BYKdb

Dataset for cluster tadcd of phylum calditrichaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

23 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A6H9KM88      ------------------------MDNNEDIKQLNFQDYLRIIRKGKWIIITSFISILSL
A0A3M1XW99      ------------MNYPKLENGKAPSRRIVTGAEQEVFRYLRIIRKRKTVIAITAFVVLAI
A0A1F4MQ28      -------------------------MEHTSAQGLDIRLIFQVIERKKNYLIGVVLFFLVL
H1XPL7          -MSSEKMNMGEGYPGNGKPLAQSYTGFENEEEVMKLQDYLQIILRRKWIVLVSFLVVFLT
A0A3M1AHA0      -----------------MEQFYLDDENSYQDEKIDLQKYIRVLIRRWKLVFSVTILVTVP
A0A6H9L3A8      -----------------MEESYFEDEEIQGEGSIDITRFWRAILKKWWLWSIVTMAVSIP
A0A3M1P834      -----------------MDSYFLDEEESLDVETLDLRRYYRALIKKWWLVAIITLAVTVP
A0A523HP09      -----------------MESVFLDDEEF--EEKIEIRRYFNAVVRKWWLVLIVTIAVTVP
A0A523HUF7      -----------------MESVFLDEEEF--EEKIEIRRYFNAVVRRWWLVLIVTIAVTVP
A0A523IKD8      -----------------MESVFLDEEEF--EEKIEIRRYFNAVVRRWWLVLIVTIAVTVP
A0A6H9KUR6      -----------------MNEIQPQSGIFAEERTLSIADYLRIVRRRWWLIVLCFIMISAG
A0A3M1NQ37      --------------MNMTNGQPKNFQKTENVAEQEIKKYLRILKKRKWVILTVWFVLFLI
A0A3N9NLG8      MIIFFTFDVIGEYTLFEENELE-----LESGSQVSISDYLKIIYRRRWLIIITFLVVFGI
A0A1J1CCX0      ------MNMGEGYPGNGKPLAQSYTGFENEEEVMKLQDYLQIILRRKWIVLVSFLVVFLT
A0A3N5JLC6      ------MNEYNTYPGDGNGKVQSLPA-RPPERKMTLNDYRRIFFRGRYVVLITFGIILLL
A0A3M2FFC7      -----------MNHPSVEAGIE-----NPGQQNVTLTDYLRIIYRGRWIVLFSFLVVFTG
A0A3M1AH62      --------------------ME-----EQLEREITLKDMMRILYRGRWVITSCFLAVMAL
A0A6H9KRD7      ------MLYLRINRKRNSSKMD-----EKFERELTLKDLVRVFYRGRWVIISCFSIIMFL
H1XXK6          --------METRVPGNFETDTW-----EGDEQPLHLTDYIRILYRGRWLIILSFIAVFSA
A0A1F4N1P8      --------------MNEFEDLQ-----QPEEEQVSLQDYLRILYRGRWIIIISFLVVMIA
A0A3M1XV95      --------------MENQFEFQ-----Q-DEQQITLQDYLRILYRGRWIIVASFLSVLLV
A0A3M1NWV5      --------------MENFAEFQ-----E-NEQQISLQDYLRILYRGRWIILTSFVVVVLA
A0A3M2I7J5      --------------MENYPELM-----E-QEQQITLQDYLRILYRGRWLILGSFVVMLLG
                                                   .    . . . .         .   

A0A6H9KM88      TVYYT--FTAKQIFETKTKILIEDPNQKNKVTPGQFLLEGFGRDTKLTNQMEILRSNIIL
A0A3M1XW99      WLGFIVAFQATPVYESSVILTFQDTK-------NTSVAEGGSKKDVNWSRASLVLTHSLL
A0A1F4MQ28      VLLYN--FLATPVYQSSVLIKKEQIY-DYRDPDPLNRIMSRQTTDEIDTEIEINKSRSVL
H1XPL7          AVVYT--INSQPVYQAQATVLVNTQSKGQGGLLLFDPTGLGFAQN-LNNELEILKSRSVA
A0A3M1AHA0      WVIYT--LKQPPVYEAKAVIRFKSYE--------------GKDPTLTESRTTVLTSRTFA
A0A6H9L3A8      WVLFV--KAEKPIYQATSIIQFQQFD-------------GQTSQQALQYQIQRLTSRSFA
A0A3M1P834      WAIYL--KSQPPIYEAAALIRFKNFA-------------GGDDVSLIQTRNTELRSRSFA
A0A523HP09      WVLYT--LSKPLEYEAQAVVQFNSFE--------------GNDPTLTESRETVLTSRSFA
A0A523HUF7      WVLYT--LSKPLEYEAQAVVQFNSFE--------------GNDPTLTESRETVLTSRSFA
A0A523IKD8      WVLYT--LSKPLEYEAQAVVQFNSFE--------------GNDPTLTESRETVLTSRSFA
A0A6H9KUR6      TAFYT--LNQDPVFQAASTIMVQEDG-GMQS-VLFDQNALFGKQDEINDQVYLLKSRSIA
A0A3M1NQ37      WEVFISFFSKGPLYTAKTLLSYQDPR---------TMSALEGRVVNYKSPMNLITSNKVL
A0A3N9NLG8      TCFVT--FTTEPEYEASTTIMIKSTG-AMER-TLFEFDYMGAQTTLISNQIEILKSRTLA
A0A1J1CCX0      AVVYT--INSQPVYQAQATVLVNTQSKGQGGLLLFDPTGLGFAQN-LNNELEILKSRSVA
A0A3N5JLC6      TALYT--FLQKPVYEANVRLMLQDNS-SVGQ-SLFDLTSAMKQETMLNNQVEILKSRTVA
A0A3M2FFC7      TVYYT--FTTDPVYDATTTLIIDKSN-AMEN-ALFDFNSFGNQSTHISNQIEIIKSRTIA
A0A3M1AH62      TVYYT--FTVTPEYEASAKVMIRTDA-TSGIPSLFDMGGVLKQETVINNQVEILKSRTLA
A0A6H9KRD7      TVYYT--FTVTPEYEAASKVIVQEES-ARGM-DIFDIGGFIQQETMINNQVEILKSRTLA
H1XXK6          TVLYT--FTTDPTYEASAVLLVESND-SMDR-ALFNLTTFGTQTNLLNNQIEILKSRNIA
A0A1F4N1P8      TVYLT--FTTPKVYEAVGTLIVESQG-SMER-NLFDFAYSGNQTTLITNQVEILKSRKLA
A0A3M1XV95      TAYVT--FTADPVYESTAKIMVESQG-SMER-ALFDVTYLGNQTTLITNQVEILRSRMLA
A0A3M1NWV5      TAYFT--FTATPVYEATAKILIEDKN-SMEK-ALFDINYLGNQSTVIQNQLEILKSRTLA
A0A3M2I7J5      AFYLN--YSTEPEYQASAKILVENPS-ANKL-ALFNVDYLNMPSTFITNQVEILQSRTLA
                             : :   :                                   :. . 

