BYKdb

Dataset for cluster orphancd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

258 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A7X8GFH1      ------------------------------------------------------------
A0A7C7CKY6      ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ------------------------------------------------------------
A0A519SD85      ------------------------------------------------------------
A0A3M1TXY5      ------------------------------------------------------------
A0A7T9KM12      ------------------------------------------------------------
A0A2E0VQ27      -------------------------------------------------------MTFNK
A0A7Y7TYP1      ------------------------------------------------------------
R6U429          ------------------------------------------------------------
A0A5C8AF42      ------------------------------------------------------------
A0A7Y5SYP1      ----------------------------------------------MEQRNEQIPTNQTT
A0A7V1N701      -----------------------------------------MNIDTRTDPAAQGDILPSA
A0A7V2NIA8      ------------------------------------------MNTTSTDLFQQAESLSA-
A0A239K409      ---------------------------------------------MVMIDKEAQKMGNRQ
A0A1M3DPL8      ------------------------------------------MNMEEENKDIKTSDFTDE
A0A1V5F519      ---------------------------------------------MNPDTGSINQNFTEE
A0A2G6R1T9      ---------------------------------------------MEENSLNQQQFDDSE
A0A350V3E4      ------------------------------------------------------------
A0A6J4K208      ------------------------------------------------------MKNSSS
A0A2W4RDE8      ----------------------------------------------------------ME
A0A212J9Z9      ----------------------------------MDNN----NKKVIESDPYFEEVKTKT
F5IV23          ----------------------------------MDNN----NKKVIESDPYFEEVKTKT
A0A1M5DFS8      ----------------------------------MEQNINTTRPNDYGADPYFDEVQAKS
A0A4Y8KZS5      ----------------------------------MEQSLN--KPNDFGTDPYFDEIQAKT
A0A2V3PNY7      ----------------------------------MEQNIN--RPADFGTDPYFDEVQAKT
A0A6G7X5K8      ----------------------------------MEQNIN--RSPDFSTDPYFDEVQAKT
A0A840CJ33      ----------------------------------MDINKNNIKKAE-NTDPYFEEVKSKT
F8X2T0          ----------------------------------MDINN---KPGA-DTDPYFEEIKSKT
A0A1M3LAG1      ----------------------------------MDINN---KPGA-DTDPYFEEIKAKT
A0A212K6G4      ----------------------------------MDINN---KPGA-DTDPYFEEIKAKT
A0A4Y9IPG7      ----------------------------------MDINN---KPGA-DTDPYFEEIKAKT
A0A0L8VEV2      -----------------------------------------------MKTMEDFSKSLER
A0A1I2A9Z9      -----------------------------------------------MKTMEEYSNSLER
A0A848XXC6      MNDQPTTPLFPLQPEEDAPASGEPSLDPTPGFEEGVVYDAVYEDLDEAFAAESASDGSEG
A0A2P8CDS1      ---------------------------------------------MDTQNPLTPNQPTTF
A0A660LQT8      -----------------------------------------------MEDKDNITPSQET
A0A3D0FMX4      -------------------------------MATDTNVQNQ------------DFTNQDD
A0A7V6G854      -------------------------------MDLSNNQNNV----------VPNNGFDEE
A0A1M3MEI8      -------------------------------MEQPVKPRER-------------VIPEEE
A0A1J5HQM0      -------------------------------MEQNKPAN---------------PFSEEE
E4T131          ----------------------------------MDKFNLE------------KPFNSEE
A0A653AC35      --------------------------------MEENPYNTQ----------YPQQFTEEE
A0A847LA02      -------------------------------MEENKKYNQQQYQNQMQQNSQSQQFTDDE
A0A389LWV6      -------------------------------------MESTNTKSTNFSIDDTNFQHPGN
A0A1G9B1T9      -----------------------------------------------METSRYSHTQALK
A0A350PNH9      ----------------------------------------MIQNNQATMQNVLVRRPQQA
A0A354LNT9      ----------------------------------------MIQNNQATMQNVLVRRPQQA
A0A161LWY6      --------------------------------------METNNNNQYQNYPLSNSDMEED
A0A6I3N9U6      --------------------------------------METNNNNQYQNYPLSNSDMEED
A0A353WYK7      ---------------------------------------------------------MEQ
A0A2W7RD29      -----------------------------------------------MNNKSESDPLLLS
A0A3N2NDY8      -----------------------------------------------MSDNINVTQESEA
D7JEV9          --------------------------------------------MEQNNNISNNTFNEEE
A0A553GA49      -------------------------------------------------------MNLEN
A0A7V5GTN5      ----------------------------------------MPYDNQDIAYEDVISPEARV
A0A497D6F6      ------------------------------------------------------------
F4KR18          ---------------------------------------MNEFEYPKAILLNSNLKDSSD
B5CTK0          ----------------------------------------------MAEKKQATDLLKGE
A0A5M4AAB9      ------------------------------------------------------------
A0A5R9QZP0      ----------------------------------------------------MSLNNNHP
A0A7X6SRJ5      -----------------------------------------------------MSYQNDS
A0A3D3HL11      -------------------------------------------------MQLMTNNNDSQ
A0A6L8U6G9      ---------------------------------------------------MTNNQNDSQ
A0A6L8UH35      ----------------------------------------------------MLKTNDSD
A0A7X9F2J5      ----------------------------------------------------MLKTNDSD
A0A352ME00      ----------------------------------------------------MLKTIEPD
A0A7X8CRA6      ----------------------------------------------------MLKTIEPD
A0A1F3D6P8      ------------------------------------------------------MTKETD
A0A356Z058      ------------------------------------------------------MTKETD
A0A7X8FHL3      ----------------------------------------------------------PD
A0A3D1BT36      ----------------------------------------------------MSKNNETK
A0A7X7CXW9      --------------------------------------------------MTNNINNDSQ
A0A4R6H3B7      -----------------------------------------------MKTMEEYSNSLER
A0A229I3A5      ----------------------------------------------------MARP-NQE
A0A3R6HJB3      ----------------------------------------------------MARP-NQE
R6NN15          ----------------------------------------------MSETQQHTRPAAKA
A0A2W7QSQ0      -------------------------------------------------MRKINKKVNSN
A0A841MQL4      -------------------------------------------------MKRIRREIDNH
A0A3P1Z8V4      --------------------------------------------MIQSSSSHPDYPHLPS
A0A1M6MYT6      -----------------------------------------MKKQQNDKDILNFYGQLEE
A0A1V5S1J9      -----------------------------------MDNNQQYTQNQYTSQANAFSDDDGG
A0A7X8JMH1      -----------------------------------MENNVP--QNNF--------NEENE
A0A3D5KRY6      ------------------------------------------------------------
R7F6L5          --------------------------------------MANQIKENEAANISPYYEQAAP
A0A7C5MRV2      -------------------------------------------------MRPVLKSRGTG
A0A0A2EYC8      -----------------------------------------MENTNN-IPNIQTFSEEE-
A0A2G6H6Y4      -----------------------------------------METSNNQIQSMQQFSEEDN
C9LKL0          ------------------------------------------------MEYSQKNEVQNS
A0A3D0QPV7      -------------------------------------------MIDEKIQRQSESFSQYK
A0A496KT23      ---------------------------------------MQRSAENFSQNSSFISQTSSV
L1M9T3          ------------------------------------------------------------
A0A2M6GH67      ------------------------------------------------------------
A0A7K1TE30      -------------------MASNENAELEELIRRATSGQEGPPAAGGPIASDAGESEPGE
A0A7D4BE70      ------------------------------------------------------------
A0A142HHS5      -------------------MASTENAELEELIRRASTGGEAAPPTGASFAEE--DTEDGD
A0A7D4C435      -------------------MALSENAELEELIRRTTTGTEATLPVSGGTGED--ESGGES
A0A3C0I8F1      --------------------------------DYFVKKIIPPTTVFLERNHENINKILEE
R5JJI4          ------------------------------------------------------------
A0A848IUK4      --------------------------------------MRDKNYDIGVRSSGLGDEERST
A0A136LSC7      ----------------------------------------------MLQPKEIGP--QVQ
A0A5C7N8Q5      ---------------------------------------------MLKEPKDIGPLTEVQ
A0A355BP94      ----------------------------------------------MSKQLNSPTTDPIE
A0A7Y5D1K7      ---------------------------------------------MNNNRLRPQRNDALE
A0A3D2HF71      -----------------------------------------MTSPSPLNNPSQPYYIPPE
A0A0A2DQN2      --------------------------------------------------------MIRQ
A0A0A2F2N5      --------------------------------------------MTPQSSSKQTKSAGTV
L1NGW4          ---------------------------------------------MANTQETTSTQPAEK
Z4WRA0          ---------------------------------------------MANTQETTSTQPAEK
U2K8K9          -----------------------------------------------MPEQQITNRPSDK
A0A069ZM60      ----------------------------------------------MSTQTNRSNQAGEK
J6GV98          ----------------------------------------------MSTQTNRSNQAGEK
A0A134B4F8      ----------------------------------------------MSTQTNRSNQAGEK
A0A134B8C7      ----------------------------------------------MSTQTNRSNQAGEK
A0A4Z0EKR0      -----------------------------------------------MTNDELFPLKTEQ
A0A521H707      -------------------------------------------------MAKKKISNLNE
A0A7T9D909      --------------------------------------MINEDISQRNLNFESYRERITN
A0A1M6B6D5      --------------------------------------------------MSEEFETNEA
A0A451FS66      --------------------------------------------------MNQEFDIKQA
A0A2E3GN39      ------------------------------------------------------------
A0A3D1MEL0      ------------------------------------------------------------
A0A519UDD1      -----------------------------------------------MANDDLFPVSREQ
A0A7Y2ACP6      ------------------------------------------------------------
A0A2A4N9A6      ---------------------------------------------------MKENQIQNP
A0A6C0GGI1      ------------------------------------------------------MANQPN
A0A368D1N7      ----------------------------------------------MSEPSKKKQQSSVL
A0A3B8TU58      ------------------------------------------------------------
A0A1T5IIR6      --------------------------------------------------MKTAPRKVTR
A0A3E0QD27      -------------------------------------------------MGKKKITNLNE
A0A0K2HKS3      -----------------------------------------MIRMSEQKDMSGDKTLSGG
B6W3W8          -----------------------------------------MIRMSEQKDMSGDKTLSGG
A0A0M1W1I6      -----------------------------------------MIRMSEQKDMSGDKTLSGG
A0A4R4GHU2      -----------------------------------------MIRMSEQKDMSGDKTLSGG
I8WPR6          -----------------------------------------MIRMSEQKDMSGDKTLSGG
A0A076IRY8      -----------------------------------------MIRMSEQKDMSGDKTLSGG
A0A3A6AD54      -----------------------------------------MIRMSEQKDMSGDKTLSGG
A0A8B3EPF6      -----------------------------------------MIRMSEQKDMSGDKTLSGG
I8WPP8          -----------------------------------------MIRMSEQKDMSGDKTLSGG
A0A372Y7D2      -----------------------------------------MIRMSEQKDMSGDKTLSGG
A0A7K3KFI2      -----------------------------------------MIRMSEQKDLSGDKATSGG
A0A3E4JJC9      -----------------------------------------MIRMSEQKDLSGDKATSGG
A0A3E4WDQ0      -----------------------------------------MIRMSEQKDLSGDKATSGG
A0A414H9P2      -----------------------------------------MIRMSEQKDLSGDKATSGG
A0A7K0JKU9      -----------------------------------------MIRMSEQKDLSGDKATSGG
C3R5A8          -----------------------------------------MIRMSEQKDLSGDKATSGG
A0A6N8DCX3      -----------------------------------------------MDLLLQELQGGKP
F0R0C9          -----------------------------------------------MAIPNNPTRPKQG
A0A1C5XJA7      --------------------------------------------------MQNNIQSNKN
A0A285T4L1      --------------------------------------------------MQNNTLSNKN
R7CUW4          --------------------------------------------------MQTTSNNNRN
A0A416GGJ1      --------------------------------------------------MQTNKKVDSG
D1JY72          --------------------------------------------------MSGDKTLSGG
D7J4K6          --------------------------------------------------MQNNSLSNKN
Q8ABP9          --------------------------------------------------MQNNSLSNKN
D6D2Z5          --------------------------------------------------MQNNSLSNKN
A0A1T3EDR4      ----------------------------------------------MIRNSKYINIRGTW
A0A6N8KXI9      --------------------------------------------MSNTANNYQPIEGLNA
A0A174SDD8      ------------------------------------------------MEKHKKLAVTEE
A0A1H7RFH3      ------------------------------------------------MEKHKKLAVTEE
A0A139L1N2      ------------------------------------------------MEKHKKLAVTEE
A0A174TVL8      ------------------------------------------------MEKHKKLAVTEE
A0A1H8BJR6      ------------------------------------------------MEKHKKLAVTEE
R9H6G0          ------------------------------------------------MEKHKKLAVTEE
A0A412GR09      ------------------------------------------------------MAVTEE
A0A7J5JXN6      ------------------------------------------------------MAVTEE
R6D982          ------------------------------------------------MEKQVKKILAEE
A0A1F0I8C4      ------------------------------------------------MEKQRKLALTEE
A0A3A5RIJ2      ------------------------------------------------------MALTEE
A0A515IZJ5      ------------------------------------------------------MALTEE
A0A7J4Y2H6      ------------------------------------------------------MALTEE
A0A4R6WE41      ---------------------------------------------MVKNKDTEGVVQEQR
A0A2T5RP38      ---------------------------------------------MNTLNQKEYRIGERK
A0A1A6CF06      ---------------------------------------------MNQYSKNSV----QK
A0A1T3D6S8      ---------------------------------------------MNQYNKHSV----QK
A0A8B4GMS2      ---------------------------------------------MNQYNKHSV----QK
A0A7Z7LUP7      ---------------------------------------------MNQYNKHSV----QK
A0A0B8T471      ----------------------------------------MDNTNYNPYIESRE----KE
A0A4R7D2K0      ----------------------------------------MDNTNYNPYIESRE----KE
A0A7T9S3V1      ---------------------------------------------MNLTTQDNL----KT
A0A7T9LVI2      -------------------------------------------MVNNQITQNIT----KA
C2FUH6          -------------------------------------------MVNNQITQNIT----KA
A0A1V3N3U3      -----------------------------------------MNNILERTGAGAE----RK
A0A1P8E011      ---------------------------------------------MKTTHYNQL----QK
A0A7T9S8K4      ---------------------------------------------MKTTHYNQL----QK
A0A2X2J8S4      --------------------------------------MENRPEVVNNQFFGA-----KN
A0A3C0S618      --------------------------------------MENRPEVVNNQFFGA-----KN
A0A4P7DRF9      ------------------------------------------MSKISNTYMQK-----QQ
A0A239XXC4      ---------------------------------------------MNKSFQGKG----KQ
A0A4U9K473      ---------------------------------------------MSKPFQGKG----KQ
A0A081PBV5      ---------------------------------------------MDNLNNINLMPKAKE
A0A1I2AN85      ---------------------------------------------MDNLNNINLMPKAKE
A0A4U0GMP3      ---------------------------------------------MENSAATNYLVQEKE
A0A0D5BSQ0      -----------------------------------------------MINQNKQNV--QK
A0A1T3F6P5      ---------------------------------------------MDTINQKNQVVGNKK
A0A853VUQ0      ---------------------------------------------MDTINQKNQVIGNKK
A0A7X0MJ00      -------------------------------------------------MSKSNKKDENE
A0A841JHZ0      ---------------------------------------------MDSFVDKSYRIGENE
A0A1H6CKR6      -------------------------------------------------MNKDFLIKDKQ
A0A7W3MGA7      --------------------------------------------MVNHSTNKPFQGKGKQ
A0A3M1Y2F5      ------------------------------------------------------------
A0A7V1ALN2      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A836SQI2      ------------------------------------------------------------
A0A7V1FAJ9      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
A0A848Y4B8      ------------------------------------------------------------
A0A7Y4V8Y1      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A847AMH6      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A7V1FAS7      ------------------------------------------------------------
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      ------------------------------------------------------------
A0A7C7CKY6      ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ------------------------------------------------------------
A0A519SD85      ------------------------------------------------------------
A0A3M1TXY5      ------------------------------------------------------------
A0A7T9KM12      ------------------------------------------------------------
A0A2E0VQ27      EYKMIIRPLLKASPV--------LIGLITIAILV------------------------TR
A0A7Y7TYP1      ------------------------------------------------------------
R6U429          ------------------------------------------------------------
A0A5C8AF42      --------------------------------VI--------------------------
A0A7Y5SYP1      GTEFLTIEDFLDSVR--------RWKWIIISSTV------------------------LA
A0A7V1N701      SLRMLFSRALQVVLK--------RWVLFMVVFFA------------------------VF
A0A7V2NIA8      --RDIYERIMGALLK--------HLVLFVVFFLV------------------------TL
A0A239K409      NEQESFIDSFFKYVR--------YWYLFLLGLLI------------------------TV
A0A1M3DPL8      ESSFDIMEWVMLFVS--------HWYLILISVFV------------------------FM
A0A1V5F519      ESSFDFQKWLHLFIK--------NWYLFLIFIPF------------------------FL
A0A2G6R1T9      ESGFDFMSWVILLVQ--------YWYLFVIFGVL------------------------AF
A0A350V3E4      -----------------------MPILLSLAVGL------------------------VV
A0A6J4K208      REKMGWTYVLRNLRR--------RWYLFALALAF------------------------AV
A0A2W4RDE8      EEKINIKKIFHKLIS--------KWYYFPLGLLI------------------------TM
A0A212J9Z9      NISFDFVLWFYRILK--------YWYLFIISVAL------------------------FL
F5IV23          NISFDFVLWFYRILK--------YWYLFIISVAL------------------------FL
A0A1M5DFS8      KFSFDFVLWFYRILK--------YWYLFVLSLAL------------------------FL
A0A4Y8KZS5      KFSFDFVLWFYRILK--------YWYLFILSLAL------------------------FL
A0A2V3PNY7      KFTFDFVLWFYRILK--------YWYLFALSLAL------------------------FL
A0A6G7X5K8      KFSFDFVLWFYRILK--------YWYLFAISLAL------------------------FL
A0A840CJ33      NISFDFILWFYRILK--------YWYLFVISIAL------------------------CL
F8X2T0          TLSFDFVLWFYRILK--------YWYLFVISVVL------------------------FM
A0A1M3LAG1      TLSFDFVLWFYRILK--------YWYLFVISIAL------------------------FM
A0A212K6G4      TLSFDFVLWFYRILK--------YWYLFVISIAL------------------------FM
A0A4Y9IPG7      TLSFDFVLWFYRILK--------YWYLFVISIAL------------------------FM
A0A0L8VEV2      EDMLAIKKFFHKLKR--------NWYWFMIAGII------------------------GG
A0A1I2A9Z9      EDMLSVKKFFHKLVR--------NWYWFMIVGII------------------------GV
A0A848XXC6      DGSTEDVDAHVVTVQ--------VGDPFVDEAVLGEVFDTDVDPDGLLSMPPFETPADLS
A0A2P8CDS1      SRPRNYRKYFFLLLS--------HWYWFVIAFIL------------------------TV
A0A660LQT8      KNGVDIVDVLYLCLD--------RWYWFVVSVLL------------------------FL
A0A3D0FMX4      RIQFDVMEWVFKFLS--------VWYLYVICLAI------------------------AF
A0A7V6G854      DISFNWLEWLMRIVR--------HWYLFVIAVIL------------------------AL
A0A1M3MEI8      ESGFDIMEWVAHFIG--------HWYLFVIGLVI------------------------AF
A0A1J5HQM0      ESSFDIMEWVNIFLH--------FWYLFVIFVII------------------------SL
E4T131          ESGFDIMEWVSYFLN--------NWYLFVIGIIL------------------------SL
A0A653AC35      ESSFDIKEWAFLFLH--------YWYLFVIFIAL------------------------AL
A0A847LA02      QSGFDIKEWLLLFLH--------YWYLFVICGLI------------------------AL
A0A389LWV6      TSSFDLVLWIFRILK--------YWYLFLVVILL------------------------SL
A0A1G9B1T9      SDPIDLSVITKKIIR--------KWYLLLGSLLL------------------------TL
A0A350PNH9      EDFIRLQDLMYLCLV--------RWRWFVISLVV------------------------TL
A0A354LNT9      EDFIRLQDLMYLCLV--------RWRWFVISLVV------------------------TL
A0A161LWY6      ESGFDIIEWLFKILR--------HWYLFVIALAI------------------------SL
A0A6I3N9U6      ESGFDIIEWLFKILR--------HWYLFVIALAI------------------------SL
A0A353WYK7      NQQFDFDKLQMVFKR--------SLPVLIMLLIF------------------------SV
A0A2W7RD29      SQKIDFSVFFKRLGK--------KWPLFLLTGII------------------------CL
A0A3N2NDY8      AEEFSLKDFLACCLS--------KWRWFTVSIVL------------------------FC
D7JEV9          TSSFNFMEWAIRFLK--------YWYLFVLGVFI------------------------SL
A0A553GA49      DQSNDLKNVLHKVGK--------HWKLYVISITL------------------------FL
A0A7V5GTN5      TARSIFLPIILAILK--------RPWLSIGSIFL------------------------VM
A0A497D6F6      -----------------------------------------------------------V
F4KR18          SQVDYWGLLHKFILS--------KWYLYLAFSII------------------------CI
B5CTK0          DSSFNIGEILHMFLS--------NWYWFLVSVIL------------------------CL
A0A5M4AAB9      ------------------------------------------------------------
A0A5R9QZP0      EEGFNIKEFILLTFR--------YKYLYLLSIVV------------------------FL
A0A7X6SRJ5      SEGFNIKEFILQALK--------YRYFYIASFAI------------------------AF
A0A3D3HL11      SEAFNIKEFLAEALS--------YKYFYIASFFI------------------------CL
A0A6L8U6G9      SEAINIKEFITEALS--------YKYFYIASFFI------------------------CL
A0A6L8UH35      ASIAPIKYFIFKVAS--------LKYLYIFVLIL------------------------CL
A0A7X9F2J5      ASMAPIKYFIFKVAS--------LKYLYIVILVL------------------------CL
A0A352ME00      SSIAPLKYFILKVAS--------LKYLYMALIVL------------------------CL
A0A7X8CRA6      SSIAPFKYFILKVAS--------LKYLYISLILL------------------------CF
A0A1F3D6P8      SGIALIKHYLQDIAY--------FKYFYIICLVI------------------------LL
A0A356Z058      SGIALIKHYLQDIAY--------FKYFYIICLVI------------------------LL
A0A7X8FHL3      SSIAPLKYFILKVAS--------LKYLYMALIVL------------------------CL
A0A3D1BT36      SESLKIKEFIFKVFS--------YKYYFISSIIL------------------------LG
A0A7X7CXW9      SEAFNIKEFITEALS--------YKYLYIASFFI------------------------CL
A0A4R6H3B7      EDMLSVKKFFHKLVR--------NWYWFMIVGII------------------------GV
A0A229I3A5      EDFIRIQDLLYLCLT--------QWRWFILSLVV------------------------TC
A0A3R6HJB3      EDFIRIQDLLYLCLT--------QWRWFILSLVV------------------------TC
R6NN15          DDFIRIQDLYYLCLA--------KWRWFVLSLVI------------------------CL
A0A2W7QSQ0      EEPINIKLILRTILK--------SWYLFPIFILL------------------------FC
A0A841MQL4      EEPINVNLIFRAILK--------YWYLFPICIIL------------------------FC
A0A3P1Z8V4      DSDTNILPVLLKCWGIFRR----YWYWFALSTVL------------------------SL
A0A1M6MYT6      ESLISKKTLFKCFR---------NWYWYVVAVIV------------------------AG
A0A1V5S1J9      GQKFDIMLWVLRFLK--------SWYLFVISLAI------------------------FL
A0A7X8JMH1      SSSFDIKIWIIRILK--------NWYLFFISISM------------------------FL
A0A3D5KRY6      -------FIKATLLK--------NWYWLA-AFSF------------------------AG
R7F6L5          ASLVSVQGFLSFVRH--------RWYWYVISVAV------------------------CV
A0A7C5MRV2      NEEINLSKIWDLFEN--------SWYYVVVTLAI------------------------SI
A0A0A2EYC8      ASSFNLMEWVMRFLK--------YWYLFAIGVVI------------------------AL
A0A2G6H6Y4      TSSLSVMEWIMRCVR--------YWYLFVIGASI------------------------GF
C9LKL0          EFKIVPFLLLCYHVFLA------KWRWFAFSIIV------------------------CV
A0A3D0QPV7      ERITNFSNEFELGLFLYIARKSLRWVLLFLITSL------------------------LA
A0A496KT23      SILELLRDAWLLCLA--------HWKWFLLSVIV------------------------CL
L1M9T3          ----MVRDGFYLCLA--------HWKWFVLSLLV------------------------CL
A0A2M6GH67      ---FITLLVVTRKSL--------IWIVFLIMLGL------------------------GA
A0A7K1TE30      GLDIPTLVLVAKRSL--------PWVLLLLIIGL------------------------TA
A0A7D4BE70      ------------------------------------------------------------
A0A142HHS5      NFDLSTLVLVARRSL--------PWVIFLLTLGI------------------------TS
A0A7D4C435      SFDLTTLVLAARKSL--------PWAVLLVSLGL------------------------LS
A0A3C0I8F1      SEGMDIVNDFDFEKFVEILRGSIPFIILIVGLSL------------------------GG
R5JJI4          ------------------------------------------------------------
A0A848IUK4      GVDWEKFLTIFRKSI--------PFVILIIALAV------------------------SA
A0A136LSC7      SIDTEKLSAVIRKNL--------VWIVLIFIAVN------------------------LA
A0A5C7N8Q5      SIDTEKLAAVFRKNL--------IWIILIFIAAN------------------------LA
A0A355BP94      GFDLDKLWVLLKKNA--------LIIILLFLSTN------------------------LI
A0A7Y5D1K7      GIDLEKLKMVARKNL--------WAIIIIFIVTN------------------------LG
A0A3D2HF71      EEGLDFKRYLSLFIS--------NWYWFAGALLI------------------------AL
A0A0A2DQN2      VSDVNLLDVLRYLVS--------YWKWFVLSVLI------------------------CA
A0A0A2F2N5      VADINLIDLFFYLLG--------YWKWFLLSILL------------------------CT
L1NGW4          GLEVNLVDIFFYLLR--------FWYLYVICVGI------------------------VV
Z4WRA0          GLEVNLVDIFFYLLR--------FWYLYVICVGI------------------------VV
U2K8K9          GADLNLVDIFMYLYR--------YKFLYILCVGI------------------------VV
A0A069ZM60      AAEVNLLDIFFYLLR--------FWWLYLLSVGV------------------------VL
J6GV98          AAEVNLLDIFFYLLR--------FWWLYLLSVGV------------------------VL
A0A134B4F8      TAEVNLLDIFFYLLR--------FWWLYLLSIGV------------------------VL
A0A134B8C7      TAEVNLLDIFFYLLR--------FWWLYLLSIGV------------------------VL
A0A4Z0EKR0      PETADLKSVLLSYAR--------YWYLFLIAVAL------------------------CL
A0A521H707      EFDFKLFTIIARKNA--------YWLFLLLTISS------------------------TF
A0A7T9D909      FSNEFELGLFLYIFK--------RSSIWIGMCLL------------------------LA
A0A1M6B6D5      GTTFDFKGFLIRLLR--------NWPLFLIFLAI------------------------TF
A0A451FS66      DGSFDFKGFFDRLLR--------SGPLFLISFLI------------------------TF
A0A2E3GN39      -------------------------------MLL------------------------SS
A0A3D1MEL0      -------------------------------MLL------------------------SS
A0A519UDD1      PGTFDARRILLQYTR--------YWYLFLIGAIL------------------------GV
A0A7Y2ACP6      -------------------------------LFL------------------------CG
A0A2A4N9A6      LPDLDIGLLIGIFRK--------SFLLFCLIFAM------------------------AM
A0A6C0GGI1      ESKLDLKQLFSRYFT--------KWYYFLISLAI------------------------AL
A0A368D1N7      YDKFNVGLLLYVLRK--------SFKWFFLFMLL------------------------SS
A0A3B8TU58      -------------------------------MLL------------------------SS
A0A1T5IIR6      NEQVNLVDLFYYLIG--------NWYWFLLCVLL------------------------AL
A0A3E0QD27      EFDFKLFSIIAKKNA--------YWLFVILTICF------------------------TS
A0A0K2HKS3      GFNINPVDIIMYLLS--------KWYWFVLSVSL------------------------FG
B6W3W8          GFNINPVDIIMYLLS--------KWYWFVLSVSL------------------------FG
A0A0M1W1I6      GFNINPVDIIMYLLS--------KWYWFVLSVSL------------------------FG
A0A4R4GHU2      GFNINPVDIIMYLLS--------KWYWFVLSVSL------------------------FG
I8WPR6          GFNINPVDIIMYLLS--------KWYWFVLSVSL------------------------FG
A0A076IRY8      GFNINPVDIIMYLLS--------KWYWFVLSVSL------------------------FG
A0A3A6AD54      GFNINPVDIIMYLLS--------KWYWFVLSVSL------------------------FG
A0A8B3EPF6      GFNINPVDIIMYLLS--------KWYWFVLSVSL------------------------FG
I8WPP8          GFNINPVDIIMYLLS--------KWYWFVLSVSL------------------------FG
A0A372Y7D2      GFNINPVDIIMYLLS--------KWYWFVLSVSL------------------------FG
A0A7K3KFI2      GFNINPIDIVMYLLS--------NWYWFILSVSL------------------------FG
A0A3E4JJC9      GFNINPIDIVMYLLS--------NWYWFILSVSL------------------------FG
A0A3E4WDQ0      GFNINPIDIVMYLLS--------NWYWFILSVSL------------------------FG
A0A414H9P2      GFNINPIDIVMYLLS--------NWYWFILSVSL------------------------FG
A0A7K0JKU9      GFNINPIDIVMYLLS--------NWYWFILSVSL------------------------FG
C3R5A8          GFNINPIDIVMYLLS--------NWYWFILSVSL------------------------FG
A0A6N8DCX3      DDALRVKEFFYLCLA--------KWRWFVVSVLS------------------------CV
F0R0C9          DDFIRIQDLFYLCLA--------KWRWFVVSLVL------------------------TL
A0A1C5XJA7      DQNINLLDLLMYLAS--------KWKWFIMSVLI------------------------FG
A0A285T4L1      EQSINLVDLFVYLLS--------KWKWFVLSVLL------------------------FG
R7CUW4          EQGINVVDLLVYFAS--------KWKWFLISVLV------------------------CG
A0A416GGJ1      ---LNLIDVFSFLAS--------KWKWFLLSVLV------------------------FG
D1JY72          GFNINPVDIIMYLLS--------KWYWFVLSVSL------------------------FG
D7J4K6          EQGVNLVDLSVYLLS--------KWKWFVLSVLL------------------------FG
Q8ABP9          EQGVNLVDLSVYLLS--------KWKWFVLSVLL------------------------FG
D6D2Z5          EQGVNLVDLSVYLLS--------KWKWFVLSVLL------------------------FG
A0A1T3EDR4      GENFHILDLFKYALG--------YWYWLVLSCIF------------------------FG
A0A6N8KXI9      HKTINLLDIVNYLLH--------YWKWYVLSILV------------------------FT
A0A174SDD8      EKSINIVDLFIYLLV--------HWKWFVLSILL------------------------FG
A0A1H7RFH3      EKSINIVDLFVYLVV--------HWKWYLLSILL------------------------FG
A0A139L1N2      EKSINIVDLFVYLVV--------HWKWYLLSILL------------------------FG
A0A174TVL8      EKSINIVDLFVYLVV--------HWKWYLLSILL------------------------FG
A0A1H8BJR6      EKSINIVDLFVYLVV--------HWKWYLLSILL------------------------FG
R9H6G0          EKSINIVDLFVYLVV--------HWKWYLLSILL------------------------FG
A0A412GR09      EKSINIVDLFVYLVV--------HWKWYLLSILL------------------------FG
A0A7J5JXN6      EKSINIVDLFVYLVV--------HWKWYLLSILL------------------------FG
R6D982          DKSINLVDILMYLLS--------YWKWYVLSILI------------------------CG
A0A1F0I8C4      EKSVNIVDVFMYLIA--------HWKWYFLSILL------------------------FG
A0A3A5RIJ2      EKSVNIVDVFMYLIA--------HWKWYFLSILL------------------------FG
A0A515IZJ5      EKSVNIVDVFMYLIA--------HWKWYFLSILL------------------------FG
A0A7J4Y2H6      EKSVNIVDVFMYLIA--------HWKWYFLSILL------------------------FG
A0A4R6WE41      DPSLNVLDVLKYLLS--------YWPWFLASILL------------------------FG
A0A2T5RP38      EQTINVLDLLKYLLH--------NWKWFALSILV------------------------FG
A0A1A6CF06      ENTINVLDIFKYLLF--------HWKWFALSILI------------------------FG
A0A1T3D6S8      ENTINVLDIFKYLLF--------HWKWFALSILI------------------------FG
A0A8B4GMS2      ENTINVLDIFKYLLF--------HWKWFALSILI------------------------FG
A0A7Z7LUP7      ENTINVLDIFKYLLF--------HWKWFALSILI------------------------FG
A0A0B8T471      GKSLNLIDLIKYLLL--------HWYWFVLSVLL------------------------FG
A0A4R7D2K0      GKSLNLIDLIKYLLL--------HWYWFVLSVLL------------------------FG
A0A7T9S3V1      EKSVNIIDLFKYLTI--------HWKWFVLSVLL------------------------FG
A0A7T9LVI2      DKSVNIIDLFKYLMI--------HWKWFALSVLL------------------------FG
C2FUH6          DKSVNIIDLFKYLMI--------HWKWFALSVLL------------------------FG
A0A1V3N3U3      NNSVNVLDIFKYLLF--------HWKWFVLSVLC------------------------FG
A0A1P8E011      DKSINVLDVLAHLLY--------HWKWFALSILL------------------------FG
A0A7T9S8K4      DKSINVLDVLAHLLY--------HWKWFALSILL------------------------FG
A0A2X2J8S4      NSTFNVLDIIKYLLF--------HWPWFLLSVCI------------------------FG
A0A3C0S618      NSTFNVLDIIKYLLF--------HWPWFLLSVCI------------------------FG
A0A4P7DRF9      EKSINILDLFRYLLA--------NWKWFLLSVLI------------------------FG
A0A239XXC4      DQSLYVLDILRYLLG--------NWKWFLLSILI------------------------FG
A0A4U9K473      DQSLHVLDILRYFLS--------NWKWFLLSILL------------------------FG
A0A081PBV5      EKSINLLDILKYLLF--------QWKWFLLSIFI------------------------FG
A0A1I2AN85      EKSINLLDILKYLLF--------QWKWFLLSIFI------------------------FG
A0A4U0GMP3      EKSINVIDILKYLLF--------HWKWFVLSILI------------------------FG
A0A0D5BSQ0      DGIINVLDILKYFLF--------HWKWFALSVLI------------------------FG
A0A1T3F6P5      EHSVNVLDILKYLLH--------NWKWFALSILV------------------------FG
A0A853VUQ0      EHSVNVLDILKYLLH--------NWKWFALSILL------------------------FG
A0A7X0MJ00      DKSVHLLDLLKHLFF--------HWKWFVLSILV------------------------FG
A0A841JHZ0      DKSVHLMDLLKYLLF--------HWKWFVLSIML------------------------FG
A0A1H6CKR6      TQSINVLDVLKYLLS--------NWRWYLLSILI------------------------FG
A0A7W3MGA7      DQSLYVLDILRYLLA--------NWKWFLLSILV------------------------FG
A0A3M1Y2F5      ------------------------------------------------------------
A0A7V1ALN2      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A836SQI2      ------------------------------------------------------------
A0A7V1FAJ9      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
A0A848Y4B8      ------------------------------------------------------------
A0A7Y4V8Y1      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A847AMH6      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A7V1FAS7      ------------------------------------------------------------
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      ----------------------------------------------------------EK
A0A7C7CKY6      ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ------------------------------------------------------------
A0A519SD85      ------------------------------------------------------------
A0A3M1TXY5      ------------------------------------------------------------
A0A7T9KM12      ------------------------------------------------------------
A0A2E0VQ27      RAVTYMTP-----EYRAGGAIKINNLNYTQA--------AINLFGEENEKNLPRQNENFL
A0A7Y7TYP1      ---------------------------------------MNDFLNSSLFGKNQ----NFE
R6U429          ---------MRDLASFTGGLSRMRSSGS-----------------------------NVY
A0A5C8AF42      ---------QLDNQDNAKDIIELENINSKQD--------------------------DIS
A0A7Y5SYP1      FTVSYIYYYYQPNVYLSTVRLLYGKTTQEVSLFSGNFGSNQSR--------------ALG
A0A7V1N701      AGGLSFVL-TRPPIYVSKSTVMFEQVGKNSGDLATSYL-------------------NLS
A0A7V2NIA8      TAGVFIVL-GLPPVYISKATLMF---GVQTSPQAMATS-------------------TLI
A0A239K409      GTAYVYIQ-HATPLYLISGTLLIKTSGNEGQ-----LSESAAFSDLNTFKTSK----NFD
A0A1M3DPL8      FLAYMQNR-KWLPSFKSSATVIIDESRGSMN------SAQVLMQGFGIQESYR----NVN
A0A1V5F519      IGGYLKNR-SWMPLYQSVGTIIINENKYR-S------SSQGFMQGFGLEEAYQ----NVN
A0A2G6R1T9      GASYLKNR-SWVPVYFSSGKLMIDPNAGQ-N------NPQ-FMQGFGVESGHK----NMA
A0A350V3E4      SYFYAYSQ---VDIYASASSMRLSKPKENVLE-------NKIFSDIEGELPER----YIN
A0A6J4K208      AGAYLYLQ-FTPRVYNLTATLLVDGPGPAVPGSDAPPA-------------------GLE
A0A2W4RDE8      PLAYAYIQ-LTEPRYLVRASMLLKGEKDKGP--------SQFLKGMELFQSAT----DLE
A0A212J9Z9      GYAYIKNK-SWVPVFYVQALMILEDRNTASVVAGSVPTGTLLR--------------NTE
F5IV23          GYAYIKNK-SWVPVFYVQALMILEDRNTASVVAGSVPTGTLLR--------------NTE
A0A1M5DFS8      GYAYLKNK-SWTPLYRSGAVLMMESRGNSGVAMGAVQLGSLVQ--------------NSV
A0A4Y8KZS5      GYAYLKNK-SWTPLYRSSATLMMEPRGNNGVAMGSVQLGSLVQ--------------SSV
A0A2V3PNY7      GYAYIKNK-SWTPLYQSGAVLMMESRGNAGVAIGSVQLGTLVQ--------------NSI
A0A6G7X5K8      GYAYLKNK-SWTPLYQSGAVLMMEQRGNSGVAMGAVQLGSLVQ--------------NSV
A0A840CJ33      TYAFIKNK-TWVPQFMIQAVMILEDKNSASVVAGAVPTASLLR--------------NTE
F8X2T0          AYAFIKNK-SWVPLYGIQAMIILEDRGS-SMISGAVPLGSILR--------------NTE
A0A1M3LAG1      AYAFIKNK-SWVPFYGIQAMIILEDRGS-SMISGAVPLGSILR--------------NTE
A0A212K6G4      AYAFIKNK-SWVPFYGIQAMIILEDRGS-SMISGAVPLGSILR--------------NTE
A0A4Y9IPG7      AYAFIKNK-SWVPFYGIQAMIILEDRGS-SMISGAVPLGSILR--------------NTE
A0A0L8VEV2      AGGYLLTQ-VTPPSYELNSLFLIKKKDNAQV--------QLDLPFSNAMGGNI----NLL
A0A1I2A9Z9      GLGYLKTQ-VTAPAYKLESLFLIKTDNKGGL--------RMDFPLPSAFGGNI----NLQ
A0A848XXC6      GDGAAGFAEPDGPAYDAETGFQIGFDAAPSTAVAPYRP-ARSPMDTRPSVAPS----SPP
A0A2P8CDS1      TGIWLYYR-YSHPVYAVSSTMLIHEQQNQNPLTTQKDPESNVFQGFGLFQGKQ----NTE
A0A660LQT8      GLGMYMIL-RTPPVYNRYASVLIKDNQSSKNTSIDQQLAQIGVGKAS----------NVN
A0A3D0FMX4      GISIYSNR-KWVPTYRTAGTLIINEYGSQ--------ASNALMQGFGVDVGYR----NVN
A0A7V6G854      FFAYVKNR-SWQPLYVTEAKVMIEEGAS---------NQYNFMQGFGVNQGYR----NMN
A0A1M3MEI8      GLSYMQNR-KWLPEYKSTGSVIIDDSRTMMN------SAQVMMQGFGIQDAYR----NVN
A0A1J5HQM0      GMAYLKNR-TWIPSYKSAGTMLIEEYKITN-------NTQAMMQGFGVDAGYK----NTR
E4T131          GLAYIENR-SWLPTFQTEGRVLIDENRSSNA-----NSSQALMQGFGIQSGYK----NAK
A0A653AC35      GAAYLKNR-SWIPSYQSTGTLMIEESSRNNS------GSQVLMQGFGVQSGYR----SLE
A0A847LA02      GLAYLKNR-TWIERYQSSGTIIIEEN--RNT------SNNVFMQGFGLQSGYR----NID
A0A389LWV6      SLALLKNK-TWTPTYKTSSTILINENKGQQV--------SDLTTGFAVSQGLR----NVN
A0A1G9B1T9      ALAYVVIL-TTPEVYKVSSSMLVRDESATGN--------QQFMEGIGLFEPQT----KIS
A0A350PNH9      GIATYHLL-STPCVYQRTASILIKEDGKSQSINSDVAS---MFSDMGISGGKS----NVN
A0A354LNT9      GIATYNLL-STPCVYQRTASILIKEDGKSQSINSDVAS---MFSDMGISGGKS----NVN
A0A161LWY6      SISFIANR-TWKPSYQVSARVILGGGQASASQ-------QMVMQGVNLNMAYK----NND
A0A6I3N9U6      SVAFIANR-TWKPSYQVSARVILGGGQASASQ-------QMVMQGVNLNMAYK----NND
A0A353WYK7      ATAYLTIR-YTKDLYQSESVLQLDIKSEAQVLGFRSFDEDIN---------------NLS
A0A2W7RD29      FIAHTSYK-STVTTYEINSKLFIYTEGQSINFFEKLQN--------VTNSQNV----LLD
A0A3N2NDY8      CLGVLYVL-RQQPVYSRSMELLIKDQDGGGGVADISNA--------FSSLGLVSSNTNVN
D7JEV9          AIAYYQNR-SFVPIYNSSLRMLLKQEAGSLS-----YMQGQGFNSVMNRLDQT----NIE
A0A553GA49      GIGVLFNK-FSEPKVNISAKLVVHESRRNMI------DPSSFMPGSELFSGRN----TFQ
A0A7V5GTN5      IPIIFFLY-SQVPRYSSVAIVSIATDNIPGLISSVGTDALRRWSG---------------
A0A497D6F6      SIAYVYKR-YATPIYEITSSLLLEVGNSNSPLTNKNANEDNVFQGFGITDSDR----NIF
F4KR18          GLAYVYYK-NQQPVYAITSKLLIRERERDYGP-----GADFVKQNINFAAAAE----DAS
B5CTK0          FFGWYTLQ-KAIPTYKRMATVLIKDNSSGSM------SESAVFEDIATVRAER----NVS
A0A5M4AAB9      ----MYYK-YTHPIYEVSASILIEEQQNQNPLITAADKQPNVFQGFSLFNGNQ----NIE
A0A5R9QZP0      LLGYTYNK-FVPTVYQVNSVIGPVEDRRTTFL-----ESSRQFSVLGSQSQTS----NLE
A0A7X6SRJ5      TAAFLVNK-FSPVVYEVNSVIGPVEDRRSSLL-----ESNNLFSGLRHLSEAR----NLE
A0A3D3HL11      LIAFLVNR-FSPTVYEVNSVIGPVEDRRSSML-----GSNDLFSGLGALAESR----NLE
A0A6L8U6G9      LIAFLVNK-FSPTVYQVNSVIGPVEDKRSSML-----GSNDLFSGLGALAESR----NLE
A0A6L8UH35      AIAFFFNK-YSSKVFEASATLSPVENKTSSIL-----SSNQLFGGLNPLQTID----NIE
A0A7X9F2J5      AVAVLFNK-YSSRVYEASATLSPVENKTSSIL-----SSNQLFGGLNPLQAID----NIE
A0A352ME00      AIAFFYNH-FSKKVYEASASLSPVEDKTSSLL-----KSNELFSGIQSLESLR----NIE
A0A7X8CRA6      ALAFLYNH-FATKVYEASASLSPVENKTSSLL-----KSNELFSSLQSLESIS----NIE
A0A1F3D6P8      TVAFLFNK-YSSRLYEVKASIGPVQNDASSLL-----TSNDLFMGLKALQSNR----NLE
A0A356Z058      TVAFLFNK-YSSRLYEVKASIGPVQNDASSLL-----TSNDLFMGLKALQSNR----NLE
A0A7X8FHL3      LAAFLYNQ-FSGKVYEVTASLSPIEDKTSTIL-----SSNELFAGFRSLESLN----NIE
A0A3D1BT36      LMAFLLNK-FTPAVYEVNSIIGPVENKQSSLL-----ESSDIFSGLGSLSQSR----NLE
A0A7X7CXW9      LAAFLVNK-FSPTVYQVNSVIGPVEDRRSSML-----GSNDLFSGLGALAESR----NLE
A0A4R6H3B7      GLGYLKTQ-VTAPAYKLESLFLIKTDNKSSNL-------RMDFPLSSAFGGNI----NLQ
A0A229I3A5      GIAIYYNL-TTPNVYQRTASLMIKDESKAQGIGGDVAS-MFSDM--GMGNMKS----NVN
A0A3R6HJB3      GIAIYYNL-TTPNVYQRTASLMIKDESKAQGIGSDVAS-MFSDM--GMGNMKS----NVN
R6NN15          GIAFIYLL-KTPPVYTRTASLLIKEESKGQSLSGDVGA-SFSDL--GLFQPNT----NVN
A0A2W7QSQ0      GVAYYYIK-TITPEYLISSVIIIKEGERNNN-----VTENSIVSDLENMKSTI----TVE
A0A841MQL4      GIAYAYLK-TVTPEYLISSTIIIKEGERSND-----VSENTIISDLENMKSSI----TVE
A0A3P1Z8V4      IAGYVYQQ-MQDRVYSGEAVILIDSSSDSSHGGMRSRSKNSLNT--LMQLNGINVGDNLE
A0A1M6MYT6      ALAWLYVQ-YTTSVYEIKSSMLVEEGKSGSPLGSGGANSENIFLGLGMMNSMR----NIH
A0A1V5S1J9      SIAYVKNR-SWQPNYKSSALVIIEE-NKGLS-----GAQAALMQGFSVERGYR----NVN
A0A7X8JMH1      TVAYFQNK-SWFPIYRSSALVIIEEANRGFN-----RSQQAFMEGFSVQGGYR----NVN
A0A3D5KRY6      MVGGYAYN-KVVLPYYRISTTVLVHDESKTT--------DLNNI--YRQLSTIQGGPAIQ
R7F6L5          GIAWLMLA-RSPRLYTKSETILIKDPTFGNS-----AS-SVDLSEVGVMPKYA----NLE
A0A7C5MRV2      LACWLYLR-YTKPLFMAVTTVRVEEDKSPGR-----GLGMLENFGFGPFRD------NIQ
A0A0A2EYC8      TIAYYQNR-SFVPIYNSSLRLLLK-QESGSFLSMQNFNSGFSRQ------DQT----NIE
A0A2G6H6Y4      GLAFYKNQ-KVVPNYLSYSQILLEDKKADSFATLQNYS---SRG------SGK----GVE
C9LKL0          ACGWYYQQ-IQPRVYTRQATMLIEGGNGSGRGGFSSSRNRGSGLNTMMDFNGVTIGDNLS
A0A3D0QPV7      AWLYLRYT---PPVYESLSVIQISEENNMKQ-----VIPGINSF----EDEQS----GVD
A0A496KT23      GGAYYHLL-RTPKTYVASASILIKPDNNRGNSPDQLLA-RQRMI--VEGASDA----QMT
L1M9T3          SSATYYLL-RTPKTYVASASILIKPDSNKGNTPDELLA-R-RMN--VESGLDA----QMT
A0A2M6GH67      SYLFLRYT---KPVYRSSSTLKIDERSQAGALGLGGPL-GNAA----AEQNMV----SLS
A0A7K1TE30      SWLYLRYT---KPIYKASSILKIDERSDVNTIGLGAAL-GAAAP--DNNRSIT----QLA
A0A7D4BE70      -----------------------------------MNA-AGV-----DNKQAA----QLA
A0A142HHS5      SWLYMRYT---KPIYEATSILKIDDHSDASALGLGMAM-GGA-----ENNQAS----QLA
A0A7D4C435      SWLYLRYT---KPVYKASSVLKIDERSDARDLGLASVS-G-------EGSHGS----ELA
A0A3C0I8F1      SYLFLRYT-KALFQSSSDLRLSIRDEAQPGG--------LPIQT--APINNNA----HLL
R5JJI4          ---------------------MIRDDSKGGS-----ISESTAFADISFLGGKR----NVD
A0A848IUK4      AVFYVRYI-PPLFESSSELKLDVKEETAVI---------GFGID--PQKNNMN----ALS
A0A136LSC7      AYLTIRYT-KDLFESESEMKLDIKRDATEL---------GIKTY--MEDQNVN----QVS
A0A5C7N8Q5      AYLTIRYT-KDLFESESEMKLDIKRDATEL---------GIKTY--IEDQNMN----VVS
A0A355BP94      AYLKIRWT-KDEFESYSELKLEVKQDATAL---------GIKQF--AEDQNRN----LVA
A0A7Y5D1K7      AYLTIRWT-KDVYESSSELRLEIKQDATAL---------GIAQI--VEDQNRN----IIA
A0A3D2HF71      SIAYSINR-WSEDVYSVSSTLLIKDEQLMGGLSSGTTT-LFPGM--EAFRSQQ----NLK
A0A0A2DQN2      GYMYYRSA-QQPYTYMSEVTVIIQDPSQRTSIDFDFIN--------PRQRGRA----NIE
A0A0A2F2N5      GYMYYKSA-KQAYTYESVVTVIVRDPAQRTSIDLDLVG----------RRSRV----NIE
L1NGW4          AFALYRTA-KQPYIYEASVKVFIKDASQRSMMDADVLR--------YMRSFRL----NMD
Z4WRA0          AFALYRTA-KQPYIYEASVKVFIKDASQRSMMDADVLR--------YMRSFRL----NMD
U2K8K9          ALALYRNA-RQPFTYEGVVKIFIRDASQRTMVDDNMLR--------YMRNTRL----NVS
A0A069ZM60      AVALYRNA-KQPYVYESSVKIFIKDASQRAMMDTEMLR--------YARAARL----NMD
J6GV98          AVALYRNA-KQPYVYESSVKIFIKDASQRAMMDTEMLR--------YARAARL----NMD
A0A134B4F8      AVALYRNA-KQPYVYESSVKIFIKDASQRAMMDADVLR--------YTRSTRL----NMD
A0A134B8C7      AVALYRNA-KQPYVYESSVKIFIKDASQRAMMDADVLR--------YTRSTRL----NMD
A0A4Z0EKR0      GAAFIYLRYYTVSVYSVYSTLLIKDEKTGQNLS---NADVLNDL--STFKATR----NID
A0A521H707      AFLYLRYT---HPIYLSQATLKIGTVNTASA-----VL-NIQNSQALDILGSN----QFA
A0A7T9D909      GTAAFLYMRYTPKSYESKALMQFQQSNTAQ---------QVLNV--DQFLEAQ----NLT
A0A1M6B6D5      SIAYYINV-RKLPVYLIENLVSIRDDQNPFF-----TSNTSLVF--NWGGTSD----KVN
A0A451FS66      SIAYYFNI-RKLPIYQMENLVAIKDDQNPFF-----TTTTSLTF--NWGGTTD----KVN
A0A2E3GN39      GVAHIFLH-FSTRIYSSKGVLIHIAGEEKQS-----LL-GLDKTLPNQDFTPT----DFQ
A0A3D1MEL0      GIAHIFLH-FSTRIYSSKGVLIHIAGEEKQS-----LL-GLDKTLPSQNFTPT----DFQ
A0A519UDD1      TAAFVHLHYYAVPQYTVYSTMLIKDDKSGQSLSSADNTGVLNDL--STFKSTR----NID
A0A7Y2ACP6      IGAYLYLR-YTVPIFESKTTLQIEKSDQAKMVLKVE-N-FGDPD-------------NLY
A0A2A4N9A6      FGVWLFLR-YTPPIY--QAVTHIRAASNKAVELGTFVN-FLEKD--KNKMLLE----ELQ
A0A6C0GGI1      TVAYFHIK-LSKRVYGVSATVLIENESAGNKAAGELLE-VIDAQ--KKYI-------EVE
A0A368D1N7      GIAHIFLH-FSTRIYSSKGVLIHIAGEDKQNLLGLDKT-LPSQN--FTPT-------DFQ
A0A3B8TU58      GVAHIFLH-FATRVYDSKGVIIHIGGEQKQNLLGFDRD-FQKQ---FTNT-------DFQ
A0A1T5IIR6      GVAYYRYS-RMPFVYSSGVTAIIKNPGDELR-----TA-RLETY--DQMINKV----SVT
A0A3E0QD27      AFLYLRYT-LPIYESRGILKIGTVNTANAVL-----NI-GSNQA--LEVLGSN----QLA
A0A0K2HKS3      GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
B6W3W8          GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
A0A0M1W1I6      GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
A0A4R4GHU2      GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
I8WPR6          GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
A0A076IRY8      GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
A0A3A6AD54      GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
A0A8B3EPF6      GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
I8WPP8          GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
A0A372Y7D2      GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
A0A7K3KFI2      GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
A0A3E4JJC9      GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
A0A3E4WDQ0      GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
A0A414H9P2      GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
A0A7K0JKU9      GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
C3R5A8          GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
A0A6N8DCX3      CVAVFYIL-CTPPLYTRSAFLMVKEDTKGKAIGSDVAS-MFADL--GLTQASA----NVN
F0R0C9          GIAVYYLL-TTPPVYTRAASLLIKEDSKGQSLSGDVGS-TFADM--GLFQANT----NVN
A0A1C5XJA7      GIAWYKYA-TAPLVYFGSATVIIKDPSSKTT-----TT-GLDRF--DNFINKV----NVA
A0A285T4L1      GLAWYHYA-TSPLVFFRNVTVIIKDPSNKTS-----TA-GLDRY--DNYINKV----NVA
R7CUW4          GLAWLSYA-RSPLVYFRSATVIIKDPSNKTS-----TA-GLDRY--DNFINKV----NVA
A0A416GGJ1      SAAWLYYA-RKPFVYFRSATVIIKDPSNKTT-----TA-GFDRY--DNYINKV----NVA
D1JY72          GYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--NTY-SYT----NVS
D7J4K6          GMAWYHYA-KSPLVFFRSVTVIIKDPSNKTS-----TA-GLDRY--DNYINKV----NVA
Q8ABP9          GMAWYHYA-KSPLVFFRSVTVIIKDPSNKTS-----TA-GLDRY--DNYINKV----NVA
D6D2Z5          GMAWYHYA-KSPLVFFRSVTVIIKDPSNKTS-----TA-GLDRY--DNYINKV----NVA
A0A1T3EDR4      GYYYYRYS-KSLYVYRDKEVVMIKKQSSAPI-----TS-AFLQS--AE--SPV----NIK
A0A6N8KXI9      SYFYYQYS-KSPYVFRRAETVMIKTPENTPT-----SS-RVTRS--SMFYNTV----SVA
A0A174SDD8      GCFWYIYC-KTPFEYSRVAIVMIKTPANSRS-----TM-QLNNS--DFA-GQV----NVA
A0A1H7RFH3      GCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--DFT-GLV----NVA
A0A139L1N2      GCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--DFT-GLV----NVA
A0A174TVL8      GCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--DFT-GLV----NVA
A0A1H8BJR6      GCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--DFT-GLV----NVA
R9H6G0          GCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--DFT-GLV----NVA
A0A412GR09      GCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--DFT-GLV----NVA
A0A7J5JXN6      GCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--DFT-GLV----NVA
R6D982          GYFWYDYS-RTPFVYSRSATVMIKTPANTPS-----AI-RLIRS--GDYMGQV----NMA
A0A1F0I8C4      GCFWYFYC-KTPFVYSRVAIVMIKTPTNSRS-----AM-QLYGS--NDFMGQI----NVA
A0A3A5RIJ2      GCFWYFYC-KTPFVYSRVAIVMIKTPTNSRS-----AM-QLYGS--NDFMGQI----NVA
A0A515IZJ5      GCFWYFYC-KTPFVYSRVAIVMIKTPTNSRS-----AM-QLYGS--NDFMGQI----NVA
A0A7J4Y2H6      GCFWYFYC-KTPFVYSRVAIVMIKTPTNSRS-----AM-QLYGS--NDFMGQI----NVA
A0A4R6WE41      GYYLYDYS-KTPFMYGQAQTVLIKTPANTPA-----TA-RFTRA--SAGYNSV----SVA
A0A2T5RP38      GYYYYQYC-KTPFVYSRSEVVMIKNSSNTPT-----TA-RITRT--NVS-SSV----SVK
A0A1A6CF06      GYFYYQYS-KSPFIYNRSEVVMIKTPSNTPT-----TA-RITRS--FSG-GGV----SVK
A0A1T3D6S8      GYFYYQYS-KSPFIYNRSEVVMIKTPSNTPT-----TA-RITRS--FGG-GGV----SVK
A0A8B4GMS2      GYFYYQYS-KSPFIYNRSEVVMIKTPSNTPT-----TA-RITRS--FGG-GGV----SVK
A0A7Z7LUP7      GYFYYQYS-KSPFIYNRSEVVMIKTPSNTPT-----TA-RITRS--FGG-GGV----SVK
A0A0B8T471      GYYYYQYS-KTQFLYSRSQTVMIKSTTNTLS-----VS-RATRL--NSYYNTV----NVA
A0A4R7D2K0      GYYYYEYS-KTQFLYSRSQTVMIKSTANTLS-----VS-RATRL--NSYYNTV----NVA
A0A7T9S3V1      GYYYYQYS-RAAYMYRSSEMVMIKTPMNTPS-----TA-RITRT--NAAFNSV----SVA
A0A7T9LVI2      GYYYYQYS-RSTFMYRSSEMVMIKTPMNTPS-----TA-RITRT--NSAFNSV----SVA
C2FUH6          GYYYYQYS-RSTFMYRSSEMVMIKTPMNTPS-----TA-RITRT--NSAFNSV----SVA
A0A1V3N3U3      LYFYYGYS-KSPFIYRSTEMVMIKTPLNTPA-----TA-RITNT--NNAVGSV----SVT
A0A1P8E011      SYYYYQYA-KSPFIYRSAETIIIKTPMNTPR-----TA-RISRT--NEAYNSI----SVA
A0A7T9S8K4      SYYYYQYA-KSPFIYRSAETIIIKTPMNTPR-----TA-RISRT--NEAYNSI----SVA
A0A2X2J8S4      GYYYYQYS-KTTFSYRQASTVMIKTPANTPS-----SA-TLTRS--GMSYNTV----NLA
A0A3C0S618      GYYYYQYS-KTTFTYRQASTVMIKTPANTPS-----SA-TLTRS--GMSYNTV----NLA
A0A4P7DRF9      GYYYYQYS-KTPYLYSQSETVMIKTASNTMV-----AT-RIARP--NNFYNAV----NVN
A0A239XXC4      GYFYYQYS-KTPFLYKKDQTVMIKTATNSMS-----AS-RITRP--NNFYNMV----NVN
A0A4U9K473      GYYYYQYS-KTPFLYKKDQTVMIKTANNSIS-----AS-RITRP--NNFYNFV----NVN
A0A081PBV5      GYYLYQYS-KTPFIYSRSETIMIKTPLNTMP-----GT-RITRA--NYY-NTV----NVA
A0A1I2AN85      GYYLYQYS-KTPFIYSRSETIMIKTPLNTMP-----GT-RITRA--NYY-NTV----NVA
A0A4U0GMP3      GYYLYQYN-KTAFIYSRTQTVMIKTPANTVS-----TA-RISRS--NSY-NVV----NVA
A0A0D5BSQ0      GYYYYQYS-KTPFVYNRSEVVMIRTPSNTPT-----TA-RITRS--SSA-NVI----SVK
A0A1T3F6P5      GYYYYQYS-KTPFVYNSSETVIVKTPSNTPT-----TA-RITRS--FGA-NSI----SVK
A0A853VUQ0      GYYYYQYS-KTPFVYNSSEIVIVKTPSNTPT-----TA-RITRS--FGA-NSI----SVK
A0A7X0MJ00      GYFYFQYS-KTQFTYNRSETVMIKTGTNSIS-----AV-RIARP--NNFYNTV----NVN
A0A841JHZ0      GYFYFQYS-KTPFVYSRSETVMIKTSTNTIS-----VS-RITRP--NNFYNTV----NVN
A0A1H6CKR6      GYFYYQYN-KTPFLYKSSQTVMIKTASNTIS-----SS-RITRP--NNIYNSV----NVN
A0A7W3MGA7      GFYYYQYS-KTPFLYKKEQTVMIKTATNSMS-----AS-RITRP--NNFYNIV----NVN
A0A3M1Y2F5      ------------------------------------------------------------
A0A7V1ALN2      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A836SQI2      ------------------------------------------------------------
A0A7V1FAJ9      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ---------------------------------------------------------SAA
A0A519TAP8      ----------------------------------------------------------MQ
A0A848Y4B8      ------------------------------------------------------------
A0A7Y4V8Y1      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A847AMH6      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A7V1FAS7      ------------------------------------------------------------
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      DDIITLQPENANKVTITRN-----------IWNNF-----------FGGKMYLNVTNIEM
