BYKdb

Dataset for cluster orphancd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

200 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A519SD85      ------------------------------------------------------------
A0A3M1TXY5      ------------------------------------------------------------
A0A2E0VQ27      --------------------------------MTFNKEYKMIIRPLLKA------SPVLI
R6U429          ------------------------------------------MRDLASF-----------
A0A5C8AF42      ------------------------------------------------------------
A0A239K409      ----------------------MVMIDKEAQKMGNRQNEQESFIDSFFK------YVRYW
A0A350V3E4      ------------------------------------------------------------
A0A1V5S1J9      ------------MDNNQQYTQNQYTSQANAFSDDDGGGQKFDIMLWVLR------FLKSW
A0A0A2EYC8      -----------------MENTNN-IPNIQTFSEEE-ASS-FNLMEWVMR------FLKYW
A0A2G6H6Y4      -----------------METSNNQIQSMQQFSEEDNTSS-LSVMEWIMR------CVRYW
A0A1M3DPL8      -----------------MNMEEENKDIKTSDFTDEESS--FDIMEWVML------FVSHW
A0A1V5F519      --------------------MNPDTGSINQNFTEEESS--FDFQKWLHL------FIKNW
A0A2G6R1T9      --------------------MEENSLNQQQFDDSEESG--FDFMSWVIL------LVQYW
A0A1M6MYT6      -------------------MKKQQNDKDILNFYGQLEEESLISKKTLFK------CFRNW
A0A2P8CDS1      ----------------------MDTQNPLTPNQPTTFSRPRNYRKYFFL------LLSHW
A0A353WYK7      ----------------------------------MEQNQQFDFDKLQMV------FKRSL
A0A355BP94      -------------------------MSKQLNSPTTDPIEGFDLDKLWVL------LKKNA
A0A136LSC7      -------------------------MLQPKEIGP--QVQSIDTEKLSAV------IRKNL
A0A5C7N8Q5      ------------------------MLKEPKDIGPLTEVQSIDTEKLAAV------FRKNL
A0A2W4RDE8      -----------------------------------MEEEKINIKKIFHK------LISKW
A0A0L8VEV2      ------------------------MKTMEDFSKSLEREDMLAIKKFFHK------LKRNW
A0A1I2A9Z9      ------------------------MKTMEEYSNSLEREDMLSVKKFFHK------LVRNW
A0A212J9Z9      -------------MDNN--NKKVIESDPYFEEVKTKTNISFDFVLWFYR------ILKYW
F5IV23          -------------MDNN--NKKVIESDPYFEEVKTKTNISFDFVLWFYR------ILKYW
F8X2T0          -------------MDIN--NKPGADTDPYFEEIKSKTTLSFDFVLWFYR------ILKYW
A0A1M3LAG1      -------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVLWFYR------ILKYW
A0A212K6G4      -------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVLWFYR------ILKYW
A0A4Y9IPG7      -------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVLWFYR------ILKYW
A0A2V3PNY7      -----------MEQNIN--RPADFGTDPYFDEVQAKTKFTFDFVLWFYR------ILKYW
A0A6G7WQ31      -----------MEQNIN--RSPDFSTDPYFDEVQAKTKFSFDFVLWFYR------ILKYW
A0A6G7X5K8      -----------MEQNIN--RSPDFSTDPYFDEVQAKTKFSFDFVLWFYR------ILKYW
A0A1M5DFS8      -----------MEQNINTTRPNDYGADPYFDEVQAKSKFSFDFVLWFYR------ILKYW
A0A4Y8KZS5      -----------MEQSLN--KPNDFGTDPYFDEIQAKTKFSFDFVLWFYR------ILKYW
A0A142HHS5      MASTENAELEELIRRASTGGEAAPPTGASFAEEDTEDGDNFDLSTLVLV------ARRSL
A0A660LQT8      ------------------------MEDKDNITPSQETKNGVDIVDVLYL------CLDRW
A0A350PNH9      -----------------MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYL------CLVRW
A0A354LNT9      -----------------MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYL------CLVRW
A0A2M6GH67      ------------------------------------------FITLLVV------TRKSL
A0A389LWV6      --------------MESTNTKSTNFSIDDTNFQHPGNTSSFDLVLWIFR------ILKYW