A0A6H9KM88      GEVADSLMNSPFKNR------------------LEILGNQDKDIKEKSSFLSVLVTQLQN
A0A3M1XW99      SKVVEKLQLNFSMIT--------------------------DNVDQDEVFRYLKVSKEAK
A0A1F4MQ28      EKVVLEKKLFLQIESIKLSKGKNINLNYSYPLYEQWLGIESPWKEQLPRFENIQLKPDEV
H1XPL7          NAVARELLAKKYYDN------------------------------SQEILHCIRAPEEDE
A0A3M1AHA0      EQVVAQMGLSMKIKS----------------------DAMKR-LKRKEIFQHFSTTKDPV
A0A6H9L3A8      EEIVKEMGLVLEVES----------------------YIENRPPVRHEIFSNFSTSGSPV
A0A3M1P834      QRVVAQLGLCLVLEQ----------------------KTEDGFLNRSDIFAEFSTTQTPV
A0A523HP09      EKVVAQMGLSVDIES----------------------DEQNQ-LSRRSLFSQVYTTQNPI
A0A523HUF7      EKVVAQMGLSVDIES----------------------DGQNQ-LSRRSLFSQVYTTQSPI
A0A523IKD8      EKVVAQMGLSVDIES----------------------DGQNQ-LSRRSLFSQVYTTQSPI
A0A6H9KUR6      EHVIQEVMRSDYSKT----------------------LPIIK--------NGVELALEAH
A0A3M1NQ37      GEVIEELQLNLSIQT----------------------GFISK--------SRLFDFLDVD
A0A3N9NLG8      ERVIKSLNLSDVRDS-------------------------------------LNLFKPNE
A0A1J1CCX0      NAVARELLAKKYYDN----------------------SQEIL--------HCIRAPEEDE
A0A3N5JLC6      ERVIRNLLKSPYSHR-------------------------------------LRVLQRPD
A0A3M2FFC7      ERVIKRMELSNVRDS-------------------------------------LSLFHPND
A0A3M1AH62      ETVLHRLQQSDLADK-------------------------------------LEILGNGE
A0A6H9KRD7      ETVIKQLQDSELANQ-------------------------------------LEILRTGK
H1XXK6          ERVVKRLEKSAYRDS-------------------------------------ISFFKKLE
A0A1F4N1P8      EKVVRTLEEDVYRDS-------------------------------------LKIFQPAD
A0A3M1XV95      ERVVHYLESVPYRDS-------------------------------------LQIFQPDE
A0A3M1NWV5      ERVVLRLQSAVYRDS-------------------------------------LEIFQPDE
A0A3M2I7J5      ERVVAELESADFRDS-------------------------------------LSIFQPTS
                  :                                                 .       

A0A6H9KM88      KA---------RAFVNKFLKRENESSNNNNSISISSTISPTQISSKKQNLIKSLKGSIGI
A0A3M1XW99      TGYYRLVHEGGEFQIYYSKDDDDNPGELLKRFAA-------SDTIDVNQLVLAVNPGFFE
A0A1F4MQ28      SHDYHLKLFGDNQYLIL-----------DAEKDNVIMSGSDLNNSAFNLPNLIFTMQWSA
H1XPL7          LG---------------------------------------REILSEEELTGVLIRTVEF
A0A3M1AHA0      PGDYLLRLNNDATYSLFILL-DDKR---KRKIKEGLVNQILDSPLSANGFNLQISPNLLN
A0A6H9L3A8      TGKYVMRFPGDGTMTLYKLPPEDEPEIAEQKLHFGYVKDDIDSLVTVNGLYFKLANKLPV
A0A3M1P834      SGDYFLRLTADGRYSLSMIIPDTER---EKQLKTGSVADITNGLCVVNGLSFRLVRNVPL
A0A523HP09      PGKYFFEFNENYSYKLSMML-DEDR---EKIVSEGLISEISQKALNVNGFSIQMAQDFSK
A0A523HUF7      PGKYFFEFNENYSYKLSMLL-DEDR---KKNVSEGLISEISQKALNVNGFSIQMAQNFSK
A0A523IKD8      PGKYFFEFNENYSYKLSMLL-DEDR---KKNVSEGLISEISQKALNVNGFSIQMAQNFSK
A0A6H9KUR6      HENYEGQPV--------------------------------DTVRIMQQARAYAVGKLRA
A0A3M1NQ37      RNSVVGDYKLVRKGETFDLLYKYEP---HGIKEYKLLTFAVDDTVAVNKMKFKLNKPFVL
A0A3N9NLG8      KG---------------------------------------EYLSMRGMIGVIRG-NMDV
A0A1J1CCX0      LG---------------------------------------REILSEEELTGVLIRTVEF
A0A3N5JLC6      TLN-----------ASLQMLNWLSL---DSKKDWS------ESEVFDEQVKNLRE-ELDV
A0A3M2FFC7      DG---------------------------------------EYLTLREMAQIIRE-NMEV
A0A3M1AH62      HGH-----------RSPGMIASFTG---FIKGIFGIESEESNEYTFEDMVQELLDERLSV
A0A6H9KRD7      YAE-----------DPKSMIAGFKN---TIKNVLGLMSSE-DEYTIDDKVEELMQQRLSI
H1XXK6          DG---------------------------------------SDLTFNQRVAIVMS-SLEV
A0A1F4N1P8      DG---------------------------------------SYMTSRSQVNWIME-HLEV
A0A3M1XV95      SG---------------------------------------VYMTFRDQVEWVMD-NLEV
A0A3M1NWV5      NG---------------------------------------DYMVLRDQVDWILD-RLTV
A0A3M2I7J5      RG---------------------------------------DYLTLREQIDWILD-HLTV
                                                                            