A0A7C7CKY6      ------LGKTTYQKPVEIG-----------VWQKL-----------EHAEILITVHDFTR
A0A1G1TG88      --------------------------------MKV-----------TPTQYF--------
A0A661XXA6      --------------------------------ISL-----------LDTSRFILSYNLGE
A0A519SD85      ----------VLLSAVNSL---KYKIVFE-SKKGL-----------RWTNTYPNE-PLKV
A0A3M1TXY5      ------------------L---DFGISYY-LKEGL-----------KTRQTYHYA-PFEV
A0A7T9KM12      ------MSFTNILNTIQQL---DFGITYY-EEKNF-----------LEHEIYEDK-PFVI
A0A2E0VQ27      AEVEVFQTRDLIRKTLENL---HWELTTY-RVGDV-----------RLSEIYEER-PFKI
A0A7Y7TYP1      NELWTLQSTPVIEQTIKNL---DLSVSYF-RKERF-----------MEIDAYKEV-PFKV
R6U429          NEMEAFSSPDLMCSVVKRL---GLETSYV-EKQFL-----------RTRDLFTNS-PLAL
A0A5C8AF42      SEIELMRSQFMFERAIKRT---SYNVSLF-SKGQV-----------LTEEKYLSS-SFYV
A0A7Y5SYP1      NELELIRSRQFGELVVTAM---AESLRVNPALARF---------------------PLFS
A0A7V1N701      PVLSSVPLDEFFKSVVNSV-------------------------------------IYRD
A0A7V2NIA8      PGMSTLVPQDYFDSIISSE-------------------------------------FFMR
A0A239K409      NEIEVLKSYRLMRRVLSKL---PVNISYY-VEESL-----------KERELYGSELPIKV
A0A1M3DPL8      NQVIMISSYDLMSRVVDSLP--EFQIEYI-SKGRF-----------KTRNLYEWT-PISI
A0A1V5F519      NQVIILNSYDLIGKVVDSLP--FMKVDYL-TIGRF-----------KTRNLYTTT-PIII
A0A2G6R1T9      NQVILLTSRDLISQVVDNLP--EMRVEYI-SKGKF-----------KTRNLYKMS-PIQI
A0A350V3E4      NEVEILKSFAIREKTAASL---------------L-----------DSFQVLKGKIPFYL
A0A6J4K208      DEKNLLSSFRRIRTAVEGL---HFQVSYF-HTHWF-----------LPREEYGDL-PFRV
A0A2W4RDE8      DEIGIIKSFSNVESAIKRL---NFGISYY-TEKNF-----------KTAEHYGNT-PFTI
A0A212J9Z9      NQQIVLKSYGLTERTVKSLPA-KMRIEYY-IQTRF-----------KYISLYTDT-PIEI
F5IV23          NQQIVLKSYGLTERTVKSLPA-KMRIEYY-IQTRF-----------KYISLYTDT-PIEI
A0A1M5DFS8      NQQMILNSYDMVVRTVAKLP--QMRVDYF-LKTKF-----------KTENLYGVT-PITI
A0A4Y8KZS5      NQQMILNSYDMVVRTVGKLP--QMRVDYF-LKTKF-----------KTENLYGMT-PISI
A0A2V3PNY7      NQQMLLNSYDMVVRAVAKLP--QMRVDYF-KKSKF-----------KVENWYGVT-PVTI
A0A6G7X5K8      NQQMILNSYDMVVRTIAKLP--QMRVDYF-KKGKF-----------KADNWYGLT-PVTI
A0A840CJ33      NQQIVLKSYGLTERTVNRLPD-RMRVDYF-KQTRF-----------KSINLYTDT-PVRV
F8X2T0          NQQIVLESYGLTERTVKNLPK-KMHIDYF-IQTRF-----------KYISLYTDS-PIEI
A0A1M3LAG1      NQQIVLESYGLTERTVKNLSK-KMHIDYF-IQTRF-----------KYISLYTDS-PIEI
A0A212K6G4      NQQIVLESYGLTERTVKNLPK-KMHIDYF-IQTRF-----------KYISLYTDS-PIEI
A0A4Y9IPG7      NQQIVLESYGLTERTVKNLPK-KMHIDYF-IQTRF-----------KYISLYTDS-PIEI
A0A0L8VEV2      NHIGILTSHSINRQVLENL---DWTTSWY-EELLL-----------RDDEMYGNE-PFEI
A0A1I2A9Z9      NNIGIITSYSINRQVMENL---DWSTSWY-HELMF-----------RNEELYKNE-PYDV
A0A848XXC6      PEPPRVQARRAFRDQAEALYR-HRRVALSLLIAGLLLALVVSVLMPKRYEAYSVL-LINA
A0A2P8CDS1      NQIQILKSWTQVRTTLEHF---NFEATYY-KIGRF-----------RTIELYKDV-PFHI
A0A660LQT8      NEMLAFQSPALTENVVRRL---KLDVNYS-VSGFF-----------HDETLYGKTLPIQV
A0A3D0FMX4      NQVIMMGSYDLMCRVVDSLP--FMRTDYI-SRGRF-----------KDTYLYRYT-PVVF
A0A7V6G854      NQLLLLGSYDLIRKTVEKLP---FSIDIY-SQGRF-----------KTNSLFAYP-PIEI
A0A1M3MEI8      NQVIMLGSYDLLGRVVDSLP--ALSIDYI-SQGRF-----------KVRNLYGQS-PVVI
A0A1J5HQM0      NQIIMLSSYDLIGRVVDSLP--QMRVDYI-SKGNF-----------KTRNLYNAS-PIQI
E4T131          NQIIMLGSNDLFSKVVDSLP--FLKVDYI-SKGSF-----------KTRNLYKTT-PIII
A0A653AC35      NQRYILTSYDFISRVVDSMP--SLNIDYI-SKGRF-----------KTRNKYNES-PIAI
A0A847LA02      NQVIMLTSYDLISRVVDSLP--FLNTDYL-SIGRF-----------KTRNLYYNT-PILV
A0A389LWV6      NQMIMYGSYDLISKSVDKL---DISTDIY-HKGLL-----------KSVSYYKAS-PILI
A0A1G9B1T9      DQTAMLTSFDIIRRTLEKL---DFGVTYY-KHDQF-----------IQHEIYKRR-PFDV
A0A350PNH9      NELIAIQSPAVLLEAGKQL---KLDVNYS-EDGTF-----------HPVALYGRTLPVTV
A0A354LNT9      NELIAIQSPAVLLEAGKQL---KLDVNYS-EDGTF-----------HPVALYGRTLPVTV
A0A161LWY6      NQMIMFTSNDLVERAINKI---NANVDYY-TTGHF-----------KVSNLYGYA-PIEI
A0A6I3N9U6      NQMIMFTSNDLVERAINKI---NANVDYY-TTGHF-----------KVSNLYGYA-PIEI
A0A353WYK7      KEIELLKSKLFFTRVAEVI---NNDVNVF-AYGKV-----------LFEERYQNS-PFFV
A0A2W7RD29      NEVVIIKSNPVIKSTLEVL---DLKVGYYVPPETTSKNFWSFNKSNLPIEIYEDA-PFEI
A0A3N2NDY8      NELISLSSPAVMYEVVKNL---GLDVNYS-TPGRF-----------HEKTLYGSNLPVNV
D7JEV9          NQILLLQSQDLIGRTIDSLP--KFRVDFY-KKLQF-----------KNRPMYATS-PIDI
A0A553GA49      NSLISLNARPLLEQVVNKL---NIDVFYY-QPKVL-----------YDKNLYTSS-PFQV
A0A7V5GTN5      ------------------------------------------------------------
A0A497D6F6      NQLIVLTSTPILNRTLEEL---DFDINYY-SVGRV-----------KSREIYKES-PFEV
F4KR18          NEIEMLTSFALMKAVVEDL---GLETRYY-WKHKF-----------SEYDAYGNF-PIVV
B5CTK0          NEMLVFKSNRLMQIVARRL---HLDVNYL-IEEGL-----------HMKELYTQA-PISV
A0A5M4AAB9      NQIQILKSWSLIYNTLEHF---NFEVTYS-ER-----------GFFRTTELYHDL-PFEI
A0A5R9QZP0      NDMNSLSSFSLVSKTIKDL---GLEISYY-EQPVRFANKKSLGFINKPLQTYGNN-KYIV
A0A7X6SRJ5      NDINSLSSFSLVSATIKNL---NLETGYF-KEKNT--------LFGRAGQIFTGN-HYSV
A0A3D3HL11      NDINSLNSFSLVATTIRSM---NLEVGYF-AGKNT--------IFQKPTQVYLGN-PFSV
A0A6L8U6G9      NDINSLNSFSLAATTIRNL---NLEIGYF-AGKNS--------LFRKPTQVYLGN-PYTV
A0A6L8UH35      NDISNLSSFGLVYSTVAKM---NLEVSYF-SEEHK--------FFKQTQEIYGYL-PFTI
A0A7X9F2J5      NDISNLSSFALAYSTVTKM---NLEVSYF-REQQK--------FLKQTHEIYGNL-PFTI
A0A352ME00      NDIKNLSSFELVYSTVNSM---NLEVSYF-SESKK--------LLKQTNELFGTT-PFTV
A0A7X8CRA6      NDITNLSSFELVYSTVSAM---NLEVSYF-REFKK--------VIKQTEELFSNS-PLTV
A0A1F3D6P8      SGISNFISFPTVSSTISSM---NLEIGYF-REKHH--------LFRQVSELYLRS-PYVV
A0A356Z058      SGISNFISFPTVSSTISSM---NLEIGYF-REKHH--------LFRQVSELYLRS-PYVV
A0A7X8FHL3      NDITNLSSFELVYKTVNSM---NLEVSYF-SEFKK--------ILTQTTELYGNT-PFTV
A0A3D1BT36      NDINSLKSFSLISETIKNL---ALEIGYF-IESDD--------ILGQVRQVYPNS-HYTV
A0A7X7CXW9      NDINSLNSFSLIATTIKNL---NLEIGYF-AGKNS--------FLQKSAQVYLGN-PYTV
A0A4R6H3B7      NNIGVITSYSINRQVMENL---DWSTSWY-HELMF-----------RNEELYKNE-PYDV
A0A229I3A5      NELIAIQSPAVLLETGKRL---KLDVDYA-IDGRF-----------HKEALYGADLPVTV
A0A3R6HJB3      NELIAIQSPAVLLETGKRL---KLDVDYA-IDGRF-----------HKEALYGADLPVTV
R6NN15          NELVSLQSPAVMYDVVKRL---HLEVDYS-TEGSF-----------YAQVRYGQNLPVTV
A0A2W7QSQ0      NELEKLKSKSLLMDAVIKN---KGFINYY-NAEDF----FK-----TKIDPFQSSIDITV
A0A841MQL4      NELEKLKSISLLTDAIIEN---KGFINYY-IQDKF----FK-----KKIDVYESPIDIEV
A0A3P1Z8V4      NELFILSSLRLMKQVVATL---GLEVDYT-CREGL-----------HNVALYRDR-PFTV
A0A1M6MYT6      NQIAVLSSTPIVSRTLDEL---DFSVNYY-SIGRF-----------AATERYQDV-PFMV
A0A1V5S1J9      NQVIMFGSYELISRVIAKQP--ELTIDYY-TQGRF-----------KSTNLYKAA-PILI
A0A7X8JMH1      NQIVMFSSLDLIKKVVDNLQ--DLHIEYY-TRGRF-----------TSTNLYKKS-PVFI
A0A3D5KRY6      DEVGVLQSYNLSLQTVKYF---NWRYSWY-QKRFI-----------GKRDLYKND-PLTL
R7F6L5          NEIAIFTSPDLMENVVKAY---NLNNFYS-YNDGF-----------KDVDIYHQE-PGII
A0A7C5MRV2      SEIQLLRSRSIVTVALSEM---DISAAYY-LVGTL-----------VTAEMYKDDSPFIV
A0A0A2EYC8      NQILLLQSQDLIGRTIDSLP--NFKIDFY-RKLKF-----------KNRPMYGRS-PIDI
A0A2G6H6Y4      NQIVILKSWDMVTRTIDSLP--QFKIDFF-KILTF-----------KQKALYENL-PINV
C9LKL0          NELFILTTRRLMRKVVDSL---GLDVDYT-TKNAL-----------HRIALYDNR-PFDV
A0A3D0QPV7      KALELMRSEFLFKKSIEKL---DFTVSFF-SEGQI-----------LTENKYPAK-YLRF
A0A496KT23      NEILALSSATITRTVAERL---NLDVEYT-HKGMF-----------HDKVIYGSELPVKV
L1M9T3          NEMLSLKSVTITRAVAERL---NLDVEYT-HKGMF-----------HPKVIYGSELPVKT
A0A2M6GH67      GEVELINSDIIYRDLKENL---NLKVNYY-AMGNV-----------LNEELYNNA-PFKI
A0A7K1TE30      GEVELIKSNLTYTRLKKII---PLNISYY-TQGTV-----------LEAELFGTS-PFRV
A0A7D4BE70      GEVELIKSGLTYKRLKQTV---PLDINYY-TQGTV-----------LETELFGTS-PFQV
A0A142HHS5      GEVELIKSGLTYKRLKQTV---PLDINYY-TQGTV-----------LETELFGNC-PYRV
A0A7D4C435      GEVELIKSGLTYKRLKELV---PLDVNYY-TQGTV-----------LEAELFGSC-PFRV
A0A3C0I8F1      GEIEFIKSELLHEEVIKKM---NLGLTIY-AQGNI-----------LDNELYGNV-PFEI
R5JJI4          NEVLVFQSRHLMEKVARRL---HLDMSYK-VKNGL-----------REDELYTHS-PITV
A0A848IUK4      GEMELLRSKVFFSRLIDSL---DIDVTIRTTFGNF-----------KNEERYKNK-PFKV
A0A136LSC7      GEIEQIKSKIFFNQVLDSL---DFEVSYY-SLGKV-----------LTDEMYKRS-PFRI
A0A5C7N8Q5      GEIEQIKSKLFFNKVLDSL---DLSVSYY-SLGKV-----------LTDEMYKRS-PFLV
A0A355BP94      GEIEQMKSKLFFSRVLDSL---DLGISYY-SLGNV-----------LEHEMYRRS-PFKA
A0A7Y5D1K7      GEIEQMKSKLFFSRVLDSL---DLWVSYY-SAGNV-----------LEFEMYRAS-PFRV
A0A3D2HF71      NEMGILRSFTLNYRVMQEMPDFHVDYTAV-GRRGI-----------VEKRIYNKS-PFIV
A0A0A2DQN2      NERLILRSQRIIENALKKI---DAQVSYK-YKKEF-----------RMIELYKAS-PIRV
A0A0A2F2N5      NERLQLRSRVVIANAIKAI---NGHVHYG-IIDGL-----------RPIELYKSA-PIQV
L1NGW4          NEKMQMSSRRVLERAVKTV---NANVYYQ-VQSGL-----------RTLELYTAA-PFSM
Z4WRA0          NEKMQMSSRRVLERAVKTV---NANVYYQ-VQSGL-----------RTLELYTAA-PFSM
U2K8K9          NERIQLSSRRVMQRTVRLS---GANVFYN-VKSGL-----------RTLELYDEA-PFKV
A0A069ZM60      NEHVQLVSRRVLERTVKMA---NANVFYN-VKSGL-----------RTLELYSDA-PFSM
J6GV98          NEHVQLVSRRVLERTVKMA---NANVFYN-VKSGL-----------RTLELYSDA-PFSM
A0A134B4F8      NERMQLVSRRVMERTVKMA---NANVLYN-VKSGL-----------RTIELYTDA-PFSM
A0A134B8C7      NERMQLVSRRVMERTVKMA---NANVLYN-VKSGL-----------RTIELYTDA-PFSM
A0A4Z0EKR0      NEIQVLRSKSLMTRVVTEL---GLFTKYS-IEGKV-----------RDTEIYGNELPIKV
A0A521H707      GDIELLRSRVMISRVLDRM---PLDVGYF-AHGKV-----------IDHEMYTKS-PFSV
A0A7T9D909      ADVELLHSRFFLLRALKRI---PMEVSYF-SKGSI-----------LTNELYVGS-PLVL
A0A1M6B6D5      TSVITLRSRSHNEKVVERT---QYYLTYL-RDGEY-----------QQEDAYKQT-PFFV
A0A451FS66      TSVITLQSRSHNEKIVERL---QFYLTYL-RDGKF-----------QLIDAYKQT-PFLI
A0A2E3GN39      QDVRVITSPIIVNKAFSQK---GLNYVFY-EVGDF-----------RSLEIYPNP-YFTI
A0A3D1MEL0      QDVRVITSPIVVNTAFSQK---GLNYIFY-EVGDF-----------RSLEIYPNP-YFTI
A0A519UDD1      NETEVIKSKSLMNRVAKEL---GLFTSYY-IEGQV-----------KDIEQY-GR-NLPI
A0A7Y2ACP6      TDVELIRSQFILEKSIHRL---GLNVRYF-VVGQV-----------RGSENYRNS-PYEV
A0A2A4N9A6      EEIAILKSVFMIKKTLTTM---NYGVSYF-AEGDL-----------LTQELYKSS-NYKV
A0A6C0GGI1      DQIGLLTSFNMVQKAIARL---DFGVSYY-LIPDI----LINNLGDQVVEEKVTE-EFPF
A0A368D1N7      QDVRVITSPIVVNKAFRQK---GLNYIFY-EVGDF-----------RSLEIYPNP-YFTI
A0A3B8TU58      QDIRVLTSPLVINNAYSDK---GLNLLFY-DVGNF-----------RSLEIYPNP-YFSV
A0A1T5IIR6      NEQLQLRSLTIMTEVVKAL---DADVNYL-DRIKF-----------RDVELYTSQSPVRM
A0A3E0QD27      GDVELIRSRVIVSRVVGAL---PLDVSYY-AHGKV-----------IDHEMYLSS-PFRI
A0A0K2HKS3      NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
B6W3W8          NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
A0A0M1W1I6      NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
A0A4R4GHU2      NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
I8WPR6          NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
A0A076IRY8      NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
A0A3A6AD54      NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
A0A8B3EPF6      NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
I8WPP8          NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
A0A372Y7D2      NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
A0A7K3KFI2      NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
A0A3E4JJC9      NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
A0A3E4WDQ0      NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
A0A414H9P2      NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
A0A7K0JKU9      NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
C3R5A8          NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
A0A6N8DCX3      NELLAMRMPSAIKEVVKRL---GLDTDYR-VNGFL-----------HKETLYGKELPVKA
F0R0C9          NELLSLQSPAVMLDVVKRL---HLHTDYL-TDGTF-----------YKQVLYGQTLPFSI
A0A1C5XJA7      NEMLQFNSKRLIREVVSRT---HADVSYK-MKDGL-----------RNVELYTKS-PVAV
A0A285T4L1      NEILQFRSKRLMREVVQRL---HADVDYR-VEEGL-----------RMNELYNQS-PINV
R7CUW4          NEILQFRSKKLMREVVQRV---HADVDYL-IQDGL-----------RYNELYTQS-PVRL
A0A416GGJ1      NEILQFRSKRLMREVVQRM---HGDVDYL-IEDGL-----------RHIELYTKA-PVTV
D1JY72          NEILQFQSHKLMRDVVNRL---HANVCYL-IMDDL-----------REEELYTQA-PVKV
D7J4K6          NEILQFRSKRLMREVVQRL---HADVDYR-VESGL-----------RMNELYTLS-PVNV
Q8ABP9          NEILQFRSKRLMREVVQRL---HADVDYR-VESGL-----------RMNELYTLS-PVNV
D6D2Z5          NEILQFRSKRLMREVVQRL---HADVDYR-VESGL-----------RMNELYTLS-PVNV
A0A1T3EDR4      DEMLQLQSKELLRQVIPYM---GGDKSYK-ISKGL-----------RDYELYTDS-PVEV
A0A6N8KXI9      SEILQLKSKELMRQTVTSL---HADISYS-EKRGL-----------RQVELYKDA-PVLI
A0A174SDD8      SEILQFKSKELMRKVIDRL---QANICYT-VHEGL-----------RPVELYTES-PVRV
A0A1H7RFH3      SEILQFKSKELMRKVIDRL---QANISYT-VYDGL-----------RPVELYTES-PVRV
A0A139L1N2      SEILQFKSKELMRKVIDRL---QANISYT-VYDGL-----------RPVELYTES-PVRV
A0A174TVL8      SEILQFKSKELMRKVIDRL---QANISYT-VYDGL-----------RPVELYTES-PVRV
A0A1H8BJR6      SEILQFKSKELMRKVIDRL---QANISYT-VYDGL-----------RPVELYTES-PVRV
R9H6G0          SEILQFKSKELMRKVIDRL---QANISYT-VYDGL-----------RPVELYTES-PVRV
A0A412GR09      SEILQFKSKELMRKVIDRL---QANISYT-VYDGL-----------RPVELYTES-PVRV
A0A7J5JXN6      SEILQFKSKELMRKVIDRL---QANISYT-VYDGL-----------RPVELYTES-PVRV
R6D982          TERLQFQSKALMRKVISRL---NADVSYA-VRDGL-----------RQKELYMAA-PVRV
A0A1F0I8C4      SEILQFKSKELMRKVIDRL---QANVSYM-VYDGL-----------RPRELYTEA-PIRV
A0A3A5RIJ2      SEILQFKSKELMRKVIDRL---QANVSYM-VYDGL-----------RPRELYTEA-PIRV
A0A515IZJ5      SEILQFKSKELMRKVIDRL---QANVSYM-VYDGL-----------RPRELYTEA-PIRV
A0A7J4Y2H6      SEILQFKSKELMRKVIDRL---QANVSYM-VYDGL-----------RPRELYTEA-PIRV
A0A4R6WE41      SETLQLRSKELMRQAVEHL---GADISYS-HKVGL-----------RVYELYDKS-PIKV
A0A2T5RP38      DEILQLRSKELMRQTIDRL---GADISYK-VHRGL-----------RDYELYKKS-PVKV
A0A1A6CF06      DEILQLKSKELMRQVVDKV---GADKSYK-IHSGL-----------RDYELYKKS-PVQV
A0A1T3D6S8      DEILQLKSKELMRQVIDKV---GADKSYK-IHSGL-----------RDNELYKKS-PVQV
A0A8B4GMS2      DEILQLKSKELMRQVIDKV---GADKSYK-IHSGL-----------RDNELYKKS-PVQV
A0A7Z7LUP7      DEILQLKSKELMRQVIDKV---GADKSYK-IHSGL-----------RDYELYKKS-PVQV
A0A0B8T471      GEILQLRSKELMRNTISSL---RSDVSYS-VQHGL-----------RTVELYRNS-PFEV
A0A4R7D2K0      GEILQLRSKELMRNTISSL---RTDISYS-VEQGL-----------RKVELYRKS-PFEV
A0A7T9S3V1      GEMLQLNSKELMRRTIDRL---DADVSYT-VRKGL-----------RDQELYTNS-PVKI
A0A7T9LVI2      GEILQLNSKELMRRTIDRL---NADVSYV-IRNGL-----------RDQELYTQS-PVKV
C2FUH6          GEILQLNSKELMRRTIDRL---NADVSYV-IRNGL-----------RDQELYTQS-PVKV
A0A1V3N3U3      SEILQLKSKELMRETIGRI---GAETSYS-IRKGL-----------RDIELYRTS-PVKV
A0A1P8E011      SEILQLKSKELMRQTVTRI---GAEMSYT-VGDGL-----------RRKELYTAS-PIKV
A0A7T9S8K4      SEILQLKSKELMRQTVTRI---GAEMSYT-VGEGL-----------RRKELYTAS-PIKV
A0A2X2J8S4      TEMLQLKSKELMRETVESI---KADVSYV-VRRQL-----------RDYELYNES-PVLV
A0A3C0S618      TEMLQLKSKELMRETVESI---KADVSYV-VRRQL-----------RDYELYNES-PVLV
A0A4P7DRF9      SEILQLRSKELMRNTIDSL---NTDISYS-VKSGL-----------RTLELYRKS-PYLV
A0A239XXC4      SEILQLRSQELMRNTISLL---NADISYS-RKEGL-----------RSVELYKTS-PFIV
A0A4U9K473      SEILQLRSQELMRNTISLL---NADVSYG-RKDGL-----------RSVELYKTS-PFIV
A0A081PBV5      SEILQLRSKELMRKTIDRI---EGDISYT-VKKGL-----------REYELYKDA-PVKV
A0A1I2AN85      SEILQLRSKELMRKTIDRI---EGDISYT-VKKGL-----------REYELYKDA-PVKV
A0A4U0GMP3      GEILQLRSKELMRRTISRL---NADVSYS-VRQGL-----------RNTELYTDA-PIQI
A0A0D5BSQ0      DEILQLKSKELMRQTIDRI---GADISYK-IRKGL-----------RDYELYKKS-PVQV
A0A1T3F6P5      DELLQLKSKELMRLVVDRI---NADKSYK-VHRGL-----------RDYELYKKS-PVQV
A0A853VUQ0      DELLQLKSKELMRLVVDKI---EADKSYK-VHKGL-----------RDYELYKKS-PVQV
A0A7X0MJ00      AEILQLRSKELMQNTIRMI---DADMSYV-MMNGL-----------RKNELYTNS-PYKV
A0A841JHZ0      SEILQLRSKELMRNTVRLI---HADMSYV-TRDGL-----------RKNELYTNS-PFKV
A0A1H6CKR6      SEILQLRSKELMRNTIGAL---DANISYK-RQNGL-----------RTLELYKTS-PFLV
A0A7W3MGA7      SEILQLRSQELMRNTISLL---NADVSYT-KEEGL-----------RTIELYKTS-PFIV
A0A3M1Y2F5      ------------------------------------------------------------
A0A7V1ALN2      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          -MVVVPSLYYGDKYFNTTVQVTKSPLQNVALRFQS-------------------------
A0A4Q3SEI4      ---------------------------------SD-------------------------
A0A836SQI2      -----------------------------LKENIK-------------------------
A0A7V1FAJ9      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      PALQPAPAAASWPPNEPDTRGAALE-------LDL-------------------------
A0A519TAP8      LLVDSVPGRALPVGDDPQYHFVILNDGAVINYLDK-------------------------
A0A848Y4B8      ------------------------------------------------------------
A0A7Y4V8Y1      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A847AMH6      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A7V1FAS7      ------------------------------------------------------------
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      ---L--------------------------------------------------------
A0A7C7CKY6      ---I--------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ---K--------------------------------------------------------
A0A519SD85      ---S-------------TVKTDKKSS----SYYFQ-FSQLDNEKF----------ELYIN
A0A3M1TXY5      ---QLDSSHVQIVGAKFFVRPISDT-----EYEIE-ADEKSAEIWNIAEDALVHE-LEPF
A0A7T9KM12      ---RLDTG-LQVSGAKVHVEPDYEAG----TYRVW-AKEKFANMFSAGLQKPVDNFVKDY
A0A2E0VQ27      ---DYGVNDDKALDKTIYFDYLGEG-----RFRFFDGSPKDSAHA----------TIV--
A0A7Y7TYP1      ---LYSKDHLQPLNVRFNVTFQSPN-----KFTLE----SQGENI----------PLYIY
R6U429          ---V-------------RAGDNNAS-----SFSFE-IMKEGEDAF----------VIKDW
A0A5C8AF42      ---T--------------------------PFELKDSSLINVPIFVAFDGKSISVNYAHL
A0A7Y5SYP1      ------------------------------TIQGTGNPYSVLGTV---------------
A0A7V1N701      ------------------------------------------------------------
A0A7V2NIA8      ------------------------------------------------------------
A0A239K409      ---V--------------------------AHSLDSTAYGREVTV----------SFNGG
A0A1M3DPL8      ---DADFISPQAYDILFKLNIKPDG-----TFTVTEDEESMPKGF----------NING-
A0A1V5F519      ---EADYVAPEAYELLFKISLHPNG-----TFTISPHNNNSMPSS----------PING-
A0A2G6R1T9      ---ETNYISTEAYGVLFKIEINEDG-----SYVISDDKGVIDEDL----------EIRG-
A0A350V3E4      ------------------------------------LSATPENQV---------------
A0A6J4K208      ---VLDSTQGQAVGVPVYVKLIDEQ-----LYRLK----VHGENV----------PVFDL
A0A2W4RDE8      ---HLDSSVHQLINVPIYIERLSSS-----KYMVS----VRGKEV----------PTYDV
A0A212J9Z9      ---E-------------M----IDIKPEAYNYAYE-VTYIDQEKC-----------EISY
F5IV23          ---E-------------M----IDIKPEAYNYSYE-IAYIDQEKC-----------EISY
A0A1M5DFS8      ---E-------------A----KYVAPSAYSIVFE-VEPIDSDKC-----------RIFY
A0A4Y8KZS5      ---E-------------A----KYVAPSAYSIVFE-IEPINADKC-----------RIFY
A0A2V3PNY7      ---E-------------A----KYVAPSAYSIVFE-IEPINSEKC-----------RIFY
A0A6G7X5K8      ---E-------------A----KYVAPSAYSIVFE-IEPINSEKC-----------RIFY
A0A840CJ33      ---D-------------I----IELQPAAYNYIYD-ITYIDKDKC-----------EISY
F8X2T0          ---A-------------IDSLETDITPEAYSKVFD-VSYVSDSQI-----------RVSY
A0A1M3LAG1      ---V-------------IDSLETDITPQAYSKVFD-VAYVSDSQI-----------RVSY
A0A212K6G4      ---A-------------IDSLETDITPGAYSKVFD-VAYVSDSQI-----------RVSY
A0A4Y9IPG7      ---A-------------IDSLETDITPQAYSKVFD-VAYVSDSQI-----------RVSY
A0A0L8VEV2      ---LYDRQAMNLEGIPIHIQMLDTS-----NFQIE----VKGKKM---------------
A0A1I2A9Z9      ---LFDRNAMNLEGIPVYVQMLDST-----NYRII----VDEKTM---------------
A0A848XXC6      ------------------------------------ENPAGAQES----------LVGDF
A0A2P8CDS1      ---ELDRSHPQLLDANFDLHFLPNN-----RVEMT----IQGKKA----------VRYDY
A0A660LQT8      ---Q-------------FLSLSDER-----SAMLD-ITYERDGHF----------ELTNF
A0A3D0FMX4      ---EPSEIRPEGYEHLYKLDIGTNG-----QLTVSIADEDTKNPM----------TFNT-
A0A7V6G854      ---KTTFLAENAYGTDYQFVAIDSK-----SFEILIKGNKISKDE----------IIKG-
A0A1M3MEI8      ---HTDYIAPEAYGILFKLSISEDG-----TFLITEEEENLRKGF----------ALRG-
A0A1J5HQM0      ---NPDYIAPEAFNLTFKLDLNANG-----TFTITVDENKQYENF----------KLNG-
E4T131          ---QTDYIAPEAYGVLFKIKLHSNG-----SYTISVDDKNLFSKF----------QING-
A0A653AC35      ---IADFVSPNAYGILFKVNVKTDG-----SYIITDENSL---NI----------KIKG-
A0A847LA02      ---TADYVHPKVYGKLFKVSLKKDG-----SYTITDEDGAVDKNL----------NIKG-
A0A389LWV6      ---KSNFISEEAASLDFRIRGIDTT-----AYEITFDGAKNIAPF----------SIVG-
A0A1G9B1T9      ---ELDSLSDQLIGVPIYVRFLSSN-----RYEIS-VEADEASVY----------QMAEE
A0A350PNH9      ---H-------------FYSLNDMQ-----SANLD-VEVKHGNLF----------SIVHV
A0A354LNT9      ---H-------------FYSLNDMQ-----SANLD-VEVKHGNLF----------SIVHV
A0A161LWY6      KGDN-------------ISDAVSGL-----EFDFR--------------------DIDGV
A0A6I3N9U6      KGDN-------------ISDAVSGL-----EFDFR--------------------DIDGV
A0A353WYK7      ---E-------------YKIEPQYF-----DHPFD-VDILNSKKF----------ILRLK
A0A2W7RD29      ---ELKENDKSIEEKFFRISWVDSL-----SYSVRFVGDEPTTSM--------------F
A0A3N2NDY8      ---K-------------FHDLEEQQ-----CAGFR-IELGKDGNV----------VLSKF
D7JEV9          ---DIISISDISYGKYYLYQRKDND-------YFT-IKVFDNEDV----------ELETV
A0A553GA49      ---VLDKNYLQLTGAEFYVEILSKD-----LFTLK----VEVDEG----------ELHNF
A0A7V5GTN5      --------------EELYFYLLDSY-----AYRAD----IQRRVR----------EAYPH
A0A497D6F6      ---IWDYEHPQLIYADFLLEILPDG-----KLLIK----VEDEHA----------AIFDF
F4KR18          DTFKLNPS----AESTFKITPLNNY-----SFRFS----QGSKTE----------TQ---
B5CTK0          RFFDVDEAETLSLTV------------------LP----HSEKEV----------T----
A0A5M4AAB9      ---EFDDRHSQLIDTNFDLKFLSDN-----KVKIK----TKSRKA----------IRYDY
A0A5R9QZP0      ---NIDKSHSQAINTRYYIEILDES-----RFRLS----VYDDGA----------KLYNY
A0A7X6SRJ5      ---SIDKSHVQPINVKFYIQVLDEN-----SFRLT----ASEEKV----------SLYNY
A0A3D3HL11      ---IIDKSHIQPINTRFRVDILDDQ-----SYRLT----ASEDEA----------SYYNY
A0A6L8U6G9      ---SIDKSHIQPINARFEIDILDDQ-----TYRLT----ASEDEV----------AYYNY
A0A6L8UH35      ---TIDKSHIQPVNTKIYITHLDDS-----TFRIT----ISDKNV----------SLYNY
A0A7X9F2J5      ---AIDKSHIQPINTKIYITVLDES-----TFRIT----ISEKDV----------ALYNY
A0A352ME00      ---SIDKSHIQPIGANIYVSILDES-----SFRLT----ASQKKV----------SYYNY
A0A7X8CRA6      ---SIDKSHNQPIGAKFYISILDDN-----SYKLS----VSGKKV----------SFYNY
A0A1F3D6P8      ---IMDKSHIQPIDVKLRVFILSDT-----TFRLV----IDQNTV----------SLYNY
A0A356Z058      ---IMDKSHIQPIDVKLRVFILSDT-----TFRLV----IDQNTV----------SLYNY
A0A7X8FHL3      ---TIDKSHIQPIDAKFRVSILDDA-----SYRLT----LSQKKV----------SFYNY
A0A3D1BT36      ---NIDKSHIQPINARFYINIVSDT-----TYRLT----VSEDDV----------SFYNY
A0A7X7CXW9      ---TLDKSHIQPINTRFQIEILDDH-----SYRLT----ASEDEA----------AYYNF
A0A4R6H3B7      ---LFDRNTMNLEGVPVYVQMLDST-----NYRII----VDEKTM---------------
A0A229I3A5      ---D-------------FVGFTDEQ-----SGSFK-LQLKGDGSY-------VISKLKGV
A0A3R6HJB3      ---D-------------FVGFTDEQ-----SGSFK-LQLKGDGSY-------VISKLKGV
R6NN15          ---S-------------FAGLADNE-----TAALT-VEPAQSKGI----------KLTSF
A0A2W7QSQ0      ---DSISKSFISPSESFEIQPISET-----KFLLI-LDEDKQKEF---------------
A0A841MQL4      ---HSFSKNFLKESESFEVQILSDE-----KFLMI-VDEDRKKEF---------------
A0A3P1Z8V4      ---HFDRPSKRYTRMEAVINPDN-------TVTLT--------------------DFEGI
A0A1M6MYT6      ---VWEEDHPQIINADFYLTIQPDG-----KLELK-IEEEDEVMVFNYKDKTVLDELDSY
A0A1V5S1J9      ---T-------------KTFVSPQAY----EREFTIQDLGN-NNF----------EISAP
A0A7X8JMH1      ---E-------------KLFISPNGY----EQEFFLEDVGNGKDF----------LITYA
A0A3D5KRY6      ---VLPSDFIQLENVPIHIKIISKT-----KYEIS-----CDEKI----------RIGGW
R7F6L5          ---S-------------SPDAANADA----SYSFK-YIVKPDGTV----------ILKDF
A0A7C5MRV2      ---S-------------YDSTGKVAY----NKMFS-LFYLGGNKF----------KLVYT
A0A0A2EYC8      ---E-------------IISTPDAG-----FWQYYLYQKQNDNEF----------TIKIF
A0A2G6H6Y4      ---E-------------ILSTYDNS-----FDNYYRFEVTGEKSF----------NISVL
C9LKL0          ---S-------------FGTKTSV------PANFQ-AEIMPGGKV----------RLFDF
A0A3D0QPV7      ---S--------------------------DLTIIDSTIFGERID----------IFSNS
A0A496KT23      ---E-------------FLNIGEEQ-----RASFG-LSLQADGRV----------ILDNF
L1M9T3          ---E-------------FLNISEEQ-----TASLS-LTLMADGRV----------LLENF
A0A2M6GH67      ---D-------------YEIRDGSFY----DKEFK-VNFIDNNTF----------KLVYL
A0A7K1TE30      ---E-------------YTISDPAYY----NRKFN-VEYVDATHY----------QLNAV
A0A7D4BE70      ---E-------------YSISDPVYY----NHKFS-VEYLDAKHY----------HLQVS
A0A142HHS5      ---T-------------YVISDPAYY----NHKFD-VEYIDAKHY----------RLNVT
A0A7D4C435      ---E-------------YTISDQAFY----NRKFN-VSYVSADSY----------HLEVV
A0A3C0I8F1      ---K-------------WWATANNPWF---DKRFD-VQIVDPKHF----------VLAFE
R5JJI4          ---L-------------FPESEERQ-----VIEMT-VTPVDSATV----------RLSDF
A0A848IUK4      ---A-------------YKASGSEIFNRLFNVHIS-SMTNYELSY----------DLGGV
A0A136LSC7      ---K-------------ASHINPKHYDQ--PIYFD-FLDNNEVSL----------RLKGA
A0A5C7N8Q5      ---T-------------TTQINPKHYDQ--SIFLD-FQDNNQFTL----------RLGDA
A0A355BP94      ---R-------------CIGNVESFQDQ--PIFVD-FVEGNKYQL----------WVGEN
A0A7Y5D1K7      ---N-------------YTLTDKRILDK--PIYFD-FIEGNKYQI----------KIGEE
A0A3D2HF71      ---I-------------YDSLNKQTI----GEKVN-VKILSAKKY----------KIEID
A0A0A2DQN2      ---S-------------FVDSLELYD----SFFVS-YKDENQVSV----------S--YN
A0A0A2F2N5      ---T-------------FADSLDQYH----QFEVT-YKDASSI-V----------LSREG
L1NGW4          ---R-------------FLDSLEKVA----TYEVR-FKDAGHVSI----------QPQGS
Z4WRA0          ---R-------------FLDSLEKVA----SYEVR-FKDAGHVSV----------LPQGS
U2K8K9          ---T-------------FLDTLDVAN----TFRVS-YQDASHVSI----------KLGKD
A0A069ZM60      ---K-------------FLDTTERKS----TYEVA-FQDAGHVRV----------TPVHT
J6GV98          ---K-------------FLDTTERKS----VYEVA-FQDAGHVRV----------TPVHT
A0A134B4F8      ---K-------------FLDTLERGS----SFDVA-FQDASHVRV----------TPAST
A0A134B8C7      ---K-------------FLDTLERGS----SFDVA-FQDASHVRV----------TPAST
A0A4Z0EKR0      ---I-------------LGKLEPTAG----GVNFT-VRPKSVDTF----------ELDDY
A0A521H707      ---EYELTDSSYFDRRFFIDFEGDS-----KFRLSYSTALSKQSG----------TF---
A0A7T9D909      ---E--------------------------DLQVL-DERIRETPI----------GITSA
A0A1M6B6D5      ---EVDTAKSQMLNHQIKVVFKDSL-----TFNLS-VSFEEAKNI----------NLQNY
A0A451FS66      ---RVDTTKAQVLNQQFKVVFKDSV-----NFNLS-VSFEEGKNI----------NLQNY
A0A2E3GN39      ---D-----------SFYQDPKMRRV----SIDYSVLINQQKDSV----------RLDYI
A0A3D1MEL0      ---D-----------SFYQDPKMRRV----SIDYSILINQQKDSV----------RLDYI
A0A519UDD1      ---K-------------VLLTTADST----AAGKS-------------------------
A0A7Y2ACP6      ---R-------------IIEVVDSLA----AFDKR-YDIIFNE-----------------
A0A2A4N9A6      ---D-------------FMVKDPIIY----QVRFN-IEILNTREF----------KLLYS
A0A6C0GGI1      ---R-------------VILDPSSNQ----LLNVPIYVKILSKNK----------YQVQV
A0A368D1N7      ---D-------------SFYQDYKMR----RVSID-YSILINQQK----------DSVRL
A0A3B8TU58      ---D-------------SFYQAPELT----KINID-YHMFLSRKK----------DSIRL
A0A1T5IIR6      ---A-------------FNREKSDPG----SVSVT-VIPEDAGHI----------RLQTS
A0A3E0QD27      ---EYEIEDSAIFSIPFYLDFESEK-----VFHLR-YPTHEGEKV----------KAFQT
A0A0K2HKS3      ---S-------------FPEEEDHL-----DFSLT-VRILNRKQV----------RLSDF
B6W3W8          ---S-------------FPEEEDHL-----DFSLT-VRILNRKQV----------RLSDF
A0A0M1W1I6      ---S-------------FPEEEDHL-----DFSLT-VRIQNRKQV----------RLSDF
A0A4R4GHU2      ---S-------------FPEEEDHL-----DFSLT-VRIQNRKQV----------RLSDF
I8WPR6          ---S-------------FPEEEDHL-----DFSLT-VRIQNRKQV----------RLSDF
A0A076IRY8      ---S-------------FPEEEDHL-----DFSLT-VRILNRKQV----------RLSDF
A0A3A6AD54      ---S-------------FPEEEDHL-----DFSLT-VRILNRKQV----------RLSDF
A0A8B3EPF6      ---S-------------FPEEEDHL-----DFSLT-VRILNRKQV----------RLSDF
I8WPP8          ---S-------------FPEEEDHL-----DFSLT-VRILNRKQV----------RLSDF
A0A372Y7D2      ---S-------------FPEEEDHL-----DFSLT-VRILNRKQV----------RLSDF
A0A7K3KFI2      ---S-------------FPEEEDHL-----DFSLT-VKTLNRKQV----------RLSDF
A0A3E4JJC9      ---S-------------FPEEEDHL-----DFSLT-VRTLNRKQV----------RLSDF
A0A3E4WDQ0      ---S-------------FPEEEDHL-----DFSLT-VRTLNRKQV----------RLSDF
A0A414H9P2      ---S-------------FPEEEDHL-----DFSLT-VRTLNRKQV----------RLSDF
A0A7K0JKU9      ---S-------------FPEEENHL-----DFSLT-VRTLNRKQV----------RLSDF
C3R5A8          ---S-------------FPEEEDHL-----DFSLT-VRTLNREQV----------RLSDF
A0A6N8DCX3      ---V-------------LPGLEDAE-----SVSFT-IQLLPGGKV----------ELDDF
F0R0C9          ---S-------------FFGLQDNE-----TASLT-LRQGASGKL----------ELSDF
A0A1C5XJA7      ---S-------------FADMLPEQ-----YVAFT-VTLLNKDSV----------EITDF
A0A285T4L1      ---S-------------FINVMPER-----YISFT-VTPKNAKQV----------LLSDF
R7CUW4          ---S-------------FPDAMPEQ-----GLALT-VQPKSERSV----------TLSRF
A0A416GGJ1      ---S-------------FPGMSPNG-----AVQFK-LKMLNLKEA----------QITTL
D1JY72          ---S-------------FPEEEDHL-----DFSLT-VRILNRKQV----------RLSDF
D7J4K6          ---S-------------FINVLPER-----HISFV-VTPKDDATV----------TLSGF
Q8ABP9          ---S-------------FINVLPER-----HISFV-VTPKDDATV----------TLSGF
D6D2Z5          ---S-------------FINLLPER-----HISFV-VTPKDDATV----------TLSGF
A0A1T3EDR4      ---I-------------LLGETSLS-----GYSLK-VEPLDGGSV----------LIREW
A0A6N8KXI9      ---H-------------LIHNNSYE-----GFEFD-LKGIDKETV----------ELFGF
A0A174SDD8      ---A-------------FLEAGTDE-----AHSLS-VTPKSNVQV----------ELSDF
A0A1H7RFH3      ---T-------------FLDAGMDE-----AHSLS-VTPKSRQQV----------ELADF
A0A139L1N2      ---T-------------FLDAGMDE-----AHSLS-VTPKSRQQV----------ELADF
A0A174TVL8      ---T-------------FLDAGMDE-----AHSLS-VTPKSRQQV----------ELADF
A0A1H8BJR6      ---T-------------FLDAGMDE-----AHSLS-VTPKSRQQV----------ELADF
R9H6G0          ---T-------------FLDAGMDE-----AHSLS-VTPKSRQQV----------ELADF
A0A412GR09      ---T-------------FLDAGMDE-----AHSLS-VTPKSRQQV----------ELADF
A0A7J5JXN6      ---T-------------FLDAGMDE-----AHSLS-VTPKSRQQV----------ELADF
R6D982          ---H-------------FLVSEPEA-----ELSLL-VTPKNERQV----------ELSDF
A0A1F0I8C4      ---A-------------FMDAIPGE-----RCFLS-VIPKNQQQV----------ELAEF
A0A3A5RIJ2      ---A-------------FMDAIPGE-----RCFLS-VIPKNQQQV----------ELAEF
A0A515IZJ5      ---A-------------FMDAIPGE-----RCFLS-VIPKNQQQV----------ELAEF
A0A7J4Y2H6      ---A-------------FMDAIPGE-----RCFLS-VIPKNQQQV----------ELAEF
A0A4R6WE41      ---K-------------ILKGLPQD-----TWSLL-ITPISKDSV----------EIGGW
A0A2T5RP38      ---V-------------FSNKSPES-----RYGFT-IIPIDAKNV----------IVKDW
A0A1A6CF06      ---K-------------VEGKTQAD-----SYGFT-VTPIDTRYV----------LLKKW
A0A1T3D6S8      ---K-------------VEGKTHAD-----SYGFT-VTPVDTRYV----------LLKKW
A0A8B4GMS2      ---K-------------VEGKTHAD-----SYGFT-VTPVDTRYV----------LLKKW
A0A7Z7LUP7      ---K-------------VEGKTHAD-----SYGFT-VTPVDTRYV----------LLKKW
A0A0B8T471      ---K-------------FLNIKPES-----NFSFT-LTAIDSTKV----------RFAT-
A0A4R7D2K0      ---K-------------FLNIKPES-----NFSFT-LTAIDSTTV----------RFAT-
A0A7T9S3V1      ---T-------------CLNKKPDQ-----SFSFT-LTPLDQKHV----------LLQKW
A0A7T9LVI2      ---T-------------WMDKKPDQ-----SFSFT-LTPLDGKYV----------LLKKW
C2FUH6          ---T-------------WMDKKPDQ-----SFSFT-LTPLDGKYV----------LLKKW
A0A1V3N3U3      ---D-------------LAGAGPTS-----QYNLL-IIPLDAQTV----------LLSGR
A0A1P8E011      ---I-------------VPQTKPED-----SFSFT-VTPVGGKEV----------VLSNW
A0A7T9S8K4      ---I-------------VPQKKSED-----SFSFT-VTPIGGKEV----------VLSNW
A0A2X2J8S4      ---Q-------------FVNYNPSG-----SFSFT-ITPRDNKSV----------LVVEN
A0A3C0S618      ---Q-------------FVNYNPSG-----SFSFT-ITPRDNKSV----------LVVEN
A0A4P7DRF9      ---E-------------FEGINQNA-----GFSFN-LRRKDANEV----------ELSDF
A0A239XXC4      ---R-------------FRNAAPQS-----GFSFN-LKYKGNNQV----------ELSSF
A0A4U9K473      ---R-------------FINVPSSA-----GFSFN-LKYKGNNQV----------ELSMF
A0A081PBV5      ---Q-------------FIDAKPEV-----GFSLQ-IEAVDQDHV----------ALSSF
A0A1I2AN85      ---Q-------------FIDAKPEV-----GFSLQ-IEAVDQDHV----------ALSSF
A0A4U0GMP3      ---S-------------FEDVRTED-----NFSFT-VSRNDDSTV----------LMSGF
A0A0D5BSQ0      ---K-------------VEGKSSED-----NYAFT-VIPVDMKHV----------VIKNW
A0A1T3F6P5      ---Q-------------VEGKSSED-----SYNFT-VVPLDANNV----------IIKNW
A0A853VUQ0      ---K-------------VEGKSSED-----SYNFT-VVPVDANNV----------IIKNW
A0A7X0MJ00      ---A-------------QLHYNPEA-----AFSFT-ITRKNTNQV----------ELSGF
A0A841JHZ0      ---E-------------PINSNSKA-----GFTFT-IISKNNKQV----------ELSGF
A0A1H6CKR6      ---K-------------FVDANPNM-----PQEFT-LKSLGKNQL----------ELSEF
A0A7W3MGA7      ---R-------------FVNAPANA-----GFSFN-LKYKGNNQV----------ELSNF
A0A3M1Y2F5      ------------------------------------------------------------
A0A7V1ALN2      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A836SQI2      ------------------------------------------------------------
A0A7V1FAJ9      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
A0A848Y4B8      ------------------------------------------------------------
A0A7Y4V8Y1      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A847AMH6      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A7V1FAS7      ------------------------------------------------------------
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      ---------------------KEQL----------------------SPEHG--------
A0A7C7CKY6      ---------------------SYQQ-----------------------NQFQ--------
A0A1G1TG88      -----------------------------------------------GPASL--------
A0A661XXA6      ---------------------EFEQEYKFSSPVINEDFEFNMVLSPSWNSSM--------
A0A519SD85      DEKRIY---------------KFDQVIIHEN----------LQIKVQRPLVRVLN-----
A0A3M1TXY5      VFNKRL---------------RFGQPYTDQN----------LSFTLHRNPDF--------
A0A7T9KM12      ELDKTE---------------RIGEPFRSDH----------LNFAIEFNRGY--------
A0A2E0VQ27      ---------------------DQGQLIEKNG----------LLLTIEPDSAF--------
A0A7Y7TYP1      SKNEYVRHKDNWAFQWNG---TIGKLIETKD----------LSFMIELDSTIDFS-----
R6U429          HVAGEEMEYAKIKG-------RLNDTLDTPV----------GKLVIAPTMLY--------
A0A5C8AF42      GKNYALKGKLNERLSNTHFEISIDSPIPSEF-----------------------------
A0A7Y5SYP1      ---------------------LLNRNATSPR-----------------------------
A0A7V1N701      ---------------------QLAATLKESG-----------------------------
A0A7V2NIA8      ---------------------QLEESLQASG-----------------------------
A0A239K409      KSYNLEEGGKTFKF-------EFGEVVRRPY----------GTFTILTSDAF--------
A0A1M3DPL8      ---------------------RIGYPLQHHL----------MFITINDISGN--------
A0A1V5F519      ---------------------HIGVPLQHNL----------FFMTVNSVSDN--------
A0A2G6R1T9      ---------------------KIGVPVKSKL----------FVINVTKDIEF--------
A0A350V3E4      ------------------------------------------------------------
A0A6J4K208      RTDRQVAVIPLIAVDKVL---RVGRPYRDPH--------------LGFRIEF--------
A0A2W4RDE8      ITNTVKDRVPVVDIQEVV---DINKPFQSKN----------LSFSITFNDAF--------
A0A212J9Z9      KENPESETKISLIA-------PFDQEIDYKL----------FRIKLHKTPNFRKD-----
F5IV23          KENPESETKISLIA-------PFEQEIDYKL----------FKIKLHKTPNFRND-----
A0A1M5DFS8      -PGSENTAPFSMEV-------PYNQYVQESR----------FYIKINKTDRFTPN-----
A0A4Y8KZS5      -PGSESTPPFSMEV-------PYNQFVQESR----------FYIKINKTDRFTPN-----
A0A2V3PNY7      -EGSETTQPFSMEV-------PYDQFVQEPR----------FYIKITKSPRFAPN-----
A0A6G7X5K8      -PGSETTAPFSMEV-------PYGQFVQEQR----------FYIKINKSPRFAAN-----
A0A840CJ33      KENSESDERIRITA-------PYDQEITHSL----------FKIKLTKTDAFRKD-----
F8X2T0          KDGLDGEPEEAFNV-------VFDSPVENKF----------FKGTIRKTKNFKRD-----
A0A1M3LAG1      KDGLDGEPEEAFNV-------VFDSPVENKF----------FKGTIRKTKNFKHD-----
A0A212K6G4      KDGLDGEPEEAFNV-------VFDSPVENKF----------FKGTIRKTKNFKRD-----
A0A4Y9IPG7      KDGLDGEPEEAFNI-------VFDSPVENKF----------FKGTIRKTKNFKRD-----
A0A0L8VEV2      ---------------------VYGKEVEIEFSQKGKF----GELFSNDYFNFTLY-----
A0A1I2A9Z9      ---------------------YYGREIEIKIDQRGVF----GEIFENDYFHFTLY-----
A0A848XXC6      VQAPGLEARKVLNQALIL---QQAPAIATRT----------AQQLLASSAPL--------
A0A2P8CDS1      RNEKELQPEK-----------EIEETRTFPIDSFVASDDYAFRIIPAADSKL--------
A0A660LQT8      VTNLDRKIEKTQVVKG-----HFGQIVNTPV----------GRVRVTPTNHF--------
A0A3D0FMX4      ---------------------IYGQTFDCGL----------FSGLFMPTEYMT-E-----
A0A7V6G854      ---------------------RYNEPVECSR----------FFITIHKLRELE-S-----
A0A1M3MEI8      ---------------------RLGKTFQHNL----------FFITVNMAEGVVHG-----
A0A1J5HQM0      ---------------------NIGEPISNNL----------FFITINNTNSYY-A-----
E4T131          ---------------------RYGRPLQHNL----------FFLTVHNVNKYM-G-----
A0A653AC35      ---------------------YLNQPIQHNL----------FFLTIAPTNQNR-Q-----
A0A847LA02      ---------------------RLGIPIQHNL----------FFMMIEPMRSTI-D-----
A0A389LWV6      ---------------------NYGTSLQHNL----------FFVTVDKTDQF--------
A0A1G9B1T9      KFAPTKARDVLIQNVQ-----KVGQPVRTPY----------LNFTLIRNE----------
A0A350PNH9      SGTDKAGNQVESDEEVQG---KLGQTVRTAM----------GHVCVDQAPGY--------
A0A354LNT9      SGTDKAGNQVESDEEVQG---KLGQTVRTAM----------GHVCVDQAPGY--------
A0A161LWY6      TYEIAHQKDKQLDELRYTG--RYGSLLNTPY----------FSVVVNKTDNF--------
A0A6I3N9U6      TYEIAHQKDKQLGELRYTG--RYGSLLNTPY----------FSVVVNKTDNF--------
A0A353WYK7      KGDQVIENTY-----------SFGEEIVCDG----------FVFMLALSPHY--------
A0A2W7RD29      NSNQDEGSGKSYVC-------KFNEWCGLPFLTLR------TRLLEAKNDGN--------
A0A3N2NDY8      HLETPDGDEEIEKEVKAK---IGAGPIETPV----------GKVSIAANGNY--------
D7JEV9          EG-------------------RYNEPVGCKY----------FLIKVIENKAF--------
A0A553GA49      LNASSEQLVEDWEFKHTY---RFGESIENEN----------FNFTVLLKEGL--------
A0A7V5GTN5      LPA---------------------------------------------------------
A0A497D6F6      LNSEIVTYVTNLSFSKEA---AYNEVIKTDY----------FSFIIKPKRE---------
F4KR18          ---------------------RFGTLFSNQF----------GVFRINRIGAL--------
B5CTK0          ITDIITSSGESVNKSFYI---PLNDTVSTPI----------GRILISPTLYY--------
A0A5M4AAB9      LRKTELSEPHAVNNSRTF---DIDEQIKSAD----------YSFRIIPISSL--------
A0A5R9QZP0      LDNKVTSRGNRIEFDSIC---TFNETITTPY----------FKFSVNLNKDL--------
A0A7X6SRJ5      IDNVIVSSNHVLEIDTIC---NFNETISNRY----------YKFSVFLNREL--------
A0A3D3HL11      IDNAVVSTENRVRIDTIC---RFNETVTSYN----------YKFSIGFNKEY--------
A0A6L8U6G9      IDNAVVSDKNIFHLDTIC---RFNETISSFN----------FKFSIALNKEI--------
A0A6L8UH35      VDNMILNDDYDLEVDTIC---KFGETIQNKA----------FKFSVTNNRNY--------
A0A7X9F2J5      VDNVIVRDDYELKVDTVC---KFSETIQNNA----------FKFSVTYNKDY--------
A0A352ME00      VDNQIISEDNFFEIDTIC---KFNETISNKV----------VRFSVALNKDF--------
A0A7X8CRA6      VDNEIISEDNVVEFDTIC---KFNETITNRL----------FSFSVGLKKEN--------
A0A1F3D6P8      LDNQIVIENVPLKVDTIC---RFNETIRGKT----------FKFSVSFNRDF--------
A0A356Z058      LDNQIVIENVPLKVDTIC---RFNETIRGKT----------FKFSVSFNRDF--------
A0A7X8FHL3      VDNLIVSENNTIEFDTIC---RFNDLVSNKL----------FRFSIALNKNF--------
A0A3D1BT36      LDNKVISAGHMLNIDTVY---KFNQTIASPY----------FRFSVSKNQDY--------
A0A7X7CXW9      IDNAIVSEKNVLRIDTIC---PFNETVSSYN----------FKFSVTLNRDF--------
A0A4R6H3B7      ---------------------YYGREIEVKIDQRGVF----GEIFENDYFHFTLY-----
A0A229I3A5      TRDNLPVDDSDEITG------RIGQIIRTPL----------GKIKVDKAPAF--------
A0A3R6HJB3      TRDNLPVDDSDEITG------RIGQIIRTPL----------GKIKVDKAPAF--------
R6NN15          VHNGEKVD--GEVVG------TLNDSLVTPI----------GKIVIRPAAAF--------
A0A2W7QSQ0      ---------------------EYGQKIKFSF----------GIISIQKKPAS--------
A0A841MQL4      ---------------------EFNQRIKMAI----------GEISIKRDSIT--------
A0A3P1Z8V4      RGLSSEQENLKLKV-------PFGVKTKTPI----------GTLTLYKETPF--R-----
A0A1M6MYT6      SYSEEA---------------TPGTRISTDE----------FAFKILLNEHF--------
A0A1V5S1J9      GTKQLP--ELKISG-------KYGIPIQNSS----------FFIQVDKSAIYRRN-----
A0A7X8JMH1      GNKQIA--EFTVKG-------EYGKQLETSL----------FFITIHKSDFYRNR-----
A0A3D5KRY6      SKHIQFHKEQ-----------TLGEAFKNEF----------FQFTISAKTGV--------
R7F6L5          NKGGTELPDKPLSC-------KLGATVKTPV----------GAIAIDRPEWV--------
A0A7C5MRV2      KRQESVEGQY-----------YFGETINIDGFKFQVVKRETARYSLVPGIEY--------
A0A0A2EYC8      DNEDVE--LETVKG-------RYNEPVGCKY----------FLIKVTKNSNY--H-----
A0A2G6H6Y4      DEHDEV--LEVVDG-------EYGEPIGCKY----------FLVKVLRDERY--N-----
C9LKL0          KLN-GEEYSDDIET-------APEQAVKTPL----------GVLKISKNATF--E-----
A0A3D0QPV7      NQITLNCRNQTFTT-------ESGGLLQSPWFR--------ARITVADPQTI--Q-----
A0A496KT23      TKDGASLSGTVMG--------KVGERCVTPV----------GLVKFVANTGY--------
L1M9T3          VRDGQNLGGSVLS--------QVGKRCATPI----------GLLKLTPTNAY--------
A0A2M6GH67      I-GEEEITGEY----------KVGEPINKKE----------IYLVLNRTPNF--N-----
A0A7K1TE30      L-GEQKIEGTH----------ALGQLVKLPG----------MQLRLLANEES--P-----
A0A7D4BE70      LKSNETLAGNY----------ELGQYVQLPG----------MRLRLLPSGSA--T-----
A0A142HHS5      V-GNAKLGGNY----------EFGQLVKLPG----------ISLRLLSAS----S-----
A0A7D4C435      L-GEETLKGTY----------KIDQYVQLPG----------IKLRLLATSYAPLA-----
A0A3C0I8F1      QGRGVI--KQKY---------QFNDTIHLSG----------MSLVLIPKPAI--N-----
R5JJI4          SLSIAGEEIRSAEVVDA----RLNDTISTPV----------GTMVVTPTLYY--T-----
A0A848IUK4      SQKFNG---------------VFGKPLVINS----------GVITLTLTENY--A-----
A0A136LSC7      VST-RG---------------SMGNPVEFDG----------TVLTITKTNYF--T-----
A0A5C7N8Q5      GPTVSG---------------TMNKPVELDK----------TILIVNKTIFF--T-----
A0A355BP94      GTKQTG---------------TLGEPVVVSD----------ANFVIELSPNA--T-----
A0A7Y5D1K7      GEEREA---------------TLGEPLVLEG----------ASFLIQLAPNA--Q-----
A0A3D2HF71      GER-----NFSKEM-------NFGDRFNEQGFDFIIELRDKNNFVFDPNASN--R-----
A0A0A2DQN2      EEEHIF---------------LLGDTISIGK----------NRLIIEPNPNY--T-----
A0A0A2F2N5      GETKQV---------------QLGEEVTYEK----------SRLIVVPSKGY--N-----
L1NGW4          SKAQDV---------------PLNVPVQLGP----------DRFIIEPRSNF--N-----
Z4WRA0          SKAQDV---------------PLNVPVQFGP----------DRFIIEPRSNF--N-----
U2K8K9          GRTQVI---------------PVGEPIRIGE----------TRFIVEARKTF--N-----
A0A069ZM60      GKSQVV---------------PLNVPVQLGD----------ERFIIEPHQNF--N-----
J6GV98          GKSQVV---------------PLNVPVQLGD----------ERFIIEPHQNF--N-----
A0A134B4F8      GKSQVI---------------ALNVPVQLGE----------ERFIIEPRQNF--N-----
A0A134B8C7      GKSQVI---------------ALNVPVQLGE----------ERFIIEPRQNF--N-----
A0A4Z0EKR0      S-------GHMYSY-------HFGEQIQKPY----------GTFSIIAGGA---------
A0A521H707      ---------------------PVNTWITIPGLKFKITIKDYGQIKKQILATT--N-----
A0A7T9D909      GTG-----TAELSY-------TLDKEVDRTVMN--------GTRITTPHFTA--T-----
A0A1M6B6D5      NSKEKK--SLFVEAGDFSKDFKIGEPVNTPFFN--------GIFVPNPDVIS--K-----
A0A451FS66      TTKEKS--SLFIDTDVFSKDYKLGESISTPFFS--------GTFIPNEEVIS--N-----
A0A2E3GN39      YQGKSW-----------------------------------GGFLKPGKPYS--DENIYL
A0A3D1MEL0      YQGKSW-----------------------------------GGFLKPGKPYV--DENIYL
A0A519UDD1      ---------FIVRV-------RPDNAFDLDDYTGHITTHKFGQQIRKPYGTF--T-----
A0A7Y2ACP6      --------EGSFNI-------EQGGITS-------------GPHRFTEEIDL--GAVKIV
A0A2A4N9A6      IDK-KY--DNIYN---------------------------FGTWIRTEFADF--K----V
A0A6C0GGI1      VGG-ET--AYIYNI-------STNKTIGETTTPEINKIVNLGDPFKDEHLNF--K----I
A0A368D1N7      --------DYIYQ----------GKSWGGFLKP--------GKPYADENIYL--A----I
A0A3B8TU58      --------EYIYK----------GSTWGGHLKP--------GKPFIDENIFI--S----I
A0A1T5IIR6      AGS-QL-------V-------ALGDTVALGR----------GKVVFLPTARY--S-----
A0A3E0QD27      NVW-NKVPGLKFRM-------TVQNWAAIQK----------QEINLQDEAYY--F-----
A0A0K2HKS3      STD-AT--SITLTA-------NLGDTIQSPI----------GKIVVSPTLYY--T-----
B6W3W8          STD-AT--SITLTA-------NLGDTIQSPI----------GKIVVSPTLYY--T-----
A0A0M1W1I6      STD-AT--SITLTA-------NLGDTIQSPI----------GKIVVSPTLYY--T-----
A0A4R4GHU2      STD-AT--SITLTA-------NLGDTIQSPI----------GKIVVSPTLYY--T-----
I8WPR6          STD-AT--SITLTA-------NLGDTIQSPI----------GKIVVSPTLYY--T-----
A0A076IRY8      STD-AT--SITLTA-------NLGDTIQSPV----------GKIVVSPTLYY--T-----
A0A3A6AD54      STD-AT--SITLTA-------NLGDTIQSPV----------GKIVVSPTLYY--T-----
A0A8B3EPF6      STD-AT--SITLTA-------NLGDTIQSPV----------GKIVVSPTLYY--T-----
I8WPP8          STD-AT--SITLTA-------NLGDTIQSPV----------GKIVVSPTLYY--T-----
A0A372Y7D2      STD-AT--SITLTA-------NLGDTIQSPV----------GKIVVSPTLYY--T-----
A0A7K3KFI2      STD-AT--GITLTA-------NLGDTIQSPV----------GKIVVSPTLYY--T-----
A0A3E4JJC9      STD-AT--GITLTA-------NLGDTIQSPV----------GKIVVSPTLYY--T-----
A0A3E4WDQ0      STD-AT--GITLTA-------NLGDTIQSPV----------GKIVVSPTLYY--T-----
A0A414H9P2      STD-AT--GITLTA-------NLGDTIQSPV----------GKIVVSPTLYY--T-----
A0A7K0JKU9      STD-AT--GITLTA-------NLGDTIQSPV----------GKIVVSPTLYY--T-----
C3R5A8          STD-AT--GITLTA-------NLGDTIQSPV----------GKIVVSPTLYY--T-----
A0A6N8DCX3      KSSERDLESGTVTG-------TLNDTLQTPL----------GKIIPVPTPFY--S-----
F0R0C9          TRNGEKVE-GISEG-------KLNDTIASPV----------GKLLVEPTPYY--N-----
A0A1C5XJA7      SMA-EN--GERQVV-------ELNDTISLNE----------GKVVVVPTNYM--T-----
A0A285T4L1      TGI-PAANDKTYTM-------RLNDTLTIGS----------ERILITGTDRW--G-----
R7CUW4          SWM-EA--DSTCTV-------AMGDTVRVHG----------QRLVVTPTNYY--A-----
A0A416GGJ1      GDA-GK----TYKV-------QLRDTTAIGN----------FKIAVTPTNFL--N-----
D1JY72          STD-AT--SITLTA-------NLGDTIQSPI----------GKIVVSPTLYY--T-----
D7J4K6          GGLPAA--KDSYDV-------RLNDTLAVGG----------ERILVTGTDHW--G-----
Q8ABP9          GGLPAA--KDSYDV-------RLNDTLAVGG----------ERILVTGTDHW--G-----
D6D2Z5          GGLPAA--GESYEV-------RLNDTLAVGG----------ERILVTGTDHW--G-----
A0A1T3EDR4      QSK-KL--EKPFKL-------SLNKPTRLPF----------GELLVKGSPHY--G-----
A0A6N8KXI9      SKG-DP--SVRIKA-------KFNEEIQTPV----------GKMTLTANNNY--D-----
A0A174SDD8      SRG-ME--QRKV-V-------KLNDTIQTAL----------GKLVVFAAENY--G-----
A0A1H7RFH3      SRG-ME--QRKV-V-------NLNDTIHTAL----------GRLIVFAAENY--G-----
A0A139L1N2      SRG-ME--QRKV-V-------NLNDTIHTAL----------GRLIVFAAENY--G-----
A0A174TVL8      SRG-ME--QRKV-V-------NLNDTIHTAL----------GRLIVFAAENY--G-----
A0A1H8BJR6      SRG-ME--QRKV-V-------NLNDTIHTAL----------GRLIVFAAENY--G-----
R9H6G0          SRG-ME--QRKV-V-------NLNDTIHTAL----------GRLIVFAAENY--G-----
A0A412GR09      SRG-ME--QRKV-V-------NLNDTIHTAL----------GRLIVFAAENY--G-----
A0A7J5JXN6      SRG-ME--QRKV-V-------NLNDTIHTAL----------GRLIVFAAENY--G-----
R6D982          SRG-AE--SRKT-V-------NINDTVETAL----------GRLVVSATENY--D-----
A0A1F0I8C4      SKG-TE--LRRV-V-------NLNDTVHTAL----------GKLVVFAAENY--G-----
A0A3A5RIJ2      SKG-TE--LRRV-V-------NLNDTVHTAL----------GKLVVFAAENY--G-----
A0A515IZJ5      SKG-TE--LRRV-V-------NLNDTVHTAL----------GKLVVFAAENY--G-----
A0A7J4Y2H6      SKG-TE--LRRV-V-------NLNDTVHTAL----------GKLVVFAAENY--G-----
A0A4R6WE41      KDN-TD--RAPVRL-------AIGQAFRTPL----------GEIQLDSTSHY--L-----
A0A2T5RP38      NKN-VD--GQEVKV-------VLNQLTKTPF----------GEIIIVPSKYY--H-----
A0A1A6CF06      NET-SE---EELKI-------ELNRWVVTPA----------GKVFITPTKFY--N-----
A0A1T3D6S8      NET-SD---EELKI-------ELNRWVVTPV----------GKVFITPTKFY--S-----
A0A8B4GMS2      NET-SD---EELKI-------ELNRWVVTPV----------GKVFITPTKFY--S-----
A0A7Z7LUP7      NET-SD---EELKI-------ELNRWVVTPV----------GKVFITPTKFY--N-----
A0A0B8T471      VDG-DV--ENYTTI-------PIGKEIKTPF----------GNMVVDTTAKF--T-----
A0A4R7D2K0      VDG-DV--ESYTTI-------PIGKEIKTPF----------GNMVVDSTKHF--T-----
A0A7T9S3V1      NGA-AK--DKELKI-------ELDKEVNTPV----------GRIIITATKYF--N-----
A0A7T9LVI2      SNG-DR--AKELKI-------ELNKESNTPV----------GRIVVTAEKQF--T-----
C2FUH6          SNG-DR--AKELKI-------ELNKESNTPV----------GRIVVTAEKQF--T-----
A0A1V3N3U3      IAG-KE--QQEIRV-------PLNKTVNTTL----------GRLTVRPTKFY--K-----
A0A1P8E011      SEG-DA--ALEVDA-------TLDKPVNTPF----------GQVIVQSALKP--N-----
A0A7T9S8K4      SEG-DA--TLEVDA-------TLDKPVNTPF----------GQVIVQSALKL--N-----
A0A2X2J8S4      VGK-DK--EKVYIA-------PLNKAIKTSF----------GGIRILATPYY--T-----
A0A3C0S618      LGK-DK--EKVYIA-------PLNKAIKTSF----------GGIRILATPYY--T-----
A0A4P7DRF9      STN-KE--AKSIIV-------PLNQLVNTPV----------GKMIIQFNPNL--N-----
A0A239XXC4      SNS-DP--DKTITV-------KLNSEVKTPV----------GNLIISANSDK--S-----
A0A4U9K473      SND-EL--AKPIIV-------KLNAETKTPV----------GNVIISANPDK--K-----
A0A081PBV5      SKG-NT--SQVLKI-------KLNQTVRTPI----------GLLKVTRSPGY--K-----
A0A1I2AN85      SKG-NT--SQVLKI-------KLNQTVRTPI----------GLLKVTRSPGY--K-----
A0A4U0GMP3      SKG-DM--EQRFIV-------KFNEKVRTPV----------GVLAVRPTDAY--S-----
A0A0D5BSQ0      SNT-NK--NEEFKV-------VLNQSVVTPI----------GKVLIKPSKFY--K-----
A0A1T3F6P5      NPS-NK--DKEIKI-------ALGKLTSTPI----------GKLLINPSRYY--K-----
A0A853VUQ0      NPA-SK--DKEIKV-------ALNSLTSTPV----------GKVLITPSKYY--K-----
A0A7X0MJ00      SVG-DP--SKTILV-------KLNGYVKTPV----------GIVSISLRPNY--N-----
A0A841JHZ0      SVG-NP--AKTMMV-------NLNEQVNTPV----------GTLLISPTPNY--R-----
A0A1H6CKR6      SNQEEA--GKPLVV-------ALNQTVNTPI----------GKVIITPNPES--K-----
A0A7W3MGA7      SNT-DP--EKTVTV-------KLNAETKTPV----------GNLIISANSDK--K-----
A0A3M1Y2F5      ------------------------------------------------------------
A0A7V1ALN2      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A836SQI2      ------------------------------------------------------------
A0A7V1FAJ9      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
A0A848Y4B8      ------------------------------------------------------------
A0A7Y4V8Y1      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A847AMH6      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A7V1FAS7      ------------------------------------------------------------
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      --------------------NRLFFMIFNDNGAFQHHITD-NFFVWIYNY-----N--AN
