BYKdb

Dataset for cluster tadcd of phylum calditrichaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

19 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3M1XW99      ------------MNYPKLENGKAPSRRIVTGAEQEVFRYLRIIRKRKTVIAITAFVVLAI
A0A1F4MQ28      -------------------------MEHTSAQGLDIRLIFQVIERKKNYLIGVVLFFLVL
H1XPL7          MSSEKMNMGEGYPGNGKPLAQSYTGFEN-EEEVMKLQDYLQIILRRKWIVLVSFLVVFLT
A0A3M1AHA0      -----------------MEQFYLDDENSYQDEKIDLQKYIRVLIRRWKLVFSVTILVTVP
A0A3M1P834      -----------------MDSYFLDEEESLDVETLDLRRYYRALIKKWWLVAIITLAVTVP
A0A523HP09      -----------------MESVFLDDEEF--EEKIEIRRYFNAVVRKWWLVLIVTIAVTVP
A0A523HUF7      -----------------MESVFLDEEEF--EEKIEIRRYFNAVVRRWWLVLIVTIAVTVP
A0A523IKD8      -----------------MESVFLDEEEF--EEKIEIRRYFNAVVRRWWLVLIVTIAVTVP
A0A3M1NQ37      ------------MNMTNGQPKNFQKTENVAEQEI--KKYLRILKKRKWVILTVWFVLFLI
A0A3N9NLG8      -----MIIFFTFDVIGEYTLFEENELELESGSQVSISDYLKIIYRRRWLIIITFLVVFGI
A0A1J1CCX0      -----MNMGEGYPGNGKPLAQSYTGFEN-EEEVMKLQDYLQIILRRKWIVLVSFLVVFLT
A0A3N5JLC6      -------MNEYNTYPGDGNGKVQSLPARPPERKMTLNDYRRIFFRGRYVVLITFGIILLL
A0A3M2FFC7      ----------------MNHPSVEAGIENPGQQNVTLTDYLRIIYRGRWIVLFSFLVVFTG
A0A3M1AH62      -------------------------MEEQLEREITLKDMMRILYRGRWVITSCFLAVMAL
H1XXK6          -------------METRVPGNFETDTWEGDEQPLHLTDYIRILYRGRWLIILSFIAVFSA
A0A1F4N1P8      -------------------MNEFEDLQQPEEEQVSLQDYLRILYRGRWIIIISFLVVMIA
A0A3M1XV95      -------------------MENQFEFQQ-DEQQITLQDYLRILYRGRWIIVASFLSVLLV
A0A3M1NWV5      -------------------MENFAEFQE-NEQQISLQDYLRILYRGRWIILTSFVVVVLA
A0A3M2I7J5      -------------------MENYPELME-QEQQITLQDYLRILYRGRWLILGSFVVMLLG
                                                        . . . .  :      .   

A0A3M1XW99      WLGFIVAFQATPVYESSVILTFQDTK-------NTSVAEGGSKKDVNWSRASLVLTHSLL
A0A1F4MQ28      VLLYN--FLATPVYQSSVLIKKEQIY-DYRDPDPLNRIMSRQTTDEIDTEIEINKSRSVL
H1XPL7          AVVYT--INSQPVYQAQATVLVNTQSKGQGGLLLFDPTGLGFAQN-LNNELEILKSRSVA
A0A3M1AHA0      WVIYT--LKQPPVYEAKAVIRFKSYE--------------GKDPTLTESRTTVLTSRTFA
A0A3M1P834      WAIYL--KSQPPIYEAAALIRFKNFA-------------GGDDVSLIQTRNTELRSRSFA
A0A523HP09      WVLYT--LSKPLEYEAQAVVQFNSFE--------------GNDPTLTESRETVLTSRSFA
A0A523HUF7      WVLYT--LSKPLEYEAQAVVQFNSFE--------------GNDPTLTESRETVLTSRSFA
A0A523IKD8      WVLYT--LSKPLEYEAQAVVQFNSFE--------------GNDPTLTESRETVLTSRSFA
A0A3M1NQ37      WEVFISFFSKGPLYTAKTLLSYQDPR---------TMSALEGRVVNYKSPMNLITSNKVL
A0A3N9NLG8      TCFVT--FTTEPEYEASTTIMIKSTG-AME-RTLFEFDYMGAQTTLISNQIEILKSRTLA
A0A1J1CCX0      AVVYT--INSQPVYQAQATVLVNTQSKGQGGLLLFDPTGLGFAQN-LNNELEILKSRSVA
A0A3N5JLC6      TALYT--FLQKPVYEANVRLMLQDNS-SVG-QSLFDLTSAMKQETMLNNQVEILKSRTVA
A0A3M2FFC7      TVYYT--FTTDPVYDATTTLIIDKSN-AME-NALFDFNSFGNQSTHISNQIEIIKSRTIA
A0A3M1AH62      TVYYT--FTVTPEYEASAKVMIRTDA-TSGIPSLFDMGGVLKQETVINNQVEILKSRTLA
H1XXK6          TVLYT--FTTDPTYEASAVLLVESND-SMD-RALFNLTTFGTQTNLLNNQIEILKSRNIA
A0A1F4N1P8      TVYLT--FTTPKVYEAVGTLIVESQG-SME-RNLFDFAYSGNQTTLITNQVEILKSRKLA
A0A3M1XV95      TAYVT--FTADPVYESTAKIMVESQG-SME-RALFDVTYLGNQTTLITNQVEILRSRMLA
A0A3M1NWV5      TAYFT--FTATPVYEATAKILIEDKN-SME-KALFDINYLGNQSTVIQNQLEILKSRTLA
A0A3M2I7J5      AFYLN--YSTEPEYQASAKILVENPS-ANK-LALFNVDYLNMPSTFITNQVEILQSRTLA
                             * :   :                            .      :. . 