A0A6H9KM88      KPLKES----------------------------DILEITVRGASPFEVAFIARVITEQY
A0A3M1XW99      QHNIHELRWQVRDVNEAVDKLRNKINYML-DKSRTILTITVSHKNPKRAAQIANTLAELF
A0A1F4MQ28      ASAGSEVYFNVQNLEIVVEQLAERISIRKIGKT-KIFQLSVKSDSPFEAQLLAATVVDKF
H1XPL7          EPVRDS----------------------------EVIKIIAKSGDPRDAALIANQFARAY
A0A3M1AHA0      VPQDIE--FTILPFREAVKEFQSKTNVSW-NRSGTLMTLTMTDEDPYLAAKMTNRLAEIF
A0A6H9L3A8      FPDEVF--FNIKNFRSSVSSFQDRVNINF-GRTGSIMEVTLNDHDPFLVAEMTNRLAQIY
A0A3M1P834      -PLEVP--FRIMSFRSAVESFQSRINVRWEDRAGTLMRLTLTDTDPKVVAEMTNRLAEIY
A0A523HP09      TPKDLT--FTVHPFRDAVKNFRSKTGTNW-NRSGNLMTITLTDEDPDLAAKMTNRLAEIF
A0A523HUF7      NPQDLT--FTVHPFRDAVKNFRSKTETNW-NRSGNLMTITLTDEDPDLAAKMTNRLAEIF
A0A523IKD8      NPQDLT--FTVHPFRDAVKNFRSKTETNW-NRSGNLMTITLTDEDPDLAAKMTNRLAEIF
A0A6H9KUR6      GLTADPVIDTN-----------------------YFIEIRVKGSSPFEAAYLTNLVATIY
A0A3M1NQ37      GYSKDEIEFKIRPFEMVIESLRRLIQFRSEDRYGTIFTISVKHYNPNRAAKIANTLAKKF
A0A3N9NLG8      SHRKDT----------------------------DIITLTYTSNSSFDAAFIANTIAEEF
A0A1J1CCX0      EPVRDS----------------------------EVIKIIAKSGDPRDAALIANQFARAY
A0A3N5JLC6      RHIRNT----------------------------DMMQINFRAHSAFEAYFVANALADVY
A0A3M2FFC7      INKKET----------------------------DIIEITYSAPSAFEAAYTVNAIAQEY
A0A3M1AH62      TPIRDT----------------------------EMIEIKVRAVSPEEAAFITNTLTAAY
A0A6H9KRD7      TPIRNT----------------------------DMIEIKVTAVTPEEAAFIANNLTSAY
H1XXK6          EPRRDT----------------------------DIITLTYRAGSPFEAAFLANVISEEF
A0A1F4N1P8      NPKKDT----------------------------DVIEVKFQAGSPFEAKNIANEVIQNF
A0A3M1XV95      TPKKDT----------------------------DIIEIKFSSRTPFEAAAICNVIAEAF
A0A3M1NWV5      TPKQET----------------------------EIIHVTFQARSPFEAARICNEVVVTY
A0A3M2I7J5      TPKTES----------------------------DIIEIVYVASTPFEAATVCNVIAESF
                                                   .: :      .  .      .   :

A0A6H9KM88      KRNNIFYNKNEISSVKKFIEASLQRIQTDLRNSEELLKQFKETENVIALESEVESLIDQL
A0A3M1XW99      VDMNLHLRRRQSDEVVSILQNQLRVAKADLDAANERLRRFRERNPWVTLSKGDNAQINVV
A0A1F4MQ28      REVRLEQKQQTVKYSYDFADQQLQQIDQKLKAAEDTLSKFKSKHKITSIDDNSAEVVDFL
H1XPL7          YERNLRMSRTRSKAAREFLEKQLIAKQEQLAKAEEALQRYMEQTGIVSVDDESQKVIEQL
A0A3M1AHA0      VEESASLKKKAVEKKRELLEEQVRLAKAKLDESERALKEFKEKYAI-NLDAEQQTQLNQM
A0A6H9L3A8      IRETVVVTKGTEGQYGQLLRERLDSAEQKMRAAQDALSQYRALHGM-DLAAELKKLNTDL
A0A3M1P834      IAQSSSVKKEMSQARVKILEEQLQKAREELEASERELVQFKKKYEV-ALDADQKGQLNQL
A0A523HP09      VEESVSLKTSDIKRRSELLEEQVNLAKSKLDEADRALKEFKENNAI-DLNAEQETQVNQL
A0A523HUF7      VEESVSLKTSDIKRRSELLEEQVNLAKSKLDEADRALKEFKENNAI-DLNAEQETQVNQL
A0A523IKD8      VEESVSLKTSDIKRRSELLEEQVNLAKSKLDEADRALKEFKENNAI-DLNAEQETQVNQL
A0A6H9KUR6      QNQDQILSQGEIREVVDFLEEQLSKKELDLKSSEEELKSFQEKENIADLSGDTQELINQL
A0A3M1NQ37      IDLNIKLRHHKGAQKLKILENQLQLAKKELDEANAKLKAFRKRYPWVVLTPTAGSYVTSV
A0A3N9NLG8      RSLNAEENSGELSELRNFVERQLEKKSEELKLSEDRLREFQEKEKLTSLDENTSELVNTL
A0A1J1CCX0      YERNLRMSRTRSKAAREFLEKQLIAKQEQLAKAEEALQRYMEQTGIVSVDDESQKVIEQL
A0A3N5JLC6      ERISQEESQAEVRQVKEFLEEQLKLYEQELKHSEEQLKSYQESAHVVALDNETIELVQKI
A0A3M2FFC7      ADASVEFNQGELKDLRKFLEEQLRKKGQELTSSEELLRDYQERERVASLDEETSELITRL
A0A3M1AH62      REKNRLMSQEEVRQVKNFLEEQLQVVKKQLAESENKLKQFKETQKVVALSHETEELIKKL
A0A6H9KRD7      QEKNRSMSQEEVRQVKEFLEEQLTTIQTQLAKSENALKDFMQTKKVVALSHETEELIKKL
H1XXK6          AKLNAETNRMEVSEMRKFIEDRLAIKAKELKESEEALKEFQEREKIASLDAETQELVTRL
A0A1F4N1P8      RMLNIELNKQELVDLRDFLEEQLQIKREELRNSEEALKNYREKEKLISLDKETSEAISRY
A0A3M1XV95      RDLNREFNRSEFRELRQFLEKQLASKEKELRSSEEALKNYREEHRLVHLDEETSDLVSRV
A0A3M1NWV5      QQLSKEVNLSEFKDLRQFLELQLRKKSEELKQSEEALRLYREREKLVSLEESTKELISQL
A0A3M2I7J5      QKLNRDFSRSELRELRRFLEFQLKKKSEELRQSEEALREYREREKLVSLDAVTSELISRL
                                 :    :     .:  ::  *  :        :           