A0A7C7CKY6      --------------------ENPYFFTFNNVHYVINHYQQ-SLDIRLLNQ-----A--AK
A0A1G1TG88      --------------------AAKYHFTIQDQGTVNAYLEK-NLAVDISSA-----D--AN
A0A661XXA6      --------------------GTEFYFIIRSHDALMDYIEA-NLSVEPVNV-----E--AN
A0A519SD85      ----------------------TIRFKYLSTPEFVNQIRK-SLKVDDSQA--------NN
A0A3M1TXY5      ----------------EVKKGQRFYFVIHGLKDLAERYQS-ALKVEAVSK-----E--AR
A0A7T9KM12      ----------------VIPKDAKYMFIPASNPDVAAYYRA-KTGTTPLGD-----E--SN
A0A2E0VQ27      ----------LKLKPNSLKPGDLFALKVNSEDALIGQYKSDKLFVKPVDK-----E--VS
A0A7Y7TYP1      ------------RENYSK-----FSFEFIDENSLIGVYKN-KFSFNIIDK-----K--AT
R6U429          ------------DQWKKP-----IVISWVNAKKLAKAYNK-SLSVSLSGK-----E--ST
A0A5C8AF42      ---------------KDESSDNELYFVFNSVESYAARLLP-SLQIVPVDP-----E--AK
A0A7Y5SYP1      -------------------------------------------------------A--LD
A0A7V1N701      -------------------------YTPPEGMTIETAILR-NLEYSFMKS--------SA
A0A7V2NIA8      -------------------------YQPVKRATIEKEIKK-ALDFSIQKN--------GS
A0A239K409      ------------PQKSPK--QKKIIVVFENINTLAKYYSD-WLKVEPINA-----K--AS
A0A1M3DPL8      ------------------NSAKDLYFKFRTKESLIGEFSS-KLALNFVMD-----G--SS
A0A1V5F519      ------------------VKEFEMYFRFRTRETLIEDFKS-RLSSRYVIE-----G--SS
A0A2G6R1T9      ------------------SNK-TMFFRFRTKTSLVNEFSG-LYPE--FIN-----K--SS
A0A350V3E4      --------------------------DPKSKNQIANVLSA-VTEISQKRG--------LD
A0A6J4K208      ------------LKKPGQFDAEGRFFVINSLADQAGQYQR-RLRVHPLGE-----G--SR
A0A2W4RDE8      ----------------KLEPDSKMFFRINNQVSLAERYRN-QLNIEPISK-----E--SN
A0A212J9Z9      ------------VKGAFKPDISTFNFRFLSEAQLIGMYSG-RIGSALQ-N-----N--SS
F5IV23          ------------VKGAFKPDISTFNFRFLSEGQLIGMYSG-RIGSDLQ-N-----N--SS
A0A1M5DFS8      ------------F--------TPFSFRFISKEELIGRYTG-RTSSGYQRE-----G--SS
A0A4Y8KZS5      ------------F--------TPFSFRFISKEELIGRYTG-RTSSGYQRE-----G--ST
A0A2V3PNY7      ------------F--------EPFSFRFVSKEELIGRYSG-RISSGLVRD-----G--ST
A0A6G7X5K8      ------------F--------EPFSFRFVSKEELIGRYSG-RISTGMIRE-----G--ST
A0A840CJ33      ------------LN-EFKPDISSFSFTFLSKNTLIGMFSG-RIDSRLQAS-----N--ST
F8X2T0          ------------F--------LPFSFRFFTNSQLTGMFSG-RVSTALKTE-----N--ST
A0A1M3LAG1      ------------F--------LPFSFRFFTNSQLTGMYSG-RVSTALKTE-----N--ST
A0A212K6G4      ------------F--------LPFSFRFFTNSQLTGMYSG-RVSTALKTE-----N--ST
A0A4Y9IPG7      ------------F--------LPFSFRFFTNSQLTGMYSG-RVSTALKTE-----N--ST
A0A0L8VEV2      ------------PKYAKRGNQ--YYFTFNNFENQVKKYMN-RLVIEEPED-----K--AD
A0A1I2A9Z9      ------------PKNVKRGET--YFFTFNNFEGLVRNYSG-RLMIEETEE-----Q--AD
A0A848XXC6      --------------------SFQNDLSGQASMQTVADYLQ-EEVVRVEPA-----GEEVD
A0A2P8CDS1      --------------------EGNYRVVFHSLDELTADYLN-RLTVAPISK-----E--GT
A0A660LQT8      ----------------DVVEHQPIHVLRTTMRKAIEHY-N-NVEITLADK-----G--AE
A0A3D0FMX4      --------------------KTTIYFRFRSQESLVADFSS-RLTLNFVAE-----G--SS
A0A7V6G854      --------------------QTSFFFRFRTINSLESEFAG-RLALNYVGD-----Q--SS
A0A1M3MEI8      --------------------KKEVYFRFRSRESLISDFSG-RLRLNFVME-----G--SS
A0A1J5HQM0      --------------------ERELYFQFRSRESLISDFAS-RLTFNFVQE-----G--SS
E4T131          --------------------NTEMYFKFRTKESLVNDFIS-RFSTSYVTE-----G--SS
A0A653AC35      --------------------EYDTYFIFRTRESLIGDFMS-RLNVNYVSD-----G--SS
A0A847LA02      --------------------NRNIYIRFRDKRSLINDFMS-RLKPEYVVK-----G--SS
A0A389LWV6      ----------------PHTVKYELNFNFLSRGQQIADYNN-RLNCSFLLD-----G--AS
A0A1G9B1T9      ------------QEPLDTLSQ--YSFMIHPLERVTEQYQK-KLVVAPFEE-----G--SD
A0A350PNH9      ------------SAFINGHESRKLHVTRTNLYAMTNHIKA-SLSASISEE-----K--AT
A0A354LNT9      ------------SAFINGHESRKLHVTRTNLYAMTDHIKA-SLSASISEE-----K--AT
A0A161LWY6      ------------------EPRKKINFAFLSNAYLIDYFTP-RISLSFVTQ-----N--ST
A0A6I3N9U6      ------------------EPRKKINFAFLSNAYLIDYFTP-RISLSFVTQ-----N--ST
A0A353WYK7      ---------------RKDNDNVHYFFKINSPQSNIRYLMD-NTEVKPLDF-----K--AK
A0A2W7RD29      -----------------------FLFKIRNEESLISEFSG-NLAIYPATT-----G--GS
A0A3N2NDY8      ----------TAPKGKKNKPVTEIIVERDGMQSTVETYGG-LVKADLADK-----D--AD
D7JEV9          -------------RDVDK-----VHFRFRHRQELIAEFSS-KLAIQLIPN--------TS
A0A553GA49      ------------NI--DKLVGKKLFFVIKSNRQVVDESKD-NLKIEATQL-----D--AT
A0A7V5GTN5      -------------------------------DSIEKVVRQ-DVTYKRKAR-----T--NS
A0A497D6F6      ---------------RNKIETATYKFRFNIRSDLLKQYKN-DLSVNMLSQ-----E--TS
F4KR18          ------------PI----SSDSSMYVSFQDTKGLARNYQH-NLSVELSDE-----KNHSS
B5CTK0          ------------GK----GEFSPLIVRKVNLKSIANSFAA-RLTIAQALA-----G--ST
A0A5M4AAB9      ------------PL------QGRYRINFNSLNELTNEYLE-KLTVYQVSL-----K--SS
A0A5R9QZP0      ------------YKGTQASKTKAHFFEFNHLDVISRRYLR-KLAIAPVNI-----R--ST
A0A7X6SRJ5      ------------LS-TELENDDTDYFVFYHIDQLTKSYLG-RLTVEPVSI-----R--SS
A0A3D3HL11      ------------YN-PKLSGETDYYFEFYHLDQLTRTYLR-RLKVEPVSI-----R--SS
A0A6L8U6G9      ------------YN-QQLAKETEFSFVFYHLDQLTKSYLK-RLKVEPVSI-----R--SS
A0A6L8UH35      ------------VS-NPTQNKHKYFIKFNHLDYLAKRYLK-SMDIHRISP-----L--AS
A0A7X9F2J5      ------------FL-NPASKKFKYFIQFNHMDYLAKGYLK-SLDIQRISP-----L--AS
A0A352ME00      ------------PL-KKTEDKSRYYFKFNHLDYLAKGYLK-QLEIEKASP-----L--AS
A0A7X8CRA6      ------------IP-VNPKVRYNYYFVLNHLDFLAKNYLK-NLEIEKASP-----L--AS
A0A1F3D6P8      ------------YT-RETNMEDFYYFSFFHLDYLTKDYLK-KLEVEPISP-----K--TS
A0A356Z058      ------------YT-RETNMEDFYYFSFFHLDYLTKDYLK-KLEVEPISP-----K--TS
A0A7X8FHL3      ------------PR-QDQA-EYSYYFKLNHLDLLSKQYLK-KLEIEKASP-----L--AS
A0A3D1BT36      ------------LN-QRPVDEERSFFMMNHIDIITEQYLN-RLTVESVSL-----K--ST
A0A7X7CXW9      ------------YN-PQTAKETDFFFEFYHLDQLTKSYLK-RLKVEPVSI-----R--SS
A0A4R6H3B7      ------------PKNVKRGET--YFFTFNNFEGSVRSYLE-RLMIEETEE-----K--AD
A0A229I3A5      ------------TQFVSGEDESVLYVSRSNVYAMTDRIKG-SLSASLSDV-----K--ST
A0A3R6HJB3      ------------TQFVSGEDEPVLYVSRSNVYAMTDRIKG-SLSASLSDV-----K--ST
R6NN15          ------------VDWQKSSEP--LTVSRSGLNSAVSRYSA-GLSVALQSE-----K--TT
A0A2W7QSQ0      ------------DDFATEMGN--VLVELVNPQVAAENYSR-VLEFQNPSV-----K--SS
A0A841MQL4      ------------NDFSEEISE--IFVDIVNPQVAAGNYSQ-AMEFENPSI-----K--SS
A0A3P1Z8V4      ------------RFPKGT--P--IVVHHYSNEIAARIYKK-ALTAAEYSK-----E--SS
A0A1M6MYT6      ------------NPESDN--E--FKFRFHSPQELIRQYQN-QLEVALKSD-----E--TT
A0A1V5S1J9      -----------------F--N--ICFKLLNPENLAITYSA-KLSFDFLMT-----G--AS
A0A7X8JMH1      -----------------F--Q--LYFGFRDLDKLACMLHD-RLTFAFKME-----G--SS
A0A3D5KRY6      ------------APQEDE--E--YVLIFNDLSRMALAYKE-KLVVKALSAIDPTIN--SN
R7F6L5          ------------SDYVDK--T--IHYSHVPVRPVAESIVG-GLKATYEAK-----E--GT
A0A7C5MRV2      ------------------------RWQAIKWKSLVGRALG-GLKVEQSGY-----L--VP
A0A0A2EYC8      ---------------SAN--S--VNFVFRNRDNLVMEFAS-KLQINLL-P-----N--TS
A0A2G6H6Y4      ---------------EIP--Q--FYFRFRTRMSLIQEFVG-RLEVAPI-D-----K--TS
C9LKL0          ------------EFSKGK--V--ITVDYIPADLAARRYQG-EISATVQDQ-----E--SS
A0A3D0QPV7      ------------AIQSEN--K--LYFVFNHPDQLLTQYFP-AINVQVLNA-----S--AK
A0A496KT23      ------------RRGMTD--E--YKVTRSPISAVAAVVRG-SFNIALSNK-----A--ST
L1M9T3          ------------RKGMTD--E--YDIKRSSISTTAAIVRS-RFDVQLSDK-----A--ST
A0A2M6GH67      ------------PFVLEQ--N--YHFVINSDGALNNYFRS-NLAVEIINP-----S--AN
A0A7K1TE30      ------------TNTPDA--K--FHFTIQDDNTIERYLNL-NLTVEVVNP-----N--AN
A0A7D4BE70      ------------GTSTEA--N--YHFTILDDNTINAYLDQ-NLTAEILNA-----N--AN
A0A142HHS5      ------------PAELDA--I--YHFVIVDDNTINSYLDH-NLKAEVLNP-----I--AN
A0A7D4C435      ------------PAFSEA--N--YHFTILDDNTINNYLDR-NLMADVLNV-----S--AN
A0A3C0I8F1      ---------------ISK--N--YYFIINSRYALLSYLQS-KLKVDIINH-----N--AG
R5JJI4          ------------DTYYGK--P--VYITKSNMEKVVEGYLR-RINISLASK-----T--AT
A0A848IUK4      ------------KGEGFD--D--YSFIINSRESQIGYIQN-SLKVEAQSL-----A--AN
A0A136LSC7      ------------ENDG-N--N--YYFVLNSRKSLIEYLSK-NIQVDPLNF-----N--AN
A0A5C7N8Q5      ------------ENDG-N--N--YFFVLNSRKTLIDYLSK-NIQVDPLNF-----N--AN
A0A355BP94      ------------PDFK-N--H--FFFVMNSRNRLLDFLSS-NLRIEPINF-----D--AN
A0A7Y5D1K7      ------------PDFK-N--H--FFFIINSREKLVEFLTD-NLKIEPLNF-----D--AN
A0A3D2HF71      -----------------------YYFYFVSPQSLANIYRS-KLSVSPVEE-----E--AS
A0A0A2DQN2      ------------SPWIAR--Q--IQVSRVPVPALAVAYQG-SLSIGQPEG-----R--AT
A0A0A2F2N5      ------------EPWPNK--A--IKITRLPVKDLAASYQG-RLFIGQPEN-----R--AT
L1NGW4          ------------SPWEHK--T--INVIRHPLVGTARYYQN-AVAISQPQE-----K--SS
Z4WRA0          ------------SPWEHK--T--INVIRHPLVGTARYYQN-AVAISQPQE-----K--SS
U2K8K9          ------------APWAYS--E--IQVSRIPFVDAVRFYQH-SVAITQPEA-----Q--TS
A0A069ZM60      ------------TPWEYK--H--IEVNRMPFTQTVRYYQH-AILVAEPEN-----R--AS
J6GV98          ------------TPWEYK--H--IEVNRMPFTQMVRYYQH-AILVAEPEN-----R--AS
A0A134B4F8      ------------APWEHK--H--IEVTRMPFTQTVRYYQH-AIMVAEPEN-----R--AS
A0A134B8C7      ------------APWEHK--H--IEVTRMPFTQTVRYYQH-AIMVAEPEN-----R--AS
A0A4Z0EKR0      ------------NKWLGT--K--IIVQFQDINQVANYYNS-AIGIAPVNT-----R--AS
A0A521H707      ----------------DE--P--YYIIFYNPETVIDQYYA-DATVTVMNQ-----Y--AQ
A0A7T9D909      --VRLDGPGLDAKLAAGD--Q--LYLKVNNAQSLAGKLAG-QVGVRIVDP-----H--AK
A0A1M6B6D5      ---------------MGT--P--YYLVFSEYDATVKRYL--DINIAPLSS-----G--SS
A0A451FS66      ---------------PGT--P--YYFIFQDYDTTVKNYL--NTKVTPESK-----G--SS
A0A2E3GN39      AISNLDQKLLEGSAESQK--S--ILFKVYTDEQLSNELMA-ITSIEP-NK-----E--TF
A0A3D1MEL0      DISNLDQKLLDESAENQK--S--ILFKVYTDEQLSNELMA-ITSIEP-NK-----E--TF
A0A519UDD1      ------VIATGLQNMPAT--K--IIVRFQDILKVADYYNK-AIGVQPINK-----N--AS
A0A7Y2ACP6      VLLDRGIATDEILN--RN--S--YYFTLPSTDAQIKEFSR-QLGVSVLNP-----T--AK
A0A2A4N9A6      SLKESDAIITDSKS--NI--Y--YFLINNLDEQARFKFAP-AIQTLITNL-----S--AR
A0A6C0GGI1      --FLNPYYETYLTK--GK--K--FFFIINNIGNLTKGYQA-KISAKPISR-----D--SR
A0A368D1N7      SNLDQKLLEGNAEN--QK--S--ILFKVYTDEQLSNELMA-ITSIEP-NK-----E--TF
A0A3B8TU58      SNFDESLLTDEFEG--EK--N--IFFNVYDNNRLADEMLS-NIKIEP-NK-----E--TF
A0A1T5IIR6      ------------PDQYGQ--S--IRIQKIPVNWAAQAYIS-RLSIAH--------D--KQ
A0A3E0QD27      --------------------------IINNSTTLVERYFK-NLTVVLMNQ-----V--AQ
A0A0K2HKS3      ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
B6W3W8          ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
A0A0M1W1I6      ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
A0A4R4GHU2      ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
I8WPR6          ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
A0A076IRY8      ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
A0A3A6AD54      ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
A0A8B3EPF6      ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
I8WPP8          ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
A0A372Y7D2      ------------DKWFNT--P--ITIRRQSTDIMASLFRS-NLNISQAEN-----D--AS
A0A7K3KFI2      ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
A0A3E4JJC9      ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
A0A3E4WDQ0      ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
A0A414H9P2      ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
A0A7K0JKU9      ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
C3R5A8          ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
A0A6N8DCX3      ------------ATEKYP--L--IHLSRTNLYDCVDGCIE-NLEAELSSE-----D--AT
F0R0C9          ------------IGFHEP-----VYVSRSSLHGATGAYSS-RLSVVLSDE-----K--ST
A0A1C5XJA7      ------------ESWIGV--P--VKVSKMPLDAVVSVYRN-SIAVKQEEE-----E--SS
A0A285T4L1      ------------QAWTER--D--IRVSKNPLNAVAGRFQG-SMGIRQEED-----E--SS
R7CUW4          ------------ASWTDV--P--IRVQKRPLESVVNRYKG-ALGIQQEEE-----E--SS
A0A416GGJ1      ------------KSWIGQ--E--ITVRKNPLESVVSYYSG-NFAIRQEED-----E--SS
D1JY72          ------------DKWFNT--P--ITIRRQSTDTMASLFRS-NLNISQAEN-----D--AS
D7J4K6          ------------KSWTGR--E--IHVVKNPLNAVAGRLQG-SMGIRQEED-----E--SS
Q8ABP9          ------------KSWTGR--E--IHVVKNPLNAVAGRLQG-SMGIRQEED-----E--SS
D6D2Z5          ------------KSWTGR--E--IHVVKNPLNAVAGRLQG-SMGIRQEED-----E--SS
A0A1T3EDR4      ------------TPYYGK--S--IRVEKLPLERSVVYFLG-QLKIKHLGE-----D--TS
A0A6N8KXI9      ------------EYFFGE--E--ILIKKIPLEAMAAYFLS-NMTIQQLQD-----D--AN
A0A174SDD8      ------------ESCFGK--P--IVVTCKPLEEMVSFWLN-NLSIRQMSG-----D--AA
A0A1H7RFH3      ------------ESSFGK--P--VLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AA
A0A139L1N2      ------------ESSFGK--P--VLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AA
A0A174TVL8      ------------ESSFGK--P--VLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AA
A0A1H8BJR6      ------------ESSFGK--P--VLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AA
R9H6G0          ------------ESSFGK--P--VLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AA
A0A412GR09      ------------ESSFGK--P--VLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AA
A0A7J5JXN6      ------------ESSFGK--P--VLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AA
R6D982          ------------SSCWGK--P--VKVSKQAREKMVYFFLS-NLSIKQVNG-----D--VA
A0A1F0I8C4      ------------GDWMER--A--VKVISHPQEDMVSFWLS-NLTIRQMSG-----D--AA
A0A3A5RIJ2      ------------GDWMER--A--VKVISHPQEDMVSFWLS-NLTIRQMSG-----D--AA
A0A515IZJ5      ------------GDWMER--A--VKVISHPQEDMVSFWLS-NLTIRQMSG-----D--AA
A0A7J4Y2H6      ------------GDWMER--A--VKVISHPQEDMVSFWLS-NLTIRQMSG-----D--AA
A0A4R6WE41      ------------PGSFGK--S--IRVEKFAREYMVNFFLS-NLKIKQMED-----D--AF
A0A2T5RP38      ------------KDNYGE--S--ILVTKYPREEMMLGLMG-NLKVKQMEE-----D--AS
A0A1A6CF06      ------------KDYYGK--D--IQVTKSPREAVMGYFIA-NLKIKQMDE-----D--TS
A0A1T3D6S8      ------------KDYYGK--D--IQVTKLPREAVMGYFIA-NLKIKQMDE-----D--TS
A0A8B4GMS2      ------------KDYYGK--D--IQVTKLPREAVMGYFIA-NLKIKQMDE-----D--TS
A0A7Z7LUP7      ------------KDYYGK--D--IQVTKLPREAVMGYFIA-NLKIKQMDE-----D--TS
A0A0B8T471      ------------SSYYGE--Q--VTVSKNAMESMVGYFLS-RMRIEQMED-----D--AS
A0A4R7D2K0      ------------PSYYGE--Q--VTVSKNAMESVVGYFLS-RMRIEQMED-----D--AS
A0A7T9S3V1      ------------SSALGE--D--IQVNKYTREAIVGMIMG-NLKIQQMEE-----D--AS
A0A7T9LVI2      ------------ASTVGE--D--IQVTKYAHEAMVGYIMG-NLKIQQMEE-----D--AS
C2FUH6          ------------ASTVGE--D--IQVTKYAHEAMVGYIMG-NLKIQQMEE-----D--AS
A0A1V3N3U3      ------------AGVFGE--E--IQVRKYDREDIVGYFLG-NLKITQLEE-----D--AS
A0A1P8E011      ------------KALPQQ--E--VKVEKFALEGMVNYFIS-TISITQMEE-----D--AS
A0A7T9S8K4      ------------KALTQQ--E--IRVEKFALEGMVNYFIS-TISITQMEE-----D--AS
A0A2X2J8S4      ------------KAAYDQ--E--ISVNKLSSIDMANALLG-RLSITQTTD-----D--AS
A0A3C0S618      ------------KAAYDQ--E--ISVNKLSSIDMANALLG-RLSITQTTD-----D--AS
A0A4P7DRF9      -----------YRKSSDE--Q--ITITKSPIDAMVGYFLG-KLQIRQ-LE-----D--VE
A0A239XXC4      -----------YRVNLSE--Q--ITITKNPIESMVSYFLG-NLKILQ-ME-----D--VE
A0A4U9K473      -----------YRVNLTE--D--ITITKTPINAMVGYFLG-NLKITQ-ME-----D--VE
A0A081PBV5      ------------VSDFDK--P--VIVRKYPREAMVGYYMA-NLKIQQMEE-----D--AS
A0A1I2AN85      ------------VSDFDK--P--VIVRKYPREAMVGYYMA-NLKIQQMEE-----D--AS
A0A4U0GMP3      ------------LAAFTN--E--IRVSKNPREAMVGYFMG-RMNIRQMED-----D--AA
A0A0D5BSQ0      ------------KDYYGT--E--IQVTKSPRESMTGYFVG-NLVVKQMEE-----D--TS
A0A1T3F6P5      ------------KDYYGV--E--IQVVKSPRESVMGNFVG-NLSIKQMEE-----E--AS
A0A853VUQ0      ------------KDYYGV--E--IQVTKFPREAVMGNFVG-NLSIKQMEE-----E--AS
A0A7X0MJ00      ------------KAILVN--S--VLVTKSPLKAVVGYFLS-NLTIVQL-E-----D--AA
A0A841JHZ0      ------------REMLGK--P--IVVTKNPLEAMVGYFLG-NLTITQM-E-----D--AA
A0A1H6CKR6      -----------YRVNVSE--P--IQVSKTPIDAMVGYFLS-NLEIVQM-E-----D--VA
A0A7W3MGA7      -----------FRVNLSE--D--ITITKSPIESMVGYFLG-NLDIVQM-E-----D--VE
A0A3M1Y2F5      ------------------------------------------------------------
A0A7V1ALN2      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          -----------------------------------------GLQATLASK-----T--AT
A0A4Q3SEI4      -----------------------------------------NIRATPAGK-----L--ST
A0A836SQI2      -----------------------------------------KLNIVIENQ-----L--AR
A0A7V1FAJ9      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      -----------------------------------------DLSEAPHLT-----L--SD
A0A519TAP8      -----------------------------------------NLDVTVVNP-----S--AN
A0A848Y4B8      ------------------------------------------------------------
A0A7Y4V8Y1      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      -----------------------------------------MKNTNAAIS----------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A847AMH6      -------------------------------------------NVKAAML----------
A0A7C3PTI0      ------------------------------------------------------------
A0A7V1FAS7      ------------------------------------------------------------
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      MIALKYVSSVPEKTADIVNHVSEDFLGYNIEKKQEHAQNVLAFIEEQLTIVY-EGLNQAE
A0A7C7CKY6      TIEVTLRDKNSKKASDIVNAIAEEFINYDILKKAKSANKVLTFIDDQLGIVY-DKLRTSE
A0A1G1TG88      TIQISFTDFNPRKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNY-DNLERAE
A0A661XXA6      IFKVSFKDYNVNKAHALISAIDTLYYKYSLNEKNRANKNKIEYLNTQLTETE-NKLDDFE
A0A519SD85      ILSLRYSNSNIYLSADILNAILASYLKFDKDQREISLTQTSKFITSLSDQLS-LKTIASS
A0A3M1TXY5      LLNITSEGPVVSMQNQFINTLLNTYIQNDLEKQREIGRKMLMLIDEQLTGVT-DSLRKAE
A0A7T9KM12      IITITTTGQDTKKEKDFVNTLMQTYIKSEQDKQNEKGKKTIAFIDSQLDKST-QNLETAE
A0A2E0VQ27      IIKVYFNHELPEKAQTFVNTLMKTYIEEGRKSREQQVAETLEYLEKQLEVVK-KRLGDAE
A0A7Y7TYP1      VIEISALSESTQKGIDLVNELMNVYSTENLNRKNHIASITIDYIEKQLGEIS-DSLNLTE
R6U429          VLVLTLTDRFPSRADNILSTLIDVYNEQWVEDKNRSARNTTAFINDRLVVIE-KELGGVE
A0A5C8AF42      TIQITFQGNNPQLCHDISLAVAEAFIEYDEEVKRKGSENILQFIDQQLDSLA-GELKSSK
A0A7Y5SYP1      IINISFMSSDPEEAAIIANILANVYIVNDLTNNRTTQSIVKNFIKTQLDEKA-QDLRKSE
A0A7V1N701      FADIIARETDAKRARLMVKSALETLIERSRLIHREELRSTTDFLDTQLAVMT-KNMEDVE
A0A7V2NIA8      FLDITAELPDPTATYELVKHAVDVFQARSASLQVQDLNNTIVFLDQQLALLS-EEMGFVE
A0A239K409      VLNISITDPVPERGRDVINKLMQDYREEELEGKNLIAASTIKLIDDRLNGLS-AELIEIE
A0A1M3DPL8      VLEISMVSETPRRDVDFINKLCDIYLMSNLERKNDAATKTIQFIDEQLENVS-KSLATSE
A0A1V5F519      ILEISLISETPDRDVDFINKLSEIYLEENLKKKNDVASKTIQFINEQLSEVS-KSLSVSE
A0A2G6R1T9      VLSISLQSPTPQRDVDFINKLFEVYLANNLERKNEQARKTIKFIDEQLTGIK-QTLKGSE
A0A350V3E4      IVSIKTESPSPQEAALISNCYAEAYADYSMKFNRGHLTLNREFLEKQVQEKY-NSLLQTE
A0A6J4K208      TLRLSIRGTLPDKEAAFLNGLLRVHLREGQERQHRQHRDVIAWIDRQLGLDGGDAAEAPE
A0A2W4RDE8      IVQLTIEQAVPQKGVDFINAVMRVYLDNELYKKNQLGLRTIAFIDEQLMGVS-DSLRRVE
A0A212J9Z9      ILSISMSGTNPAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLIN-DSLDISR
F5IV23          ILSISMSGTNPAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLIN-DSLDISR
A0A1M5DFS8      ALAISIYGTSPAQDVDFLKALLKEFEEYNLTLKNEAADRTIAFIDRQMTLIS-DSLEQSE
A0A4Y8KZS5      ALAVSIFGTSPLQDVDFLRALLKEFEDYNLTLKNEAADRTIAFIDRQMALIS-DSLQQSE
A0A2V3PNY7      ALGISIFGSSPAQDVDFLRALLQEFEEYNLTLKNEAADRTIAFIDKQMGIIA-DSLQQSE
A0A6G7X5K8      ALGVSIYGSSPAQDVDFLRALLKEFEDYNLTLKNEAADRTIAFIDRQMGIIA-DSLQQSE
A0A840CJ33      ILNISMAGPNPDRDIDYLNILLDEFLDYNLALKNEQAERTITFLDNQLKLIN-DSLDISR
F8X2T0          ALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVIN-DSLNISR
A0A1M3LAG1      ALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVIN-DSLNISR
A0A212K6G4      ALTVSMYGTDPAKDMDYLKALLDKFQDYNLALKNQQADLTIKFLDAQITVIN-DSLNISR
A0A4Y9IPG7      ALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVIN-DSLNISR
A0A0L8VEV2      LIYLSLIDQVPQKGADYLNELSRVYLAYELREKNHTSATTIDFIDSQLKDVI-DTLQVAG
A0A1I2A9Z9      LIRLSMVDEVPQKAADYLNELSRVYLTYELREKNHASATTIDFIDSQLKDVI-DTLKVAG
A0A848XXC6      AIRVTATSSDPEEAARIAQVYTTEYADLTRETSRERITATRMFLEEQVARRQ-GELDEIE
A0A2P8CDS1      IVKLSTTCENPQKGIDFLNEMMQVYQTHNLDKKNIIATKTIFFITSQLANVS-DSLSASQ
A0A660LQT8      ILNMSFNDVSQERAEDVLRMLIDAYNEAWLADKNQIAVNTSKFINERLQVIE-NELGNVD
A0A3D0FMX4      VLTIQLVSETPERDKEFIDKLCDIYLLQSLERKNKVAESTIQFIDQQLDTIR-KSLASSE
A0A7V6G854      VIALSLVGNDVERDKVFLDALSEEFLANNLEKKNSEAIRTIDFINDQLGYLL-DSLNFSE
A0A1M3MEI8      VLEISLASATPARDVDFINKLCEVYLISNLERKNDAASKTITFIDKQLESVA-EELSMSE
A0A1J5HQM0      VLEIAMNSETPERDIDYINKHVTMSLLQNLERKNDAANKTINFIDEQLQNVS-KSLTVSQ
E4T131          VLRINFVSDTPDRDIDFINKLCETFLADNLSRKNDAANKTIQFIDEQLKGVS-KSLTTSE
A0A653AC35      VLAVSLVSPTPQRDIDFLNKLSELFLAENLERKNDAANKTMRFIDEQLSDVK-KSLEASE
A0A847LA02      VLSVSLQSETPDRDIDFINKLFDVFRTENLERKNDAASKTINFIDDQLNLVS-QSLAVSE
A0A389LWV6      VMEISLVGKVTQRDIDFLKILNQEFFDDNLKRKNATAERAIEFINEQLLILK-DSISSAE
A0A1G9B1T9      ILVLTTTGEIVEKELMFLNSLMETYIEDEVKNKNLLGLRTINFIDKQIATVA-DSLSQVE
A0A350PNH9      VIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIE-RELGDVD
A0A354LNT9      VIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIE-RELGDVD
A0A161LWY6      VLAVSLVGTVYQRDIDFLNALCDEFLLDNLNRKNEEANRTISFIDKQLSDIS-DSLRTSE
A0A6I3N9U6      VLAVSLVGTVYQRDIDFLNALCDEFLLDNLNRKNEEANRTISFIDKQLSDIS-DSLKTSE
A0A353WYK7      TISVTFKDFNKYKAQDILMAIDTLYIYYTQLEKNRVNDQKIKFLNEQLHQTE-STLSELE
A0A2W7RD29      ILDIRLITNNPAKGEDFLNQLMNNYLFIELDDKNSIATNTINFISNQIQNVS-DTLGVIE
A0A3N2NDY8      VIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIE-RELGNVD
D7JEV9          VLNISVLSDNPLRDVDFLTRHAQSFLDDNLDKKNYEADKTIQFINDQLGIIS-DSLSRSE
A0A553GA49      AISINLVSTNFNMGKEFLDKYIETVIEYDLQRKNHIAFSTIDFIDDHLSDVF-DSLSIAE
A0A7V5GTN5      FLDLKAESNSPEFAKFLAEAAVASFEDLSVKLRRSDAQLVAEFIETQLSKLN-DKLSQRE
A0A497D6F6      IIELSLKTLNVAKGIDFLNTLVAVYQAYTLERKNENASRTINFISTQLQTVS-DSLGISE
F4KR18          VLILGLRDVVPQRGIDIVNRLVDKFNQLKSEVNTEITLKTLELIDGRLANIS-AELASAE
B5CTK0          MLNLSIIDSSVARADDVLNTLIAVYNEDLINDKNQIAINTSNFISERLNIIE-KELGNVD
A0A5M4AAB9      ILKLKTTCENTEKGIAFLDMLMRVYQEHNLKKKNTIATKTIFFITSQLSEVR-DSLKASQ
A0A5R9QZP0      LININFKGENLDLTVDFLNNYLQTYLNDNLSKKNNVAFNTINFIDAQISDIS-DSLVKSE
A0A7X6SRJ5      LINVRFQGENIRLTIDFLNKYLQTYLDENLSKKNRIAQNTITFIESQISDIS-DSLVTSE
A0A3D3HL11      LINVLFHGENRRLTIDFLNKFIQSYLDENLAKKNKIAINTIDFIDSQISEIS-DSLTQSE
A0A6L8U6G9      LINLLFTGENRRLTIDFLNNFIQAYLDDNLSKKNKIALNTIDFIDSQISEIS-DSLTISE
A0A6L8UH35      IINIKFTDNNLEKTIKFLNQYLNSFLDDNLGKKNKIALSTVNFIDSQISEIS-DSLNISE
A0A7X9F2J5      IINIKFTENNLEKTIKFLNQYLNSFLDDNLSKKNKIALSTVNFIDSQISEIS-DSLNISE
A0A352ME00      IINVRFSENNLDKTINFLNRYLSTFLEGNLAKKNNMASKTVNFIDSQVSDMA-DSLVRSE
A0A7X8CRA6      IINIKFSESNLDKTITFLNRFLNTFLERNLEKKNYLARSTVRFIDSQISEIS-DSLVQSE
A0A1F3D6P8      LIILKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEIS-DSLVISE
A0A356Z058      LIILKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEIS-DSLVISE
A0A7X8FHL3      IINVTFAENNLDKTITFLNRYLNTFLDENLTKKNNMAAKTVSFIDSQISDIS-DSLVISE
A0A3D1BT36      LINVFFQGENLDLTVDFLNTFLQTYLDNNLSKKNTIALNTVNFIDSQISEIS-ESLSSSQ
A0A7X7CXW9      LINLLFSGENKRLTIDFLNSFIKAYLDDNLSKKNKIADNTVKFIDSQISEIS-DSLSVSE
A0A4R6H3B7      LIRLSMVDEVPQKAADYLNELSSVYLTYELREKNHASATTIDFIDSQLKDVI-DTLKVAG
A0A229I3A5      VIDLTYKDVLAKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIE-RELGDVD
A0A3R6HJB3      VIDLTYKDVLAKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIE-RVLGDVD
R6NN15          IVDLTFKDVCIQRAEDILNTVIAVYNENWIKDKNQIAVSTSMFINDRLGVIE-SELGHVD
A0A2W7QSQ0      TLYIRLYDTSPEMGKQIMSSVIEGYNQRIINQKNETALKTINFINERLGIVK-NDLEEFE
A0A841MQL4      TLYIRMLDSSPEMGKRILTSVIDGYNQRILDQKNESSLKTINFINDRLGVVK-EDLEGFE
A0A3P1Z8V4      LLLLTCTDINKHRAEDVLNEVCNIYKKDIVDNKNRVAQRTAEFIDERLTLIS-RELSDVE
A0A1M6MYT6      ILDLTLRDRNVRKGMAFLNKLTEVYQLDNLEKKNENANRTIQFINSQLASIS-DSLSVSE
A0A1V5S1J9      VVQASISGTVPERDCDFLNGLCEEFLADNLARKNDAAIKTIEFIDEQLSTIA-DSLRISE
A0A7X8JMH1      VLEVSITGNVHERDCDFLNALCDAFLAEGLARKNDAAIKTIEFIDSQMITIS-DSLRVSE
A0A3D5KRY6      MITLELKTNQLERDVDFLDQLSKMYIQYGLEKKNRKASNTITFIDNQIAGVN-YSLQSAG
R7F6L5          LIALSYTSTSPYRCEDVLNGVVQAYNDQWINDKKAIADATSDFISERLSVIE-QELGNVD
A0A7C5MRV2      ILKVSQIDFVAKFASDFLNTLMKVYEKEDISRKQQAATQALDFIAEQLDTIK-SSVNSAE
A0A0A2EYC8      VLNISVASDNPIRDVDFLSKHAKSFLDDNLDKKNYEADKTIQFINDQLSVIS-DSLSRSE
A0A2G6H6Y4      VLNLSLASNNPARDIDFLNQHSKSFLSNNLDRKNSEAEKTIHFINDQLSNVS-DSLSRSE
C9LKL0          LIVLTCQDINIARATDIINTLFSCYKQDVVDNKNRVGQNTAHFIDERLSLIG-SELAGVE
A0A3D0QPV7      TLQISMRDHNKAIAHDIVYAITHAFNEFALERKNESSKKILDFIDSQIDTVY-TKLKNSE
A0A496KT23      IIDIQYSDVNTARAKDAIDMLISVYNENWVRDRNQISVSTNEFIKERLAVIQ-RELGSVD
L1M9T3          IIDIRYSDVNTARAKDAIDMLISVYNENWVKDRNQISVSTNEFIKERLSVIQ-RELGNVD
A0A2M6GH67      TISISFTDFNPRKAQDIINRVDSAYLVQKLLVKNQATQQQLKFLDEQIQATK-DDVTRYE
A0A7K1TE30      TIQISFTDNNRLKAKRIVDVLDSVYLDAKLARKQESTDKALAYLDEQLDENG-LRLEKAE
A0A7D4BE70      TIQISFLDNNRVKAQRLVNALDTVYRDAKLARKQESTEKALAYLDQQLEENG-RNLAKAE
A0A142HHS5      TIQISFLDNNRFKAQRIVNALDTVYRDVKLAYKQETTENSLAYLDKQLEENG-QNLAKAE
A0A7D4C435      TIQISFQDYNRLKAQRIVNALDTVYRDAKVARKKESNEKALAYLDQQLSANG-NNLAKAE
A0A3C0I8F1      IIRISFKDHNAEKVRDIVNVIDTVYLEKTLAAKSQATLQQTNYLNEQLEKVD-EELTKYE
R5JJI4          IINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIE-RELGSVD
A0A848IUK4      TIKITFTDNDKYKAYDVVNAIDSLYLEYSREQKMQANKQKIAFLEEQMSNTA-QNLENYE
A0A136LSC7      TIRVSFRDHNAHKAYDVVNKIDSLYIVYSNQQKNLANKQKIEWLNNELVQVE-EKMEGYE
A0A5C7N8Q5      TIRVSFRDHNALKAYDVVNKIDSLYIIYSNQQKNLANKQKIDWLNNELVQVE-RKMEGYE
A0A355BP94      TIRVTFRDFNPLKVYTVVNKIDSVYLYYSNEQKNQANRQKIDWLNQELHQVE-NKMEGFE
A0A7Y5D1K7      TIRISLRDFSVRKVYTIVNKIDSVYLHYSNEQKNSSNKQKIEWLNNELGQVE-TKMENFE
A0A3D2HF71      LVTLTVTGTNPEQEADYLNKLMDVYIEFGLENKNRTADQTIDFIEKQLAIIS-DSLHLAE
A0A0A2DQN2      ILSLSITEASKQKATDLLGALVEAYNEEVNTLRTQISVNTTEFINNRLISLE-EELESME
A0A0A2F2N5      VLSLTLTDNSKQRATDLLEAIVDAYNTETSSVRNQIAVNTARFINERIANLS-EELDALA
L1NGW4          TLMLSLQDRTKQRALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLS-KELGIVE
Z4WRA0          TLMLSLQDRTKQRALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLS-KELGIVE
U2K8K9          TLTLTLRDKTLKRALDILAAQVMAYNQEEVEMRNQVSKNTAEFVNERLEALS-RELGVVE
A0A069ZM60      TLTLRLQDRTKKRALDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALG-KELGLVE
J6GV98          TLTLRLQDRTKKRALDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALG-KELGLVE
A0A134B4F8      TLAIRLQDRTKKRALDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALG-KELGLVE
A0A134B8C7      TLAIRLQDRTKKRALDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALG-KELGLVE
A0A4Z0EKR0      VLNLTLTDPIAGKAKDVLNKLMDVYNREAIEEKNLTTANTLKFLDDRLEKLA-YGLSGTE
A0A521H707      TVRISFKDQNSQKASDFVNTMVDEFNRYDKERKSEGADKSLQFIDETVLGID-TQLRLSE
A0A7T9D909      TVAVTCVDNNEYIARDVVKAIIEEFAEYDVERRRESSESILRFIASQKDTVF-NELRKNE
A0A1M6B6D5      VLQMRMTGHNKAKLVDYLNMSVQVLSEDMLERKNLFATKTIRFIDSSLAEKS-IELSLVE
A0A451FS66      VLRLTVIGSNKAKLVDYLNTSIQILSEDMLERKNLYATKTIQFIDSSLAKKS-AELNSVQ
A0A2E3GN39      AILVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSISFLDKQIDSIK-PLYDDAL
A0A3D1MEL0      AIQVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLDQQIDSIK-PLYDDAL
A0A519UDD1      ILYLSLTDPIPAKAKDILNKLMEVYNKEAIEDKNLLATNTLRFLDDRLAYLT-SDLSSVE
A0A7Y2ACP6      TIQISYQNPNARLARDLVMNHAQSFLEFNQERKEQSSQKILDFIDSQLDTVS-ENLRNSE
A0A2A4N9A6      TMILNFRDPNPAKAADFLNNLVQSYMEYGLDKRKESIINSANFIEDQLQKIEIQLLNSTN
A0A6C0GGI1      ILNLYAEGTVAAKEAKFLDTLISVYLETDLIEKQEANIKAIAFINSQLSTVA-NQLENS-
A0A368D1N7      AIQVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLDQQIDSIK-PLYDGAL
A0A3B8TU58      SVAITGKHPSKAKALVMVDLLIESFLNFHLYQKTESIKQSISFLDEQIDSIK-PLYDEAL
A0A1T5IIR6      ILTLVEQDYNAQRAADIINMLVVKYNEAAIREKNRVAVHTEDFINERLAIIE-EELGGVE
A0A3E0QD27      TILIKFNDNNAVKASDFVNSIMDEFNEYDRERKSEGAIKSLDFINETVAGID-VELRASE
A0A0K2HKS3      ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVE
B6W3W8          ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVE
A0A0M1W1I6      ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVE
A0A4R4GHU2      ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVE
I8WPR6          ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVE
A0A076IRY8      ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVE
A0A3A6AD54      ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVE
A0A8B3EPF6      ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVE
I8WPP8          ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVE
A0A372Y7D2      ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVE
A0A7K3KFI2      ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVE
A0A3E4JJC9      ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVE
A0A3E4WDQ0      ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVE
A0A414H9P2      ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVE
A0A7K0JKU9      ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVE
C3R5A8          ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVE
A0A6N8DCX3      VIELSYKDISIPRAEDVLNTVITVYNEEWMKDKNQITVSTSRFISERLEALE-HELGKVD
F0R0C9          VINLSFQDVCIQRAEDVLNTVIAVYNENWVKDKNQIAVSTSMFINERLGVIE-GELGNVD
A0A1C5XJA7      ILTLALKDNSSERAEDILNMLVNVYNEETIRDKNQVAVNTANFINERLIIIG-QELGDVE
A0A285T4L1      ILVLSLKDDSPLRAEDVLNTLVNVYNEEALNDKNQVAVNTSEFINERLLIIE-RELGGVE
R7CUW4          ILTLALKDSSPVRAEDVLNMLITVYNEEAIKDKNQVAVNTANFINERLIIIE-RELGGVE
A0A416GGJ1      ILTLALRDFSPERAEELLNTMINVYNEEAIEDKNQVAINTANFINERLIIIE-KDLGVVE
D1JY72          ILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVE
D7J4K6          ILVLSLKDGSPLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIE-RELGGVE
Q8ABP9          ILVLSLKDGSPLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIE-RELGGVE
D6D2Z5          ILVLSLKDGSPLRAEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIE-RELGGVE
A0A1T3EDR4      VLELSIEDSSSKRGVSFLKSLVAVYNALYLDDKKRIAQSTGEFIADRLKIVE-GELSGVE
A0A6N8KXI9      LLEISIQDGSPKRADDIITKMIEVYNELTVIDKNQIANNTSNFIKERLQIIE-SELGSVE
A0A174SDD8      LLRIAMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVE
A0A1H7RFH3      LLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVE
A0A139L1N2      LLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVE
A0A174TVL8      LLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVE
A0A1H8BJR6      LLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVE
R9H6G0          LLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVE
A0A412GR09      LLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVE
A0A7J5JXN6      LLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVE
R6D982          LLNIMMDDFSPLRAGDVLNMLITVYNEEAIEDKNRIAVNAAQFIRERIEIIE-DELGSVE
A0A1F0I8C4      LLRITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVE
A0A3A5RIJ2      LLRITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVE
A0A515IZJ5      LLRITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVE
A0A7J4Y2H6      LLRITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVE
A0A4R6WE41      LLQMHLEDRSARRAGDILTELITVYNRTALEDLNQTAVNTADFIKNRLQIIE-EELYEVE
A0A2T5RP38      LLQVSLDDLSSERADDILGTLIKMYNEIYLQDKNKIAVNTANFIKDRLAIIE-SELGAVE
A0A1A6CF06      LLQVSIEDVSSDRADDMLTTLINVYNEVYLQDKNKIAVNTADFIKERLAIIE-GELGAVE
A0A1T3D6S8      LLQVSMDDVSSDRADDMLTTLINVYNEVYLQDKNKIAINTADFIKERLAIIE-GELGAVE
A0A8B4GMS2      LLQVSMDDVSSDRADDMLTTLINVYNEVYLQDKNKIAINTADFIKERLAIIE-GELGAVE
A0A7Z7LUP7      LLQVSMDDVSSDRADDMLTTLINVYNEVYLQDKNKIAINTADFIKERLAIIE-GELGAVE
A0A0B8T471      LLQMSLEDVSAERAADMLSTLVTVYNKETVEDKNRVAKNSAEFIKERIAIIE-TELGGVE
A0A4R7D2K0      LLQMSLEDVSAERAADMLSTLVSVYNQETVEDKNRVAKNSAEFIKDRIAIIE-DELGGVE
A0A7T9S3V1      LLQITLEDRSAVRASDIITTLITVYNEFSLEDKNQIAINTAQFIRERLQIIE-GELGNVE
A0A7T9LVI2      LLQITLEDQSIKRANDIITTLITVYNEFSLEDKNQIAINTAQFIRERLQIIE-SELGNVE
C2FUH6          LLQITLEDQSIKRANDIITTLITVYNEFSLEDKNQIAINTAQFIRERLQIIE-SELGNVE
A0A1V3N3U3      LLQIVIEDQNPQRAAALIAEMITVYNEISLKDKNQIGVNTANFIKERLAIIQ-QELGSVE
A0A1P8E011      LLQIVAEDTNPLRATALIAEMINVYNEVALQDKNQIGVNTANFIRERLAIIE-QELGSVE
A0A7T9S8K4      LLQIVAEDTNPLRATALIAEMINVYNEVALQDKNQIGVNTANFIRERLAIIE-QELGSVE
A0A2X2J8S4      LLQIAMEDSNPQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILS-EELGSVE
A0A3C0S618      LLQIAMEDSNPQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILS-EELGSVE
A0A4P7DRF9      LLQVTMEDSNPLRAADMITKLIKVYNVMTIKDKNMIAHNTADFIRDRIAIIE-EELSSVE
A0A239XXC4      ILQMTLEDASPLRAEDMITKLIEVYNQMTIEDKKTVANNTADFINDRIVIIE-KELSSVE
A0A4U9K473      VLQMTMEDSSPMRAEEMISKLIEVYNEMTVQDKKKIANNTANFINDRLVIIE-KELSSVE
A0A081PBV5      LLQVFVEDSSLQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQ-SELGSVE
A0A1I2AN85      LLQVFVEDSSLQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQ-SELGSVE
A0A4U0GMP3      LLQISMEDNSPRRAEDVITMLITVYNEEAIDDKNRIAVNTADFIRERIDIIE-SELGLVE
A0A0D5BSQ0      LLQITLSDNSSERASDILTLLVQVYNEVYLQDKNKIAVNTAKFIKDRLVIIE-AELGAVE
A0A1T3F6P5      LLQVTITDDSPERAADILTSLIIVYNEVYLQDKGKIAENTANFIKDRLAIIE-GELGAVE
A0A853VUQ0      LLQVTISDDSPDRAADILTSLITVYNDVYLQDKGKIAENTANFIKDRLAIIE-GELGAVE
A0A7X0MJ00      MLQITLEDTSPLRAGDLITKLIEVYNSMTIKEKNRIAINTSEFIQKRLSIIQ-QELGSVE
A0A841JHZ0      ILQISMEDSSPSRAGDLIMKLIEVYNGMTINDKNRIGVSTAEFIKKRLSIIE-QDLGSVE
A0A1H6CKR6      ILQMTMEDTSPMRAAEMITNLITVYNNMTINDKKALGDTTANFIRDRIAIIE-TELSGVE
A0A7W3MGA7      ILKMTLEDASPLRAEDMVTKLIEVYNQMTIEDKKTVANNTADFINDRIVIIE-KELSSVE
A0A3M1Y2F5      ------------------------------------------------------------
A0A7V1ALN2      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      -----------------MKQLISRYQKASIGEKNKVADNTIAFINANLARIS-SELVQVE
A0A2P8G5K0      ---MSVQDVLPRKGEAILNQLIARYQKASIGEKNKVADNTIAFINNNLARIS-SELALVE
R5DEG6          IINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIE-KELGDVD
A0A4Q3SEI4      VINLTMNDEVPERGENILDNLLTVYNKAAISDKNVMSSNTLDFVEERIRFVV-KELDSIE
A0A836SQI2      TIKITFRDKDPIKVSDVVNTIAEEFLKYDVDRKKRSTAGILKFIDKQSALVY-EKLNYLD
A0A7V1FAJ9      -MTLSMLDKNSDLVAPMVNQLAQLFVNESISSGKQQQENYTSLLEQKLQIAK-ENLRKAN
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ---IAFQSANARKAHDIVTALANEFTKYDIEERSKSSRNVLGFIDKQLDKYY-NKLKVSE
A0A7C7LI79      --------------------IAQEFIDYDIKKKAKSANKVLAFIDEQLTLVY-EKLRTSE
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      LPPVPVTPPPPAGQA---------------------------------------------
A0A519TAP8      TIQISFTDNNPEKAAHIINNIDTVYLQEKLDRKKQSSALSLEFIDQVIADND-KRWRAAE
A0A848Y4B8      ------------------------------------------------------------
A0A7Y4V8Y1      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A847AMH6      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A7V1FAS7      ------------------------------------------------------------
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      KQLQEFKRKNKIS-ETNNATSFL-----LPSSF----N-NNDYERQKKQLNVLSQMN---
A0A7C7CKY6      NKMQSFKKQNKLS-KQDDLLTVY-----VERLD----HFESQLIDLELESDLLKDIT---
A0A1G1TG88      NRYQGFVEQTKTY-DVRSEVAAL-----AAKGE----DLEEQRLKLNQNLVLLSDISRMV
A0A661XXA6      KYFEDVTISNRTV-SLDEDVKRT-----VTIMN----NLDSQQVRLQDRLADLNSIINEI
A0A519SD85      VALQKFKEVDNDI-ISPLAISHN-----VKAYS----DLNEELKRISIAEQTLKFVYKDL
A0A3M1TXY5      FSLRGFRAGTNIV-DIGVTSKDL-----TDQLT----ELERQRAALAVAGQYYEYVLEDI
A0A7T9KM12      GNLQNVQTTAGSL--VGSASDRG-----AAVFN----DLSRLKDDQGKARSKLEYLSELI
A0A2E0VQ27      AGLAGYRSENQLI-NSTQETDAV-----LRELT----QLNLQKVDLDMKTSELKRLQEYL
A0A7Y7TYP1      ENLQRFRSSNQLL-DVAQQATGI-----TNQYR----DLQNQLAEIVSKKRYYDYVSDYI
R6U429          EHLKDYKAEHNIT-DIQSLSAAY-----LGEST----EYKSMSFEVNNQLAIAKFIKEYL
A0A5C8AF42      DSLMLYQRQSNLP-DPEAVGTTI-----SENIS----KLQDQQFEIDEEIRSLNLVSSKL
A0A7Y5SYP1      NDIQTYMVQSGIV-TVSSESQNV-----VSNIA----SLEARINESRLQIGIFEEEIRIA
A0A7V1N701      REIQEFQEKNAID-PADV-ERGV-----WGELY----DLQQQLVETEVTLSLEALNYQSF
A0A7V2NIA8      REVKEFEEKNQIT-PGNVMESSV-----YSRLY----ALQDELAQSQVSLSLNELNHKTY
A0A239K409      KDVEQYKRQNKLA-DVASQSKVY-----VEESN----TYQKQLAEWSVQIDVLETIETYI
A0A1M3DPL8      DNLSDFRKRNQLI-NVSSLTDEL-----LSKAA----SFDEELNQIRLKETYIAYVEKYI
A0A1V5F519      DEMTRFRRDNQII-DISSHGSEL-----MSKAN----SLDEKKAELKLKETYLNYLTKYL
A0A2G6R1T9      NDITEFRRSNQIV-DITTHTSEI-----VEKST----EYNERKSALRLKEKYLNYLADYI
A0A350V3E4      DKLTNFLRTENVV-ELNAQANSI-----ISSLSGIEGDYNRSLIDVQSTTRALTDIKGEL
A0A6J4K208      PVPAEALPQPRPG---------------EGLRD----ALLAERERARNRVQLYEGLLQSL
A0A2W4RDE8      GTLESFRARSNVI-DIRTSAQTL-----TNNLD----KLETERANLEVKLKYYQYILQSL
A0A212J9Z9      FKLERFQKETGVY-DVSSQSLRI-------ALD----SADREKDALALREKSVLLLTEKM
F5IV23          FKLEKFQKETGVY-DVSSQSLRI-------ALD----SADREKDALALREKSVLLLTEKM
A0A1M5DFS8      QTFKTFQDETGLY-RIQGGDQRA-------DRD----AVLQGIAENKAQEELILRLTDEI
A0A4Y8KZS5      TTFKRFQDETGLY-KIEGGDKRL-------ERN----DILTAMAENKAQEDIILRLTDEI
A0A2V3PNY7      IIFKDFQDETGLY-RITKSDGRV-------ELE----SVMKSIGEVKAQEDLILRLTDEI
A0A6G7X5K8      ASFKDFQDETGLY-RLTKTDGRS-------ELE----SVMQSIGEVKAQEDMILRLTDEI
A0A840CJ33      LKLEQFQRETGVY-NITSQSLKI-------DLD----SANREKDALAIKERSILALTEAV
F8X2T0          LKLEQFQKETGVY-EVSSATVRR-------ELD----VADVDRDQVAMREKTVLFTTQKI
A0A1M3LAG1      LKLERFQKETGVY-EVSSATVRR-------ELD----VADVDRDQVAMREKTVLFTTQKI
A0A212K6G4      LKLERFQKETGVY-EVSSATVRR-------ELD----VADVDRDQVAMREKTVLFTTQKI
A0A4Y9IPG7      LKLERFQKETGVY-EVSSATVRR-------ELD----VADVDRDQVAMREKTVLFTTQKI
A0A0L8VEV2      NKFTSFRSQNQIV-DIGQEGGII-----VQRLV----DLDKERSLAQSHLDYYRNLQKYL
A0A1I2A9Z9      NNFTSFRSRNQIV-DMSQEGGII-----VQRLV----DLDTERSMIQSHLDYYKNLQQYL
A0A848XXC6      RQVADYMARENAV-GLDAQTQGT-----ISQIA----ALQASLDQSRIQTRMREAQLNSL
A0A2P8CDS1      KIRERFQSRNNLL-DVSYQSQQL-----LDQLV----KLEDQKSLLETQHQYYQYLETYL
A0A660LQT8      KNISSYKSANLLS-DTDEASKLY-----IKKTE----ENTDKMMDLNNQIYMTRYVSQLI
A0A3D0FMX4      SAMTDFRKRNEIV-DIQSYSSEL-----LGKVN----AYDQERLAMRLKETYFEYLTNYL
A0A7V6G854      SQLRDFRRKNNII-DINAYSGSL-----MAKLD----GFNQKRSELDLKDAYFNYLSNYL
A0A1M3MEI8      DEFTSFRRRNQII-DVGSFSGDL-----LSKAA----AYDTEINQLKLKESYLDYLVKYV
A0A1J5HQM0      GEMTDFRQRNQII-NVDTHAGEL-----LGKSN----SYESQFSTLKLKETYLDYLTKYL
E4T131          SQMTNFRQSNKIV-DVSSHTSDL-----LGKAT----KYDGQQAELKLREDYLTYLTKYL
A0A653AC35      GAMTQFRQSNQIV-DMSSHSTEV-----LGKAT----AYDEKQNELQLRESYFNYLTDYL
A0A847LA02      GAMTEFRRSNQIV-DLPSHSSEI-----LGKAT----QYDEKQSQLKLRESYLNYLDNYL
A0A389LWV6      SKLNAYQSQAGIF-SSDNSLRSS------TELV----DLDKKKAEIRLRKEYTKFLQDNL
A0A1G9B1T9      QSLRSFRDRTRTV-DIGTTARDL-----NTKLD----ELQKTREDLLIDYRSYQNLFQYL
A0A350PNH9      KDISSFKSRNLLP-DVETAAQQY-----MQKSG----DVDKQILELNSRLSMARYLRDFL
A0A354LNT9      KDISSFKSRNLLP-DVETAAQQY-----MQKSG----DVDKQILELNSRLSMARYLRDFL
A0A161LWY6      SHLQHFRKANQIL-DLNAYGSTI-----LGHLT----SYDEKRLQYNLKESYLNYLADYI
A0A6I3N9U6      SHLQHFRKANQIL-DLNAYGSTI-----LGHLT----SYDEKRLQYNLKESYLNYLTDYI
A0A353WYK7      NYFENFTIDNRTT-DMNVSLSRT-----ITMLE----ELDSIKMKLNDQLDNFNEIYDKL
A0A2W7RD29      NELQNFRAANQTT-NISSEGEVI-----FGRLQ----SMGEELAKEKIKKEYLLSLDRYL
A0A3N2NDY8      NEIFDFKRDHRVP-NLEEAAKTQ-----MKQSV----EMSNKMLEVTNQMSMSIYLRDYL
D7JEV9          SNLNSFKVANKMY-GQNNTSIL------TERME----SLENQGKQIRLRDEYFKYLRNYL
A0A553GA49      QSLQDFKTDQQVV-DVNLKAGQI-----YENLR----AIGIEKDQLEAHVNNLEFLNENF
A0A7V5GTN5      AEIQAFLTDRRLTLDEEDIIGGI-----SNDLL----NLERQLTEAKTRRDLAKLQIDTY
A0A497D6F6      NAMQAFQSKHKLL-NISIQSEQL-----LDQVN----ELEKEKVVLETKNKYYKYLREYI
F4KR18          STVESYKLNNDIIAETTTDLSIT-----LEDVN----NLVKEQRKVELQQKMLQAMKSDL
B5CTK0          SNIETFKRQNRLT-DVNSEASMY-----LASSS----SYQQEGVGIENQLTLAKYIKSYL
A0A5M4AAB9      KIRERFQSNNQLL-DVGYQSQQL-----LDQLV----KLEDQKNLLETQHQYYKYLENYL
A0A5R9QZP0      SELRNFKASNQVT-DLSYQGQQA-----LTQIT----AVDNEISSLNVQEKYYNYILDYF
A0A7X6SRJ5      SKLRDYRSAYQVT-DLSYQGQQA-----LQQMT----QIENEMVTLQVQERYYNYVLEYL
A0A3D3HL11      SKLRDYRSANQVT-DLSYQGQQA-----LEQMR----QIENERSMLQVQERYYNYILDYF
A0A6L8U6G9      SKLRDYRSAHQVT-DLSYQGQQA-----LEAMR----EIENERTTLQVQERYYNYVLDYM
A0A6L8UH35      SQLRNYRAANQVM-DLSFQGQQT-----FEQMT----LIQQERATLQLQQRYYNYVINYF
A0A7X9F2J5      SQLRNYRAANQVM-DLSFQGQQT-----YEQMT----QIQQERAALQVQQRYYNYVINYF
A0A352ME00      SALKNYRSANQVM-DLSFQGQRV-----YEQMT----DIDNERANLKVQERYYNYVINYF
A0A7X8CRA6      SELRNYRSANQVM-DLSFQGQQS-----FEQMS----SIETERAALQVQERYYNYVLNYF
A0A1F3D6P8      SKLRNYRSANQVM-DLSFQGKSL-----YEKLE----QIETERANLQIQERYYNYIINNF
A0A356Z058      SKLRNYRSANQVM-DLSFQGKSL-----YEKLE----QIETERANLQIQERYYNYIINNF
A0A7X8FHL3      SQLRNYRSANQVM-DLSFQGQRV-----FDQMQ----EIENERANLQIQERYYNYVINYL
A0A3D1BT36      SELRDYRSTHQVT-DLSYQGQQA-----LNQME----QIDNEKATLQAQQRYYNYIIDYF
A0A7X7CXW9      SKLRDYRSAHQVT-DLSYQGQQA-----LEQLR----QIENERSQLQVQERYYNYILDYM
A0A4R6H3B7      NNFTSFRSRNQIV-DMSQEGGII-----VQRLV----DLDTERSMIQSHLDYYKNLQQYL
A0A229I3A5      KNISAFKSSNLLP-DVEAAAQQY-----MQKST----EVDKQIMDLNSRLAIAQYIRNYL
A0A3R6HJB3      KNISTFKSSNLLP-DVEAAAQQY-----MQKST----EVDKQIMDLNSRLAIAQYIRNYL
R6NN15          ENISTFKSENLLP-DVQAASQLY-----MTERS----QAQSQILTLNTQLSMARYIRNYL
A0A2W7QSQ0      KSGENFKTRNNIT-DISMNSKIY-----LENTA----ETRKQVAEVSGKIDILESIELTM
A0A841MQL4      RSGENFKNQNNIT-DVSLNSKIY-----LESTA----ETRRQVAEVSGKIDILESIEYNI
A0A3P1Z8V4      HRLATFKQNNSIV-DLTATATAM-----TQQSI----QARQKTIELETELSVASFLADHL
A0A1M6MYT6      SRMEDFQSEHQIV-NISAQSEQL-----LERMR----ELDQERIAMETQNKYYHYLRDYI
A0A1V5S1J9      GRLKDYKANNFVV-ASVGGSNL------MGQYT----QLDAMQTDLRLKESYLNYLTNYL
A0A7X8JMH1      RALQNFKSDNFMV-AANSSTEL------SAKYR----ALETKETELRLKDSYIKYLTNYL
A0A3D5KRY6      NMFTNFRAENRTV-DLGREASLV-----VENLK----KVEADRANLDLRLESFNNLKYYL
R7F6L5          SDISSYKARTMSP-DLEAQAQIN-----MARSS----ELQNQQYDLSNQIQILNYVRGEL
A0A7C5MRV2      QILQEFKQDKEFI-SVDLKVGFD-----MESMK----RNAELQSHHVLKLMEINRLSTDI
A0A0A2EYC8      SNLNSFKIANKMY-GQNNSILL------TNKME----ALEEQGKIIKLRDEYFKYLRNYL
A0A2G6H6Y4      AKLNSYKIEHKIY-SSDMTSVL------VGQME----KLKNQGKQIKLRDEYFKYIKRYL
C9LKL0          GRLASLKESNRIV-DFKTAADQY-----SSMSV----TARQSSVDLQSQVSVARYLKDFM
A0A3D0QPV7      LELQAFRQLNKVQ-NFEGVSKNY-----LERLT----ELEGQLLKVDIDEELIIEVERAL
A0A496KT23      QNIAGYKSANLLP-DVEQSGNMA-----VNQAN----EAEAKARELSTQVYMTRHVKEYL
L1M9T3          QNIAGYKSANLLP-DVEQSGSMA-----MAQAN----DAEIKARELSTQTYMTRHVREYL
A0A2M6GH67      KAMQDFAIQNKTY-DVRGEIAKS-----MARLE----ELYKERSDLGLQINLLRDIHNLV
A0A7K1TE30      DNLKGFVLKNGTY-DAKGELGNI-----TSKME----ELAADRLKLEQKGALLAEVGRLA
A0A7D4BE70      DNLKNFVQRNGTY-DAKSELGDI-----TSKLE----DIQTTRLKLQQKITVLTEVAQLA
A0A142HHS5      DNLKIFVQQNGTY-DAKGELGTI-----TNKLE----KIEEDRFKLEQKLTLLADVSQRA
A0A7D4C435      DNLKSFVQRNGTY-DAKEQLSEI-----TTKLT----EIEKQRDELEQKLTLLNNVGRLA
A0A3C0I8F1      SLLEGSLIENKTT-DLLSKFSTS-----VKESE----NFGEKKAEITNLLNLLDQLEVQA
R5JJI4          ANIESFKRENQLT-DITSETGMY-----LQNTS----RYKQEGLSLENQLSIVKYIKEYL
A0A848IUK4      NYFENFTIENQTV-DLQQDMSKA-----IGFLN----ELDSQKRALRIYKIKIDKVQSQL
A0A136LSC7      NYFESFTLQNKSS-DLTLDLKKT-----IAAIN----VVDSQRYSLNKQLAELNTLIDQI
A0A5C7N8Q5      DYFESFTLQNKSS-DLTLDLKNT-----IATIN----RVDSQRFNLNKRLIELNALIEHI
A0A355BP94      NYFEDFTLKNKSS-DLTTELRQT-----IYALN----QVDSQRFSLNKRILELNGYIEEL
A0A7Y5D1K7      NYFENFTLKNKSS-NLDSDLRKT-----IFVIN----QLDSQRFELNRKITDISTLMDDL
A0A3D2HF71      NSLESFRLANRLI-DLSREGVAI-----QNRLE----EIDKEKTSLMLQKNYYEYLKDYI
A0A0A2DQN2      NNREELLIENQFI-NPASLAESY-----MNRTQ----TNQNGRIELEAQERLIAYMQSYL
A0A0A2F2N5      SNIDSFQRANNFI-APEVVAGAY-----TSRAQ----TGHEASFEIDAQKRLARYFLDFI
L1NGW4          NEMESFLVTNRTL-DFDAKMGRY-----NTRSV----DYEVQAMEIETQLKLVSFMLSNL
Z4WRA0          NEMESFLVTNRTL-DFDAKMGRY-----NTRSV----DYEVQAMEIETQLKLVSFMLSNL
U2K8K9          QDMTRFSARNKTI-DFTSKVESY-----NARSL----EEEDASIKIEKQLKLVSYMLSQL
A0A069ZM60      GDMERFLMNNRTL-DFEGKVGVY-----NSRSL----ESEAEALQIETQLKLISYMLSEF
J6GV98          GDMERFLMNNRTL-DFEGKVGVY-----NSRSL----ESEAEALQIETQLKLISYMLSEF
A0A134B4F8      GDMERFLMNNRTL-DFEGKVGVY-----NSRSL----ESEAEALQIETQLKLISYMLSEF
A0A134B8C7      GDMERFLMNNRTL-DFEGKVGVY-----NSRSL----ESEAEALQIETQLKLISYMLSEF
A0A4Z0EKR0      KVVEKFKSANQLT-DITTQASNY-----TSQAN----SYDKQLSEWAIQIDVLESIEGYL
A0A521H707      YSVEAFKKEHLII-DPLQNAEDA-----LAHIN----LLIDQRIEVQLQLAVLQRIEKNI
A0A7T9D909      FDLKYLQTTNRVS-DKSGLTAIY-----LSRQE----DYENKMAEVRIEENLLSEIERAT
A0A1M6B6D5      DELNDFRRNNVIF-DLNIEGAEL-----NEKLN----ALDLRKEAAARELDYYNTLQEYL
A0A451FS66      DELNKFRNKSAVY-DLATEGSEL-----NSKLN----ALDLRKEAVNRELNYFITLQEYL
A0A2E3GN39      IAVRNAEAQKGYR-NIEALGGGL-----YKDIK----DLQKKLVRIEYVTSVLEWFAVMI
A0A3D1MEL0      IAVRNAEAQKGYR-NIEALGGGL-----YQDVK----ELQKKLVRIEYVTSVLEWFAVMV
A0A519UDD1      KLVEQYKSTKGLT-DVSTQASVY-----TSQAS----TYNTQLSELAIQIDVLESLERYL
A0A7Y2ACP6      FLLNAFKQEHKLS-NIENISDIY-----LTRLN----DLEEK----LFALDLEAQTLTRL
A0A2A4N9A6      KLMNINLDTKTIA-NISRVFQSEGKYIINDNPE----FLIAQKINDLKLEINIIDTVNYY
A0A6C0GGI1      -----KQALEGYK-RTYGTERGVAKLNAYERLE----ALQLQRSDYTTRLRSLNNTLDYM
A0A368D1N7      IAVRNAEAQKGYR-NIEALGGGL-----YEDVK----ELQRK----LVRIEYVTSVLEWF
A0A3B8TU58      VAVRNAEAQKGYR-NIEALGGGL-----YADVK----NLQQK----LVRLDYLISVLGWF
A0A1T5IIR6      GELARFKSSNKIM-DVDYTANMY-----LGDSR----GYNAEIVAVETKLALSNYLKDHV
A0A3E0QD27      GSLEQFKKDNMII-DPRQNASEA-----LTHIN----KLIEQRVEMQLQLAVMNRLERDI
A0A0K2HKS3      NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYL
B6W3W8          NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYL
A0A0M1W1I6      NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYL
A0A4R4GHU2      NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYL
I8WPR6          NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYL
A0A076IRY8      NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYL
A0A3A6AD54      NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYL
A0A8B3EPF6      NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYL
I8WPP8          NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYL
A0A372Y7D2      NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYL
A0A7K3KFI2      NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYL
A0A3E4JJC9      NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYL
A0A3E4WDQ0      NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYL
A0A414H9P2      NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYL
A0A7K0JKU9      NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYL
C3R5A8          NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYL
A0A6N8DCX3      SDISTYKSENLLP-DAEKASMLF-----MEQAQ----ENDNRLIAISTQAAIAKYIREHL
F0R0C9          ENISSYKSEHLLP-DVQAASNLY-----MAQSS----ETNAQILALNTQLSMARYIRNYL
A0A1C5XJA7      SDLESFKRENQTL-DISSSASMY-----MGESQ----KYNSSALELETQLRLAQYIKEYL
A0A285T4L1      TELEAFKQSNQLM-DIGSLAGQY-----MGEAQ----TYSADALEQETQLKLAQFIKEYL
R7CUW4          SDLESFKRSNQIV-DISSAAGMY-----MTESQ----KYNADALELETQLRLANFIKDYL
A0A416GGJ1      SDLETFKSSNQLM-DVSSTAGMY-----MSESQ----KYGADGMELETQLRLAQYIKEYL
D1JY72          NELQSYKQNNDII-DIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYL
D7J4K6          TELESFKQHNQVM-DIGSLAGRY-----MGEAQ----AYSADALEQETQLKLARFIKEYL
Q8ABP9          TELESFKQHNQVM-DIGSLAGRY-----MGEAQ----AYSADALEQETQLKLARFIKEYL
D6D2Z5          TELESFKQHNQVM-DIGSLAGRY-----MGEAQ----AYSADALEQETQLKLARFIKEYL
A0A1T3EDR4      QKIEDFKLSNQGM-DAQSLKSLS-----LSEQG----ENKSQGMKIDMDISLLEMLSSYL
A0A6N8KXI9      SDIENLKSRNQGI-DVGTASEIY-----LTDSR----QYQADKNKIETDIKLANMMRDYL
A0A174SDD8      TDIEDLKKANNGV-DINMAAGMY-----IQDSR----QYESSIKELDTQLQLVTFIKQYL
A0A1H7RFH3      TDIEDLKRANNGV-DIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYL
A0A139L1N2      TDIEDLKRANNGV-DIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYL
A0A174TVL8      TDIEDLKRANNGV-DIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYL
A0A1H8BJR6      TDIEDLKRANNGV-DIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYL
R9H6G0          TDIEDLKRANNGV-DIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYL
A0A412GR09      TDIEDLKRANNGV-DIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYL
A0A7J5JXN6      TDIEDLKRANNGV-DIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYL
R6D982          TDIEVMRKESDWG-DINTAASMY-----VSDGR----KYESSLKELDTQLQLVSFIKQYL
A0A1F0I8C4      TDIEDLKRANNGV-DINTVAGIY-----IQDSR----QYELLIKELDTQLQLVTFIRQYL
A0A3A5RIJ2      TDIEDLKRANNGV-DINTVAGIY-----IQDSR----QYELLIKELDTQLQLVTFIRQYL
A0A515IZJ5      TDIEDLKRANNGV-DINTVAGIY-----IQDSR----QYELLIKELDTQLQLVTFIRQYL
A0A7J4Y2H6      TDIEDLKRANNGV-DINTVAGIY-----IQDSR----QYELLIKELDTQLQLVTFIRQYL
A0A4R6WE41      TDIEKLKVNNQGV-DVGTAGQLY-----VAEGR----AFQTQRTQIETDKRLVEMMRDYL
A0A2T5RP38      ANIENLKIDNQGL-DIETAGGMY-----LSESN----QYKTEKTKTETDLRLAEMMRSYL
A0A1A6CF06      SNIENLKIANQGI-DIATAGGMY-----LSESS----QYKTEGTKIETDIRLAEMMHSYL
A0A1T3D6S8      SNIENLKIANQGM-DVATSGNMY-----LSESN----QYKTEGTKIETDIRLAEMMHSYL
A0A8B4GMS2      SNIENLKIANQGM-DVATSGNMY-----LSESN----QYKTEGTKIETDIRLAEMMHSYL
A0A7Z7LUP7      SNIENLKIANQGM-DVATSGNMY-----LSESN----QYKTEGTKIETDIRLAEMMHSYL
A0A0B8T471      TDLEQMKARNEGM-DVNTATGVF-----WGESR----EYQSTTRGIETQLRLVELMRQRI
A0A4R7D2K0      TDLEQMKARNEGM-DVNTATGVF-----WGESR----EYQSTTRGIETQLRLVELMRQRI
A0A7T9S3V1      NNIEQLKTANQGV-DVNVAGDMY-----LSESK----QYQGERNKLETDIKLVDMMRSHL
A0A7T9LVI2      NNIEQLKTANQGV-DVNVAGEMY-----LSESR----QHLEERNKLETDIRLVDMMRSHL
C2FUH6          NNIEQLKTANQGV-DVNVAGEMY-----LSESR----QHLEERNKLETDIRLVDMMRSHL
A0A1V3N3U3      SNIEQLRQSNQGV-NIETAGEMY-----LNDSR----QFQSARTKIETERKLTQLMQRQL
A0A1P8E011      SSIEDLRTQNQGM-DASTVGTAY-----FEDSR----LYQSERNKVETDINLAQMMRGYL
A0A7T9S8K4      SSIENLRTQNQGM-DASTVGTAY-----FEDSR----LYQSERNKVETDINLAQMMRGYL
A0A2X2J8S4      GDLEKIKVNNNGM-DVAEVGGMY-----IEDSR----SYRLEATKIDTDLKLAEMMSDYL
A0A3C0S618      GDLEKIKINNNGM-DVAEVGGMY-----IEDSR----SYRLEATKIDTDLKLAEMMSDYL
A0A4P7DRF9      SDIEGMKIQNQGL-DVKAAGEQY-----WSESR----GYQSTSKDIETQKKLVEIMRQRL
A0A239XXC4      SSLEGMKTQNQGL-DVKSAGEQY-----WTESR----TYQSSSKELETQMKLVEIMRQRL