A0A1G9B1T9      ------------------------METSRYSHTQALKSDPIDLSVITKK------IIRKW
A0A161LWY6      ---------------METNNNNQYQNYPLSNSDMEEDESGFDIIEWLFK------ILRHW
A0A6I3N9U6      ---------------METNNNNQYQNYPLSNSDMEEDESGFDIIEWLFK------ILRHW
A0A3D0FMX4      --------------------MATDTNVQNQDFTNQDDRIQFDVMEWVFK------FLSVW
A0A1M3MEI8      ---------------------MEQPVKPRERVIPEEEESGFDIMEWVAH------FIGHW
A0A1J5HQM0      ---------------------MEQNKPANP--FSEEEESSFDIMEWVNI------FLHFW
A0A653AC35      -------------------MEENPYNTQYPQQFTEEEESSFDIKEWAFL------FLHYW
E4T131          ---------------------MDKFNLEKP--FNSEEESGFDIMEWVSY------FLNNW
A0A521H707      ----------------------------MAKKKISNLNEEFDFKLFTII------ARKNA
A0A1F3D6P8      -------------------------------MTKETDSGIALIKHYLQD------IAYFK
A0A356Z058      -------------------------------MTKETDSGIALIKHYLQD------IAYFK
A0A3D1BT36      -----------------------------MSKNNETKSESLKIKEFIFK------VFSYK
A0A352ME00      -----------------------------MLKTIEPDSSIAPLKYFILK------VASLK
A0A3D3HL11      --------------------------MQLMTNNNDSQSEAFNIKEFLAE------ALSYK
A0A5R9QZP0      -----------------------------MSLNNNHPEEGFNIKEFILL------TFRYK
A0A2W7RD29      ------------------------MNNKSESDPLLLSSQKIDFSVFFKR------LGKKW
A0A3N2NDY8      ------------------------MSDNINVTQESEAAEEFSLKDFLAC------CLSKW
D7JEV9          ---------------------MEQNNNISNNTFNEEETSSFNFMEWAIR------FLKYW
A0A4R6H3B7      ------------------------MKTMEEYSNSLEREDMLSVKKFFHK------LVRNW
A0A2W7QSQ0      --------------------------MRKINKKVNSNEEPINIKLILRT------ILKSW
R7F6L5          ---------------MANQIKENEAANISPYYEQAAPASLVSVQGFLSF------VRHRW
A0A553GA49      --------------------------------MNLENDQSNDLKNVLHK------VGKHW
A0A497D6F6      ------------------------------------------------------------
A0A5M4AAB9      ------------------------------------------------------------
F4KR18          ----------------------MNEFEYPKAILLNSNLKDSSDSQVDYWGLLHKFILSKW
C9LKL0          -------------------------MEYSQKNEVQNSEFKIVPFLLLCY----HVFLAKW
A0A3D0QPV7      --------------------MIDEKIQRQSESFSQYKERITNFSNEFELGLFLYIARKSL
A0A496KT23      ----------------MQRSAENFSQNSSFISQTSSVSILELLRDAWLL------CLAHW
L1M9T3          -----------------------------------------MVRDGFYL------CLAHW
A0A3C0I8F1      ---------DYFVKKIIPPTTVFLERNHENINKILEESEGMDIVNDFDFEKFVEILRGSI
R5JJI4          --------------------------MIRDDSKGGSISESTAFADISF------------
A0A3D2HF71      ------------------MTSPSPLNNPSQPYYIPPEEEGLDFKRYLSL------FISNW
A0A0A2DQN2      ---------------------------------MIRQVSDVNLLDVLRY------LVSYW
A0A0A2F2N5      ---------------------MTPQSSSKQTKSAGTVVADINLIDLFFY------LLGYW
L1NGW4          ----------------------MANTQETTSTQPAEKGLEVNLVDIFFY------LLRFW
Z4WRA0          ----------------------MANTQETTSTQPAEKGLEVNLVDIFFY------LLRFW
U2K8K9          ------------------------MPEQQITNRPSDKGADLNLVDIFMY------LYRYK
A0A069ZM60      -----------------------MSTQTNRSNQAGEKAAEVNLLDIFFY------LLRFW
J6GV98          -----------------------MSTQTNRSNQAGEKAAEVNLLDIFFY------LLRFW
A0A134B4F8      -----------------------MSTQTNRSNQAGEKTAEVNLLDIFFY------LLRFW
A0A134B8C7      -----------------------MSTQTNRSNQAGEKTAEVNLLDIFFY------LLRFW
A0A4Z0EKR0      ------------------------MTNDELFPLKTEQPETADLKSVLLS------YARYW