A0A6H9KM88      TQFEVLEINAQTSYLSTQKQLDV------LKSQLDKT----KLNLVDVMANASSPKIVSL
A0A3M1XW99      SSLQLTKNQIEQTLND-------------LQALVERTAQAADPAVKFSTARELVTYLTDM
A0A1F4MQ28      SKLETEKVNTDLELTEYENKIQE------MRREVKNRGYFDQTYLTPESNNESYSPFSVL
H1XPL7          ATVQAQYENVSIELESVKESLNF------YRKQIARQ----EPNVARIMSDASDPYIRLL
A0A3M1AHA0      VAAEQEKENLVAYKKA-------------LKGLLARL----DSETLSSSGDGNT-QAQLN
A0A6H9L3A8      TRYKENYEILRDNNLA-------------LTQLKKKI----KTI--NGGGEINPEELNTN
A0A3M1P834      ALLEKKRDDLETTLKT-------------LNDLLQKK----EEEERALAGPDADPYATDL
A0A523HP09      VVEEQQKRNLETYRNT-------------LKSLLSKL----DDE--LLSGNGNSITASDN
A0A523HUF7      VVEEQQKRNLETYRNT-------------LKSLLSKL----DDE--LLSGNGSSITASDN
A0A523IKD8      VVEEQQKRDLETYRNT-------------LKSLLSKL----DDE--LLSGNGSSITASDN
A0A6H9KUR6      AEFETLYNSALTDLKAYEKRLEY------LNQQLGIQ----KKNLQNNIAQISNPLILKL
A0A3M1NQ37      SNYEEKKQQAEMTVADIQNYLKNLNNSQGLDEKINNT----RELLTY-LGGQGRPVIPEY
A0A3N9NLG8      SGYEAKLEQAQIELRSNLELKKS------LEQQLNER----KETLSTDLSEISSGYLLSL
A0A1J1CCX0      ATVQAQYENVSIELESVKESLNF------YRKQIARQ----EPNVARIMSDASDPYIRLL
A0A3N5JLC6      TDFETLYNSARTDLLAARQRLDY------IDSELARQ----NTNFDIE-TISKTTALEEF
A0A3M2FFC7      SAVEAELEQSQVMLQASLEMKNS------LEKQLDER----RETVSSELSEISTPYIQTL
A0A3M1AH62      AEFETLYNEAKTELNSFKERLSY------IDKQLGKS----KQNFDIE-SISATTYFEEL
A0A6H9KRD7      AEFEGFYHEALTSLNSFKERLAY------INEQLGKN----RQHFDIE-SISADAYFEEL
H1XXK6          SETESFLEQARIELNSKLQLKKN------LEEKLNER----KETLPANLSEISTPYIQTL
A0A1F4N1P8      AESQAQLEQALVEMDAYLEQKKS------LEDQLENR----RSSFSTEISVVSSPILEQL
A0A3M1XV95      ADIQSQLDAAMVELEAAQENKRN------LEKQIDER----RQSLSIEVTQVSSPLLKEL
A0A3M1NWV5      AESQAELEASMVELESLQEQKRN------LEKQLEER----RKALSSEVTQVSSPLLVEL
A0A3M2I7J5      AEVQAELETAAIELEAAQEKKHN------LEKQLEER----RETLAVEVSQISSPLLQEL
                   :                                                        

A0A6H9KM88      REEMLALDRIIATYIASGIEKTH--------ERISALKKKRDFIRKDLIAETKRFINSEL
A0A3M1XW99      KVALA----------------------PAFEKEYNDLVVKRNTLLQQYAPTHPFVVQVEK
A0A1F4MQ28      LRQLSDLELKRLELL---------QKRKDTHPDVVTINEQISQIKAQLTDYNQNTIIAYQ
H1XPL7          QEEIARLEVEK---DITISQNPHAAEDPIYKEKLIKIDSQIDNLRKKLRKRTNDYLKSVL
A0A3M1AHA0      RRYIFRQIAEHPVFDNN-------ATMLVYRAKLLDLEDQWKQVVDVSSAENPKAKEIDA
A0A6H9L3A8      LRDIYHQILELSIFEND-------VDAKLALGKFERYEKKYDDQVRNTSEKNKKSIEFAT
A0A3M1P834      R-YVMNEIASHPAFDGS-------AAMLIKRSRLKDLETQWRAIVNSTTERNIKARQVLA
A0A523HP09      RKYIFSQLAEHAHFDNN-------STMLLYRQKLRDETESWRAIVASSSERNPRAISIDL
A0A523HUF7      RKYIFSQLAEHAYFDNN-------STMLLYRQKLRDETESWRAIVASSSERNPRAISIDL
A0A523IKD8      RKYIFSQLAEHAYFDNN-------STMLLYRQKLRDETESWRAIVASSSERNPRAISIDL
A0A6H9KUR6      RDELAEIERKASSFLSQDVSEDN--------PNLKKLRSRQETIKERLITETKKLVLGGL
A0A3M1NQ37      LRRFNELETERNTLLSTYAPSHP---------LVLKNQEAIEDLIQKIITEAHIF-----
A0A3N9NLG8      QSQLAQAEAEKTKYMMAIQSEVQDASKQHFESRLKVYDERINALREKLNEEAKKISSSNM
A0A1J1CCX0      QEEIARLEVEK---DITISQNPHAAEDPIYKEKLIKIDSQIDNLRKKLRKRTNDYLKSVL
A0A3N5JLC6      TRKIAEKEAQLAVYQSETIQKGE---SQFTRRQIETLQRQIDALKAQFKQNVKNIAANQF
A0A3M2FFC7      QEELARIVAEKTKYETAVASQATGVNSDYFNAQIAEYDSKIKSLKQRLEEEAKKLSTSSM
A0A3M1AH62      KKEMATLQTKRASYVANMINQGV-YNKND--IQLQKYDEQISILTDKMKSELAKLASQEI
A0A6H9KRD7      KKSMATLQSQRSAYMANLINRGV-YNEND--AELKKFDDQISGLTEKLKTELAKLASQDI
H1XXK6          QQELARVVAERTSYVTALETQVQ-SKREFFTPELVRYDERIKALKKKIREEAAKIANSEM
A0A1F4N1P8      QSEYAKLVSEKVTYETLIAQDR--VDPAEYNLQLQSLENRLKAQEKRLQDEAKKIAATSM
A0A3M1XV95      QEQYAELVAEKLKYETLVKQDLS-IDPQEYQLQLSSMTSRIKAIQKKLLEEAQRIATTSM
A0A3M1NWV5      QQEYARMVNDKVKYEALIAQDHT-IDPQEYQMELLSRANRIKAIQKRLQEEAQRIANTSM
A0A3M2I7J5      QKEYARMVSEKVKYETLIAQDRT-IDPQEYQMQLQSMSSRIKAVQDKLQEEAQRIANTSM
                                                                            