A0A4U9K473      SDLEGMKTQNQGL-DVKSAGEQY-----WTESR----GYQSSSKELGTQMKLVEIMRQRL
A0A081PBV5      SNLENLKVSNQGI-DVNAASQMY-----VSEGM----MHESAGNDVQTQLKLVEMMQNYM
A0A1I2AN85      SNLENLKVSNQGI-DVNAASQMY-----VSEGM----MHESAGNDVQTQLKLVEMMQNYM
A0A4U0GMP3      SDLERLRIANQGL-DLASSRQMY-----SSESQ----TYYAEGNAAETQMKLVELMKQYL
A0A0D5BSQ0      SNIENLKVANQGI-DVETAGSMY-----LAEKN----QYKTDRTKVETDIRLAEMMRSYL
A0A1T3F6P5      SNVENLKVANQGI-DVATAGGLY-----LNEKN----QYKTEGAKIETDIRLAEMMRSYL
A0A853VUQ0      SNVENLKVANQGI-DVATAGGLY-----LNEKS----QYKSEGAKIETDIRLAEMMRSYL
A0A7X0MJ00      SNLENMKAANQGL-DIKSASETY-----WTTSR----TQQSSIQDIETQKKMVEMMREHL
A0A841JHZ0      SNLESMKVANQGL-DIKSASDAY-----WTDSR----QYQSSGKDLETQLSLIEIMRQRL
A0A1H6CKR6      SQIEGMKTSNQGL-DVKSAGEQY-----WSDSR----GYDASSKEIETQMKLVEIMRQRL
A0A7W3MGA7      SSLEGMKTQNQGL-DVKSAGEQY-----WTESR----TYQSSSKELATQMKLVEIMRQRL
A0A3M1Y2F5      ------------------------------------------------------------
A0A7V1ALN2      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      TRIEHFRKRHRVIDMAE-------------------------------------DSRQAL
A0A2P8G5K0      TNIEHFRKRHRIIDMAE-------------------------------------DGRQAL
R5DEG6          SDIESYKREHQLTDISS---ETGMYLQTSSQYRQEGLSLENQLSLAK-------YIKNYL
A0A4Q3SEI4      TKLQNYRTKTGVVDLSE---QGKLYLQSVGENDRMMTDLHIQTAMLD-------EVEKYV
A0A836SQI2      RQIKKIQQDNNFFTETTNEILPNIYLNKLNLLEDRILDLGYERSALQ-------RISDIL
A0A7V1FAJ9      EEIKNFKQTHIIDLNKE---LNSKVTAIADLENKIETLQNTQKTIKL-------LLGKLD
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      NKLQKFQKENKISGSSE---FSAMYMEKLNRLENQLIDLDLQINVLK-------EIQNKA
A0A7C7LI79      NKMQSFNKQNKMAGKGD---FITIYVGKLDNLESELLDLELEQNMLK-------EINTMI
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ----------VGFGMDN---DLVEL----------RLELEQNLELLD-------EVGALA
A0A519TAP8      EAHTEFVRRNKTYDVKG---DMATLKNGLEQQQEARQKLQDKLRLLS-------DINGLM
A0A848Y4B8      ----------------------------LETELGAIEPRLAEFVASG----AGREIQLAQ
A0A7Y4V8Y1      --------------------MANNELDQVEKRMQNFENYFENFTLQNKSSDLSQDLERTI
A0A5Q4EKA0      -------------------------------------MLQMEFNILT-------EIAKSL
A0A519SYE7      --------------------DISGLKDRLEQQQLTREKLIQNLRLLD-------DVQQMV
A0A7C7CFR2      --------------------ELES-------------------SMLD-------DIENMI
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A847AMH6      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A7V1FAS7      ------------------------------------------------------------
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      --QKITSDENVNTMELMTLMS---------GAQSS------------------ES-MIMN
A0A7C7CKY6      --ATIAGEKELDAYNLLPVLT---------G-TPY------------------KD-EIGD
A0A1G1TG88      QQTHITRNEEETVEQSIPGL----------G-DIN------------------DP-VLSQ
A0A661XXA6      KDGQIV---------IMPTL----------D-DKF------------------PA-HIIS
A0A519SD85      ----TKG-----IPDRLSYDV---------Q-DIP------------------DV-QLQD
A0A3M1TXY5      ----QADNS---LAEVVAPAS---------T-GIE------------------DP-LLTS
A0A7T9KM12      THMGTDDGG---TPSTISAAN---------V-G--------------------AP-SLSN
A0A2E0VQ27      ----LSGNS---LSDFSPNFE---------A--LS------------------DP-IFRG
A0A7Y7TYP1      ----TKNDD---FSNMIPTAS---------M-GIN------------------DP-ILNN
R6U429          ----ENPAH---DGALIPANS---------G--LT------------------NS-TVES
A0A5C8AF42      ----KSDPNRLEIYRLLPEML---------G-KSY------------------EQ-SLTG
A0A7Y5SYP1      ----REQLKTLQPSSSVEFSG------------YS------------------DS-YIRI
A0A7V1N701      ----GDQFTRLAMETARDLGG------------RE------------------AP-MVEE
A0A7V2NIA8      ----SKEYQDLTQSSAAELGG------------MD------------------NP-AITV
A0A239K409      ----SNSKE---NSYRLVPST---------L-SIE------------------DP-TLQE
A0A1M3DPL8      ----QTNLN---EGAIIAPSN---------I-GLN------------------EP-MLMT
A0A1V5F519      ----TGNFE---EGTVVAPSN---------L-GLN------------------EP-LLMQ
A0A2G6R1T9      ----KTNLS---SGNIIIPTN---------T-GLN------------------ES-TLVV
A0A350V3E4      ----DKYDP---KATDYFESK------------IT------------------DP-YVAE
A0A6J4K208      ----GRENEMI-ALPVSPPDT-----------------------------------ALQQ
A0A2W4RDE8      ----QSGKN---TDIVAPSTF---------G--VD------------------DP-LLSN
A0A212J9Z9      ----KEKILG--TDDLMDPAS---------M-NIR------------------NP-KLSE
F5IV23          ----KEKILG--TDDLMDPAS---------M-NIR------------------NP-KLSE
A0A1M5DFS8      ----NNSILS--NTELIDPSA---------F-GIS------------------DT-KLSQ
A0A4Y8KZS5      ----KSSILN--STELVSPNA---------F-GIN------------------EP-KLSQ
A0A2V3PNY7      ----SNSILN--KTELIDPTA---------L-GLN------------------EP-KLAR
A0A6G7X5K8      ----NSSILN--RTELVEPSA---------L-GIT------------------EA-KLTQ
A0A840CJ33      ----KEGIMG--SEELIEPTN---------L-NIT------------------NR-KLSE
F8X2T0          ----KEGIMG--SSELIDPVS---------I-GLT------------------DEIKLSR
A0A1M3LAG1      ----KEGIMG--SAELIDPIS---------I-GLT------------------DEIKLSR
A0A212K6G4      ----KEGIMG--SAELIDPIS---------I-GLT------------------DEIKLSR
A0A4Y9IPG7      ----KEGIMG--SAELIDPIS---------I-GLT------------------DEIKLSR
A0A0L8VEV2      ----SDTEK---MQEVVAPSV---------V-GIV------------------DE-SLNN
A0A1I2A9Z9      ----DDTEK---MKQVVAPSV---------V-GIV------------------DD-ALNN
A0A848XXC6      ----QR------ELATMQPRM---------A-ARA------------------SS-TSDS
A0A2P8CDS1      ----SRNDN---LQSLVAPTT---------V-GID------------------DP-LLVN
A0A660LQT8      ----SNDKK---KYDLLPVNS---------G--IN------------------ST-AIES
A0A3D0FMX4      ----NTTME---QGTVIAPST---------M-GLD------------------AQ-ALGT
A0A7V6G854      ----TKNIK---EESIVAPSS---------L-GVS------------------DP-TLLE
A0A1M3MEI8      ----KTNLQ---DGSIVAPTN---------L-GLN------------------EP-MLMA
A0A1J5HQM0      ----RTNME---DGSIIAPSS---------L-GLN------------------EP-MLMG
E4T131          ----KTNLE---DGAIVAPSS---------L-GLS------------------EP-MLMK
A0A653AC35      ----KTNLE---AGAIVAPAS---------L-GLN------------------EP-MLMT
A0A847LA02      ----KTNLD---AGSIVAPSS---------L-GLN------------------EP-MLMS
A0A389LWV6      ----KKE-----DGNLVPPSS---------M-GIQ------------------DV-ELAV
A0A1G9B1T9      ----EQND----YTEVIAPSV---------R-NIN------------------DE-VMSG
A0A350PNH9      ----TGKVG---KNQLLPANI---------G--ID------------------SP-GIEQ
A0A354LNT9      ----TGKVG---KNQLLPANI---------G--ID------------------SP-GIEQ
A0A161LWY6      ----KKNVN---NQELLTPSS---------L-GIV------------------DP-VLTG
A0A6I3N9U6      ----KKNVN---NQELLTPSS---------L-GIV------------------DP-VLTG
A0A353WYK7      ----LDTADLQLGNSELR---------------ML------------------SS-EVAQ
A0A2W7RD29      ----RNNDF---DNIVVPSLV---------G--IT------------------DP-TINS
A0A3N2NDY8      ----NNPGN---AKSVIPVNT---------G--IG------------------SP-TLEA
D7JEV9          ----KNNID---NESLASPTT---------I-GIQ------------------EP-RLIA
A0A553GA49      ----QKDED---FSAHSVTLM---------S-NLN------------------NE-VLND
A0A7V5GTN5      ----SQQIE---QRLSNSLNG--------TR-DTR------------------VD-QIRM
A0A497D6F6      ----INNQE---LETIIAPSA---------M-DID------------------DP-LLNA
F4KR18          ----QDTSS---KFKLIPINP-----------ALY------------------DG-KIRD
B5CTK0          ----TDPSK---NFNLIPTNT--------GI-SGA------------------DV-NIES
A0A5M4AAB9      ----LQNGD---LESLVAPST---------V-GID------------------DP-LLVN
A0A5R9QZP0      ----DQNQD---ITGLSPPSS---------A-NVI------------------DP-IMNS
A0A7X6SRJ5      ----GKNED---MAGLAPPSS---------S-NVV------------------DP-ILNS
A0A3D3HL11      ----DKNQD---MTSLAPPSS---------S-NVV------------------DP-ILSS
A0A6L8U6G9      ----EKNQD---MSSLSPPSA---------A-NVV------------------DP-IMNS
A0A6L8UH35      ----KANQD---MAGVVPPSA---------M-NVS------------------DP-ITNQ
A0A7X9F2J5      ----KANQD---MVGVVPPSA---------M-NVS------------------DP-ITNQ
A0A352ME00      ----KMNAD---VSGLAPPSA---------M-NVS------------------DP-IINQ
A0A7X8CRA6      ----KMNES---GSGVVLPSA---------M-NVS------------------DP-IINQ
A0A1F3D6P8      ----KSSND---MSGVVPPSA---------M-NVA------------------DP-IMNQ
A0A356Z058      ----KSSND---MSGVVPPSA---------M-NVA------------------DP-IMNQ
A0A7X8FHL3      ----NLNDD---ISGLSPPSS---------M-NVS------------------DP-IINQ
A0A3D1BT36      ----NNNQD---IAGLAPPSA---------A-NVS------------------DP-IMNT
A0A7X7CXW9      ----EKNQD---MAGLAPPSA---------A-NVA------------------DP-IMNS
A0A4R6H3B7      ----DDTEKM--KQVVAPSVV---------G--IV------------------DD-ALNN
A0A229I3A5      ----TGKVG---KNQLLPTNT---------G--IE------------------SP-GIEQ
A0A3R6HJB3      ----TGKVG---KNQLLPSNT---------G--IE------------------SP-GIEQ
R6NN15          ----TAASS---RNQLLPANS---------G--LE------------------SA-NIEN
A0A2W7QSQ0      ----NNQSG---QFDLIPGGL---------A--DL------------------DP-SLSG
A0A841MQL4      ----NNQTG---QFDLIPGGL---------A--DL------------------DP-SLSG
A0A3P1Z8V4      ----RSSGK---GKEVIPAVA---------G--FT------------------NA-ALAQ
A0A1M6MYT6      ----NTTASRELETVIAPSAM---------G--IE------------------DP-LLNN
A0A1V5S1J9      ----KSNVE---EGAIIAPDN--------LG--VS------------------DA-NLSS
A0A7X8JMH1      ----EKNIE---DGSLIAPTS--------LG--VN------------------EP-TLTL
A0A3D5KRY6      ----ENRDQ---NKDLVFPSI---------E-QLT------------------DP-ALIE
R7F6L5          ----SREG----IDETLPSNM---------G--IA------------------NT-GLES
A0A7C5MRV2      ----ARGNR---ELSLPYSIE---------G--QT------------------DP-ILTS
A0A0A2EYC8      ----KNNID---SESLASPTT--------IG--IQ------------------EP-RLIA
A0A2G6H6Y4      ----NKNIQ---TESLASPTT--------IG--IQ------------------EP-RLIS
C9LKL0          ----QNNSN---KHQLIPVLN------------LP------------------DA-TFAG
A0A3D0QPV7      ----KEYHNESDIYNVLSILS---------G-TRF------------------ES-ELSG
A0A496KT23      ----TDGRH---ENQVLPSNS---------G--IN------------------NA-SIQS
L1M9T3          ----TDGRH---ENQVLPSNS---------G--IN------------------NP-SIQA
A0A2M6GH67      ----AH-------DSDLEQII------PSLK-QIE------------------DA-ELST
A0A7K1TE30      ----TQERITASEDQTVEQTL------PGLG-DLE------------------DP-VLTE
A0A7D4BE70      ----TQERLTPSDDIPVTQSI------PELE-VLD------------------NP-SLAQ
A0A142HHS5      ----AAERLTPSDEVTVDQTI------PGLA-LLE------------------DP-ALSQ
A0A7D4C435      ----EQEQLTPNDDVSVEQSI------PGLV-LLG------------------DP-IISR
A0A3C0I8F1      ----QNDSI---ITTLMPEVN------------LP------------------GI-DFNS
R5JJI4          ----VDPQK---GSDLIPANT---------G--IS------------------DN-SVES
A0A848IUK4      ----ENDDQ---LEIGSLTLE------------NF------------------PK-TITE
A0A136LSC7      ----TASDF---ANA-IRPAN------------SF------------------PE-SILQ
A0A5C7N8Q5      ----TTEDF---SST-SRPTR------------SL------------------PE-SINQ
A0A355BP94      ----STGKL---VQ--VAPRN------------FL------------------PE-YLNT
A0A7Y5D1K7      ----SSGKT---TAF-IMPKP------------YL------------------PT-FINE
A0A3D2HF71      ----DTKKE---SGEIIAPSVM--------G--VT------------------DQ-LLIR
A0A0A2DQN2      ----KDASK---TNEFLPLNI---------G--IM------------------SP-ALDE
A0A0A2F2N5      ----NNPSK---RSEYLPQNI---------G--LN------------------NA-ALET
L1NGW4          ----SSPQK---QTEYMPLNI---------G--VS------------------DP-NLDG
Z4WRA0          ----SSPQK---QTEYMPLNI---------G--VS------------------DP-NLDG
U2K8K9          ----NSPSK---RNELMPLNI---------A--MP------------------DP-ELDG
A0A069ZM60      ----SNSHR---KNGYLPLNV---------G--VP------------------DQ-ALDG
J6GV98          ----SNSHR---KNGYLPLNV---------G--VP------------------DQ-ALDG
A0A134B4F8      ----SNSHR---KNGYLPLNV---------G--VP------------------DQ-ALDG
A0A134B8C7      ----SNSHR---KNGYLPLNV---------G--VP------------------DQ-ALDG
A0A4Z0EKR0      ----EKNAG---NYSAVPSTL---------G--IK------------------DE-TLLA
A0A521H707      ----NSDEN---TESLLPLLS---------G-TYI------------------DG-VIQG
A0A7T9D909      ----LAQDASVDVHHLIPLLV---------G-TPY------------------AQ-TFDE
A0A1M6B6D5      ----VTRSDY--RDVPAPSVA---------G--IS------------------ES-SVVA
A0A451FS66      ----TTRTDY--RDVPAPSVA---------G--IS------------------EG-SIIA
A0A2E3GN39      ----QQEEDLSLASTQLSGEE------------FD------------------GI-TRAL
A0A3D1MEL0      ----QQEEDLSLVSTQLSGEE------------FD------------------GV-TRAL
A0A519UDD1      ----VTTAG---RYTTVPSSL---------G--IK------------------DG-TLTS
A0A7Y2ACP6      ----AA-VE---SGTLENLDLYQLIAMTVGT--RF------------------ES-SLQA
A0A2A4N9A6      ----L--------NNNISLENIILLPKE------A------------------YV-TIIG
A0A6C0GGI1      ----IT-------GQDLEMSQVPITA----G--IN------------------DQ-IIID
A0A368D1N7      ----AVMVQ---QEEDLNLASTQLSGEDFDG--VT------------------RA-LSVD
A0A3B8TU58      ----AVMVE---QEEDLSLASTQLSGADFEG--II------------------NG-LSVS
A0A1T5IIR6      ----VSGAE---SYRLIPGNM---------G--LE------------------DN-SMDE
A0A3E0QD27      ----TSDSE---VESLLPFLS---------G-SYS------------------DG-VILS
A0A0K2HKS3      ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
B6W3W8          ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
A0A0M1W1I6      ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
A0A4R4GHU2      ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
I8WPR6          ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
A0A076IRY8      ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
A0A3A6AD54      ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
A0A8B3EPF6      ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
I8WPP8          ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
A0A372Y7D2      ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
A0A7K3KFI2      ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
A0A3E4JJC9      ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
A0A3E4WDQ0      ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
A0A414H9P2      ----VDPSK---ETELISSNT---------G--IA------------------DI-NIET
A0A7K0JKU9      ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
C3R5A8          ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
A0A6N8DCX3      ----TGGKK---RNQLIPVNL---------G--LE------------------NT-DIEG
F0R0C9          ----TAASS---RNQLLPANS---------G--IE------------------SA-NIEQ
A0A1C5XJA7      ----TDPKK---EADLIPSNT---------G--IS------------------DM-NIEN
A0A285T4L1      ----TDPTK---NRDLIPSGT---------G--IS------------------DA-SVEG
R7CUW4          ----TDPSK---ETDLIPSNT---------G--LS------------------DM-NIES
A0A416GGJ1      ----IDPAK---ETDLIPANT---------G--LS------------------DA-SVES
D1JY72          ----VDPSK---ETELIPSNT---------G--IA------------------DI-NIET
D7J4K6          ----TDPTK---SRDLIPSGT---------G--IS------------------DA-AVEG
Q8ABP9          ----TDPTK---SRDLIPSGT---------G--IS------------------DA-AVEG
D6D2Z5          ----TDPTK---SRDLIPSGT---------G--IS------------------DA-AVEG
A0A1T3EDR4      ----KDADK---SKGLLPSNM---------G--LS------------------GG-NIEQ
A0A6N8KXI9      ----RSAER---TKDLIPNNT---------G--LV------------------DA-NVES
A0A174SDD8      ----QDSSK---DDELIPSNI---------G--LE------------------DL-NIES
A0A1H7RFH3      ----QDSSK---EDELIPSNI---------G--LE------------------DL-NIET
A0A139L1N2      ----QDSSK---EDELIPSNI---------G--LE------------------DL-NIET
A0A174TVL8      ----QDSSK---EDELIPSNI---------G--LE------------------DL-NIET
A0A1H8BJR6      ----QDSSK---EDELIPSNI---------G--LE------------------DL-NIET
R9H6G0          ----QDSSK---EDELIPSNI---------G--LE------------------DL-NIET
A0A412GR09      ----QDSSK---EDELIPSNI---------G--LE------------------DL-NIET
A0A7J5JXN6      ----QDSSK---EDELIPSNI---------G--LE------------------DL-NIET
R6D982          ----QDAAK---EDELIPGDI---------G--LT------------------DA-VIEG
A0A1F0I8C4      ----QDSGK---EEELIPGNI---------G--LT------------------DI-NIES
A0A3A5RIJ2      ----QDSGK---EEELIPGNI---------G--LT------------------DI-NIES
A0A515IZJ5      ----QDSGK---EEELIPGNI---------G--LT------------------DI-NIES
A0A7J4Y2H6      ----QDSGK---EGELIPGNI---------G--LT------------------DI-NIES
A0A4R6WE41      ----TADGK---SKELIPNNT---------G--LV------------------DA-NVEG
A0A2T5RP38      ----NNKN----RNELIPNNT---------G--LV------------------DA-SVES
A0A1A6CF06      ----NNKNK---RNALIPNNT---------G--LV------------------DT-GVES
A0A1T3D6S8      ----TNKNK---RNALIPNNT---------G--LV------------------DT-GVES
A0A8B4GMS2      ----TNKNK---RNALIPNNT---------G--LV------------------DT-GVES
A0A7Z7LUP7      ----TNKNK---RNALIPNNT---------G--LV------------------DT-GVES
A0A0B8T471      ----DNTES---RNDLIPSNT---------G--LV------------------ED-NIEA
A0A4R7D2K0      ----ENDVD---RNDLIPSNT---------G--LV------------------ED-NIES
A0A7T9S3V1      ----DNKTK---KNELIPSNT---------G--LV------------------EA-NIES
A0A7T9LVI2      ----DNKTK---RNELIPSNT---------G--LV------------------EA-NIEN
C2FUH6          ----DNKTK---RNELIPSNT---------G--LV------------------EA-NIEN
A0A1V3N3U3      ----HDANK---RNELIPNNT---------G--LV------------------DG-GVEA
A0A1P8E011      ----SDGSK---KNELIPNNT---------G--LV------------------DA-SVET
A0A7T9S8K4      ----ADGSK---KNELIPNNT---------G--LV------------------DA-SVET
A0A2X2J8S4      ----SKSDK---QTALIPNNT---------G--LI------------------DG-NIEG
A0A3C0S618      ----SKSDK---QTALIPNNT---------G--LI------------------DG-NIEG
A0A4P7DRF9      ----NDPAR---ARDLIPSNT---------G--LV------------------DG-NIES
A0A239XXC4      ----SDPSR---VDDLIPSNT---------G--LV------------------DN-NIEG
A0A4U9K473      ----SDPSR---VDDLIPSNT---------G--LV------------------DG-SIEE
A0A081PBV5      ----RDADK---KDDLIPNNT---------G--LV------------------DV-NIEN
A0A1I2AN85      ----RDADK---KDDLIPNNT---------G--LV------------------DV-NIEN
A0A4U0GMP3      ----EDAER---RNDLIPNNT---------G--LV------------------DM-NIES
A0A0D5BSQ0      ----GSRDQ---KNALIPNST---------G--LV------------------DA-NVET
A0A1T3F6P5      ----TNRGK---QNNLIPNNT---------G--LV------------------DS-GVEG
A0A853VUQ0      ----TNKGK---QNNLIPNNT---------G--LV------------------DS-GVEG
A0A7X0MJ00      ----IK--K---NNDLIPSNT---------G--LV------------------DN-NIEN
A0A841JHZ0      ----ID--K---DKELIPSNT---------G--MV------------------DN-SIES
A0A1H6CKR6      ----DDPSK---RDELIPSNT---------G--LV------------------DQ-SIES
A0A7W3MGA7      ----SDPSR---VDDLIPSNT---------G--LV------------------DN-NIED
A0A3M1Y2F5      --------------------------------------------------NINDP-FLQS
A0A7V1ALN2      ------------------------------------------------------------
A0A3D4RLG4      ----------------------------------------------MHKYKATSK-ICRK
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      QNLNTNASEEKQLAVHLKIVK---------L--LEGHLRAKPSAAIPSALYPQEG-NFEA
A0A2P8G5K0      QKSATNALEEKELAIRLKIVR---------L--LEAHLLEKPAAAIPSALYPQEG-TFEA
R5DEG6          T-------DPGKNSDLIPANT---------G--IS------------------DV-NIES
A0A4Q3SEI4      L-------AKDRQIGVVPAIT---------S--VK------------------DP-MLGQ
A0A836SQI2      E-----NQKSINVYEIIGLLT---------G--IE-----------------SEN-LLMS
A0A7V1FAJ9      SQNDLKNNEKSYVYREMANQE---------I--FA-----------------NDP-SMGI
A0A3N2LCI3      --------------KMLPMNS---------G--VA------------------NV-DIQS
A0A6H9Q899      ----------------LPANS---------G--IE------------------SV-NIES
A0A3D4CJE1      K----NANDNMQVYDLLSILA---------G--TD-----------------YES-TING
A0A7C7LI79      T----NTED-IDVYKLLPVLT---------G--AS-----------------FQE-EITD
A0A4Q5ZQ60      ------------VESFLPSLS---------L--VN------------------DQ-MLGE
A0A519Q885      EQERLTVRENQTVTQNIPGLV---------D--LS------------------DP-VLVQ
A0A519TAP8      NRDQLTRNEDETVADNLPGLT---------E--LE------------------DP-VLVG
A0A848Y4B8      ERAAELSGRLETIYLRNPDFR---------T--ADQ----------------VPD-DVQT
A0A7Y4V8Y1      VAINATDSARFQLTKKIGQLN---------S--VIEQINDNKLPFSLQQQRFLPE-YVNR
A0A5Q4EKA0      E-----QDNEVDIYRLIAILA---------G--------SE-----------FSG-MVSR
A0A519SYE7      ARGQLTRSENETVANNLPGLT---------E--LNDPLLAG-----------MLN-ELDE
A0A7C7CFR2      A-----NKEDIDVYNLLPALT---------G--------SS-----------FQD-EISR
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A847AMH6      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A7V1FAS7      ------------------------------------------------------------
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      FLNGINQLQKERERLLL----------NVTQDNHNVRIID----NQIAEQK----RMLQE
A0A7C7CKY6      LISNLHNLLATKEQALY----------TITANSEEAKSLD----YQIDVQK----RLLVA
A0A1G1TG88      LLGQLNGMQWDQERVRR----------SYTGATEAVQQKN----AQMDYTL----SSILR
A0A661XXA6      LINELNLLINDREKLGL----------SYRENTYTYKARQ----KEIDLLK----SDLLG
A0A519SD85      MTSKYQDLVIKRNHLLK----------QYTISSKFVTDID----QEIEIFR----NSITN
A0A3M1TXY5      LLVDLARLKQERAAIRL----------TAKERSPKVQNID----AKINNVR----QAILK
A0A7T9KM12      LIDKYNQDVNELATKRL----------TERQQSAPTIALA----RKVQTER----NQIIQ
A0A2E0VQ27      SYLKAQSYEEQRQDYLQ----------KYTLQHPLILNLD----QKIKETR----AFLNE
A0A7Y7TYP1      LMLELTTAQAQHSNLLE----------NKQEKNPLVKKLE----IQIANIR----KTIIE
R6U429          QIGEYNQLVLSRDRLVS----------GSSSENPLVLDYN----NSIAALK----IAINR
A0A5C8AF42      QIASLYDLLEKKEDLLY----------RVTDENSEVKALN----SKIQTKL----NSIRK
A0A7Y5SYP1      LQQKIAETESRRDIQRA----------TLDTAAPAAKAEMERLEREAKNLR----ELLEK
A0A7V1N701      LKERIIDLQRRIDVLLK-----------QDPHSPQVDLLR----GELGAAR----DSLLT
A0A7V2NIA8      IRGEIRTLEAR---LVS-----------LSEDSQEYDEVQ----QQITSAQ----QNLVE
A0A239K409      LISRFNELQLERERLLR----------TTEKINPIILSID----QQLQSLR----VNILE
A0A1M3DPL8      IVQQINDLLLKRSELTE--------------KNIFHSKYT----REIDNLK----TAINE
A0A1V5F519      LVQQINELYLQRSELTE--------------KNLYYAKYT----KAIENVK----TSIFE
A0A2G6R1T9      LAQQFNELLEERNSTSR--------------KNPVYKKLT----REINNIK----ASINE
A0A350V3E4      LQGEIARLEIQRDLAKTGNDELVKNSKSLKDINNKVAELKRSLDEKLNILK----EGANS
A0A6J4K208      RLGRYNDLLREREQLQL-----------DNAPAGRISKVN----AQIQKTR----VGLVE
A0A2W4RDE8      LLIELSKLNQERSGLNY----------SAREGNPLAQVIE----LKITNLK----ASITE
A0A212J9Z9      FVVTYNELLQKARNLGA--------------KNPLYNKTI----DELNDLR----VKILQ
F5IV23          FVVKYNELLQKARNLGA--------------KNPLYNKTI----DELNDLR----VKILQ
A0A1M5DFS8      SVGEYNKIVKKLASMGE--------------AHPLYAKSE----QSMNNLR----IKILE
A0A4Y8KZS5      SIADYNNIIKKLASMGE--------------AHPLYSKSE----QSMNSLR----IKILE
A0A2V3PNY7      SIGEYNNLVNKLSSMGS--------------AHPMYAKSE----QSLTNLR----INILE
A0A6G7X5K8      SIGEYNSLINKLASMGS--------------AHPMYAKSE----QSLTNLR----IKILE
A0A840CJ33      LIIKYNEIINRAKNLGP--------------KNPLYNRII----DQLNDYR----KQILT
F8X2T0          YVEEYNQELRKSKNLGP--------------KSPIYMTAI----NKLNESR----VQILR
A0A1M3LAG1      YVEEYNQELRKSKNLGP--------------KSPIYMTAI----NKLNESR----VQILR
A0A212K6G4      YVEEYNQELRKSKNLGP--------------KSPIYMTAI----NKLNESR----VQILR
A0A4Y9IPG7      YVEEYNQELRKSKNLGP--------------KSPIYMTAI----NKLNESR----VQILR
A0A0L8VEV2      LVTQLSDLYRQREVFSY----------TVQEKNPKLILVN----NQIEMVK----RNLQE
A0A1I2A9Z9      LVVHLSDLYRQREVISY----------TAQEKNPKLILIG----NEIEMVK----RNLRE
A0A848XXC6      ELRQLDSQITELERVVEQIYLRNPEFRGNPNAHPDLRELE----SRLQRLR----TEKRR
A0A2P8CDS1      LLQELSQLNIEKTTLSA---------TVKDPDHPRMRQLN----IQMETTK----RTLLE
A0A660LQT8      MIGDYNSNVLQRNRLVM----------NSSTSSPLIADLE----DRISKQR----QVIGV
A0A3D0FMX4      LVTQLNDLQIKRAELSE--------------KNIYYDKYT----TDMQNIK----VAILE
A0A7V6G854      LVTQFNDLQLERSQIGE--------------KNPNYKRVT----ENIEKIR----QALFE
A0A1M3MEI8      LVQQINELIMKRAELPE--------------KSMFHSKYT----REIETVK----NAINE
A0A1J5HQM0      LVSQINDLNLKRSELSE--------------KNMYYAKYT----RDIDHIK----VAINE
E4T131          LVEQVNDLYNQRSDLTE--------------ANPYYAKFT----KQIETSK----LTILE
A0A653AC35      LVQQFNDAVTLRNETTE--------------KNPLYSKYN----REVEALR----TSINE
A0A847LA02      LVQQFNNVIAKKNETSE--------------KNPLYSKYE----REIEGLK----KSINE
A0A389LWV6      LVSKYNDIFFEIK--------------GLGSENPIYKRYK----LQLTDIK----SSINQ
A0A1G9B1T9      LLRNLIELNQQRAQLKT----------SVRQSLPAIEELD----AKVKSIR----AQLHE
A0A350PNH9      QITEYNKQQLERNNLVA----------NSSEQNPLVADYD----QSLASMR----HSIVT
A0A354LNT9      QITEYNKQQLERNNLVA----------NSSEQNPLVADYD----QSLASMR----HSIVT
A0A161LWY6      LLTQYNETIRKLL--------------QTTPQNPFYAKYQ----EELNKLK----GSLTD
A0A6I3N9U6      LLTQYNETIRKLL--------------QTTPQNPFYAKYQ----EELNKLK----GSLTD
A0A353WYK7      DINRLEELKKEMNILKG----------AYKTNTFAYRKKK----EEINFLR----ERIIG
A0A2W7RD29      LIDELINLQNEKSNQLV----------TLTDSSPIVIEQQ----KRIVISK----KNTLE
A0A3N2NDY8      QISNYNNLLLTRNTLAA----------SSSDTNPLVVDYD----GQIKGLR----EAIVN
D7JEV9          LVDKYNELQIKLLDLGV--------------KNPQYDVVI----SQIRQIK----TQLNE
A0A553GA49      LLNEYIGLVGRKQHLLE----------NKQAKSPQLRELT----FQISNLK----NTILV
A0A7V5GTN5      LRSRLDDLNNRLSELIE---------------GSLVTTLDSLKFNNLQVER----KQVLS
A0A497D6F6      LILELNNLSIEKSSMTS----------VKNTEHPKLKRLN----AQIENAK----SNLLE
F4KR18          LIQPYNDLVMERERFLT----------KGQTSNPVVQSNN----QKLKSLQ----SSINL
B5CTK0          SIATYNAMLLKRDKLID----------SSSDKNPVVVNLN----NSLSALK----QTIIR
A0A5M4AAB9      LLQDLNQLNIELSTLAA---------TVHDPEYPRMRQLR----IQMETTK----RTLLE
A0A5R9QZP0      MILELLELNAERSAILS----------SKAEKSLFLGQIE----NNIRLQK----QSIVE
A0A7X6SRJ5      LVLDLLGMNAERSAILS----------NNAGKNLFLGQLE----NKIRLQR----QTIIE
A0A3D3HL11      MIMELQQSSAERANILS----------NNAEKNLFLGQIE----NKIRLLK----QAIIE
A0A6L8U6G9      LVLELFALNSERATILS----------NNAEKNLFLGQIE----NKIRLQK----QAIIE
A0A6L8UH35      MISELLNLYNQRSTITA---------GSSTDKNIFLGQID----NRIRMQR----QAIIE
A0A7X9F2J5      LITELLNLYNQRSSITA---------GTSNDKNIFLGQID----NKIRLQK----QAIIE
A0A352ME00      MITNLNDLNAQRSTIIA---------GSNPQKNIFIGQID----SKIDFQK----QIILE
A0A7X8CRA6      LITTLNDLNLQRSSLLA---------GSNPQKNIFLNQID----AKIAAQK----QTIIE
A0A1F3D6P8      LITQLLLLYSQRSGIAS----------NNAEKNLFLGQID----NKIKVQK----QAIIE
A0A356Z058      LITQLLLLYSQRSGIAS----------NNAEKNLFLGQID----NKIKVQK----QAIIE
A0A7X8FHL3      LISNLNELTAQRSSLLA---------GSNPQKNIFIKQLD----ERINFQR----QIILE
A0A3D1BT36      LVLELLDLNSQRSAILS----------NNVQKSLFLEQIE----NKINLQK----QTIIE
A0A7X7CXW9      LVLEMLALNAERSTILS----------NNAEKNLFLGQIE----NKIRLQK----QTIIE
A0A4R6H3B7      LVVHLSDLYRQREVISY----------TAQEKNPKLILIG----NEIEMVK----RNLRE
A0A229I3A5      QITEYNKSQLERNNIVA----------NSSEQNPLVADYD----QSLTSMR----KSISA
A0A3R6HJB3      QITEYNKSQLERNNIVA----------NSSEQNPLVADYD----QSLTSMR----KSISA
R6NN15          QISEYNNLQLQRNNLVA----------NSSEQNPLVVDMD----ESLRSMR----RSIVS
A0A2W7QSQ0      LLTQYNTLQRDKQRIIR----------IVQPNNPQLLSLN----DQIVNVK----SNILA
A0A841MQL4      LLTQFNELQRQKQRIIR----------VVQPNNPQLLSLN----DQISNVR----STILA
A0A3P1Z8V4      QITEYNRLVLTRNRYAV----------NSNDDTPAVRDLD----RQLEALR----SAINT
A0A1M6MYT6      LILQLNDLINERLSQTS---------IRQNSEHPTIVRLN----AQIASVK----NSLRE
A0A1V5S1J9      LVSQFTEMQLKRKEIGV--------------KSPLYAKYT----RDIDAVK----AQMYE
A0A7X8JMH1      LVKDFTEVMFKKKEVGE--------------RSPLYAKYT----RDLSNIK----EQMFE
A0A3D5KRY6      TVKKLNGLYSNREVLSY----------TVQEKNPVLVSLN----NEIRFTQ----KSLLE
R7F6L5          QIQVYNQQVIERNRLLK----------TTGANNPQVVEKD----EALRTMK----RNIQH
A0A7C5MRV2      LISSYNGLVQEKLAALQ----------SYTASHPKVKEMD----SKLEELR----FSISE
A0A0A2EYC8      LVDKYNELQIKLLDLGV--------------KNPQYDIVF----NQISQTK----AQLNE
A0A2G6H6Y4      LVDKYNELQLQLIDLGV--------------KNPQYEIVI----AQIEQIK----KQLKE
C9LKL0          LVNEYNTMMIERNSTEK----------NSSPNSPLVKDLD----SKLTTMR----NTILS
A0A3D0QPV7      MVKELHVLILTKEKEKF----------SSTSKSTYMKSLD----YQIDIQL----KMINQ
A0A496KT23      QINDYNTRLLERNRLLA----------TSSAQNPAVMDLE----TQLGSIR----RGIIQ
L1M9T3          QINDYNSKLLERNRLLA----------TSSAQNPAVMDLE----TQLGSIR----RGIIQ
A0A2M6GH67      KIAELSSLQRSYKILLL----------SYKKTTQTVKIRE----EEMRLTK----EAVTE
A0A7K1TE30      LLNELNTTQQNLRRLTR----------SYNETTEAVKQQR----SVLAYAR----IALQR
A0A7D4BE70      QLTELNSLQQNLRRVER----------SYTDKTEALAQIR----AQVKFAT----NTLNR
A0A142HHS5      QLNNLNALQQNLRRIRR----------SYQDRLEAVQGPL----AQLKFAQ----ATLQH
A0A7D4C435      QLDELNTLQQNLRRIRR----------SYQDATEAVKQPK----AMVAFAQ----TTLKH
A0A3C0I8F1      LILKINALFSEIASISY----------YKTDNNATLKVKR----TQLIKYQ----KELRA
R5JJI4          QIKEYNDMLLKRDKLVA----------GSSNKNPIVIDLN----NSLGAMK----QTIIR
A0A848IUK4      LIININTLENERLQLLE----------KYNENTYAVRKLN----NELNVYR----GELND
A0A136LSC7      RIEELHKKTRERDKLAL----------AYNENTFAFRQKE----REVSLVK----DELFN
A0A5C7N8Q5      RMEELYKQARERDKLGL----------AYNENTFAFRQKQ----KEVTLLK----DELFS
A0A355BP94      RIEEYLKLVRGKERLAL----------SYKDNTFAYQQKD----QELNAAR----TALFT
A0A7Y5D1K7      RIEEFQKITQDQNKLTL----------SYKDNTYAFQQKE----KEVNTIK----SALFG
A0A3D2HF71      LVEELSQLQKQKKQLSL----------NLLESTGPLRVLE----GNIANTR----IAISN
A0A0A2DQN2      SIGQFNQIKQERDLWMQA--------TGASQDNPIVERYN----QSMHVAR----AAVAR
A0A0A2F2N5      AITAYNQVKPEYDRWLAT--------TGGMEDHPMVQKYA----KAMEQTR----MSISH
L1NGW4          YIAKYNQLKGDRDRLVKA--------SEGSTENPVIAEYD----RGLAQIR----QNAIS
Z4WRA0          YIAKYNQLKGDRDRLVKA--------SEGSTENPVIAEYD----RGLAQIR----QNAIS
U2K8K9          YITQYNQLKFQRDKLVES--------SGGSTQNPVIAEYD----ATLDQLR----KSATE
A0A069ZM60      YIAQYNQLKSQRDKLVEG--------AGGSTENPVITEYD----NALSQLR----KNAIE
J6GV98          YIAQYNQLKSQRDKLVEG--------AGGSTENPVITEYD----NALSQLR----KNAIE
A0A134B4F8      YIAQYNQLKSQRDKLVEG--------AGGSTENPVITEYD----NALSQLR----KNAIE
A0A134B8C7      YIAQYNQLKSQRDKLVEG--------AGGSTENPVITEYD----NALSQLR----KNAIE
A0A4Z0EKR0      LIGKFNELQQERKRMLR----------TTEPSNPIVQNIN----EQLASLR----ISILE
A0A521H707      LITKIQALEDQKTTLKF----------LATEHNAAVISLE----KDIAFQR----SNLIL
A0A7T9D909      LIRHLRAMLAERDLMAT----------EATPSHTGLKALD----DRIQVQR----TMIIE
A0A1M6B6D5      GVGKIVSLAEQRNKLQY----------SFKEDAPVFNDID----RQIDAVK----IVLLE
A0A451FS66      GVGKIVALAQERNKLQY----------SFKEGAPVFNDID----RQINAVK----SVLLE
A0A2E3GN39      SVDEILKLEYEKESALM----------QVTPEHPTVVLIE----RNLDKAR----ATLIA
A0A3D1MEL0      SVDEILNLEYEKESALM----------QVTPEHPTVVLIE----RNLDKAR----ATLIA
A0A519UDD1      LIGKYNELQIERQRLLP----------NLEPSSILIQNVN----EQLANLR----ANTLE
A0A7Y2ACP6      MLTQLADLLRSKEEVYF----------EVTENSDVVKSLD----YRIQIQR----DLIVQ
A0A2A4N9A6      QLRELEL---QKKFLAQ----------HETELGPNTKLIN----GQIKANK----KILLY
A0A6C0GGI1      LVRQLDILYQERAKLAL----------SIRSDNPLYQQQQ----EKIVNTR----NTIIE
A0A368D1N7      EILKLEY---EKESALM----------QVTPEHPTVVLIE----RNLDKAR----ATLIA
A0A3B8TU58      EILNLEA---EKEKALM----------QVTPEHPAIVLIE----RNLDKAR----VTLVA
A0A1T5IIR6      VIARYNDLVLQRDRLVA----------ASSTTSPAVLKLE----NTLGSLR----SNILG
A0A3E0QD27      IVSKIHELEDKRSNLRF----------IATDKNAAVISLE----QDIDFQK----KNLVM
A0A0K2HKS3      QIAAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
B6W3W8          QIAAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
A0A0M1W1I6      QIAAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
A0A4R4GHU2      QIAAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
I8WPR6          QIAAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
A0A076IRY8      QITAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
A0A3A6AD54      QITAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
A0A8B3EPF6      QITAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
I8WPP8          QITAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
A0A372Y7D2      QITAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
A0A7K3KFI2      QITAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
A0A3E4JJC9      QITAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
A0A3E4WDQ0      QITAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
A0A414H9P2      QITAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
A0A7K0JKU9      QITAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
C3R5A8          QITAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
A0A6N8DCX3      LITEYNTVQLKRNNLIT----------NSSDQNPLIADLD----QSLASMR----TSIVS
F0R0C9          QIGEYNTMQLQRNNLVA----------NSSEQNPLVKDLD----QSLASMR----RAIIT
A0A1C5XJA7      QIGMYNAAKLKRDRLIS----------DSSDKNPVVEELN----SSLRAMK----QSIIR
A0A285T4L1      QINQYNALKLKRDKLIA----------DSSESNPVVEELN----NAIHALR----QSIIR
R7CUW4          QINLYNTAKLKRDRLIS----------DSSEKNPVVEELN----NSLRAMK----QTIIR
A0A416GGJ1      QINTYNELKLRRDKLID----------DSSDKNPVVEEMN----NSLRAMK----QNIVR
D1JY72          QIAAYNANKLKRDKLIE----------GSSDKNPIVQELN----KNLIAMR----QNIIR
D7J4K6          QINQYNALKLKRDKLIA----------DSSESNPVVEELN----NSIHALR----QSIIR
Q8ABP9          QINQYNALKLKRDKLIA----------DSSESNPVVEELN----NSIHALR----QSIIR
D6D2Z5          QINQYNALKLKRDKLIA----------DSSESNPVVEELN----NSIHALR----QSIIR
A0A1T3EDR4      QIQAYNSFFLKRNRLME----------GGNNKNPVVRDLD----ASLVSLR----QEIQR
A0A6N8KXI9      QINEYNNILLKKNRLEE----------GSSSENPIVKELN----RDLSSMR----GNINR
A0A174SDD8      QIARYNETLLRRNRLMN----------GSSSNNPVVQELN----RTMQTMK----QNIYR
A0A1H7RFH3      QISRYNETLLRRNRLMN----------GSSSNNPVVQELN----RTTQTMK----LNIYR
A0A139L1N2      QISRYNETLLRRNRLMN----------GSSSNNPVVQELN----RTMQTMK----LNIYR
A0A174TVL8      QISRYNETLLRRNRLMN----------GSSSNNPVVQELN----RTMQTMK----LNIYR
A0A1H8BJR6      QISRYNETLLRRNRLMN----------GSSSNNPVVQELN----RTMQTMK----LNIYR
R9H6G0          QISRYNETLLRRNRLMN----------GSSSNNPVVQELN----RTMQTMK----LNIYR
A0A412GR09      QISRYNETLLRRNRLMN----------GSSSNNPVVQELN----RTMQTMK----LNIYR
A0A7J5JXN6      QISRYNETLLRRNRLMN----------GSSSNNPVVQELN----RTMQTMK----LNIYR
R6D982          QIARYNEALLRRNRLRS----------GSGGNHPVVQELT----RSVETMR----QNINR
A0A1F0I8C4      QIARYNETLLRRNRLVS----------GSSSNNPVVQELD----RSMQTMR----QNIFR
A0A3A5RIJ2      QIARYNETLLRRNRLVS----------GSSSNNPVVQELD----RSMQTMR----QNIFR
A0A515IZJ5      QIARYNETLLRRNRLVS----------GSSSNNPVVQELD----RSMQTMR----QNIFR
A0A7J4Y2H6      QIARYNETLLRRNRLVS----------GSSSNNPVVQELD----RSMQTMK----QNIFR
A0A4R6WE41      QIVEYNKALLRRNRLEE----------GSSMANPVVQELD----QGLDAMH----TNILR
A0A2T5RP38      QIAEYNMALLKRNRLAE----------GGNTLNPVVVDLD----EALKSMR----NNINR
A0A1A6CF06      QIADYNTALLKRNRLAE----------GGNSANPVVLDMD----EALNSMR----NNISR
A0A1T3D6S8      QIAEYNTALLKRNRLAE----------GGNSANPVVLDMD----ESLNAMR----NNISR
A0A8B4GMS2      QIAEYNTALLKRNRLAE----------GGNSANPVVLDMD----ESLNAMR----NNISR
A0A7Z7LUP7      QIAEYNTALLKRNRLAE----------GGNSANPVVLDMD----ESLNAMR----NNISR
A0A0B8T471      QITEYNEVLLKRNRLVG----------GDNSANPIVKDMD----AALRAIR----DNISR
A0A4R7D2K0      QITEYNEVLLKRNRLVS----------GDNSENPIVKDMD----AALRAIR----DNISR
A0A7T9S3V1      QITDYNSTLLRRNRLVE----------GSSTENPVVQDMD----RALGAMR----NNIDR
A0A7T9LVI2      QITDYNTTLLRRNRLVE----------GSSTENPIVQDLD----KALGAMR----GNIDR
C2FUH6          QITDYNTTLLRRNRLVE----------GSSTENPIVQDLD----KALGAMR----GNIDR
A0A1V3N3U3      QITEYNRALLRKNRLVE----------GSSTANPVVQDLD----KALAAMH----ENISS
A0A1P8E011      QINDYNTTLLRRNRLIE----------GSSDANPVVQDLD----RALQAMR----GNIGR
A0A7T9S8K4      QINDYNTTLLRHNRLIE----------GSSDANPVVQDLD----RALQAMR----GNIGR
A0A2X2J8S4      QIQAYNTLQIRKNKLME----------DGNSENPIVKEID----KSLNTMR----SGIER
A0A3C0S618      QIQAYNTLQIRKNKLME----------DGNSENPIVKEID----KSLNTMR----SGIER
A0A4P7DRF9      IISEYNSVLLKRNRLQA----------GENSNNPIVQDMD----NALVAMR----ENIVR
A0A239XXC4      IISEYNTLLLRRNRLMS----------GNSSENPIVQDLN----NALSQVR----QNIAR
A0A4U9K473      IIAEYNTLLLRRNRLMS----------GNSSENPIVQDLN----NALTQVR----QNIAR
A0A081PBV5      RINEYNTASLRRNRLLE----------GSSSENPIVQDLN----ITLAAMR----KNIYR
A0A1I2AN85      RINEYNTASLRRNRLLE----------GSSSENPIVQDLN----ITLAAMR----KNIYR
A0A4U0GMP3      QINEYNVALLKRNRLVE----------GGSFSNPIIQDLD----NALQAMR----KNIDR
A0A0D5BSQ0      QITEYNTALLKRNRLAE----------GGNTSNPVVLDLD----EALKAMR----NNIGR
A0A1T3F6P5      QIAEYNKALLKRNRLAE----------GGNTANPVVLDLD----DALAAMR----TNIGR
A0A853VUQ0      QIAEYNKALLKRNRLAE----------GGNSSNPVVLDLD----DALGAMR----TNISR
A0A7X0MJ00      QIAEYNIVLLKKNRLQE----------GNNSENPAIKDLD----AALMAMH----KNIIR
A0A841JHZ0      QITEYNSLLLKRNRLLE----------GNNSANPVVKDLN----VVLAAMH----QNIMR
A0A1H6CKR6      IITEYNTLLLRRNRLTA----------GNSSENPIVQDLN----TALNALR----DNISR
A0A7W3MGA7      IISEYNTLLLRRNRLMS----------GNSSENPIVQDLN----NALSQVR----QNIAR
A0A3M1Y2F5      LMGKLTELVSERAELDF----------SVTADNPNIDRIN----LEISRVK----SSLLE
A0A7V1ALN2      ---------------------------------LYIEKIF----TEVEISS---------
A0A3D4RLG4      KNWRWSLSNAITELMTT----------TXTQKNVYYAKYT----KDIENVK----TAINE
A0A2T2UAJ4      ----------------------------GGKGVGYVAEQR----RGLAQSR----IELNG
A0A6I0DZQ5      -------------------------------------KYT----REIETVK----NAINE
A0A1H6Z2F8      LIGKYNEMELSRTRALA----------SLAPGHPDIRSIE----KQMEVLR----TNLFD
A0A2P8G5K0      LAGKYNEMQMARIMALA----------TLAPEHPQLRSLE----KQIEVLR----NNLLD
R5DEG6          QIGEFNEMLLKRDKLIS----------NSSSKNPVVQDLN----NSLIAMK----QTIIR
A0A4Q3SEI4      LLNSLFESEMQYEKLKK----------TIPGGNPTMYTLK----TQIENLR----PAILE
A0A836SQI2      ILNNLQELFSKRQSLLN----------DITDNNLKIKLID----KQIAQQK----QEILK
A0A7V1FAJ9      LRQQLNDLEKRKDVLAG----------QYTETHPKVIEVS----QQIDQTQ----NKIRK
A0A3N2LCI3      QITDYNNLVLQRNSLLA----------KSSDKNPLVVQLN----EQMDQMR----HAILA
A0A6H9Q899      QIAEYNKQLLQRNSLVA----------NSSAENPLVVDMD----QALASMR----GAIIR
A0A3D4CJE1      LITNLQRLLDKKQQLQN----------EVTPDSEILKTLN----LQIEAQR----DLIIE
A0A7C7LI79      LLSKLNALLSSKEEVLY----------TATTQSEEIKAFN----YRIEVQK----KLLIA
A0A4Q5ZQ60      QMKALVELQKQHALLMG----------SAKKATFAVKSKE----EEITFVK----NNIAE
A0A519Q885      LLEQLNKEQINLARVKR----------SYKESTFAVEDQE----ANIIITR----QAVRK
A0A519TAP8      LLDLLDSQQRSLRLTLK----------SQTDKTFAVQRNQ----AVIRDTR----ELLQR
A0A848Y4B8      LRDEIAQIRGRVSDLTQ----------EYLEEAVPVGVDG----NSAAMQRITTLRRQLA
A0A7Y4V8Y1      KLEDFNKLQQDRDRLAL----------AYNENTFAFRQKE----KEVSLAK----ETIFK
A0A5Q4EKA0      MLQNLQDLLIEREQLLY----------QVTPESSQIQALN----HQINIQR----KLVVE
A0A519SYE7      QQRSLRLTLLSQTNKTF----------AVQRDQADIQETR----AALERQL----SRDQA
A0A7C7CFR2      LVNSLHELLAKKEEILY----------TATPESEAIKKVD----YQINVQK----KLLVA
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      --------------------------------------------ENIETIR----QQLIS
A0A3D3LSK1      -----------------------------------------------------------N
A0A496L711      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A847AMH6      --------------------------------------------ENISNIL----DQNEL
A0A7C3PTI0      ------------------------------------------------------------
A0A7V1FAS7      ------------------------------------------------------------
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      FITIT------------------------------------NERLKTQIESAQ-------
A0A7C7CKY6      MLEAL------------------------------------SNKLVNKQESLH-------
A0A1G1TG88      QITQA------------------------------------RKALANRIALLD-------
A0A661XXA6      QIENA------------------------------------KENTIEDESDLV-------
A0A519SD85      NLLLQ------------------------------------HKLLTEKGNLIR-------
A0A3M1TXY5      NVNTS------------------------------------IRANNIAISNVN-------
A0A7T9KM12      SAQDA------------------------------------RRGAQLDLDQIT-------
A0A2E0VQ27      SVNST------------------------------------LENLQQKTLELE-------
A0A7Y7TYP1      NISAV------------------------------------RQTTNISIDELN-------
R6U429          SIENL------------------------------------ISTLKLQADKVA-------
A0A5C8AF42      SVAAI------------------------------------LERLYANSRSVQ-------
A0A7Y5SYP1      RIEES---------IQSELPGSNTMELVRQNQNKIAVGTVSIVIENFKIEKLQ-------
A0A7V1N701      TISEA--------QSGEPKLRQERSALLSALIDKRTESELNLVGLRNKQAFLR-------
A0A7V2NIA8      AMTSA---------AGVSTLKSERAAKTASVIARLTEAEVQLTNLSNKINYIN-------
A0A239K409      NIHNI------------------------------------KGGLVLTRRNLK-------
A0A1M3DPL8      VIKNT------------------------------------KASINIQKDDLN-------
A0A1V5F519      LIKNM------------------------------------RASLEIEKNEVN-------
A0A2G6R1T9      AIKSM------------------------------------RKSIQIEKQDID-------
A0A350V3E4      NSPEE------------------------------------MRSLTSKYFETKVLNNQNK
A0A6J4K208      YAGSL------------------------------------ANRARQRTLLLD-------
A0A2W4RDE8      NVSNI------------------------------------IDATNIALNDLN-------
A0A212J9Z9      EIQVS------------------------------------QINLQNQKDALV-------
F5IV23          EIQVS------------------------------------QINLQNQKDALV-------
A0A1M5DFS8      DLRNA------------------------------------QDKVQEKKENLN-------
A0A4Y8KZS5      DLRTA------------------------------------QDKIQEKKELLN-------
A0A2V3PNY7      ELRAL------------------------------------QDRVQNKKESLD-------
A0A6G7X5K8      ELRGL------------------------------------QDRIQNKKEDLN-------
A0A840CJ33      EVQSQ------------------------------------QVYLQDQKDALV-------
F8X2T0          ELQLI------------------------------------QVKLQDQKDLLV-------
A0A1M3LAG1      ELQLI------------------------------------QVKLQDQKDLLV-------
A0A212K6G4      ELQLI------------------------------------QVKLQDQKDLLV-------
A0A4Y9IPG7      ELQLI------------------------------------QVKLQDQKDLLV-------
A0A0L8VEV2      NLKNL------------------------------------INNAIVQIQGLD-------
A0A1I2A9Z9      NLKNL------------------------------------INNAIIQVQGLD-------
A0A848XXC6      LADQLAGDVAASGGLNPTADGANGESYMATLRQQIAQEQAALSGARAQTGALA-------
A0A2P8CDS1      NSRNI------------------------------------MHQSEITLNDLT-------
A0A660LQT8      SINNW------------------------------------LLTLQNQVKSLT-------
A0A3D0FMX4      VLSSM------------------------------------RASMDIEKKDLE-------
A0A7V6G854      VLKNV------------------------------------KAVNNLERKNFD-------
A0A1M3MEI8      MVRNM------------------------------------QVSMDIQKKDLN-------
A0A1J5HQM0      VTKNM------------------------------------RASLEIEKNDLK-------
E4T131          VIKSM------------------------------------RASLEIEKSDFN-------
A0A653AC35      VLKNM------------------------------------KTSLALDKEDLN-------
A0A847LA02      VIKNM------------------------------------RVSMQIEQSDID-------
A0A389LWV6      SIVSM------------------------------------KNSIGIEEADLN-------
A0A1G9B1T9      NVNNL------------------------------------IATTKYKIESVE-------
A0A350PNH9      SIDNF------------------------------------VVTLNSQLGNLQ-------
A0A354LNT9      SIDNF------------------------------------VVTLNSQLGNLQ-------
A0A161LWY6      ALRNV------------------------------------RAAFSIEKKDID-------
A0A6I3N9U6      ALRNV------------------------------------RAAFSIEKKDID-------
A0A353WYK7      YVEES------------------------------------RKGIYDKLDEIN-------
A0A2W7RD29      LVKSA------------------------------------ISNIDISIDDLN-------
A0A3N2NDY8      AINGQ------------------------------------IVALNKSLRNME-------
D7JEV9          LINSV------------------------------------SDVYKIEKSSYQ-------
A0A553GA49      NLQYE------------------------------------LDASRLALQQIR-------
A0A7V5GTN5      DLINQ------------------------------------MYTPENGMEDISATSRISL
A0A497D6F6      NVNNI------------------------------------ISQSELALTDVK-------
F4KR18          AIDHM------------------------------------QDDLNMQQNKLK-------
B5CTK0          SIDNT------------------------------------IVALNVKLKNLQ-------
A0A5M4AAB9      NSRSI------------------------------------MHQSELTLQDIS-------
A0A5R9QZP0      NVKNN------------------------------------LNALNLKINELN-------
A0A7X6SRJ5      NVKNN------------------------------------LNTLNLTQNELN-------
A0A3D3HL11      NVKNN------------------------------------LNTLNLTQNELD-------
A0A6L8U6G9      NVKNS------------------------------------LNTLNLTQNELD-------
A0A6L8UH35      NFTNN------------------------------------LNTLTLSLNELD-------
A0A7X9F2J5      NFTNN------------------------------------LNTLTLSLNELD-------
A0A352ME00      NFTNN------------------------------------LNTLTLSLNELD-------
A0A7X8CRA6      NFTNN------------------------------------LNTLTLSLKELD-------
A0A1F3D6P8      TVTNN------------------------------------LNTLNLSLNELN-------
A0A356Z058      TVTNN------------------------------------LNTLNLSLNELN-------
A0A7X8FHL3      NFTNN------------------------------------LNTLTLSLNELD-------
A0A3D1BT36      NVKNN------------------------------------LNTLSLTLNELD-------
A0A7X7CXW9      NVKNN------------------------------------LNTLNLTQNELD-------
A0A4R6H3B7      NLKNL------------------------------------INNAIIQVQGLD-------
A0A229I3A5      SLDNF------------------------------------VVTLKTQLGTLQ-------
A0A3R6HJB3      SLDNF------------------------------------VVTLKTQLGTLQ-------
R6NN15          SVDNL------------------------------------ITTLNTQIHSLE-------
A0A2W7QSQ0      NISSI------------------------------------KSNLLISKRNFE-------
A0A841MQL4      NIRSI------------------------------------KSNLAISKRNYE-------
A0A3P1Z8V4      SLANH------------------------------------VKSIELELRAAR-------
A0A1M6MYT6      NVDNI------------------------------------ISQSDMALENLN-------
A0A1V5S1J9      ALKNI------------------------------------RVGLDIQKADMQ-------
A0A7X8JMH1      ALRNI------------------------------------RVGFNIEKADFD-------
A0A3D5KRY6      NIESL------------------------------------ISNAKLEQKTLD-------
R7F6L5          TAATY------------------------------------ATSLNTRLSGVR-------
A0A7C5MRV2      NIASI------------------------------------KNNTEQKIGFYK-------
A0A0A2EYC8      LISSV------------------------------------SDIYKIESDAYQ-------
A0A2G6H6Y4      LIASV------------------------------------SDVYSIETDLYK-------
C9LKL0          SVRSY------------------------------------VKTLEMRAKSAR-------
A0A3D0QPV7      AITSL------------------------------------KNQFSKRKGSLK-------
A0A496KT23      SLDNE------------------------------------LDMLKTQQRVTE-------
L1M9T3          SLDNE------------------------------------LDMLKTQQRATE-------
A0A2M6GH67      LLQQN------------------------------------IDLLQNQTATLT-------
A0A7K1TE30      QLRQD------------------------------------QKLLSNELALLD-------
A0A7D4BE70      QLAQA------------------------------------RKQLQTEMALLD-------
A0A142HHS5      QLVQA------------------------------------QKQLRGQIALLD-------
A0A7D4C435      QIKQA------------------------------------QIQLRNQLNVLS-------
A0A3C0I8F1      QINEA------------------------------------QRMLNKEIGALQ-------
R5JJI4          SVDNL------------------------------------IVGLNIQLKNIR-------
A0A848IUK4      QLAYL------------------------------------EKNVNEELSRIQ-------
A0A136LSC7      QLSTL------------------------------------KKEWLADMAELG-------
A0A5C7N8Q5      QLSTL------------------------------------KKDWLADMAELG-------
A0A355BP94      QLAEI------------------------------------KKQWLGAMLELN-------
A0A7Y5D1K7      QLTEV------------------------------------RKNWMGSMVELN-------
A0A3D2HF71      NIADG------------------------------------LANIEKSISEAD-------
A0A0A2DQN2      ALKDA------------------------------------AAAISIKLKEMR-------
A0A0A2F2N5      TLEGY------------------------------------IKSLDLQLREIE-------
L1NGW4          SLNQY------------------------------------ANVLRVRLKDAQ-------
Z4WRA0          SLNQY------------------------------------ANVLRVRLKDAQ-------
U2K8K9          ILNQQ------------------------------------ASALRARLKSVE-------
A0A069ZM60      SLNQQ------------------------------------AAVLRMRLKDIQ-------
J6GV98          SLNQQ------------------------------------AAVLRMRLKDTQ-------
A0A134B4F8      SLNQQ------------------------------------AAVLRMRLKDAQ-------
A0A134B8C7      SLNQQ------------------------------------AAVLRMRLKDAQ-------
A0A4Z0EKR0      NLRNI------------------------------------KKGLQITSNSLK-------
A0A521H707      SLNNA------------------------------------REALIQKIKSLD-------
A0A7T9D909      SVAHM------------------------------------RERFARRKAQYE-------
A0A1M6B6D5      NIRSS------------------------------------KSLMNEEIRTIN-------
A0A451FS66      NIRSS------------------------------------RSLKADEINSIN-------
A0A2E3GN39      QVEIN------------------------------------IDKFQQEKDAVV-------
A0A3D1MEL0      QVEIN------------------------------------IDKNQQERDAVV-------
A0A519UDD1      NLRNI------------------------------------KKGLQITSANLK-------
A0A7Y2ACP6      SIASL------------------------------------REKNQNEQKELK-------
A0A2A4N9A6      SIKAI------------------------------------RATLFAQLALID-------
A0A6C0GGI1      NLRRL------------------------------------VSVVNSSLAVTN-------
A0A368D1N7      QVEIN------------------------------------IDKNQQERDAVV-------
A0A3B8TU58      QVRIN------------------------------------IERYQQERQLMI-------
A0A1T5IIR6      MISNL------------------------------------QTSLEIQRRDLS-------
A0A3E0QD27      SIQNA------------------------------------RLSIREKINNID-------
A0A0K2HKS3      AIDNM------------------------------------IVSIDVKLNEAR-------
B6W3W8          AIDNM------------------------------------IVSIDVKLNEAR-------
A0A0M1W1I6      AIDNM------------------------------------IVSIDVKLNEAR-------
A0A4R4GHU2      AIDNM------------------------------------IVSIDVKLNEAR-------
I8WPR6          AIDNM------------------------------------IVSIDVKLNEAR-------
A0A076IRY8      AIDNM------------------------------------IVSIDVKLNEAR-------
A0A3A6AD54      AIDNM------------------------------------IVSIDVKLNEAR-------
A0A8B3EPF6      AIDNM------------------------------------IVSIDVKLNEAR-------
I8WPP8          AIDNM------------------------------------IVSIDVKLNEAR-------
A0A372Y7D2      AIDNM------------------------------------IVSIDVKLNEAR-------
A0A7K3KFI2      AIDNM------------------------------------IVSIDVKLNEAR-------
