BYKdb

Dataset for cluster tadcd of phylum balneolaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

11 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2N0VGH6      --MSDIIRSDREGRGPNNGSKFEFVPTTPMS-----------NQAQENSLNPKYLVSLIL
A0A1B6Y5X7      --------------------MHYNGNSHNSSNSILSSHTNQQNSDDDQEIDLLKVFNVLF
A0A371QRZ8      ----MSQSIQKNNNGNGED-RNGYDQISTFS---------IPKQDQNDGLDPKTIVFTIF
A0A371QNR3      MSDNNVDPSSNYRSGSNNG-NRGYYSNGSQQ------GRGDRGHSPDDEIDLKHLFAVLM
A0A3M8G9D1      --------------MHLNG-SNGTPKNPS--------HIENNFSSEEREVDLLKLANLLL
A0A6A8Q7N6      ----MNISSNEHHYPNNNG-SNGFSGNPPYS------GRTEGTYDDEQEIDLFQLFNTLL
A0A2D9FS21      ----MDSSSNEHHYPHKNGNNNGFYTGPNFNSG----NNFQQNAED-DEIDLFKLFSTLL
A0A521C203      ----MSSFSNNHHHPYGNG-QNGFHANGNGSLGTFGNNSFGNNTEDDDEIDLFKLFGTLL
A0A6I7NPW2      -----MQSQNNDNSFSQSG-NGAPDKNYSYYGEYYHGQPIPDEPSGKDEIDLKHLINVSL
A0A2N0VKD0      ------------MGQFERG-NGFSANKNLYNGDY-------PNELDPDEIDLIKLFSIIL
A0A651G3P5      -----MSDVNQQNSYSSRG-NGKLNGNGYYGGEYTSAMGMPSDETKRDEIDLKHLINVSL
                                                                 ::   :    :

A0A2N0VGH6      KYKWLILLFVILGGTGAWFYADTVTPTYESTGTILINAGTS----GDDELSKIISQTTGV
A0A1B6Y5X7      LYKWTLISITGLVTILSAIYASMQIPIYESKGTIIISESKNRYSYAGAGIENLLTSTYGI
A0A371QRZ8      RYKWLILLFLIAGGTAAWFYADTITPEYQTTGTLLISSPDRG---GQNELSRIINQTTG-
A0A371QNR3      RRKWAVIGITLLFTIGALAYAYNTIPVYESNGTLLITESQSSRGQIGGDLSELLSATYGF
A0A3M8G9D1      LNKWKIIAITSVFTIGAMIFSLSLTPIYSSSGTIIISESKNRYSYAGSDLSNLLTTTYGI
A0A6A8Q7N6      RNKWTLLAFLILFSGIAAVMAINQTPIYESEGTIIISESKNRYSYAGSDLSNLLTTTYGI
A0A2D9FS21      QNKWTLLVFLGVFTVIAAVLAISQTPIYKSEGTIFITESENRYSYAGSDLSNLLTTTYGI
A0A521C203      RNKWTLILFVGVFSVLAAILAISQIPIYKSDGTLFISESKNRYSYAGSDLSNLLTTTYGI
A0A6I7NPW2      RYKWWVLSITLIITAIATIYAWSLDPVYQSSGTIMIAEERNRYTWAGSDISSIVSSSFNV
A0A2N0VKD0      RYKWIIAGITLMFTIASVIYSYSIIPVYESDGTILIKDDQNRYPGGGAELSNLLSATYGI
A0A651G3P5      RYKWWVIGITVLFTGLAWLYAQTFDDVYTSSGTIVIAEERNRYTWGGSDIGSILSSSFGV
                  ** :  :       :   :      * : **:.*             :  ::. : . 