A0A229I3A5      ------------------------------MARPNQEEDFIRIQDLLYL------CLTQW
A0A3R6HJB3      ------------------------------MARPNQEEDFIRIQDLLYL------CLTQW
B5CTK0          -----------------------MAEKKQATDLLKGEDSSFNIGEILHM------FLSNW
A0A1M6B6D5      ---------------------------MSEEFETNEAGTTFDFKGFLIR------LLRNW
A0A451FS66      ---------------------------MNQEFDIKQADGSFDFKGFFDR------LLRSG
A0A2E3GN39      ------------------------------------------------------------
A0A3D1MEL0      ------------------------------------------------------------
F0R0C9          ------------------------MAIPNNPTRPKQGDDFIRIQDLFYL------CLAKW
A0A2A4N9A6      ----------------------------MKENQIQNPLPDLDIGLLIGI------FRKSF
A0A6C0GGI1      -------------------------------MANQPNESKLDLKQLFSR------YFTKW
A0A368D1N7      -----------------------MSEPSKKKQQSSVLYDKFNVGLLLYV------LRKSF
A0A3B8TU58      ------------------------------------------------------------
A0A1T5IIR6      ---------------------------MKTAPRKVTRNEQVNLVDLFYY------LIGNW
A0A3E0QD27      --------------------------MGKKKITNLNEEFDFKLFSIIAK------KNAYW
A0A0M1W1I6      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A4R4GHU2      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
I8WPR6          ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A0K2HKS3      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
B6W3W8          ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A4R4GSI6      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A076IRY8      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A3A6AD54      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A3A6MIU7      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
I8WPP8          ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A372Y7D2      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A3E4JJC9      ------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMY------LLSNW
A0A3E4WDQ0      ------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMY------LLSNW
A0A414H9P2      ------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMY------LLSNW
C3R5A8          ------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMY------LLSNW
A0A1C5XJA7      ---------------------------MQNNIQSNKNDQNINLLDLLMY------LASKW
A0A3E5BU42      ---------------------------MQNNTLSNKNEQSINLVDLFVY------LLSKW
R7CUW4          ---------------------------MQTTSNNNRNEQGINVVDLLVY------FASKW
A0A416GGJ1      ---------------------------MQTNKKVDSG---LNLIDVFSF------LASKW
D1JY72          ---------------------------MSGDKTLSGGGFNINPVDIIMY------LLSKW
D7J4K6          ---------------------------MQNNSLSNKNEQGVNLVDLSVY------LLSKW
Q8ABP9          ---------------------------MQNNSLSNKNEQGVNLVDLSVY------LLSKW
A0A5M6AHF7      ---------------------------MQNNSLSNKNEQGVNLVDLSVY------LLSKW
D6D2Z5          ---------------------------MQNNSLSNKNEQGVNLVDLSVY------LLSKW
A0A1T3EDR4      -----------------------MIRNSKYINIRGTWGENFHILDLFKY------ALGYW
A0A174SDD8      -------------------------MEKHKKLAVTEEEKSINIVDLFIY------LLVHW
A0A1H7RFH3      -------------------------MEKHKKLAVTEEEKSINIVDLFVY------LVVHW
A0A139L1N2      -------------------------MEKHKKLAVTEEEKSINIVDLFVY------LVVHW