A0A3E4JJC9      AIDNM------------------------------------IVSIDVKLNEAR-------
A0A3E4WDQ0      AIDNM------------------------------------IVSIDVKLNEAR-------
A0A414H9P2      AIDNM------------------------------------IVSIDVKLNEAR-------
A0A7K0JKU9      AIDNM------------------------------------IVSIDVKLNEAR-------
C3R5A8          AIDNM------------------------------------IVSIDVKLNEAR-------
A0A6N8DCX3      SIDNL------------------------------------VMSLDTQRNELL-------
F0R0C9          SVDNL------------------------------------MVTLDTRIRSLQ-------
A0A1C5XJA7      AVDNM------------------------------------IVSINVKRNDAQ-------
A0A285T4L1      AVDNM------------------------------------IVSINMKRNDAR-------
R7CUW4          AVDNM------------------------------------IVSLNVKRNDAQ-------
A0A416GGJ1      AVDNL------------------------------------IVSLNVRRRDAL-------
D1JY72          AIDNM------------------------------------IVSIDVKLNEAR-------
D7J4K6          AVDNM------------------------------------IVGINMKRNDAR-------
Q8ABP9          AVDNM------------------------------------IVGINMKRNDAR-------
D6D2Z5          AVDNM------------------------------------IVGINMKRNDAR-------
A0A1T3EDR4      SLDHS------------------------------------IRGLVQRRRQAS-------
A0A6N8KXI9      AVDNA------------------------------------VEGLRIKLTNVD-------
A0A174SDD8      ALDNL------------------------------------STTLRLKKQDYS-------
A0A1H7RFH3      ALDNL------------------------------------SASLRLKKQDYS-------
A0A139L1N2      ALDNL------------------------------------SASLRLKKQDYS-------
A0A174TVL8      ALDNL------------------------------------SASLRLKKQDYS-------
A0A1H8BJR6      ALDNL------------------------------------SASLRLKKQDYS-------
R9H6G0          ALDNL------------------------------------SASLRLKKQDYS-------
A0A412GR09      ALDNL------------------------------------SASLRLKKQDYS-------
A0A7J5JXN6      ALDNL------------------------------------SASLRLKKQDYS-------
R6D982          SINNQ------------------------------------VTSLKLKRTEIS-------
A0A1F0I8C4      ALDNL------------------------------------SASLKQKKNDYT-------
A0A3A5RIJ2      ALDNL------------------------------------SASLKQKKNDYT-------
A0A515IZJ5      ALDNL------------------------------------SASLKQKKNDYT-------
A0A7J4Y2H6      ALDNL------------------------------------SASLKQKKNDYT-------
A0A4R6WE41      AINNT------------------------------------LSGLQVKINNVQ-------
A0A2T5RP38      AVDNA------------------------------------LRGLTIKMRNAQ-------
A0A1A6CF06      AVDNA------------------------------------LKGLNIKLNNAR-------
A0A1T3D6S8      AVDNA------------------------------------LKGLNIKLNNAR-------
A0A8B4GMS2      AVDNA------------------------------------LKGLNIKLNNAR-------
A0A7Z7LUP7      AVDNA------------------------------------LKGLNIKLNNAR-------
A0A0B8T471      SVDNA------------------------------------AMGLRIRIRNLQ-------
A0A4R7D2K0      SVDNA------------------------------------AMGLRIRIRNLQ-------
A0A7T9S3V1      AVDNA------------------------------------TDGLRVRMQKAR-------
A0A7T9LVI2      AVENA------------------------------------TEGLRVKMQKAR-------
C2FUH6          AVENA------------------------------------TEGLRVKMQKAR-------
A0A1V3N3U3      AVDNA------------------------------------VAGLDLKIRNAQ-------
A0A1P8E011      AVDNA------------------------------------IGGLKIKAGNMK-------
A0A7T9S8K4      AVDNA------------------------------------IGGLKIKAGNMK-------
A0A2X2J8S4      TLGNT------------------------------------ISGLQVKKNNAV-------
A0A3C0S618      TLGNT------------------------------------ISGLQVKKNNAV-------
A0A4P7DRF9      AVDNV------------------------------------ITGFNIKIRNLQ-------
A0A239XXC4      AIDNV------------------------------------ISGFRIRMSNMK-------
A0A4U9K473      AIDNV------------------------------------ISGLRIRMSNLR-------
A0A081PBV5      AMENA------------------------------------VSGLQIKINNLK-------
A0A1I2AN85      AMENA------------------------------------VSGLQIKINNLK-------
A0A4U0GMP3      SIENT------------------------------------LAGLRIKLRNAQ-------
A0A0D5BSQ0      AVDNT------------------------------------LRGLNVRLNNAK-------
A0A1T3F6P5      AVDNA------------------------------------LRGLNIKLNNTR-------
A0A853VUQ0      AVDNA------------------------------------VRGLNIKLNNTR-------
A0A7X0MJ00      IMTNA------------------------------------ITGFTVKISNLK-------
A0A841JHZ0      AVDNE------------------------------------ITGLKVKIRNIG-------
A0A1H6CKR6      AVDNV------------------------------------LTGYRIKVRNLR-------
A0A7W3MGA7      AIDNV------------------------------------ISGFRIRMSNMK-------
A0A3M1Y2F5      NINNR------------------------------------VSSTEFELESVE-------
A0A7V1ALN2      --------------------------------------------LQSKEKSYK-------
A0A3D4RLG4      VVGSM------------------------------------RASLEIEKKDLQ-------
A0A2T2UAJ4      LQARL------------------------------------DV--------LN-------
A0A6I0DZQ5      MVRNM------------------------------------QVSMDIQKKDLN-------
A0A1H6Z2F8      AIQNQ------------------------------------KQELALSISAIH-------
A0A2P8G5K0      AIGLQ------------------------------------IQELTVNAAAIR-------
R5DEG6          SVDNL------------------------------------IVGLNIKIKNIR-------
A0A4Q3SEI4      SIQNQ------------------------------------RASLNANRSKLG-------
A0A836SQI2      LVNSI------------------------------------LIRIDQELADVK-------
A0A7V1FAJ9      LAEKK------------------------------------QKEIKRDIQKYK-------
A0A3N2LCI3      SVDNS------------------------------------INALNMQISSLQ-------
A0A6H9Q899      SIDNQ------------------------------------IVTLNSQIKSLR-------
A0A3D4CJE1      SLRSL------------------------------------LDKLLTQRNEVA-------
A0A7C7LI79      SIKAL------------------------------------VNKCEVRKETLK-------
A0A4Q5ZQ60      SVKKN------------------------------------KKLAQDKIASLS-------
A0A519Q885      QLIQA------------------------------------RKLLQKKLGLLG-------
A0A519TAP8      ------------------------------------------------------------
A0A848Y4B8      EEKIT------------------------------------LSGLEAQRDVLN-------
A0A7Y4V8Y1      QLTEL------------------------------------KSDWLKTLAELR-------
A0A5Q4EKA0      SITTL------------------------------------KNNLDARIKEIL-------
A0A519SYE7      LVRQQ------------------------------------LARLDKLDATLN-------
A0A7C7CFR2      TIRSL------------------------------------SKKLDLKKQTLE-------
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      NRNQL-------------------------------------------------------
A0A3D3LSK1      KIGIV-------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A847AMH6      ALADL-------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A7V1FAS7      ------------------------------------------------------------
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      ----------------------KIESEPEST--SSFE--QN--EIEFV---RLQRVY-SV
A0A7C7CKY6      ----------------------QKVKEIESK-FFNLP--TQ--ELEYA---RILRLF-TI
A0A1G1TG88      ----------------------RQQNKLDAK-QQGLP--SR--ATEQA---RLQRPL-AL
A0A661XXA6      ----------------------NQKIQLNQQ-LKKLP--SK--STEYN---KVKRFY-TL
A0A519SD85      ----------------------KTSDSIQRK-LSQLP--NK--ERLLG---ELQSRF-DV
A0A3M1TXY5      ----------------------ERIEALRTR-LRRLP--ES--ERILT---NIKRNF-DH
A0A7T9KM12      ----------------------ARVNQLEYQ-LNQLP--QS--SRQVS---IATRKY-DL
A0A2E0VQ27      ----------------------SQIAEVNQK-VERFP--EK--ERQLV---VLQRQV-AL
A0A7Y7TYP1      ----------------------KRINKIAGQ-ISNLP--KT--QRELG---GIERKY-RL
R6U429          ----------------------AEETNIMNK-ISNTS--GQ--ELQLL---SIERQQ-KI
A0A5C8AF42      ----------------------GKIQGFESE-FFELP--EK--KMEFS---RLKNIQ-DL
A0A7Y5SYP1      ----------------------TLLADYEKR-FQAIP--TK--NVEYA---RLERAR-RS
A0A7V1N701      ----------------------ERIRVFKED-HPDIL--ET--ALRFS---KLIRSK-EV
A0A7V2NIA8      ----------------------AQIADYQRQ-HPDLL--GS--ALEYS---RMQRSR-MV
A0A239K409      ----------------------DRTNLYDAK-INSVP--LV--ERELQ---EIDRQR-GI
A0A1M3DPL8      ----------------------TRLASVQKQ-IETLP--EQ--ELEMV---GIERNY-RM
A0A1V5F519      ----------------------RLLADVNSQ-IAELP--KK--ELEII---GIERNY-KV
A0A2G6R1T9      ----------------------SKIAAVRSK-MNMLP--KK--ETQMT---ALTRQY-KI
A0A350V3E4      IKESLLR---------------GYLNKYQEK-FNKLP--AQ--SIEYA---NLERER-LA
A0A6J4K208      ----------------------RSIAKATPS-PPATP---------LP---EVRRQL-KL
A0A2W4RDE8      ----------------------QRIARLNAQ-LERLP--RN--ERELV---KIQRRY-DF
A0A212J9Z9      ----------------------RKYEVLQLK-IDNLP--PQ--ERDLI---KFQREF-RV
F5IV23          ----------------------RKYEVLQLK-IDNLP--PQ--ERDLI---KFQREF-RV
A0A1M5DFS8      ----------------------SRLASVESE-MSTLP--AQ--EREYA---RYEKRY-QV
A0A4Y8KZS5      ----------------------ASLSSVETE-MTTLP--AQ--EREYA---RYEKVY-KV
A0A2V3PNY7      ----------------------NNTKEIEDK-MATLP--AQ--EREYI---RYEKRY-QV
A0A6G7X5K8      ----------------------NSTREIESR-MSTLP--AQ--EREYA---RYEKKY-QV
A0A840CJ33      ----------------------RKYIVLDAK-MDNLP--PQ--ERDLI---KFQNEN-RM
F8X2T0          ----------------------KKYQNLDLK-LDNLP--PQ--ERDLI---KYQREY-NV
A0A1M3LAG1      ----------------------KKYQNLDLK-LDNLP--PQ--ERDLI---KYQREY-NV
A0A212K6G4      ----------------------KKYQNLDLK-LDNLP--PQ--ERDLI---KYQREY-NV
A0A4Y9IPG7      ----------------------KKYQNLDLK-LDNLP--PQ--ERDLI---KYQREY-NV
A0A0L8VEV2      ----------------------RRVDQVNRQ-LSAHP--KT--EQQMM---NMQRMY-DL
A0A1I2A9Z9      ----------------------RRIEKVNQQ-LTAYP--KT--EQQLM---NMKRMY-DL
A0A848XXC6      ----------------------GRLAEASGV-LTTIP--EQ--ARELA---QLQRNQ-VA
A0A2P8CDS1      ----------------------KRIDNLQQR-TRNLP--SV--ERNYV---NIERRY-QL
A0A660LQT8      ----------------------SQEGTLTSK-MAQAP--NQ--ASYLQ---SISREQ-KV
A0A3D0FMX4      ----------------------LRFSEVRAG-INALP--EK--ELEMV---ALERNY-RI
A0A7V6G854      ----------------------QQCAEIQSE-IDLLP--AK--EHQMI---NFERKY-KI
A0A1M3MEI8      ----------------------RRYAEVQQE-INQLP--AK--ELEMI---GIERRY-KM
A0A1J5HQM0      ----------------------EKNDKVNKE-IEQLP--SK--EIEMT---SIARKY-KM
E4T131          ----------------------KRLSVVNKQ-IEELP--EK--ELEQI---AIQRKY-KM
A0A653AC35      ----------------------KKLYAVKQQ-ITALP--QK--EMEMV---TLERKY-RV
A0A847LA02      ----------------------TKLSNVQRD-ISRLP--AK--EMQLI---GIERKY-RV
A0A389LWV6      ----------------------QRYSKLSAE-VASLP--DK--ERKLL---THERDF-KI
A0A1G9B1T9      ----------------------NQIEELDSQ-INLLP--KN--EQELI---NIERKF-QF
A0A350PNH9      ----------------------ANEAQTTSQ-IASNP--SQ--AKYLQ---TVGRQQ-KV
A0A354LNT9      ----------------------ANEAQTTSQ-IASNP--SQ--AKYLQ---TVGRQQ-KV
A0A161LWY6      ----------------------TQSRKASGQ-LATLP--DI--ETQMN---SFERQF-KM
A0A6I3N9U6      ----------------------TQSRKASGQ-LATLP--DI--ETQMN---SFERQF-KM
A0A353WYK7      ----------------------LKKNRLETD-FSSLP--SK--STEYA---KTERYY-DL
A0A2W7RD29      ----------------------YRISEISKD-FRKLP--FT--EQNLI---KIEREF-TL
A0A3N2NDY8      ----------------------GAKGAAESQ-LASGS--TQ--AKYLL---SVERQQ-KV
D7JEV9          ----------------------SDLSALNKL-LVEAP--NK--ELRML---DYERRY-KI
A0A553GA49      ----------------------SKISTLNVE-LNRLP--ET--QRNLT---TYERNF-RL
A0A7V5GTN5      KKLESQLEGWLIDFEHSEVQVAYYESAIKRY-IKEHP--NL--SQDILEYFNISRAK-NV
A0A497D6F6      ----------------------NRLWRYERR-IQTLP--ET--ERNYI---NIERKY-QL
F4KR18          ----------------------YHYDQSSNH-LRSVP--SK--ERGLS---DRVRIQ-SI
B5CTK0          ----------------------AQEARTASR-IAAVP--TH--QKYIL---SVERQQ-KI
A0A5M4AAB9      ----------------------KRTDSLRKQ-TRSLP--AV--ERDYV---NIERSY-QL
A0A5R9QZP0      ----------------------YRRNKLSRE-ISRLP--KT--ELNMV---SMQRQF-NI
A0A7X6SRJ5      ----------------------YRAERLSGQ-ISRLP--RT--ELNMV---SMQRKF-NL
A0A3D3HL11      ----------------------YRESKLSGE-ISRLP--RT--ELNMV---SMQRQF-NL
A0A6L8U6G9      ----------------------YREGKLSGE-ISRLP--RT--ELNMV---SMQRQF-NL
A0A6L8UH35      ----------------------YRENKLSRE-ISQLP--RT--EMNMV---GMKRKF-DL
A0A7X9F2J5      ----------------------YRENKLSRE-ISQLP--RT--EMNMV---GMKRKF-DL
A0A352ME00      ----------------------YRQNKLSKE-ASSLP--RT--EMNMV---SMKRKF-DL
A0A7X8CRA6      ----------------------YRQEKLSRE-ISKLP--RT--EMNMV---SMQRKF-NL
A0A1F3D6P8      ----------------------YRADKLSRE-ISQLP--RT--ELNMV---GLQRKF-DL
A0A356Z058      ----------------------YRADKLSRE-ISQLP--RT--ELNMV---GLQRKF-DL
A0A7X8FHL3      ----------------------YRQNKLSRE-ASSLP--RT--EMNMV---SMQRKF-DL
A0A3D1BT36      ----------------------YRAEKLSSQ-IARLP--RT--ELNMV---SMQRQY-NI
A0A7X7CXW9      ----------------------YRESKLSGE-ISRLP--RT--ELNMV---SMQRQF-NL
A0A4R6H3B7      ----------------------RRIEKVNQQ-LTAYP--KT--EQQLM---NMKRMY-DL
A0A229I3A5      ----------------------ANEAATTSQ-IASNP--NQ--AKYLQ---TVGRQQ-KV
A0A3R6HJB3      ----------------------ANEAATTSQ-IASNP--NQ--AKYLQ---TVGRQQ-KV
R6NN15          ----------------------KSDQRATER-IAANP--SQ--AKYLL---SVERQQ-KV
A0A2W7QSQ0      ----------------------TTLNENSYK-AQSIP--GI--ERELV---EISRNT-DL
A0A841MQL4      ----------------------QTLNESIYK-AQSIP--GI--ERELV---EINRNK-EL
A0A3P1Z8V4      ----------------------STQSRFDGQ-AGAIP--VK--EREAL---DIVRQQ-NL
A0A1M6MYT6      ----------------------QRIRQFEAQ-VRRLP--AT--ERNYV---NIERKY-KL
A0A1V5S1J9      ----------------------NRLQKLSAG-MQELP--YK--EQQLL---NIQRKF-KI
A0A7X8JMH1      ----------------------KRMAELQAQ-IQVLP--IK--EQQLL---NFERKF-KV
A0A3D5KRY6      ----------------------DQQARINSE-LSKLP--KT--EQNLI---GIKRNF-DL
R7F6L5          ----------------------SQESVTNSR-LATAP--RQ--ANYLL---SVERQQ-KV
A0A7C5MRV2      ----------------------AELSKSRNN-LQSIP--QT--QRIYQ---GLMREH-KV
A0A0A2EYC8      ----------------------KDLNELNNL-LIAAP--NK--ELRML---DYERRY-KI
A0A2G6H6Y4      ----------------------KDLNTLKSE-LVEAP--SK--ELRML---DYQRRF-RI
C9LKL0          ----------------------SNESVINGE-VSRAP--GL--ERRAL---SIGRQQ-NL
A0A3D0QPV7      ----------------------DKIRQYETI-YYGLP--EK--EIEHA---RMERMF-AI
A0A496KT23      ----------------------SSHSEATSK-ISANP--RQ--ASYLL---SVERQQ-KV
L1M9T3          ----------------------ASHSEATSR-ISANP--RQ--ASYLL---SVERQQ-KV
A0A2M6GH67      ----------------------RDINAIEAE-LKQMP--AR--VTEWA---RLQRPF-EN
A0A7K1TE30      ----------------------QQRNLLSDN-LRSLP--GK--ETELA---RLKRPL-EL
A0A7D4BE70      ----------------------KQQSQLGGA-LQSLP--GK--ETELE---RLKRPL-EL
A0A142HHS5      ----------------------TQQGKLSNE-LQLIP--GK--ETELE---RLKRPL-GL
A0A7D4C435      ----------------------SQQGLLSGE-LQSLP--GK--ETELE---RLRRPL-QL
A0A3C0I8F1      ----------------------SKFSRAQGE-FLKIP--SK--ETELK---RIKRLH-TI
R5JJI4          ----------------------EQEEQTTKR-IEAVP--TQ--QKYVL---TVERQQ-KI
A0A848IUK4      ----------------------SQKSNLGGD-FKSMP--SK--GTQYN---KAKRFY-EL
A0A136LSC7      ----------------------KRKEKLERA-FAEMP--DK--NTQFS---KNQRYY-KL
A0A5C7N8Q5      ----------------------RRKEKLERE-FAEMP--DK--NTQFS---KNQRYY-KL
A0A355BP94      ----------------------QKKESLEKK-FASMP--DK--STQYS---KNQRFY-KL
A0A7Y5D1K7      ----------------------QKKAKLEKD-FATMP--DK--NTQFS---KNQRFY-KL
A0A3D2HF71      ----------------------KRLNEVERE-IMKLP--ST--ERQMI---NIQRKF-DI
A0A0A2DQN2      ----------------------YQDNQAYAE-LVTLP--PK--ERQWL---DAERQY-KM
A0A0A2F2N5      ----------------------IRNRQGLAE-MMAVP--NK--QRQWL---DIERQQ-RM
L1NGW4          ----------------------GTQSSLLSQ-LPDVS--NK--GREKA---EIDRKI-AI
Z4WRA0          ----------------------GTQSSLLSQ-LPDVS--NK--GREKA---EIDRKI-AI
U2K8K9          ----------------------RDQSALFSK-LPGVT--EE--GRTKA---DIDRRL-AI
A0A069ZM60      ----------------------GQQSSLLSK-LPEVS--NQ--GREKA---DIDRRL-EI
J6GV98          ----------------------GQQSSLLSK-LPEVS--NQ--GREKA---DIDRRL-EI
A0A134B4F8      ----------------------GQQSSLLSK-LPEVS--NQ--GREKA---DIDRRL-EI
A0A134B8C7      ----------------------GQQSSLLSK-LPEVS--NQ--GREKA---DIDRRL-EI
A0A4Z0EKR0      ----------------------ASSGQFQSK-IKKVP--GM--ERELL---EINRQK-SI
A0A521H707      ----------------------ERMNEFEQI-FLTLP--AQ--EAELA---RLNRLY-LV
A0A7T9D909      ----------------------QQLSEFERQ-FLALP--EK--ELEFA---RLSRLY-NI
A0A1M6B6D5      ----------------------RDIGRYEAE-IRKLP--KE--QQELL---KIERRY-NL
A0A451FS66      ----------------------QDIGRYESE-IRKLP--KE--QQDLL---NIERRY-NL
A0A2E3GN39      ----------------------AEINKLLEE-LDLLP--LF--EAEYL---RLKRDY-EV
A0A3D1MEL0      ----------------------AEINKMLEE-LDLLP--LF--EAEYL---RLKRDY-EV
A0A519UDD1      ----------------------ASSGQFQTK-IKQVP--GI--ERELL---EINRQQ-SI
A0A7Y2ACP6      ----------------------RRSSAVEGT-FAGLP--TQ--ELEYA---RFKRLY-SI
A0A2A4N9A6      ----------------------KAVRQ-KQK-LDSEVNFDA--AIEYL---RVSTAY-KM
A0A6C0GGI1      ----------------------QSISQLENN-IFRLPQDQR--QLEQL---QSKKDYNEQ
A0A368D1N7      ----------------------AEINKLLEE-LDLLP--LF--EAEYL---RLKRDY-EV
A0A3B8TU58      ----------------------DEINKILEE-LDVLP--LF--EAEYL---RLKRDY-ET
A0A1T5IIR6      ----------------------DRERNAVAK-FSSMP--TK--ERQML---EIQRQQ-SI
A0A3E0QD27      ----------------------ERIREFEGN-FLKLP--SQ--EAELS---RLSRLF-EI
A0A0K2HKS3      ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
B6W3W8          ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
A0A0M1W1I6      ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
A0A4R4GHU2      ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
I8WPR6          ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
A0A076IRY8      ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
A0A3A6AD54      ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
A0A8B3EPF6      ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
I8WPP8          ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
A0A372Y7D2      ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
A0A7K3KFI2      ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
A0A3E4JJC9      ----------------------SRAGEAQWR-GTNIP--RQ--QQQML---SIERQQ-RI
A0A3E4WDQ0      ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
A0A414H9P2      ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
A0A7K0JKU9      ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
C3R5A8          ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
A0A6N8DCX3      ----------------------RNERRTTAK-IAVNP--DQ--TKYLQ---TVGRQQ-KV
F0R0C9          ----------------------RSEQQTTER-LAANP--SQ--AKYLL---SVERQQ-KV
A0A1C5XJA7      ----------------------NREMRVQER-LSAMP--TK--ERQML---SIERQQ-KI
A0A285T4L1      ----------------------SRQAQAQAR-FTTVP--TK--ERQML---SIERQQ-KI
R7CUW4          ----------------------NREMRAQSR-VTSIP--TK--ERQML---SIERQQ-KI
A0A416GGJ1      ----------------------SRETRAQVR-FSSIP--KK--ERKML---SIERQQ-KI
D1JY72          ----------------------SRAGEAQWR-VTNIP--RQ--QQQML---SIERQQ-RI
D7J4K6          ----------------------SRQEQAQAR-FTTVP--TK--ERQML---SIERQQ-KI
Q8ABP9          ----------------------SRQEQAQAR-FTTVP--TK--ERQML---SIERQQ-KI
D6D2Z5          ----------------------SRQEQAQAR-FTTVP--TK--ERQML---SIERQQ-KI
A0A1T3EDR4      ----------------------ALEQRALGQ-MLKVP--SK--EREQY---SIYRSH-AV
A0A6N8KXI9      ----------------------REYRRLTGK-VMEIP--KK--ERTML---SVERQQ-KV
A0A174SDD8      ----------------------LQENQVRQK-VQAVP--RK--QREML---SVERQQ-KV
A0A1H7RFH3      ----------------------LQENRVRQK-VQAVP--RK--QREML---SIERQQ-KV
A0A139L1N2      ----------------------LQENRVRQK-VQAVP--RK--QREML---SIERQQ-KV
A0A174TVL8      ----------------------LQENRVRQK-VQAVP--RK--QREML---SIERQQ-KV
A0A1H8BJR6      ----------------------LQENRVRQK-VQAVP--RK--QREML---SIERQQ-KV
R9H6G0          ----------------------LQENRVRQK-VQAVP--RK--QREML---SIERQQ-KV
A0A412GR09      ----------------------LQENRVRQK-VQAVP--RK--QREML---SIERQQ-KV
A0A7J5JXN6      ----------------------LQENRVRQK-VQAVP--RK--QREML---SIERQQ-KV
R6D982          ----------------------GQERLARRK-VRDVP--GK--QREML---SVERQQ-KV
A0A1F0I8C4      ----------------------VQENRVRQK-VQAVP--RK--QREML---SVERQQ-KV
A0A3A5RIJ2      ----------------------VQENRVRQK-VQAVP--RK--QREML---SVERQQ-KV
A0A515IZJ5      ----------------------VQENRVRQK-VQAVP--RK--QREML---SVERQQ-KV
A0A7J4Y2H6      ----------------------VQENRVRQK-VQAVP--RK--QREML---SVERQQ-KV
A0A4R6WE41      ----------------------REENQVKGQ-VMQIP--GK--QRMIL---EVERKQ-KV
A0A2T5RP38      ----------------------REEEQAIGK-TLQMP--KK--QRAML---SVERQH-KV
A0A1A6CF06      ----------------------QEGRTAQAK-VLQMP--QK--ERTML---SIERQH-KV
A0A1T3D6S8      ----------------------QEGRTAQAK-VLQMP--QK--ERTML---SIERQH-KV
A0A8B4GMS2      ----------------------QEGRTAQAK-VLQMP--QK--ERTML---SIERQH-KV
A0A7Z7LUP7      ----------------------QEGRTAQAK-VLQMP--QK--ERTML---SIERQH-KV
A0A0B8T471      ----------------------QEEAASRAK-AQSLP--AK--QRMML---SIERQQ-KV
A0A4R7D2K0      ----------------------QEEAASRAK-AQSLP--AK--QRMML---SIERQQ-KV
A0A7T9S3V1      ----------------------QEEQQARGK-VIQIP--QK--QRIML---SIERQQ-KV
A0A7T9LVI2      ----------------------SEEQQARGK-VIQMP--QK--QRIML---SVERQQ-KV
C2FUH6          ----------------------SEEQQARGK-VIQMP--QK--QRIML---SVERQQ-KV
A0A1V3N3U3      ----------------------QEESMAKGK-ALQVP--KK--QRIML---SVERQQ-KV
A0A1P8E011      ----------------------KEENVARGK-AMQVP--QK--QRVML---SVERQQ-KV
A0A7T9S8K4      ----------------------KEENVARGK-AMQVP--QK--QRVML---SVERQQ-KV
A0A2X2J8S4      ----------------------KEENRASGK-SRQMP--QK--QRLVL---SIERQQ-KV
A0A3C0S618      ----------------------KEENRASGK-SRQMP--QK--QRLVL---SIERQQ-KV
A0A4P7DRF9      ----------------------QEENAAIRK-AQSLP--TK--QRMML---SVERQQ-KV
A0A239XXC4      ----------------------DEENAAIGK-AKSLP--SK--QRIML---SAERQQ-KV
A0A4U9K473      ----------------------DEENAAIGK-ARSLP--SK--QRIML---SAERQQ-KV
A0A081PBV5      ----------------------KEQTQARNK-AMAVP--AK--QRMML---SVERQQ-KV
A0A1I2AN85      ----------------------KEQTQARNK-AMAVP--AK--QRMML---SVERQQ-KV
A0A4U0GMP3      ----------------------REGGAARSK-VQSIP--PK--ERVML---SVERQQ-KV
A0A0D5BSQ0      ----------------------QEEATAQSK-TLQIP--QQ--ERAIL---SIERQR-KI
A0A1T3F6P5      ----------------------QEEGVAQSK-MLQMP--QK--ERTMV---SVERQR-RV
A0A853VUQ0      ----------------------QEESIAQGK-MLQMP--QK--ERTMV---SVERQR-RV
A0A7X0MJ00      ----------------------QEEAKALHS-AHELP--AK--QRLML---SEERQQ-KV
A0A841JHZ0      ----------------------QEKQQAINK-AQGLP--AK--QRMML---SEERQQ-KV
A0A1H6CKR6      ----------------------QEENAAIGR-ARSMP--AK--QRMML---SVERQQ-KV
A0A7W3MGA7      ----------------------DEENAAIGK-ARSLP--SK--QRIML---SAERQQ-KV
A0A3M1Y2F5      ----------------------DQIRTANGR-LSRLP--RN--ERMLT---QMGRTY-ES
A0A7V1ALN2      ----------------------ILADDYKRKLLYDMP--KR--ERHLY---ELVQNV-ET
A0A3D4RLG4      ----------------------NRYKEVEKE-IPNLP--TK--ELQMV---AIERNY-RI
A0A2T2UAJ4      ----------------------ERLRENRQK-LEQIP--TQ--SIKLA---QPQRER-RS
A0A6I0DZQ5      ----------------------RRYAEVQQE-INQLP--AK--ELEMI---GIERRY-KM
A0A1H6Z2F8      ----------------------AYGKGFEAE-ISRLP--GH--QRALL---SQSREQ-GI
A0A2P8G5K0      ----------------------KYGKESEAE-ISKLP--AH--QRAFL---AQSREQ-GI
R5DEG6          ----------------------AQEEQTSRR-ISAVP--TQ--QKEVL---SVERRQ-KI
A0A4Q3SEI4      ----------------------AGTGMYTSI-LKGIP--KK--ERDLL---DISRQQ-AI
A0A836SQI2      ----------------------NKVTGYKNK-LNIKG--FD--EMEFS---RLQRLY-TV
A0A7V1FAJ9      ----------------------QEQSSIKNS-LKLLP--SE--QLKLA---ELSQKV-QV
A0A3N2LCI3      ----------------------GSQASTTSK-IASNP--SQ--AKYLL---SVERQQ-KV
A0A6H9Q899      ----------------------QTEQQTTSR-IAANP--TQ--AKYLL---SVERQQ-KV
A0A3D4CJE1      ----------------------QKIKEFEQK-FYNIP--AK--ELEYA---RLERMF-SI
A0A7C7LI79      ----------------------GKINEIEAK-FINLP--TK--ELEYA---RLLRLF-SI
A0A4Q5ZQ60      ----------------------NTIMQAENE-LLKLP--SK--ETDLT---RLRRFY-NL
A0A519Q885      ----------------------DQDSKLENK-RRVLP--LL--ATQEA---RLQRPL-EL
A0A519TAP8      ----------------------------------------------------------SL
A0A848Y4B8      ----------------------ARIAEYEGE-LRAIP--RQ--SIDLA---QLQRDR-QS
A0A7Y4V8Y1      ----------------------QSKENLEKG-FATMP--DK--NTQYS---KNQRFY-KL
A0A5Q4EKA0      ----------------------SKIESYEGI-LLNHG--GRYSLIEYS---MLQRVH-TI
A0A519SYE7      ----------------------TRL--------MAMP--DL--ATQQD---RLKRPL-DL
A0A7C7CFR2      ----------------------SKIKEVEDK-FYNLP--TQ--ELEYA---RLLRLF-TI
A0A7W1G0I5      ------------------------------------------------------------
A0A2T4XEQ1      -------------------------------------------------------DV-NI
A0A2K8ZAP1      ----------------------VANNQRMEGMIRTVP--GK--ERALL---NITRQQ-GI
A0A3D3LSK1      ----------------------NSLSSQYNAQIKTLP--SQ--VIEYA---KLERDK-LA
A0A496L711      ----------------------------------------------ML---DYERRY-KI
A0A348PT57      ---------------------------------------SK--EIEYA---RIERVY-NS
A0A847AMH6      ----------------------LQRSGMIESQVRRLP--AT--EQNFV---NIERKY-NL
A0A7C3PTI0      ----------------------KKAKEFEFDKLSTLP--ED--EVEYA---RLQRLY-AI
A0A7V1FAS7      --------------------------------MDTLP--DK--SLQLA---RLERAK-KL
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      ------------------------------------------------------------
A0A833B0I1      ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A7X8GFH1      HKNFYD----QLVSKRAEYLISKAGHV-TNNVILQKA-DIP-RYQIAPIKSKVFAIAIIL
A0A7C7CKY6      NEKFYT----SLLEKKAEYSISRAGFV-SKNEILERS-LPP-TIPVSPDRRMIYALSLIV
A0A1G1TG88      AEGTYT----MLMGKKVDYNIQKAGTT-ADFQILFPA-SEP-RVPISPVRLMVYAIGLAG
A0A661XXA6      YEEIYL----SLMQSKNEFEIAIAGST-TKIKILSPA-TMP-DSPIKPNKTIIYMAGGVS
A0A519SD85      DRKVYN----YLSEKKLEAEIARAAVI-PGAVIIDKA-DYP-EEPNLPLPVTLYTSSALF
A0A3M1TXY5      SSEVHK----YLLQKRAETAIALATDI-ANKFVVDEAKQVG-SGPVSPKVGLIYAVAFVL
A0A7T9KM12      NASINT----YLMEKRYEAEIAVNSDQ-VDKYIIDPARVKD-GGAVSPSKKKALGMALAV
A0A2E0VQ27      NEALYN----YLMRKYTELSIMQQSDL-FPHKIIEHA-VRP-KATVAPNKSLYYGMAFLL
A0A7Y7TYP1      NDAIYN----YLLEKRAEAKITKASNL-PDDVILEPAMTTG---KISPNTKKNYILAFIL
R6U429          KEELYI----YLLQKREENEIASLVNV-GNTRLVMEP-AGE-DMPQSPNKKMIMLIALIL
A0A5C8AF42      NEKYFT----LLTEKKVLYSISDAGYA-SNNRILSRP-AVN-NTPVSPNRKLIYVTFVFF
A0A7Y5SYP1      AEELYL----ILEKKYQEAIISELQIN-TNIKVIDLA-IPD-FVAVEPQRARMVSLLTVL
A0A7V1N701      LNNAFN----MLMEKREEARIQAASET-GGIKVIDPP-NLP-LKPEDEKKGFYAAVSLLL
A0A7V2NIA8      LESTYN----LMMTKREETRVQAASET-GGVKIIDPP-YIP-VEPEDPEVMLRLIMTGLI
A0A239K409      KQQLYK----YLLEKREESSLALATSA-PNSLVLRPA-IIE-GVPVEPKKQTVFLLAFIA
A0A1M3DPL8      NDSYYT----MFLQKRAEAQILKASNT-PDNNILDRA-RTT-SVTNQGTKSKTIMMYFLI
A0A1V5F519      NDNYYT----FFLQKRAEAEIQKASNT-PDNNILDQA-RTV-SLINADVKSNTMFMFILL
A0A2G6R1T9      DDNYYN----FFISKKAEAQIQKAANS-PDNEVVEQA-RVR-FVVNGGKKKETTMTYLLF
A0A350V3E4      NEKVYL----MLLEKYQEALINEESQP-NNVKIIDYG-KVP-KAPSKPNRFLIITIGLLI
A0A6J4K208      DDKMYRSIHDYLLTRRAEAGMALATGR-TGSMIVDEARPDG-QKPVYPDAPLVYTVAALL
A0A2W4RDE8      SDNVYN----YLLEKRAEAGIAIASNV-VEKSVVDEAMMVG-SAPVSPNKRMIYAAAFIL
A0A212J9Z9      NEMYHQ----YLTQRQYEAKIQKASNT-PDNFIWEAPRQMG-GAVNGGEIGKNYTYYFII
F5IV23          NEMYHQ----YLTQRQYEAKIQKASNT-PDNFIWEAPRQMG-GAVNGGEIGKNYTYYFII
A0A1M5DFS8      NDAYYT----YLRNKRYEATIQKASNI-PDNFVLEEPRQLG-GPVNGDEKKKTYTFYLAI
A0A4Y8KZS5      NDAYYT----YLRNKRYEATIQKASNI-PDNFVLEEPRQMG-GPINGDEKNKTYTFYLAI
A0A2V3PNY7      NDAYYT----YLRQRRYEATIQKASNI-PDNFIMEAPRQKG-GPVNGDEKRKNYTFYFFI
A0A6G7X5K8      NDAYYT----YLRQRRYEATIQKASNI-PDNFIMEEPRQKG-GPVNGDEKSKNYTFFFLI
A0A840CJ33      NEIYQQ----YLTQRKREAEIQKASNM-PDNTVWEVPRRMG-GAYNGDVLNKNYMYFFII
F8X2T0          NEMYHQ----FLTQRQYEAKIQRASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMI
A0A1M3LAG1      NEMYHQ----FLTQRQYEAKIQRASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMI
A0A212K6G4      NEMYHQ----FLTQRQYEAKIQRASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMI
A0A4Y9IPG7      NEMYHQ----FLTQRQYEAKIQRASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMI
A0A0L8VEV2      NNELYT----FLLKKRAEAAITHASNV-SDTEVLDEARPEL-AELMGPYLTFNVAGGLLA
A0A1I2A9Z9      NNELYT----FLLKKRAEAAITHASNV-SDTQVLDEARPEL-ASRLGPNLVINVAGGMLA
A0A848XXC6      TEELTL----FLTQKLQEAQVAEETEF-GLVQVIREP-QIP-TEPTSPNLLLNLFIGGLL
A0A2P8CDS1      NNDTYT----FLLQKLSEAQIAKASNM-PDNEIIDPARMEG-NTPISPNNMTIYLVALLF
A0A660LQT8      KESLYI----FLLQKREENELSIAFTA-YNTRIITPP-MGS-NKPISPVKRNILLIALGL
A0A3D0FMX4      DDNYYT----FFLQKRAESEIQKASNT-PDNDRLDKA-RIL-ECTNAGAKNANRTKYLLL
A0A7V6G854      NNNYYT----FLLQKRSEAQIRKASNV-SDNVVLQRA-RVT-SLINGDKKSKTYITFLVI
A0A1M3MEI8      NDSYYT----LFLQKRAEAEILKASNT-PDNNILDRA-RVI-NVVNQGEKSKTTLLFLLL
A0A1J5HQM0      DDNYYT----FFLQKRAESEILKSSNT-PDNNILDRA-RII-AVTNDGTQSKTTLTFLII
E4T131          DDNYYT----FFLQKRAESEILKASNT-PDNDILDKA-RIV-GVTNSDKRSKTTMVFLLF
A0A653AC35      DDNYYT----FFLQKRAEAAIQKASNS-PDNNILDKA-RIM-GVTNGKVISKNYMTYGLI
A0A847LA02      DDNYYT----FFLQKRAEAAIQKASNS-PDNTVLDRA-RVI-TLTNGDTKSKTTMMYLLV
A0A389LWV6      NDSYNT----YLLQRRIESQIQLASNM-PDNLVLDNA-RTT-GLVNAGDISNTYVYFVVT
A0A1G9B1T9      SDNQYN----YLLQKRTEVGIAVASNA-STKKVVEEARLDG-RTPVSPNKILILLTAIVL
A0A350PNH9      KEALYL----FLLQKREENELSKAFTA-YNTRIITPP-TGD-TKPVQPVRRNIILVAFVL
A0A354LNT9      KEALYL----FLLQKREENELSKAFTA-YNTRIITPP-TGD-TKPVQPVRRNIILVAFVL
A0A161LWY6      NDTYYT----YLLQKRAEAQIQRASNV-PDNTILERA-RMI-SITNGGDKKKSMMMALAL
A0A6I3N9U6      NDTYYT----YLLQKRAEAQIQRASNV-PDNTILERA-RMI-SITNGGDKKKSMMMALAL
A0A353WYK7      YEEFYL----SLMKNKAQFELAQAGTV-TDFKILSSA-SLP-SNPIAPNKILIWAGAIIA
A0A2W7RD29      NEGIYN----FLLQKRAEAAISKASNI-NNNKIIEQA-KAN-ALPIGPRKLNFYGYAIII
A0A3N2NDY8      KESLYL----YLLQKREENELTQKFTA-DNTRIITPP-TGS-LQPVAPKVKFILAICMFF
D7JEV9          NDSYYT----FLLQKRSEAQIRKASNS-PDNAVMQKA-RTS-QLVNANQKQKKYMIFFFI
A0A553GA49      NDAIYT----FLIQKRSEAQIAKASNL-PAFELIDYPA--F-DGRAAPKKSRNLILMVFF
A0A7V5GTN5      LQKAID----ILIEKHETIRIEMAAES-GGVKVIDEPR-IP-NKPIPQNRGQKLAAAFLI
A0A497D6F6      NNETYT----FLLQKLTDAQIARASNV-SDSRVIEDAHIKG-IGPVEPKKSRIYLIALFL
F4KR18          KENLYV----YLLQKREETALALVSNY-ANALLFDPPYS-S-IGPVGPNKIKIFAAAGMG
B5CTK0          KEELYL----YLLNKREENALAQSITE-SNVRTIDPASG-S-NTPIAPDRMRIWMISFLI
A0A5M4AAB9      NNNNYN----FLLQKLSEAQIAKASNT-PDNEVIDPARIIG-DKPVKPNNIKTGIAALLL
A0A5R9QZP0      TDAMYT----FLLQKRSEAAISMASNY-PDYEILEPARLVT-SSVISPKTTINYLLSLFI
A0A7X6SRJ5      TDAIYT----FLLQKQSEAAIAMASNY-PDYEILEPARDST-RSILSPKTMLNWILAIFL
A0A3D3HL11      TDQIYT----FLLEKKAEAAIAMASNY-PDYEILEPARDVT-ASIIAPRTNLNWLIALFM
A0A6L8U6G9      TDQIYT----FLLEKKAEAAIAMASNY-PDYEILEPARDIT-ASIIAPRSSLNWIIALFM
A0A6L8UH35      NDAIYT----YLLQKRSEAAIALASNY-PDYEILEPAREIT-SKIVSPKDFINYLIAVFM
A0A7X9F2J5      NDAIYT----YLLQKRSEAAIALASNY-PDYEILEPAREIT-SKIVSPKEFVNYLIAIFM
A0A352ME00      NDEIYT----FLLQKRSEAQISLASTR-PDYEIVEPARTIT-SRIVAPKSAINYMMALFF
A0A7X8CRA6      NDAIYT----FLLQKRSEAAIALASNY-PDYEIVEPARTIT-SKIVAPKKAINYLMALFF
A0A1F3D6P8      SDVIYT----YLLQKRSEAAITMASNY-PDFEVIEPAREFT-KKIIVPRPKLSYLLAIFF
A0A356Z058      SDVIYT----YLLQKRSEAAITMASNY-PDFEVIEPAREFT-KKIIVPRPKLSYLLAIFF
A0A7X8FHL3      NDEIYT----FLLQKRSEAQISLASTR-PDYEIIEPARTIT-SRIVAPKKAVNYLMALFL
A0A3D1BT36      TDAIYT----FMLQKRSEAGIAMASNH-PDYEVLESARSIT-SSIIKPKKMINYIASFFL
A0A7X7CXW9      TDQIYT----FLLEKKAEAAIAMASNY-PDYEILEPARDVT-ASIIAPRSSLNWIIALFM
A0A4R6H3B7      NNELYT----FLLKKRAEAAITHASNV-SDTQVLDEA-RPELAFRLGPNLVINVAGGMLA
A0A229I3A5      KEALYL----FLLQKREENELSKAFTA-YNTRIITPP-TGD-NTPVEPVRRKILLIALVL
A0A3R6HJB3      KEALYL----FLLQKREENELSKAFTA-YNTRIITPP-TGD-NTPVEPVRRKILLIALVL
R6NN15          KESLYL----FLLQKREENELSQAFTA-YNTRVITPP-TGS-MAPTAPMKKNILLVALAL
A0A2W7QSQ0      KQEQYQ----YLLRKRDEAVLTLEVTGVSSAQMVDPP-IAS-LKPVKPNKLMIMAAALGL
A0A841MQL4      KQEQYQ----YLLRKRDEAILALEITGINSAQVVDPP-IAS-LKPVKPKKLMVMGAAFGI
A0A3P1Z8V4      KEALYT----FLLNKREEVALQLAIEE-ANVRVVEEP-LFA-SRPISPRKGIIMLIALLL
A0A1M6MYT6      NNETYI----FLMQKLSEAQIAKASNI-PDSQMIEEAKMAG-TGPVEPQKRKIYALALLL
A0A1V5S1J9      NDDYYT----FLVQKRADAQIQKASNS-PDNIILDKA-RLA-SMTNAGEKNKAYTMFLAI
A0A7X8JMH1      NDNYYS----FLLQKRADAQILKASNS-PDNIILDRA-RLT-GVTNGASKGSNYSTFLLI
A0A3D5KRY6      NNELYT----FLLQRRAEAEITRASNT-PDATVLDPV-DQDIAIILGPILWLDLAVGFAV
R7F6L5          KESLYL----FLLQKREENELAQAFKS-YNTQVVRQP-AGP-GAPISPVSTNTYLIAVLI
A0A7C5MRV2      KESILS----TLLEKQAEAQIAKASIV-SSVYILDRA-LTP-RAPISPLAQKVYIIGCGL
A0A0A2EYC8      NDSYYT----FLLQKRSEAQIRKASNS-PDNAVMQKA-RTM-SLINAKEKQNKYIVFLLI
A0A2G6H6Y4      NDEYYT----YLLQKRAAAEILKASNT-PDNTVLQTA-MIS-GQLNDKEKRTNYLIFIVL
C9LKL0          KEALYT----YLMNKREEVALQLAVND-ANVRLVEDP-LGS-NTPISPSRSTIILISLLI
A0A3D0QPV7      NEKYHT----MLLEKKTEYEISLAGQT-TGNQILEQA-TIP-KLPVSPKKRMIVIAFFFI
A0A496KT23      KESLYL----FLLQKREENELSQAFTA-YNTQIIETP-HIT-GIPPQPVSRNILLTAFLI
L1M9T3          KESLYI----FLLQKREENELSQAFTA-YNTQIIETP-HVT-GTPATPVSKKILGIALLL
A0A2M6GH67      VEGAYR----QLINRRLDFNIAKAGTT-ADFQILQPA-SLP-AAPIKPDKLMVYAIGLAS
A0A7K1TE30      YGGTQQ----MLMEKKVEYNIKNAGTT-PDFQILSPA-SAP-DAPISPIKLLVYAIGLAG
A0A7D4BE70      YGNSYQ----MLLEKKVEYNIKNAGTT-ADFQILSPA-SAP-DIPISPVRLLIYVIGLVG
A0A142HHS5      YGNSYQ----MLLEKKVEYNIKNAGTT-ADFQILSPA-FAP-EEPISPKKLLVYAIGLAG
A0A7D4C435      YGNTYQ----MLLEKKVEYNIQNAGTT-ANFQILSPA-YAP-DTPISPVRLFVYAIGLAG
A0A3C0I8F1      YEAFYS----QMLNKKAEIGISRSAIV-PEFVILAPA-SQP-TKPIYPVPTNIYSLGLAA
R5JJI4          KEELYL----YLLNKREENALTQAITE-SNARIIDPA-SGS-SVPVAPKSMMILLAAIVL
A0A848IUK4      QEEIYL----TLAQNKMEFEIAQAGTI-PEFTILSSA-TLP-VSPIRPNPLLAYAIAVVS
A0A136LSC7      YEEFYL----TMMQSKAEFEIAQAGST-PDFKILSPA-TLP-IKPISPSKVMVLGIGFVA
A0A5C7N8Q5      YEEFYL----TMMQSKAEFEIAQAGST-PDFKILSPA-TLP-TTPISPSKIMVLGIGFVA
A0A355BP94      YEEFYL----SMMQAKAEFEIAQAGST-PDLKILSSA-ILP-GRPVAPNRYLILGIGLVA
A0A7Y5D1K7      YEEFYL----SMMQAKAEFEIAQAGST-PDFKILSSA-VLP-TKPVAPNRYIILGIGFVG
A0A3D2HF71      NNTVYT----FLLEKRAEAGIARASTV-SDNRIIDYAGVYS-STMIKPKERQNFMLAIIL
A0A0A2DQN2      KEALYT----QLLSKREENLFAQTITN-NNAYILDLG-VGT-SAPISPVPSRSILLGIVL
A0A0A2F2N5      KEALYT----QLLSKREENTLAQTAQS-NNAYVMDFD-TGS-NSPISPNTTRTLLISFAI
L1NGW4          RERLYT----ELLNKREEYALMQAMTQ-DSAYILDMN-DAP-APPVSPNKTRTVLLAILI
Z4WRA0          RERLYT----ELLNKREEYALMQAMTQ-DSAYILDMN-DAP-APPVSPNKTRTVLLAILI
U2K8K9          QEGLYT----ELLSKREEYALRQSMTQ-DSAYILDMN-DAPNTPPVSPNTLRTIVLAFLL
A0A069ZM60      RQRLYT----ELLNKREEYALRQAMTQ-DSAYVLDMD-DAP-SKPISPNTLRVVLIAILI
J6GV98          RQRLYT----ELLNKREEYALRQAMTQ-DSAYVLDMD-DAP-SKPVSPNALRVALIAILI
A0A134B4F8      RQRLYT----ELLNKREEYALRQAMTQ-DSAYVLDMD-DAP-SKPVSPNTLRVVLIAILI
A0A134B8C7      RQRLYT----ELLNKREEYALRQAMTQ-DSAYVLDMD-DAP-SKPVSPNTLRVVLIAILI
A0A4Z0EKR0      KQNIYS----YLLQKREEAALSLAATT-AIARVIDPA-TGG-DYPISANSRTIYLMALLL
A0A521H707      NEKFYQ----LLLEKKVEFAITKAGII-TNNIVLEQG-KPA-LNPLSPNRKLILAGSLLV
A0A7T9D909      NEKYYT----QLLEKDIEYRISRAGFV-SGNRTLEEP-ELA-KAAVAPDGRLVYVSYLSV
A0A1M6B6D5      SEGTYN----MFLAKRSEAGLVKAANV-SDVLVIDPAKDTG-GGQIGPNTQLNYMMAGLI
A0A451FS66      SEGTYN----LFLAKRSEAGLVKAANV-SDVVIIDTAKDTG-GGKIGPNTQLNYVMAGLL
A0A2E3GN39      KSSFYN----SLLDRKASFTLSRAGIV-SDYIILEMP-KIA-EKHVAPDDSFIRFVGLAI
A0A3D1MEL0      KSSFYN----SLLDRKASFTLSRAGIV-SDYIVLEVP-KIA-EEHVAPDDSFIRFVGLAI
A0A519UDD1      KQNIYS----YLLQKREETALSLAATA-SVARVLDPA-MGG-NFPVSPNGRTIYLMSLLL
A0A7Y2ACP6      NERYYS----SLLEKRIQYRISKAGFV-SESKILEIG-TVP-SAPIKPNRNLIYTGFLGL
A0A2A4N9A6      EKKYYE----RLLEKHANLQIHAAGII-NDVVILAEA-SVP-KIQEYPSPVYAMLTGIIS
A0A6C0GGI1      TVAFYE----Q--KRAAAEILLATNAP-SKKRVDYAK-MVG-NGPMSPKTNAIYLIAFLV
A0A368D1N7      KSSFYN----SLLDRKASFTLSRAGIV-SDYIILEMP-KIA-EQHVAPDDSFIRFVGLAI
A0A3B8TU58      KAMFYN----NLIERKSSFSLSKAGIV-SDYTILENP-KIA-KNHISPNDSFIRFVGLAI
A0A1T5IIR6      KQELYL----FLLNKREENALSQAMAD-DNIRVVDPA-VAN-LTPTSPQRMKIVMLAILI
A0A3E0QD27      NQKFYQ----LLLEKKVEFSITKAGII-SNNIVLERG-KPA-VNPLSPNRRLVIAGSLLL
A0A0K2HKS3      KEELYL----YLLNKREENALGQATTE-TDARVLDPA-GGG-DTPISPNGRSMIMAGIMK
B6W3W8          KEELYL----YLLNKREENALGQATTE-TDARVLDPA-GGG-DTPISPNGRSMIMAGIMK
A0A0M1W1I6      KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
A0A4R4GHU2      KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
I8WPR6          KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
A0A076IRY8      KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
A0A3A6AD54      KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
A0A8B3EPF6      KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
I8WPP8          KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
A0A372Y7D2      KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
A0A7K3KFI2      KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
A0A3E4JJC9      KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
A0A3E4WDQ0      KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
A0A414H9P2      KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
A0A7K0JKU9      KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
C3R5A8          KEELYL----YLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMK
A0A6N8DCX3      KEALYL----FLLQKREENELSQAFTP-YNMRILTPP-SGN-LEPVAPQKKKILAVAFLL
F0R0C9          KEALYL----FLLQKREENELSQAFTA-YNTRVITPP-TGS-MLPTAPVRRNILLVAFAL
A0A1C5XJA7      KESLYL----FLLNKREENALSQAMAD-NNARVIDSA-EAT-KYPISPNRNKILALGILL
A0A285T4L1      KESLYM----FLLNRREENALSQAMAD-NNARTIDSV-DGP-VGPIAPVRNRILLLGVLV
R7CUW4          KESLYL----FLLNRREENALSQAMAD-NNARIIDSA-EGG-DSPISPRRNRILLLGLLV
A0A416GGJ1      KESLYM----FLLNRREENALTQAMAD-NNARLIDEA-DKG-SGPIAPVRNRILILGLLA
D1JY72          KEELYL----YLLNKREENALGQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGIMK
D7J4K6          KEALYM----FLLNRREENALSQAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLV
Q8ABP9          KEALYM----FLLNRREENALSQAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLV
D6D2Z5          KEALYM----FLLNRREENALSQAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLV
A0A1T3EDR4      KENLYL----YLLNKREENALNAAIGE-AKLHVVDHA-VIS-HVPISPNILISVFTGLGI
A0A6N8KXI9      KEELYL----FLLNKREENALNQAMTE-DNMRIIDPA-TGS-GAPISPSKFRKVGLGVGL
A0A174SDD8      KESLYI----FLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLMLGVGC
A0A1H7RFH3      KESLYI----FLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGC
A0A139L1N2      KESLYI----FLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGC
A0A174TVL8      KESLYI----FLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGC
A0A1H8BJR6      KESLYI----FLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGC
R9H6G0          KESLYI----FLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGC
A0A412GR09      KESLYI----FLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGC
A0A7J5JXN6      KESLYI----FLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGC
R6D982          KESLYL----FLLNKREENALNQSMVD-NNARIIDSA-SGS-NAPFYPNKYKKLLLGGGM
A0A1F0I8C4      KESLYV----FLLNKREENALNQAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGC
A0A3A5RIJ2      KESLYV----FLLNKREENALNQAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGC
A0A515IZJ5      KESLYV----FLLNKREENALNQAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGC
A0A7J4Y2H6      KESLYV----FLLNKREENALNQAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGC
A0A4R6WE41      KEDLYL----FLLNKREENALNQAMTE-DNIRIVDPA-YGS-EAPMYPSRLRKVGMGLAV
A0A2T5RP38      KEELYL----YLLNKREENALNEAMTD-ENIRVVDPA-SGP-DVAVYPNRLKKIFTGVAL
A0A1A6CF06      KEELYL----FLLNKREENALNEAITE-ANLRIVDPP-VGD-AYPIYPNRLKKVFTGVAI
A0A1T3D6S8      KEELYL----FLLNKREENALNEAITE-ANLRIVDPP-VGD-AYPIYPNRLKKLFTGVAI
A0A8B4GMS2      KEELYL----FLLNKREENALNEAITE-ANLRIVDPP-VGD-AYPIYPNRLKKLFTGVAI
A0A7Z7LUP7      KEELYL----FLLNKREENALNEAITE-ANLRIVDPP-VGD-AYPIYPNRLKKLFTGVAI
A0A0B8T471      KEELYI----LLLNRREENALNQAMTD-DNLRVVDPP-SGS-EAPIYPSKARKVMTGVGF
A0A4R7D2K0      KEELYI----LLLNRREENALNQAMTD-DNLRVVDPP-SGS-EGPIYPSKARKVMTGVGF
A0A7T9S3V1      KEELYV----FLLNKREENALNKAMTD-DNIRIIDPA-YGP-DTPVYPVRFKKVMTGVGI
A0A7T9LVI2      KEELYV----FLLNKREENALNKAMTD-DNIRIIDPA-SGS-DAPVYPVRFKKVMTGVGI
C2FUH6          KEELYV----FLLNKREENALNKAMTD-DNIRIIDPA-SGS-DAPVYPVRFKKVMTGVGI
A0A1V3N3U3      KEELYL----YLLNKREENALNLAMTE-DNIRIIDRA-SVA-TSPIFPSKFRKVATGIGI
A0A1P8E011      KEELYL----YLLNKREENAINQAMTE-DNIRVIDPA-IVS-FDPVAPSRMRKLGLGMAI
A0A7T9S8K4      KEELYL----YLLNKREENAINQAMTE-DNIRVIDPA-IVS-FDPVAPSKMRKLGLGMAI
A0A2X2J8S4      KESLYV----FLLNKREENAINQAMTD-DNIKVIDPA-SGS-FAPVYPNKFKKVGLGVAI
A0A3C0S618      KESLYV----FLLNKREENAINQAMTD-DNIKVIDPA-SGS-FAPVYPDKFKKVGLGVAI
A0A4P7DRF9      KEELYI----FLLNKREENAINQAMTD-DNIRIIDSA-SGS-DWPIYPNKLKKLAIGIGI
A0A239XXC4      IEELYI----FLLNKREENAINRAMTD-DNIRVIDSA-SGS-NLPFYPSKLKKVAIGVAI
A0A4U9K473      IEELYI----FLLNKREENAINREMTD-DNIRVIDSA-SGS-DLPFYPSKFKKIALGVAI
A0A081PBV5      KEELYL----LLLNKREENAINQAMTE-DNVRIIDPA-SGS-DAPIYPSRIKKLALGVGI
A0A1I2AN85      KEELYL----LLLNKREENAINQAMTE-DNVRIIDPA-SGS-DAPIYPSRIKKLALGVGI
A0A4U0GMP3      KEELYI----FLLNRREENSLNQAMTD-DNVRIIDPA-SGS-SAPIYPSRFSKVALGVGI
A0A0D5BSQ0      KEELYL----FLLNKREENALNEAIAE-SNLRIVDPP-TGL-DFPVSPNKLKKLSIGVAI
A0A1T3F6P5      KEDLYM----FLLNKREENALNEAVTE-ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAI
A0A853VUQ0      KEDLYM----FLLNKREENALNEAVTE-ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAI
A0A7X0MJ00      KEDLYI----FLLNKREENALNLAMTD-DNIRVIDPA-SGS-DSPISPNKFRKMMMGVGI
A0A841JHZ0      KEDLYI----LLLNKREENELNLAMTD-DNIRIIDPA-SGT-DFPIYPNKFRKMMVGIGI
A0A1H6CKR6      KEELYI----FLLNKREENAINQAMTD-DNIKVIDSA-NTS-NYPFYPSLLKKLALGIGI
A0A7W3MGA7      IEELYI----FLLNKREENAINRAMTD-DNIRVIDSA-SGS-DAPFYPSKFKKVAIGVAI
A0A3M1Y2F5      INELYS----YLQKKKTEAEIALANLT-VDLMIIDPA-RYT-GKESRNSRMLIMALALIL
A0A7V1ALN2      QRLNYQ----SLVNNNEKIQMVESEKV-GNVQILMPA-SMP-EAPTKQHQTVKMIIGALL
A0A3D4RLG4      DDNYYT----FFLQKRAETEIQKASNT-PDNAVLDKA-RTT-YITNAKQQRKTMISYLAL
A0A2T2UAJ4      TEQIYS----FVQEKLQEARLAEQSEI-GYAEIIRSA-APG-RPVGPDTR-RNLLLGLML
A0A6I0DZQ5      NDSYYT----LFLQKRAEAEILKASNT-PDNNILDRA-RVI-NVVNQGEKSKTTLLFLLL
A0A1H6Z2F8      QQELYL----FLLKKRMETAISRSANI-ANARVIDPP-KAS-PLPVSPNRQLTILVAFLA
A0A2P8G5K0      QQELYL----FLLKKRVETAISRSANI-ANARVIDPP-KAS-RLPVYPNRELTILIAVFT
R5DEG6          KEELYL----YLLNKREENELTQRMTE-SNARIIDPA-AGS-NAPVAPKAMMILLASVVL
A0A4Q3SEI4      KNDAYS----FLLQKREEAAISYAAVV-ADSRTINHA-TAS-FLPISPEKTFVYLVSIVI
A0A836SQI2      NEKYYN----QLLEKKAEYMIYEAGYV-SNDVILEKA-SPA-KYPISPIKTQIFVALFIV
A0A7V1FAJ9      ANTIYS----ELLAKHQEAQITESVES-GVVDILDPA-IPP-EHPINRDKKKKAAMGGFL
A0A3N2LCI3      KESLYL----FLLQKREENELSQAFTA-YNTRVVNKP--AS-FGPTAPNTRNILMMSFLL
A0A6H9Q899      KEALYL----FLLQKREENELSQAFTA-YNTRIVTPP-HGS-MLPTSPVRKNIFMVAFAL
A0A3D4CJE1      DEKFFT----LLLEKRTEYSISEAGFV-PQHTILEQA-EIP-NVPIKPNKKLIFVVFVFG
A0A7C7LI79      NEKFYT----TLLEKKAEFSISKAGFV-SKNAILEVG-VPP-IIPVSPDKQKVFTLGTLV
A0A4Q5ZQ60      YEQSYL----LLMEKKIQFGIAKAGTT-DNSQILSPA-SLP-TLPIYPNKMLVYAIGIAA
A0A519Q885      YSGAVR----DLMQKQLEYEIQNAGTI-PDFQILSAA-ATP-DEPISPKKILVYAIGLAG
A0A519TAP8      YASTYQ----RLVDRKMDFNIQQAGTT-PEFQILSPA-SPP-SEPITPVRLLVYAIGLAG
A0A848Y4B8      TERLYT----ALEGKYQEARVAEQSEL-GYAEVIRGA-SIP-HAPFRPNRERNILLGILL
A0A7Y4V8Y1      YEEFYL----SMMQSKAQFEIAQAGNV-PDFKILSPA-SLP-IVPISPKKLLILGIGLVA
A0A5Q4EKA0      NERFYN----QLVEKKAEYSISKAGYV-SQSVILERS-RVP-GQPISPKPRGVYASSLLA
A0A519SYE7      YANTYS----QLLNQKLNFGIQQAGTT-ANFQILSPA-YPP-GEPISPVRALVYAIGLAS
A0A7C7CFR2      NEKFYT----NLLEKKAEYSISKAGFV-SKNMILESA-TVP-TSPISPDSSKVIALVLII
A0A7W1G0I5      ---------------------------------------MK-LTPVSPNKSLNLGIAFFI
A0A2T4XEQ1      AESIYL----TISRQYAETALWEQTQF-GLGRPLDYA-VAP-LSPFKPNKRLFILIGIFL
A0A2K8ZAP1      KNNLYT----YLLQKREETALSAASRV-SDSRIVDPA-HTT-SQPVKPVKLMIFALFAVV
A0A3D3LSK1      AEKLYA----ALESNYQESLINERTQT-IKSYVIDPG-YDD-NSPIGPDRRNMNIFGIIA
A0A496L711      NDSYYT----FLLQKRSEAQIRKASNS-PDNAVMQKA-RTS-QLVNANQKQKKYMIFFFI
A0A348PT57      NEKYYT----LLLEKKTEYAISEAGFI-SENRVLRRA-STS-RIPISPVKPIIYASFLAL
A0A847AMH6      NNETYT----FLLEKLSEAQIAKASNQ-PESQIVELA--ES-QGLIAPKKDKIYSYGAMG
A0A7C3PTI0      NEKFYT----LLLEKKTEYSISEAGNV-SLHEILEKS-LPP-TSPVSPSKKLVVISAFMV
A0A7V1FAS7      NENIYL----MMKQKYEESRITKAGQI-GKIRIIDQA-LPP-QFPVSPKKKMNLLLAVLI
A0A7V0M115      ------------------------------------------------------------
A0A7C1IBE4      ---------------------------------------------------MKIVGKVSK
A0A3D5KRM7      ------------------------------------------------------------
A0A831LDA6      -----------------------------------------------------YAIALLL
A0A833B0I1      ---------------------SQAFTA-YNTRIVTPP-HGS-MLPTSPVHKNIFMVAFAL
A0A1V5S5I3      ------------------------------------------MIPTAPVKKNIALVAIVL
R7JFY1          -----------------------------------------------------------M
A0A2M7VVW6      ---------------------------------------------------MIMATGVLL
A0A413V760      -----------------------------------------------------------L
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      -------------------------------MLTAGT-TAD-FQILSAASAPDAPISPKK
                                                                            

A0A7X8GFH1      VLIMIFILTLIR-YLLYNNIMNMSDIARFT-KV--P--ISGVIPN------S--------
A0A7C7CKY6      GLILSVGLLLVT-YLLHDVVTSVQEIKIHT-SA--R--ILGIVPS------Y--------
A0A1G1TG88      GLFLGLGLIAVR-YLLHNTITNTRELERST-QA--A--VLGVIPT------Y--------
A0A661XXA6      FIVLSFIFIVIS-YLAHDKIDGIADVERNT-AA--T--LLGSVPK------Y--------
A0A519SD85      GLAGGITFIFLK-RKINPFVNIAEDILQHT-IT--P--VLATLRR------STDSNDLLS
A0A3M1TXY5      SLGLPLAIMLVY-DFFNEKISGDQDIEACT-NI--P--ILGYIAR------YEKSNN---
A0A7T9KM12      GLLLPLILVLVL-DFFNDRIMDLDELKRLS-PI--P--VLSTVPT------SKQQR----
A0A2E0VQ27      ALLAGMFYAYLR-SYVKETVSSKDELEEKLPQY--P--IIGEVY----------------
A0A7Y7TYP1      GLGIPFGFFILK-STLNDKLVATDNIEQLT-DV--P--VAGKIIH------NTKKTR---
R6U429          GAGIPFGIFFMI-NQLDTRVKTRNDLTNM--QV--P--FLAEIPQ------LGQGAGILN
A0A5C8AF42      GIVIGLGIMFFK-YLTFNEINMLDDLKKLL-PS--RASILGGVPL------FKSEMEFSQ
A0A7Y5SYP1      GLLVGLGLSIGL-KKMDNRIHKLDDLEKL--NI--Q--ILGQVPV------DEERLATGN
A0A7V1N701      GLFLGFGVCFAA-DLFDDSFKTPEEVEHIL-RL--S--TLGMIPE------IRLPRDKLK
A0A7V2NIA8      ALMIASFGAYMA-DLFDNTIKSTDEIQKEL-NV--S--VLGMIPF------INPKKVDFT
A0A239K409      GLGVPLASIFIK-NAFNRKVQQRADVERAT-TA--P--VLGEVSY------NDTKDV---
A0A1M3DPL8      GILLPSVFIILK-ELLNNTIRTSRDVEKMS-AF--P--LIGLVRH------TNSTDP---
A0A1V5F519      GILIPSLIIVLK-EVLNNTIRSIKDIEKRS-VF--P--VIGMIRH------AKNDLP---
A0A2G6R1T9      GLMIPAIFLIAR-ELLNNTIRGQKDVEKNS-KF--P--IIGNIRH------TKKANP---
A0A350V3E4      GLGLGYGFALLR-NILDVSVKSPEDLENI--GI--S--LIGWVPT------FMREPKAGR
A0A6J4K208      GLLLPLGLLTLR-HFMRNRIINQTDIQLNT-AI--P--TLGVVGY------NEKAGN---
A0A2W4RDE8      GFGGALGLLILK-DFLNDNIVTHEDLEQYT-RI--P--FLGVVSH------GSRREQ---
A0A212J9Z9      GLILPLCFVVLKEEILNFSITTKEECEKIS-GF--P--VIGTIEN------VS-------
F5IV23          GLILPLCFVVLKEEILNFSITTKEECEKIS-GF--P--VIGTIEN------VS-------
A0A1M5DFS8      GLAIPLIFVICKEELFNYAISTKEDCERLS-GL--P--VIGTIEN------IS-------
A0A4Y8KZS5      GLAIPLIFVICKEELFNYAISTKEDCERLS-SL--P--VIGTIEN------IS-------
A0A2V3PNY7      GLGLPLLFVIAKEEIFNLVISTKEDCERLS-GL--P--VIGTIEN------IS-------
A0A6G7X5K8      GLALPLAFVVCKEEIFNHAISTKEDCERLS-GL--P--VIGTIEN------IS-------
A0A840CJ33      GLIIPLCFVILKEEVLNFSITTKEECEKIS-GL--P--VIGTIEN------VS-------
F8X2T0          ALVIPLIFVVVKEEVLNFAITSKEECEKIS-GL--P--VIGTIEN------IS-------
A0A1M3LAG1      ALVIPLIFVVVKEEVLNFAITSKEECEKIS-GL--P--VIGTIEN------IS-------
A0A212K6G4      ALVIPLIFVVVKEEVLNFAITSKEECEKIS-GL--P--VIGTIEN------IS-------
A0A4Y9IPG7      ALVIPLIFVVVKEEVLNFAITSKEECEKIS-GL--P--VIGTIEN------IS-------
A0A0L8VEV2      GLFVPFMVIMLA-TYFYDRIKSAEDIEEYT-DI--P--VIGNIVN------SGIGSEY--
A0A1I2A9Z9      GLFIPFVVIMLA-TYFYDRIKSAEDIEEYS-DI--P--VIGNIVN------TGIGAEF--
A0A848XXC6      GLLLGLTAAAFR-YRTDANIHTPADLEEH--GF--T--VVGTIPD------LGKEAEGTP
A0A2P8CDS1      GIFLPAGGIILK-NEFDNKVRTPEDLENLT-KY--P--ILGHIIH------D--------
A0A660LQT8      ALALPFGIFYLR-EMLDTRVRGRRDMENL--DI--P--HIGEIPH------MDASVESWT
A0A3D0FMX4      GLIIPFLFVILR-ELLNNKVRTTREAEALS-HY--K--LLAQVRH------TRGSNP---
A0A7V6G854      GLLIPFAFIILK-ELLNFTIRTETDLQKLT-KY--P--IIGQIRH------TNNLTP---
A0A1M3MEI8      GLVVPAGFVVVK-ELLNVRIMTNRDVEKYS-SF--P--LIGMIRH------TNSDNP---
A0A1J5HQM0      GLLIPAAFVALR-EFSNGTIRSNKDIEKNS-KF--T--MIGSVRH------TNSNDP---
E4T131          GLLIPTFIVILI-ELLNNTVHSTKDVEKNS-VF--P--LIGAVRH------TKSTDP---
A0A653AC35      GFLIPFLIVLLT-ELLNNTIRNAKDVEKNS-PF--S--LIGAVRH------TQNKDP---
A0A847LA02      GLLLPALFLVIK-ELINNTIRDEKDIEKIS-PF--P--LIGTIKH------TNSQDP---
A0A389LWV6      GLILTIIFIFLKEVLLKTSIQSRSEVEKIS-EL--P--ILGTIEH------TERKEM---
A0A1G9B1T9      GLALPVGALILA-DMFQDKISSREEVANII-SM--P--LVGEVPR------LRRKEN---
A0A350PNH9      GVLIPVVVIFIR-ENMNTTVRGRNDLKNI--TI--P--FLGEIPY------CISRKNRPT
A0A354LNT9      GVLIPVVVIFIR-ENMNTTVRGRNDLKNI--TI--P--FLGEIPY------SISRKNRPT
A0A161LWY6      GLIIPLLIIILK-EYLKTKVMDKRDIEKLS-PF--P--YIGSLPH------ATHDDAT--
A0A6I3N9U6      GLIIPLLIIILK-EYLKTKVMDKRDIEKLS-PF--P--YIGSLPH------ATHDDAT--
A0A353WYK7      SVILSFLFIIIR-YLLHNSVSSEKDIEHIT-PT--S--ILGSIPF------VEKLKGRDS
A0A2W7RD29      TFLLPVIITFLQ-ETVFKKLVDPSEIEKLL-NI--P--VIGSIPV------AEGKTN---
A0A3N2NDY8      GLCVPGVAIYII-SATDTKVRSRKDLDRM--SA--P--FAGEIPF------VGKKSIKDR
D7JEV9          GLAIPAVLIILK-ELLNNAIRTEKDIERAT-RN--RFPTIGSVRH------T--------
A0A553GA49      GLLLPTIYVLLN-ESYFEKISDIEDYRFSF-KA--P--VLGQI-----------------
A0A7V5GTN5      SLVLGFGLAYMV-DLFDNTVQGEIDIASKF-NL--P--VYGSIPV------LNLRGLRTR
A0A497D6F6      GLFVPALIILMK-YFSTNKITTVDDIKEIT-NA--P--VVGLV-----------------