A0A2N0VGH6      GTSSTLANEVQVLRSRDFARQIARSLIEEEPGDYRD-FPVLWNEDENGNISRASEEAVTG
A0A1B6Y5X7      GVGSTIANELQIMQSRQLSLNLAKRINDIEFDEHGRKFPILWKNYPEDST-SIDIESIAS
A0A371QRZ8      GTNATLANEMQIIQSRSFARQVARKLMEDDEVDINE-LPAFWRESDDGSVYQRELEGVAN
A0A371QNR3      GMGSTLGNELQIMRSRRMSNMLADKVMQQDLMENGQRFPVLWQEYPIDST-VVSAGAVAT
A0A3M8G9D1      GVGSTIANELQILRSVSLSYQLAEKILEIQKDETGNIYPIVMRSYPDNPV-STSVDTVAM
A0A6A8Q7N6      GVGSTIANELQILKSRSLSSELADSLLKREFTKSGKKFPLLWKSYPEDSS-TALHEIVAG
A0A2D9FS21      GAGSTIANELQIIKSRTLSEDLADSVLAKKFTESGHKYPVIWRAYPDDST-TIGRDTVAM
A0A521C203      GVGSTIANELQIIKSRTLSEDVADSLMSKELSEAGFKYPVLWRAYPEDST-TTSIDTVAQ
A0A6I7NPW2      GAGNRLVNEIQVFQSRRLAEEVAKHVLEMEVMENGERFPILWRDYPYDST-LVTLGTLTG
A0A2N0VKD0      GMGSTLSNELQVFRSRSMSFTLANRVIQEDVMKNGSRFPILWRAFPDDST-VVTRDSVAT
A0A651G3P5      GVGNRLVNEIQVFQSRRLAEEIAAKMYEQEVMENGEMFPMLHRSYPDDDT-KISVEALTG
                * .  : **:*::.*  ::  :*  :   .  .     * . .    .         :: 

A0A2N0VGH6      RIRRNLSIVRPERDSELLEVSFESPSPIETSHISNKAMEIYVESSTQENRRAAELTAEFL
A0A1B6Y5X7      RFRSNISFEKKDPNADIVEISYTSPLPTEAATIINLTMNTYSALSTDQNRNMAVSALDFL
A0A371QRZ8      SIRSGIKLQLVNRDSDIIEVSYISESPVETATMVNAAMNVYVEQSTAQNRQAADSTTSFL
A0A371QNR3      RIRNNISYGRVDRDTEVVEIRFRSYSPMEAQWMVDEAINSYSELSTDQNRMAANSAMRFL
A0A3M8G9D1      RFRGLISFSQIDPEADLVRISFESPSPYEASEIVNMTMDTYSSISTDQNRRMAVDALTFL
A0A6A8Q7N6      RIRNTLSASQVTREADIVSLSFQSPSPEEAAYMVNLTMTTYSRLSTEQNRTMAESALSFL
A0A2D9FS21      RIRNNLTAERVDQQTDIVSIGFESPLPEETAYISNLTMDTYSRLSTAQNRTMASSALSFL
A0A521C203      RIRDNLSAVQVDQETDIVRIGFESPLPEEAAFVTNLVMDTYSQLSTEQNRAMATSALSFL
A0A6I7NPW2      RIGSRLRVQRVDMDTDILRITFTSISPHEASHLVNITMDTYTQVSATQRRSDAHAALAFL
A0A2N0VKD0      RIRNNMDIVRQDQDTDMLRITFKSYSPLEAAWMVDQAIEGYTDLSQQQNRGAASSALDFL
A0A651G3P5      RIRSAMNVNRVDMDTDILRISYTTRHPLEAKYLVNTTIDTYTEVSARQRRSSANAALAFL
                 :   :       ::::: : : :  * *:  : : .:  *   *  :.*  *  :  **

A0A2N0VGH6      EREKRDIEQKLQESERRLQEFMDNTGIVQMDEQASGIVTRQTSIEMELQQVNLELESVNQ
A0A1B6Y5X7      SDERSRLKEELISTEDSLQLFMNRTMLVALDPQSEKLVSSIASIEVEKQNLEVELVAVNS
A0A371QRZ8      ERERAELKSRLAEAEQELENFMDRTGIVRVDNQATSAVNRREQIRAEIEEVQLDLEATEL
A0A371QNR3      EDERRQIEENLREKEEQLKQFMDRSGIVAVDGQTQQLITRISELESQKQQVRTRLVAINT
A0A3M8G9D1      RGEKSKIQEQLEVVEDSLKTFMDQSQLIAVDPQTEKLIVNISGAEVERKEVEIALVAVNS
A0A6A8Q7N6      SAERNRIQQQLEATEQELQGFMDETHLVAVSPQTQELITTLSTLEGRKQEIEVQLVAVTS
A0A2D9FS21      RQERSSIEEQLRETENELQAFMDSSNLLAVDAQTEQLINNISTLETKKQEIEVQLVSVNS
A0A521C203      RGERENIEDQLEQTENELEQFMDESMLIATDAQTQQLINTITTLETKKQEIRVQYVAVNS
A0A6I7NPW2      EQEMEEARRALDESEQALRDYMSRTNLVQIDGQTSAVINRITELESRLQEIQVQRVGISS
A0A2N0VKD0      ERERELIREELNENEQRLRVYMNETGLIQVDEQTSAAIERISELEAQRQELQVRKVAVTS
A0A651G3P5      EQEKDEYEQRLINSEEAVREYMSRTGLMQIDGQTSTVINRLADLETQRQQVQVQRVGLNS
                  *       *   *  :  :*. : ::  . *:   :          :::     .   