A0A174TVL8      -------------------------MEKHKKLAVTEEEKSINIVDLFVY------LVVHW
A0A1H8BJR6      -------------------------MEKHKKLAVTEEEKSINIVDLFVY------LVVHW
R9H6G0          -------------------------MEKHKKLAVTEEEKSINIVDLFVY------LVVHW
A0A412GR09      -------------------------------MAVTEEEKSINIVDLFVY------LVVHW
A0A6I0S0M4      -------------------------------MAVTEEEKSINIVDLFVY------LVVHW
A0A081PBV5      ----------------------MDNLNNINLMPKAKEEKSINLLDILKY------LLFQW
A0A1I2AN85      ----------------------MDNLNNINLMPKAKEEKSINLLDILKY------LLFQW
A0A4U0GMP3      ----------------------MENSAATNYLVQEKEEKSINVIDILKY------LLFHW
A0A1H6CKR6      --------------------------MNKDFLIKDKQTQSINVLDVLKY------LLSNW
A0A235E1C0      ---------------------MVNHSTNKPFQGKGKQDQSLYVLDILRY------LLANW
R6D982          -------------------------MEKQVKKILAEEDKSINLVDILMY------LLSYW
A0A1F0I8C4      -------------------------MEKQRKLALTEEEKSVNIVDVFMY------LIAHW
A0A3A5RIJ2      -------------------------------MALTEEEKSVNIVDVFMY------LIAHW
A0A515IZJ5      -------------------------------MALTEEEKSVNIVDVFMY------LIAHW
A0A5M5NLR3      -------------------------------MALTEEEKSVNIVDVFMY------LIAHW
A0A0D5BSQ0      ------------------------MINQNKQNV--QKDGIINVLDILKY------FLFHW
A0A1T3F6P5      ----------------------MDTINQKNQVVGNKKEHSVNVLDILKY------LLHNW
A0A0W8EPA0      ----------------------MDTINQKNQVIGNKKEHSVNVLDILKY------LLHNW
A0A365UKN1      ----------------------MDTINQKNQVIGNKKEHSVNVLDILKY------LLHNW
A0A4R6WE41      ----------------------MVKNKDTEGVVQEQRDPSLNVLDVLKY------LLSYW
A0A2T5RP38      ----------------------MNTLNQKEYRIGERKEQTINVLDLLKY------LLHNW
A0A1A6CF06      ----------------------MNQYSKNSV----QKENTINVLDIFKY------LLFHW
A0A1T3D6S8      ----------------------MNQYNKHSV----QKENTINVLDIFKY------LLFHW
A0A1P8E011      --------------------------MKTTHYNQLQKDKSINVLDVLAH------LLYHW
A0A1V3N3U3      ----------------------MNNILERTGAGAERKNNSVNVLDIFKY------LLFHW
C2FUH6          ------------------------MVNNQITQNITKADKSVNIIDLFKY------LMIHW
A0A0B8T471      ---------------------MDNTNYNPYIESREKEGKSLNLIDLIKY------LLLHW
A0A4R7D2K0      ---------------------MDNTNYNPYIESREKEGKSLNLIDLIKY------LLLHW
A0A2X2J8S4      -------------------MENRPEVVNNQFFGA-KNNSTFNVLDIIKY------LLFHW
A0A3C0S618      -------------------MENRPEVVNNQFFGA-KNNSTFNVLDIIKY------LLFHW
A0A4P7DRF9      -----------------------MSKISNTYMQK-QQEKSINILDLFRY------LLANW
A0A239XXC4      --------------------------MNKSFQGKGKQDQSLYVLDILRY------LLGNW
A0A4U9K473      --------------------------MSKPFQGKGKQDQSLHVLDILRY------FLSNW
A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A6A1IRV5      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A642EJV3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A519SD85      ------------------------------------------------------------
A0A3M1TXY5      --------L---------------------------------------------------
A0A2E0VQ27      GLITIAILVTRRA------VTYMTPEYRAGGAIKINN---------------LNYTQAAI
R6U429          ----------TGG-LSRMRSSGS-------------------------------------
A0A5C8AF42      -------------------------------VIQLDN----------------QDNAKDI
A0A239K409      YLFLLGLLI-TVG-TAYVYIQHATPLYLISGTLLIKT----------------SGNEGQL
A0A350V3E4      MPILLSLAV-GLV-VSYFYAYSQVDIYASASSMRLSK----------------PKENVLE