F4KR18          GLAIPFFLILVL-ELLKNSVQTEEDLKSMLPEK--T--IMGVI-----------------
B5CTK0          GIGIPAVFLMLL-KMTDTKVRTKKDIENKL-SI--P--FLGEI-----------------
A0A5M4AAB9      GIFFPSTLIIIR-NALDNKVRTLDDLKLLT-DS--P--VLGQI-----------------
A0A5R9QZP0      GFIIPSIFTLLK-VFFSQKVSSVRDIERVI-HQ--P--ILNLI-----------------
A0A7X6SRJ5      AFIIPTLYIILR-NFFNEKITSVSDVEKML-KR--P--VLSLI-----------------
A0A3D3HL11      AFMVPTIYIILK-NFFNEKISSVRDVEHMI-GQ--P--VMNLI-----------------
A0A6L8U6G9      AFMIPTLYIILR-NFFNEKITSVRDVERII-GQ--P--VMNLI-----------------
A0A6L8UH35      GLLIPTMYLVLR-DFFDDKIRSLNDAEYLL-HK--P--ILSVI-----------------
A0A7X9F2J5      GLLIPTMYLILR-DFFDDKIRSLNDAEYLL-HR--P--ILSVI-----------------
A0A352ME00      GLLLPTLYLMIR-DFFDDKIRSINDAEYML-HR--S--VMSVI-----------------
A0A7X8CRA6      GLLFPTLYLMIR-DFFDDKIRSINDAEYML-HR--S--VMSVI-----------------
A0A1F3D6P8      GLAIPTTFIFIR-NFFNNKISSIYDLESLI-NQ--S--GMGVI-----------------
A0A356Z058      GLAIPTTFIFIR-NFFNNKISSIYDLESLI-NQ--S--GMGVI-----------------
A0A7X8FHL3      GLFIPTLYLMIR-DFFDDKIRSINDAEYML-HR--S--VMSVI-----------------
A0A3D1BT36      GLLIPSLIIILK-DFFNEKITRAYEIEDVL-GK--P--VLSTI-----------------
A0A7X7CXW9      AFMIPTLYIILR-NFFNEKITSVRDVEKII-GQ--P--VMNLI-----------------
A0A4R6H3B7      GLFIPFVVIMLA-TYFYDRIKSAEDIEEYS-DI--P--VIGNIVN---------------
A0A229I3A5      GFLIPMVVIYIR-EKANTTVRGRKDLKK-V-NV--P--FLGEIPF------SISRKNRPT
A0A3R6HJB3      GFLIPMVVIYIR-EKANTTVRGRKDLKK-V-NV--P--FLGEIPF------SISRKNRPT
R6NN15          GVLIPVVFVFLQ-ETLNTRVRGKKDLEN-L-SI--P--FVGEIPL------YGKVRRSGL
A0A2W7QSQ0      GLSLPLGLILVN-YLVTSKVTSKRVIEKIL-NA--Q--ILGEIAK------NDQNGV---
A0A841MQL4      GFIFPLALVFAN-YFFSSKITSKSKIEKIV-DA--H--ILGEIAK------SEEKGV---
A0A3P1Z8V4      GILIPSFAFWLL-DLFDHTVSGRQDVENAL-DI--P--IVGELPH------V--------
A0A1M6MYT6      ALAFPTGIIILL-DLLNTKILSKDDVEALT-DY--P--IIGHVF----------------
A0A1V5S1J9      GLLVPVAIIVLL-ELMVPYIRTESEVISMA-PK--QYQLLGVIMH------TDRKTP---
A0A7X8JMH1      GLLIPLAFVGIK-EFMYPFIRSENEILHLS-RR--AYQIIGVIRH------TSKNIP---
A0A3D5KRY6      GLLGALGLIILK-EAATNTVSDADEVARLL-DV--A--TIGSISH------NRYKTE---
R7F6L5          GLIIPSGVYVVK-ANLDNKVRSREDVEN-I-GI--P--FIGEIPQ------K--------
A0A7C5MRV2      GVCLGLLLILLS-GMLKNTVSYREEVENMS-VT--P--IIGVVRR------S--------
A0A0A2EYC8      GLAVPAALIILK-ELLNNAIRTEKDIEKAI-KN--KFQIIGTV-----------------
A0A2G6H6Y4      GLMIPVVLIVLK-EFMNSAVRTEKDVDIAT-KN--RFDIIGSV-----------------
C9LKL0          GLLIPTLILTIR-RLMDITVSGRHDVEEAT-TI--P--LVGELP----------------
A0A3D0QPV7      GILFSSVMIVIR-YLMHNEITTLHEITRIS-NA--SLGILGIIPK---------------
A0A496KT23      GLAIPAAFVFGR-EALNSTVRGRKDLED-Y-SM--P--LVGELPL------KGKKRPVWK
L1M9T3          GLGIPAALIFAR-EGFNTTVRGRKDLED-M-SV--P--LVGELPF------KGKKRPVWQ
A0A2M6GH67      GLFLGIGLIAAR-YFMHNTITNLGEVERNT-KA--P--VLGVVPR------Y--------
A0A7K1TE30      GLITGLGLIATR-YFMHNTITGVQELERNT-KA--S--VLGVIPT------Y--------
A0A7D4BE70      GLVLGLGLIAVR-YLMHNTVTSVSELEHST-KA--S--VLGVIPT------Y--------
A0A142HHS5      GLILGLGLIGTR-YLMHNTITSVNELERNT-KA--S--VLGVIPT------Y--------
A0A7D4C435      GLVLSLGLIATR-YLMHNTITSVNELERNT-NA--S--VLGVIPT------Y--------
A0A3C0I8F1      GVVLSLLLVAIR-YLLNNTVANQKELEKII-IA--P--VLGVIPF------HN-------
R5JJI4          GGTIPMIVLWLL-NVTDTKVRTRKELDNIL-TI--P--FLGDIPR------HG-------
A0A848IUK4      AMFLSLVFIASR-YILHDKITSQSELERLT-TT--P--VLGVIPK------Y--------
A0A136LSC7      AIVLCLFFIGLV-YLLNNKITSVKEVERGI-NL--P--MLGAIPA------S--------
A0A5C7N8Q5      GIVLSIFFIGLV-YVLNNKITSVKEVERGI-NL--P--MLGAIPA------S--------
A0A355BP94      GLVINFFFISIV-YLLSNKITSLQEIERTI-HV--P--VLGVIPE------M--------
A0A7Y5D1K7      GLILNFFFIGII-YLSNNKITGLTEIERST-GV--P--VLGVIPE------M--------
A0A3D2HF71      GLFFPGIGILLL-DYFNNKIIDKKDIEKRT-SA--P--IIGFIGH------NTFKTD---
A0A0A2DQN2      GLFIPAAYAILK-LLTDTKIHSRRDVVDQV-SL--P--FLGEIPL------NT-------
A0A0A2F2N5      GLFIPTAFFLLK-LLADTKVRTRKDVLERV-SI--P--YLGDIPQ------SD-------
L1NGW4          GLALPTIGLIIR-LLADNKVRTRKDILDRL-TI--P--FLGDIPK------ED-------
Z4WRA0          GLALPTIGLIIR-LLADNKVRTRKDILDRL-TI--P--FLGDIPK------ED-------
U2K8K9          GLALPTIFLIVR-LLTDNKVRTRKDILDRL-TI--P--FLGDIPK------EE-------
A0A069ZM60      GLVLPSVYLIIR-LLADNKVRSRKDVMDRV-SI--P--FLGDIPR------EE-------
J6GV98          GLVLPSVYLIIR-LLADNKVRSRKDVMDRV-SI--P--FLGDIPK------EE-------
A0A134B4F8      GLVLPSVYLIIR-LLADNKVRSRKDVMDRV-SI--P--FLGDIPR------EE-------
A0A134B8C7      GLVLPSVYLIIR-LLADNKVRSRKDVMDRV-SI--P--FLGDIPR------EE-------
A0A4Z0EKR0      GLAIPFGGIYTN-NLLDNKVQSQQDVSAMT-PT--P--ILGEISH------NNSNES---
A0A521H707      GFILSFVIIFVK-YLFYNEITSLDEINLYT-NA--A--LLGIIPK---------------
A0A7T9D909      GAVIALLIILVR-YILHDNITSLFDIAKQS-QA--SIGILGMIPK---------------
A0A1M6B6D5      GFFVPILLIFVR-AFFDTKVESVKDLEAIT-PI--P--MIGVIGK------NHSETV---
A0A451FS66      GLFIPLFIIFGM-AFFDTKVEYVKDLAKIT-PI--P--LFGVIGK------NHSGNI---
A0A2E3GN39      GAILSLILVVFR-YVTHKEIINIEDITSQT-ET--S--LLGVIQR---------------
A0A3D1MEL0      GAILSLILVVFR-YITHKEIINIEDITSQT-ET--S--LLGVIQR---------------
A0A519UDD1      GLGLPLAGIYAA-NLLNNKVQTQQDVASVT-EA--P--ILGDIAH------N--------
A0A7Y2ACP6      GIVLSLLFVVIR-YLLHNNITSLNEIAKLS-NA--SIGILGIIPK------Y--------
A0A2A4N9A6      FLMLSLITVIFR-YMLHNKISHLSDIDRST-NA--T--VLGIIPQ------F--------
A0A6C0GGI1      GLFIPAGGILAY-DLVNNTIKSKDDVRGVT-NI--P--VLGLIGH------S--------
A0A368D1N7      GAILSLILVVIR-YITHKEIINIEDITSQT-ET--S--LLGIIQR------Y--------
A0A3B8TU58      GAILSLILVVFR-YITHKEIINIEDVTSQT-ET--A--LLGVIQR------Y--------
A0A1T5IIR6      GLLIPGVILIAR-LFLDTKIRTRKEIEENI-DV--P--FLAEIPL------NGTLRGIVF
A0A3E0QD27      GFIISFLIIFVK-YLFYNEITTLDEINLYT-DA--A--LLGIIPK------Y--------
A0A0K2HKS3      GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKRK---
B6W3W8          GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKRK---
A0A0M1W1I6      GIALPAIVLLLF-LFFDTRIRNRKDIEDVV-TV--P--FLGEIPK------DSSKRK---
A0A4R4GHU2      GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKRK---
I8WPR6          GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKRK---
A0A076IRY8      GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKGK---
A0A3A6AD54      GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKGK---
A0A8B3EPF6      GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKGK---
I8WPP8          GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKGK---
A0A372Y7D2      GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKGK---
A0A7K3KFI2      GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKGK---
A0A3E4JJC9      GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKGK---
A0A3E4WDQ0      GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKGK---
A0A414H9P2      GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKGK---
A0A7K0JKU9      GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKGK---
C3R5A8          GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKGK---
A0A6N8DCX3      GLMFPAGCILLR-ENMNTTVRRRKDIA-RL-AV--P--FIGEIPL------DTSGKK---
F0R0C9          GLLIPVVIVFVR-ENMNTKVRGKKDLE-CL-SM--P--FAGEIPL------AGESRR---
A0A1C5XJA7      GLALPTVSFLVI-MFMDTRIHSRKDILGAV-SV--P--FLGEIPL------D--------
A0A285T4L1      GLAVPGVVFLMI-LFMDTRVRSRKDLKGAV-SI--P--FLGEIPQ------D--------
R7CUW4          GIALPGVGCLLV-LFLDTRVHGRKDIEKAV-SV--P--FLGEIPL------D--------
A0A416GGJ1      GIALPGVACLLI-LFLDTRVHGRKDLEGVV-TA--P--LLGEIPL------D--KKL---
D1JY72          GIALPAIVLLLF-LFFDTRIRNRKDIEDAV-TV--P--FLGEIPK------DSSKRK---
D7J4K6          GLAVPGVVFLMI-LFMDTRVHSRKDLKGAV-SI--P--FLGEVP----------------
Q8ABP9          GLAVPGVVFLMI-LFMDTRVHSRKDLKGAV-SI--P--FLGEVP----------------
D6D2Z5          GLAVPGVVFLMI-LFMDTRVHSRKDLKGAV-SI--P--FLGEVP----------------
A0A1T3EDR4      GFLVWVALLLLR-LFLNTTVKSREEIESAL-NI--P--FLGEIPY------S--------
A0A6N8KXI9      GFLIPTIILLAM-LMLDTKVRGKGDLENGL-SI--P--VMGEIPL------A--------
A0A174SDD8      GVIVPSVILLLM-LILDTGVHNRKEVESIV-SA--P--FLADIPQ------T--------
A0A1H7RFH3      GVIVPSVILLLM-LMLDTGVHNRKEIESIV-SA--P--FLADIPQ------T--------
A0A139L1N2      GVIVPSVILLLM-LMLDTGVHNRKEIESIV-NA--P--FLADIPQ------T--------
A0A174TVL8      GVIVPSVILLLM-LMLDTGVHNRKEIESIV-SA--P--FLADIPQ------T--------
A0A1H8BJR6      GVIVPSVILLLM-LMLDTGVHNRKEIESIV-SA--P--FLADIPQ------T--------
R9H6G0          GVIVPSVILLLM-LMLDTGVHNRKEIESIV-SA--P--FLADIPQ------T--------
A0A412GR09      GVIVPSVILLLM-LMLDTGVHNRKEIESIV-SA--P--FLADIPQ------T--------
A0A7J5JXN6      GVIVPSVILLLM-LMLDTGVHNRKEIESIV-NA--P--FLADIPQ------T--------
R6D982          GILIPTVILLLI-LIVDTRVRNRKDMEAVV-SA--P--FLAEIPK------S--------
A0A1F0I8C4      GVIVPTVVLLLI-LVLDTRVHSRKEIEASV-SA--P--FLADIPQ------V--------
A0A3A5RIJ2      GVIVPTVVLLLI-LVLDTRVHSRKEIEASV-SA--P--FLADIPQ------V--------
A0A515IZJ5      GVIVPTVVLLLI-LVLDTRVHSRKEIEASV-SA--P--FLADIPQ------V--------
A0A7J4Y2H6      GVIVPTVALLLI-LVLDTRVHSRKEIEASV-SA--P--FLADIPQ------V--------
A0A4R6WE41      GTVLPAVVLLLM-LMLDTGVRSRQDIQKVV-TA--P--FLGELPM---------------
A0A2T5RP38      GTAVPAVILLSM-LVLNTGVRGRQDLENVL-SV--P--FLGEIPL------A--------
A0A1A6CF06      GTVLPMIVLLSL-LLLNTAVRGRQDLENVL-SV--P--FLGEIPL------A--------
A0A1T3D6S8      GTVLPMIVLLSL-LLLNTAVRGRQDLENVL-SV--P--FLGEIPL------A--------
A0A8B4GMS2      GTVLPMIVLLSL-LLLNTAVRGRQDLENVL-SV--P--FLGEIPL------A--------
A0A7Z7LUP7      GTVLPMIVLLSL-LLLNTAVRGRQDLENVL-SV--P--FLGEIPL------A--------
A0A0B8T471      GVVLPTVVLLLL-LLLDTKVNGRKDIEEAV-SV--P--FLGEIPF------S--------
A0A4R7D2K0      GVVLPAVVLLLL-LLLDTKVNGRKDIEEAV-TV--P--FLGEIPF------S--------
A0A7T9S3V1      GMVLPAAVLLFM-LIFNTGVSGRQDIESVL-DI--P--FLGEIPQ------A--------
A0A7T9LVI2      GIVLPAAVLLCL-LIFNTGVRGRQDIESVL-DI--P--FLGEIPQ------A--------
C2FUH6          GIVLPAAVLLCL-LIFNTGVRGRQDIESVL-DI--P--FLGEIPQ------A--------
A0A1V3N3U3      GLILPTVILLFL-LVFNTGVRSRQDVETVL-SV--P--FLGEIPL------S--------
A0A1P8E011      GFILPAIVIMTL-SILDTGVRRRQDIEEAI-DV--P--LLGEIPL------A--------
A0A7T9S8K4      GFILPAIVIMTL-SILDTGVRRRQDIEEAI-DV--P--LLGEIPL------A--------
A0A2X2J8S4      GLVIPSLLLILM-LVVDSGVRNRKDLEEGL-SV--P--FLGEIPL------A--------
A0A3C0S618      GLVVPSVILILL-LIVDSGVRNRKDLEDGL-SV--P--FLGEIPL------A--------
A0A4P7DRF9      GLAIPAIVLLLM-LLFNTKIRNKRDIESEV-SI--P--FAGEIPF------S--------
A0A239XXC4      GIAVPAAILLLM-LLLNTKVRNRKDIEDAV-SV--P--FLAEIPF------S--------
A0A4U9K473      GIAVPAAILLLM-LLLNTKVRNRKDVEDAI-SV--P--FVGEIPF------S--------
A0A081PBV5      GIALPAIVFLLM-LMLDTGVRSRKDIEEVL-SV--P--FLGEIPF------T--------
A0A1I2AN85      GIALPAIVFLLM-LMLDTGVRSRKDIEEVL-SV--P--FLGEIPF------T--------
A0A4U0GMP3      GAAIPAVVLLLM-LLLDTGVRNRKDIEGAV-TT--P--FLGEIPF------S----D---
A0A0D5BSQ0      GAVLPAVVLLSM-LMLNTGVRGRQDLEDVL-SV--P--FLGEIPL------M--------
A0A1T3F6P5      GTVLPAVVLLSM-LMLNTGVRGRQDLENVL-TV--P--FLGEIPL------A--------
A0A853VUQ0      GAVLPAVVLLSM-LMLNTGVRGRQDLENVL-TV--P--FLGEIPL------A--------
A0A7X0MJ00      GFALPTSMLLLV-LLLNTGVRSRKDIETQI-TV--P--FLGEIPF------S--------
A0A841JHZ0      GLALPTVTLLLV-LLLNTGVHSRKDLEDQL-SA--P--FLGEIPF------S--------
A0A1H6CKR6      GLAIPTAILLLI-LMLNTKIRYRKDIEDNI-SV--P--LVGEIPF------S--------
A0A7W3MGA7      GIAVPAAILLLM-LLLNTKIRNRKDIEDAV-SV--P--FLAEIPF------S--------
A0A3M1Y2F5      AIGLPAGFLVVL-SYFSDKVSTYQELKKAT-PI--P--VLGTVIK---ND----------
A0A7V1ALN2      GLIFGIGLSYMI-EWQDVSLHTIEEVESRL-NV--P--VLTAIPDFYTLK-------RGK
A0A3D4RLG4      GFLLPLVLSVLI-ELIYNKLRIPKEVERLS-SF--P--LIGSLRH---VRS---------
A0A2T2UAJ4      GLVAGGGLVVLR-EQLDTRIYQPDDLREHG-HH-----VLGVVPS---MTPLIDDEFGGQ
A0A6I0DZQ5      GLVVPAGFVVVK-ELLNVRIMTNRDVEKYS-SF--P--LIGMIRH---TNS---------
A0A1H6Z2F8      GLLAPACVIYVG-QIFNNKITSKDDISRQC-DV--T--IIGEISQ---------------
A0A2P8G5K0      GILTPLGVLYTS-QIFNNKITSKEDIQRQC-DV--M--ILGEISQ---------------
R5DEG6          GCAIPAGILWLL-MVSDTKVRSRKDVEGVL-SV--P--FLGEIPM---------------
A0A4Q3SEI4      GLLIGFSFVIIK-ELLTHKVQFRHDIERLT-TI--P--VVAEVIKVKAKT----------
A0A836SQI2      SFVVIFIYLIFR-YLFFDQIVSIEDILDFT-EV--P--LLGVIPLIKMNE----------
A0A7V1FAJ9      AIFLSLGTAIIL-EFMDKSIKSTEDIKKYL-KL--P--VIGTIPNVKFNE----------
A0A3N2LCI3      GLAIPFGVVYLM-ESNNTKVRGRKDVEHLA-V---P--FLGELPQ---DG----------
A0A6H9Q899      GLLIPVVIIFMR-ENMNTRVRGRKDLENVT-V---P--FIGEIPL---FT----------
A0A3D4CJE1      SLVLGIGFVVIK-YLFHNEITSVADITQEG-KAKLG--VLGVIPK---YK----------
A0A7C7LI79      ALFLSGLLLIIS-YLLHNNIISITDISKQT-SA--A--ILGVIPT---YK----------
A0A4Q5ZQ60      SFFLSIVLVTAR-YFLHNTITNLKELERNT-MA--P--LLGIVPS---YT----------
A0A519Q885      GLILGLGLIGVR-YLMHNTVTSVAELERNT-KA--T--VLGVIPS---YT----------
A0A519TAP8      GLILGLGLIATR-YLMHNTVTGVAELERGA-RA--A--VLGVIPT---YD----------
A0A848Y4B8      GLGLGVTLAILK-TRLDHRIHRPDDL-RDR-GL--P--VIGTIPK---MDALIQEDFNGA
A0A7Y4V8Y1      SFVVNFFFLGIS-YLLNNKITSAQEVEKSI-HV--P--LLGVIPT---SH----------
A0A5Q4EKA0      ALFLGIGVFLLK-YLFYNEIPSLHDILKYT-QA--P--VIGVIPK---YK----------
A0A519SYE7      GLALGLGLIATR-YLMHNTITSVQELERGT-RA--A--VLGVIPT---YD----------
A0A7C7CFR2      ASFLSAAMLVIS-YLLHNEITSVNELTSGG-RK--S--LLGIIPS---YT----------
A0A7W1G0I5      GLILPFAGFGAK-NFMDNSIKDEFYMRSIT---KLP--SIGRIYHYKKKKH---------
A0A2T4XEQ1      GGAVGVGLAFGR-EFLNRTIDGLDKLKGS----GYP--ILAVIPDFTEYVK---------
A0A2K8ZAP1      GLVIPIGVITAK-DTVNNHVLRRSDVEEVT---QIP--IIGEVIKERQLGT---------
A0A3D3LSK1      GLIIGLAFALMR-IYFNKNLSTPEELESK----GVS--LLSWIPNIEQITD---------
A0A496L711      GLAIPAVLIILK-ELLNNAIRTEKDIERAT-KNRFQ--IIGSVRHTKHKAD---------
A0A348PT57      GLILSFLLIGIR-YILNNDISGVHDLSRLM-NPRIS--LLGVVPKYSKNIP---------
A0A847AMH6      GLALPAVLILLI-VLMNSKVVSKEDVESIT---RLP--LLSLVFFNKQSNN---------
A0A7C3PTI0      ALFVSFGLVLVR-YILHNDINSLNEITKMT-NASIS--VLGIVPRYKKEIP---------
A0A7V1FAS7      GLGMGVGIAFFL-EYIDNSIKTIEDVEQL----RLP--LLAAIPEIEPEKQNGNFFSLPG
A0A7V0M115      --------------MDKSIKSTEDIKKYLK-LPVIG--TIPNVKFNEEHEL---------
A0A7C1IBE4      ALNKVESVHKPD-FTSPAPPDEPQVISSST-VAEER--KRKVAAKAPSLPP---------
A0A3D5KRM7      -----------------------------M-VENSE--SDSLDNIRYSKTR---------
A0A831LDA6      GLGLPAGSIMLA-DFFNTKIMSQEDIESI----T-------KFPVVGHVFH---------
A0A833B0I1      GLLIPIVIIFMR-ENMNTRVRGRKDLENL----TIP--FIGEIPLFTRKKK---------
A0A1V5S5I3      GLLIPVVIVFIR-ENMNTKVRGRKDLESL----SLP--FAGEIPLAVSGKG---------
R7JFY1          AIPAGILWLR---WANDTRIRSMKDVQDRT---ALP--LLGEIP----ALE---------
A0A2M7VVW6      GIVISLIILILK-YVLKNTISTMDEITKFS-NGAVG--ILGTVP----TY----------
A0A413V760      GIPMGVFWLL---NVTDTKVRTRKELDGVL---TIP--FLGNIP----RHG---------
A0A3M1NUH2      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A7V5RHV9      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      MLVYAIGLAGGL-VLGLGLIGVRYLMHNTV-TSIGE--LERNTKASVLGVI---------
                                                                            

A0A7X8GFH1      ------------TQTN-KINRFVVENKPN-SI-ITEAFRTLRSNL---------EFMVKD
A0A7C7CKY6      ------------KNDI-PVSQLLVNQNSK-SL-IAESFRAIRTNL---------QFISNE
A0A1G1TG88      ------------DKEKMEVSRLVVNDNPK-SA-ISEAIRSIRTNL---------DFISSA
A0A661XXA6      ------------KSAK-EHAKIIVNEHPK-SA-LSESMRSIRTNM---------QFMLPE
A0A519SD85      KN-------------------LILQEAPR-SL-FSESLRSLRSNL---------FSLINK
A0A3M1TXY5      ---------------------YIIEKDSR-TS-FAESFRSLRVKM---------LFVVEG
A0A7T9KM12      ----------------------IKVNEDR-SV-LAEGFRTARINL---------QYLNAN
A0A2E0VQ27      ---------------------RLTRKTPP-GFSLVSGLTANLRDL---------PKPETK
A0A7Y7TYP1      ---------------------NVMFEFPK-SS-IAESFRALRTNL---------EFYLKG
R6U429          KMRK--------KMCDDANTKIVVAPSNR-NS-INEAFRVLRTNL---------DFMTGG
A0A5C8AF42      ---------------------LVVHESPK-SM-LAESMRKIRTNL---------SYIKP-
A0A7Y5SYP1      LIKDI-------------------------SAIVQEMHRQISINI---------NYILNR
A0A7V1N701      PEAG---KISPGERKYRIQRSLLISNLPPSNP-VVEAYRTLKTNI---------AFSFPD
A0A7V2NIA8      HGNGYKPVISSSGKPYPI-----IAYMQPQDP-SVESYRSLRTGL---------VFSAVD
A0A239K409      ---------------------IVVSESSK-TA-IAELFRLIRTNL---------QFVVQG
A0A1M3DPL8      ---------------------YLIVNNPR-SS-FTEMFRIIRTRI---------EFIAKR
A0A1V5F519      ---------------------DLTLKNPK-SS-FTEMFRVIRTRV---------EFVVRR
A0A2G6R1T9      ---------------------LLTLKHPR-SS-FTEMFRVIRTRI---------EFIVQR
A0A350V3E4      HTHT---EQE-----------LVLAYNSD-SV-PAEAFRTLRTRL---------QFSKLE
A0A6J4K208      ---------------------YLVAYSSK-SA-LAESFRSLRVNL---------QYLFLD
A0A2W4RDE8      ---------------------SNVVANAL-SP-VGESFRSLRVNL---------QYLTLG
A0A212J9Z9      ------------KKLN--NGVVLVKNYPK-SS-FAESFRNMRVRI---------EYMAQR
F5IV23          ------------KKLN--NGVVLVKNYPK-SS-FAESFRNMRVRI---------EYMAQR
A0A1M5DFS8      ------------KKMSS-NSTTLVKNFPK-SS-FAESFRNMRIRL---------EYMAQK
A0A4Y8KZS5      ------------KKMPS-GNTTLVKNFPK-SS-FAESFRNMRIRL---------EYMAQK
A0A2V3PNY7      ------------KKLSSSGSTTLVKNFPK-SS-FAESFRNMRIRI---------EYIAQK
A0A6G7X5K8      ------------KKISSAGSTTLVKNFPK-SS-FAESFRNMRIRI---------EYMAQK
A0A840CJ33      ------------KKLS--NGVVLVKNYPK-SS-FAESFRNMRVRI---------EYMAQR
F8X2T0          ------------KKLA--GGVVLVKNFPK-SS-FAESFRNMRVRI---------EYMAQR
A0A1M3LAG1      ------------KKLA--GGVVLVKNFPK-SS-FAESFRNMRVRI---------EYMAQR
A0A212K6G4      ------------KKLA--GGVVLVKNFPK-SS-FAESFRNMRVRI---------EYMAQR
A0A4Y9IPG7      ------------KKLA--GGVVLVKNFPK-SS-FAESFRNMRVRI---------EYMAQR
A0A0L8VEV2      ---------------------LAAIDNPR-SA-IAESFRELRTNL---------QFIVPG
A0A1I2A9Z9      ---------------------LAAIDNPR-SA-IAESFRELRTNL---------QFVAPK
A0A848XXC6      VTVD---GHAIPRS-------LVALAAPF-TP-AAEAFRHLHAAL---------QGSA--
A0A2P8CDS1      DQAA---ISH-----------TALLDHPN-SP-VGETYRALRMKL---------KFMLNG
A0A660LQT8      SKLL---VKLGLKKLPQRLDKNEVVVKPQNANIINEAFRVLRSNF---------EFCTNK
A0A3D0FMX4      ---------------------TEVVDHPR-SS-YAEQLRALRTRI---------EFVVRR
A0A7V6G854      ---------------------VLTVKSPK-SA-FTESFRVIRTRL---------EFITKR
A0A1M3MEI8      ---------------------FIVAANPR-SS-FTEMFRIIRTRI---------EFITQR
A0A1J5HQM0      ---------------------LITINNPR-SA-FTEMFRVIRTRI---------EFIVQR
E4T131          ---------------------LVVSKNPR-SA-YTEMFRIIRTRI---------EFIVQR
A0A653AC35      ---------------------MLAAHRPR-SS-FTEMFRVIRTRI---------EFIVQR
A0A847LA02      ---------------------ILAAKHPR-SS-FTEMFHVIRTRI---------EFIVQR
A0A389LWV6      ---------------------MVLYKYPK-SS-FAENFRHLRSRM---------IYLTKR
A0A1G9B1T9      ---------------------ALVYSRPR-SA-AAESFRTIRSNL---------LLQNHV
A0A350PNH9      LLQR---IQF--WKKPKETLQIVVKAGKR-DI-VNEAFRVLRTNL---------EFMIGT
A0A354LNT9      LLQR---IQF--WKKPKETRQIVVKAGKR-DI-VNEAFRVLRTNL---------EFMIGT
A0A161LWY6      ---------------------ITVLKRPK-SA-IAEAYRMVRTRI---------KFVSRQ
A0A6I3N9U6      ---------------------ITVLKRPK-SA-IAEAYRMVRTRI---------KFVSRQ
A0A353WYK7      DR-------------------LVIDKVPK-SE-ISEAFRSIRTNL---------EFIKRT
A0A2W7RD29      ---------------------VQLVDYPN-SK-VAESFRLLRTNL---------NFILPN
A0A3N2NDY8      MARL---LPAKKNSKELERVVVAVKEGSR-DA-VSESFRIVRGNI---------DFMIRG
D7JEV9          KHKA---DER-----------VIASKYPN-SY-FVEQLRVIRTKI---------EFILKR
A0A553GA49      ----------TLCSN--GSKKIFEPSNED-AV-VAESFRKLRTNL---------GFWPWK
A0A7V5GTN5      QHKQ---MLLPAEGNGQVNSTLLSFHSES-SP-VSEAYRSIRTSV----------LFTAR
A0A497D6F6      -----------FNTRKDYKGNTLILDKPG-SP-ASEQYRSVKNKI----------NFISG
F4KR18          -----------NHQK--GKKQHSLLSKSQ-NT-LTERFRTLRTNL---------QF--HQ
B5CTK0          -----------PKYQ--GKDDIIIHENGR-DS-ISEAFRIIRTNM---------DFMRMK
A0A5M4AAB9      -----------PHDEQVLPSQIPLLEHPN-SP-LGESYRALRTKL----------KFIQN
A0A5R9QZP0      -----------YTNY--HNTENVNTEFPN-SS-LAESFRNLRTNI----------FLKFK
A0A7X6SRJ5      -----------YTNY--YKTEAVVSEFPG-SP-IAESFRNLRSNL----------FLKFR
A0A3D3HL11      -----------YTNF--YKTESVVKDYPG-SS-IAESFRNLRSSL----------FLKFR
A0A6L8U6G9      -----------YKNY--YKSESVVKDYPG-SS-IAESFRNLRSSL----------FLKFR
A0A6L8UH35      -----------YSNN--HKSESVVAEFPK-SA-VSESFRNLRSSL----------FLKAG
A0A7X9F2J5      -----------YSNN--HKSESVVAEFPK-SA-VSESFRNLRSSL----------FLKAG
A0A352ME00      -----------YSNN--LKSEAVVAEFPK-SA-ISESFRNLRSSL----------FLKSD
A0A7X8CRA6      -----------YSNN--LKSETVVAEHPK-SA-ISESFRNLRSSL----------FLKSD
A0A1F3D6P8      -----------FNNN--YKSEAVVLEAPK-SA-IAESFRNLRSSL----------FLKLK
A0A356Z058      -----------FNNN--YKSEAVVLEAPK-SA-IAESFRNLRSSL----------FLKLK
A0A7X8FHL3      -----------YSNN--LKSEAVVAEYPK-SA-IAESFRNLRSTL----------FLKSD
A0A3D1BT36      -----------YNNS--FKYEDVVHKAVG-SP-IAESFRNLRSNL----------FFRSK
A0A7X7CXW9      -----------YTNY--YKTESVVKDYPG-SS-IAESFRNLRSSL----------FLKFR
A0A4R6H3B7      ------------TGI--GAEFLAAIDNPR-SA-IAESFRELRTNL---------QFVAPK
A0A229I3A5      LEQR---IKFWKKPK--EVRMIVVKAGKR-DI-VNEAFRVLRTNF---------EFTIGT
A0A3R6HJB3      LEQR---IKFWKKPK--EVRMIVVKAGKR-DI-VNEAFRVLRTNF---------EFTIGT
R6NN15          FHKK---V----TPL--TETKVVVKEGSR-DV-VNEAFRVLRTNL---------EFVSGE
A0A2W7QSQ0      ---------------------IAISPKSI-SP-AAEQLRMIRSNL---------KFQSGD
A0A841MQL4      ---------------------IAISNKSI-SP-TAEQLRMIRSNL---------KFQTGS
A0A3P1Z8V4      KKTT---DQT--LV-------YDVDTDQN-SP-SAEAFRLLRYGL---------HFMN--
A0A1M6MYT6      NNRK---ESE--SH-------TLVLDKPN-SP-ASEPYSAIRTKL---------ELITKG
A0A1V5S1J9      ---------------------VIVDKYPK-SA-ITEAFRVIRTRI---------EFLSGK
A0A7X8JMH1      ---------------------VIVDAYPR-SA-MAEIFRVVRTRL---------EFLVGK
A0A3D5KRY6      ---------------------RPTIDFPR-SS-IAESFRGIRGNL---------EFLFND
R7F6L5          GRKK---LGK--DSS--SERQVVVRADST-NV-INEAFRVVRTNL---------DFFLTS
A0A7C5MRV2      NESL---KQK--YP-------LLKSVEHPKSS-LSESIRAIRTNM---------QFINSE
A0A0A2EYC8      RHTK---HKA--DE-------KVIAAKYP-NSYFVEQLRVIRTKI---------ELILKR
A0A2G6H6Y4      LHTK---HKT--ED-------KVIAPKYP-NSYFVEQLRVIRTKV---------EIILGR
C9LKL0          TWEE---GGD--DG-------LITTCSSD-AP-IVEAFRMLRYGL---------NFMR--
A0A3D0QPV7      YKED---IPV--SQ-------LIVDKNPK-SL-ISEAFRTIRTNM---------QFLTAD
A0A496KT23      RWRK---EKI--VAA--PN--MVVADQKR-DI-LNEAFRTVRTKL---------EFTLGF
L1M9T3          RWRK---QTI--VAQ--PN--MVVADQQR-DI-INEAFRTVRTKL---------EFSMGF
A0A2M6GH67      TKEK---LLV--SK-------LIVHKNPK-SA-ISESIRSIRTNL---------DFISSA
A0A7K1TE30      EKEK---LEV--SR-------LVVDKNPK-SS-VSEAIRSIRTNL---------DFISPS
A0A7D4BE70      EKER---LDV--SR-------LVVDKNPK-SS-VSEAIRSIRTNL---------DFISPS
A0A142HHS5      DKEQ---LNI--SR-------LIVDKNPK-SS-VSEAIRSIRTNL---------DFISPS
A0A7D4C435      EKEK---LHI--SR-------MVVDKNPK-SS-VSEAIRSIRTNL---------DFISPS
A0A3C0I8F1      KQKN---AKY--SK-------LVILDNPK-ST-INEALRSVRTNL---------DFVLNK
R5JJI4          TRKG---EDT--DA-------IVVHESGR-DS-VSEAFRIIRTNM---------EFMRVK
A0A848IUK4      KKEK---LEN--TR-------LIVNDNPR-SM-VSESLRSIRTNM---------DFLHQS
A0A136LSC7      HHTV-----Q--SL-------FHVIDNPK-SI-VSEAIRTLRTNL---------EFFNTG
A0A5C7N8Q5      NHTV-----Q--SL-------FHVIDNPK-SI-VSEAIRTLRTNL---------EFFNTG
A0A355BP94      RRNT-----T--SP-------FYIVENPR-SI-VSEAIRTLRTNL---------DFFTSS
A0A7Y5D1K7      KNKA-----A--SP-------FYIVDNPR-SI-VSEAIRTLRTNL---------DFFTSS
A0A3D2HF71      ---------------------LPAVEHTG-SS-LAESLRSVRTNL---------KYFMKD
A0A0A2DQN2      TKKG---G----EG-------IGVSEQGT-DL-TSEAFRILRSNM---------DFM-GQ
A0A0A2F2N5      TN----------LF-------VAVEPQGS-DA-ITEAFRVLRTNM---------GFMKKY
L1NGW4          APGR---K----QP-------RGAREQGS-DE-TSESFRVLRENL---------RFMIGS
Z4WRA0          APGR---K----QP-------RGAREQGS-DE-TSESFRVLRENL---------RFMIGS
U2K8K9          R--A---KSG--HT-------RGVREQGG-DE-TSEAFRVLRENM---------RFMIGS
A0A069ZM60      KRGG---KKS--QP-------RGVREQGG-DE-TSEAFRVLRENM---------RFMIGT
J6GV98          KRGG---KKA--QP-------RGVREQGS-DE-TSEAFRVLRENM---------RFMIGT
A0A134B4F8      KRGG---KKS--QP-------RGVREQGS-DE-TSEAFRVLRENM---------RFMIGT
A0A134B8C7      KRGG---KKS--QP-------RGVREQGS-DE-TSEAFRVLRENM---------RFMIGT
A0A4Z0EKR0      ---------------------VVVTNGNR-SP-IAEMFRLIRTNL---------HFAAVG
A0A521H707      YKSE---IPV--SQ-------LLVDKNPK-SA-ISESFRSVRTNL---------QFISNE
A0A7T9D909      YKKE---IPI--SQ-------LLVDKNPK-SL-IAESFRTIRTNL---------QFVDNT
A0A1M6B6D5      ---------------------LAVLSKPK-SA-IAEAFRSLRSSL---------QFLYKQ
A0A451FS66      ---------------------LAVLSHPK-SA-IAEAFRSLRSSL---------QFLYKQ
A0A2E3GN39      YSEK---LPM--SS-------IVVTNRPK-SG-ISESFRGVRSNL---------EFLD-A
A0A3D1MEL0      YSEK---LPM--SS-------IVVTNRPK-SG-ISESFRGVRSNL---------EFLE-A
A0A519UDD1      DTGD---T-------------VVVARESR-TP-IAEMFRLVRTNL---------NFVA-I
A0A7Y2ACP6      K-EK---IPI--SQ-------LIIDKKPK-SL-IAESFRTVRTNL---------EFLG-D
A0A2A4N9A6      KREE---MPI--SQ-------LVVEKNPK-AG-ITEALRSLRANL---------QFIS-T
A0A6C0GGI1      D-GK---NGI-----------LAKTDNHK-SA-LSEAFRSLRVNL---------QYLA-A
A0A368D1N7      S-EK---LPV--SS-------IVVTNRPK-SG-ISESFRGVRSNL---------EFLE-E
A0A3B8TU58      S-EK---LPM--SS-------IVVTNRPK-SG-ISESFRGVRSNL---------EFLA-A
A0A1T5IIR6      KQGK---HKQ--GHD--DPSPFVYDPTSH-TV-FTEAMRMLCTNL---------SFLDSG
A0A3E0QD27      -KNE---IPV--SQ-------LLVDKNPK-SA-ISESFRSVRTNL---------QFIS-N
A0A0K2HKS3      IENK---KTA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
B6W3W8          IENK---KTA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
A0A0M1W1I6      IENK---KTA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
A0A4R4GHU2      IENK---KTA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
I8WPR6          IENK---KTA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
A0A076IRY8      TENK---ETA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
A0A3A6AD54      TENK---ETA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
A0A8B3EPF6      TENK---ETA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
I8WPP8          TENK---ETA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
A0A372Y7D2      TENK---ETA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
A0A7K3KFI2      TENK---ETA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
A0A3E4JJC9      TENK---ETA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
A0A3E4WDQ0      TENK---ETA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
A0A414H9P2      TENK---ETA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
A0A7K0JKU9      TENK---ETA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
C3R5A8          TENK---ETA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
A0A6N8DCX3      KRLL---RKQ--VED--EKR-IVVKEGSR-NA-MNEAFRVLRTNM---------EFMSGN
F0R0C9          KHLF---ASK--TYD--APRGIVVKQGKR-NI-INEAFRVLRTNL---------EFMTSE
A0A1C5XJA7      KN-Y---KSS--RK-------GAANAYGYGDNVVTEAFRILRTNM---------SFMAKK
A0A285T4L1      KEAA---K--------------TGVAVGRDDGMLSESFRILRTNM---------AFMAKK
R7CUW4          KEAA---RQH--GR-------TAKASVGQDDSIVSEAFRILRTNM---------AFMSRK
A0A416GGJ1      AKKK---KTV--HG-------PRLFLDKQDDI-IAEAFRILRTNM---------AFMAKK
D1JY72          IENK---KTA--HG-------IAVRAQGR-DI-VSEAFRIIRTNM---------DFMRVK
D7J4K6          QDKE---AAK--AG-------VAVGEED--GM-LAESFRILRTNM---------TFMVKK
Q8ABP9          QDKE---AAK--AG-------VAVGEED--GM-LAESFRILRTNM---------TFMVKK
D6D2Z5          QDKE---AAK--AG-------VAVGEED--GM-LAESFRILRTNM---------TFMVKK
A0A1T3EDR4      RSKS---ESG--MG-------VFVYHTGK-DA-LSEAFRILRTNI---------TFMVNS
A0A6N8KXI9      -DNK---KST--SD-------VKVFENGR-DP-LTESFRILRTNL---------SFMSPE
A0A174SDD8      PKAM---ANV--HE-------VVGRARGL-DA-LSESFRILRTNL---------GFMLSQ
A0A1H7RFH3      PKAM---ANV--HE-------VVVRARGL-DA-LSESFRILRTNL---------GFMLSQ
A0A139L1N2      PKAM---ANV--HE-------VVVRARGL-DA-LSESFRILRTNL---------GFMLSQ
A0A174TVL8      PKAM---ANV--HE-------VVVRARGL-DA-LSESFRILRTNL---------GFMLSQ
A0A1H8BJR6      PKAM---ANV--HE-------VVVRARGL-DA-LSESFRILRTNL---------GFMLSQ
R9H6G0          PKAM---ANV--HE-------VVVRARGL-DA-LSESFRILRTNL---------GFMLSQ
A0A412GR09      PKAM---ANV--HE-------VVVRARGL-DA-LSESFRILRTNL---------GFMLSQ
A0A7J5JXN6      PKAM---ANV--HE-------VVVRARGL-DA-LSESFRILRTNL---------GFMLSQ
R6D982          AEKV---TEI--ND-------IMVRARGQ-DA-LSESFRILRTNL---------GFVASQ
A0A1F0I8C4      SKTE---ADA--QE-------VMVRARGL-DP-LSEAFRILRTNL---------GFMISQ
A0A3A5RIJ2      SKTE---ADA--QE-------VMVRARGL-DP-LSEAFRILRTNL---------GFMISQ
A0A515IZJ5      SKTE---ADA--QE-------VMVRARGL-DP-LSEAFRILRTNL---------GFMISQ
A0A7J4Y2H6      SKTE---ADA--QE-------VMVRARGL-DP-LSEAFRILRTNL---------GFMISQ
A0A4R6WE41      -EKK---YDD--KG-------IAVSKTGR-DP-LTEAFRILRTNI---------NFMAIN
A0A2T5RP38      RGRR---QGK--GD-------ILVSGSGR-DP-LTEAFRILRTNI---------NFMTKD
A0A1A6CF06      RSRR---QGK--GD-------ILVSKTGR-DP-LTEAFRILRTNI---------NFMTKD
A0A1T3D6S8      RNRR---QGN--GD-------VLVSQSGR-DP-LTEAFRILRTNI---------NFMTKD
A0A8B4GMS2      RNRR---QGN--GD-------VLVSQSGR-DP-LTEAFRILRTNI---------NFMTKD
A0A7Z7LUP7      RNRR---QGN--GD-------VLVSQSGR-DP-LTEAFRILRTNI---------NFMTKD
A0A0B8T471      KQTI---RAN--DD-------VVVNEQGR-DP-ATEAFRILRTNI---------GFMSSA
A0A4R7D2K0      RQTM---RAN--DD-------VVVNEQGR-DP-ATEAFRILRTNI---------GFMSSA
A0A7T9S3V1      GKIK---SDD--NA-------ILVSKTGR-DV-LTEAFRIIRTNI---------GFMAAN
A0A7T9LVI2      GKRK---TDS--NK-------VLVSKTGR-DV-LTEAFRIIRTNI---------GFMSRN
C2FUH6          GKRK---TDS--NK-------VLVSKTGR-DV-LTEAFRIIRTNI---------GFMSRN
A0A1V3N3U3      KRKS---EQH--AV-------FRVEKTGR-DP-LTEAFRILRTNI---------NFMSRE
A0A1P8E011      TNKR---TSQ--NN-------ILVSAMGR-DP-LTEAFRILRTNM---------SFMARE
A0A7T9S8K4      TNKR---TSQ--NN-------ILVSAMGR-DP-LTEAFRILRTNM---------SFMTRE
A0A2X2J8S4      KKNK---HTV--GN-------VSVSQTGR-DA-LTEAFRILRTNI---------NFMSRG
A0A3C0S618      KKNK---HTV--GN-------VSVSQTGR-DA-LTEAFRILRTNI---------NFMSRG
A0A4P7DRF9      TDMQ---SAK--QE-------VVVKEQGT-DE-VTEAFRIFRTNL---------GFMSSG
A0A239XXC4      TEMK---TAK--SD-------IVIKEQGV-DE-VTEAFRIFRTNL---------SFMSSG
A0A4U9K473      TEMK---SAK--SE-------IVIKEQGV-DE-VTEAFRIFRTNL---------SFMSSG
A0A081PBV5      --LK---DKG--GE-------AVVEEKGR-DY-TSEAFRILRTNI---------GFMA-A
A0A1I2AN85      --LK---DKG--GE-------AVVEEKGR-DY-TSEAFRILRTNI---------GFMA-A
A0A4U0GMP3      KRRR---SKE--GN-------LVIEAQGG-DP-VTEAFRILRTNI---------GFMASA
A0A0D5BSQ0      RSRK---QGK--SD-------VLVSKSGR-DP-LTEAFRILRTNI---------NFMAKN
A0A1T3F6P5      KGRR---QGN--GD-------ILVSQSGR-DP-LTEAFRILRTNI---------NFMTKD
A0A853VUQ0      RGRR---QGN--GD-------VLVSQSGR-DP-LTEAFRILRTNI---------NFMTKD
A0A7X0MJ00      SEIR---NSK--NG-------IVVQEQGF-DE-VTEAFRITRTNL---------GFMSPG
A0A841JHZ0      SDIR---KSQ--TG-------IVVHEQGI-DE-VTEAFRIIRTNL---------DFMTPG
A0A1H6CKR6      TDLK---TAK--SD-------IVIKEQGT-DE-VTEAFRIFRTNL---------GFMSAG
A0A7W3MGA7      TEMK---SAK--SE-------IVIKEQGV-DE-VTEAFRIFRTNL---------SFMSSG
A0A3M1Y2F5      -----------------DGLEVIKQSTSY-SP-LAECFRAVRVHIYNKLTNKREKIDVSE
A0A7V1ALN2      PVSEKSGKESKKSQLEKSLADVYVYHYPY-SP-ASESLRRLQTQL---------ELLLPS
A0A3D4RLG4      ------------------QNPTLVQKNPR-SS-YTEMLRTIRTKI---------EFIVGR
A0A2T2UAJ4      ETIEIDGRS--------VNTLLAMLVSPM-SA-AAEAYRRIRTNL---------RFAKPD
A0A6I0DZQ5      ------------------DNPFIVAANPR-SS-FTEMFRIIRTRI---------EFITQR
A0A1H6Z2F8      ----------------QSRADRLSRNNVR-SL-LREQFRSLRTNI---------QFVVGE
A0A2P8G5K0      ----------------QSRTGLLKVADNR-SL-IKEQFRSLRTNI---------QFTTGE
R5DEG6          -----RDKK--------DKNEVVVHENGR-DS-VSEAFRIVRTNM---------DFMRVK
A0A4Q3SEI4      -------------------ADVYNNTKRQ-LS-FIEQFRQLRASV---------ALNGRK
A0A836SQI2      -----------------SVSNLVIEDGNN-SI-VSEAFRSMRTNL---------FFFKQI
A0A7V1FAJ9      -----EHELNDADKIKKIDSQLVTYDYSP-TP-IGEAYRALRTKI---------MFSKSM
A0A3N2LCI3      -----HEKK----KEAGEANTIVVKGGKL-DI-INEAFRVLRTNV---------EFMCNS
A0A6H9Q899      -----RKKKGIFGKKPQEVKAVVVKEGSR-DI-INEAFRVLRTNL---------EFMTGK
A0A3D4CJE1      -----KE-I--------PVSQLIIDKNPK-SV-ISESFRTIRANL---------QFISNK
A0A7C7LI79      -----KD-I--------PITLLLVDKNPK-SL-IAEAFRSIRTNL---------QFIDGS
A0A4Q5ZQ60      -----KEKL--------PVSRLIVDLSPK-SA-ISESIRSIRTNL---------EFISSS
A0A519Q885      -----KEQM--------SISRLVVDKNPK-AS-VSEAIRSIRTNM---------EFINAA
A0A519TAP8      -----KEKL--------EVSRLVVDKNPK-AS-VSEAIRSIRTNL---------DFISPS
A0A848Y4B8      ERITVDGQS--------LDTHLVALLNPM-AV-ASESYRALRTSI---------QFSRPD
A0A7Y4V8Y1      -----RK----------SNSLFHVVDNPK-SM-VSESFRSLRTNL---------DFFTIG
A0A5Q4EKA0      -----SE-I--------PPNQLLVLKKPK-SL-ISESLRAIRTNL---------QFINND
A0A519SYE7      -----KEKL--------EVSRLIVDKNPK-SS-VSEAIRSIRTNL---------DFISPA
A0A7C7CFR2      -----KD-I--------PVSQLLVDKHPK-SL-IAEAFRSIRTNL---------HTSNSD
A0A7W1G0I5      -------------------QSSILIDMPR-SA-IAESFRSVRTNI---------EYFLEG
A0A2T4XEQ1      KKYEEKSKVA--VKGRLVSTNWFSLLDNI-SP-VTESYRRLHNNI---------IYSQ-P
A0A2K8ZAP1      -------------------ESFVFKSRMH-SV-IGEQIRALRTNL---------LFLNGD
A0A3D3LSK1      --------------KSDPTNDFIVAKKPS-SQ-ISEAFKALRTRI---------TFSKLE
A0A496L711      -------------------ERVIASKYPN-SY-FVEQLRVIRTKI---------EFIL-K
A0A348PT57      ------------------LSQLIIDKNPK-SV-MAEAFRTLRTNL---------DFFQ-T
A0A847AMH6      -------------------SPTPVLDNPN-TV-ASEPYRSMRGKL---------KLMV-K
A0A7C3PTI0      ------------------VSQLLVDKNPK-SL-IAEAFRSIRTNL---------QFIS-N
A0A7V1FAS7      KGKRHHHNVI--DDSNEIAERLVTHLRPK-SP-IAEAYRSLRTQI---------QYAK-S
A0A7V0M115      -------NDA--DKIKKIDSQLVTYDYSP-TP-IGEAYRALRTKI---------MFSKSM
A0A7C1IBE4      -------DLG--ASTENWDERLVHAIETF-SG-VAESFRKLRTMI---------L---HP
A0A3D5KRM7      -------IMP--LDAEVLQDNRIIMGLYN-DQ-RADLFRVLRTNI---------L---KQ
A0A831LDA6      -------SEL--GKKHR----TLVLDKPN-SL-ASEPYRAIRTKL---------NLI--T
A0A833B0I1      -------GIL--GKKPQEVKAVIVKEGNR-DI-INEAFRVLRTNL---------EFM--T
A0A1V5S5I3      -------K-----KKVHNAKKIVIRQGNR-DI-VNEAFRVLRTNL---------EFMLDA
R7JFY1          -------K-----NQE----KLVVKEGSR-DA-VSEAFRILRANM---------DFM--R
A0A2M7VVW6      -------------NREIPISQLVINRDPK-SV-ISEAFRTIRTNL---------QFI--S
A0A413V760      -------N-----NKGEDSDGIVVRENSR-DS-VSEAFRIIRTNM---------DFM--R
A0A3M1NUH2      ----------------------------M-SP-VVESYRHLRTNI---------QFS-RP
A0A2T2TDL4      --------------------------------------------L---------QLG-RP
A0A359ATS6      ----------------------------R-DV-INEAFRVVRTNL---------EFM-DG
A0A1V6HYH8      ------------------------------------------------------------
A0A7X7LGP1      ------------------------------------------------------------
A0A838FHH6      ------------------------------------------------------------
A0A7Y4VJX2      ----------------------------------------RTNLD---------FF--TA
A0A3D1AEJ6      -------------------------------------------MD---------FMR-VK
A0A7K3KYQ2      ---------------------------------------LRTNVE---------FMC-NS
A0A2E0MDX6      --------------------------------------------M---------QFI-AN
A0A2M7KCE1      ----------------------------------SEAFRSVRSSL---------EFI-KN
A0A523GUD4      ---------M--LKSPITDIEHLKEARND-TP-GNAEIMRLLSKL---------DTF-RN
A0A7V5RHV9      ---------------METTQNIIEMFDDE-SA-EANEFRRLYSKM---------KNL-YS
A0A641X2Z6      ----------------METITLIADRDAK-SP-VAEAYRTIRTNI---------QFS-NV
A0A6L8U2P8      -------MSV--IYSNNLKSEAVVAEYPK-SA-IAESFRNLRSTL---------FLK-SD
A0A7C6G639      ------------------------------------MFRVIRTRI---------EFI-VQ
A0A519PJW5      -----------------------------------EAIRSIRTNL---------DFI-SP
A0A519T3R9      -------PTY--SKEQMSVSRLVVDKNPK-SS-VSEAIRSIRTNL---------DFI-SP
                                                                            

A0A7X8GFH1      P--------NSK-KIVAITSTISGEGKTFIAINLGGVIAL-SGKRVVLIDLDLRKPKIHL
A0A7C7CKY6      P--------GS--KIIAITSTISGEGKTFVSMNLAGIIAL-ANKKVIIIDLDLRKPKIHL
A0A1G1TG88      K--------KK--RLISVTSTISGEGKTFVTVNLAGIIAM-SGQRVIVLDLDMRKPKVNL
A0A661XXA6      T--------KS--KVYSITSTIGSEGKTFISTNMGALLAM-AGKKVIILDMDLRRPKVHK
A0A519SD85      ---------DC--NMICITSEISGEGKSLISKNLAYAFAI-TGKKVILVDADLRKPKLHE
A0A3M1TXY5      D--------KK--KVIGVTSSSSGEGKTFCATNLAATLAH-AGKQTLLIDTDLRRPKVQT
A0A7T9KM12      V--------DR--QVVGITSSSSGEGKTFCSVNLATVMAL-GSKRTVLVDADMRKPKVHE
A0A2E0VQ27      G--------QA--QLFVLSSNMPNEGKTFVSARIAKAMAA-YGYKVLLLDLDVRKPELHE
A0A7Y7TYP1      G------N-AR--KVILVTSCIEGEGKSFNALNIAMSYAQ-LGRKTILLDCDLRK--VTS
R6U429          Q------E-GC--HKVMITSFNPTAGKTFVLMNMAATMAL-KGAKVLLLDLDLRKGTLGK
A0A5C8AF42      ---------DY--KTIAISSSISGEGKTFVALNLAGIIAM-SGKKTILLDLDLRKPKVHL
A0A7Y5SYP1      K-----GRENG--LFLLTTSTIPQEGKTFTGILMAGSLAD-LGYKVLLIDGDLRRPTVDK
A0A7V1N701      V--------NL--KSITISSPQSGEGKSITSANLAISFAM-SGLNTLLVDCDLRRPIQHS
A0A7V2NIA8      K--------QL--ECFTVSSADHADGKTLTSCNLSIAFAM-GGKKTLLVDCDLRVPDQHR
A0A239K409      G--------ER--KVILVTSSVSGEGKTFFSLNLGASLAL-TGKNVVVLDFDLRKQSILA
A0A1M3DPL8      K--------TD--ITIMVTSSESGDGKTYFCINLACIYAM-ASPKTLLVDMDIRKPSVYQ
A0A1V5F519      K--------TD--IVMMVTSVDAGDGKTFFSTNMAGVYGM-TGHKTLLIDMDIRKPAINR
A0A2G6R1T9      K--------TG--IMMLGTSTESGDGKTYVNINLASVYGM-TGKKTLLIDMDIRKPSVGD
A0A350V3E4      P------E-PI--KTILITSSIPREGKTIISSNLAASFAL-SS-RVLLLDCDFRKPRMHN
A0A6J4K208      T--------GK--KVIGITSSGQGEGKTFCASNLSVVMAQ-SGKKTLLIDADLRKPRIAA
A0A2W4RDE8      K--------EV--NVIGITSSRESEGKTYCSVNLAAAMAN-SRRRTILIDADMRRPKVAS
A0A212J9Z9      E--------NK--ITVLVTSTEPADGKTFIATNIASVYQL-MGKKVIIVDLDLRRPSVAK
F5IV23          E--------NK--ITVLVTSTEPADGKTFIATNIASVYQL-MGKKVIIVDLDLRRPSVAK
A0A1M5DFS8      E--------TG--ISVLVTSAEPGDGKTFIAGNIASVYQL-TGRRVVLIDFDLRRPSVAK
A0A4Y8KZS5      E--------TG--ISLLVTSAEPGDGKTFIAGNIASVYQL-TGRRVVLIDFDLRRPSVAK
A0A2V3PNY7      E--------TG--ISTLITSAEPGDGKTFIAGNIASVYQL-TGKKVVLIDFDLRRPSVGK
A0A6G7X5K8      E--------SG--ISILITSAEPGDGKTFIAGNVASVYQL-TGKKVVLIDFDLRRPSVAK
A0A840CJ33      E--------NK--ITILVTSTEPADGKTFIATNIASVYQL-MGKKVIIVDLDLRRPSVAK
F8X2T0          E--------NK--ITILVTSTEPADGKTFIATNVASVYQL-MGKKVIIVDLDLRRPSVGK
A0A1M3LAG1      E--------NK--ITILVTSTEPADGKTFIATNVASVYQL-MGKKVIIVDLDLRRPSVGK
A0A212K6G4      E--------NK--ITILVTSTEPADGKTFIATNVASVYQL-MGKKVIIVDLDLRRPSVGK
A0A4Y9IPG7      E--------NK--ITILVTSTEPADGKTFIATNVASVYQL-MGKKVIIVDLDLRRPSVGK
A0A0L8VEV2      L------KNKS--LVIGVNSVIPGEGKSFTAANLASMIAL-NNKRVLLIDCDLRKPSLHN
A0A1I2A9Z9      K------NNEC--TIIGVNSVISGEGKSFTSANLASMIAL-NNKKVLLVDCDLRKPSLHN
A0A848XXC6      ---------AP--QVLLVTSSEVGSGKSFTAANLAVAAAQ-AGRRALLVDADLRRPSVHA
A0A2P8CDS1      T--------EQ--PVIAVTSTGSDEGKTFTAMNLAASFAL-LGQKAVLLDLDLRNSKMAE
A0A660LQT8      F------G-KG--AVTMVVSANPNSGKTFVTMNLAMSMVI-KNKKAVVVDLDLRKAATSL
A0A3D0FMX4      K--------TG--IMVLTTSAQSGDGKTYLSTNLAALYAM-SGKKTLLMDMDIRKPNIHE
A0A7V6G854      K--------TG--VFIMVTSAEPHDGKTYFSANLSGVYGL-SNQKVLLIDMDLRKPNVSK
A0A1M3MEI8      K--------DK--ITIMVTSSESGDGKTYFSLNLASVYGL-ASPRTLLVDLDIRKPSIHK
A0A1J5HQM0      K--------KN--IMVAVTSSESGDGKTYFSINMAGVYSM-ASKKVLLVDLDIRKPSIHE
E4T131          K--------TN--IIVMTTSTESGDGKTYFSINLASVYAM-ASKKTILVDMDIRKPSVNQ
A0A653AC35      K--------TN--ISILTTSAESGDGKTYFCTNLASVYAM-SGLKTILVDMDIRKPSINE
A0A847LA02      K--------NN--ILILSTSAESGDGKTYFSTNLASVYGM-TGKKTLLVDMDIRKPSINA
A0A389LWV6      D--------SP--IVMLITSTEPRDGKTFVACNLASAYQM-TGKKTLMIDFDLRRPALSK
A0A1G9B1T9      N------G-AS--KTLLVTSSVSNEGKTLCSVNLASSFAV-ANNRTIIIDADLRRPRVHN
A0A350PNH9      H------P-EQ--NVIILTSFNPGSGKSHLAGNIAMSLAI-KKKKVLVIDGDLRRGATSM
A0A354LNT9      H------P-EQ--NVIILTSFNPGSGKSHLAGNIAMSLAI-KKKKVLVIDGDLRLGSTSM
A0A161LWY6      M--------DA--SCVIVTSTESGDGKTHFCLNYASMCAM-TGEPTILVDMDLRKPSVSK
A0A6I3N9U6      M--------DA--SCVIVTSTESGDGKTHFCLNYASMCAM-TGEPTILVDMDLRKPSVSK
A0A353WYK7      D--------KN--TVIAITSTVSGEGKTFVTVNLGGVISL-LKSKVVLVDLDMRKPRLQK
A0A2W7RD29      S--------ES--TVLLVSSVLPAEGKSFTSVNLATAFAL-TELKVLIIDCDLRKPKVSD
A0A3N2NDY8      K------E-GG--NVIMITSFNPGSGKSFISFNLSASFAL-KGKKVLVVDGDLRHGSASQ
D7JEV9          K--------EK--ITVLISSTESGDGKTYISLNLAGVFAL-QNKKILLIDFDIRKPNLTK
A0A553GA49      D------TLEG--RVVLFTSTMPGEGKTFCSYNLAQSLAS-LGKKTVILDFDLRKGDLSE
A0A7V5GTN5      E------R-QQ--KAFVISSAVAGEGKSLTTYNLGVSFAQ-GGTKTLIVDADLRRASLHK
A0A497D6F6      K------K-SN--PVIAFTSSIANEGKSFSALNIASLYAL-SKKKTVLLDLDLRMSSMAK
F4KR18          R------E-KT--KSILVTSSTSDEGKTFVATNLAMSFAL-AKKKTIVVDFDLRKPSISK
B5CTK0          K------D-NM--KVVTFTSMMPGAGKTFVSMNLALSFAL-TDKKIILMDLDIRKGTLSA
A0A5M4AAB9      G------N-EH--NVIAVTSTAAGEGKTFTALNLAASFAL-LGKKTVFLDLDLRNSRIGK
A0A5R9QZP0      S------K-PL--KVILVTSALPQDGKSFIAFNLATAIAA-VGHKTIIIDCDLRKPTLHM
A0A7X6SRJ5      N------E-PL--KVIMVTSSQPMDGKSFVSFNLAAAIAS-VGHKSILVDCDLRRPTLHE
A0A3D3HL11      S------E-PQ--KVIMITSAQPQDGKSFVSSNLAASIAS-VGHKTVLLDCDLRRPTLHE
A0A6L8U6G9      S------E-PH--KVLMVTSSQPQDGKSFVSSNLAASIAS-VGHKTVLIDADLRRPTLHE
A0A6L8UH35      H------E-QS--KVILITSSQPQDGKSFISFNLASSIAS-VGYKTILIDCDLRRPTLHS
A0A7X9F2J5      H------E-HS--KVILITSSQPQDGKSFISFNLASSIAS-VGYKTILIDCDLRRPTLHS
A0A352ME00      H------E-KS--KVILITSSQPQDGKSFVSLNLSSSIAS-VGYKTVLIDCDLRRPTLHI
A0A7X8CRA6      H------E-KS--KVILITSSQPQDGKSFVSLNLSSSIAS-VGYKTILIDCDLRRPTLHI
A0A1F3D6P8      S------E-KS--KVIVITSSQPKDGKSFISFNLAASIAI-VGYKTIIIDCDLRKPTLHE
A0A356Z058      S------E-KS--KVIVITSSQPKDGKSFISFNLAASIAI-VGYKTIIIDCDLRKPTLHE
A0A7X8FHL3      H------E-KS--KVILITSSQPQDGKSFVSLNLASSIAS-VGYKTILVDCDLRRPTLHI
A0A3D1BT36      T------N-PL--KVILVTSCQPQDGKSFVAMNLASSIAS-VGHKTIILDCDLRRPTLHD
A0A7X7CXW9      S------E-PH--KVLMITSSQPQDGKSFVSSNLAASIAS-VGHKTVLLDCDLRRPTLHE
A0A4R6H3B7      K-----NN-EC--TIIGVNSVISGEGKSFTSANLASMIAL-NNKKVLLVDCDLRKPSLHN
A0A229I3A5      H------P-EQ--NVIVFTSFNPGSGKSHIAANMAMSLAI-KKKKVLLIDGDLRHGSTSM
A0A3R6HJB3      H------P-EQ--NVIVFTSFNPGSGKSHIAANMAMSLAI-KKKKVLLIDGDLRHGSTSM
R6NN15          N------G-KG--QVILMTSFNPGSGKTFLTVNIAATLAI-KGKRVLVIDGDLRRGSTSV
A0A2W7QSQ0      N---------N--KVILVSSSMSGEGKTFFCLNLAATLSI-VDKKVVVVDLDLRRPSIFK
A0A841MQL4      D---------N--KVILVSSSVSGEGKTFFSLNLATTLSL-VDNKVVVLDLDLRRPSIFK
A0A3P1Z8V4      -------R-TA--KVFLITSASPGQGKSFVSRNLAVALSM-TGKKVLLVDTDVRKQNLTA
A0A1M6MYT6      -------K-EH--AVIAVTSSFPSEGKTYNAINIASSVAL-SNKTAVILDLDLRKSRINE
A0A1V5S1J9      S--------KG--ISVMVTSSQSGDGKSYISANIAGVFAM-TGRKTILVDLDMRKPSINT
A0A7X8JMH1      K--------KN--ITMMFTSTHSEEGKTYISVNMAAIFAM-TGKKVILIDSDLRKPSVSA
A0A3D5KRY6      S--------PR--KVLAIHSYMPGEGKSFVAFNIAVIFAM-NNKKVLLVDGDLRKPRLHL
R7F6L5          D-----KK-GA--QVIMVTSANPGSGKTFITMNLAVALAL-KHKRVLMIDFDLRRAALSN
A0A7C5MRV2      K-----EE-GS--KIVSITSTVSGEGKSFITINLGGIISL-LNVKVVILDMDLRKPKLHF
A0A0A2EYC8      -------K-ER--ITMLVSSTESGDGKTYISLNLAGVFAL-QKKKVLLIDFDIRKPNLTR
A0A2G6H6Y4      -------K-EA--ITMLISSTESGDGKTYMSLNLAGVFGL-QNKKVLLIDFDIRKPNLTE
C9LKL0          -------H-SA--KVCVVTSSTPGQGKSFISRNLAAIMGM-ANKRVLLVDADIRKRTLSS
A0A3D0QPV7      -------K-DA--KLVSVTSTISGEGKTFVAINLAGMIAF-SGKKVVILDLDMRKPKIHI
A0A496KT23      D------G-RN--KVVMLSSLNPGSGKTFITANLSAAFSL-KGKRVLVMDLDLRKASLSD
L1M9T3          D------N-GC--KVIMVTSMNPGSGKTFITANLSTAYAL-KGKRVLVMDLDLRKASLSQ
A0A2M6GH67      K--------KK--RLISITSTVSGEGKTFVAVNLGGIIAL-SDQKVVILDLDLRRPKVNL
A0A7K1TE30      T--------KR--RLISVTSTISGEGKTFVTVNLGGIIAL-SGQRVIILDLDMRKPKVNL
A0A7D4BE70      T--------KK--RLISVTSTISGEGKTFVTVNLAGIIAQ-SGQRVIVLDLDMRKPKVNL
A0A142HHS5      N--------KK--RLISVTSTISGEGKTFVTVNLGGIIAL-SGQRVVILDLDMRKPKVNL
A0A7D4C435      S--------KK--RLISVTSTISGEGKTFVTVNLGGIIAL-SGQRVIILDLDMRKPKVNL
A0A3C0I8F1      SGGLNDTS-TS--KVISITSTISGEGKTFVAANLAGIIAM-LNLKVLIIDFDMRRPKVHI
R5JJI4          S------D-NL--QVVMFTSANPGAGKTFVSSNLAMSIAQ-TNKKVVLVDVDIRKGTLSG
A0A848IUK4      S--------GH--RVITVSSTVSGEGKTFVSVNLGGIIAM-SGFKVIVLDLDMRKPKVNL
A0A136LSC7      E--------KC--KVITITSTVSGEGKSFLAMNLGGVLAL-SRKRVILVDLDMRKPKSEK
A0A5C7N8Q5      E--------KS--KVITITSTISGEGKSFLAMNLGGVLAL-SRKRVVLVDLDMRKPKSEK
A0A355BP94      E--------TN--KIIVISSTVSGEGKSFLAMNLGGILAM-SNKKVILLDLDMRKAKEIL
A0A7Y5D1K7      D--------KK--KVIVISSSVSGEGKSFLAMNLGGILAM-SKKKVILLDLDMRKAKENS
A0A3D2HF71      -------I-SN--PVIAVSSTITGEGKTFVAVNLAAIIAL-PGKKVLLIDLDLRKPKAHK
A0A0A2DQN2      N-G----V-MP--KRIVLTSFGAEAGKSYISYNLAKSLVF-AGKSVVLIDIDIRKRTLTR
A0A0A2F2N5      G-R----T-SG--QRIMCVSFGANAGKTFTTYNLARSLIF-ADKKVVIVDLDLRKGMMSK
L1NGW4          G-D----T-PS--KKIIFTSFGESAGKSYVSYNLAKTLTF-SGSTVVIVDLDLRKGTLSR
Z4WRA0          G-D----T-PS--KKIIFTSFGESAGKSYVSYNLAKTLTF-SGSTVVVVDLDLRKGTLSR
U2K8K9          A-A----G-KT--KKIIFTSFGESAGKSYVSYNLAKTLTF-SGHRVVLVDLDLRKGTLSH
A0A069ZM60      G-G----K-KA--KKVIFTSFGESAGKSYVSYNLAQTLTF-AGHSVVLVDLDLRKGTLSR
J6GV98          G-G----K-KA--KKVIFTSFGESAGKSYVSYNLAQTLTF-AGHSVVLVDLDLRKGTLSR
A0A134B4F8      G-G----K-VA--KKVIFTSFGESAGKSYVSYNLAQTLTF-AGHSVVLVDLDLRKGTLSR
A0A134B8C7      G-G----K-VA--KKVIFTSFGESAGKSYVSYNLAQTLTF-AGHSVVLVDLDLRKGTLSR
A0A4Z0EKR0      -------R-KK--TVFLITSSMSGEGKTFFSINLGASLAI-TDKRTLLLDLDLRNPKVAQ
A0A521H707      S--------GP--KVIAITSTISGEGKTFIAINLAGVIAF-SEKKVVIIDLDMRKPKIHL
A0A7T9D909      T--------GS--KIIAITSTISGEGKTFVAINLAGIISF-SGKRVIVLDLDMRKPKIHL
A0A1M6B6D5      QGI----T-GA--KTVLLTSSVSGEGKTFCSINLASIFAL-SDKKTIIIDLDLRKPKVGA
A0A451FS66      HGV----T-GA--KTVLFTSSVSGEGKTFCSINIASIFAL-SEKRTVIVDLDLRKPKVSG
A0A2E3GN39      D------K-GF--RSIAVTSTIPGEGKTFVAINLAAIIAM-QGKRVLLVDVDLRKPRIHK
A0A3D1MEL0      E------K-GF--RSIAVTSTIPGEGKTFVAINLAAIIAM-QGKRVLLVDVDLRKPRIHK
A0A519UDD1      G------R-EK--TVLLITSSMSGEGKTFFSINLGASIAL-TGKRVVLLDLDLRNPRVAS
A0A7Y2ACP6      V------K-GS--KVMAITSTISSEGKTFVALNLAGIIAL-SGKKVVILDLDMRRPKIHK
A0A2A4N9A6      N------P-GP--KIMAITSTISTEGKTFVAINMAGIIAL-SGKKVIILDLDLRKPRIHK
A0A6C0GGI1      G------M-DQ--KAIGITSSVSGEGKTFCAINLSTVLAL-SGKRTVLIDVDLRKPKVAA
A0A368D1N7      E------K-GF--RSIAVTSTIPGEGKTFVAINLAAIIAM-QGKRVLLVDVDLRKPRIHK
A0A3B8TU58      E------K-NF--RSIAVTSTIPGEGKTFVAINLAAIIAM-QGKRVLLVDVDLRKPRVHK
A0A1T5IIR6      K------K-AP--FVIATTSYSSSSGKTFITANMASCLAD-AQKRVILVDTDMRKRSLSG
A0A3E0QD27      E------P-GP--KVVAITSTISGEGKTFVAINLAGVIAF-SEKRVVIIDLDMRKPKIHL
A0A0K2HKS3      S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
B6W3W8          S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
A0A0M1W1I6      S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
A0A4R4GHU2      S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
I8WPR6          S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
A0A076IRY8      S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
A0A3A6AD54      S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
A0A8B3EPF6      S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
I8WPP8          S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
A0A372Y7D2      S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
A0A7K3KFI2      S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
A0A3E4JJC9      S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
A0A3E4WDQ0      S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
A0A414H9P2      S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
A0A7K0JKU9      S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
C3R5A8          S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
A0A6N8DCX3      G---------T--EVILLTSFNPGSGKTFLTVNIAASLAI-KGKRVLVIDGDLRHGSLSS
F0R0C9          N------E-KA--NVILLTSFNPGSGKTFLSLNIAGSLAL-KGKKVLIIDGDLRKASVSA
A0A1C5XJA7      D------R-PL--QVITFTSFNSGAGKSFVAFNLADSLAY-TKKKVILIDLDIRKGSLSH
A0A285T4L1      D------K-PM--QVITFTSFNEGAGKTFVSRNLAMSLVL-TKKRVVLVDLDIRKGTLSR
R7CUW4          D------R-PT--QVITFTSFNEGAGKTFISCNLAMSFVY-ARKRVVVIDLDIRKGTLSR
A0A416GGJ1      G------V-PV--KVITFTSFREGAGKTFILRNLAVSLMA-AKKKVVVLDLDIRKRTLSR
D1JY72          S------K-NM--QVVTFSSFGPGAGKTYVSSNLAASFAQ-TDKKVILIDMDIRKGTLTS
D7J4K6          D------K-PM--QVVTFTSFNEGAGKTFISRNLAMSLVL-TRKRVVLVDLDIRKGTLSR
Q8ABP9          D------K-PM--QVVTFTSFNEGAGKTFISRNLAMSLVL-TRKRVVLVDLDIRKGTLSR
D6D2Z5          D------K-PM--QVVTFTSFNEGAGKTFISRNLAMSLVL-TRKRVVLVDLDIRKGTLSR
A0A1T3EDR4      G------I-SP--QVITYTSFSAGVGKTFNTLNLAASFSY-MKKRVVLVDLDLRKGTLST
A0A6N8KXI9      S------Q-GA--KVIMLSSSRIGAGKTFSALNLSATLAF-LNKKVVLVDLDIRKGTLSS
A0A174SDD8      T------Q-ER--KVITLTSFNIGAGKTFISINLAASLVQ-TEKKIVLLDLDLRKGKLSE
A0A1H7RFH3      T------Q-ER--KVITLTSFNIGAGKTFISINLAASLVQ-TEKKIVLLDLDLRKGKLSE
A0A139L1N2      T------Q-ER--KVITLTSFNIGAGKTFISINLAASLVQ-TEKKIVLLDLDLRKGKLSE
A0A174TVL8      T------Q-ER--KVITLTSFNIGAGKTFISINLAASLVQ-TEKKIVLLDLDLRKGKLSE
A0A1H8BJR6      T------Q-ER--KVITLTSFNIGAGKTFISINLAASLVQ-TEKKIVLLDLDLRKGKLSE
R9H6G0          T------Q-ER--KVITLTSFNIGAGKTFISINLAASLVQ-TEKKIVLLDLDLRKGKLSE
A0A412GR09      T------Q-ER--KVITLTSFNIGAGKTFISINLAASLVQ-TEKKIVLLDLDLRKGKLSE
A0A7J5JXN6      T------Q-ER--KVITLTSFNIGAGKTFISINLAASLVQ-TEKKIVLLDLDLRKGKLSE
R6D982          S------P-GQ--KVVTLTSFNVSAGKTFVSVNLSASLVQ-ADKKVILIDLDLRKATLSL
A0A1F0I8C4      P------Q-EQ--KVITLASFNMGAGKTFVSVNLAASLVQ-AEKKIIMIDLDLRKGRLSH
A0A3A5RIJ2      P------Q-EQ--KVITLASFNMGAGKTFVSVNLAASLVQ-AEKKIIMIDLDLRKGRLSH
A0A515IZJ5      P------Q-EQ--KVITLASFNMGAGKTFVSVNLAASLVQ-AEKKIIMIDLDLRKGRLSH
A0A7J4Y2H6      P------Q-EQ--KVITLASFNMGAGKTFVSVNLAASLVQ-AEKKIIMIDLDLRKGRLSH
A0A4R6WE41      G------A-PP--QVITFSSFTIGAGKTFNVMNLSATVSY-LKKRVVMVDLDLRKGTLTR
A0A2T5RP38      D------A-PP--KVLTFTSFSAGVGKTFSVLNLATTLSF-LEKKVVVIDLDLRKGTLSS
A0A1A6CF06      E------H-PP--KVITFTSFSAGVGKTFSVLNLAATLSY-LDKKVVVIDLDLRKGTLSS
A0A1T3D6S8      E------H-PP--KVITFTSFSAGVGKTFSVLNLAATLSY-LDKKVVVLDLDLRKGTLSS
A0A8B4GMS2      E------H-PP--KVITFTSFSAGVGKTFSVLNLAATLSY-LDKKVVVLDLDLRKGTLSS
A0A7Z7LUP7      E------H-PP--KVITFTSFSAGVGKTFSVLNLAATLSY-LDKKVVVLDLDLRKGTLSS
A0A0B8T471      E------R-EI--RVITFTSFNVGAGKTFTAVNLAASLTF-LLQNVVLLDLDLRKGTLSD