A0A2N0VGH6      AIQNHEQRMESLKPGLSEQFSEAVGPRIRNSQEQLARYESERTLILTKNPNVRERETTPP
A0A1B6Y5X7      GIEQYKNQLNEIKPGLANQYSEAIGPIIERYQYALAELETNKLLLLTKNPDISENN---P
A0A371QRZ8      AIQNQEEELERIRPGLINDFSEAIAPRIQGYQETLREYERERYLILSNYPNVRQREEPPS
A0A371QNR3      AIENYERQIDEIRPGLAQQFAEGVGSSMERLQFQLAELETERMLLLNRNPGLRENPEREP
A0A3M8G9D1      SLEEYQQQLNEIKPGLANQYSEAFGAIIERYQFALSELETEKLLLEVKNPNITD--EH-S
A0A6A8Q7N6      AIQQYESQLDEIKPGLAEQYSESVAPILINYQFLLRETSTELLQLYTNNPELRKQPEH-P
A0A2D9FS21      AISTYENQLEEVKPGLADKISESLGPQLTNFQFRLAELQTEKLMLMQRNPELRENPEH-P
A0A521C203      AIETYESQLDEIKPGLADQFSESVTPRLTNFQFALAELETEKLLLLANNPELEDNPDH-P
A0A6I7NPW2      AITSNEQQLEQIRPGLAERLAENISGQMDRAQYRIAELRTQRTILLNNNPALRQNPELEP
A0A2N0VKD0      AISAYEQQLDEIKPGLADQFSDNVGTTLERYQYRLAELETEKLLLLQRNPSLRDQPDQEP
A0A651G3P5      SITAFEGQLEQIRPGLAEQFADNISATMQRSQFRLAELETERSLLLQRNPSLRNNPQQEP
                .:   :  :: :.*** :  :: .   :   *  :     :   :  . * : .     .

A0A2N0VGH6      RLKYLDEEIERVKNEIRELSAQLFT-EDEE----YTGMDSEERAQMIATIQTRLTELRIQ
A0A1B6Y5X7      EIVRIDRQIEQVKKQIKDRTNALLT-SESDLYLSFIGSGEETVTQRIAEITKTLLELEVK
A0A371QRZ8      RLKFLDEQIDDLKERIAELSSEIFS-EEDE----YMGMETAERTRMVTDIQNRLVELRLQ
A0A371QNR3      QLVQINNNIAMLKEEINRVASRLVD-ESEE-YLTFLRSSDGGIAGRLLDLRTRLIELNVE
A0A3M8G9D1      EIIRIQSQIDQFKLRIKSVTDDLLE-NDSALNLSFASRGDGSVMKRLAEISEKLIELEVE
A0A6A8Q7N6      EVRKLINKIDNIKAEIKKKANQLIQ-NNSDVYLSFLNMESGGVTSKIIETTQRLTELKVE
A0A2D9FS21      ELVKIENQIEATQDQIKSIANRLIN-SSSSLALSFLGSESGGIAEKIIQINEKLIQLRVE
A0A521C203      ELKKIDQQINRVQSQIRSIAENLID-SKSSLALSFLGSETGNIGQKIIDINEKLIQLRVE
A0A6I7NPW2      QFMRLEAEIEALAQEIRSITQSILDSDESDAYIGFLGRDDGGIATRIAELRRNLIELRIQ
A0A2N0VKD0      YLVEIEDQIQLLRREINRIASTLVD-ESADAYIGFLSNTDNGIAGRITELRTQLIELRIE
A0A651G3P5      QFVTLEEEIETLKNRINQMASDLLS-DDTDMFIGFLNSAEGGITGRIMELRQQLIQLRIE
                 .  :  :*      *   :  :.  ..      :           :      * :* ::