A0A3M1XW99      SKVVEKLQLNFSMIT---------------------------DNVDQDEVFRYLKVSKEA
A0A1F4MQ28      EKVVLEKKLFLQIESIKLSKGKNINLNYSYPLYEQWLGIESPWKEQLPRFENIQLKPDEV
H1XPL7          NAVARELLAKKYYDN---------------------------------------------
A0A3M1AHA0      EQVVAQMGLSMKIKS----------------------DAMKR-LKRKEIFQHFSTTKDPV
A0A3M1P834      QRVVAQLGLCLVLEQ----------------------KTEDGFLNRSDIFAEFSTTQTPV
A0A523HP09      EKVVAQMGLSVDIES----------------------DEQNQ-LSRRSLFSQVYTTQNPI
A0A523HUF7      EKVVAQMGLSVDIES----------------------DGQNQ-LSRRSLFSQVYTTQSPI
A0A523IKD8      EKVVAQMGLSVDIES----------------------DGQNQ-LSRRSLFSQVYTTQSPI
A0A3M1NQ37      GEVIEELQLNLSIQT----------------------GFISK------------------
A0A3N9NLG8      ERVIKSLNLSDVRDS---------------------------------------------
A0A1J1CCX0      NAVARELLAKKYYDN----------------------SQEIL------------------
A0A3N5JLC6      ERVIRNLLKSPYSHR---------------------------------------------
A0A3M2FFC7      ERVIKRMELSNVRDS---------------------------------------------
A0A3M1AH62      ETVLHRLQQSDLADK---------------------------------------------
H1XXK6          ERVVKRLEKSAYRDS---------------------------------------------
A0A1F4N1P8      EKVVRTLEEDVYRDS---------------------------------------------
A0A3M1XV95      ERVVHYLESVPYRDS---------------------------------------------
A0A3M1NWV5      ERVVLRLQSAVYRDS---------------------------------------------
A0A3M2I7J5      ERVVAELESADFRDS---------------------------------------------
                  *                                                         

A0A3M1XW99      KTGYYRLVHEGGEFQI-------YYSKDDDDNPGELLKRFAASDTIDVNQLVLAVNPGFF
A0A1F4MQ28      SHDYHLKLFGDNQYLILDAEKDNVIMSGSDLNNSAFNLPNLIFTM---QWSAASAGSEVY
H1XPL7          --------SQEILHCI-------RAPEEDELG----------------------------
A0A3M1AHA0      PGDYLLRLNNDATYSL-------FILL-DDKRKRKIKEGLVNQIL---DSPLSANGF---
A0A3M1P834      SGDYFLRLTADGRYSL-------SMIIPDTEREKQLKTGSVADIT---NGLCVVNGL---
A0A523HP09      PGKYFFEFNENYSYKL-------SMML-DEDREKIVSEGLISEIS---QKALNVNGF---
A0A523HUF7      PGKYFFEFNENYSYKL-------SMLL-DEDRKKNVSEGLISEIS---QKALNVNGF---
A0A523IKD8      PGKYFFEFNENYSYKL-------SMLL-DEDRKKNVSEGLISEIS---QKALNVNGF---
A0A3M1NQ37      -------------SRL-------FDFLDVDRNSVVGDYKLVRKGE---T-----------
A0A3N9NLG8      ---------------L-------NLFKPNEKG----------------------------
A0A1J1CCX0      -------------HCI-------RAPEEDELG----------------------------
A0A3N5JLC6      ---------------L-------RVLQRPDTLNASLQMLNWLSLD---SKKDWS------
A0A3M2FFC7      ---------------L-------SLFHPNDDG----------------------------
A0A3M1AH62      ---------------L-------EILGNGEHGHRSPGMIASFTGF---IKGIFGIESEES
H1XXK6          ---------------I-------SFFKKLEDG----------------------------
A0A1F4N1P8      ---------------L-------KIFQPADDG----------------------------
A0A3M1XV95      ---------------L-------QIFQPDESG----------------------------
A0A3M1NWV5      ---------------L-------EIFQPDENG----------------------------
A0A3M2I7J5      ---------------L-------SIFQPTSRG----------------------------
                               :                                            

A0A3M1XW99      EQHNIHELRWQVRDVNEAVDKLRNK-----------------------------------
A0A1F4MQ28      FNVQNLEIVVEQLAERISIRKIGKT-----------------------------------
H1XPL7          REILSEEELTGVLIRTVEFEPVRDS-----------------------------------
A0A3M1AHA0      NLQISPNLLNVPQDIEFTILPFREA---------------------------------VK
A0A3M1P834      SFRLVRNVPL-PLEVPFRIMSFRSA---------------------------------VE
A0A523HP09      SIQMAQDFSKTPKDLTFTVHPFRDA---------------------------------VK
A0A523HUF7      SIQMAQNFSKNPQDLTFTVHPFRDA---------------------------------VK
A0A523IKD8      SIQMAQNFSKNPQDLTFTVHPFRDA---------------------------------VK
A0A3M1NQ37      FDLLYKYEPHGIKEYKLLTFAVDDTVAVNKMKFKLNKPFVLGYSKDEIEFKIRPFEMVIE
A0A3N9NLG8      EYLSMRGMIGVIRG-NMDVSHRKDT-----------------------------------
A0A1J1CCX0      REILSEEELTGVLIRTVEFEPVRDS-----------------------------------
A0A3N5JLC6      ESEVFDEQVKNLRE-ELDVRHIRNT-----------------------------------
A0A3M2FFC7      EYLTLREMAQIIRE-NMEVINKKET-----------------------------------
A0A3M1AH62      NEYTFEDMVQELLDERLSVTPIRDT-----------------------------------
H1XXK6          SDLTFNQRVAIVMS-SLEVEPRRDT-----------------------------------
A0A1F4N1P8      SYMTSRSQVNWIME-HLEVNPKKDT-----------------------------------
A0A3M1XV95      VYMTFRDQVEWVMD-NLEVTPKKDT-----------------------------------
A0A3M1NWV5      DYMVLRDQVDWILD-RLTVTPKQET-----------------------------------
A0A3M2I7J5      DYLTLREQIDWILD-HLTVTPKTES-----------------------------------
                                       .                                    