A0A4R7D2K0      E------R-EI--RVITFTSFNVGAGKTFTAINLAASLTF-LLQNVVLLDLDLRKGTLSD
A0A7T9S3V1      G------K-PP--QVITFTSFSIGAGKTFTALHLAATLSF-LDKKILILDLDLRKGTISS
A0A7T9LVI2      G------N-SP--QVITFTSFSIGAGKTFTALNLAATLSF-LDKKILILDLDLRKGTISS
C2FUH6          G------N-SP--QVITFTSFSIGAGKTFTALNLAATLSF-LDKKILILDLDLRKGTISS
A0A1V3N3U3      G------R-AP--QVITFTSFGVEVGKTFSSINLSATLSF-MEKRTVVVDLDLRKGTLSS
A0A1P8E011      G------K-HP--QTITLTSFIPGVGKTFTSLNLSSTLSF-LNKKVIVVDMDLRKGTLSE
A0A7T9S8K4      G------K-HP--QTITLTSFIPGVGKTFTSLNLSSTLSF-LNKKVVVVDMDLRKGTLSE
A0A2X2J8S4      G------V-PP--KVITFSSARVGAGKTFSVINLATTLSF-LNKRVIMVDLDLRKGTLSS
A0A3C0S618      G------V-PP--KVITFSSARVGAGKTFSVINLATTLSF-LNKRVIMVDLDLRKGTLSS
A0A4P7DRF9      D------K-EQ--KVLTFTSFNVGAGKTFSVINLGVSFTF-LKKRVVLVDLDLRKGTLSH
A0A239XXC4      D------K-KQ--KVVTFTSFNVGAGKTFSVINLGVSMTF-LKKKVVLVDLDLRKGTLSN
A0A4U9K473      D------K-SQ--KVITFTSFNVGAGKTFSVINLGVSMTF-LKKKVVLVDLDLRKGTLSN
A0A081PBV5      G------K-EQ--RVITFTSFNIGAGKTFTAINLAASFRY-LNKKVLLLDLDLRKGTLSN
A0A1I2AN85      G------K-EQ--RVITFTSFNIGAGKTFTAINLAASFRY-LNKKVLLLDLDLRKGTLSN
A0A4U0GMP3      D------K-TL--QVITFTSFNIGAGKTFTAMNLAASFSF-LQKRVVLLDLDLRKGTLSK
A0A0D5BSQ0      G------E-PP--RVITFTSFSAGVGKTFSALNLATTLSY-LEKKVVVIDLDLRKGTLSS
A0A1T3F6P5      E------H-PP--KVITFTSFSAGVGKTFSVLNLAATLSY-LDKKVVVLDLDLRKGTLSS
A0A853VUQ0      E------H-PP--QVITFTSFSAGVGKTFSVLNLAATLSY-LDKKVVVLDLDLRKGTLSS
A0A7X0MJ00      D------K-KE--QVLTFTSFNPGAGKTFSVINLGMSLKF-LNKRVVLLDLDLRKGTLSH
A0A841JHZ0      E------K-KQ--QVLTFTSFNVGAGKTFSVINLGMSLKF-LNKRVVLLDLDLRKGTLSN
A0A1H6CKR6      D------K-SQ--KVITFTSFNVGAGKTFSVINLGVSLTY-LKKRVVLVDLDLRKGTLSN
A0A7W3MGA7      D------K-KQ--KVITFTSFNVGAGKTFSVINLGVSMTF-LKKKVVLVDLDLRKGTLSN
A0A3M1Y2F5      R--------G---ILLGVCSTWSDEGKSFCAANLAASFGI-GGYNTLLVDLDLRNPSQPE
A0A7V1ALN2      E--------NGKGHVILLTSAGPNEGKSTIAANLAVAMAQ-TDMHVVLIDADLRRPTLHK
A0A3D4RLG4      K--------Q-N-IVLSITSTQSGDGKTFLATNLAALYGM-TGKKTLLIDLDIRKPNIHE
A0A2T2UAJ4      D--------D-L-QTMAVSSADKGDGKTTTCANLALALAS-AGKRTIVVDADLRRPWMHE
A0A6I0DZQ5      K--------D-K-ITIMVTSSESGDGKTYFSLNLASVYGL-ASPRTLLVDLDIRKPSIHK
A0A1H6Z2F8      R--------Q-N-TVVLLTSSMADEGKSFVAMHLAHSLAL-ASRKVLLVDFDLRKPTLAS
A0A2P8G5K0      R--------P-H-MVILLTSAMANEGKSFVAMHLAHSLAL-AGKKVLLVDFDLRKPSLAT
R5DEG6          E--------KNM-QVVMFTSFNPGAGKTFVSINLAMSFAL-THKKVVLVDLDIRKGTLSS
A0A4Q3SEI4      L--------K-Y-RRILVTSSIAGEGKSFIANNLALSLAI-SGKKVVLVDLDLRHPKTTT
A0A836SQI2      K--------G-K-QIISITSTVAGEGKTFIAINLSAIIAK-SGKKVILLDLDMRKPRLHL
A0A7V1FAJ9      G--------R-I-KTVVVTSFAPGDGKSFTCSNLAITLAQ-HKTNVLLVDADLRRGVLHN
A0A3N2LCI3      S--------EGN-KVIAMTSFNPGSGKSFVSMNLGMAIAL-KGKKVLIVDGDMRHGSTS-
A0A6H9Q899      D--------KTS-NVIIVTSFNPGSGKSFLTMNIAMSFAI-KGKKVLVIDGDLRHGSAS-
A0A3D4CJE1      P--------G-S-KVMAITSTVSGEGKTFVAINIAGIIAY-SGKKVIILDLDMRKPKIHL
A0A7C7LI79      E--------G-P-KIIAVTSTVASEGKTFVTINLAGIIAF-SEKKVIVLDLDLRKPKIHL
A0A4Q5ZQ60      A--------K-K-RIISVTSTIGGEGKTFVAVNLAGIIAQ-SGQRVVILDLDMRKPKVNL
A0A519Q885      N--------K-K-RLISITSTISGEGKTFVAVNLAGIIAL-SGQRVVILDLDMRKPKVNL
A0A519TAP8      N--------K-K-RIISVTSTISGEGKTFVAVNLGGIIAL-SGQRVIILDLDMRKPKVNL
A0A848Y4B8      V--------M-V-ETILVTSGSPSEGKSVTSANLAIVMAQ-AGRRVLLIDADLRRPTVHK
A0A7Y4V8Y1      G--------H-K-KIITVTSTISGEGKSFLATNLGGVLSM-SKKKVLLIDLDMRKQKNES
A0A5Q4EKA0      P--------G-P-KLVAVTSTISGEGKTFFAMNLAGILAF-SNKKVIVIDFDMRKPKIHL
A0A519SYE7      G--------K-K-RIISITSTISGEGKTFVAVNLSGIIAL-SGQRVVILDLDMRKPKVNL
A0A7C7CFR2      P--------G-P-KVIAITSTVSGEGKTFVAINLSGIIAF-SDKKVVILDLDLRKPKIHL
A0A7W1G0I5      K------R----KQVILITSTMTGEGKSFCSMNLATSMAL-LNRRTVLVDFDVRKPNLHQ
A0A2T4XEQ1      D------L-E--VKTILVTSPGKGEGKTTTAVNLAGILAE-SGKRVLIIDFDFRRPNLHK
A0A2K8ZAP1      A------Q-K--NQVILFTSSISGDGKSFMSLNLGASLAL-VNRKTVIVDMDMRKPKLHK
A0A3D3LSK1      D------K-P--LKTILVTSSLPSDGKTIVSVNLAGSFAL-DNKKVILIDCDLRKPRVHT
A0A496L711      R------K-E--KITVLISSTESGDGKTYISLNLAGVFAL-QNKKILLIDFDIRKPNLTK
A0A348PT57      D------N-E--KKIIAVTSTISGEGKTFVAINLGGILAF-SDKKVIILDLDMRKPRIHK
A0A847AMH6      G------K-E--NPVIAVTSTAPGEGKTYTAINIASSFAL-TKKKTVILDFDLRNSKIND
A0A7C3PTI0      E------P-G--SKLMAVTSTISGEGKTFVAINLAGIIAY-SDKKVIILDLDMRKPKIHL
A0A7V1FAS7      E------S-P--IHSILVSSPGPGEGKSTSVTNLAITIAQ-MGTKTILVDSDLRRPVIHS
A0A7V0M115      G------R----IKTVVVTSFSPGDGKSFTCSNLAITLAQ-HKTNVLLVDADLRRGVLHN
A0A7C1IBE4      E------S-GEPPRSVMVVSCDPQEGKSFVCANLGVSFAHSVKEQALVIDCDLRRPSLQS
A0A3D5KRM7      L------R-ENNWNSFFITSATPGAGKSWVATNLAIAIALEGNQTVLLVDADLRHPSICN
A0A831LDA6      -------K-GKPKPVIAVTSTFPKEGKSYNAINIASSFAL-MRKKTVLLDLDLRNSKLKE
A0A833B0I1      G------K-DKTSNVIIMTSFNPGSGKSFLTMNIAVSLAI-KGKKVLVIDGDLRHASASS
A0A1V5S5I3      K------T-GGKAGVTLFTSFNPGSGKTFLAMNTAAVFAL-KGKRILVIDGDLRHGSASA
R7JFY1          G------G-DEHMQVLLFTSMNAGAGKTFISSNLAASLVL-THQKVVLLDLDIRKGTLGK
A0A2M7VVW6      -------K-SEESKLMAITSTISGEGKTFCAINLSGIIAM-SGKKVIILDLDMRKPKIHL
A0A413V760      V------K-AANLQVVMFTSANPGAGKTFVSSNLAMSIAQ-TNKKVVLVDVDIRKGTLSG
A0A3M1NUH2      D------T-V--VETIVVTSPSVEEGKSTTAANLAVVMAE-AGRRTVLIDADLRRPRVHQ
A0A2T2TDL4      D------E-T--NTTVLVTSPGSGDGKSLTAANLATVTAQ-AGHSTLLIDGDLRRPRLHE
A0A359ATS6      S------G-EPDSNVLMLTSFNPGSGKTFLTMNMAISLAI-KGKSVLVIDGDLRRGSISD
A0A1V6HYH8      -----------------MTSTISGEGKTFVAINLGGILAL-SNKKVLIIDTDLRRPKMSI
A0A7X7LGP1      ----------------------SGEGKTFFAMNLAGILAF-SDKKVIVIDLDMRKPKIHL
A0A838FHH6      --------------------TVAGEGKTFIAVNMAGIMAV-GGKKVILLDFDLRKPQIHK
A0A7Y4VJX2      G------G-T--KKIITITSTISGEGKSFLASNLGGVIAM-SRKKTILLDLDMRKQKSAS
A0A3D1AEJ6      Q------D-N--IKVITTTSTSVGSGKTFVSSNLAASLAM-TGKKVLLMDMDIRKGTLGK
A0A7K3KYQ2      S------E-G--NKVIAMTSFNPGSGKSFVSMNLGMAIAL-KGKKVLIVDGDMRHGSTSA
A0A2E0MDX6      N------E-G--SKIITVTSTISGEGKTFVAINLGGIIAF-SEKKVIILDLDMRKPKTHI
A0A2M7KCE1      I------K-E--SKTIAISSTISGEGKTFIALNLGGIYSF-QGKKTILIDLDLRKPRFHL
A0A523GUD4      G------T-H--KQTVMITSALSGEGKSTISTNIAIASSRNRQRPSLIIDFDLRRPRLHH
A0A7V5RHV9      G------R-E--LKNLLVTSATISEGKSTTAALLAATIARYRDTKTIIVDCDLRRPRIHQ
A0A641X2Z6      G------Q-E--LKTIIVTSATPNEGKSTTISNLAVVMAQ-AGHKVLLMDCDMRNPTQHK
A0A6L8U2P8      H------E-K--SKVILITSSQPQDGKSFVSLNLASSIAS-VGYKTILVDCDLRRPTLHI
A0A7C6G639      R------K-S--KIMLLITSAEFSDGKTYFCTNLASTYGM-TGLKTLLIDMDIRKPSINE
A0A519PJW5      S------N-K--KRLISVTSTISGEGKTFVTVNLGGIIAL-SGQRVIILDLDMRKPKVNL
A0A519T3R9      A------S-K--KRLISITSTISGEGKTFVTVNLAGIIAL-SGQRVVVLDLDMRKPKVNL
                                         **:      .           :.:* *.*      

A0A7X8GFH1      T-FKSS--NKQ------GLSTILIGKD---SYKD--CLIK-T-EFD------NFDVITSG
A0A7C7CKY6      G-FNSD--NKN------GISTILSGVD---KVED--TISK-S-NVD------NLDYITAG
A0A1G1TG88      A-FGAE--NVK------GVSTILIDRH---SVAE--CIQH-T-SID------ALQFISAG
A0A661XXA6      A-FDKE--SSDC-----GMSTLLIKKH---NLSE--CITK-S-HIE------DLDFIGAG
A0A519SD85      S-FNTG--NQ-M-----GLTNYIHSDL---ALEQ--IIRK-T-SIE------NLEFIPSG
A0A3M1TXY5      Y-FRTE--HH-A-----GLSDFLCGEV--DYVNE--IIHS-T-HIE------NLHIIPAG
A0A7T9KM12      R-LGLE--LG-T-----GLSTYLIGEA--G-IDE--IVRK-S-DIP------GMDVITAG
A0A2E0VQ27      E-LGMD--NS-D-----GFCEAIKSDR--HALD---LVQN-T-SDE------NLYFIPAG
A0A7Y7TYP1      Y-FNQENELI-D-----GISSYLIEKS---SLNK--IIMH-S-PHD------KLDYINSG
R6U429          A-LEHNK----S-----GISAFLNGKLESIVPEI--QNIK-E----------NLDLISVG
A0A5C8AF42      G-LNTN--NN-Y-----GMSGLIINKF---TLEQ--CIQH-S-TIE------DLDFITAG
A0A7Y5SYP1      H-LPIR--KF-P-----GLTELILNGD-LSGVQKVESFHS-A----------TFDVIASG
A0A7V1N701      L-FNTT--SE-P-----GLTDVLFEQN---GWEK--APRP-T-GIE------NLTLMPVG
A0A7V2NIA8      L-FDVE--RT-P-----GLSDLLVGQC---EWDE--VFRK-S-MHE------NLTVVPAG
A0A239K409      D-LGLA--CE-F-----GITDYLSFNT--VTVEE--MLNQ-SDQVP------NLFIVGSG
A0A1M3DPL8      T-IGCD--NN-M-----GVSNFLANQC---SLDE--IIVR-P-DGA------EFDFITAG
A0A1V5F519      R-FNVN--HP-K-----GVTNYLINEC---TLDE--IINV-V-PEV------NYDVIFAG
A0A2G6R1T9      R-LGIS--EK-A-----GVTNYLIGEN---ELDD--LIIK-N-DDF------SFDVLLGG
A0A350V3E4      I-FNMK--RY-P-----GLCDYLFGTV---TIEE--AVRE-T-SFP------NLHIMTCG
A0A6J4K208      R-FDID--NA-A-----GLASYLTGAH---KADD--IIQA-T-ATE------NLYIIPSG
A0A2W4RDE8      Y-FQLE--ND-K-----GLSNYLIGEA---SLKE--IINE-T-GIK------GYDVITSG
A0A212J9Z9      T-LQID--SQ-K-----GISNYLIGQV---TLDE--IIYS-H-PDY------GFDIIPAG
F5IV23          T-LQID--SQ-K-----GISNYLIGQV---TLDE--ITYS-H-PDY------GFDIIPAG
A0A1M5DFS8      L-LNLQ--SK-K-----GVSNFLIGQV---SLDE--ITVT-H-PEY------EFDVITAG
A0A4Y8KZS5      L-LNTQ--TK-K-----GVSNFLIGQV---SLDE--ITIT-H-PEY------EFDVITAG
A0A2V3PNY7      L-LSIE--SK-K-----GVSNYLIGQV---TLDE--ITIT-H-PEY------EFDVITAG
A0A6G7X5K8      L-LNIE--SK-K-----GVSNFLIGQV---TLDE--ITLT-H-PEY------EFDIITAG
A0A840CJ33      T-LQVE--AQ-K-----GISNYLIGQV---DLND--IITS-H-PDY------GFDIIPAG
F8X2T0          T-LQVD--AQ-K-----GISNYLIGQV---TLEE--IIIS-H-PDY------GFDIIPAG
A0A1M3LAG1      T-LQID--AQ-K-----GISNYLIGQV---TLDE--IIIS-H-PDY------GFDIIPAG
A0A212K6G4      T-LQID--AQ-K-----GISNYLIGQV---TLDE--IIIS-H-PDY------GFDIIPAG
A0A4Y9IPG7      T-LQID--AQ-K-----GISNYLIGQV---TLDE--IIIS-H-PDY------GFDIIPAG
A0A0L8VEV2      R-LKYK--NK-E-----GLSTYLTDFS---SFDD--IFRQ-T-RVE------NLQFVSAG
A0A1I2A9Z9      R-LKYK--NK-E-----GLSTYLTDFS---TFED--IFRQ-T-RVD------NLQFVSAG
A0A848XXC6      Y-LG-------L-----GASPALGAGI---ETEN--LIYW-NTVVP------GLFALTAR
A0A2P8CDS1      M-HNYD--KN-R-----GVSNYLLGEM---RLED--ITFR-S-THP------YMWLIPSG
A0A660LQT8      F-VGRPK----Y-----GIANYLNGQG---TLDE--IVCK-Y-RDT------DLDVIPVG
A0A3D0FMX4      K-LGTS--IE-K-----GLTNYLIGEI---SKQE--MIQH-D-PSY------EFDIIYAG
A0A7V6G854      L-FELS--TT-K-----GLVDYLINNA---TLDE--IIKK-D-FSY------GFDVILVG
A0A1M3MEI8      R-LGVE--NS-L-----GLTNFLVGQC---KAQD--IIMR-P-DGA------GFDFIPAG
A0A1J5HQM0      R-FNIN--PS-Q-----GITNFLVGQA---TLDE--VIIH-I-PEL------EYDFLPGG
E4T131          R-FNIV--HP-L-----GVTNYLVGQC---ALDE--IILK-L-PKV------DFDILPAG
A0A653AC35      R-LSIS--EK-D-----GVTNYLIGEK---PLDK--LILK-K-DGI------NFDILLAG
A0A847LA02      R-LGIT--ET-L-----GVTDYLIGDG---TLDD--LIIQ-K-EDV------NFDILLGG
A0A389LWV6      A-LDLD--TQ-K-----GLSNFLIGKA--SLADV--VISH-P-DF-------GFDILPAG
A0A1G9B1T9      I-LEKT--NG-V-----GLSNYLQGTA---DMSE--IIQP-T-DQE------NLYVITAG
A0A350PNH9      L-VGSPG----E-----GLSDYLNGRT--DDLEG--IICH-G-EEYGLVK--DFDVLPIG
A0A354LNT9      L-VGSPG----E-----GLSDYLNGRT--DDLEG--IICH-G-EEYGLVK--DFDVLPIG
A0A161LWY6      R-LSLE--NE-T-----GITNCMLGQV--SLDDA--IIKK-S-PEI------NFDLLLAG
A0A6I3N9U6      R-LSLE--NE-T-----GITNCMLGQV--TLDEA--IIKK-S-PEI------NFDLLLAG
A0A353WYK7      V-FYHN--IQAK-----GVSTILIEKH---SVEE--CILK-T-NLE------NLDYISSG
A0A2W7RD29      Y-LGVD--NT-A-----GLSNYLSRRV--DDEST--IVKA-T-SIP------GLSCITSG
A0A3N2NDY8      F-VDMPS----K-----GLSNYLTGNT--DNWQS--LVVP-VAGQN------GMSVMPIG
D7JEV9          N-LGGMVKNK-L-----GFVNYMIGDC---SLNE--AIES-T-PY-------GFDFLKAG
A0A553GA49      N-YFKS--EN-K-----GISMFLSNQV---ELDD--IIEK-Q-EGK------NISYIAAG
A0A7V5GTN5      M-VGID--RT-P-----GITDYLFGNI---NVDD--IIVP-DGNVE------NLYLIPAG
A0A497D6F6      N-LELD--TD-K-----GVVSYLTGEA---GIDD--ITFS-S-KHP------DLDIIPAG
F4KR18          Y-FEGN--AE-I-----GLSSFLINQL---EVEE--VIQT-SGDLP------NLDYISGG
B5CTK0          H-SKR---KE-L-----GVTDYLSGKI---ADLNQIIVKG-K-LHA------NLDMIYAG
A0A5M4AAB9      K-MGYE--SN-R-----GASNYILNEM---SIND--ITFN-T-PHP------YLHIIPAG
A0A5R9QZP0      K-LKKD--NP-F-----GISNFMNKEV---TAQE--IIFD-S-GIK------NLSYIPAG
A0A7X6SRJ5      K-IKTN--NS-K-----GLSHYMANNT---PKEE--LIAK-S-GIN------NLSIIPAG
A0A3D3HL11      K-LKIV--NS-V-----GLSNYMVNNA---STKE--IIKK-T-DVD------NLWFIPAG
A0A6L8U6G9      K-LKIV--NS-V-----GLSNYMVRNV---SSKE--ILRK-T-DID------NLWFIPAG
A0A6L8UH35      K-LKVE--NR-M-----GLTNYMTKNA---SLNE--IIRH-T-NIE------NLSFIPAG
A0A7X9F2J5      K-LKVE--NR-T-----GLTNYMTKNA---SVNE--IIRP-T-NIE------NLSFISAG
A0A352ME00      K-LKED--NA-K-----GISNFMIKKA---TADE--IIRN-T-AIT------NLDFISAG
A0A7X8CRA6      K-LKEN--NN-Y-----GLTNFMTNKA---QADE--IIRG-T-NIT------NLDFISAG
A0A1F3D6P8      K-FKED--NS-S-----GISNFMVKNA---TVTE--IIRN-T-SVE------NLSFIPAG
A0A356Z058      K-FKED--NS-S-----GISNFMVKNA---TVTE--IIRN-T-SVE------NLSFIPAG
A0A7X8FHL3      K-LKED--NS-R-----GLSNYMIKKA---SIED--IIRN-T-AIP------NLDFISAG
A0A3D1BT36      K-FKID--NE-G-----GITKYLTDKN---VDND--IILK-T-FVD------NLDFIPAG
A0A7X7CXW9      K-LKIV--NS-V-----GLSNYMVRNV---TSKE--IIKK-T-DVD------NLWLIPAG
A0A4R6H3B7      R-LKYK--NK-E-----GLSTYLTDFS---TFED--IFRQ-T-RVD------NLQFVSAG
A0A229I3A5      L-IHSPG----E-----GLSDYLNGRI--ADIHD--ILYK-G-EENGLVK--NFDVIPIG
A0A3R6HJB3      L-IHSPG----E-----GLSDYLNGRI--TDIHD--ILYK-G-EENGLVK--GFDVIPIG
R6NN15          Y-VGSPH----H-----GLSNYLAGKV--QRIED--VIVP-A-SET---V--RFDVLPIG
A0A2W7QSQ0      S-LNIK--SK-H-----SLFDYLNHDI--KDLKE--IITP-S-GIN---S--NMDIIGLN
A0A841MQL4      S-LKIS--NE-N-----SLYEYLNQDV--KNIKD--VIHP-S-GIH---P--NFDIIGLN
A0A3P1Z8V4      G-FTNG--RK-K-----GLTEYLIGDS--EAPHD--IIHT-D-GVC---K--GVDFLPAG
A0A1M6MYT6      D-IGLK--IE-K-----NVVDYILGKA---TLEE--ITHK-T-KHP------RLKVIPAG
A0A1V5S1J9      G-LYLS--VN-K-----GISNYLANQI--SLDEA--IVKH-P-DY-------KFDILPVG
A0A7X8JMH1      T-LSLP--EN-K-----GLSNYLAGQI--DLSEA--IIKK-S-NY-------KFDIMTVG
A0A3D5KRY6      M-LKQE--NT-T-----GLSLLLEKKT---KAEE--IIRK-T-DIP------NLSFVPSG
R7F6L5          A-FGSPR----E-----GIANYLCGAD--QMSDI--VQHN-V-NDV---E--GLDLIGVG
A0A7C5MRV2      S-FGHD--NS-A-----GVSTYLVNQN---TLPE--ILTK-T-QYK------NLDIITSG
A0A0A2EYC8      N-LGD-IIKTKS-----GFVNYMIGDC---TIEE--AIES-T-PY-------GFDFLKAG
A0A2G6H6Y4      N-LQESLSKHKV-----GFVNYMIGEC---SLEE--AIDT-T-GY-------GFDFLKAG
C9LKL0          K-FGRS-----N-----GLTGWLVDEEEKLSLDE--IIIK-D-GVA---K--QVDFLPAG
A0A3D0QPV7      G-FGTD--NE-V-----GMSSLLIGRD---QLEQ--CIRK-S-EME------NLHFITAG
A0A496KT23      Y-VGQPK----V-----GISNYLSGQI--EDWHE--IITP-L-D--------RVDVLPCG
L1M9T3          Y-VGNPQ----I-----GLSNYLSGQI--NDWHK--IIIP-L-G--------QVDCLPSG
A0A2M6GH67      A-FDAE--NN-I-----GISTILIERH--SVPEC--IQKT-A-IP-------NLDFIPAG
A0A7K1TE30      A-FGAE--NV-R-----GISTILIDRH--SVAEC--VQHS-T-IE-------SLDFISAG
A0A7D4BE70      A-FGAE--NV-R-----GISTILIDRH--TVAEC--IQHT-D-IS-------ALDFISAG
A0A142HHS5      A-FDAE--NV-R-----GISTILIDRH--TVAEC--IQHT-S-IE-------SLDFISAG
A0A7D4C435      A-FDAE--NV-R-----GISTILIDRH--SVAEC--IQHT-G-IE-------SLDFISAG
A0A3C0I8F1      A-FDREEEDNLK-----GTSTILIGRH--TPQEC--IQHT-P-IE-------NLDFIPSG
R5JJI4          I-FSNPS-GR-M-----GLTHYLSGRT--DGLDD--IIGA-S-EEY---G--KLDIIFSG
A0A848IUK4      A-FDEEF-MT-T-----GMSTLLIGKH--DLDQT--IRST-K-QE-------NLYYIPSG
A0A136LSC7      Y-PTGND-SS-M-----GMSTILIKKN--NWQEC--VLKT-S-LE-------NFDFIPSG
A0A5C7N8Q5      Y-PTGND-SP-L-----GMSTILIKKN--KWQEC--VVKT-S-LE-------NFDFIPSG
A0A355BP94      H-ARVTD-PS-K-----GISTLLIHKT--TLEES--ITKT-D-MA-------GFDYIPSG
A0A7Y5D1K7      H-ADIKD-PS-K-----GVSTILIHRN--TLAES--ITKT-S-LE-------GLDFIPAG
A0A3D2HF71      I-LGNND-NT-E-----GISKYLIGES---KIED--IIIK-T-EVE------NLWYAPAG
A0A0A2DQN2      K-LNFE--HN-M-----GLTSYLSGMD--VSIDE--LIQQ-D-PNC---E--MLSIIPAG
A0A0A2F2N5      R-LEMS---G-R-----GMTNYLSDDS--IKIED--VLRQ-D-KNC---P--SLHVIPIG
L1NGW4          R-AHVA---G-Q-----GVTEYLVDKA--MPVEK--IIHK-D-PNF---S--KLAIIPAG
Z4WRA0          R-AHVA---G-Q-----GVTEYLIDKA--MPVEK--IIHK-D-PNF---S--KLAIVPAG
U2K8K9          R-AGII---G-K-----GVTEYLSDPT--VQVDQ--IIRK-D-PNA---P--KLSVIASG
A0A069ZM60      R-IGLA---G-M-----GATEYLSNPD--VRLDQ--ILRK-D-PNA---P--KLQVITSG
J6GV98          R-IGLA---G-M-----GATEYLSNPD--VRLDQ--ILRK-D-PNA---P--KLQVITSG
A0A134B4F8      R-IGLA---G-M-----GATEYLSNPD--VRLDQ--ILRK-D-PNA---P--KLQVITSG
A0A134B8C7      R-IGLA---G-M-----GATEYLSNPD--VRLDQ--ILRK-D-PNA---P--KLQVITSG
A0A4Z0EKR0      R-LALP--AG-P-----GITDYLVSSD--ILISD--IIRE-S-EQV---P--NLFIISSG
A0A521H707      G-FNVE--NI-R-----GMSTILIGKD--TT-DF--CINK-S-SLA------NLDFITAG
A0A7T9D909      G-FGVE--NI-R-----GMSTLLIGKD---ALEN--CINH-S-TIP------GLDFITAG
A0A1M6B6D5      A-FNIQ--NS-M-----GVVNYLINEA---DLDG--IIQK-T-EID------TLDVITSG
A0A451FS66      A-FNMD--NS-I-----GVVNYLINEA---DLDT--ITQK-T-EVD------YLDVIPSG
A0A2E3GN39      I-FDLP--NS-A-----GMSTLLNKRS--TKEDI--TFST-S-EE-------NLWAVPAG
A0A3D1MEL0      I-FDLP--NS-A-----GMSTLLNKRS--TKEDI--TFST-P-EE-------NLWAIPAG
A0A519UDD1      E-LNML--KS-I-----GLSNYLVNDD--ISIKN--ILRL-S-EKV---P--DLFIIGSG
A0A7Y2ACP6      G-FGVD--NE-K-----GMSTMLINKH--TFEDC--V--R-Q-SKL---E--GLDYITAG
A0A2A4N9A6      A-FEID--NA-K-----GMSTILIGKD--KVEDC--I--F-K-SNI---D--TLHFIPSG
A0A6C0GGI1      Y-LGLK--NT-T-----GLSSYLIKSS--TLEEI--I--Q-P-TKV---K--NFDVISSG
A0A368D1N7      I-FDLP--NS-S-----GMSTLLNKRS--IKEDI--I--F-S-TPE---E--NLWAIPAG
A0A3B8TU58      I-FNLP--NS-A-----GMSTLLNKRS--IKEDV--T--F-S-TSE---E--NLWAIPAG
A0A1T5IIR6      V-FALKH-KT-K-----GLSNYLYDLD--LTLDD--ILFK-D-VKS------GIDFIPAG
A0A3E0QD27      G-FNVE--NT-K-----GMSTILIGKD--EA-DN--CIRK-S-NLT------NLDFITAG
A0A0K2HKS3      H-TRLHT-EE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
B6W3W8          H-TRLHT-EE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
A0A0M1W1I6      H-TRLHT-EE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
A0A4R4GHU2      H-TRLHT-EE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
I8WPR6          H-TRLHT-EE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
A0A076IRY8      H-TRLHT-KE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
A0A3A6AD54      H-TRLHT-KE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
A0A8B3EPF6      H-TRLHT-KE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
I8WPP8          H-TRLHT-KE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
A0A372Y7D2      H-TRLHT-KE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
A0A7K3KFI2      H-TRLHT-KE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
A0A3E4JJC9      H-TRLHT-KE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
A0A3E4WDQ0      H-TRLHT-KE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
A0A414H9P2      H-TRLHT-KE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
A0A7K0JKU9      H-TRLHT-KE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
C3R5A8          H-TRLHT-KE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
A0A6N8DCX3      Y-IGS---PG-I-----GLSDYLAKRT--DDLKG--VIHK-V-DVR---YA-GLDMIPVG
F0R0C9          F-IDS---PK-T-----GLSDYLGRKT--DAIDT--AVVE-A-P-Q---CP-GLYILPVG
A0A1C5XJA7      R-MHK---HG-V-----GMTNYLADET--IALDD--IIHD-C-GKD-------YDFINAG
A0A285T4L1      H-FSK---HP-V-----GVTNYLADES--IALDD--IIHT-D-EKS---G--GLDIISSG
R7CUW4          H-LGE---HR-T-----GVTNYLADTT--VTVDD--IIRK-G-EH--------FDIIASG
A0A416GGJ1      H-FAKH---P-Y-----GMTNYLSDAS--IRLED--ILVK-G-NGV---D--IPDAILAG
D1JY72          H-TRLHT-EE-K-----GMTSFLAGKA--TT-DE--IIKH-N-EIC---E--NLDFIPAG
D7J4K6          H-FHK---HP-V-----GVTNYLADDS--IRLDD--IIHT-D-GKF---D--NLDIISSG
Q8ABP9          H-FHK---HP-V-----GVTNYLADDS--IRLDD--IIHT-D-GKF---D--NLDIISSG
D6D2Z5          H-FHK---HP-V-----GVTNYLADDS--IRLDD--IIHT-D-GKF---D--NLDIISSG
A0A1T3EDR4      R-VGLE--GK-A-----GVSHYLSGLL--RDINT--VIYH-R-EIG---L--GVDVIPLG
A0A6N8KXI9      K-FNLE--VD-K-----GVTHYLANHS--VDLSE--IIYP-T-NLL---NDYNVDLIPIG
A0A174SDD8      M-SHCT--QV-K-----GVAHYLSNPS--IEVND--IILR-D-AFG---E--GLDLVPIG
A0A1H7RFH3      M-AHCR--QV-K-----GVAHYLSDSS--VEVTD--IIVQ-D-TFG---E--GLDLVPIG
A0A139L1N2      M-AHCR--QV-K-----GVAHYLSDSS--VEVTD--IIVQ-D-AFG---E--GLDLVPIG
A0A174TVL8      M-AHCR--QV-K-----GVAHYLSDSS--VEVTD--IIVQ-D-AFG---E--GLDLVPIG
A0A1H8BJR6      M-AHCR--QV-K-----GVAHYLSDSS--VEVTD--IIVQ-D-AFG---E--GLDLVPIG
R9H6G0          M-AHCR--QV-K-----GVAHYLSDSS--VEVTD--IIVQ-D-AFG---E--GLDLVPIG
A0A412GR09      M-AHCR--QV-K-----GVAHYLSDSS--VEVTD--IIVQ-D-AFG---E--GLDLVPIG
A0A7J5JXN6      M-AHCR--QV-K-----GVAHYLSDSS--VEVTD--IIVQ-D-AFG---E--GLDLVPIG
R6D982          I-AKARGNGI-K-----GMAHYLSNKS--ISMDD--IIMK-D-GFG---E--RIDLIPVG
A0A1F0I8C4      F-AHAK--RV-K-----GVAHYLSNPL--VSADD--IILH-D-AFG---E--GLDLIPIG
A0A3A5RIJ2      F-AHAK--RV-K-----GVAHYLSNPL--VSADD--IILH-D-AFG---E--GLDLIPIG
A0A515IZJ5      F-AHAK--RV-K-----GVAHYLSNPL--VSADD--IILH-D-AFG---E--GLDLIPIG
A0A7J4Y2H6      F-AHAK--RV-K-----GVAHYLSNPL--VSADD--IILH-D-AFG---E--GLDLIPIG
A0A4R6WE41      R-MGIK--FR-K-----GVTHYLSDSS--VKIDD--VLYK-S-DLS---E--GVDCVPIG
A0A2T5RP38      R-VDLL--HG-K-----GSSHYLSSPS--ISIDE--IIHK-S-DVA---E--GVDFIPIG
A0A1A6CF06      R-VDLL--HE-K-----GTSHYLSNSS--ISVDE--ILQK-S-ELL---E--NVDVIPIG
A0A1T3D6S8      R-TGLL--HG-K-----GTSHYLSNPS--IKISE--ILHK-S-EVA---E--GVDFIPIG
A0A8B4GMS2      R-TGLL--HG-K-----GTSHYLSNPS--IKISE--ILHK-S-EVA---E--GVDFIPIG
A0A7Z7LUP7      R-TGLL--HG-K-----GTSHYLSNPS--IKISE--ILHK-S-EVA---E--GVDFIPIG
A0A0B8T471      H-LKLG--SV-K-----GVTHFLADPA--VSLDH--ITYK-A-NVG---N--GVDVIPIG
A0A4R7D2K0      H-LKLG--SV-K-----GVTHFLADPA--VSLDH--ITYK-A-NVG---N--GVDVIPIG
A0A7T9S3V1      R-LHIK--NT-L-----GASHYLSNSN--VSIDD--TICK-S-GIA---D--NIDIIPIG
A0A7T9LVI2      R-VNVK--SA-L-----GVSHYLSNSQ--VAIDD--IICK-S-GIA---D--NVDIISIG
C2FUH6          R-VNVK--SA-L-----GVSHYLSNSQ--VAIDD--IICK-S-GIA---D--NVDIISIG
A0A1V3N3U3      R-LGLL--DK-I-----GCSHFLADAT--VTLDT--VIYP-V-KGL---E--FLDCVPIG
A0A1P8E011      R-MGII--HG-K-----GLSHYLSDVN--LELEE--IIHY-N-LHG---K--NVDYISIG
A0A7T9S8K4      R-MGII--HG-K-----GLSHYLSDVN--LELEE--IIHY-N-LHG---K--NVDYISIG
A0A2X2J8S4      R-IPVP--VR-K-----GITHYLSDKE--LNLSE--VIYK-T-EVS---D--NIDIIPIG
A0A3C0S618      R-IPVP--VR-K-----GITHYLSDKE--LNPSE--VIYK-T-EIS---D--NIDIIPIG
A0A4P7DRF9      K-TKVP--MP-V-----GITHYLADSN--TQIDD--IIYK-D-RIA---D--GLDIIPIG
A0A239XXC4      I-TKFP--MP-I-----GVTHYLSDSS--VTVDE--IIYK-D-RTD---S--EIDIVPIG
A0A4U9K473      I-TKFP--MP-I-----GVTHYLSDSA--VTIDE--IIYK-D-RVD---A--DIDIIPIG
A0A081PBV5      R-VNAQKEKG-L-----GVTNFLANPK--VTVDD--IIYQ-G-LVG---G--IIDVIPIG
A0A1I2AN85      R-VNAQKEKG-L-----GVTNFLANPK--VTVDD--IIYQ-G-LVG---G--IIDVIPIG
A0A4U0GMP3      S-LKGRRK---------GVTHYLSDAN--VAWSD--IVYK-N-EFA---N--SVDIVPIG
A0A0D5BSQ0      R-IDLLHG---K-----GVSHYLSSPS--VSVDE--VLHK-S-EVA---N--GVDFVPIG
A0A1T3F6P5      R-TGLLHG---K-----GTSHYLSNSS--IQISD--ILHK-S-EVA---E--GVDFIPIG
A0A853VUQ0      R-TGLLHG---K-----GTSHYLSNSS--IKISD--ILHK-S-EVA---E--GVDFIPIG
A0A7X0MJ00      L-TKVPMP---I-----GITHFLADAN--IQIDQ--IIYK-D-RIA---E--HIDIIPIG
A0A841JHZ0      R-TKVPMP---V-----GISHFLSDTN--VSIDQ--IIYK-D-RIA---E--HIDIVPIG
A0A1H6CKR6      I-TKFPMP---I-----GATHYLSDSA--ITVDE--IIYK-D-RVD---A--NIDIVPIG
A0A7W3MGA7      I-TKFPMP---I-----GVTHYLSDSA--ITVDE--IIYK-D-RTD---A--EIDIVPIG
A0A3M1Y2F5      Y-FRYP--RQ-M-----GISNGLLGPE---RSHWKKWIIK-D-VES------QIDILPAG
A0A7V1ALN2      F-FQVH--RS-D-----GLVDILSGDL---RMKGLIRRAP-E-MKK------RLELVTSG
A0A3D4RLG4      K-LGVD--AG-L-----GVTNYLIGEC---EIED--ILHK-D-TSY------NFDFLLAG
A0A2T2UAJ4      M-LNVD--RD-L-----GLSQVLY-EG---ELDP--EAYA-T-EVE------NLFVIPAG
A0A6I0DZQ5      R-LGVE--NS-L-----GLTNFLVGQC---KAQD--IIMR-P-DGA------GFDFIPAG
A0A1H6Z2F8      L-LNLR--PE-G-----VTEHIALEKD---LLIQ----QC-A-NGP------PFDFIAAG
A0A2P8G5K0      L-LNLR--PN-G-----VTECIASGHE---PLIQ----QN-S-SET------SFDFLAAG
R5DEG6          --HVQV--SD-M-----GVTNYLSGRI---DNVDEIIQKG-E-LYD------KLDIIHAG
A0A4Q3SEI4      M-HDLN--GQ-R-----GVAEFLENNE---VPVST-IMYP-T-SNE------KIFVVPAG
A0A836SQI2      S-FNSK--NE-I-----GMSNLLIGDN---SLEE--CIHS-G-PIS------NLDFITTG
A0A7V1FAJ9      T-FSVS--KE-P-----GVSNYLMGVV---NFNE--IVQE-T-NVP------NLYLASCG
A0A3N2LCI3      A-YMGS--PA-K-----GLADYLGGAV---SEVDTLIVKT-P-ECQ------NMQVLPIG
A0A6H9Q899      S-YIDS--PD-K-----GLSDYLGGRI---DKLDEIIVPD-P-RHK------SMDILPVG
A0A3D4CJE1      G-FNVE--ND-R-----GMSTLLIGND---SLNN--CIKH-S-ALK------GLDFITAG
A0A7C7LI79      G-FNFE--NK-K-----GISTILSNKD---RIED--CIQS-S-TLK------NLDVITAG
A0A4Q5ZQ60      A-FEAE--NI-R-----GMSTILIEKH---SVQE--CIQH-S-RLS------NLDFISAG
A0A519Q885      A-FGAE--NI-Q-----GVSTILINRH---TVAE--CIQH-T-SIE------SLDFISAG
A0A519TAP8      A-FDAD--NV-R-----GISTILIERH---TLEE--CIQH-T-SIE------SLDFISAG
A0A848Y4B8      K-LGVP--RE-P-----GLVQLLFQDE---PFNP--EVYR-T-VVD------DLYVIPAG
A0A7Y4V8Y1      SMLALD--PS-K-----GISTTLIKKT---TWAE--CIQS-T-GLE------NLDFLPAG
A0A5Q4EKA0      G-FNVE--NI-N-----GVSTILSNID---TIDD--CIQP-S-RVK------NLDFITAG
A0A519SYE7      A-FGAE--NV-R-----GISTILIERH---TVAE--CIQH-T-NIE------SLDFISAG
A0A7C7CFR2      G-FNYD--NE-H-----GISTILSGKD---KLED--CINT-S-TIP------NMDVITAG
A0A7W1G0I5      S-LN--VNNE-L-----GMSSFLNGKA---KMEDI--IVN-T-EIP------NLDFIPAG
A0A2T4XEQ1      T-LG--ESQT-P-----GILELLFDGV---HFDDV--IRE-T-AYP------GIHCLTTG
A0A2K8ZAP1      S-LH--IENK-L-----GLSNYLTGEA---DLDNL--LHPII-GHE------NYYIITAG
A0A3D3LSK1      V-FE--FDRF-P-----GLSDFLFHHV---NFEDI--VRD-S-GFD------NLSVITAG
A0A496L711      N-LSGMVKNK-L-----GFVNYMIGDC---SLNEA--IES-T-PY-------GFDFLKAG
A0A348PT57      G-FN--STNE-Y-----GMSTYLSNRD---NLKDI--IRK-S-ELD------GLHFITAG
A0A847AMH6      N-FG--IDSN-R-----GVVSYILGDH---ELDEV--IVP-L-KHP------NISIIPSG
A0A7C3PTI0      G-FN--VPNL-K-----GMSTLLIGKD---QVEDC--IQH-S-SLE------NLHFITAG
A0A7V1FAS7      L-FG--VQKD-V-----GLTNYLVGNA---ALEDV--IRS-T-AVD------NLYLMTSG
A0A7V0M115      T-FS--VSKE-P-----GVSNYLMGVV---NFNEI--VQE-T-NVP------NLYLASCG
A0A7C1IBE4      L-FG--LKHA-R-----GLTEYLRDGD---NISDM--IYA-T-GLP------KLSIIPSG
A0A3D5KRM7      H-LG--LNCK-F-----GLIDYLSGVT---SLEQI--LIH-P-KIE------NLVLLPGK
A0A831LDA6      E-FE--LESD-E-----GVVNYIIGR----SNLNDITF-K-T-KHP------FLKFIPAG
A0A833B0I1      Y-ID---SPD-K-----GLSDYLGGRI---DNLDEIIVPD-P-KHK------SMDILPVG
A0A1V5S5I3      Y-LG--SRHK-------GLSDYLGKRE---NNLDGLIQEN-P-DIP------GFFLLPAG
R7JFY1          Q-AG--YRGE-------GITNYLSGKV---TDVTSLICQD-E-LVP------GLDVIHAG
A0A2M7VVW6      G-FG--VKND-K-----GMSTILI-DK---DQIKECIHHS---ELT------NLDFITSG
A0A413V760      I-FS--NSSN-RM----GLTHYLSGST---DKLDDIIGRS-E-EYD------KLDVIFSG
A0A3M1NUH2      L-FG--RELG-P-----GLAHFLVQEP---RFDEE--LVA-T-PID------NLWIIPAG
A0A2T2TDL4      V-FD--VSRT-P-----GITEALQNDL---DEHA---MKR-P-LID------NLCVLPAG
A0A359ATS6      Y-VD--TPKI-------GLSDYLGKRI---DTPEEIIVVD-K-KHP------TLHILPVG
A0A1V6HYH8      T-FN--NLND-F-----GLSNYLLGEC---NIEQC--IKG-T-EIN------NLFYFPAG
A0A7X7LGP1      G-FN--VENQ-K-----GVSTILSGID---NVESC--IQS-S-RVR------NLDFITAG
A0A838FHH6      A-FN--VDNH-T-----GVSTLLIGKH---NLNDC--IRH-S-EWE------NLDFITSG
A0A7Y4VJX2      H-FA--TFDH-SK----GISTVLIKKN---TWQEC--VQQ-T-ELE------NLYFLPSG
A0A3D1AEJ6      G-VD--THKN-IEGYDIGLTSYLSKIV---TKVESLIIQD-Q-DYP------NIDIIRSG
A0A7K3KYQ2      Y-MG--SPAR-------GLADYLGGAV---SEVDTLIVKT-P-ECQ------NMQVLPIG
A0A2E0MDX6      G-FN--VQNT-I-----GMSTLLIGQS---SLEDC--IQK-S-HLE------NLHFITAG
A0A2M7KCE1      C-FN--TDNS-K-----GLSTILIGKN---KVHDC--IKK-S-KIA------NLDYITAG
A0A523GUD4      I-FK--VDKE-P-----GVVDAVTNQI---SFQEL--IKD-S-GFP------NLKIITSG
A0A7V5RHV9      L-FG--VAKE-D-----GVADVLMGKK---RLDAC--FKQ-S-PLE------NLKILTSG
A0A641X2Z6      L-FK--LTN--K-----GLSNCISASE---EVREV--IQK-T-GIE------NLELLASG
A0A6L8U2P8      K-LK--EDNS-R-----GLSNYMIKKA---SIEDI--IRN-T-AIP------NLDFISAG
A0A7C6G639      R-LE--LSEN-D-----GVTNYLIGEK---SLDEL--ILK-K-EKY------NFDILLGG
A0A519PJW5      A-FD--AENV-R-----GISTILIDRH---SVAEC--VQH-T-SIE------SLDFISAG
A0A519T3R9      A-FG--AENI-K-----GVSTILIDRH---SVAEC--VQH-T-SIE------ALDFISAG
                                                                            

A0A7X8GFH1      PPPPNPAELANSENFDMLIAELKNEYD--VIIIDTPPIGIVSDAIFSFKRADLRIYVTRA
A0A7C7CKY6      PIPINPSELIISEKMDELLVYLKSSYD--MIVIDNPPVGIVTDGISSIQKADYPIYVVKA
A0A1G1TG88      PTPPNPSELILSPRFDQMLNELYESYD--VVMIDTPPVGLVTDGILIMRRADIPIYIVRA
A0A661XXA6      PVPPNPSELILREAFDEILEKLRGLYD--VILLDTPPIGIVTDGLLAMQKADLPIYILRA
A0A519SD85      PLPINPSELLENEKIDVLINSLKRMYD--IIIFDSAPVGIVTDSTPILKKADINLFILRC
A0A3M1TXY5      NPSNNPTDLISNSRMKELVEACMDEYD--HIIFDTPPIGLVSDYLILMHLTDYNIYVVRH
A0A7T9KM12      PVPPNPLELFESPRLAELVQQLRSRYD--QVIIDASPMGVVSEFKVLVHQLDITLYVVRQ
A0A2E0VQ27      QYDDSLEGKVFSAKALDIIHDLRWHFD--MVIVDVAPIGLFDDSIVLMRKSTANLFLIRK
A0A7Y7TYP1      PVPPNPSELLALDRTKELIFELRDQYD--YIIIDTPPLAQVTDGYLLIDYADIKVIVARY
R6U429          SLPPNPAELLVSEKFDKMMDELSARYD--YIFMDCPPVDIVADTSIIAKHADYTVFVIRA
A0A5C8AF42      PIPPNPSELLLSDRFKEIVEELKQTYD--VIIIDNPPIGLVSDGIKNLTEADIPIYVFKS
A0A7Y5SYP1      TIPVSPVPLISSEEFMSHINKFRAQYD--YIIMDAPPSLSVGDVYIYAEHADGLIYVSGA
A0A7V1N701      SSTPNPADLISSEKMRRFIQRSTELYD--IVIFDTPPITFAVDARLLANRTQGLILVIQN
A0A7V2NIA8      SRTPSPSDLLASESMNRFLARAKQEYD--TIILDAPPIHVAIDAKILTSKSDGLVLVALM
A0A239K409      AIPVNPAELMMSNRVEQLFEELQKKFD--YILIDTAPVGQVSDAFSLSKYVDLTVCLVRY
A0A1M3DPL8      TVPPNAGELIRSDNLKDMFDELRKRYE--YIIVDTSPIGVVADAYSFAALSDINLFVIRS
A0A1V5F519      TVPPNPAELIRSEKIIEMMGELRKRYD--YIILDSSPIGLVTDSFSLASLADVNLLVVRN
A0A2G6R1T9      TVPPNPGELIRSEKLKGMLKELRTRYE--YIIIDTSPI-------------------VRN
A0A350V3E4      TIPTNPAELIASKHMQTFLNMMKPKYD--YILIDSPPLATVTDAELLSSYVDGTVVVSLA
A0A6J4K208      PLPASPLNLLGTPRMEALLEKVRQEYD--YVILDTPPLGLVSDFLVLLKYTDFNMYIVRH
A0A2W4RDE8      PIPPNPLDLIGTPRMAELLNELKQSYH--TIIIDSPPIGFVSEYIILMKYTDANIYVVRS
A0A212J9Z9      TLPPNPSELIKTAKTKQVLEHLKEMYD--YVIIDCSPVGLVSDAYILSEIADTTLFVVRR
F5IV23          TLPPNPSELIKTAKTKQVLEHLKEMYD--YVIIDCSPVGLVSDAYILSEIADTTLFVVRR
A0A1M5DFS8      TLPPNPSELIKTKKTKDLIEYLKTKYD--YVVVDCSPIGLVSDAYILSKYVDTSLFVVRR
A0A4Y8KZS5      TLPPNPSELIKTKKTRDLIEYLKTRYD--YVIVDCSPIGLVSDAYILSKYVDTTLFVVRR
A0A2V3PNY7      TLPPNPSELIKTKKTKDLLDHLKSKYD--YVIVDCSPIGLVSDAYILSKYVDTTLFVVRR
A0A6G7X5K8      TLPPNPSELIKTKKTKDLIDYLKTKYD--YVIVDCSPIGLVSDAYILSKYVDTTLFVVRR
A0A840CJ33      TLPPNPSELIKTAKTKELIDHLKEIYD--YVVIDCSPVGLVSDAYILSEYVDTTLFVIRR
F8X2T0          TLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLVSDAYILSSMADTTLFVVRR
A0A1M3LAG1      TLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLVSDAYILSSMADTTLFVVRR
A0A212K6G4      TLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLVSDAYILSSMADTTLFVVRR
A0A4Y9IPG7      TLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLVSDAYILSSMADTTLFVVRR
A0A0L8VEV2      PIPPNPSELLENGKFEELIERCRDMFD--YIVFDNPPLSLVSDGIVIGQKVDINLFVTRQ
A0A1I2A9Z9      PIPPNPSELLENGKFEELIDRCRNIFD--YIVFDNPPLSIVSDGIIIGQKVDINLFVTRQ
A0A848XXC6      EPAETPEALWGPEQAERLLTGLRSAFD--LVIIDAPPGLVAADAAMLAPHCDAALLVASA
A0A2P8CDS1      SFPPNPGELLADKKLKELIELLKEEYD--VIVIDSSPL-LVADLFQYSHLCNAYLYVSRQ
A0A660LQT8      IMPPNPTELLYAERMDQLFTELKERYD--YIFLDCPPVEIVADAAIISRHADLTLFVVRA
A0A3D0FMX4      SIPPNPGELIRSDQVVELLEELRSEYD--YIVIDSSPIGLVTDAYALIERSDITLFVVRY
A0A7V6G854      TVPPNPGDLIRSEELKQLLSQLKTMYD--YIIFDTSPLGLVADAYTIAQMADANLIIVRS
A0A1M3MEI8      TIPPNAGELIRSEKLRTLFAKLKEYYD--YIIVDTSPIGVVADAYSFADLSDINLFIVRS
A0A1J5HQM0      TVPPNAGELIRSEKLVEMFQELRNRYE--FIVVDTSPIGIVADAYAIAHLSDINIFVARS
E4T131          SIPPNPGELIRSEKLGKMFEELRTRYD--FIIVDSSPIGMVTDAYSLAQHSDVNLFVVRN
A0A653AC35      TVPPNPGELIRSDKLREMFKELESRYD--YVIVDTSPIGLVADAYSLAPLMDANIFVVRS
A0A847LA02      TTPPNPGELIRSEKLRDMFLELREKYS--FIIVDTSPIGLVADSYSLAPMMDANLLIARS
A0A389LWV6      TIPPNPSELINSEMTKKLLSFLSKEYE--YIILDCSPVGLVSDAHFLAKLADVVLYVVRN
A0A1G9B1T9      KSDGHPGEILLSERLPQLINKLKMEFK--FVVLDTPPVKIVTDALVLSAYSDINILVARR
A0A350PNH9      TMPPNPTELLFTDRLEKMIRQMRGEYD--YVFIDCPPVEIVADTQIIEKLADRTIFVVRS
A0A354LNT9      TMPPNPTELLFTDRLEKMIRQMRGEYD--YVFIDCPPVEIVADTQIIEKLADRTIFVVRS
A0A161LWY6      TIPPNPGEMIRSPKLLELINELKMRYH--YVIIDTSPVGIVSDAYPLAPISDCVIYITRS
A0A6I3N9U6      TIPPNPGEMIRSPKMLELIKELKSRYH--YVIIDTSPVGIVSDAYPLAPISDCVIYITRS
A0A353WYK7      PIPPNPSELIHTGSFDKMIGDLKSKYD--VVIIDTPPVGLVTDGILALKKSDIALFVVRS
A0A2W7RD29      PYPPNPSELIANKEIIKLLIKMKDQFD--IIILDTPPLGIVSDSMSLFPLVDVSLLAFKC
A0A3N2NDY8      HRPPNPSELLDNGRIGQFLDEARKEYD--YIFVDCPPTDVVVDTQIVEKYVDRTIFVVRA
D7JEV9          VIPPNPGEFVRSHKLLEMLAELQSMYD--YIIIDSSPLGLVADAYALFSVVDIKLLVVRS
A0A553GA49      HLPPNPSELVESDKTLEMLAELKTRYD--FIILDAGPTSVTAESLVLGKMADLILVVMRV
A0A7V5GTN5      AKANNPADLLSSHKMRQFMDEISPLFE--IILFDTPPVTPCMDSRNLANLVGGMIYIVRA
A0A497D6F6      PIPSNPAELLIDERLEKLMDKLKSTYD--MIIVDTSPVGVVADTLQITSQFDIIIFVVRQ
F4KR18          PFIPNVSEQLTEQQLSVLFAYLKSKYD--VIIIDSSPIGVVSDGMLLNNYVDNTLFVVRS
B5CTK0          AVPPNPAELLLSERLDQMIEELRTRYD--YIIVDNVPAGMIADAAIVNRIADWTLYIVRA
A0A5M4AAB9      SIPPNPGEMLADIQLMELTALLKQEYE--TIIIDSSPL-LVADVFQFSNLWDTLLFVTRQ
A0A5R9QZP0      PTLPNAAELIEAGKLDSLITHVQNDFN--YVIIDSTPTGLVSDAVALMNYASHILMVCRN
A0A7X6SRJ5      PVLPNSSELIEAGVLDELMDYLKNKFE--YVILDATPTGLVADAIPLIKYASHILLVCRN
A0A3D3HL11      PILPNSSELIEAGVLDSLIEELKQQFD--YVIIDSTPAGLVADATLMIKYASYILLVCRN
A0A6L8U6G9      PILPNSSELIESGVLDELIEELKGNFD--YVIIDSTPAGLVADASLMVKYASFILLVCRN
A0A6L8UH35      PVIPNPSEMMELGVLDGLIGELKSRFD--YIIIDTTPVGIVADAILMMKYASKVLMVMRN
A0A7X9F2J5      PVIPNPSEMMELGVLDGLISELKTRYD--YIIIDTTPVGIVADATLMMKYASKVLMVMRN
A0A352ME00      PVIPNPSELMESGILDNLINYLKTKYD--YIIIDTTPVGIVADAILMMKYASKVLMVIRN
A0A7X8CRA6      PVIPNPSELIESGVMDNLINYLKTKYD--YIVIDTTPVGIVADAILMMKYASKVLMVIRN
A0A1F3D6P8      PLLPNPSELIESGVLDELMNFLKKEYD--YIIVDTSPVGLVADATQLIRYATHILLVTRI
A0A356Z058      PLLPNPSELIESGVLDELMNFLKKEYD--YIIVDTSPVGLVADATQLIRYATHILLVTRI
A0A7X8FHL3      PVIPNPSELMESGVLDHLINQLKTQYD--YIVIDTTPVGIVADAILMMKYASKVLMVIRN
A0A3D1BT36      PVLPNSSELIEAGALDKLIQYLEDNYE--YIIIDTTPSGMVADAAQLIKYSSINLLVCRN
A0A7X7CXW9      PILPNSSELIEAGVLDELIEELKQQFD--YVIIDSTPAGLVADATLMIKYASFILLVCRN
A0A4R6H3B7      PIPPNPSELLENGKFEELIDRCRNIFD--YIVFDNPPLSIVSDGIIIGQKVDINLFVTRQ
A0A229I3A5      TIPPNPTELLFTPLLEQMIKTMREEYD--YVFIDCPPIEVVADTPIYEQFADRTIFVVRA
A0A3R6HJB3      TIPPNPTELLFTPLLEQMIKTMREEYD--YVFIDCPPIEVVADTPIYEQFADRTIFVVRA
R6NN15          TIPPNPTELLAGERLQTLLADFRTRYD--YILIDCPPIELVADTHIIGKYADRTIFVVRA
A0A2W7QSQ0      KSIENASEIITSQKIIKLINSLKSSYD--HIIIDTSPIGLVADAYSLSEIVDLVVYVVRM
A0A841MQL4      KTIENASEIINKNIIKKLIDYLKIHYD--HVIIDTSPIGLVSDAYSLSDITDVVVFVVRM
A0A3P1Z8V4      TIPPNVSELLMSERFEQMIATLRQHYD--FILLDTTPCFAVADAGIVSRVAEVTLFVMRV
A0A1M6MYT6      PHPPNPLQMLTDKNLSGLIDQLKKQYD--VVIVDTPPVGMVADFFLLRDMFDAAVFIVRH
A0A1V5S1J9      VVPPNPGELIKSDNMNNLISILKETYD--YIVFDTSPIGLVTDAYGIIESVDIILYAVRA
A0A7X8JMH1      VIPPNPGELMKSQKMKELIKELKEIYD--FIIFDAPPIGLVADSYAIINEMDLNIYVVRC
A0A3D5KRY6      PVLPNSSELLSTNLIKDFIQAAKEQFD--YIIFDNAPIGVVFDGSLIGRHADINLILLRL
R7F6L5          NLPPNPSELLYSERLKTLLSTMEQEYD--FIFFDCPPIEVVADSRILNEYVDTTIFVIRA
A0A7C5MRV2      PIPPNPAELIQSNRMTELLDELRKQYD--YILIDTPPIGLVTDGTTILKLSDIALYVIRA
A0A0A2EYC8      VIPPNPGEFVRRPQLLEMINLLKEMYD--YVVIDSSPLGLVADAYALFSTVDIKLLIVRS
A0A2G6H6Y4      VMPPNPGEFVRSPKLEQMITELKSMYD--YIIIDTSPLGLVTDSYALFPMVDVKLLVVRS
C9LKL0          MLPPNPSELLMSSRLEALVEEARELYD--FIIIDTTPILAVSDASIVDRVADVTLFVIRV
A0A3D0QPV7      PIPPNPAELIINGKLDSILEELKRIYD--IVIVDLPPVGLVTDGIPIVQMADYPIYVFRA
A0A496KT23      VIPPNPAELLSTERFAEMIKAAREEYD--IIFLDCPPVEIVADAEIINPHADLTLFIVRA
L1M9T3          VIPPNPAELLSTSRFRDLIETVRQEYD--LIFIDCPPVEIVADAEIINPVADLTLFVVRA
A0A2M6GH67      PTPPNPSELILNPKFDEMLEELRQLYD--VIIVDTPPIGIVTDGTLVMRKADIPIYIVRA
A0A7K1TE30      PTPPNPSELILSPRFDQMLEELYRNYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRA
A0A7D4BE70      PTPPNPSELILNPRFDQMLEELYLTYD--VIMIDTPPVGLVTDGILIMRKADVPIYIVRA
A0A142HHS5      PTPPNPSELILNPRFDLMIQELYRTYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRA
A0A7D4C435      PTPPNPSELILHPRFDQMLEELRKIYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRA
A0A3C0I8F1      PIPPNPSELILRPICDEFIKQLTLSYD--VIILDTPPIGLVTDGVLLMQKAEVPIYIFKA
R5JJI4          PVPPNPAELLLSERFDRLITELRKRYD--YIIVDNVPAGMVADASIVNRVADLTIFVVRS
A0A848IUK4      PTPPNPSELLMGESFKEVIRKLRSQFD--VVILDTPPVGIVSDGVMAMKLSDLSVYVVRA
A0A136LSC7      PHPPNPSELLLNGEFSDFLEELRATYD--YVVIDTPPVGLVTDGVMAMKRSDLSIYVFRA
A0A5C7N8Q5      PHPPNPSELLLNGEFSDFLEELRANYD--YIVIDTPPVGLVTDGVMAMKRSDLSIYVFRA
A0A355BP94      PHPPNPSELLLSKAFEDLLAELRTRYD--YIVIDTPPVGLVTDGIMAMKRADLSIYVVRA
A0A7Y5D1K7      PHPPNPSELLLNGEFEDLLTELRGIYD--YIVIDTPPVGLVTDGIMAMKRADLSIYVVRA
A0A3D2HF71      PIPPNPAELIESESMKEFIDKAKKDFE--FIIIDTPPAAVVTDALLLADLADFYIFVVRQ
A0A0A2DQN2      TIAPNPTELLLSKRLDSLIDELGRRYD--YVIMDNVPFGVVADASIVNRAADLTLFIIRA
A0A0A2F2N5      SSAPNPAELLMSERLDALMDELSARYD--YVLIDGVPFGIVADATIVNRVVDLTLFILRS
L1NGW4          AIPPNPAELLLGHRLDDLAQELSDRFD--FVIFDNVPFGSVADAAIANRIADLTIFVLRA
Z4WRA0          AIPPNPAELLLGHRLDDLAQELSDRFD--FVIFDNVPFGSVADAAIANRIADLTIFVLRA
U2K8K9          AVPPNPAELLLGERLDELADKLSEQFD--FVVFDNVPFGSVADAAIANRVADLTIFILRA
A0A069ZM60      AVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSVADAAIANRIADLTIFVLRA
J6GV98          AVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSVADAAIANRIADLTIFVLRA
A0A134B4F8      AVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSVADAAIANRIADLTIFVLRA
A0A134B8C7      AVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSVADAAIANRIADLTIFVLRA
A0A4Z0EKR0      PIPPNPAELLLSSKFAQLIEELKENFD--YIIMDTPPVGQVADAFTFSAFADISIYLVRY
A0A521H707      PIPPNPSELILSQRMNELLDYLKSKYD--IIIIDTPPVGIVTDGVEIIQNADYPIYIIRA
A0A7T9D909      PIPPNPSELIISDIMGQLLDRLKGMYD--IILIDNPPVGLVTDGLAMIQKADYPIYIFRS
A0A1M6B6D5      PIPPNPSELLLGERLDQLLGLLKDQYD--YIILDSPPMGLVSDALVLTKHVDATLYMVRQ
A0A451FS66      PTPPNPSELLIGERMDEFMERLKERYD--YIILDSPPIGLVSDAMEIIKYADATLYMVRH
A0A2E3GN39      PIPPNPSELIGGEPFINFIDEVKTSFD--VVIFDTPPIGLVTDSIPVISTVNNPIYVLRA
A0A3D1MEL0      PIPPNPSELIGGDSFVNFLDEVKTSFE--VVIFDTPPIGLVTDAIPVISGTNNPIYVLRA
A0A519UDD1      PIPPNPAELIMSPKLAYLIEELKKSFD--YILIDTPPVGQVSDAFALKPLIDLTIYVVRY
A0A7Y2ACP6      PIAPNPSELMISSRMDEIILEAKEKYD--MVVIDNPPVGLVTDGIASIKIADYPIYIFRA
A0A2A4N9A6      PIPPNPAELIINQRTEELLAVLRKQYD--LIVIDTPPIGIVSDGIDIIRKADYPLYIFRA
A0A6C0GGI1      PIPPNPVEMIELKEMRDLIAKLKAEYD--YVIVDTPPLSFVAEYMILKEYLDANIFVVRA
A0A368D1N7      PIPPNPSELIGGDSFVNFLDEVKTLFE--VVIFDTPPIGLVTDAIPVISRANNPIYVLRA
A0A3B8TU58      PIPPNPSELIGGDSFVNFIEEIKTSFD--VLVFDTPPIGLVTDSIPVISKVNNPIYVMRA
A0A1T5IIR6      AVPPNPTELLGRPRLEELIEALRQKYD--YILLDGVPIQMLADPIVLNRVVDINLFILRS
A0A3E0QD27      PIPPNPSELILSRKMVELVEYLKSKYD--VVIIDTPPVGIVTDGVDVIQNADYPIYIIRA
A0A0K2HKS3      PIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
B6W3W8          PIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
A0A0M1W1I6      PIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
A0A4R4GHU2      PIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
I8WPR6          PIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
A0A076IRY8      PIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
A0A3A6AD54      PIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
A0A8B3EPF6      PIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
I8WPP8          PIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
A0A372Y7D2      PIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
A0A7K3KFI2      PIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
A0A3E4JJC9      PIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
A0A3E4WDQ0      PIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
A0A414H9P2      PIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
A0A7K0JKU9      PIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
C3R5A8          PIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
A0A6N8DCX3      TMPPNPTELLSGEYMRELVTEMRARYD--YIFIDCPPVDIVADTQILEKVTDRTFFVVRA
F0R0C9          TLPPNPTELLAEDRFGKLVAGLRDRYD--YIFIDCPPIEIVADTQIIEKVADRTLFIVRA
A0A1C5XJA7      TSAPNPAELLMDSRLDSMMEELRKRYD--YIVVDNVPVGLVADATIANRIADITIFVVRA
A0A285T4L1      TVAPNPAELLMDSRLDTMMAELRKRYD--YVIVDNVPVGIVADATISNRISDLTIFVVRA
R7CUW4          PVAPNPAELLLDSRLDTLIAELRTRYD--YIIVDNVPVGIVADATIANRIADLTVFVVRS
A0A416GGJ1      PVAPNPAELLLENRLDELIEELKTMYD--YVIVDNVPIGIIADASIANRVADLTLFVVRA
D1JY72          PIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV
D7J4K6          TVAPNPAELLMDERLDAMVEELRQRYD--YIIVDNVPVGIVADATITNRISDLTIFVVRA
Q8ABP9          TVAPNPAELLMDERLDAMVEELRQRYD--YIIVDNVPVGIVADATITNRISDLTIFVVRA
D6D2Z5          TVAPNPAELLMDERLDTMVEELRQRYD--YIIVDNVPVGIVADATITNRISDLTIFVVRA
A0A1T3EDR4      AIAPNPVELLLSKHLDELIEALKLKYD--YVIVDGVPMGIVADANIIDRISELTLFIIRE
A0A6N8KXI9      VPAPNPVELLLSKRLDDLFGQLREVYD--YIVVDSVPIEIVADGYISNRVTDLTLFVIRS
A0A174SDD8      VIAPNPTELLLSKRLDELVDKLRERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV
A0A1H7RFH3      VIAPNPTELLLSKRLDKLVAELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV
A0A139L1N2      VIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV
A0A174TVL8      VIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV
A0A1H8BJR6      VIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV
R9H6G0          VIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV
A0A412GR09      VIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV
A0A7J5JXN6      VIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV
R6D982          VIAPNPAELLLSGRLDELIGHLRERYD--YIIVDGVPVGMVADVSISNRISDVTLFIVRA
A0A1F0I8C4      VIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVVADASVVNRISDLTLFIVRV
A0A3A5RIJ2      VIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVVADASVVNRISDLTLFIVRV
A0A515IZJ5      VIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVVADASVVNRISDLTLFIVRV
A0A7J4Y2H6      VIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVVADASVVNRISDLTLFIVRV
A0A4R6WE41      VLAPNPVELLLSQRLDELIGELKLRYD--YIIVDGVPVAIVADGSIISRISDLTLFVIRA
A0A2T5RP38      AIAPNPVELLLGKRLDELITKLKERYD--YVIIDGVPVGIVADASIIDRVADLTLFIIRI
A0A1A6CF06      AIAPNPVELLLSKRLDELINELKNRYD--YIIIDGVPTGVVADASIIDRVADLTLFIIRI
A0A1T3D6S8      AIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADASIIDRVADLTLFIIRI
A0A8B4GMS2      AIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVANASIIDRVADLTLFIIRI
A0A7Z7LUP7      AIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADASIIDRVADLTLFIIRI
A0A0B8T471      VIAPNPVELLLSKRLDVLIAQLKERYR--YIVVDNVPIDLVADAAVVNRISELTVFVVRA
A0A4R7D2K0      VIAPNPVELLLSKRLDVLITKLKERYR--YIVVDNVPIDLVADAAVVNRISELTVFVVRA
A0A7T9S3V1      IVAPNPVELLLSKRLDDLVAELRNRYD--YIVVDGVPAGLVADASIVNRISDLTIFMIRA
A0A7T9LVI2      MVAPNPVELLLGKRLDELIADLRNRYD--YIIVDGVPVGLVADASIVNRISDLTIFMVRV
C2FUH6          MVAPNPVELLLGKRLDELIADLRNRYD--YIIVDGVPVGLVADASIVNRISDLTIFMVRV
A0A1V3N3U3      LIAPNPVELLLSARLDELIAELRKRYD--YIVVDGVPLGIVADASIVDRISDLTLFMIRA
A0A1P8E011      MEAPNPVELLLSKRLDQLISDLRNRYD--YIIIDGVPTGIVADATVVDRVSDLTLFVIRA
A0A7T9S8K4      MEAPNPVELLLSKRLDQLISDLRNRYD--YIIIDGVPTGIVADATVVDRVSDLTLFVIRA
A0A2X2J8S4      VIAPNPVELLHSDRLDNLIAELKKQYD--YIIIDSVPVEIIADAYITDRVSELTIFVIRS
A0A3C0S618      VIAPNPVELLHSDRLDNLIAELKKQYD--YIIIDSVPVEIIADAYITDRVSELTIFVIRS
A0A4P7DRF9      VIAPNPVELLLSERLDNLFAELKNRYD--YIIVDNVPLGIVADAKIVNRITDVTLFVVRA
A0A239XXC4      VIAPNPVELLLSERLDQLIAELKERYD--YIIVDNVPLGIVADADIVNRITDVTIFVVRA
A0A4U9K473      VIAPNPVELLLSERLDNLIAELKERYD--YIIVDNVPLGIVADADIVNRITDVTIFVVRA
A0A081PBV5      VIAPNPVELLLSTRLDELIIELKKRYD--YIIVDNVPVNLVADASIVDRISELTIFVVRS
A0A1I2AN85      VIAPNPVELLLSTRLDELIIELKKRYD--YIIVDNVPVNLVADASIVDRISELTIFVVRS
A0A4U0GMP3      TIAPNPVELLLGGRLDELIAALKSNYD--YVIVDNVPVALVADAAIVDRISELTLFVVRA
A0A0D5BSQ0      AIAPNPVELLLSKRLDELINELKERYD--YVIIDGVPVGIVADASIIDRVADLTLFIIRV
A0A1T3F6P5      AIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADASIIDRVADLTLFIIRI
A0A853VUQ0      AIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADASIIDRVADLTLFIIRI
A0A7X0MJ00      VIAPNPVELLLSERLDLLINSLKQQYD--YIVVDGVPLGIVADSSIVNRISDTTIFVIRA
A0A841JHZ0      VIATNPVELLLSERLDILVNTLKERYD--YIVVDGVPFGIVADSSIVNRISDTTIFVIRA
A0A1H6CKR6      VIAPNPVELLLSERLDRLFVELKERYD--YIIVDNVPLGIVADADIVNRITDVTIFVVRA
A0A7W3MGA7      VIAPNPVELLLSDRLDTLINELKERYD--YIIVDNVPLGIVADADIVNRITDVTIFVVRA
A0A3M1Y2F5      PHLPNSIDLLDTGAFEELIEELPLHYQ--YVIVDLPPIMQASDYMLVEKWLDFTAFVVRH
A0A7V1ALN2      GKVTNPMAVLKSAKLSYFLNMLRNVYD--YVIIDAPPLISFSDPLLLGKHTDGVILVIEA
A0A3D4RLG4      TIPPNPGELIRTDKLVSLLQELRKQYD--FIIIDTSPIGQVPDAFALIEQTDLTLYVIRC
A0A2T2UAJ4      DTVPNPAELLGSNRMKEFVEALEAKFD--YVLIDTPPALLFSDVLGLAPRCDGTLLVVAA
A0A6I0DZQ5      TIPPNAGELIRSEKLRTLFAKLKEYYD--YIIVDTSPIGVVADAYSFADLSDINLFIVRS
A0A1H6Z2F8      MQS--MDDTMLSPKIAGLIPALKAGYD--YVLLDSPPVGLVADARLLGPYADMTLYIVRQ
A0A2P8G5K0      QQSPGTGEIILSPKVADLISTLKIRYD--YVLLDSPPVGLVADARLLGAHADMTLYIVRQ
R5DEG6          PVPPNPAELLLSDRLEALIAELRERYD--YIILDNVPAGVVADAVIVNRVADLTIYVVRA
A0A4Q3SEI4      YSDVNPTELLLNGDINGLLTKLEATFD--FVLIDTCPVDPVTDAYILSESCDLTVFVVRH
A0A836SQI2      PIPPNPSELVVRPEMDIILSELKKHYD--VIIMDTPPVGLVADAFVNFKKADYPIYVLRA
A0A7V1FAJ9      AMVPNPSELLGSMRLKRFIDEAKRRFD--FIMFDTPPLNAATDSVVLGTQVDGLLIITRA
A0A3N2LCI3      SIPPNPTELLESPRFGELIGELKSRFD--YVIIDCPPIEVVADAQIIDKFADRTFFVIRA
A0A6H9Q899      TIPPNPTELLFDERLKQAIDAVRERYD--YVLIDCPPIELVADTQIIEKLGDRTIFVVRA
A0A3D4CJE1      PIPPNPSELIINGNLTEIIEELKQTYD--LVIIDNPPIGLVTDALYTISMADYPIYVLRA
A0A7C7LI79      PIPPNPSELIISKKMDELIEFLKTKYD--ILVIDNPPVGIVTDGISIIQNADYPIYVFRA
A0A4Q5ZQ60      PTPPNPSELILNDKFDLVLQELKEIYD--VILIDSPPVGLVTDGILIMRKADVPLYIVRA
A0A519Q885      PTPPNPSELILSPRFDQMLQELHRHYD--VIMIDTPPVGLVTDGILIMRKADIPIYIVRA
A0A519TAP8      PTPPNPSELILNPRFDQMLAELHRSYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRA
A0A848Y4B8      AKAPNPSELLGSKAMRDLVATFREEFD--VIIFDAPPVLAATDAVLLSTQCDATVLVASA
A0A7Y4V8Y1      PHPPNPSELLLNGEFTNLLEELKEAYD--FIVIDTPPVGLVTDGIMAMKRADLSIYVLRA
A0A5Q4EKA0      PVPPNPSELILTPRMDEMINYLKSKYD--YVIVDNPPVGIVTDGMKSILMADYPIYIFKA
A0A519SYE7      PTPPNPSELILSPHFDQMLAELHRTYD--VILIDTPPVGLVTDGILIMRKADVPIYIARA
A0A7C7CFR2      PIPPNPSEMILSQQMQDLIEKLKLKYD--MIVIDNPPVGIVTDGISIIQQADYPIYVFRA
A0A7W1G0I5      PIPFNPAELISSERTEDLLTELGNKYD--YIIIDTPPLGLVTEAFLLMKYADLKLFVVRE
A0A2T4XEQ1      RRSPNPASVAQSDKLKSIVEGVKDQYD--YVVIDSAPYGIITDAAPMMKMADGIVVSVRF
A0A2K8ZAP1      SLPLNPSELLSSPRLANLLQELKERFE--YILVDSPPIGLVTDSQVIAPYADATIFVVRH
A0A3D3LSK1      TIPPNPSEMLGSLQMKKFLELVESKYD--IVILDSPPLISVTDSEILYNLTDGTVLVAQA
A0A496L711      VIPPNPGEFVRSHKLLEMLAELQSMYD--YIIIDSSPLGLVADAYALFSVVDIKLLVVRS
A0A348PT57      PIPPNPSELIISGNLTKGLDELKKIYD--IIIIDNPPVGLVTDGIASLKLADYPIYIFRN
A0A847AMH6      PLPPNPGEMLMDPKLIAMMEELKKRFE--VIIIDSAPVGHVNDLFQVTDKIDSIIFVIRD
A0A7C3PTI0      PIPPNPSELIISKKMDEILAHLKTQYD--VIVIDNPPVGLVTDGINIIQKADYPIYIFRA
A0A7V1FAS7      VLPPNPAELVGSKRMKALVELLSKQFD--YVLFDSPPIIAVTDAIVMAPMVDAVVLVVRS
A0A7V0M115      AMVPNPSELLGSMRLKRFIDEAKRRFD--FIMFDTPPLNAATDSVVLGTQVDGLLIITRA
A0A7C1IBE4      SPPDNPSELLSSDRMSAMLDELADMADNRLLVLDSPPFHVAAETLVLSQLVDKVVLVVRW
A0A3D5KRM7      ESKVNYSELISSPKMIEFIKETKSRYESRIIIFDVPPLFVADDALLYMSYCDAALFVVED
A0A831LDA6      PIPPNPGEMLTDEKLLELLAKLKEEYD--VIVIDSAPVGYVADLFHLHEIIDTNLFVVRH
A0A833B0I1      TIPPNPTELLFDERLKQTIDTVREQYD--YVLIDCPPVELVADTQIIEKLADRTVFVVRA
A0A1V5S5I3      TIPPNPTELLAEPMFKEAIERLRGNYD--YIFIDCPPIDIVADTQIIEKLADRTVFVVRA
R7JFY1          PVPPNPAELLQNKRLDAMIAELRTRYD--YILLDNVPAGLVADAQIVARLADLTICVIRA
A0A2M7VVW6      PIPPNPSELIISGKLDEVIAELKKEYD--LVVLDNPPIGLVSDAMEMLKKADYPIYVFKS
A0A413V760      PVPPNPAELLLSERFDRLITELRKRYD--YIIVDNVPAGMVADASIVNRVADLTIFVVRS
A0A3M1NUH2      KVVPRSSELFATRVMRDFIESLRARFD--VIILDTPPVRVATDAALLATQCDLTLVVVRA
A0A2T2TDL4      TEVENPAKVLGSSRFRDFLQRAEQYFD--HVIVDSSPVLATADGPLLSDLCETTLCVARA
A0A359ATS6      TIPPNPTELLVEERLKELINRMRSRYD--YILIDCPPIDVVADTAIIEKLADRTIFVVRA
A0A1V6HYH8      SLPEYPNELLTSSKMDELLENLKKYYD--IIILDTPPIGLISDTTKFVLLADTTVYVFRS
A0A7X7LGP1      PVPPNPSELILKPNMDEMIAYLKNNYD--FVIVDNPPVGIVTDGMKSILMADYPIYVFKA
A0A838FHH6      PLPPNPAEFIASQKTDDIIKALKEQYD--VLVVDTPPVGMVTDALQLLKRADMPVYILRA
A0A7Y4VJX2      PHPPNPSELLLNGEFTELLDELKREFD--YIVIDTPPVGLVTDGIMAMRKSDLSIYVVRA
A0A3D1AEJ6      PEPPNPAELLLSPRLDELIRELREMYD--FIVIDNVPAGMVADAMISNRVTDLTLYIIRA
A0A7K3KYQ2      SIPPNPTELLESPRFGELIGELKSRFD--YVIIDCPPIEVVADAQIIDKFADRTFFVIRA
A0A2E0MDX6      PIPPNPAELIISNKMTDVINELKNLYD--VIVIDTPPVGIVTDAFPIISKVDYPVYIVRA
A0A2M7KCE1      PIPPNPSELTAGNEILNVINELKQIYD--VIIIDTPPLGLVTDALNIFKSCDYPIYVVKA
A0A523GUD4      NLNDSPIKIFNAQNIKAFLETASSFYD--YIVVDAPPVIPVSDPLIIGKFVDNVILVAKA
A0A7V5RHV9      GIIDNPTELFNSSRMKDLFSEIKFYFD--AIIVDTPPVIPVTDSLILSTEMDGALFVLKA
A0A641X2Z6      PVAPNPSELLGSKRMEQLLEQLKPDYD--YILIDTPPIMPVTDAAVLSGKVDGLVMLVSS
A0A6L8U2P8      PVIPNPSELMESGVLDHLINQLKTQYD--YIVIDTTPVGIVADAILMMKYASKVLMVIRN
A0A7C6G639      TVPPNPGELIRSEQLKQMFLALRERYD--YIIVDTSPIGLVADAYSLAPMMDANLFVARS
A0A519PJW5      PTPPNPSELILHPRFDLMLQELYRTYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRA
A0A519T3R9      PTPPNPSELILSPRFDQMLQELYRSYD--VIMIDTPPVGLVTDGILIMRKADVPIYIVRA
                                              :..*  *                       

A0A7X8GFH1      NYSKRNFINNINYVSEQ-KKIV-N-ASIVLNAAEIVSSKYG-----------YGYK-GYR
A0A7C7CKY6      NYSKKHYLNSIDRLREE-SKIQ-N-MAVILNG---VEFGKG-----------LGQNQNLG
A0A1G1TG88      DYSRKAFIKNMNRLMRT-NNLT-R-MCTILND---AQSKGA-----------YGYGYGYG
A0A661XXA6      GYSKLSFIGNINRLMAT-GRYP-N-LSVILNN---VSNKKT----------------GFG
A0A519SD85      GVSRQEYINTPEAIKQK-LMLD-N-IYIVFND---FLPDNFF------------------
A0A3M1TXY5      NVTEVADLKLINELFET-GKIQ-N-IGLLLNG---VASLSD-------------------
A0A7T9KM12      GFTRRAMLRPVNELYRT-DKLK-R-IDLLLND---VKAGDG-------------------
A0A2E0VQ27      GTTRLRQLKPINELLDS-FQIP-N-LYLVLNG---VRQKAKK------------------
A0A7Y7TYP1      NYSKKKICSLILRDLKK-KKIE-N-ICIVLND---NRINMEQ------------------
R6U429          GLFDKRALPAVEDAYER-GVYN-H-MAVILNG---VDTTSK----------------SYG
A0A5C8AF42      HYSKRNFAFRVKELFEM-QQLN-Q-LNVILNG---VQTSKR--------------SSAYG
A0A7Y5SYP1      ELVNKRDFIRQYRTIANRFGPK-V-LGVVLNK---VRKNHL-------------------
A0A7V1N701      EKTRINTAKLSVNQVRQ-VGGR-L-IGTVINR---ISARPL-------------------
A0A7V2NIA8      EKNTMADLRSCIAQVDQ-VDGR-L-FGVVFNG---IKINKL-------------------
A0A239K409      NYTPKHEIENINDILYN-NKFK-Q-PMIVLNG---AKKFNS-------------------
A0A1M3DPL8      NKTNKQFVKTLSNQLKE-DTKS-R-FYSILND---VEIESASYSQYYSRKYVYGRSKSYG
A0A1V5F519      NKTHKDFFKNVVNQIVT-DKLS-N-FYVVFTD---VETD--------------GNYYSYK