A0A2N0VGH6      QNQLQSRSQALAQSKEEIDQDLNSLPEGMMQLARLQRDVALNEELFVNVSENYAEMSVLK
A0A1B6Y5X7      RTQLQTQGDVINDRYQKTNTRFEKLPDEIIQLARLKRNVRVTEEMYLQVSAQFAEMSLWE
A0A371QRZ8      KNQQESRIQVLEERRREADDSFRTLPNEMIQLVQLQRNVEEQEQLYLDVSRQYAEMSTWR
A0A371QNR3      KSQHEAQQEVLDERLTEENRFFENLPQNMVEFARLQRDVQINEQLFLTVSDQYAETAFWE
A0A3M8G9D1      KTKYKTQLNFLNEYYESLNLEFEKLPNDIIELAKLQRNVKINEELFLLVSSQYAEMSLWE
A0A6A8Q7N6      KAQFETQQKVLNERVSSLNARFDNLPKDIIQLSRLKRDVKINEELFLLVSNQYAEMSLWE
A0A2D9FS21      KSQYEAQIEALTKRAAMFNRQFDGLPREIIELARLKRDVKINEELYLLVSNQFAEMNLWE
A0A521C203      RSQYETQIEALDERIASFNERFEELPEDIIELARLKRDVKINEELYLLVSNQFAEMNLWE
A0A6I7NPW2      ELQLNAQEEAIQARLGTENLFFDGLPDNMIELARLQRDSRVNEQLYSTISQNYTQTTLWE
A0A2N0VKD0      ESQYLAQETAIDERMAAENEFFNNLPDNMIELARLKRDAEIQEELFLTISQQYAETALWE
A0A651G3P5      ESQLNAQEEVLNQRIEEEGQFFDGLPENMIEFARLQREKQVNEQLFATISQQFTQTNLWE
                  :  :.   :       .  :  **  :::: .*:*:    *:::  :* ::::     

A0A2N0VGH6      QSQFGFGRIVDSALTPTIPVSPNKKILLIIGIMLGGIVSGGFIFIREFMDNSVNNLEMLK
A0A1B6Y5X7      KTQFGLGRPLDYAIPTKAPIKPKKKIIILAGFLLGGVLATGCVLVLEMMNDRITSTDVLR
A0A371QRZ8      ETRFGNGRIIDLATVPGGPISPNKILILMMGIVLAGMVAGAIILVREFFDNTISSIGTIK
A0A371QNR3      QTQFGLGRPVDYGMMPGRPVEPRTRMIGLIGLLLGGVVGMGYAFGREALIKVIDGTEKMR
A0A3M8G9D1      KTQFGLGRPLDKALVPLEPIKPRKKIITIIGFFFGGFLAVGFVLIRNLIDDKITSTDSIK
A0A6A8Q7N6      KTQFGLGRPLDFAVVPKQPVKPQKRLWVLIGFLIGGVLGVGFIFIKESLDDTIKSSEALK
A0A2D9FS21      RTQFGMGRPLDYAVVPNNPIKPQKKLWVLIGFLLGGILGVGFIFIKEALDDTIKSSDALR
A0A521C203      RTQFGLGRPLDYAVVPKNPIKPQKKLWVLIGFLLGGILGAGFIFIREALDDSIKSSDFLK
A0A6I7NPW2      QTQFGAGRPLDYGLTPGGPSGPNRTRYIMIGFLLGGILSVGFVFTKENLNRTIDGTDKLR
A0A2N0VKD0      QTQFGQGRPLDYAFVPDKPTEPKKRMIVIVGFLLGGIVSLGAVFTRELFNNTLDSVDHLK
A0A651G3P5      QTQFGAGQPLDYGLAPGGPSGPNRTRYVMIGFLLGGILSVGFVFVKENLNRTIDGTDKLR
                 :.** *. :* .  .  *  *.     : *:.:.*.:. .  :  : :   : .   :.

