BYKdb

Dataset for cluster tadcd of phylum balneolaeota

[Download (right click)] [Edit] [Sequences] [Repertoires]

9 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2N0VGH6      ------MSDIIRSDREGRGPNNGSKFEF----VPTTPMSNQAQENSLNPKYLVSLILKYK
A0A1B6Y5X7      -----------------MHYNGNSHNSSNSILSSHTNQQNSDDDQEIDLLKVFNVLFLYK
A0A371QRZ8      ------MSQSIQKNNNGNGEDRNGYDQISTFSI-----PKQDQNDGLDPKTIVFTIFRYK
A0A371QNR3      MSDNNVDPSSNYRSGSNNG---NRGYYSNGS-QQGRGDRGHSPDDEIDLKHLFAVLMRRK
A0A3M8G9D1      ----------MHLNG-SNGTPKNPSHIEN---------NFSSEEREVDLLKLANLLLLNK
A0A2D9FS21      MDSSSNEHHYPHKNGNNNGFYTGPNFNSG-----NNFQQNAED-DEIDLFKLFSTLLQNK
A0A521C203      MSSFSNNHHHPYGNG-QNGFHANGNGSLGTF-GNNSFGNNTEDDDEIDLFKLFGTLLRNK
A0A2N0VKD0      -------MGQFER---GNGFSANKNLYNGDY-------PNELDPDEIDLIKLFSIILRYK
A0A651G3P5      MSDVNQQNSYSSR---GNGKLNGNGYYGGEYTSAMGMPSDETKRDEIDLKHLINVSLRYK
                                      .                       ::   :    :  *

A0A2N0VGH6      WLILLFVILGGTGAWFYADTVTPTYESTGTILINAGTS----GDDELSKIISQTTGVGTS
A0A1B6Y5X7      WTLISITGLVTILSAIYASMQIPIYESKGTIIISESKNRYSYAGAGIENLLTSTYGIGVG
A0A371QRZ8      WLILLFLIAGGTAAWFYADTITPEYQTTGTLLISSPDRG---GQNELSRIINQTTG-GTN
A0A371QNR3      WAVIGITLLFTIGALAYAYNTIPVYESNGTLLITESQSSRGQIGGDLSELLSATYGFGMG
A0A3M8G9D1      WKIIAITSVFTIGAMIFSLSLTPIYSSSGTIIISESKNRYSYAGSDLSNLLTTTYGIGVG
A0A2D9FS21      WTLLVFLGVFTVIAAVLAISQTPIYKSEGTIFITESENRYSYAGSDLSNLLTTTYGIGAG
A0A521C203      WTLILFVGVFSVLAAILAISQIPIYKSDGTLFISESKNRYSYAGSDLSNLLTTTYGIGVG
A0A2N0VKD0      WIIAGITLMFTIASVIYSYSIIPVYESDGTILIKDDQNRYPGGGAELSNLLSATYGIGMG
A0A651G3P5      WWVIGITVLFTGLAWLYAQTFDDVYTSSGTIVIAEERNRYTWGGSDIGSILSSSFGVGVG
                * :  :       :   :      * : **:.*             :  ::. : * * .

A0A2N0VGH6      STLANEVQVLRSRDFARQIARSLIEEEPGDYRD-FPVLWNEDENGNISRASEEAVTGRIR
A0A1B6Y5X7      STIANELQIMQSRQLSLNLAKRINDIEFDEHGRKFPILWKNYPEDST-SIDIESIASRFR
A0A371QRZ8      ATLANEMQIIQSRSFARQVARKLMEDDEVDINE-LPAFWRESDDGSVYQRELEGVANSIR
A0A371QNR3      STLGNELQIMRSRRMSNMLADKVMQQDLMENGQRFPVLWQEYPIDST-VVSAGAVATRIR
A0A3M8G9D1      STIANELQILRSVSLSYQLAEKILEIQKDETGNIYPIVMRSYPDNPV-STSVDTVAMRFR
A0A2D9FS21      STIANELQIIKSRTLSEDLADSVLAKKFTESGHKYPVIWRAYPDDST-TIGRDTVAMRIR
A0A521C203      STIANELQIIKSRTLSEDVADSLMSKELSEAGFKYPVLWRAYPEDST-TTSIDTVAQRIR
A0A2N0VKD0      STLSNELQVFRSRSMSFTLANRVIQEDVMKNGSRFPILWRAFPDDST-VVTRDSVATRIR
A0A651G3P5      NRLVNEIQVFQSRRLAEEIAAKMYEQEVMENGEMFPMLHRSYPDDDT-KISVEALTGRIR
                  : **:*::.*  ::  :*  :   .  .     * . .    .         ::  :*