A0A6H9KM88      --SPQDPLNYSQELVEQILELEVKAESEKATADAFRDVVQTYSQKLQSLPEKSLQFIRLQ
A0A3M1XW99      --------DFESFRSKLLQAAQDQLNVLRQRLASTQQQIEESKKKLQRLPQKELELAELV
A0A1F4MQ28      ----------------------IIINSLREKQNRLLSLIQKYSGRIESLPAEESQLAELI
H1XPL7          PGQLTDPAKYLVEVKQKIFDTQIQVQALEAKKKALAVVLLDYQKQFDRIPKRSIEFARLQ
A0A3M1AHA0      --------EISLTHLQIKKLALQEIDDLNKQIARLESKINQLKFKLKQLPAQQQKLNELT
A0A6H9L3A8      --------ELIAIFKEIDAVIEDKFGENKQELRQLNETISSINFQLKKHPKKLAQYTRLE
A0A3M1P834      --------QIRSLHTEIEQIARREMIGIQQELEQTKREIAQQEYKLKQLPARESELSELT
A0A523HP09      --------DIRQTQIQIEDLASQEISLLAGEIRRLSRKAQRLRYNIGRLPAQQQRLGELT
A0A523HUF7      --------DIRQTQIQIEDLASQEISLLAGEIRRLSRKAQRLRYNIGRLPAQQQRLGELT
A0A523IKD8      --------DIRQTQIQIEDLASQEISLLAGEIRRLSRKAQRLRYNIGRLPAQQQRLGELT
A0A6H9KUR6      --TPNDPMAHAQQLVSQVIEAETEIRTLKARSVALKGIVDTYSKKLEKLPAKTLRLARLA
A0A3M1NQ37      ------------------------LKIVQDQIGTYSAKIESEKQRLAGLPTKELQLAELV
A0A3N9NLG8      ---VSDPFQLSQQLLTQYLDVESKVKAGTATINALQEVVSEYGGRLNFLPEKTLELARLE
A0A1J1CCX0      PGQLTDPAKYLVEVKQKIFDTQIQVQALEAKKKALAVVLLDYQKQFDRIPKRSIEFARLQ
A0A3N5JLC6      ---V-DPAKVSSALFTSKIEVETEIRSLEPKVSAFEKILEQYNAELEGLPTKKLQLARLA
A0A3M2FFC7      ---VQDPFQLTQELVSRIINLDAEIKANTAKINTLQEVINTYNAQLESLPVKVLELARLK
A0A3M1AH62      ---L-NPVAVNEELFARKVEVEANIEALKPKVTSLKKIVDDYEAQLETLPDKSLKLARLE
A0A6H9KRD7      ---V-NPVAMNEQLFISKVEVEANIQALKPKVASLKKIVDEYTVKLESLPQKSLQLARLQ
H1XXK6          ---ISDPLRISQDLVNQLINLSGEITATEAKIAALEDVLKVYNQRLENLPDKVLQLVRLE
A0A1F4N1P8      ---VQDPLLIAQNLTVKILEAETQIKGLRAKITALQNIMKDYDIQLSKLPNQSLELARLT
A0A3M1XV95      ---VADPLQIIQDLLAKELTVDNEIKALRAKIEVLSDILSQYEAKLADLPEQSLELARLE
A0A3M1NWV5      ---VSDPLQIAQELITTKLQLETQIKGLRAKMDALRDVVQQYESQLEVLPSQGLELARLE
A0A3M2I7J5      ---VADPLQIAQKLIAEILDVETQMKALQAKVDALREVVDEYELELERLPGQGLELARLQ
                                                             :   *        * 

A0A6H9KM88      RSTQVDEKIFLLMQEKYQEIRIQEYSQTGNLQIVDAPTEPKNPVSPNKRLNI---LLGAI
A0A3M1XW99      RDQEVKNDIYLKILSRLNAAKIENQVEVSDVFIVDYATPPTPKDPLSDLIKK--GLFGVL
A0A1F4MQ28      RQKEVYAKMFSLLLDKREEMRMAELSKLQDIIVVDPAQKPLKPISPRKSLNV---ILALL
H1XPL7          RARLSAEKLYLLVEEKYQEATIAEQSQFGYIEIIDQAIVPKLPISPKIRMNL---MLGAL
A0A3M1AHA0      RTNQVLEKQYTDLLAMYRDAQITEAVETEDIEILDPAIEPEFPKNLNKKIQA---GLGGI
A0A6H9L3A8      EDEKNARTIWEIQKSSYDKFALTSATESTKISIMDEAIPPDFPINRNKKTKA---AVGVI
A0A3M1P834      RRNSVLAKKYQDLLAKSQDATISAAVETGDIEILDPAIVPDAPTNKDKKQKA---ILGGL
A0A523HP09      RDQQVLEKQYLDLLTQYRDAQISKAVESEEIVILDEAIRPESHKGLRKPKQA---FIGGV
A0A523HUF7      RDQQVLEKQYLDLLTQYRDAQISKAVESEEIVILDPAIVPELPKNLNKKTQA---SMGGV
A0A523IKD8      RDQQVLEKQYLDLLTQYRDAQISKAVESEEIVILDPAIVPELPKNLNKKTQA---SMGGV
A0A6H9KUR6      RTKSVDEKLYYMMKEKYEESRISMAGQIGKVRIIDRAVEPGSPISPKKRQNL---MLGML
A0A3M1NQ37      RNQSLKSNLYEAILGRYNAAKIDNEVVVSDIVVIDEAIPP--PWQPEIYVLIKQSLMGFF
A0A3N9NLG8      RKRKVDEETYVMLTQKLEETKIQAAAQSRNVHVIDQAIEPMAAVRPKTNMNI---MLGVL
A0A1J1CCX0      RARLSAEKLYLLVEEKYQEATIAEQSQFGYIEIIDQAIVPKLPISPKIRMNL---MLGAL
A0A3N5JLC6      RSAQVAEKLYVMLQEKYQESRITEVGQLGNVRVIDPAKEPYEPILPRKGLNM---LLGVL
A0A3M2FFC7      RRQMVDEQTYMLMTKRLEETKIQEAGQRKEVRVVDEAIEPLFPTKPKKKLNL---ALGVV
A0A3M1AH62      RSARVDEKIFIMMKEKYEESRINEVGQLGDVRIIDPAKPPSEPIKPKKKLNM---ILGML
A0A6H9KRD7      RAAKVDEKIYLMMKEKFQESRITEVGQLGDVRIIDPAKPPKDPVRPKKALNL---ILGMV
H1XXK6          RRKQVDEQTYMMLTQKLEEAKIQESAQARNVKIIDRAIKPNRPVKPNKRMNL---MLGAM
A0A1F4N1P8      RELEVDQETYNLMTKKLEETRITEAGQEENIQILDLAILPDSPIKPKKRLNL---MLGAL
A0A3M1XV95      RQLQVDQNTYVLMTEKLEETKISEAGQKENIRIIDLAVEPLNPVKPKKRLNL---LLGAL
A0A3M1NWV5      RQVQVDQNTFILLTQKLEETKIAEAGQRETIRIVDPAIEPKFPVSPKKKLNL---LLGAV
A0A3M2I7J5      RRVEVDQNTYILLTQKLEETKIADAGQKDIIRILDRAIEPLSPIKPKKKLNL---LLGAL
                         :           :        : ::* .  *                .. .