A0A2N0VGH6      TSYLPLLAAVPVLDKVSKKSKKSFKN----GSGKIPDELVLLRDRSNLASEAIRRLKNNL
A0A1B6Y5X7      DFNKPVLGAIPDFSVVGEFNPNERQYI---GDKSISNQLVTFFDHISPISEAYRRLRINV
A0A371QRZ8      TQDLPMLAAIPSLKKISVKNGNGSGDYKVGKGK-IPNEMVLFRDRSHVISESIRRLKNNI
A0A371QNR3      KLNYPVLSVIPDIKKVVKEKFKGDDTIPVADGRKVSSTILTLVDRISPVAESFRRLHNNI
A0A3M8G9D1      DFKLPLLGTIPDFSILDGLDSNERQFI---DDKSVSNQLITFLDHISPISEAYRRLRINV
A0A6A8Q7N6      EFHVPFLGNVPDFELIGDLDPKEKQMV---NNKLVSNQLLTFLDHISPISEAYRRLRINI
A0A2D9FS21      SYKVPFLGNIPDFNIIDSFDPGQKQYV---QGKPVSNQLLTFLDHISPISEAYRRLRINT
A0A521C203      KYNVPFLGNIPDFKIIDSLDPDGKQLI---QGKSVSNQLLTFLDHISPISEAYRRLRINT
A0A6I7NPW2      KTGYPLLAIIPDTKKYIENRFKGHSYVKA-NGKKISSSWSTLIDTISPIAEAYRRLHNNI
A0A2N0VKD0      ERGYPLLTVIPDMTNRMKEIFGDSKTVTI-QGKSISTSLLSITDSISPVSESFRRLHNNI
A0A651G3P5      KLGYPLLAIIPDTTNVIRKRYDSERFIEA-EDHRVSTSWLSLLDTVSPAAESFRRLHNNI
                    *.*  :*                    .  :.     : *     :*: ***. * 

A0A2N0VGH6      IYQNGDYPPKTIAITSAEKGDGKSTVVSNLAVSFAEDGYKTLLIDTDFRRPKLHSYFGHD
A0A1B6Y5X7      VYANPDKEYKILMVSSATKGEGKSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIFGEN
A0A371QRZ8      IFQNSDNIPKTIAITSSEKGEGKSTIACNLAIAFADEGYKTLMIDTDFRRPRVHTLFGLP
A0A371QNR3      VYSQPDEKFQTILVTSSAQGEGKTTIVSNLAVALTEAGKKVLIVDLDLRRPKLHILWKES
A0A3M8G9D1      VYANPDKVHRVIMVTSATKGEGKSTLAANLAVTFSEAEKSVLLIDLDLRRPTQHKIFGEN
A0A6A8Q7N6      IYANPDKNYKVLMVTSSTKGEGKSTIAANLGVTFAEAGKKALIIDLDLRRPTMHKIFGEN
A0A2D9FS21      IYANPDKDYKVLMVTSSTKGEGKSTIAANLAVTFAEAEKSVLIIDLDLRRPTMHKIFGEN
A0A521C203      VYSDPDKDYKVLMVSSSAKGEGKSTIAANLAVTFAEAEKSVLVVDLDLRRPTMHKVFGEN
A0A6I7NPW2      IYSNPDSLPKMILITSTKKGEGKTTVSMNLGVALAEAGKRVLVVDTDLRRPSTHDFSGLP
A0A2N0VKD0      IYSHPDENFKRILITSSAKGEGKSTVSTNLAVILADSGKKVLIIDSDLRRPNLHKLLGEN
A0A651G3P5      IYSDPDSENKVILITSSKKGEGKTTISMNLAVAFAESGKRVLVIDTDLRRPNIHHFSGVA
                ::   *   . : ::*: :*:**:*:  **.: ::     .*::* *:***  *      