A0A1V5S1J9      YLFVISLAI-FLS-IAYVKNRSWQPNYKSSALVIIEE---------NKGLSGAQAALMQG
A0A0A2EYC8      YLFAIGVVI-ALT-IAYYQNRSFVPIYNSSLRLLLK----------QE---SGSFLSMQN
A0A2G6H6Y4      YLFVIGASI-GFG-LAFYKNQKVVPNYLSYSQILLED---------KK---ADSFATLQN
A0A1M3DPL8      YLILISVFV-FMF-LAYMQNRKWLPSFKSSATVIIDE---------SRGSMNSAQVLMQG
A0A1V5F519      YLFLIFIPF-FLI-GGYLKNRSWMPLYQSVGTIIINE---------NKYR-SSSQGFMQG
A0A2G6R1T9      YLFVIFGVL-AFG-ASYLKNRSWVPVYFSSGKLMIDP---------NAGQ-NNPQ-FMQG
A0A1M6MYT6      YWYVVAVIV-AGA-LAWLYVQYTTSVYEIKSSMLVEE------GKSGSPLGSGGANSENI
A0A2P8CDS1      YWFVIAFIL-TVT-GIWLYYRYSHPVYAVSSTMLIHE------QQNQNPLTTQKDPESNV
A0A353WYK7      PVLIMLLIF-SVA-TAYLTIRYTKDLYQSESVLQLDI---------------KSEAQVLG
A0A355BP94      LIIILLFLS-TNL-IAYLKIRWTKDEFESYSELKLEV---------------KQDATALG
A0A136LSC7      VWIVLIFIA-VNL-AAYLTIRYTKDLFESESEMKLDI---------------KRDATELG
A0A5C7N8Q5      IWIILIFIA-ANL-AAYLTIRYTKDLFESESEMKLDI---------------KRDATELG
A0A2W4RDE8      YYFPLGLLI-TMP-LAYAYIQLTEPRYLVRASMLLKG---------EK-----DKGPSQF
A0A0L8VEV2      YWFMIAGII-GGA-GGYLLTQVTPPSYELNSLFLIKK---------KD-----NAQVQLD
A0A1I2A9Z9      YWFMIVGII-GVG-LGYLKTQVTAPAYKLESLFLIKT---------DN-----KGGLRMD
A0A212J9Z9      YLFIISVAL-FLG-YAYIKNKSWVPVFYVQALMILED----------------RNTASVV
F5IV23          YLFIISVAL-FLG-YAYIKNKSWVPVFYVQALMILED----------------RNTASVV
F8X2T0          YLFVISVVL-FMA-YAFIKNKSWVPLYGIQAMIILED----------------RGSSMIS
A0A1M3LAG1      YLFVISIAL-FMA-YAFIKNKSWVPFYGIQAMIILED----------------RGSSMIS
A0A212K6G4      YLFVISIAL-FMA-YAFIKNKSWVPFYGIQAMIILED----------------RGSSMIS
A0A4Y9IPG7      YLFVISIAL-FMA-YAFIKNKSWVPFYGIQAMIILED----------------RGSSMIS
A0A2V3PNY7      YLFALSLAL-FLG-YAYIKNKSWTPLYQSGAVLMMES----------------RGNAGVA
A0A6G7WQ31      YLFAISLAL-FLG-YAYLKNKSWTPLYQSGAVLMMEQ----------------RGNSGVA
A0A6G7X5K8      YLFAISLAL-FLG-YAYLKNKSWTPLYQSGAVLMMEQ----------------RGNSGVA
A0A1M5DFS8      YLFVLSLAL-FLG-YAYLKNKSWTPLYRSGAVLMMES----------------RGNSGVA
A0A4Y8KZS5      YLFILSLAL-FLG-YAYLKNKSWTPLYRSSATLMMEP----------------RGNNGVA
A0A142HHS5      PWVIFLLTL-GIT-SSWLYMRYTKPIYEATSILKIDD-----------------HSDASA
A0A660LQT8      YWFVVSVLL-FLG-LGMYMILRTPPVYNRYASVLIKD----------------NQSSKNT
A0A350PNH9      RWFVISLVV-TLG-IATYHLLSTPCVYQRTASILIKE---------DGKSQSINSDVASM
A0A354LNT9      RWFVISLVV-TLG-IATYNLLSTPCVYQRTASILIKE---------DGKSQSINSDVASM
A0A2M6GH67      IWIVFLIML-GLG-ASYLFLRYTKPVYRSSSTLKIDE----------------RSQAGAL
A0A389LWV6      YLFLVVILL-SLS-LALLKNKTWTPTYKTSSTILINE---------NK-----GQQVSDL
A0A1G9B1T9      YLLLGSLLL-TLA-LAYVVILTTPEVYKVSSSMLVRD---------ES-----ATGNQQF
A0A161LWY6      YLFVIALAI-SLS-ISFIANRTWKPSYQVSARVIL------------------GGGQASA
A0A6I3N9U6      YLFVIALAI-SLS-VAFIANRTWKPSYQVSARVIL------------------GGGQASA
A0A3D0FMX4      YLYVICLAI-AFG-ISIYSNRKWVPTYRTAGTLIINE----------------Y---GSQ
A0A1M3MEI8      YLFVIGLVI-AFG-LSYMQNRKWLPEYKSTGSVIIDD----------------S-RTMMN
A0A1J5HQM0      YLFVIFVII-SLG-MAYLKNRTWIPSYKSAGTMLIEE----------------Y--KITN
A0A653AC35      YLFVIFIAL-ALG-AAYLKNRSWIPSYQSTGTLMIEE----------------S-SRNNS
E4T131          YLFVIGIIL-SLG-LAYIENRSWLPTFQTEGRVLIDE----------------NRSSNAN
A0A521H707      YWLFLLLTI-SST-FAFLYLRYTHPIYLSQATLKIGT----------------VNTASAV
A0A1F3D6P8      YFYIICLVI-LLT-VAFLFNKYSSRLYEVKASIGPVQ----------------NDASSLL