A0A2G6R1T9      EKTNKAFFKRINEQIVS-DKFN-N-FYIVLND---INITSKAYGR-------YGYGYGYG
A0A350V3E4      SKTRLDLLVNTIDTLNK-INDT-F-IGVILNN---FDYQAT-------------------
A0A6J4K208      RLTERAGLNKINELYNS-NRLR-N-VGILING---ARALSA-------------------
A0A2W4RDE8      DYTTKYNLDRINKLYDE-RKVT-N-ISILLND---VKYSRV-------------------
A0A212J9Z9      AKTNKSFFKSVITQLKY-DGVE-D-IALVFND---VKGRE--------------------
F5IV23          AKTNKSFFKSVITQLRY-DGVE-D-IALVFND---VKGRE--------------------
A0A1M5DFS8      AKTNKAFFKSVVNQMRN-DGLD-H-VAIVFND---VKGRE--------------------
A0A4Y8KZS5      AKTNKAFFKSVVNQMRN-DGLE-H-VALVFND---VKGRE--------------------
A0A2V3PNY7      GKTNKAFFKSVVSQMRN-DGLE-H-AALVFND---VKGRE--------------------
A0A6G7X5K8      AKTNKAFFKSVVNQMRN-DGLE-H-AALVFND---VKGRE--------------------
A0A840CJ33      AKTNKSFFKSVITQLKQ-DGVG-N-IALIFND---VKGRE--------------------
F8X2T0          AKTNKAFFKSVITQLGF-DGVE-N-IALVFND---VKGRE--------------------
A0A1M3LAG1      AKTNKAFFKSVITQLGF-DGVE-N-IALVFND---VKGRE--------------------
A0A212K6G4      AKTNKAFFKSVITQLGF-DGVE-N-IALVFND---VKGRE--------------------
A0A4Y9IPG7      AKTNKAFFKSVITQLGF-DGVE-N-IALVFND---VKGRE--------------------
A0A0L8VEV2      DYSKKNEVRFIDHVNKK-KAMK-N-AGIILND---IHLSKHAHV----------------
A0A1I2A9Z9      DYSKKNEVKFIDHVHRK-KSMK-N-PGIVLND---IHVSKHAHV----------------
A0A848XXC6      DHSDVDALAQVATELAG-AGLG-Q-IGAVLNR---FNPAHS-------------------
A0A2P8CDS1      GVTPQPAIKSALQEISN-QHIR-N-VGILLND---IRINNQPLGDRY-----N-------
A0A660LQT8      HLLERSMLPEINDFYRS-NRYP-N-MVTVLNG---TLDTYK----------------SYG
A0A3D0FMX4      NKTQRNFCREVLAQMEE-DGKQ-N-IYIVFSD---LPHERSG-RYNY-----NSKSYHY-
A0A7V6G854      GKTNKNFFKNFISQINATNNLH-N-IYLVLND---IDVKKNG------------------
A0A1M3MEI8      DKTHKLFLRTLTAQLKS-DNVH-D-FYSILND---VELKSNS-YSRY-----YSRKYAYG
A0A1J5HQM0      GKTSKSHFAKISKQLKS-DNVE-A--YCILND---VMSEESR-YSRY-----YSRRYGY-
E4T131          GKTNKTFFKKLCAQLKL-DNIP-Q-LYTVLND---VLDDESK-YTKY-----KLYKYAY-
A0A653AC35      EKTNKSFFKKLNAQLKA-DNIK-N-LYLVIND---VDSQKSSYYGRY-----SNYGYGY-
A0A847LA02      GKTNKSFFKKLVEQIKS-DKLK-H-FYVILND---FDIESLP-YGRY-----TK---SY-
A0A389LWV6      EKTNRNFFKHTISEFKG-DVTSGK-MAIIYND---VDLDGN-------------YYASRN
A0A1G9B1T9      GVTSKSQLMDVEELHQN-NTLH-N-LYVVLND---VQATKG-------------------
A0A350PNH9      GLMQRSMLGDIEQFYKD-KKFK-N-MSLILNG---TKAQGGR----------YGHYYRYG
A0A354LNT9      GLMQRSMLGDIEQFYKD-KKFK-N-MSLILNG---TKAQGGR----------YGHYYRYG
A0A161LWY6      RKTNKKFFKSVINQLKT-DRMQ-H-VGVVLND---IDANTGG----------YGYNYSYQ
A0A6I3N9U6      RKTNKKFFKSVINQLKT-DRMQ-H-VGVVLND---IDAKTGG----------YGYNYSYQ
A0A353WYK7      GFSKKSFIQNIDRLVKA-HHLD-Q-SSIIFNA---NRSSKN-------------------
A0A2W7RD29      GYNNHKGIVELNKLKSN-DFIK-K-VYCILNG---VDSHYH-------------------
A0A3N2NDY8      GLLDRKALEEIDAIYRN-KRFK-Q-MSIVLNG---TEAASR---------------KSYG
D7JEV9          FKTNKMEFTDLSKRLYS-DNIE-D-IYIILND---VDKSKI-------------------
A0A553GA49      NYTLKKEFKEIIEELDG-SFGK-K-VTVVLNG---V---KVS----------RQ------
A0A7V5GTN5      ELTKLNVLEHSLSLLNR-VNVE-V-HGVIVNY---A---SFR----------YGYGYYYL
A0A497D6F6      RMTKKQVFKSAIEELQN-FNVD-K-LGVLFND---VSSRDMK----------HGYGYTLG
F4KR18          NFTKKATIAKAREIFEQ-NKLV-N-PAIIFNG---V---KKQ----------ND------
B5CTK0          GVLDRKQLPDVDALYKS-GQFT-N-MALILNG---V---DFK----------HAHKYGYG
A0A5M4AAB9      GITLKPAAKSALQEISS-QNTN-R-LGLLLND---I---SIN----------NQFDRYNN
A0A5R9QZP0      NHTIKNVFFDVLNFFKA-NRID-N-FDIVYND---L---DKK----------KS------
A0A7X6SRJ5      NHTRKDVLNDVLTMFST-NKID-N-FDIVFND---L---ALK----------GS------
A0A3D3HL11      DYTRKDVFTDVLNLFRT-NNIT-D-YDIVFND---L---NLK----------KS------
A0A6L8U6G9      EYTRKDVFTDVLNLFQT-NNIN-N-FDIVFND---L---NLK----------KS------
A0A6L8UH35      NYTRKDILVNVINNLRI-NKLN-N-YDIVYND---L---NLH----------KS------
A0A7X9F2J5      NYTRKDILVNVINNLKT-NKLN-N-YDIVYND---L---NLH----------KS------
A0A352ME00      NYTRKDIFANVINNLKS-NKLT-N-YDIVYND---L---NLH----------KS------
A0A7X8CRA6      NYTRKDIFANVLNNLKT-NKMN-N-FDIVYND---L---SLH----------KS------
A0A1F3D6P8      NYTRKDILEHVLKNFSS-NRIT-N-YDAVLNS---L---PLD----------TS------
A0A356Z058      NYTRKDILEHVLKNFSS-NRIT-N-YDAVLNS---L---PLD----------TS------
A0A7X8FHL3      NYTRKDVFANVLSNLKA-NKMT-N-FDIIYND---L---SLH----------KS------
A0A3D1BT36      NHTRKDVFNSVLNFYKT-HNIE-N-FDIIYND---V---EIK----------ES------
A0A7X7CXW9      EYTRKDVFTDVLNLFRT-NNIN-D-FDIVFND---L---NLK----------KS------
A0A4R6H3B7      DYSKKNEVKFIDHVHRK-KSMK-N-PGIVLND---IHVSKHA----------HV------
A0A229I3A5      GLMERSMLPEVNALYKE-KKFK-N-MTLILNG---TKAHGG--------------RYGSH
A0A3R6HJB3      GLMERSMLPEVNALYKE-KKFK-N-MTLILNG---TKAQGG--------------RYGSH
R6NN15          GLLERSMLPELEALYIE-HKFK-N-MTVLLNG---TEGNGS-------------YRYGYR
A0A2W7QSQ0      NYTRVDNLHALAEIIDE-NIFK-Q-NFVVLND---SNEYSG-------------------
A0A841MQL4      KYTKTENLKSLAEIVDK-KIFR-Q-NFVVIND---SNKYYG-------------------
A0A3P1Z8V4      GVQSKHGLPAVAELYRS-RKIG-N-ICLVIND---CDIKAR----------------TYG
A0A1M6MYT6      KSTPKKPLKDILEELES-HQIE-E-LGIIVNN---VYRTKSN----------RGYGYGYG
A0A1V5S1J9      EQTNKSFYKKAMSQLEA-NNVK-K-VGLIFND---VNLKKL----------------EYS
A0A7X8JMH1      ERTNKPLFKKTITQLQE-DKIP-N-VHVLFND---VNIRKL----------------EYA
A0A3D5KRY6      NFSQKSEISAINKIGHE-GILK-H-VAIILNE---IPQVEG-------------------
R7F6L5          GLFDRRMLKSIRNLYAE-RRYN-N-MCLLLNG---TSVGHN-----------YGYGYGYG
A0A7C5MRV2      DYSKKSFASNPDQLVED-HDIK-N-LYIVLNS---VSAANR----------------RYG
A0A0A2EYC8      LKTNKVEFTDLAKRLYA-DNVE-D-IYVILND---VDKSKV-------------------
A0A2G6H6Y4      FKTSKREFSELTRRLYM-DKVK-N-VYIILND---VDRSKT----------------GYG
C9LKL0          GVQVRAFLPELEKMNKD-KKYR-H-LCIALND---VDVKAK---------------YGYG
A0A3D0QPV7      NYSKKNFVQNADRLVNE-NNIQ-R-LSVVLNS---VDTDRGS----------SGYNYGYG
A0A496KT23      SLMERSYLKDIERWYAE-KKYN-N-LTLLLNG---TTDALG----------------RYG
L1M9T3          GLMERSFLNDIERWYLD-KKFH-N-LTLLLNG---TTDALG----------------RYG
A0A2M6GH67      DYSKKEFLKNINKVIKT-NKFN-K-LTVILND---AKAQGG---------------YGYG
A0A7K1TE30      NYSRKAFLKNLNRLMRN-NQFN-R-MCTILND---AQAQGA---------------HGYG
A0A7D4BE70      NYSRKSFLKNLNRLMRN-NQFT-R-MCTILND---AKAQGS---------------YGYG
A0A142HHS5      NYSRKTFLKNMNRLMRN-NQFT-R-MTTILND---AKAQGS---------------YGYG
A0A7D4C435      NYSRKTFLKNMNRLLRN-NQFT-R-MCTILND---AKAEGS---------------YGYG
A0A3C0I8F1      NYSKKAFSKSINKLILK-NNFT-N-LSVVLNA---VNKRFS-------------------
R5JJI4          GVMDRRQLPELEKMYRE-EQLC-N-MCVVLNG---VSYERRS----------YGYGYGYG
A0A848IUK4      DYSKRKFIKTLNRLKHI-NRFK-N-ISVIIND---LSLHSIN----------KG------
A0A136LSC7      NYSHKDFLQNLARVVTL-NKLT-H-VSSVLNA---IPLS---------------------
A0A5C7N8Q5      NYSRKDFLQNLARVVTL-NKLV-H-VSTVLNA---IPLN---------------------
A0A355BP94      NYSRKEFLSNLERIVSI-NKLS-H-VAVVLNA---LPTS---------------------
A0A7Y5D1K7      NYSKKEFLSNLERLISI-NKLS-N-VAVVLNA---LPNT---------------------
A0A3D2HF71      RFSSKNTVELIEELYRN-ETIG-R-IGIVMND---ISLTGY-----------------YG
A0A0A2DQN2      ERMDRRMLPELERLYQE-QVLT-N-MAIILNG---VNHNSSS----------YGYGYSYG
A0A0A2F2N5      GTVDRRVLPDLQLLYDE-KILN-N-MAIVLNG---ISSQNKG----------YGYGYGYG
L1NGW4          ARLDKRALPELQRLYDN-EILR-N-MSIVLNG---ASDGGHG----------YGYGYGYG
Z4WRA0          ARLDKRALPELQRLYDN-EILR-N-MSIVLNG---ASDGGH------------GYGYGYG
U2K8K9          AKLDRRALPELQRLYDD-HILT-N-MAIVLNG---ATESGH------------GYGYGYG
A0A069ZM60      GRLDRRALPELQHLYDE-NILT-N-MSIVLNG---ATESGH------------GYGYGYG
J6GV98          GRLDRRALPELQHLYDE-NILT-N-MSIVLNG---ATESGH------------GYGYGYG
A0A134B4F8      GRLDRRALPELQHLYDE-NILT-N-MSIVLNG---ATESGH------------GYGYGYG
A0A134B8C7      GRLDRRALPELQHLYDE-NILT-N-MSIVLNG---ATESGH------------GYGYGYG
A0A4Z0EKR0      NMTIKSQLKIIRNIYKS-KSLI-A-PMIVLND---AKQSNG-------------------
A0A521H707      HYSKRMFMQNLNKLIEE-YKIR-N-LAVVLNG---VETSKF------------KYGYGYG
A0A7T9D909      DYSKKQFVQNVDRMINE-NKIT-K-MSAILNG---VDIDRNK----------YGYNYGYG
A0A1M6B6D5      NYTHKNMLTFVNEKFRR-GEVK-H-ISIVINE---YVEKSG-------------K--GYG
A0A451FS66      NRTRKNMLTFVNEKYKR-GEIK-H-ISIVLNE---YVEKSG-------------RGFGYG
A0A2E3GN39      DYSHRSFVGHIESTKEN-LQVP-S-LSIIMND---YGRGVSG----------SYYNYGYG
A0A3D1MEL0      DYSHRSFVGHIESTKDN-LKVT-N-LSIVLND---YGRGVSG----------SYYN--YG
A0A519UDD1      NYTKKAQLTIPRNIYNS-KTLS-H-TMIVLND---AKEIN--------------------
A0A7Y2ACP6      DYSKKHFVQNVDRLINE-NGIK-K-LAVVLNN-----VDIER----------NKYGSYYG
A0A2A4N9A6      DYSKKDFVKIMNKLMND-HKIS-K-LALILNE---SGGGS---------------QYGYG
A0A6C0GGI1      NYTKREVLDTINELYES-KAIN-N-LSIVIND----------------------------
A0A368D1N7      DYSHREFVGHIESIKDN-LKVP-N-LSIVLND---YGRGVSG----------SYYNYGYG
A0A3B8TU58      DYSHRSFVGHIESTKEN-LQIP-N-LSIIVND---YGRGVSG----------SYYN----
A0A1T5IIR6      GQLDRRILPQLDELNDK-HHLH-N-MAIVFNG---PQIKKRR----------GYGFGSYG
A0A3E0QD27      QYSKRMFINNLNRLIEE-SKVR-N-LAVVLNG---VETSRF------------RYGYGYG
A0A0K2HKS3      GKLDRRMLPELEKIYRS-GQLN-N-MSLVLNG---AIVKTS----------------GYG
B6W3W8          GKLDRRMLPELEKIYRS-GQLN-N-MSLVLNG---AIVKTS----------------GYG
A0A0M1W1I6      GKLDRRMLPELEKIYRS-GQLN-N-MSLVLNG---AIVKTS----------------GYG
A0A4R4GHU2      GKLDRRMLPELEKIYRS-GQLN-N-MSLVLNG---AIVKTS----------------GYG
I8WPR6          GKLDRRMLPELEKIYRS-GQLN-N-MSLVLNG---AIVKTS----------------GYG
A0A076IRY8      GKLDRRMLPEVEKIYRS-GQLN-N-MSLVLNG---AIVKTG----------------GYG
A0A3A6AD54      GKLDRRMLPEVEKIYRS-GQLN-N-MSLVLNG---AIVKTG----------------GYG
A0A8B3EPF6      GKLDRRMLPEVEKIYRS-GQLN-N-MSLVLNG---AIVKTG----------------GYG
I8WPP8          GKLDRRMLPEVEKIYRS-GQLN-N-MSLVLNG---AIVKTG----------------GYG
A0A372Y7D2      GKLDRRMLPEVEKIYRS-GQLN-N-MSLVLNG---AIVKTG----------------GYG
A0A7K3KFI2      GKLDRRMLPEVEKIYRS-GQLN-N-MSLVLNG---AIVKTG----------------GYG
A0A3E4JJC9      GKLDRRMLPEVEKIYRS-GQLN-N-MSLVLNG---AIVKTG----------------GYG
A0A3E4WDQ0      GKLDRRMLPEVEKIYRS-GQLN-N-MSLVLNG---AIVKTG----------------GYG
A0A414H9P2      GKLDRRMLPEVEKIYRS-GQLN-N-MSLVLNG---AIVKTG----------------GYG
A0A7K0JKU9      GKLDRRMLPEVEKIYRS-GQLN-N-MSLVLNG---AIVKTG----------------GYG
C3R5A8          GKLDRRMLPEVEKIYRS-GQLN-N-MSLVLNG---AIVKTG----------------GYG
A0A6N8DCX3      GLMERNMLPEVENLYKQ-KKLK-N-MAVILNG---TENESG----------------RYG
F0R0C9          GLLERSMLAELETIYQE-KRFK-N-MAVILNG---TLDGNN----------------RYG
A0A1C5XJA7      GRLDKRQLPDIEKLYQE-KVLN-N-MALILNG---ADLERH----------------GYG
A0A285T4L1      GKLDRRQLPDLEELYRD-NKLC-N-MSLILNG---VDPSRR----------------GYG
R7CUW4          GRLDRRQLPDIESLYED-KKLH-N-MALVLNG---VDPHRH----------------GYG
A0A416GGJ1      GSVDRRLLPEIEDLYEN-KKLN-N-MAVVLNA---VEHRTV-------------------
D1JY72          GKLDRRMLPELEKIYRS-GQLN-N-MSLVLNG---AIVKTS----------------GYG
D7J4K6          GRLDRRLLPDMEELYRD-NKLR-N-MAIILNG---VGPHRR----------------GYG
Q8ABP9          GRLDRRLLPDMEELYRD-NKLR-N-MAIILNG---VGPHRR----------------GYG
D6D2Z5          GRLDRRLLPDMEELYRD-NKLR-N-MAIILNG---VGPHRR--------------GYGYG
A0A1T3EDR4      GKLDRRMLAELENIYQE-RKLS-N-LGIVFNG---VRIGAF----------------GYG
A0A6N8KXI9      GKMDKRQLPEIEKVYQN-HKLK-N-MAVVLNG---VKEDPR--------------SYGYG
A0A174SDD8      GKIDRRQLPELERLYQE-HKLN-N-MAVVLNG---TEKGSS----------------GYG
A0A1H7RFH3      GKIDRRQLPELERLYQE-HKLN-N-MAVVLNG---TEKGSS----------------GYG
A0A139L1N2      GKIDRRQLPELERLYQE-HKLN-N-MAVVLNG---TEKGSS----------------GYG
A0A174TVL8      GKIDRRQLPELERLYQE-HKLN-N-MAVVLNG---TEKGSS----------------GYG
A0A1H8BJR6      GKIDRRQLPELERLYQE-HKLN-N-MAVVLNG---TEKGSS----------------GYG
R9H6G0          GKIDRRQLPELERLYQE-HKLN-N-MAVVLNG---TEKGSS----------------GYG
A0A412GR09      GKIDRRQLPELERLYQE-HKLN-N-MAVVLNG---TEKGSS----------------GYG
A0A7J5JXN6      GKIDRRQLPELERLYQE-HKLN-N-MAVVLNG---TEKGSS----------------GYG
R6D982          GKLDKRQLPELERLYQE-HKLN-N-MAVVLNG---TKQGRR----------------GYG
A0A1F0I8C4      GKLDRRQLPELERLYQE-HRLN-N-LAVVLNG---AKKGSR----------------GYG
A0A3A5RIJ2      GKLDRRQLPELERLYQE-HRLN-N-LAVVLNG---AKKGSR----------------GYG
A0A515IZJ5      GKLDRRQLPELERLYQE-HRLN-N-LAVVLNG---AKKGSR----------------GYG
A0A7J4Y2H6      GKLDRRQLPELERLYQE-HRLN-N-LAVVLNG---AKKGSR----------------GYG
A0A4R6WE41      GKMDRRQLPELEKLYQS-NKLA-R-LGVVLNG---VKLGSG----------------AYG
A0A2T5RP38      GKMDRRQLPEIEKIYQE-KKLS-N-LAIVLNG---LKLNGY----------------GYG
A0A1A6CF06      GKMDRRQLPEIEKIYQE-KKLS-N-LAIVLNG---LKLNGY----------------GYG
A0A1T3D6S8      GKMDRRQLPEIEKLYQE-KKLS-N-LAIVLNG---LKLNGY----------------GYG
A0A8B4GMS2      GKMDRRQLPEIEKLYQE-KKLS-N-LAIVLNG---LKLNGY----------------GYG
A0A7Z7LUP7      GKMDRRQLPEIEKLYQE-KKLS-N-LAIVLNG---LKLNGY----------------GYG
A0A0B8T471      GAMDRRLLPEIEKIYRK-GKLN-N-MAILLNG---IRKLKS----------------SYG
A0A4R7D2K0      GAMDRRLLPEIEKIYRK-GKLN-N-MAILLNG---IRKLKS----------------SYG
A0A7T9S3V1      GKMDRRQLPDIEKIRNE-GKLS-N-MSIILNG---LKHGRR----------------GYG
A0A7T9LVI2      GKMDRRQLPEIEKIRQE-GKLS-N-MSVILNG---LKQGRR----------------GYG
C2FUH6          GKMDRRQLPEIEKIRQE-GKLS-N-MSVILNG---LKQGRR----------------GYG
A0A1V3N3U3      GKMDRRQLPEIEKIYRD-RKLS-N-LAVALNG---IKLHGP----------------GYG
A0A1P8E011      GKMDKRQLPEIQKIYAE-KRLS-N-LAIILNG---LKLGQS----------------GYG
A0A7T9S8K4      GKMDKRQLPEIQKIYAE-KRLS-N-LAIILNG---LKLGQS----------------GYG
A0A2X2J8S4      GKMDKRELPDIEKIYQS-KKLS-N-MAILFNG---VNSGKR----------------GYG
A0A3C0S618      GKMDKRELPDIEKIYQS-KKLS-N-MAILFNG---VNSGKR----------------GYG
A0A4P7DRF9      GKMDKRQLPEVQKIYES-GDLT-N-MAILLNG---VKFNDT----------------RYG
A0A239XXC4      GKMDRRQLPDVQKIYDS-SALT-N-MAILLNG---VKFGNN----------------PYG
A0A4U9K473      GKMDRRQLPEIQKIYDS-GSLT-N-MAIVLNG---VKFGNS----------------AYG
A0A081PBV5      GKMDRRQLPEIQSLYDQ-RKIS-H-MAVLLNG---VRLNKG----------------GYG
A0A1I2AN85      GKMDRRQLPEIQSLYDQ-RKIS-H-MAVLLNG---VRLNKG----------------GYG
A0A4U0GMP3      GKMDRRQLPELDKLHRQ-GKLT-N-MAILLNG---IRKGKM----------------GYG
A0A0D5BSQ0      GKMDRRQLPEIEKIYQE-KKLS-N-LAIVLNG---MKLNGY-----------GY---GYG
A0A1T3F6P5      GKMDRRQLPEIEKLYQE-KKLS-N-LAIVLNG---MKLNGY-----------GYGYGGYG
A0A853VUQ0      GKMDRRQLPEIEKIYQE-KKLS-N-LAIVLNG---MKLNGY-----------GYGYGGYG
A0A7X0MJ00      GKMDRRQLPDLEKIYRK-KTFN-N-LSIILNG---INS--------------NGGNYGYS
A0A841JHZ0      GKLDRRQLPGLEKIYRK-NTFT-N-LSLVLNG---VRL--------------NQGRYGYA
A0A1H6CKR6      GKMDRRQLPDIQKLYSS-GSLT-N-LAILLNG---VKFTNT-----------GYGGYGYG
A0A7W3MGA7      GKMDRRQLPDIQKIYDS-SALT-N-MAILLNG---VKFGSSY----------GYGYGGYG
A0A3M1Y2F5      QQTRLQDLERINELFEQ-ERIG-K-IGLLINH---VANPAQ------FR-----------
A0A7V1ALN2      GKTQEAAAKRSLKMIQK-VHIP-F-LGVVINK---LNFKNE------Y------------
A0A3D4RLG4      MQTNKYFCKNTLQQMEA-DYKD-K-VQLVFSD---MPVEKK------RK-RLGRKSYGYA
A0A2T2UAJ4      GETDGRAFDHAAEMLAD-GEAD-V-AGAVLNQ---FDASSS------VL-----------
A0A6I0DZQ5      DKTHKLFLRTLTAQLKS-DNVH-D-FYSILND---VELKSN------SYSRYYSRKYAYG
A0A1H6Z2F8      HFTFIHQLAELQKASEQ---LP-D-LQIVING---TRDL---------------------
A0A2P8G5K0      HFTFIHQLAEIQNARNQ-SLLP-D-LHVVLNG---TRSL---------------------
R5DEG6          GRMDRRALPEVEKLYRE-GKLR-N-MSLILNG---TVYKHG------TY--------GYH
A0A4Q3SEI4      NFTPKSMIEMLEESHKV-GALK-N-ISIVFNG---IRSR------------------GFF
A0A836SQI2      NYSKKTFINNINLIREE-KKID-S-ISLVLNA---YEVNDA------EY--------GYG
A0A7V1FAJ9      EVTNRNVAKQKLDLFEN-VPVN-I-IGVVLNG---AIQDMA------HE--------GYS
A0A3N2LCI3      GLFDRSMLPELDRLYEE-KKYR-N-MSFILNG---SRNDQG------RY--------GYS
A0A6H9Q899      GLLERSMLAELEKIYGE-KKYK-N-MSLILNG---TEGSGG------RY--------GYR
A0A3D4CJE1      NYSKKEYLKNAYRIYEE-NNIH-K-LSLVLNS---VD-FEQ------------------G
A0A7C7LI79      DFSKKNYVKNVDRLINE-SNIG-K-LSVVLNG---MD-TES------KY--------GYG
A0A4Q5ZQ60      NYSKKVFLKNVNKLIKG-HGFS-K-LALILND---AQ-TSG------IY--------GYG
A0A519Q885      NYSRKTFLKNLNRLMRN-NQFG-R-MCTILND---AQ-AQG------SY--------GYG
A0A519TAP8      NYSRKAFLKNLNRLMSN-NQFS-K-MCTILND---AK-AQG------AY--------GYG
A0A848Y4B8      GATKDYDLDHAVEQLHS-VGAE-L-IGTVLNG---FDVS-K------AY--------GYK
A0A7Y4V8Y1      NYSKKEFVNTLNRISSI-HKLT-N-LAVVLNA---LPTT---------------------
A0A5Q4EKA0      NYSKRMFIQNVNRLIGE-SHIS-K-LSVVLNA---VDKEYS------SY--------GYD
A0A519SYE7      NYSRKVFLKNLNRLMSN-NQFT-K-MCTVLND---AKAQ-G------SY--------G--
A0A7C7CFR2      NSSKKNYISNVDRLITE-SKVK-N-LAVVFNG---VDTD-S------VF--------GND
A0A7W1G0I5      GCTSKKQLSILLNELES-KKIN-N-IFWLYNDVD-------------------------V
A0A2T4XEQ1      NKTQTNELAQTLENLEN-IHVS-I-LGLSLVGYD----------HKISSD----------
A0A2K8ZAP1      DHTPKNYIKMVDALYKE-QRFQ-K-LSIVLNGVG--------------------------
A0A3D3LSK1      EKTDKKAFFKTYNQLKR-INPH-NLLGAVLNNFK----------FNTS------------
A0A496L711      FKTNKMEFTDLSKRLYS-DNIE-D-IYIILNDVD----------KSK-------------
A0A348PT57      EYSKKSFIDNINRIFIE-NKIT-N-LSAVLNSVD----------LSRARYGSYGRGYGAK
A0A847AMH6      NFTNRSWLKHSMEEIKA-FKLK-N-VGIVVNAVK----------IKKGKYLGYGYGYG--
A0A7C3PTI0      EYSKRNFIQNVDRLFNE-NGIK-R-LSIVLNGVD----------VQRKAY-GYNYGYG--
A0A7V1FAS7      QLTDKNATKRAFELLNN-VNAY-M-PGVLLNDV---------------SS-AYIYG-S--
A0A7V0M115      EVTNRNVAKQKLDLFEN-VPVN-I-IGVVLNGAI----------QDMA-----------H
A0A7C1IBE4      GKSGRENIKKMVDRIGR-EKI----IGVVFNAFE----------FNILDKKIQGVGYHNY
A0A3D5KRM7      EKNTVDEIKHSMKILEE-TNL----LGIVLNKSR----------QPIP-----------S
A0A831LDA6      KFTHKIALKTALEEVRK-HQLK-G-VGIIVNNIKLGKKNYSFSGGYGY-----GYGYGYG
A0A833B0I1      GLLERSMLAELEKIYEE-KKYK-N-MSLILNGTE--------GSGGRY-----GYRYGYR
A0A1V5S5I3      GLLERDMLPELQRMYDE-HRFK-N-MALVLNGTD----------GGNS-----RYGYRYG
R7JFY1          GVLDRRQIPALEMLSRR---FP-K-FSLVLNYVK----------GHHG-----GYGYGYG
A0A2M7VVW6      EYSRKNFINNLNKLIVE-NGIK-K-LSIVLNGVD----------YSNK-----YYSYGYN
A0A413V760      GVMDRRQLPELENMYRQ-EQLR-N-MSVILNGVP----------SDHK-----GYGYGYG
A0A3M1NUH2      GQTREGELEFAMESLAA-VGAP-A-IGTVFNGFD----------VSMAY----------G
A0A2T2TDL4      GTTTEAELDHAMEVLSG-IGAN-V-AGVVFNGFD----------ISMAY----------G
A0A359ATS6      GLLERSMLVELEKIYNE-QKYK-N-MCVILNGTT----------GNGG-----RYGYGYR
A0A1V6HYH8      EYSKKEFIVNLEKLKQE-LNPK-E-IIIVLNGFN----------DKFI-----KQSKYGK
A0A7X7LGP1      NYSKRVFIQNVNRLIED-SNLH-N-MSIVLNAVD----------REYS-----SYGYDKG
A0A838FHH6      DYSSRNFLNNVNYLVKE-HDVK-K-LSIVLNDMG----------EGAS-----IYAYSYG
A0A7Y4VJX2      NYSKREFLNNINRIQTI-HKVS-G-LAVVLNALV----------TSSK------------
A0A3D1AEJ6      GKMDRRMLPEIEQLYRE-ERLK-N-MAVILNGTG----------SGIG------------
A0A7K3KYQ2      GLFDRSMLPELDRLYEE-KKYR-N-MSFILNGSR----------NDQG-----RYGYSHT
A0A2E0MDX6      HFSKKVFLKNIQMLRDK-KKIK-N-LSVILNGAG----------GDKKYGGFRKYGYGYG
A0A2M7KCE1      HYSKRSFLYNLNHLLLE-KHIE-N-LSVVVNGID----------IEKS-----RYG---G
A0A523GUD4      GETPKRVIKRAVDMIHN-VEIE-I-SGIILNNMR----------NVLPY----YYDHK-Y
A0A7V5RHV9      GQTQKAVVNRAVELMKN-SGLN-I-LGVIVNNMK----------GVLPY----YYDYK-Y
A0A641X2Z6      GEVTPAAAKEAKQRLLQ-AGAH-I-LGVILNKVE----------LAHTH----GYGYYYY
A0A6L8U2P8      NYTRKDVFANVLSNLKA-NKMT-N-FDIIYNDLS----------LHKS-----------S
A0A7C6G639      GKTNKSFFKRLNDQLKD-DKLK-H-FYVILNDIN----------MDASR----YGGYTKN
A0A519PJW5      NYSRKAFLKNMNRLMQN-NQFS-R-MCTILNDAK----------AAGSY----GYGY--G
A0A519T3R9      NYSRKTFLKNLNRLLHN-NQLS-R-LCTILNDAQ----------AQGS------YGY--G
                                                                            

A0A7X8GFH1      Y--------G-YG---YG------YGYYSYGPEKKKQKGILKYFKK--------------
A0A7C7CKY6      Y--------G-YS---YG------YGYYQEESEFVKKTLLQRLLNS--------------
A0A1G1TG88      Y--------G-YGSGTYG------QGYYEDHGSAPPPTLAQKLGRLFK------------
A0A661XXA6      Y--------S-YGDVYTS------SPYYQE------------------------------
A0A519SD85      -----------SHYNKSKQILPYPNGYYSSYYQSI-------------------------
A0A3M1TXY5      -----------YGYLDTD------YGINGYVKKGKKRKRYEAIN----------------
A0A7T9KM12      -----------YGYV------------------------YESK-----------------
A0A2E0VQ27      ------------------------GAYARYLKKRKPAPALS-------------------
A0A7Y7TYP1      -----------YGYG---------YGYNKNQ-----------------------------
R6U429          Y--------GHYGYG-YGYGYGYGYGYGNNVQD---------------------------
A0A5C8AF42      Y--------G-YGYN-YG------YGYYEGDSEIEKGNLLNRLWSFISSKFRR-------
A0A7Y5SYP1      -----------SSQGNYY------YYYSSNQK----------------------------
A0A7V1N701      -----------YGSEYY------IYGES--------------------------------
A0A7V2NIA8      -----------SSKYYYGRFFNEYYGAKKYYTEKIRTEAQENA-----------------
A0A239K409      ---------NKYGYG---------YGYVKK------------------------------
A0A1M3DPL8      L--------GTYGYG-YG------YGYTSSGRSKHKGNNTYFQYYQDDEKDI--------
A0A1V5F519      -----------YGYS-SK------YGYYTS--KGQKNIDEYRKYYDDNN-EI--------
A0A2G6R1T9      -----------YGYG-YG------YGYGYG--VKNKKDNQYTHYYNDDDIDI--------
A0A350V3E4      ----------------YGSYYKYYYYYYGSEKGKESAGTNGKSTNGVNTNGSQKEKIIKP
A0A6J4K208      -----------YGYSDKT------YKY-GYGD----------------------------
A0A2W4RDE8      -----------NGYS-YS------YKYKQKKYKQRSYKAV--------------------
A0A212J9Z9      ---------GYYGTSRY-------YGDRTYYLKKNSYYHDDYFEN---------------
F5IV23          ---------GYYGTSRY-------YGDRTYYLKKNSYYHDDYFEN---------------
A0A1M5DFS8      ---------GYYGTSRY-------YGDKSYYLKRNSYYHDDYFEK---------------
A0A4Y8KZS5      ---------GYYGTSRY-------YGDKSYYLKRNSYYHDDYFEK---------------
A0A2V3PNY7      ---------GYYGTSRY-------YGDKSYYLKRNSYYHDDYFEK---------------
A0A6G7X5K8      ---------GYYGTSRY-------YGDKSYYLKRNSYYHDDYFEK---------------
A0A840CJ33      ---------GYYGTSRY-------YGDKTYYLKKNSYYHDDYFEN---------------
F8X2T0          ---------GYYGTSRY-------YGDKTYYLKKNSYYHDDYFES---------------
A0A1M3LAG1      ---------GYYGTSRY-------YGDKTYYLKKNSYYHDDYFES---------------
A0A212K6G4      ---------GYYGTSRY-------YGDKTYYLKKNSYYHDDYFES---------------
A0A4Y9IPG7      ---------GYYGTSRY-------YGDKTYYLKKNSYYHDDYFES---------------
A0A0L8VEV2      ---------GAYGAD-YSHRKNSSYYYFDSSPSYTG------------------------
A0A1I2A9Z9      ---------GSYGAD-YSYKKKSSYYYFESSPSYTG------------------------
A0A848XXC6      ---------VAYRRT-YG------YRYATRYAAERPGMPPSPHPSASSEDASAD------
A0A2P8CDS1      -----------YSYM-YG------YGYKTQKPKNRPA------------------AYWRK
A0A660LQT8      H--------HRYGYR-YG------YRY-GYGIDYGKS-----------------------
A0A3D0FMX4      ---------G-YGYG-YG------YGGYGYGYGYGYGSRKKGTNH-------YYTDE-DE
A0A7V6G854      ---------G-YGYG-YG------NYGY-GGYGYGYLRKRKKGSRYYYNSEDYYVNDIDD
A0A1M3MEI8      NSRRYGTKSG-YGYG-YG------Y-----GYGYTKVSDKKNSDGTYYQ---YYQDDAHD
A0A1J5HQM0      ---------G-YGYG-YG------SGYG-YGYGYGNTRKKKEASEKYFQ---YYQDD-RE
E4T131          ---------L-FGFS-YG------Y----------TSKKKKGDAEKYFH---YYQDD-TE
A0A653AC35      ---------G-YGYG-YG------Y----------AQLKKKKEYDKNTH---YYEDD-DD
A0A847LA02      ---------G-YGYG-YG--------------------NKKKGQNKYTH---YYEDD-SE
A0A389LWV6      Y----------YGKSSYYHKHNSYYNNDEFVDEQNQN-----------------------
A0A1G9B1T9      -----------HGY--YE------------------------------------------
A0A350PNH9      YH---------YGYG-YG------YHYGSDKNGGAKIGK---------------------
A0A354LNT9      YH---------YGYG-YG------YHYGSDKNGDAKIGK---------------------
A0A161LWY6      R----------YGYGTYGNNPVTKDYIKDYYEEE--------------------------
A0A6I3N9U6      R----------YGYGTYGNNPVTKDYIKDYYEEE--------------------------
A0A353WYK7      -----------YGYGSYGKS----YGYYEEPEYLESNLF----------------ATFKS
A0A2W7RD29      -----------IGSN-KN------YGYYEVYKDNKGLVNRVKNYLRSSK-----------
A0A3N2NDY8      A----------YGY--YG------------------------------------------
D7JEV9          ---------G-YVYG---------YGY-GMHKKMGNYYVTEEFEQDDVSILEKLIYKISD
A0A553GA49      ------------RYY---------N-YSAYYAKPNLN-----------------------
A0A7V5GTN5      YHRYHSYGYYSGGYH---------YYYYSYYQDSEVKDEDEQVKKRKRKKSEPKEPEPTE
A0A497D6F6      Y-----------GYG---------LGYGRTAKK---------------------------
F4KR18          ------------AYG---------YSYKDYGYA---------------------------
B5CTK0          Y-----------GYG---------YGYGDTKTKHKKKS----------------------
A0A5M4AAB9      H-----------SYG---------YGYENNYKKKISKELKPQRRSQKTEV----------
A0A5R9QZP0      ------------TYG---------G-YDTYYHNNPKRKK---------------------
A0A7X6SRJ5      ------------RYG---------R-YDSYYKKDKPSLIKKFA-----------------
A0A3D3HL11      ------------RYG---------R-YDNYYKQ---------------------------
A0A6L8U6G9      ------------RYG---------R-YDNYYKQ---------------------------
A0A6L8UH35      ------------SYR---------H-YSNYYIKN--------------------------
A0A7X9F2J5      ------------SYR---------H-YSNYYIKN--------------------------
A0A352ME00      ------------SYR---------H-YSNYYIKN--------------------------
A0A7X8CRA6      ------------SYR---------H-YSNYYIKN--------------------------
A0A1F3D6P8      ------------PYR---------H-YTSYYLKK--------------------------
A0A356Z058      ------------PYR---------H-YTSYYLKK--------------------------
A0A7X8FHL3      ------------SYR---------H-YCNYYIRN--------------------------
A0A3D1BT36      ------------RYG---------R-YHGYYKKPKAFTARK-------------------
A0A7X7CXW9      ------------RYG---------R-YDNYYKQ---------------------------
A0A4R6H3B7      ---------GSYGAD-YSYKKKSSYYYFESSPSYTG------------------------
A0A229I3A5      Y--------G-YGYG-YG------YGY-NYNKEKNGGGKILNNWIIE-------------
A0A3R6HJB3      Y--------G-YGYG-YG------YGY-NYNKEKNGGAKS--------------------
R6NN15          Y--------G-YHYG-YG------SSY-YYGNEKQK------------------------
A0A2W7QSQ0      ---------SKFGYGYYS----------GKDTDVVSTRA---------------------
A0A841MQL4      ---------SKFGYGYYS----------GNNKSMVSVKSSS-------------------
A0A3P1Z8V4      Y--------G-YGYG-YG------YGYGNNLDETASR------------------KWWQL
A0A1M6MYT6      Y--------G-YGYG-YG------YGHDTDSNQKKGKTKTKGRSIFKPS-----------
A0A1V5S1J9      R--------YYDSYGSYGKKSGYYYYDKKFKSPRSQYL-----------------NYFDN
A0A7X8JMH1      T--------SYSNYSKYGKS---YYTNLLYNNYKDNNG-----------------VYFDD
A0A3D5KRY6      -----------YGY----------YSEDGKSKKSKKK-----------------------
R7F6L5          Y--------G-YGYG-YG------YGY-AYGDDNDKKKKKRKKS----------------
A0A7C5MRV2      ---------G-YGYKVYG------SGYYSDDKPQEPWW-----------------KFWKK
A0A0A2EYC8      --------------G-YG------YGY-SKYKKMGNYYVTEEFEQDDISMLEKIIDKIGE
A0A2G6H6Y4      Y--------G-YGYG-YG------YGY-GGSKKNNAYYVTAEFEKENTTAFQRVIEFVGD
C9LKL0          Y--------G-YGYG-YG------YGYGNYSYGYGEQYNNRKSKKKLSG------RLLSK
A0A3D0QPV7      Y--------G-YGYG-YG------YTYGGNYYTERTNATEKKI------------RFFRR
A0A496KT23      Y--------HKYGYG-YGG-----YGY-GYGYGS--------------------------
L1M9T3          Y--------HKYGYG-YGG-----YGYGGYGYGK--------------------------
A0A2M6GH67      Y--------A-YGYG-YS------NSYYDLE-------------------------EKEG
A0A7K1TE30      Y--------G-YGYG-YG------YGYGSYGMGYYEEPT----------------APKKT
A0A7D4BE70      Y--------G-YGYG-YG------YGYGTYGMGYYEEPT-----------------QRKT
A0A142HHS5      Y--------G-YGYG-YG------YGYGTKGMGYYDETE-----------------QKPT
A0A7D4C435      Y--------G-YGYG-YG------YGYG-HGMGYYEDPV-----------------QKPS
A0A3C0I8F1      -----------YGYG-YG------YGYGAYYGKRSVAYYNDSESNYKPI------RWINR
R5JJI4          Y--------G-YGYG-YG------YGNEHHGNNKQ--------------------GVAKR
A0A848IUK4      -----------YGYN-YG------YGYYAEDEESGI-------------------KPKKI
A0A136LSC7      ------------GNY-YG------YGYYEDKTPRRK-------------------RWIKI
A0A5C7N8Q5      ------------GKY-YG------YGYYEDRTPRMR-------------------RWTKI
A0A355BP94      ------------GKT-YG------YGYYHEDQKKRS-------------------LIRKI
A0A7Y5D1K7      ------------GKT-YG------YGYYQEDKSKKH-------------------WLKQI
A0A3D2HF71      YGLRYGYAGG-YGYS-YGYNYYGDYVYSRYGHSGEGKYYIEE------------------
A0A0A2DQN2      Y--------GYYGYG-YG------YGHLGKKSLRK--------------------RFVER
A0A0A2F2N5      Y--------G-YGYG-YG------YGY-GNKKERS--------------------GIFSR
L1NGW4          Y--------G-YGYG-YG------YGY-GN-KKKK--------------------GILYR
Z4WRA0          Y--------G-YGYG-YG------YGY-GN-KKKK--------------------GILYR
U2K8K9          Y--------G-YGYG-YG------YGY-GNKKKKK--------------------TLLQR
A0A069ZM60      Y--------G-YGYG-YG------YGY-GNKKKKK--------------------GLLRR
J6GV98          Y--------G-YGYG-YG------YGY-GNKKKKK--------------------GLLRR
A0A134B4F8      Y--------G-YGYG-YG------YGY-GNKKKKK--------------------GLLRR
A0A134B8C7      Y--------G-YGYG-YG------YGY-GNKKKKK--------------------GLLRR
A0A4Z0EKR0      --------NN-YGFG-YG------YGY-PVKEKMKKKATG--------------------
A0A521H707      Y--------G-YGYG-YG------YGY-GYYDDEARKNL----------------SFFEK
A0A7T9D909      Y--------G-YGYG-YG------YGY-GGYYEDRGKDQDSVK------------LPFGL
A0A1M6B6D5      Y--------G-YGYG-YGGSSYKSYGN-GYHEAIKKP------------------SLWKR
A0A451FS66      Y--------G-YGYG-YGDGSYKSYGD-GYHGPLGKK------------------SLADR
A0A2E3GN39      YGYGYGYGYG-YGYG-YG------YGY-GYYSDSDNTRKKERS------------SLFSI
A0A3D1MEL0      YGYGYGYGYG-YGYG-YG------YGY-GYYSDPDNTRKKERS------------ILFSR
A0A519UDD1      ------------GNN-YG------YGY-GYGYEQDKSHHKQKAAL---------------
A0A7Y2ACP6      Y--------G-YGYG-YG------YAY-GGGYGYNSGYYDQDG----------KKSSWFK
A0A2A4N9A6      Y--------G-YGYG-YG------YGY-GYGYGYGYGYYAEDASRNKSLWERITNSKFIS
A0A6C0GGI1      I--------N-FSTV-YG------LSY-N---GKANGYYKN-------------------
A0A368D1N7      Y--------G-YGYG-YG------YGY-GYGYGYGYGYYSDPDNTRKK-----KRSSLIS
A0A3B8TU58      Y--------G-YGYG-YG------YGY-GYGYGYGYGYYSDPDETREN-----ERTGFFS
A0A1T5IIR6      YGYGY----G-YGYG-YG------YGY-GYGDEPKKK------------------RFLGI
A0A3E0QD27      Y--------G-YGYG-YG------YGY-GYYDDEAKKPL----------------TTWQA
A0A0K2HKS3      ---------G-YGYG-YG------YGY-GYVDGSE--------------------SSWKR
B6W3W8          ---------G-YGYG-YG------YGY-GYVDGSE--------------------SSWKR
A0A0M1W1I6      ---------G-YGYG-YG------YGY-GYVDGSE--------------------SSWKR
A0A4R4GHU2      ---------G-YGYG-YG------YGY-GYVDGSE--------------------SSWKR
I8WPR6          ---------G-YGYG-YG------YGY-GYVDGSE--------------------SSWKR
A0A076IRY8      ---------G-YGYG-YG------YGY-GYVDGSE--------------------SCWKR
A0A3A6AD54      ---------G-YGYG-YG------YGY-GYVDGSE--------------------SCWKR
A0A8B3EPF6      ---------G-YGYG-YG------YGY-GYVDGSE--------------------SCWKR
I8WPP8          ---------G-YGYG-YG------YGY-GYVDGSE--------------------SCWKR
A0A372Y7D2      ---------G-YGYG-YG------YGY-GYVDGSE--------------------SCWKR
A0A7K3KFI2      ---------G-YGYG-YG------YGY-GYVDGSE--------------------SCWKR
A0A3E4JJC9      ---------G-YGYG-YG------YGY-GYVDGSE--------------------SCWKR
A0A3E4WDQ0      ---------G-YGYG-YG------YGY-GYVDGSE--------------------SCWKR
A0A414H9P2      ---------G-YGYG-YG------YGY-GYVDGSE--------------------SCWKR
A0A7K0JKU9      ---------G-YGYG-YG------YGY-GYVDGSE--------------------SCWKR
C3R5A8          ---------G-YGYG-YG------YGY-GYVDGSE--------------------SCWKR
A0A6N8DCX3      Y--------R-YGYK-YG------YRY-GYGNDK--NTD---------------------
F0R0C9          Y--------K-YGYK-YG------YHY-GYGSKDYYNNE---------------------
A0A1C5XJA7      Y-------GS-YGYG-YG------YGY-GNNKNK--------------------------
A0A285T4L1      -----------YGYG-YG------YGY-GKRKNK--------------------------
R7CUW4          -----------YGYG-YG------YGY-GRYGYGNKKHGRN-------------------
A0A416GGJ1      -----------YGYG-YG------YSY-QYKGGE--------------------------
D1JY72          ---------G-YGYG-YG------YGY-GYVDGSES-------------------SWKRL
D7J4K6          Y--------G-YGYG-YG------YGY-GYGKHGRRK-----------------------
Q8ABP9          Y--------G-YGYG-YG------YGY-GYGKHGRRK-----------------------
D6D2Z5          Y--------G-YGYG-YG------YGY-GYGKHGRRK-----------------------
A0A1T3EDR4      Y--------G-YGQELKG-------------------------------------GLWSR
A0A6N8KXI9      Y--------G-YGYG-YG------YGY-GYEVQKKK-------------------GFFSN
A0A174SDD8      Y--------G-YGYN-YG------YGY-AATQKKKG-------------------GWWRR
A0A1H7RFH3      Y--------G-YGYN-YG------YGY-AATQKKKG-------------------GWWRR
A0A139L1N2      Y--------G-YGYN-YG------YGY-AATQKKKG-------------------GWWRR
A0A174TVL8      Y--------G-YGYN-YG------YGY-AATQKKKG-------------------GWWRR
A0A1H8BJR6      Y--------G-YGYN-YG------YGY-AATQKKKG-------------------GWWRR
R9H6G0          Y--------G-YGYN-YG------YGY-AATQKKKG-------------------GWWRR
A0A412GR09      Y--------G-YGYN-YG------YGY-AATQKKKG-------------------GWWRR
A0A7J5JXN6      Y--------G-YGYN-YG------YGY-AATQKKKG-------------------RWWRR
R6D982          Y--------G-YGYG-YG------YGY-SYGNDEKKK------------------NWFFG
A0A1F0I8C4      Y--------G-YGYG-YG------I-------DVEKS------------------GWWSR
A0A3A5RIJ2      Y--------G-YGYG-YG------I-------DVEKS------------------GWWSR
A0A515IZJ5      Y--------G-YGYG-YG------I-------DVEKS------------------GWWSR
A0A7J4Y2H6      Y--------G-YGYG-YG------I-------DVEKS------------------GWWSR
A0A4R6WE41      Y-------GR-YGYGNYG------YSY-GNEKK----------------------SIWKK
A0A2T5RP38      Y-------GG-YGYGSYG------YGY-GEEKKK---------------------SVFDW
A0A1A6CF06      Y-------GG-YGYGSYG------YGY-GEEKRK---------------------SIFSW
A0A1T3D6S8      Y-------GG-YGYGS--------YGY-GEEKKK---------------------SVFDW
A0A8B4GMS2      Y-------GG-YGYGS--------YGY-GEEKKK---------------------SVFDW
A0A7Z7LUP7      Y-------GG-YGYGSYG------YGY-GEEKKK---------------------SVFDW
A0A0B8T471      Y--------G-YGYG-YG------YGY-QKEKAGLR-------------------GFFNR
A0A4R7D2K0      Y--------G-YGYG-YG------YGY-QKEKAGLT-------------------GFFRR
A0A7T9S3V1      Y--------G-YGYG-YG------YGY-G--DQKKSNKLS---------------LFWKK
A0A7T9LVI2      Y--------G-YGYG-YG------YGY-GYSNEKRHNLFS---------------SLLEK
C2FUH6          Y--------G-YGYG-YG------YGY-GYSNEKRHNLFS---------------SLLEK
A0A1V3N3U3      Y--------G-YGYG-YG------YGY-GNTEQQVWYK-----------------RWWRK
A0A1P8E011      Y--------G-YGYG-YG------YG--REEGQNSWRKIARSI----------RTIFTRK
A0A7T9S8K4      Y--------G-YGYG-YG------YG--REEGRNSWRKIARSI----------RTIFTRK
A0A2X2J8S4      Y--------G-YGYG-YG------YGY-RYGDDKK--------------------SFWKK
A0A3C0S618      Y--------G-YGYG-YG------YSY-RYGDDKK--------------------SFWKK
A0A4P7DRF9      YGSYGYGYGG-YGYG-YG------YGY-GNHKKKK--------------------SIFNI
A0A239XXC4      Y--GGYGYGG-YGYG-YG------YGY-SAQQKRG--------------------FFSRL
A0A4U9K473      S--YGYGYGG-YGYG-YG------YGY-GAQKKKR--------------------FLL--
A0A081PBV5      Y--------G-YGYG-YG------YGY-GYGNETKK-------------------TIWDK
A0A1I2AN85      Y--------G-YGYG-YG------YGY-GYGNETKK-------------------TIWDK
A0A4U0GMP3      Y--------G-YGYG-YG------YGY-GYGNTKT-------------------------
A0A0D5BSQ0      Y--------G-------S------YGY-GYGEEKKK-------------------SVFDW
A0A1T3F6P5      Y--------G-------S------YGY-GYGEEKKK-------------------SVFDW
A0A853VUQ0      Y--------G-------S------YGY-GYGEEKKK-------------------TIFNW
A0A7X0MJ00      Y--------G-Y-----G------YGY-GYGH-KKS-------------------SLLSR
A0A841JHZ0      N--------G-YGYA-KG------YGY-GYAI-KKL-------------------SLFSR
A0A1H6CKR6      Y--------G--GYG-YG------YGY-GYGNRKKK-------------------SFFQK
A0A7W3MGA7      Y--------G--GYG-YG------YGY-GYGQPKKK-------------------GFFSR
A0A3M1Y2F5      ----HGDASY-YTYG-KK------YAKV--------------YGAMHT------------
A0A7V1ALN2      --------GP-YNYY-NS------YY----------------KDYYREKERPAQPLIKNL
A0A3D4RLG4      Y-------NS-YGYG-YG------YGYGGKND----------YNYYSDDE----------
A0A2T2UAJ4      --------QS-YGYN-YG------YAYSYRRL----------YEYYRDEDKGAPEPSGIR
A0A6I0DZQ5      NSRRYGTKSG-YGYG-YG------YGYGYTKVSDKKNSDGTYYQYYQDDAHDI-------
A0A1H6Z2F8      -----------HRYQ-YN------YY----------------------------------
A0A2P8G5K0      -----------HRYQ-YN------YY----------------------------------
R5DEG6          -----------YGYG-YG------YGYG---YG---------YGQRKKK-----------
A0A4Q3SEI4      K-------GK-YGYG-YG------YGRK-KVYG---------DHVYKSEAVQRKA-----
A0A836SQI2      ----------------YG------YGYG--------------------------------
A0A7V1FAJ9      Y-------YH-Y------------------------------------------------
A0A3N2LCI3      --------HT-YRYG-YG------YGYG---YG---------YNYGSGEKKEE-------
A0A6H9Q899      --------YG-YRYG-YH------YGYG---SG---------YHYSSDEKRVGGG-----
A0A3D4CJE1      Q-------YG-YGYG-YG------YGYG---YG---------YGYYED--VPEKQ--VWW
A0A7C7LI79      S-------YE-HGYG-YG------YGYA---YG---------YGYYDE--ESEKHKSPWY
A0A4Q5ZQ60      --------YG-YGYG-YG------YGYG-YGYG---------YGYYDE--QEKKGLLGRI
A0A519Q885      --------YG-YGYG-YG------YGYG--TYG---------MGYYEEPSQGKPSISQRF
A0A519TAP8      --------YG-YGYG-YG------YGSSGTGYG---------MGYYDEAVQ-PPTLGQKI
A0A848Y4B8      -----------YKYQ-YR------Y---GSMYG---------YGHDGSKAA---------
A0A7Y4V8Y1      ----------------------------GKTYG---------YGYYEDK---PKRKGWRD
A0A5Q4EKA0      -----------KGYS-YG------YYYGGYGSG---------YGYYDDQINIVKRSFWKR
A0A519SYE7      -----------YGYG-YG------Y---GYGYG---------YGSY--------------
A0A7C7CFR2      -----------YNYG-YG------Y---AYNYG---------YGYYDEESDSKKRSFWQR
A0A7W1G0I5      KG---------TEYG-KK------NAYYTND-----------------------------
A0A2T4XEQ1      YY---------YQNK-YK------YYSYNDYLEYTEEKEEVA------------------
A0A2K8ZAP1      KG---------ESLS-YS------YNY-----GDYMDLTKKFD-----------------
A0A3D3LSK1      YG---------YYYN-YY------YYY--------SGDSKKKNN----------------
A0A496L711      IG---------YVYG-YG------YGMPKKMGNYYVTEEFEQDDVSILEKLIYKISDMTK
A0A348PT57      YG---------YGYG-YG------YGY-----GYTSGNGYYSEDNEEEEPKLNFLRNLRS
A0A847AMH6      YG---------YGYG-YG------YGK-----GYGYGNRKRVAADKAKAS----------
A0A7C3PTI0      YG---------YGYG-YG------YGY-----GYYDDLKKDDDRSVVKKIFTN-------
A0A7V1FAS7      YY---------YYYY-YY------YYY-----GEESGQSKKKHKKSSKKHHRV-------
A0A7V0M115      EG---------YSYY-HY------------------------------------------
A0A7C1IBE4      YA---------EEYY---------------------------------------------
A0A3D5KRM7      YK---------YGYG-YG------YG----------------------------------
A0A831LDA6      YG---------YGYG-YG------KGYGNDKEDKSSKRKVLRTEDMKA------------
A0A833B0I1      YG---------YHYG-YG------SGYH--------------------------------
A0A1V5S5I3      YH---------YDYG-SK------SYYGK-------------------------------
R7JFY1          YG---------YGYG-Y--------GYGNEKKRK--------------------------
A0A2M7VVW6      YN---------YSYG-NK------DGYYYDDTQK--------EKLTKRIFKKKK------
A0A413V760      YG---------YGYG-YG------YGYGNESHGHKHGRYESLKNLFSRFFKRS-------
A0A3M1NUH2      YK---------YRYR-HY------DRYTQYTSEYGTYGYRDVKELLKDKES---------
A0A2T2TDL4      YK---------YRYR-HY------DQYGPYDQYRSLPEEASA------------------
A0A359ATS6      YG---------YKYG-YH------YGSEKKKTWWGNKG----------------------
A0A1V6HYH8      YG---------YEYK-YD------I----YGYYTDNEEKQSNTKKSMKKYFNYFYKKNK-
A0A7X7LGP1      YA---------YGYY-GG------YG---YGYGYY-EELLV--KDTNKPWFKKLIRKRN-
A0A838FHH6      YG---------YG-Y-GG------YGSQEYGYDYYTDDVRA--KRGLLGKMTKFIRSFF-
A0A7Y4VJX2      -----------------A------YG---YGYYEDKTAPKG--WRSLLNFF---------
A0A3D1AEJ6      -----------YGYG-YG------YG---YGY---GNDKDK-------------------
A0A7K3KYQ2      YR---------YGYG-YG------YG---YGYNYGGGEKKK-------------------
A0A2E0MDX6      YG---------YGYG-YG------YGYGGNH-GYYEEK-PQKEKTTFNKIFSKK------
A0A2M7KCE1      YN---------YGYG-YG------YGNSEYHTDYYDESITKKKKNIFTKIISHL------
A0A523GUD4      YG---------YDYY-NY------NTNDK-------------------------------
A0A7V5RHV9      YG---------YKYY-TK------DAHPQVA-----------------------------
A0A641X2Z6      YG---------SDST-SG------GGHSSLKVRW--------------KLRRY-------
A0A6L8U2P8      YR---------H--------------YSNYYIRN--------------------------
A0A7C6G639      YG---------YGYG-YS------YGYGGYGYGYGYGYGRKKRLKEANKYAQYYDDDSEV
A0A519PJW5      YG---------YGYG-YG------YGYGSYGMGY-YEE-PVQKPTLSQRIKGLFS-----
A0A519T3R9      YG---------YGYG-YG------YGYGTYGMGY-YEEMDNRKLTVGQRLKRLFS-----
                                                                            

A0A7X8GFH1      -------------------
A0A7C7CKY6      -------------------
A0A1G1TG88      -------------------
A0A661XXA6      -------------------
A0A519SD85      -------------------
A0A3M1TXY5      -------------------
A0A7T9KM12      -------------------
A0A2E0VQ27      -------------------
A0A7Y7TYP1      -------------------
R6U429          -------------------
A0A5C8AF42      -------------------
A0A7Y5SYP1      -------------------
A0A7V1N701      -------------------
A0A7V2NIA8      -------------------
A0A239K409      -------------------
A0A1M3DPL8      -------------------
A0A1V5F519      -------------------
A0A2G6R1T9      -------------------
A0A350V3E4      N------------------
A0A6J4K208      -------------------
A0A2W4RDE8      -------------------
A0A212J9Z9      -------------------
F5IV23          -------------------
A0A1M5DFS8      -------------------
A0A4Y8KZS5      -------------------
A0A2V3PNY7      -------------------
A0A6G7X5K8      -------------------
A0A840CJ33      -------------------
F8X2T0          -------------------
A0A1M3LAG1      -------------------
A0A212K6G4      -------------------
A0A4Y9IPG7      -------------------
A0A0L8VEV2      -------------------
A0A1I2A9Z9      -------------------
A0A848XXC6      -------------------
A0A2P8CDS1      VNSKKQAQTT---------
A0A660LQT8      -------------------
A0A3D0FMX4      -------------------
A0A7V6G854      ADDVKK-------------
A0A1M3MEI8      I------------------
A0A1J5HQM0      I------------------
E4T131          I------------------
A0A653AC35      I------------------
A0A847LA02      I------------------
A0A389LWV6      -------------------
A0A1G9B1T9      -------------------
A0A350PNH9      -------------------
A0A354LNT9      -------------------
A0A161LWY6      -------------------
A0A6I3N9U6      -------------------
A0A353WYK7      LFSK---------------
A0A2W7RD29      -------------------
A0A3N2NDY8      -------------------
D7JEV9          MTKKIRNIKK---------
A0A553GA49      -------------------
A0A7V5GTN5      SDVV---------------
A0A497D6F6      -------------------
F4KR18          -------------------
B5CTK0          -------------------
A0A5M4AAB9      -------------------
A0A5R9QZP0      -------------------
A0A7X6SRJ5      -------------------
A0A3D3HL11      -------------------
A0A6L8U6G9      -------------------
A0A6L8UH35      -------------------
A0A7X9F2J5      -------------------
A0A352ME00      -------------------
A0A7X8CRA6      -------------------
A0A1F3D6P8      -------------------
A0A356Z058      -------------------
A0A7X8FHL3      -------------------
A0A3D1BT36      -------------------
A0A7X7CXW9      -------------------
A0A4R6H3B7      -------------------
A0A229I3A5      -------------------
A0A3R6HJB3      -------------------
R6NN15          -------------------
A0A2W7QSQ0      -------------------
A0A841MQL4      -------------------
A0A3P1Z8V4      W------------------
A0A1M6MYT6      -------------------
A0A1V5S1J9      TEEEL--------------
A0A7X8JMH1      LEDDV--------------
A0A3D5KRY6      -------------------
R7F6L5          -------------------
A0A7C5MRV2      LRS----------------
A0A0A2EYC8      KTKRIRNIHSSRLFK----
A0A2G6H6Y4      ITKKIRNIKK---------
C9LKL0          LRK----------------
A0A3D0QPV7      KNKK---------------
A0A496KT23      -------------------
L1M9T3          -------------------
A0A2M6GH67      VLTRLKRNFT---------
A0A7K1TE30      FTERLKGLFS---------
A0A7D4BE70      WRQRLKGLFS---------
A0A142HHS5      LGKRIKSLFS---------
A0A7D4C435      LGQRLKGLFS---------
A0A3C0I8F1      IYKRAMSFRK---------
R5JJI4          IINKLIAFFK---------
A0A848IUK4      LRFLKKEG-----------
A0A136LSC7      FGLK---------------
A0A5C7N8Q5      FGLK---------------
A0A355BP94      FRS----------------
A0A7Y5D1K7      FN-----------------
A0A3D2HF71      -------------------
A0A0A2DQN2      MKMFFVS------------
A0A0A2F2N5      FRKS---------------
L1NGW4          LGLKK--------------
Z4WRA0          LGLKK--------------
U2K8K9          LGIRR--------------
A0A069ZM60      LGLR---------------
J6GV98          LGLR---------------
A0A134B4F8      LGLR---------------
A0A134B8C7      LGLR---------------
A0A4Z0EKR0      -------------------
A0A521H707      FKNRFSRK-----------
A0A7T9D909      GNRKKKGA-----------
A0A1M6B6D5      MKKSITKK-----------
A0A451FS66      IKNIFKQT-----------
A0A2E3GN39      FRKKS--------------
A0A3D1MEL0      FRKKT--------------
A0A519UDD1      -------------------
A0A7Y2ACP6      QLKGKIWK-----------
A0A2A4N9A6      LLKN---------------
A0A6C0GGI1      -------------------
A0A368D1N7      RFRKKS-------------
A0A3B8TU58      RFRKNS-------------
A0A1T5IIR6      FKRK---------------
A0A3E0QD27      FKARLGKK-----------
A0A0K2HKS3      LFKKKS-------------
B6W3W8          LFKKKS-------------
A0A0M1W1I6      LFKKKS-------------
A0A4R4GHU2      LFKKKS-------------
I8WPR6          LFKKKS-------------
A0A076IRY8      LFRKKS-------------
A0A3A6AD54      LFRKKS-------------
A0A8B3EPF6      LFRKKS-------------
I8WPP8          LFRKKS-------------
A0A372Y7D2      LFRKKS-------------
A0A7K3KFI2      LFRKKS-------------
A0A3E4JJC9      LFRKKS-------------
A0A3E4WDQ0      LFRKKS-------------
A0A414H9P2      LFRKKS-------------
A0A7K0JKU9      LFRKKS-------------
C3R5A8          LFRKKS-------------
A0A6N8DCX3      -------------------
F0R0C9          -------------------
A0A1C5XJA7      -------------------
A0A285T4L1      -------------------
R7CUW4          -------------------
A0A416GGJ1      -------------------
D1JY72          FKKKS--------------
D7J4K6          -------------------
Q8ABP9          -------------------
D6D2Z5          -------------------
A0A1T3EDR4      FLRMFRRV-----------
A0A6N8KXI9      LFRRS--------------
A0A174SDD8      KGKK---------------
A0A1H7RFH3      KGKK---------------
A0A139L1N2      KGKK---------------
A0A174TVL8      KGKK---------------
A0A1H8BJR6      KGKK---------------
R9H6G0          KGKK---------------
A0A412GR09      KGKK---------------
A0A7J5JXN6      KGKK---------------
R6D982          KRKKESV------------
A0A1F0I8C4      MKKRMKR------------
A0A3A5RIJ2      MKKRMKR------------
A0A515IZJ5      MKKRMKR------------
A0A7J4Y2H6      MKKRMKR------------
A0A4R6WE41      IFG----------------
A0A2T5RP38      FKRS---------------
A0A1A6CF06      FKRS---------------
A0A1T3D6S8      FKR----------------
A0A8B4GMS2      FKR----------------
A0A7Z7LUP7      FKR----------------
A0A0B8T471      LFRR---------------
A0A4R7D2K0      LFQR---------------
A0A7T9S3V1      IRS----------------
A0A7T9LVI2      IKGL---------------
C2FUH6          IKGL---------------
A0A1V3N3U3      IKS----------------
A0A1P8E011      IKH----------------
A0A7T9S8K4      IKH----------------
A0A2X2J8S4      VFNK---------------
A0A3C0S618      VFNK---------------
A0A4P7DRF9      FKKR---------------
A0A239XXC4      FGKK---------------
A0A4U9K473      -------------------
A0A081PBV5      LFGKR--------------
A0A1I2AN85      LFGKR--------------
A0A4U0GMP3      -------------------
A0A0D5BSQ0      FKRS---------------
A0A1T3F6P5      FKRS---------------
A0A853VUQ0      FKRS---------------
A0A7X0MJ00      LSSKIFG------------
A0A841JHZ0      LKSKLFS------------
A0A1H6CKR6      LLGR---------------
A0A7W3MGA7      LFGKN--------------
A0A3M1Y2F5      -------------------
A0A7V1ALN2      SNLLQSEQKKIRKTHHEEN
A0A3D4RLG4      -------------------
A0A2T2UAJ4      AWWGG--------------
A0A6I0DZQ5      -------------------
A0A1H6Z2F8      -------------------
A0A2P8G5K0      -------------------
R5DEG6          -------------------
A0A4Q3SEI4      -------------------
A0A836SQI2      -------------------
A0A7V1FAJ9      -------------------
A0A3N2LCI3      -------------------
A0A6H9Q899      -------------------
A0A3D4CJE1      KAIFNKK------------
A0A7C7LI79      RKIFRS-------------
A0A4Q5ZQ60      KDKFKKA------------
A0A519Q885      KRLFS--------------
A0A519TAP8      KSFFS--------------
A0A848Y4B8      -------------------
A0A7Y4V8Y1      LVKI---------------
A0A5Q4EKA0      IL-------GLGSKKL---
A0A519SYE7      ---------GMGY------
A0A7C7CFR2      LFGRTLIQRGFWH------
A0A7W1G0I5      -------------------
A0A2T4XEQ1      -------------------
A0A2K8ZAP1      -------------------
A0A3D3LSK1      -------------------
A0A496L711      KIRNIKK------------
A0A348PT57      KLKNDDN------------
A0A847AMH6      -------------------
A0A7C3PTI0      -------------------
A0A7V1FAS7      -------------------
A0A7V0M115      -------------------
A0A7C1IBE4      -------------------
A0A3D5KRM7      -------------------
A0A831LDA6      -------------------
A0A833B0I1      -------------------
A0A1V5S5I3      -------------------
R7JFY1          -------------------
A0A2M7VVW6      -------------------
A0A413V760      -------------------
A0A3M1NUH2      -------------------
A0A2T2TDL4      -------------------
A0A359ATS6      -------------------
A0A1V6HYH8      -------------------
A0A7X7LGP1      -------------------
A0A838FHH6      -------------------
A0A7Y4VJX2      -------------------
A0A3D1AEJ6      -------------------
A0A7K3KYQ2      -------------------
A0A2E0MDX6      -------------------
A0A2M7KCE1      -------------------
A0A523GUD4      -------------------
A0A7V5RHV9      -------------------
A0A641X2Z6      -------------------
A0A6L8U2P8      -------------------
A0A7C6G639      -------------------
A0A519PJW5      -------------------
A0A519T3R9      -------------------
                                   

© 1998-2022Legal notice