A0A3M1XW99      ------INYMLDKSRTILTITVSHKNPKRAAQIANTLAELFVDMNLHLRRRQSDEVVSIL
A0A1F4MQ28      ---------------KIFQLSVKSDSPFEAQLLAATVVDKFREVRLEQKQQTVKYSYDFA
H1XPL7          ---------------EVIKIIAKSGDPRDAALIANQFARAYYERNLRMSRTRSKAAREFL
A0A3M1AHA0      EFQSKTNVSW-NRSGTLMTLTMTDEDPYLAAKMTNRLAEIFVEESASLKKKAVEKKRELL
A0A3M1P834      SFQSRINVRWEDRAGTLMRLTLTDTDPKVVAEMTNRLAEIYIAQSSSVKKEMSQARVKIL
A0A523HP09      NFRSKTGTNW-NRSGNLMTITLTDEDPDLAAKMTNRLAEIFVEESVSLKTSDIKRRSELL
A0A523HUF7      NFRSKTETNW-NRSGNLMTITLTDEDPDLAAKMTNRLAEIFVEESVSLKTSDIKRRSELL
A0A523IKD8      NFRSKTETNW-NRSGNLMTITLTDEDPDLAAKMTNRLAEIFVEESVSLKTSDIKRRSELL
A0A3M1NQ37      SLRRLIQFRSEDRYGTIFTISVKHYNPNRAAKIANTLAKKFIDLNIKLRHHKGAQKLKIL
A0A3N9NLG8      ---------------DIITLTYTSNSSFDAAFIANTIAEEFRSLNAEENSGELSELRNFV
A0A1J1CCX0      ---------------EVIKIIAKSGDPRDAALIANQFARAYYERNLRMSRTRSKAAREFL
A0A3N5JLC6      ---------------DMMQINFRAHSAFEAYFVANALADVYERISQEESQAEVRQVKEFL
A0A3M2FFC7      ---------------DIIEITYSAPSAFEAAYTVNAIAQEYADASVEFNQGELKDLRKFL
A0A3M1AH62      ---------------EMIEIKVRAVSPEEAAFITNTLTAAYREKNRLMSQEEVRQVKNFL
H1XXK6          ---------------DIITLTYRAGSPFEAAFLANVISEEFAKLNAETNRMEVSEMRKFI
A0A1F4N1P8      ---------------DVIEVKFQAGSPFEAKNIANEVIQNFRMLNIELNKQELVDLRDFL
A0A3M1XV95      ---------------DIIEIKFSSRTPFEAAAICNVIAEAFRDLNREFNRSEFRELRQFL
A0A3M1NWV5      ---------------EIIHVTFQARSPFEAARICNEVVVTYQQLSKEVNLSEFKDLRQFL
A0A3M2I7J5      ---------------DIIEIVYVASTPFEAATVCNVIAESFQKLNRDFSRSELRELRRFL
                                :: :      .  .      .   :                 : 

A0A3M1XW99      QNQLRVAKADLDAANERLRRFRERNPWVTLSKGDNAQINVVSSLQLTKNQIEQTLNDLQA
A0A1F4MQ28      DQQLQQIDQKLKAAEDTLSKFKSKHKITSIDDNSAEVVDFLSKLETEKVNTDLELTEYEN
H1XPL7          EKQLIAKQEQLAKAEEALQRYMEQTGIVSVDDESQKVIEQLATVQAQYENVSIELESVKE
A0A3M1AHA0      EEQVRLAKAKLDESERALKEFKEKYAI-NLDAEQQTQLNQMV----AAEQEKENLVAYKK
A0A3M1P834      EEQLQKAREELEASERELVQFKKKYEV-ALDADQKGQLNQLA----LLEKKRDDLETTLK
A0A523HP09      EEQVNLAKSKLDEADRALKEFKENNAI-DLNAEQETQVNQLV----VEEQQKRNLETYRN
A0A523HUF7      EEQVNLAKSKLDEADRALKEFKENNAI-DLNAEQETQVNQLV----VEEQQKRNLETYRN
A0A523IKD8      EEQVNLAKSKLDEADRALKEFKENNAI-DLNAEQETQVNQLV----VEEQQKRDLETYRN
A0A3M1NQ37      ENQLQLAKKELDEANAKLKAFRKRYPWVVLTPTAGSYVTSVSNYEEKKQQAEMTVADIQN
A0A3N9NLG8      ERQLEKKSEELKLSEDRLREFQEKEKLTSLDENTSELVNTLSGYEAKLEQAQIELRSNLE
A0A1J1CCX0      EKQLIAKQEQLAKAEEALQRYMEQTGIVSVDDESQKVIEQLATVQAQYENVSIELESVKE
A0A3N5JLC6      EEQLKLYEQELKHSEEQLKSYQESAHVVALDNETIELVQKITDFETLYNSARTDLLAARQ
A0A3M2FFC7      EEQLRKKGQELTSSEELLRDYQERERVASLDEETSELITRLSAVEAELEQSQVMLQASLE
A0A3M1AH62      EEQLQVVKKQLAESENKLKQFKETQKVVALSHETEELIKKLAEFETLYNEAKTELNSFKE
H1XXK6          EDRLAIKAKELKESEEALKEFQEREKIASLDAETQELVTRLSETESFLEQARIELNSKLQ
A0A1F4N1P8      EEQLQIKREELRNSEEALKNYREKEKLISLDKETSEAISRYAESQAQLEQALVEMDAYLE
A0A3M1XV95      EKQLASKEKELRSSEEALKNYREEHRLVHLDEETSDLVSRVADIQSQLDAAMVELEAAQE
A0A3M1NWV5      ELQLRKKSEELKQSEEALRLYREREKLVSLEESTKELISQLAESQAELEASMVELESLQE
A0A3M2I7J5      EFQLKKKSEELRQSEEALREYREREKLVSLDAVTSELISRLAEVQAELETAAIELEAAQE
                : .:     .*  ::  *  : .      :       :                :     