A0A356Z058      YFYIICLVI-LLT-VAFLFNKYSSRLYEVKASIGPVQ----------------NDASSLL
A0A3D1BT36      YYFISSIIL-LGL-MAFLLNKFTPAVYEVNSIIGPVE----------------NKQSSLL
A0A352ME00      YLYMALIVL-CLA-IAFFYNHFSKKVYEASASLSPVE----------------DKTSSLL
A0A3D3HL11      YFYIASFFI-CLL-IAFLVNRFSPTVYEVNSVIGPVE----------------DRRSSML
A0A5R9QZP0      YLYLLSIVV-FLL-LGYTYNKFVPTVYQVNSVIGPVE----------------DRRTTFL
A0A2W7RD29      PLFLLTGII-CLF-IAHTSYKSTVTTYEINSKLFIYT----------------EGQSINF
A0A3N2NDY8      RWFTVSIVL-FCC-LGVLYVLRQQPVYSRSMELLIKDQDGGGGVADIS-----NAFSSLG
D7JEV9          YLFVLGVFI-SLA-IAYYQNRSFVPIYNSSLRMLLKQ---------EA-----GSLSYMQ
A0A4R6H3B7      YWFMIVGII-GVG-LGYLKTQVTAPAYKLESLFLIKT---------DN----KSSNLRMD
A0A2W7QSQ0      YLFPIFILL-FCG-VAYYYIKTITPEYLISSVIIIKE------GERNN-----NVTENSI
R7F6L5          YWYVISVAV-CVG-IAWLMLARSPRLYTKSETILIKD---------PT---FGNSASSVD
A0A553GA49      KLYVISITL-FLGIGVLFNKFSEPKVNISAKLVVHES--------RRN-----MIDPSSF
A0A497D6F6      -----------VS-IAYVYKRYATPIYEITSSLLLEV------GNSNSPLTNKNANEDNV
A0A5M4AAB9      -----------------MYYKYTHPIYEVSASILIEE------QQNQNPLITAADKQPNV
F4KR18          YLYLAFSII-CIG-LAYVYYKNQQPVYAITSKLLIRE------RERDY-----GPGADFV
C9LKL0          RWFAFSIIV-CVA-CGWYYQQIQPRVYTRQATMLIEGGNGSGRGGFSS-----SRNRGSG
A0A3D0QPV7      RWVLLFLITSLLA--AWLYLRYTPPVYESLSVIQISE---------EN-----------N
A0A496KT23      KWFLLSVIVCLGG--AYYHLLRTPKTYVASASILIKP---------DN-----NRGNSPD
L1M9T3          KWFVLSLLVCLSS--ATYYLLRTPKTYVASASILIKP---------DS-----NKGNTPD
A0A3C0I8F1      PFIILIVGLSLGGSYLFLRYTKALFQSSSDLRLSIRD----------------EAQPGGL
R5JJI4          ----------LGG-KR--------------------------------------------
A0A3D2HF71      YWFAGALLI-ALS-IAYSINRWSEDVYSVSSTLLIKD---------EQLMGGLSSGTTTL
A0A0A2DQN2      KWFVLSVLI-CAG-YMYYRSAQQPYTYMSEVTVIIQD---------PS-----QRTSIDF
A0A0A2F2N5      KWFLLSILL-CTG-YMYYKSAKQAYTYESVVTVIVRD---------PA-----QRTSIDL
L1NGW4          YLYVICVGI-VVA-FALYRTAKQPYIYEASVKVFIKD---------AS-----QRSMMDA
Z4WRA0          YLYVICVGI-VVA-FALYRTAKQPYIYEASVKVFIKD---------AS-----QRSMMDA
U2K8K9          FLYILCVGI-VVA-LALYRNARQPFTYEGVVKIFIRD---------AS-----QRTMVDD
A0A069ZM60      WLYLLSVGV-VLA-VALYRNAKQPYVYESSVKIFIKD---------AS-----QRAMMDT
J6GV98          WLYLLSVGV-VLA-VALYRNAKQPYVYESSVKIFIKD---------AS-----QRAMMDT
A0A134B4F8      WLYLLSIGV-VLA-VALYRNAKQPYVYESSVKIFIKD---------AS-----QRAMMDA
A0A134B8C7      WLYLLSIGV-VLA-VALYRNAKQPYVYESSVKIFIKD---------AS-----QRAMMDA
A0A4Z0EKR0      YLFLIAVALCLGA-AFIYLRYYTVSVYSVYSTLLIKD---------EK-----TGQNLSN
A0A229I3A5      RWFILSLVV-TCG-IAIYYNLTTPNVYQRTASLMIKD---------ES-----KAQGIGG
A0A3R6HJB3      RWFILSLVV-TCG-IAIYYNLTTPNVYQRTASLMIKD---------ES-----KAQGIGS
B5CTK0          YWFLVSVIL-CLF-FGWYTLQKAIPTYKRMATVLIKD---------NS-----SGSMSES
A0A1M6B6D5      PLFLIFLAI-TFS-IAYYINVRKLPVYLIENLVSIRD---------DQ-----NPFFTSN
A0A451FS66      PLFLISFLI-TFS-IAYYFNIRKLPIYQMENLVAIKD---------DQ-----NPFFTTT
A0A2E3GN39      ------MLL-SSG-VAHIFLHFSTRIYSSKGVLIHIA---------GE-----EKQSLLG
A0A3D1MEL0      ------MLL-SSG-IAHIFLHFSTRIYSSKGVLIHIA---------GE-----EKQSLLG
F0R0C9          RWFVVSLVL-TLG-IAVYYLLTTPPVYTRAASLLIKE---------DS-----KGQSLSG
A0A2A4N9A6      LLFCLIFAM-AMF-GVWLFLRYTPPIY--QAVTHIRA---------AS-----NKAVELG
A0A6C0GGI1      YYFLISLAI-ALT-VAYFHIKLSKRVYGVSATVLIEN---------ES-----AGNKAAG