A0A2N0VGH6      RNLSIVRPERDSELLEVSFESPSPIETSHISNKAMEIYVESSTQENRRAAELTAEFLERE
A0A1B6Y5X7      SNISFEKKDPNADIVEISYTSPLPTEAATIINLTMNTYSALSTDQNRNMAVSALDFLSDE
A0A371QRZ8      SGIKLQLVNRDSDIIEVSYISESPVETATMVNAAMNVYVEQSTAQNRQAADSTTSFLERE
A0A371QNR3      NNISYGRVDRDTEVVEIRFRSYSPMEAQWMVDEAINSYSELSTDQNRMAANSAMRFLEDE
A0A3M8G9D1      GLISFSQIDPEADLVRISFESPSPYEASEIVNMTMDTYSSISTDQNRRMAVDALTFLRGE
A0A2D9FS21      NNLTAERVDQQTDIVSIGFESPLPEETAYISNLTMDTYSRLSTAQNRTMASSALSFLRQE
A0A521C203      DNLSAVQVDQETDIVRIGFESPLPEEAAFVTNLVMDTYSQLSTEQNRAMATSALSFLRGE
A0A2N0VKD0      NNMDIVRQDQDTDMLRITFKSYSPLEAAWMVDQAIEGYTDLSQQQNRGAASSALDFLERE
A0A651G3P5      SAMNVNRVDMDTDILRISYTTRHPLEAKYLVNTTIDTYTEVSARQRRSSANAALAFLEQE
                  :     : ::::: : : :  * *:  : : .:: *   *  :.*  *  :  **  *

A0A2N0VGH6      KRDIEQKLQESERRLQEFMDNTGIVQMDEQASGIVTRQTSIEMELQQVNLELESVNQAIQ
A0A1B6Y5X7      RSRLKEELISTEDSLQLFMNRTMLVALDPQSEKLVSSIASIEVEKQNLEVELVAVNSGIE
A0A371QRZ8      RAELKSRLAEAEQELENFMDRTGIVRVDNQATSAVNRREQIRAEIEEVQLDLEATELAIQ
A0A371QNR3      RRQIEENLREKEEQLKQFMDRSGIVAVDGQTQQLITRISELESQKQQVRTRLVAINTAIE
A0A3M8G9D1      KSKIQEQLEVVEDSLKTFMDQSQLIAVDPQTEKLIVNISGAEVERKEVEIALVAVNSSLE
A0A2D9FS21      RSSIEEQLRETENELQAFMDSSNLLAVDAQTEQLINNISTLETKKQEIEVQLVSVNSAIS
A0A521C203      RENIEDQLEQTENELEQFMDESMLIATDAQTQQLINTITTLETKKQEIRVQYVAVNSAIE
A0A2N0VKD0      RELIREELNENEQRLRVYMNETGLIQVDEQTSAAIERISELEAQRQELQVRKVAVTSAIS
A0A651G3P5      KDEYEQRLINSEEAVREYMSRTGLMQIDGQTSTVINRLADLETQRQQVQVQRVGLNSSIT
                .    . *   *  :  :*. : ::  * *:   :        : :::     .   .: 