A0A3M1XW99      LVERTAQAADPAVKFSTA-----RELVTYLTDMKVALAPAFEKEYNDLVVKRNTLL----
A0A1F4MQ28      KIQE------MRREVKNRGYFDQTYLTPESNNESYSPFSVLLRQLSDLELKRLELL----
H1XPL7          SLNF------YRKQIARQ----EPNVARIMSDASDPYIRLLQEEIARLEVEK---DITIS
A0A3M1AHA0      ALKG------LLARLDSE--------TLSSSGDGNTQAQLNRRYIFRQIAEHPVFDNN--
A0A3M1P834      TLND------LLQKKEEE----ERALA---GPDADPYATDLR-YVMNEIASHPAFDGS--
A0A523HP09      TLKS------LLSKLDDE------LLS---GNGNSITASDNRKYIFSQLAEHAHFDNN--
A0A523HUF7      TLKS------LLSKLDDE------LLS---GNGSSITASDNRKYIFSQLAEHAYFDNN--
A0A523IKD8      TLKS------LLSKLDDE------LLS---GNGSSITASDNRKYIFSQLAEHAYFDNN--
A0A3M1NQ37      YLKNLNNSQGLDEKINNT----RELLTY-LGGQGRPVIPEYLRRFNELETERNTLLSTYA
A0A3N9NLG8      LKKS------LEQQLNER----KETLSTDLSEISSGYLLSLQSQLAQAEAEKTKYMMAIQ
A0A1J1CCX0      SLNF------YRKQIARQ----EPNVARIMSDASDPYIRLLQEEIARLEVEK---DITIS
A0A3N5JLC6      RLDY------IDSELARQ----NTNFDIE-TISKTTALEEFTRKIAEKEAQLAVYQSETI
A0A3M2FFC7      MKNS------LEKQLDER----RETVSSELSEISTPYIQTLQEELARIVAEKTKYETAVA
A0A3M1AH62      RLSY------IDKQLGKS----KQNFDIE-SISATTYFEELKKEMATLQTKRASYVANMI
H1XXK6          LKKN------LEEKLNER----KETLPANLSEISTPYIQTLQQELARVVAERTSYVTALE
A0A1F4N1P8      QKKS------LEDQLENR----RSSFSTEISVVSSPILEQLQSEYAKLVSEKVTYETLIA
A0A3M1XV95      NKRN------LEKQIDER----RQSLSIEVTQVSSPLLKELQEQYAELVAEKLKYETLVK
A0A3M1NWV5      QKRN------LEKQLEER----RKALSSEVTQVSSPLLVELQQEYARMVNDKVKYEALIA
A0A3M2I7J5      KKHN------LEKQLEER----RETLAVEVSQISSPLLQELQKEYARMVSEKVKYETLIA
                                                                  .         

A0A3M1XW99      -----QQYAPTHPFVVQVEKDFESFRSKLLQAAQD-------------------------
A0A1F4MQ28      -----QKRKDTHPDVVTINEQISQIKAQLTDYNQNTIIAYQ-------------------
H1XPL7          QNPHAAEDPIYKEKLIKIDSQIDNLRKKLRKRTNDYLKSVLPGQLTDPAKYLVEVKQKIF
A0A3M1AHA0      -----ATMLVYRAKLLDLEDQWKQVVDVSSAENPKAKEIDA--------EISLTHLQIKK
A0A3M1P834      -----AAMLIKRSRLKDLETQWRAIVNSTTERNIKARQVLA--------QIRSLHTEIEQ
A0A523HP09      -----STMLLYRQKLRDETESWRAIVASSSERNPRAISIDL--------DIRQTQIQIED
A0A523HUF7      -----STMLLYRQKLRDETESWRAIVASSSERNPRAISIDL--------DIRQTQIQIED
A0A523IKD8      -----STMLLYRQKLRDETESWRAIVASSSERNPRAISIDL--------DIRQTQIQIED
A0A3M1NQ37      PSHPLV--------------------------------------LKNQEAIEDLIQKIIT
A0A3N9NLG8      SEVQDASKQHFESRLKVYDERINALREKLNEEAKKISSSNM---VSDPFQLSQQLLTQYL
A0A1J1CCX0      QNPHAAEDPIYKEKLIKIDSQIDNLRKKLRKRTNDYLKSVLPGQLTDPAKYLVEVKQKIF
A0A3N5JLC6      QK---GESQFTRRQIETLQRQIDALKAQFKQNVKNIAANQF---V-DPAKVSSALFTSKI
A0A3M2FFC7      SQATGVNSDYFNAQIAEYDSKIKSLKQRLEEEAKKLSTSSM---VQDPFQLTQELVSRII
A0A3M1AH62      NQGV-YNKND--IQLQKYDEQISILTDKMKSELAKLASQEI---L-NPVAVNEELFARKV
H1XXK6          TQVQ-SKREFFTPELVRYDERIKALKKKIREEAAKIANSEM---ISDPLRISQDLVNQLI
A0A1F4N1P8      QDR--VDPAEYNLQLQSLENRLKAQEKRLQDEAKKIAATSM---VQDPLLIAQNLTVKIL
A0A3M1XV95      QDLS-IDPQEYQLQLSSMTSRIKAIQKKLLEEAQRIATTSM---VADPLQIIQDLLAKEL
A0A3M1NWV5      QDHT-IDPQEYQMELLSRANRIKAIQKRLQEEAQRIANTSM---VSDPLQIAQELITTKL
A0A3M2I7J5      QDRT-IDPQEYQMQLQSMSSRIKAVQDKLQEEAQRIANTSM---VADPLQIAQKLIAEIL
                                                                            