A0A2N0VGH6      NESGLTD-YLSGRIKLVKLMKDTDINMLKLITSGGRHEAPDTVVNSKKFNDFLNQMEEVF
A0A1B6Y5X7      KEPGLSD-ALFDAS--IDVRLSTVAPNVDLITVGHKTPEPASVLDSKRLKQLIDKYKAEY
A0A371QRZ8      NEKGISN-LVKGDSAASEIIQSSEIKFLKVISAGSNILRPESIVNDKKFNEFLEKMDKLF
A0A371QNR3      QRPGLIE-VLFEDVTLEEAIKPSAAPGIDLLMAGTKTPNPAAINQSEALRKLIIELKERY
A0A3M8G9D1      REPGLTD-SLFETIKISDITRETIAPNVDLITVGKKTPEPATVLDSKRLKQLIDKLSERY
A0A6A8Q7N6      KEPGLVE-LLFQKAGFDEAIKSTIAPNVDLITVGQKTPEPASVLDSKRLKDSIDHLKDHY
A0A2D9FS21      KEPGIVE-MLFDTAGFDSTINPTIAPNVDLLTVGKKTPEPASVLDSRRLKDVIDKLKDKY
A0A521C203      REPGLVE-LLFETAGFDNCIKETIAPNVDVICAGKKTPEPASVLDSQRLKTVIDKLKDKY
A0A6I7NPW2      REPGLVE-YFYDDLPLSSVIKETVAPGLFLLTAGRSIPNPAAVMQSSKLRKLFEIITTKY
A0A2N0VKD0      RIPGLIDTLFNDDIELSQVIRETVVPNLDLLTTGQEPPNPSAVLQSEKLKGLIDQVEEHY
A0A651G3P5      RMPGIAE-IFYDDKSLTASIKPTIAPGVHVLTAGRKIPNPSAVIQSKKLRVLLDKVKEKY
                .  *: :  .            :    : ::  *     * :: :.  :.  :      :

A0A2N0VGH6      DIIILDTPPFGIVSDSTALLKRAKSTVLVTKYRKTNRGVFQKTVEDLERINANISGIVVN
A0A1B6Y5X7      DHIILDTAPYGIISDSASLLRLIDGLIVVSRFNVTTKRELKFTLEGLEHLNADVLGIVLN
A0A371QRZ8      DVIILDTPPFGIISDSTSLLRKADATVMVAKYRKTNKEVYMHTLDELRRINANVCGMVLN
A0A371QNR3      DHILIDTAPYGIITDAAPMMRLADGIVVAARFNKTKETQLEHTLGNLERIHANILGTVLL
A0A3M8G9D1      DHIILDTAPYGIISDSASLLRLVDGIVVVSRFNVTTKRELKYTLEGLNHLNADVLGVVLN
A0A6A8Q7N6      DHIILDTAPYGIISDSASLLRLIDGMVLVTRFNTTTKRELDFTIDGLKHLNAEIVGTVLN
A0A2D9FS21      DHIILDTAPYGIISDSASLLRLTDGIIVVSRFATTTHKELEFTLNGLKQLNAEIVGLVLN
A0A521C203      DHIILDTAPYGIISDSASLLRLTDGIIVVARFGLTSKKELDFTLDGLKHLNANIVGLVLN
A0A6I7NPW2      DHIIIDTPPYGVITDAAPIMRWADAVVLVTRFGDTQTNELNHTIENLRRINASVIGTMIT
A0A2N0VKD0      DHIIIDTAPYGIITDAAPLIPIVDGVVLIARFGETPINELNQSIENLERVHAKIIGTVLT
A0A651G3P5      DHIIIDTPPFGVITDAAPIIKLADLVVLVTRFGVTQINELNFTIENLKRIQAKLAGTVIT
                * *::**.*:*:::*::.::   .  :: :.:  *       ::  * .::*.: * :: 

A0A2N0VGH6      GFDHKKETSGYYGSGYYKSMYESYESYV-------
A0A1B6Y5X7      AFDPKKSTDYY---TNYNYYKRTYSEYYKYR----
A0A371QRZ8      DFEPKKDPASHYGSGYYKSLYDGYGAYA-------
A0A371QNR3      GFDHHKSSDYYYGNDNYYYAYEAYDEYHKEKA---
A0A3M8G9D1      AFDPKRSTDYY---TNYSYYKRTYSEYYQEEV---
A0A6A8Q7N6      AFDPKKSTDYY---TNYYYYKRAYSEYYEEKNS--
A0A2D9FS21      AFDPKKSSDYY---TNYYYYKRAYSDYYEEDKA--
A0A521C203      AFDPKRSSDYY---TNYYYYKRAYKDYYEEEKAAL
A0A6I7NPW2      GYIHKDSADYYYSNEYTYDSYYAYEEYQENK----
A0A2N0VKD0      AYNYEKSGDYYTRSNGHYDYQRAYKDYNRSI----
A0A651G3P5      AFNHRDSADYYYSNKYTYDSYQAYEAYQEDEEELV
                 :    .   :            *  *        

© 1998-2021Legal notice