGLVQ---
A0A660YSB0      TCSNLAVTLAQ-HKTNTLLVDADLRRGVLHNTFSVPKEPGLSNFLMGMVS-FEELLN---
A0A496T222      SVTNLAITMAQ-MGSKTILVDSDLRRPVLHSLFDLKRDVGLSNYLVGRAE-IEEVIR---
A0A3A0BWH6      SVSNLAITMAQ-MGSKVLLIDSDLRRPVLHTIFKVDRRIGLSNILVGKVS-VSEAVQ---
A0A496TXM2      SVTNLAITMAQ-MGSKTILVDSDLRRPVLHSLFDLKRDVGLSNYLVGRAE-IEEVIR---
A0A661X1B4      TAANLAITFAQ-AGINTLLVDTDLRRPSIHRLFGLPKEPGLINYLFGKCE-FKEIVH---
A0A3N9NL50      TTLNIAQIYAR-SGIKTLVIDCDLRRPMVHKALKIRQEPGLTNLLVDKTATLDSCVQLLD
A0A496T4Z1      VAAFLAITISKYRDTNTLLIDCDLRRPKIHRLFRLAQERGMAEVLLERLP-LQSCIK---
A0A660YR51      VAAFLAITISKYRDTNTLLIDCDLRRPKIHRLFRLAQERGMAEVLLERLP-LQSCIK---
A0A496THL7      VAAFLAITISKYRDTNTLLIDCDLRRPKIHRLFRLAQERGMAEVLLERLP-LQSCIK---
A0A3A0DU25      IAALLACTIARYRNTKTILVDCDLRRPRVHQLFGMPKEEGVADVLMGTRK-LDTCFK---
A0A3A0DZV2      VAAYLAVTSALYQSTETVLVDCDLRRPVIHRHYELPLQQGIAEVLSRELD-LSAAIK---
                    :*   :     :.:::* *:*.             *. : *      .   ..   

A0A1W9SG21      -DTLIPNLSMVSCGSLLPNPSELLGSHQMQRFLDEAKRKFDIIIFDSPPLNAATDAVVIG
A0A3N9NJI9      -KTAITNLSLVTAGTSPPNPAEMLDSHKMTELISKLTDRFDLLIFDSPPLIAVSDPKILA
A0A1F4QQE0      -PTHIPNLSLISCGSMIPNPSELLGSLQLRRFLEDARRKFDVIIFDTPPLDAATDAVVLG
A0A3N9N7Z2      -PTHVPNLSVLSCGSLIPNPSELLGSMQMRRFIAEVKRKYDFIIFDAPPLDAATDSVVIS
A0A3N9P469      -PTHVPNLSVLSCGSLIPNPSELLGSMQMRRFVAEVKRKYDFIIFDAPPLDAATDSVVIS
A0A660YSB0      -ETHVPNLTVVSCGSMMPNPSELLGSLRLRKFIDEAKRRFDFVIFDTPPLNAATDAVVLG
A0A496T222      -PTSVDNLYLISCGILPPNPSELLGSKRMQELIQQLKNECDYVLFDSPPLIAVTDAVVMA
A0A3A0BWH6      -KTEIDNLYVLPCGTLPPNPSELLASSAMTRALEEMKDLFDIILFDSPPIIAVTDAAVLC
A0A496TXM2      -PTSVDNLYLISCGILPPNPSELLGSKRMQELIQQLKNEYDYVLFDSPPLIAVTDAVVMA
A0A661X1B4      -DSGIKDLSIIPCGIIPPNPSEVLAAPQTHELIEKLKGMYDIVIFDSAPVLAVTDASIVS
A0A3N9NL50      DEQLNGHLAVLTCGAIPPNPVELLSSKSMQDLLTKAQAIYELIFIDAPPVISVSDSVILG
A0A496T4Z1      -ESPLKNLKIMTSGVVENSPAELLNSLRIKDVFAEIKFYFDTIVVDCAPIVPVSDPLVLS
A0A660YR51      -ESPLKNLKIMTSGVVENSPAELLNSLRIKDVFAEIKFYFDTIVVDCAPIIPVSDPLVLS
A0A496THL7      -ESPLKNLKIMTSGVVENSPAELLNSLRIKDVFAEIKFYFDTIVVDCAPVIPVSDPLVLS
A0A3A0DU25      -QTPIENLRLLTSGGVVTSPTELINSARMRDLFSEIKFYFDTIIVDSPPVIPVTDALILS
A0A3A0DZV2      -PSALPHLKIITAGKPNQTPAELFSLTHLQSVVDEMREKFSIIIFDAPPIIPVSDTLLLS
                       * ::..*    .* *::        . .     . :..* .*: ..:*. :: 