A0A3M1XW99      ----QLNVLRQRLASTQQQIEESKKKLQRLPQKELELAELVRDQEVKNDIYLKILSRLNA
A0A1F4MQ28      ---IIINSLREKQNRLLSLIQKYSGRIESLPAEESQLAELIRQKEVYAKMFSLLLDKREE
H1XPL7          DTQIQVQALEAKKKALAVVLLDYQKQFDRIPKRSIEFARLQRARLSAEKLYLLVEEKYQE
A0A3M1AHA0      LALQEIDDLNKQIARLESKINQLKFKLKQLPAQQQKLNELTRTNQVLEKQYTDLLAMYRD
A0A3M1P834      IARREMIGIQQELEQTKREIAQQEYKLKQLPARESELSELTRRNSVLAKKYQDLLAKSQD
A0A523HP09      LASQEISLLAGEIRRLSRKAQRLRYNIGRLPAQQQRLGELTRDQQVLEKQYLDLLTQYRD
A0A523HUF7      LASQEISLLAGEIRRLSRKAQRLRYNIGRLPAQQQRLGELTRDQQVLEKQYLDLLTQYRD
A0A523IKD8      LASQEISLLAGEIRRLSRKAQRLRYNIGRLPAQQQRLGELTRDQQVLEKQYLDLLTQYRD
A0A3M1NQ37      EAHIFLKIVQDQIGTYSAKIESEKQRLAGLPTKELQLAELVRNQSLKSNLYEAILGRYNA
A0A3N9NLG8      DVESKVKAGTATINALQEVVSEYGGRLNFLPEKTLELARLERKRKVDEETYVMLTQKLEE
A0A1J1CCX0      DTQIQVQALEAKKKALAVVLLDYQKQFDRIPKRSIEFARLQRARLSAEKLYLLVEEKYQE
A0A3N5JLC6      EVETEIRSLEPKVSAFEKILEQYNAELEGLPTKKLQLARLARSAQVAEKLYVMLQEKYQE
A0A3M2FFC7      NLDAEIKANTAKINTLQEVINTYNAQLESLPVKVLELARLKRRQMVDEQTYMLMTKRLEE
A0A3M1AH62      EVEANIEALKPKVTSLKKIVDDYEAQLETLPDKSLKLARLERSARVDEKIFIMMKEKYEE
H1XXK6          NLSGEITATEAKIAALEDVLKVYNQRLENLPDKVLQLVRLERRKQVDEQTYMMLTQKLEE
A0A1F4N1P8      EAETQIKGLRAKITALQNIMKDYDIQLSKLPNQSLELARLTRELEVDQETYNLMTKKLEE
A0A3M1XV95      TVDNEIKALRAKIEVLSDILSQYEAKLADLPEQSLELARLERQLQVDQNTYVLMTEKLEE
A0A3M1NWV5      QLETQIKGLRAKMDALRDVVQQYESQLEVLPSQGLELARLERQVQVDQNTFILLTQKLEE
A0A3M2I7J5      DVETQMKALQAKVDALREVVDEYELELERLPGQGLELARLQRRVEVDQNTYILLTQKLEE
                     :                    :  :*     :  * *      . :  :      

A0A3M1XW99      AKIENQVEVSDVFIVDYATPPTPKDPLSDLIKK--GLFGVLIALGAGLGMGVVVDFFDKT
A0A1F4MQ28      MRMAELSKLQDIIVVDPAQKPLKPISPRKSLNV---ILALLAGVMLGLTAIFVLEHFEKR
H1XPL7          ATIAEQSQFGYIEIIDQAIVPKLPISPKIRMNL---MLGALLGLGLGVGLVFLLEYLDVS
A0A3M1AHA0      AQITEAVETEDIEILDPAIEPEFPKNLNKKIQA---GLGGIFGLILGIGLAFLLEFLDKS
A0A3M1P834      ATISAAVETGDIEILDPAIVPDAPTNKDKKQKA---ILGGLFGILLGMGVVVVTEFLNKT
A0A523HP09      AQISKAVESEEIVILDEAIRPESHKGLRKPKQA---FIGGVFGLGFGFFFVILLEFFDKS
A0A523HUF7      AQISKAVESEEIVILDPAIVPELPKNLNKKTQA---SMGGVFGLGLGVFFVILLEFFDKS
A0A523IKD8      AQISKAVESEEIVILDPAIVPELPKNLNKKTQA---SMGGVFGLGLGVFFVILLEFFDKT
A0A3M1NQ37      AKIDNEVVVSDIVVIDEAIPP--PWQPEIYVLIKQSLMGFFVALAIGIALAIVIDFFDKT
A0A3N9NLG8      TKIQAAAQSRNVHVIDQAIEPMAAVRPKTNMNI---MLGVLIGLGLGIGLVFLMEYFDNS
A0A1J1CCX0      ATIAEQSQFGYIEIIDQAIVPKLPISPKIRMNL---MLGALLGLGLGVGLVFLLEYLDVS
A0A3N5JLC6      SRITEVGQLGNVRVIDPAKEPYEPILPRKGLNM---LLGVLLGLGFGIALAFTMDYMDDS
A0A3M2FFC7      TKIQEAGQRKEVRVVDEAIEPLFPTKPKKKLNL---ALGVVLGIGLGIGITFLREYFDNS
A0A3M1AH62      SRINEVGQLGDVRIIDPAKPPSEPIKPKKKLNM---ILGMLVGIGLGIGVTFLLEAMDNS
H1XXK6          AKIQESAQARNVKIIDRAIKPNRPVKPNKRMNL---MLGAMLGLGLGVGITFMIEYLDRS
A0A1F4N1P8      TRITEAGQEENIQILDLAILPDSPIKPKKRLNL---MLGALIGLGLGIGLTFLLEYFDDS
A0A3M1XV95      TKISEAGQKENIRIIDLAVEPLNPVKPKKRLNL---LLGALIGIGLGVGLTFLLEYFDDS
A0A3M1NWV5      TKIAEAGQRETIRIVDPAIEPKFPVSPKKKLNL---LLGAVIGIGLGIGLTILLEFFDDS
A0A3M2I7J5      TKIADAGQKDIIRILDRAIEPLSPIKPKKKLNL---LLGALLGIGLGVGLTFLLEFFDDS
                  :        : ::* *  *                :. . .:  *.   .  : ::  