A0A6H9KM88      IGLAFGVGITLLLEFLDDSIKTLQDL-ERLGFKVLGAIPIIETERKAKGARTTVQLTTAM
A0A3M1XW99      IALGAGLGMGVVVDFFDKTVKDVEDLNQKVQYPVLGQIPVIQVV-------EPDEK----
A0A1F4MQ28      AGVMLGLTAIFVLEHFEKRLTNLDDVERLFSVTLMGILPVYDAQ-------LREQI----
H1XPL7          LGLGLGVGLVFLLEYLDVSIRTPEDL-KRRGWQPLSVIPSMDSQ-------MIAEL----
A0A3M1AHA0      FGLILGIGLAFLLEFLDKSIKNADEVKKFLKLTVLGSIPQIDFS-------DVYDF----
A0A6H9L3A8      ASFFLGIVIVIGIEFLDKSLKSVIDVKNNLKVNVLGTIPDIDFE-------DLNEF----
A0A3M1P834      FGILLGMGVVVVTEFLNKTLRSVDDVRRYLKLPILGTIPQIDFS-------DVFDF----
A0A523HP09      FGLGFGFFFVILLEFFDKSVKTVNDVKRFLKLPVMGTIPLLDFS-------DVFDF----
A0A523HUF7      FGLGLGVFFVILLEFFDKSVKTVNDVKRFLKLPVMGTIPLLDFS-------DVFDF----
A0A523IKD8      FGLGLGVFFVILLEFFDKTVKTVNDVKRFLKLPVMGTIPLLDFS-------DVFDF----
A0A6H9KUR6      FGLGLGFAIAISLEYLDKTVRTVEDI-ERLNLPFVGTIPHIDVE-------SSGGLSSLL
A0A3M1NQ37      VALAIGIALAIVIDFFDKTVDNAEDLQQKLYYPVIGTIPVIQND-------ESVPE----
A0A3N9NLG8      IGLGLGIGLVFLMEYFDNSVKTSEEL-EAMGFNILASIPKIEMD-------KYEEK----
A0A1J1CCX0      LGLGLGVGLVFLLEYLDVSIRTPEDL-KRRGWQPLSVIPSMDSQ-------MIAEL----
A0A3N5JLC6      LGLGFGIALAFTMDYMDDSITSMEDM-DSLGLPLIATIPMIKPD-------TTGSL----
A0A3M2FFC7      LGIGLGIGITFLREYFDNSIKTQEEL-EQLGFNILATIPKIEMS-------KVEEK----
A0A3M1AH62      VGIGLGIGVTFLLEAMDNSVRTIEDL-EKLGLPVLGSIPVIKEE-------DAMKRIKVL
A0A6H9KRD7      VGLGLGVGITFLLEAMDNSIRTSEDV-ERLGVSILGSIPVINEN-------ETYNKIKVE
H1XXK6          LGLGLGVGITFMIEYLDRSVRKPEDM-ERMGYNVLATIPKIELD-------KVEKS-KIK
A0A1F4N1P8      IGLGLGIGLTFLLEYFDDSIKNPEEL-EKMGFPILATIPEISSK-------EVIEN-VIS
A0A3M1XV95      IGIGLGVGLTFLLEYFDDSIKNPEEL-ERMGFPILSIIPQIPLS-------ELAQK-ILS
A0A3M1NWV5      IGIGLGIGLTILLEFFDDSIKNPDEL-ERMGLPILSIIPQISQD-------ELSRP-KVA
A0A3M2I7J5      LGIGLGVGLTFLLEFFDDSIKNPEEL-ERMGFPILAIIPEISQE-------DVVSK-KFS
                 ..  *.   .  : ::  :    ::        :. :*                     

A0A6H9KM88      PAKEGEAEGETVAPRRVETRLITYLNPRSPISESYRIARTNLQFLLSNKDKPNTSKALVI
A0A3M1XW99      --------NLEESRGKIDPKLITLDYSPTLESESYRDLRTKILF----RNKNQNLHSFLV
A0A1F4MQ28      -----------RNSKSIEERAVVLIKEQYAFKEMYRLLRTKIGN----IPGG---KMMMF
H1XPL7          --------AQNKENPAIDDHLIALLSPRSSVAEGYRRLRTNLQY----ARLDKPLKSFLV
A0A3M1AHA0      --------QDSEKLKQIDQQLVTHDYSPTPIGEAYRSLRTNILF----SRERGQLQSMVI
A0A6H9L3A8      --------QDDEKARLVDNQLVTHNYSPTPIGEAYRSLRTSIMF----SKAAGRVQTLVI
A0A3M1P834      --------QDSEKVKQIDQQLVTHDYSPTPIGEAYRSLRTNLMF----TKETGRIRSLVI
A0A523HP09      --------QDSEKLKQIDQQLVTHDYSPTPIGEAYRSLRTNLLF----SKEHGKIQSLVT
A0A523HUF7      --------QDSEKLKQIDQQLVTHDYSPTPIGEAYRSLRTNLLF----SKEHGKIQSLVT
A0A523IKD8      --------QDSEKLKQIDQQLVTHDYSPTPIGEAYRSLRTNLLF----SKEHGKIQSLVT
A0A6H9KUR6      PNGNG-------KNADFQARMIALNRPKSPISEAYRIIRTNLQY----SQADGNLKTILI
A0A3M1NQ37      -------NIEEIKGKR-DPKLITLDYSPTLESESYRDLRTKILF----MNQNKNLSSFLV
A0A3N9NLG8      -LESKLEKLGPIEGKRIEARLITHLDPKSPVAEAYRTLRTNLQF----SKIDRQLKTILV
A0A1J1CCX0      --------AQNKENPAIDDHLIALLSPRSSVAEGYRRLRTNLQY----ARLDKPLKSFLV
A0A3N5JLC6      --FSRVARIDDPEVNAINERLVTHLKPKSPVSESYRSLRTNILF----TAPENPKQVILV
A0A3M2FFC7      -LEARLAKMGPMEGKRIEARLITHLDPKSPVSEAYRSLRTNIQF----SRVDQKIKAVLV
A0A3M1AH62      PQSAQNGNVDPVHIRRMAARLITHFAPKSPISEAYRTFRTNIQY----TQVDKPIKSLLV
A0A6H9KRD7      PSGVKSGTAD--DVKRMASRLITHFAPKSPISEAYRTFRTNIQY----AKIDKKLQTMLV
H1XXK6          QNES----------AKIEARLITHIDPKSPVSEAYRTLRTNLQF----SKIEKDLKTILV
A0A1F4N1P8      ANGE-SEEMG--EARQIETRLVTHFDPKSPVSEAYRTLRTNIQF----KNKKTKQHVILV
A0A3M1XV95      RNGDKEAEIQ--EGKQIESRLVTHFDPKSPVSEAYRTLRTNIQF----KNLKNTNPMILV
A0A3M1NWV5      VNGN--GELN--EGEVIESQLITHFDPKSPISEAYRTLRTNIQF----QNLGTDNLSLLV
A0A3M2I7J5      RNGQ--GQLS--EEQLLESRLVTHLDPKSPISEAYRTLRTNIQF----KNLRQKENTLLV
                                   . :.         * **  **.:               .: 