A0A368D1N7      KWFFLFMLL-SSG-IAHIFLHFSTRIYSSKGVLIHIA---------GE-----DKQNLLG
A0A3B8TU58      ------MLL-SSG-VAHIFLHFATRVYDSKGVIIHIG---------GE-----QKQNLLG
A0A1T5IIR6      YWFLLCVLL-ALG-VAYYRYSRMPFVYSSGVTAIIKN---------PG-----DELRTAR
A0A3E0QD27      LFVILTICF-TSA-FLYLRYTLPIYESRGILKIGTVN---------TA-----NAVLNIG
A0A0M1W1I6      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
A0A4R4GHU2      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
I8WPR6          YWFVLSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
A0A0K2HKS3      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
B6W3W8          YWFVLSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
A0A4R4GSI6      YWFVLSVSL-FGG-YTWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
A0A076IRY8      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
A0A3A6AD54      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
A0A3A6MIU7      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
I8WPP8          YWFVLSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
A0A372Y7D2      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
A0A3E4JJC9      YWFILSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
A0A3E4WDQ0      YWFILSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
A0A414H9P2      YWFILSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
C3R5A8          YWFILSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
A0A1C5XJA7      KWFIMSVLI-FGG-IAWYKYATAPLVYFGSATVIIKD---------PS-----SKTTTTG
A0A3E5BU42      KWFVLSVLL-FGG-LAWYHYATLPLVFFRNVTVIIKD---------PS-----NKTSTAG
R7CUW4          KWFLISVLV-CGG-LAWLSYARSPLVYFRSATVIIKD---------PS-----NKTSTAG
A0A416GGJ1      KWFLLSVLV-FGS-AAWLYYARKPFVYFRSATVIIKD---------PS-----NKTTTAG
D1JY72          YWFVLSVSL-FGG-YAWYQYAKLPFIYSRSATVMIKD---------AY-----SNNIGRG
D7J4K6          KWFVLSVLL-FGG-MAWYHYAKSPLVFFRSVTVIIKD---------PS-----NKTSTAG
Q8ABP9          KWFVLSVLL-FGG-MAWYHYAKSPLVFFRSVTVIIKD---------PS-----NKTSTAG
A0A5M6AHF7      KWFVLSVLL-FGG-MAWYHYAKSPLVFFRSVTVIIKD---------PS-----NKTSTAG
D6D2Z5          KWFVLSVLL-FGG-MAWYHYAKSPLVFFRSVTVIIKD---------PS-----NKTSTAG
A0A1T3EDR4      YWLVLSCIF-FGG-YYYYRYSKSLYVYRDKEVVMIKK---------QS-----SAPITSA
A0A174SDD8      KWFVLSILL-FGG-CFWYIYCKTPFEYSRVAIVMIKT---------PA-----NSRSTMQ
A0A1H7RFH3      KWYLLSILL-FGG-CFWYIYCKTPFTYSRVAIVMIKT---------PA-----NSRSTMQ
A0A139L1N2      KWYLLSILL-FGG-CFWYIYCKTPFTYSRVAIVMIKT---------PA-----NSRSTMQ
A0A174TVL8      KWYLLSILL-FGG-CFWYIYCKTPFTYSRVAIVMIKT---------PA-----NSRSTMQ
A0A1H8BJR6      KWYLLSILL-FGG-CFWYIYCKTPFTYSRVAIVMIKT---------PA-----NSRSTMQ
R9H6G0          KWYLLSILL-FGG-CFWYIYCKTPFTYSRVAIVMIKT---------PA-----NSRSTMQ
A0A412GR09      KWYLLSILL-FGG-CFWYIYCKTPFTYSRVAIVMIKT---------PA-----NSRSTMQ
A0A6I0S0M4      KWYLLSILL-FGG-CFWYIYCKTPFTYSRVAIVMIKT---------PA-----NSRSTMQ
A0A081PBV5      KWFLLSIFI-FGG-YYLYQYSKTPFIYSRSETIMIKT---------PL-----NTMPGTR
A0A1I2AN85      KWFLLSIFI-FGG-YYLYQYSKTPFIYSRSETIMIKT---------PL-----NTMPGTR
A0A4U0GMP3      KWFVLSILI-FGG-YYLYQYNKTAFIYSRTQTVMIKT---------PA-----NTVSTAR
A0A1H6CKR6      RWYLLSILI-FGG-YFYYQYNKTPFLYKSSQTVMIKT---------AS-----NTISSSR
A0A235E1C0      KWFLLSILV-FGG-FYYYQYSKTPFLYKKEQTVMIKT---------AT-----NSMSASR