A0A2N0VGH6      NHEQRMESLKPGLSEQFSEAVGPRIRNSQEQLARYESERTLILTKNPNVRERETTPPRLK
A0A1B6Y5X7      QYKNQLNEIKPGLANQYSEAIGPIIERYQYALAELETNKLLLLTKNPDISENN---PEIV
A0A371QRZ8      NQEEELERIRPGLINDFSEAIAPRIQGYQETLREYERERYLILSNYPNVRQREEPPSRLK
A0A371QNR3      NYERQIDEIRPGLAQQFAEGVGSSMERLQFQLAELETERMLLLNRNPGLRENPEREPQLV
A0A3M8G9D1      EYQQQLNEIKPGLANQYSEAFGAIIERYQFALSELETEKLLLEVKNPNITD--EH-SEII
A0A2D9FS21      TYENQLEEVKPGLADKISESLGPQLTNFQFRLAELQTEKLMLMQRNPELRENPEH-PELV
A0A521C203      TYESQLDEIKPGLADQFSESVTPRLTNFQFALAELETEKLLLLANNPELEDNPDH-PELK
A0A2N0VKD0      AYEQQLDEIKPGLADQFSDNVGTTLERYQYRLAELETEKLLLLQRNPSLRDQPDQEPYLV
A0A651G3P5      AFEGQLEQIRPGLAEQFADNISATMQRSQFRLAELETERSLLLQRNPSLRNNPQQEPQFV
                  :  :: :.*** :. :: . . :   *  *   : :. ::  . * : :     . : 

A0A2N0VGH6      YLDEEIERVKNEIRELSAQLFTEDEE----YTGMDSEERAQMIATIQTRLTELRIQQNQL
A0A1B6Y5X7      RIDRQIEQVKKQIKDRTNALLTSESDLYLSFIGSGEETVTQRIAEITKTLLELEVKRTQL
A0A371QRZ8      FLDEQIDDLKERIAELSSEIFSEEDE----YMGMETAERTRMVTDIQNRLVELRLQKNQQ
A0A371QNR3      QINNNIAMLKEEINRVASRLVDESEEY-LTFLRSSDGGIAGRLLDLRTRLIELNVEKSQH
A0A3M8G9D1      RIQSQIDQFKLRIKSVTDDLLENDSALNLSFASRGDGSVMKRLAEISEKLIELEVEKTKY
A0A2D9FS21      KIENQIEATQDQIKSIANRLINSSSSLALSFLGSESGGIAEKIIQINEKLIQLRVEKSQY
A0A521C203      KIDQQINRVQSQIRSIAENLIDSKSSLALSFLGSETGNIGQKIIDINEKLIQLRVERSQY
A0A2N0VKD0      EIEDQIQLLRREINRIASTLVDESADAYIGFLSNTDNGIAGRITELRTQLIELRIEESQY
A0A651G3P5      TLEEEIETLKNRINQMASDLLSDDTDMFIGFLNSAEGGITGRIMELRQQLIQLRIEESQL
                 :: :*   .  *   :  :. ..      :           :  :   * :* :: .: 

A0A2N0VGH6      QSRSQALAQSKEEIDQDLNSLPEGMMQLARLQRDVALNEELFVNVSENYAEMSVLKQSQF
A0A1B6Y5X7      QTQGDVINDRYQKTNTRFEKLPDEIIQLARLKRNVRVTEEMYLQVSAQFAEMSLWEKTQF
A0A371QRZ8      ESRIQVLEERRREADDSFRTLPNEMIQLVQLQRNVEEQEQLYLDVSRQYAEMSTWRETRF
A0A371QNR3      EAQQEVLDERLTEENRFFENLPQNMVEFARLQRDVQINEQLFLTVSDQYAETAFWEQTQF
A0A3M8G9D1      KTQLNFLNEYYESLNLEFEKLPNDIIELAKLQRNVKINEELFLLVSSQYAEMSLWEKTQF
A0A2D9FS21      EAQIEALTKRAAMFNRQFDGLPREIIELARLKRDVKINEELYLLVSNQFAEMNLWERTQF
A0A521C203      ETQIEALDERIASFNERFEELPEDIIELARLKRDVKINEELYLLVSNQFAEMNLWERTQF
A0A2N0VKD0      LAQETAIDERMAAENEFFNNLPDNMIELARLKRDAEIQEELFLTISQQYAETALWEQTQF
A0A651G3P5      NAQEEVLNQRIEEEGQFFDGLPENMIEFARLQREKQVNEQLFATISQQFTQTNLWEQTQF
                 :.   : .     .  :  **  ::::..*:*:    *:::  :* ::::      :.*