A0A6H9KM88      TSSNPGEGKSTTVSNMAITNANAGLKTLLVDTDLRRPVLHTVFGFRKDI-GLTSILSGRI
A0A3M1XW99      TSLQPNEGKSLLTSNLAITIAQQKISTLLIDGDLRRGVQHSTFGNKKKP-GLSDFLVSRA
A0A1F4MQ28      TSCEENTGKTTVISNLALSFAKMGKKVLVLDCDLRKGKIGKFFDLPENARGMIDYLSNNQ
H1XPL7          TSPNPKEGKTTTASNLAITFSQAGLNTLLVDTDLRRPAIHRLFGLPKEP-GLTNHLFGQN
A0A3M1AHA0      TSNEPGDGKSFTAANLSITFAQLKSNTLLIDGDLRRGVLHNTFGVPKEP-GFSNYLTSMI
A0A6H9L3A8      TSIAPGDGKSFTAANLAITMAQHKSNTLLVDTDLRRGVLHNTFGIPKEP-GFSTYLTNNI
A0A3M1P834      TSNEPGDGKSFTAANLSITLAQLRSNTLLVDGDLRRGVLHNTFGVAKEP-GFSNYLQDVV
A0A523HP09      TSTEPGDGKSFTTANLAITFAQLKTNTLLIDGDLRRGVLHNTFGLPKEP-GFSNYLTRMV
A0A523HUF7      TSTEPGDGKSFTTANLAITFAQLKTNTLLIDGDLRRGVLHNTFGLPKEP-GFSNYLTRMV
A0A523IKD8      TSTEPGDGKSFTTANLAITFAQLKTNTLLIDGDLRRGVLHNTFGLPKEP-GFSNYLTRMV
A0A6H9KUR6      TSPGPGEGKSTTTINLGITLANMGLKTLIIDADLRRPVVHNFFKFDKKP-GLTNLLATES
A0A3M1NQ37      TSLRPGEGKSLTASNIAITIAQQKISTLLIDGDLRRGVLHNEFGNKKRP-GLSDFLISKA
A0A3N9NLG8      TSSGPKEGKSTTAANLAIAMAQVGNKVVLVDADLRRPVIHSIFGIDKED-GVTNYLMGKN
A0A1J1CCX0      TSPNPKEGKTTTASNLAITFSQAGLNTLLVDTDLRRPAIHRLFGLPKEP-GLTNHLFGQN
A0A3N5JLC6      TSSGPREGKSTSVANLAIIFAQMGAKTLLIDADLRRPMLHKLFRVNQQP-GLTNVLIGQK
A0A3M2FFC7      TSSGPKEGKSTTSANLAIAMAQSGKRVVLIDADLRRPVVHSIFGMDKDE-GLTNYMMDDI
A0A3M1AH62      TSPGPGEGKSTSVANLAITMAQMGSRVILVDADLRRPVLHSVFDTDRRI-GLTNVLVGRV
A0A6H9KRD7      TSPGPGEGKSTSAVNLAITMAQMGSRVVLIDADLRRPVVHSIFNTDRRV-GLTNVLIGRA
H1XXK6          TSAGPKEGKSTTAANLSIALAQAGNRVVIVDADLRRPILHSVFGTTKEE-GLTNHLAGSI
A0A1F4N1P8      TSSAPKEGKSTTVANLAITMAQMGNKTVLIDGDLRRPVIHSIFNMKKEN-GLTNYLIGNA
A0A3M1XV95      TSSAPKEGKSTTVANLAITLAQMGARVLLVDTDLRRPVIHSIFNLKKEK-GVTNFLLGKM
A0A3M1NWV5      TSSAPKEGKSTTLANLAITMAQMGSRVLIVDTDLRRPVVHSIFKLKKDK-GITNYLMGKL
A0A3M2I7J5      TSSAPKEGKSTTIANLAITMAQMGSRTLLVDTDLRRPVLHSLFNLKKDK-GISNYLVGKL
                **     **:    *:.:  ::    .:::* ***.      *       *.   :    

A0A6H9KM88      SLN-----DAVLDTG-I--ENLDLLVSGALPPNPAELLGSPKMSEVIEDMKKKYDIILFD
A0A3M1XW99      TIDYDNVSKVIHPTF-I--PNLFLIPAGSPIPNPTEVIGSTRMQDLLQLLGTKFGMIVLD
A0A1F4MQ28      NRP-----EVYNNFSFLTQQTLAVVPNGGYTDDSSELLSAMAVKSMLEDFQKAYDYILID
H1XPL7          TLD-----EITHKEV-I--PHLSVMTSGLVPPNPSEILAAPQTHELIDRLKSMYDLVIFD
A0A3M1AHA0      PIQ-----HIIHETH-I--PNLSLITCGSLIPNPSELLASHQMKRFLDEMRRKFDLIIFD
A0A6H9L3A8      PIP-----EVIQETH-I--PNLSVVSCGALIPNPSELLGSHQMKRFLDEVRRRFDLIIFD
A0A3M1P834      PLQ-----SILNPTQ-I--PNLTLISCGSLIPNPSELLGSHQMQRFLDEVRRKFDLIVFD
A0A523HP09      PLQ-----SVLYETH-I--PNLTLITCGSLIPNPSELLGSQQMRKFLDEVRRKYELIIFD
A0A523HUF7      PLQ-----SVLYETH-I--PNLTLITCGSLIPNPSELLGSQQMRKFLDEVRRKYELIIFD
A0A523IKD8      PLQ-----SVLYETH-I--PNLTLITCGSLIPNPSELLGSQQMRKFLDEARRKYELIIFD
A0A6H9KUR6      AAD-----DVIKTLD-I--DNLHILTSGVMPPNPSELLGSVRMRNLLESLKSQFDIILLD
A0A3M1NQ37      TVDHDNVNKLIQKTF-V--PNLYLISTGSPIPNPTEMLGSERMVNLMNLLKSRFGMIILD
A0A3N9NLG8      NFE-----ETIKSTF-H--ENLFIFTSGILPPNPSELLASQKMEQLLHKLNENFDTIILD
A0A1J1CCX0      TLD-----EITHKEV-I--PHLSVMTSGLVPPNPSEILAAPQTHELIDRLKSMYDLVIFD
A0A3N5JLC6      QLE-----EAITAVPDV--LNLSLLTCGINPPNPAELLGSERMNILLQKMRQEYNMVLID
A0A3M2FFC7      DYD-----TMIKKSI-M--DNLYVIPSGVLPPNPSEMLESEKMKKLLERLRNDFDFVLFD
A0A3M1AH62      SLD-----DAVKETE-I--NNLYLLPSGTLPPNPSELLGSTAMKQLLDELKQRFDMVLFD
A0A6H9KRD7      KLE-----ETIVQTE-I--HNLSIITCGTLPPNPSELLGSAAMDAFIEELKTKFDIILFD
H1XXK6          SYE-----QVFKETV-V--ENLSLVTSGVLPPNPSELLASKKMEDFLNKLCEDFDIVVLD
A0A1F4N1P8      TLK-----EIVRPTF-V--EHLAVIPSGPLPPNPSELLGSDEMKKLLEDLKNQFEVILFD
A0A3M1XV95      TFE-----EVIKPTI-I--DNLFVCTSGPLPPNPSEILSREEMKEFITIAKQQFDYLLFD
A0A3M1NWV5      PFE-----DIVKPSF-V--ENLYIVTSGPLPPNPSELLASEAMENFVQEARNNFDVVLFD
A0A3M2I7J5      TFD-----EIVKSTF-I--DNLFIVTSGPLPPNPSEMLSLETMDEFIDRARREFDVVLFD
                                     * :   *    :.:*::       .:      :  :::*