A0A1W9SG21      TQVDALVLVVRSGVTDRDVAKHKLELFKNVPVRILGAVLNGTNSEFGHD------GYSYY
A0A3N9NJI9      PKVQNVLLVVRVGKVNYRLVKDAYSRLDKVDAKVIGAVLNGVGTKRGYG------YYSRY
A0A1F4QQE0      TQVDAMAVVVRSGKTSRTLAKEKLEIFETVPVKLIGIILNGSETA-LVH------NYSYY
A0A3N9N7Z2      TLVDAVVVVVRSGKTNRNNAKERMDIFSTVPARLAGVVINGTEEANMKN------SYSYY
A0A3N9P469      TLVDAVVIVVKAGKTNRNNAKERLDIFNTVPANLVGVVMNGTEEANMKS------SYSYY
A0A660YSB0      TQVDGVTLIVRAGKTNRNIARQKLDLFDNVPATIIGVIINGAEKDLAHE------GYSYY
A0A496T222      PWVDGVVLVLRSGKTDRDAAVRAFELLRNVKANVLGTLLNDVLPSYMYG------SYYYY
A0A3A0BWH6      PRLDGVILVLKSGQTDRDAAFRAYTLLKNVNARLLGSLLNGVQIESMYG------SYYYY
A0A496TXM2      PWVDGVVLVLRSGKTDRDAAVRAFELLRNVKANVLGTLLNDVLPSYMYG------SYYYY
A0A661X1B4      TQVEGTLLIILAGTTVMDELEHSIEQLERVNARVLGVAMNNFDIKRAYGSYYGQYKSRYY
A0A3N9NL50      QKVDGVLLVLRSGKINREAAQKAKKILENGKINIAGTLLNDVDYKNVYG-----Y---YK
A0A496T4Z1      PEMDGILLVVKAGKTPKEVVKRAVDSMRDIGVNIIGVVLNNKERVLPYY-----YDYKYY
A0A660YR51      PEMDGILLVVKAGKTPKEVVKRAVDSMRDIGVNIIGVVLNNKERVLPYY-----YDYKYY
A0A496THL7      PEMDGILLVVKAGKTPKEVVKRAVDSMRDIGVNIIGVVLNNKERVLPYY-----YDYKYY
A0A3A0DU25      PEMDGALLVLKAGETHKAVVQRAVDLIRNAGLNILGVIINNQKAVLPYY-----YDHKYY
A0A3A0DZV2      NFVDGILIVVKAGKSQKRVTQRALDMLQTNSDKILGVVVNNLRSALPYY-----YDHRYY
                  ::   :::  *             :      : *  :*.                   

A0A1W9SG21      HY--------------------------------
A0A3N9NJI9      NYYHHAEYYTSIEKKSADKRRKKPYIKPQFFKSS
A0A1F4QQE0      HY--------------------------------
A0A3N9N7Z2      HY--------------------------------
A0A3N9P469      HY--------------------------------
A0A660YSB0      HY--------------------------------
A0A496T222      YYYYYYSSEDGKTKKRKKKHHHHTQLYTS-----
A0A3A0BWH6      YHYYYYGKGDGKKSKTRRSRHSSTNAA-------
A0A496TXM2      YYYYYYSSEDGKTKKRKKKHHHHTQLYTS-----
A0A661X1B4      GYYGYYTYGHHSTEKKSKKKKSTV----------
A0A3N9NL50      DYYYYSDKDKIK----------------------
A0A496T4Z1      GYQYYHDYKE------------------------
A0A660YR51      GYQYYHDYKK------------------------
A0A496THL7      GYQYYHDYKE------------------------
A0A3A0DU25      GYSYYNTEEKVK----------------------
A0A3A0DZV2      GYKYYRQIENANAKRSDH----------------
                 :                                

© 1998-2020Legal notice