A0A2N0VGH6      GFGRIVDSALTPTIPVSPNKKILLIIGIMLGGIVSGGFIFIREFMDNSVNNLEMLKTSYL
A0A1B6Y5X7      GLGRPLDYAIPTKAPIKPKKKIIILAGFLLGGVLATGCVLVLEMMNDRITSTDVLRDFNK
A0A371QRZ8      GNGRIIDLATVPGGPISPNKILILMMGIVLAGMVAGAIILVREFFDNTISSIGTIKTQDL
A0A371QNR3      GLGRPVDYGMMPGRPVEPRTRMIGLIGLLLGGVVGMGYAFGREALIKVIDGTEKMRKLNY
A0A3M8G9D1      GLGRPLDKALVPLEPIKPRKKIITIIGFFFGGFLAVGFVLIRNLIDDKITSTDSIKDFKL
A0A2D9FS21      GMGRPLDYAVVPNNPIKPQKKLWVLIGFLLGGILGVGFIFIKEALDDTIKSSDALRSYKV
A0A521C203      GLGRPLDYAVVPKNPIKPQKKLWVLIGFLLGGILGAGFIFIREALDDSIKSSDFLKKYNV
A0A2N0VKD0      GQGRPLDYAFVPDKPTEPKKRMIVIVGFLLGGIVSLGAVFTRELFNNTLDSVDHLKERGY
A0A651G3P5      GAGQPLDYGLAPGGPSGPNRTRYVMIGFLLGGILSVGFVFVKENLNRTIDGTDKLRKLGY
                * *. :* .  .  *  *.     : *:.:.*.:. .  :  : :   : .   :.    

A0A2N0VGH6      PLLAAVPVLDKVSKKSKKSFKN----GSGKIPDELVLLRDRSNLASEAIRRLKNNLIYQN
A0A1B6Y5X7      PVLGAIPDFSVVGEFNPNERQYI---GDKSISNQLVTFFDHISPISEAYRRLRINVVYAN
A0A371QRZ8      PMLAAIPSLKKISVKNGNGSGDYKVGKGK-IPNEMVLFRDRSHVISESIRRLKNNIIFQN
A0A371QNR3      PVLSVIPDIKKVVKEKFKGDDTIPVADGRKVSSTILTLVDRISPVAESFRRLHNNIVYSQ
A0A3M8G9D1      PLLGTIPDFSILDGLDSNERQFI---DDKSVSNQLITFLDHISPISEAYRRLRINVVYAN
A0A2D9FS21      PFLGNIPDFNIIDSFDPGQKQYV---QGKPVSNQLLTFLDHISPISEAYRRLRINTIYAN
A0A521C203      PFLGNIPDFKIIDSLDPDGKQLI---QGKSVSNQLLTFLDHISPISEAYRRLRINTVYSD
A0A2N0VKD0      PLLTVIPDMTNRMKEIFGDSKTVTI-QGKSISTSLLSITDSISPVSESFRRLHNNIIYSH
A0A651G3P5      PLLAIIPDTTNVIRKRYDSERFIEA-EDHRVSTSWLSLLDTVSPAAESFRRLHNNIIYSD
                *.*  :*                    .  :.   : : *     :*: ***. * ::  

A0A2N0VGH6      GDYPPKTIAITSAEKGDGKSTVVSNLAVSFAEDGYKTLLIDTDFRRPKLHSYFGHDNESG
A0A1B6Y5X7      PDKEYKILMVSSATKGEGKSTVAANLAVTFTGSEKKVLIIDLDLRRPTQHKIFGENKEPG
A0A371QRZ8      SDNIPKTIAITSSEKGEGKSTIACNLAIAFADEGYKTLMIDTDFRRPRVHTLFGLPNEKG
A0A371QNR3      PDEKFQTILVTSSAQGEGKTTIVSNLAVALTEAGKKVLIVDLDLRRPKLHILWKESQRPG
A0A3M8G9D1      PDKVHRVIMVTSATKGEGKSTLAANLAVTFSEAEKSVLLIDLDLRRPTQHKIFGENREPG
A0A2D9FS21      PDKDYKVLMVTSSTKGEGKSTIAANLAVTFAEAEKSVLIIDLDLRRPTMHKIFGENKEPG
A0A521C203      PDKDYKVLMVSSSAKGEGKSTIAANLAVTFAEAEKSVLVVDLDLRRPTMHKVFGENREPG
A0A2N0VKD0      PDENFKRILITSSAKGEGKSTVSTNLAVILADSGKKVLIIDSDLRRPNLHKLLGENRIPG
A0A651G3P5      PDSENKVILITSSKKGEGKTTISMNLAVAFAESGKRVLVIDTDLRRPNIHHFSGVARMPG
                 *   . : ::*: :*:**:*:  ***: ::     .*::* *:***  *      .  *