A0A6H9KM88      TPPTIAVTDSSVLASKVDGCVLIVYSGVTTTDSVKRAKAILANVGINLLGTVLNNVDIRS
A0A3M1XW99      TPPISASSDVAILANLVDGALIVVRAGYTNVEELVGRLHEYPSVEEKIMGLVLNMVKVDR
A0A1F4MQ28      TPPITKVSDVLILGDFVKDIILIVRPFLTYKEAIRGALEEMRQAGLNLQGVVVNGFNVGK
H1XPL7          TAPVLAVTDASILATQVEGTLLIILAGTTIFDELEHSIEQLERVNAHILGVAMNNFDIKR
A0A3M1AHA0      SPPLNAATDAVVIGTQVDATILVIRAGKTDRDLARQKLELFSNVPANIIGVVLNGTTADL
A0A6H9L3A8      TPPLNAATDAVVIGTQVDANVLVVRAGKTQRDVAKQKMELYHHVPAKIIGAILNGAGEEY
A0A3M1P834      TPPLNAATDAVVLGTQVDGTVIVIRAGKTHRDLAKSKLELFSNVPARVIGAILNGTTADM
A0A523HP09      SPPLNAATDAVVIGTQVDAAVMVIRAGKTNREFANQKLELFANVPAKVLGVILNGTTSDM
A0A523HUF7      SPPLNAATDAVVIGTQVDAAVMVIRAGKTNREFANQKLELFANVPAKVLGVILNGTTSDM
A0A523IKD8      SPPLNAATDAVVIGTQVDAAVMVIRAGKTNREFANQKLELFANVPAKVLGVILNGTTSDM
A0A6H9KUR6      SPPIIAVTDALIVASEVDGVLLINKSGKSQIEGVKRADQLLKTARARFLGVVLNDVRAEN
A0A3M1NQ37      TAPFQASSDSAILSTLVEGTIVVVRAGYTNVDLLNKKIAEYPNIQEKLIGVVLNMVKINV
A0A3N9NLG8      SPPVIAVTDAAVLSTKVDGTILVVSSGQTNKDALGKAFNLLNSVNSKLLGVLLNGVDVKG
A0A1J1CCX0      TAPVLAVTDASILATQVEGTLLIILAGTTIFDELEHSIEQLERVNAHILGVAMNNFDIKR
A0A3N5JLC6      TPPVNAVTDPSVLARAVDGVILVVRSASTQRGSAFVAVEQLRRVEAPLLGIILNSVSRTS
A0A3M2FFC7      TPPIIAVTDAAILGTIVDGAILVVKAGQTNYDALVRAKSLLDAVNTRILGALLNGVEVGG
A0A3M1AH62      SPPIIAVTDAAVLSSKLDAVIVVVKSAQTDREAAFRATALLKNVKTHVLGALLNGVRIES
A0A6H9KRD7      TPPVIAVTDAAVLGSKVDGVILVVKSGQTDREACFRANALLQNVKTLVLGSLLNGVNIES
H1XXK6          SPPVIAVTDASILSTKVDGTLLVVYAGQTERDAIKRAANMLNSVSARLLGIVLNGFDVQG
A0A1F4N1P8      SPPVIAVTDAAIMSTLVDGIVLVIKAHQTHREAIKRAKSLLDTAEARIFGSLLNGVNIQK
A0A3M1XV95      SPPIIAVTDAAILASMADGCLLVIKAHQTRKDVVQRAKTLLENVNAKIFGCLLNGVNVER
A0A3M1NWV5      SPPIIAVTDAALLSSKVEGVILVIRAHQTQKEAVKRAKTLLDNVHARIIGCLLNSVDIER
A0A3M2I7J5      SPPIIAVTDAAVLSTKVDGMLLVIRAHQTQRNAIKRAKNLLDNVNAPIVGCVLNSVSIDR
                :.*    :*  ::.   .  :::  .  :                  . *  :*      

A0A6H9KM88      HYGS--------YSYYYQYYYY--------YSGDKKLKDRKGSKRKSLYRYKYGKYGYGG
A0A3M1XW99      KKNQ----------YTYSYYNY--------------------------------------
A0A1F4MQ28      SA----------YYYRYGHGYNYQTISES-------------------------------
H1XPL7          AYGSYYGQYKSRYYGYYGYYTY-------GHTGGKKAKKKRTETS---------------
A0A3M1AHA0      AHPG------------YSYYHY--------------------------------------
A0A6H9L3A8      AHEG------------YSYYHY--------------------------------------
A0A3M1P834      AHPG------------YSYYHY--------------------------------------
A0A523HP09      AHPG------------YSYYHY--------------------------------------
A0A523HUF7      AHPG------------YSYYHY--------------------------------------
A0A523IKD8      AHPG------------YSYYHY--------------------------------------
A0A6H9KUR6      MYGS--------YYYYYSNQYYYGESSTQGNNGKYQKRHKKRKVS---------------
A0A3M1NQ37      KKDE--------YSYSYSYYNY--------------------------------------
A0A3N9NLG8      LYGS--------YDYYYYHHYY-------TKPGKGMKRLKSS------------------
A0A1J1CCX0      AYGSYYGQYKSRYYGYYGYYTY-------GHTGGKKAKKKRTETS---------------
A0A3N5JLC6      YYGS--------YYHEEYYYYY-------TADGEKKHKSKAKSSQEKSVNSQKSA-----
A0A3M2FFC7      MYGS--------YYYYYYHHYY-------SKPGGKKKRRY--------------------
A0A3M1AH62      MYGS--------YYYYYHYYYY-------GKEGDRKRKKKKKRRSKT-------------
A0A6H9KRD7      LYGS--------YYYYYHYYYY-------GKDNTKKRKKKTAKPESQTA-----------
H1XXK6          IYGS--------YYYYYYHHYY-------GGEGKSKPKRKFI------------------
A0A1F4N1P8      TYGT--------NYYYYYYQYY-------QYYGHDLKRRKRSIA----------------
A0A3M1XV95      AYGSY-------YYYYYYYHYY-------NYYGHDLQRRKKSKIF---------------
A0A3M1NWV5      AYGS--------YYYYYYYHYY-------SYYGHDLKRRKRTKIT---------------
A0A3M2I7J5      AYGS--------YYYYYYYHYY-------SYYGHDLKRRKKARA----------------
                                                                            

A0A6H9KM88      YGGYGGYGGSSPGYGSSYGYDADRDGDKNS
A0A3M1XW99      ------------------------------
A0A1F4MQ28      ------------------------------
H1XPL7          ------------------------------
A0A3M1AHA0      ------------------------------
A0A6H9L3A8      ------------------------------
A0A3M1P834      ------------------------------
A0A523HP09      ------------------------------
A0A523HUF7      ------------------------------
A0A523IKD8      ------------------------------
A0A6H9KUR6      ------------------------------
A0A3M1NQ37      ------------------------------
A0A3N9NLG8      ------------------------------
A0A1J1CCX0      ------------------------------
A0A3N5JLC6      ------------------------------
A0A3M2FFC7      ------------------------------
A0A3M1AH62      ------------------------------
A0A6H9KRD7      ------------------------------
H1XXK6          ------------------------------
A0A1F4N1P8      ------------------------------
A0A3M1XV95      ------------------------------
A0A3M1NWV5      ------------------------------
A0A3M2I7J5      ------------------------------
                                              

© 1998-2021Legal notice