A0A3M1XW99      VKDVEDLNQKVQYPVLGQIPVIQVVEPDE--------------KNLEESRGKIDPKLITL
A0A1F4MQ28      LTNLDDVERLFSVTLMGILPVYDAQLREQ-----------------IRNSKSIEERAVVL
H1XPL7          IRTPEDL-KRRGWQPLSVIPSMDSQMIAE--------------LAQNKENPAIDDHLIAL
A0A3M1AHA0      IKNADEVKKFLKLTVLGSIPQIDFSDVYD--------------FQDSEKLKQIDQQLVTH
A0A3M1P834      LRSVDDVRRYLKLPILGTIPQIDFSDVFD--------------FQDSEKVKQIDQQLVTH
A0A523HP09      VKTVNDVKRFLKLPVMGTIPLLDFSDVFD--------------FQDSEKLKQIDQQLVTH
A0A523HUF7      VKTVNDVKRFLKLPVMGTIPLLDFSDVFD--------------FQDSEKLKQIDQQLVTH
A0A523IKD8      VKTVNDVKRFLKLPVMGTIPLLDFSDVFD--------------FQDSEKLKQIDQQLVTH
A0A3M1NQ37      VDNAEDLQQKLYYPVIGTIPVIQNDESVP-----ENIEEIKG---------KRDPKLITL
A0A3N9NLG8      VKTSEEL-EAMGFNILASIPKIEMDKYEEKLE--SKLEKLGP-----IEGKRIEARLITH
A0A1J1CCX0      IRTPEDL-KRRGWQPLSVIPSMDSQMI-------AELAQNKE-------NPAIDDHLIAL
A0A3N5JLC6      ITSMEDM-DSLGLPLIATIPMIKPDTTGSLF---SRVARIDD-----PEVNAINERLVTH
A0A3M2FFC7      IKTQEEL-EQLGFNILATIPKIEMSKVEEKLE--ARLAKMGP-----MEGKRIEARLITH
A0A3M1AH62      VRTIEDL-EKLGLPVLGSIPVIKEEDAMKRIKVLPQSAQNGN--VDPVHIRRMAARLITH
H1XXK6          VRKPEDM-ERMGYNVLATIPKIELDKVEK-----SKIKQNES--------AKIEARLITH
A0A1F4N1P8      IKNPEEL-EKMGFPILATIPEISSKEVIE-----NVISANGE-SEEMGEARQIETRLVTH
A0A3M1XV95      IKNPEEL-ERMGFPILSIIPQIPLSELAQ-----KILSRNGDKEAEIQEGKQIESRLVTH
A0A3M1NWV5      IKNPDEL-ERMGLPILSIIPQISQDELSR-----PKVAVNGN--GELNEGEVIESQLITH
A0A3M2I7J5      IKNPEEL-ERMGFPILAIIPEISQEDVVS-----KKFSRNGQ--GQLSEEQLLESRLVTH
                :   :::        :. :*                                   . :. 

A0A3M1XW99      DYSPTLESESYRDLRTKILFRNKNQNLHSFLVTSLQPNEGKSLLTSNLAITIAQQKISTL
A0A1F4MQ28      IKEQYAFKEMYRLLRTKIGNIPGG---KMMMFTSCEENTGKTTVISNLALSFAKMGKKVL
H1XPL7          LSPRSSVAEGYRRLRTNLQYARLDKPLKSFLVTSPNPKEGKTTTASNLAITFSQAGLNTL
A0A3M1AHA0      DYSPTPIGEAYRSLRTNILFSRERGQLQSMVITSNEPGDGKSFTAANLSITFAQLKSNTL
A0A3M1P834      DYSPTPIGEAYRSLRTNLMFTKETGRIRSLVITSNEPGDGKSFTAANLSITLAQLRSNTL
A0A523HP09      DYSPTPIGEAYRSLRTNLLFSKEHGKIQSLVTTSTEPGDGKSFTTANLAITFAQLKTNTL
A0A523HUF7      DYSPTPIGEAYRSLRTNLLFSKEHGKIQSLVTTSTEPGDGKSFTTANLAITFAQLKTNTL
A0A523IKD8      DYSPTPIGEAYRSLRTNLLFSKEHGKIQSLVTTSTEPGDGKSFTTANLAITFAQLKTNTL
A0A3M1NQ37      DYSPTLESESYRDLRTKILFMNQNKNLSSFLVTSLRPGEGKSLTASNIAITIAQQKISTL
A0A3N9NLG8      LDPKSPVAEAYRTLRTNLQFSKIDRQLKTILVTSSGPKEGKSTTAANLAIAMAQVGNKVV
A0A1J1CCX0      LSPRSSVAEGYRRLRTNLQYARLDKPLKSFLVTSPNPKEGKTTTASNLAITFSQAGLNTL
A0A3N5JLC6      LKPKSPVSESYRSLRTNILFTAPENPKQVILVTSSGPREGKSTSVANLAIIFAQMGAKTL
A0A3M2FFC7      LDPKSPVSEAYRSLRTNIQFSRVDQKIKAVLVTSSGPKEGKSTTSANLAIAMAQSGKRVV
A0A3M1AH62      FAPKSPISEAYRTFRTNIQYTQVDKPIKSLLVTSPGPGEGKSTSVANLAITMAQMGSRVI
H1XXK6          IDPKSPVSEAYRTLRTNLQFSKIEKDLKTILVTSAGPKEGKSTTAANLSIALAQAGNRVV
A0A1F4N1P8      FDPKSPVSEAYRTLRTNIQFKNKKTKQHVILVTSSAPKEGKSTTVANLAITMAQMGNKTV
A0A3M1XV95      FDPKSPVSEAYRTLRTNIQFKNLKNTNPMILVTSSAPKEGKSTTVANLAITLAQMGARVL
A0A3M1NWV5      FDPKSPISEAYRTLRTNIQFQNLGTDNLSLLVTSSAPKEGKSTTLANLAITMAQMGSRVL
A0A3M2I7J5      LDPKSPISEAYRTLRTNIQFKNLRQKENTLLVTSSAPKEGKSTTIANLAITMAQMGSRTL
                        * ** :**::           .: **     **:   :*::: :::    .:

A0A3M1XW99      LIDGDLRRGVQHSTFGNKKK-PGLSDFLVSRATIDYDNVSKVIHPTF-I--PNLFLIPAG
A0A1F4MQ28      VLDCDLRKGKIGKFFDLPENARGMIDYLSNNQNRP-----EVYNNFSFLTQQTLAVVPNG
H1XPL7          LVDTDLRRPAIHRLFGLPKE-PGLTNHLFGQNTLD-----EITHKEV-I--PHLSVMTSG
A0A3M1AHA0      LIDGDLRRGVLHNTFGVPKE-PGFSNYLTSMIPIQ-----HIIHETH-I--PNLSLITCG
A0A3M1P834      LVDGDLRRGVLHNTFGVAKE-PGFSNYLQDVVPLQ-----SILNPTQ-I--PNLTLISCG
A0A523HP09      LIDGDLRRGVLHNTFGLPKE-PGFSNYLTRMVPLQ-----SVLYETH-I--PNLTLITCG
A0A523HUF7      LIDGDLRRGVLHNTFGLPKE-PGFSNYLTRMVPLQ-----SVLYETH-I--PNLTLITCG
A0A523IKD8      LIDGDLRRGVLHNTFGLPKE-PGFSNYLTRMVPLQ-----SVLYETH-I--PNLTLITCG
A0A3M1NQ37      LIDGDLRRGVLHNEFGNKKR-PGLSDFLISKATVDHDNVNKLIQKTF-V--PNLYLISTG
A0A3N9NLG8      LVDADLRRPVIHSIFGIDKE-DGVTNYLMGKNNFE-----ETIKSTF-H--ENLFIFTSG
A0A1J1CCX0      LVDTDLRRPAIHRLFGLPKE-PGLTNHLFGQNTLD-----EITHKEV-I--PHLSVMTSG
A0A3N5JLC6      LIDADLRRPMLHKLFRVNQQ-PGLTNVLIGQKQLE-----EAITAVPDV--LNLSLLTCG
A0A3M2FFC7      LIDADLRRPVVHSIFGMDKD-EGLTNYMMDDIDYD-----TMIKKSI-M--DNLYVIPSG
A0A3M1AH62      LVDADLRRPVLHSVFDTDRR-IGLTNVLVGRVSLD-----DAVKETE-I--NNLYLLPSG
H1XXK6          IVDADLRRPILHSVFGTTKE-EGLTNHLAGSISYE-----QVFKETV-V--ENLSLVTSG
A0A1F4N1P8      LIDGDLRRPVIHSIFNMKKE-NGLTNYLIGNATLK-----EIVRPTF-V--EHLAVIPSG
A0A3M1XV95      LVDTDLRRPVIHSIFNLKKE-KGVTNFLLGKMTFE-----EVIKPTI-I--DNLFVCTSG
A0A3M1NWV5      IVDTDLRRPVVHSIFKLKKD-KGITNYLMGKLPFE-----DIVKPSF-V--ENLYIVTSG
A0A3M2I7J5      LVDTDLRRPVLHSLFNLKKD-KGISNYLVGKLTFD-----EIVKSTF-I--DNLFIVTSG
                ::* ***.      *       *. : :                         * : . *