A0A2N0VGH6      LTD-YLSGRIKLVKLMKDTDINMLKLITSGGRHEAPDTVVNSKKFNDFLNQMEEVFDIII
A0A1B6Y5X7      LSD-ALFDAS--IDVRLSTVAPNVDLITVGHKTPEPASVLDSKRLKQLIDKYKAEYDHII
A0A371QRZ8      ISN-LVKGDSAASEIIQSSEIKFLKVISAGSNILRPESIVNDKKFNEFLEKMDKLFDVII
A0A371QNR3      LIE-VLFEDVTLEEAIKPSAAPGIDLLMAGTKTPNPAAINQSEALRKLIIELKERYDHIL
A0A3M8G9D1      LTD-SLFETIKISDITRETIAPNVDLITVGKKTPEPATVLDSKRLKQLIDKLSERYDHII
A0A2D9FS21      IVE-MLFDTAGFDSTINPTIAPNVDLLTVGKKTPEPASVLDSRRLKDVIDKLKDKYDHII
A0A521C203      LVE-LLFETAGFDNCIKETIAPNVDVICAGKKTPEPASVLDSQRLKTVIDKLKDKYDHII
A0A2N0VKD0      LIDTLFNDDIELSQVIRETVVPNLDLLTTGQEPPNPSAVLQSEKLKGLIDQVEEHYDHII
A0A651G3P5      IAE-IFYDDKSLTASIKPTIAPGVHVLTAGRKIPNPSAVIQSKKLRVLLDKVKEKYDHII
                : :  .            :    : ::  *     * :: :.  :. .: : .  :* *:

A0A2N0VGH6      LDTPPFGIVSDSTALLKRAKSTVLVTKYRKTNRGVFQKTVEDLERINANISGIVVNGFDH
A0A1B6Y5X7      LDTAPYGIISDSASLLRLIDGLIVVSRFNVTTKRELKFTLEGLEHLNADVLGIVLNAFDP
A0A371QRZ8      LDTPPFGIISDSTSLLRKADATVMVAKYRKTNKEVYMHTLDELRRINANVCGMVLNDFEP
A0A371QNR3      IDTAPYGIITDAAPMMRLADGIVVAARFNKTKETQLEHTLGNLERIHANILGTVLLGFDH
A0A3M8G9D1      LDTAPYGIISDSASLLRLVDGIVVVSRFNVTTKRELKYTLEGLNHLNADVLGVVLNAFDP
A0A2D9FS21      LDTAPYGIISDSASLLRLTDGIIVVSRFATTTHKELEFTLNGLKQLNAEIVGLVLNAFDP
A0A521C203      LDTAPYGIISDSASLLRLTDGIIVVARFGLTSKKELDFTLDGLKHLNANIVGLVLNAFDP
A0A2N0VKD0      IDTAPYGIITDAAPLIPIVDGVVLIARFGETPINELNQSIENLERVHAKIIGTVLTAYNY
A0A651G3P5      IDTPPFGVITDAAPIIKLADLVVLVTRFGVTQINELNFTIENLKRIQAKLAGTVITAFNH
                :**.*:*:::*::.::   .  :: :.:  *       ::  * .::*.: * *:  :: 

A0A2N0VGH6      KKETSGYYGSGYYKSMYESYESYV-------
A0A1B6Y5X7      KKSTDYY---TNYNYYKRTYSEYYKYR----
A0A371QRZ8      KKDPASHYGSGYYKSLYDGYGAYA-------
A0A371QNR3      HKSSDYYYGNDNYYYAYEAYDEYHKEKA---
A0A3M8G9D1      KRSTDYY---TNYSYYKRTYSEYYQEEV---
A0A2D9FS21      KKSSDYY---TNYYYYKRAYSDYYEEDKA--
A0A521C203      KRSSDYY---TNYYYYKRAYKDYYEEEKAAL
A0A2N0VKD0      EKSGDYYTRSNGHYDYQRAYKDYNRSI----
A0A651G3P5      RDSADYYYSNKYTYDSYQAYEAYQEDEEELV
                  .   :            *  *        

© 1998-2020Legal notice