A0A3M1XW99      SPIPNPTEVIGSTRMQDLLQLLGTKFGMIVLDTPPISASSDVAILANLVDGALIVVRAGY
A0A1F4MQ28      GYTDDSSELLSAMAVKSMLEDFQKAYDYILIDTPPITKVSDVLILGDFVKDIILIVRPFL
H1XPL7          LVPPNPSEILAAPQTHELIDRLKSMYDLVIFDTAPVLAVTDASILATQVEGTLLIILAGT
A0A3M1AHA0      SLIPNPSELLASHQMKRFLDEMRRKFDLIIFDSPPLNAATDAVVIGTQVDATILVIRAGK
A0A3M1P834      SLIPNPSELLGSHQMQRFLDEVRRKFDLIVFDTPPLNAATDAVVLGTQVDGTVIVIRAGK
A0A523HP09      SLIPNPSELLGSQQMRKFLDEVRRKYELIIFDSPPLNAATDAVVIGTQVDAAVMVIRAGK
A0A523HUF7      SLIPNPSELLGSQQMRKFLDEVRRKYELIIFDSPPLNAATDAVVIGTQVDAAVMVIRAGK
A0A523IKD8      SLIPNPSELLGSQQMRKFLDEARRKYELIIFDSPPLNAATDAVVIGTQVDAAVMVIRAGK
A0A3M1NQ37      SPIPNPTEMLGSERMVNLMNLLKSRFGMIILDTAPFQASSDSAILSTLVEGTIVVVRAGY
A0A3N9NLG8      ILPPNPSELLASQKMEQLLHKLNENFDTIILDSPPVIAVTDAAVLSTKVDGTILVVSSGQ
A0A1J1CCX0      LVPPNPSEILAAPQTHELIDRLKSMYDLVIFDTAPVLAVTDASILATQVEGTLLIILAGT
A0A3N5JLC6      INPPNPAELLGSERMNILLQKMRQEYNMVLIDTPPVNAVTDPSVLARAVDGVILVVRSAS
A0A3M2FFC7      VLPPNPSEMLESEKMKKLLERLRNDFDFVLFDTPPIIAVTDAAILGTIVDGAILVVKAGQ
A0A3M1AH62      TLPPNPSELLGSTAMKQLLDELKQRFDMVLFDSPPIIAVTDAAVLSSKLDAVIVVVKSAQ
H1XXK6          VLPPNPSELLASKKMEDFLNKLCEDFDIVVLDSPPVIAVTDASILSTKVDGTLLVVYAGQ
A0A1F4N1P8      PLPPNPSELLGSDEMKKLLEDLKNQFEVILFDSPPVIAVTDAAIMSTLVDGIVLVIKAHQ
A0A3M1XV95      PLPPNPSEILSREEMKEFITIAKQQFDYLLFDSPPIIAVTDAAILASMADGCLLVIKAHQ
A0A3M1NWV5      PLPPNPSELLASEAMENFVQEARNNFDVVLFDSPPIIAVTDAALLSSKVEGVILVIRAHQ
A0A3M2I7J5      PLPPNPSEMLSLETMDEFIDRARREFDVVLFDSPPIIAVTDAAVLSTKVDGMLLVIRAHQ
                    :.:*::       ::      :  :::*:.*.   :*  ::.   .  :::: .  

A0A3M1XW99      TNVEELVGRLHEYPSVEEKIMGLVLNMVKVDRKKNQ--------YTYSYYNY--------
A0A1F4MQ28      TYKEAIRGALEEMRQAGLNLQGVVVNGFNVGKS-----------AYYYRYGHGYNYQTIS
H1XPL7          TIFDELEHSIEQLERVNAHILGVAMNNFDIKRAYGSYYGQYKSRYYGYYGYYTYGHTGGK
A0A3M1AHA0      TDRDLARQKLELFSNVPANIIGVVLNGTTADLAHPG--------YSYYHY----------
A0A3M1P834      THRDLAKSKLELFSNVPARVIGAILNGTTADMAHPG--------YSYYHY----------
A0A523HP09      TNREFANQKLELFANVPAKVLGVILNGTTSDMAHPG--------YSYYHY----------
A0A523HUF7      TNREFANQKLELFANVPAKVLGVILNGTTSDMAHPG--------YSYYHY----------
A0A523IKD8      TNREFANQKLELFANVPAKVLGVILNGTTSDMAHPG--------YSYYHY----------
A0A3M1NQ37      TNVDLLNKKIAEYPNIQEKLIGVVLNMVKINVKKDE--------YSYSYSYYNY------
A0A3N9NLG8      TNKDALGKAFNLLNSVNSKLLGVLLNGVDVKGLYGS--------YDYYYYHHYYTKPGKG
A0A1J1CCX0      TIFDELEHSIEQLERVNAHILGVAMNNFDIKRAYGSYYGQYKSRYYGYYGYYTYGHTGGK
A0A3N5JLC6      TQRGSAFVAVEQLRRVEAPLLGIILNSVSRTSYYGS--------YYHEEYYYYYTADGEK
A0A3M2FFC7      TNYDALVRAKSLLDAVNTRILGALLNGVEVGGMYGS--------YYYYYYHHYYSKPGGK
A0A3M1AH62      TDREAAFRATALLKNVKTHVLGALLNGVRIESMYGS--------YYYYYHYYYYGKEGDR
H1XXK6          TERDAIKRAANMLNSVSARLLGIVLNGFDVQGIYGS--------YYYYYYHHYYGGEGKS
A0A1F4N1P8      THREAIKRAKSLLDTAEARIFGSLLNGVNIQKTYGT--------NYYYYYYQYYQYYGHD
A0A3M1XV95      TRKDVVQRAKTLLENVNAKIFGCLLNGVNVERAYGSY-------YYYYYYYHYYNYYGHD
A0A3M1NWV5      TQKEAVKRAKTLLDNVHARIIGCLLNSVDIERAYGS--------YYYYYYYHYYSYYGHD
A0A3M2I7J5      TQRNAIKRAKNLLDNVNAPIVGCVLNSVSIDRAYGS--------YYYYYYYHYYSYYGHD
                *                  : *  :*                                  

A0A3M1XW99      --------------------
A0A1F4MQ28      ES------------------
H1XPL7          KAKKKRTETS----------
A0A3M1AHA0      --------------------
A0A3M1P834      --------------------
A0A523HP09      --------------------
A0A523HUF7      --------------------
A0A523IKD8      --------------------
A0A3M1NQ37      --------------------
A0A3N9NLG8      MKRLKSS-------------
A0A1J1CCX0      KAKKKRTETS----------
A0A3N5JLC6      KHKSKAKSSQEKSVNSQKSA
A0A3M2FFC7      KKRRY---------------
A0A3M1AH62      KRKKKKKRRSKT--------
H1XXK6          KPKRKFI-------------
A0A1F4N1P8      LKRRKRSIA-----------
A0A3M1XV95      LQRRKKSKIF----------
A0A3M1NWV5      LKRRKRTKIT----------
A0A3M2I7J5      LKRRKKARA-----------
                                    

© 1998-2020Legal notice