R6D982          KWYVLSILI-CGG-YFWYDYSRTPFVYSRSATVMIKT---------PA-----NTPSAIR
A0A1F0I8C4      KWYFLSILL-FGG-CFWYFYCKTPFVYSRVAIVMIKT---------PT-----NSRSAMQ
A0A3A5RIJ2      KWYFLSILL-FGG-CFWYFYCKTPFVYSRVAIVMIKT---------PT-----NSRSAMQ
A0A515IZJ5      KWYFLSILL-FGG-CFWYFYCKTPFVYSRVAIVMIKT---------PT-----NSRSAMQ
A0A5M5NLR3      KWYFLSILL-FGG-CFWYFYCKTPFVYSRVAIVMIKT---------PT-----NSRSAMQ
A0A0D5BSQ0      KWFALSVLI-FGG-YYYYQYSKTPFVYNRSEVVMIRT---------PS-----NTPTTAR
A0A1T3F6P5      KWFALSILV-FGG-YYYYQYSKTPFVYNSSETVIVKT---------PS-----NTPTTAR
A0A0W8EPA0      KWFALSILL-FGG-YYYYQYSKTPFVYNSSEIVIVKT---------PS-----NTPTTAR
A0A365UKN1      KWFALSILV-FGG-YYYYQYSKTPFVYNSSEIVIVKT---------PS-----NTPTTAR
A0A4R6WE41      PWFLASILL-FGG-YYLYDYSKTPFMYGQAQTVLIKT---------PA-----NTPATAR
A0A2T5RP38      KWFALSILV-FGG-YYYYQYCKTPFVYSRSEVVMIKN---------SS-----NTPTTAR
A0A1A6CF06      KWFALSILI-FGG-YFYYQYSKSPFIYNRSEVVMIKT---------PS-----NTPTTAR
A0A1T3D6S8      KWFALSILI-FGG-YFYYQYSKSPFIYNRSEVVMIKT---------PS-----NTPTTAR
A0A1P8E011      KWFALSILL-FGS-YYYYQYAKSPFIYRSAETIIIKT---------PM-----NTPRTAR
A0A1V3N3U3      KWFVLSVLC-FGL-YFYYGYSKSPFIYRSTEMVMIKT---------PL-----NTPATAR
C2FUH6          KWFALSVLL-FGG-YYYYQYSRSTFMYRSSEMVMIKT---------PM-----NTPSTAR
A0A0B8T471      YWFVLSVLL-FGG-YYYYQYSKTQFLYSRSQTVMIKS---------TT-----NTLSVSR
A0A4R7D2K0      YWFVLSVLL-FGG-YYYYEYSKTQFLYSRSQTVMIKS---------TA-----NTLSVSR
A0A2X2J8S4      PWFLLSVCI-FGG-YYYYQYSKTTFSYRQASTVMIKT---------PA-----NTPSSAT
A0A3C0S618      PWFLLSVCI-FGG-YYYYQYSKTTFTYRQASTVMIKT---------PA-----NTPSSAT
A0A4P7DRF9      KWFLLSVLI-FGG-YYYYQYSKTPYLYSQSETVMIKT---------AS-----NTMVATR
A0A239XXC4      KWFLLSILI-FGG-YFYYQYSKTPFLYKKDQTVMIKT---------AT-----NSMSASR
A0A4U9K473      KWFLLSILL-FGG-YYYYQYSKTPFLYKKDQTVMIKT---------AN-----NSISASR
A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      --------------MKVTPTQYF-------------------------------------
A0A661XXA6      --------------ISLLDTSRFILSYNLGEKEFEQE-----------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A6A1IRV5      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A642EJV3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A519SD85      -----------------------------VLLSAVNSL---KYKIVF-------------
A0A3M1TXY5      -----------------------------------------DFGISY-------------
A0A2E0VQ27      NLFGEENEKNLPRQNENFLAEVEVFQTRDLIRKTLENL---HWELTT-------------
R6U429          ----------------NVYNEMEAFSSPDLMCSVVKRL---GLETSY-------------
A0A5C8AF42      IELENINSKQD-----DISSEIELMRSQFMFERAIKRT---SYNVSL-------------
A0A239K409      SESAAFSDLNTFKTSKNFDNEIEVLKSYRLMRRVLSKL---PVNISY-------------
A0A350V3E4      NKIFSDIEGELPER--YINNEVEILKSFAIREKTAASL----------------------
A0A1V5S1J9      FS---VERGYR-----NVNNQVIMFGSYELISRVIAKQP--ELTIDY-------------
A0A0A2EYC8      FNSGFSRQDQT-----NIENQILLLQSQDLIGRTIDSLP--NFKIDF-------------
A0A2G6H6Y4      YS---SRGSGK-----GVENQIVILKSWDMVTRTIDSLP--QFKIDF-------------
A0A1M3DPL8      FG---IQESYR-----NVNNQVIMISSYDLMSRVVDSLP--EFQIEY-------------
A0A1V5F519      FG---LEEAYQ-----NVNNQVIILNSYDLIGKVVDSLP--FMKVDY-------------
A0A2G6R1T9      FG---VESGHK-----NMANQVILLTSRDLISQVVDNLP--EMRVEY-------------
A0A1M6MYT6      FLGLGMMNSMR-----NIHNQIAVLSSTPIVSRTLDEL---DFSVNY-------------
A0A2P8CDS1      FQGFGLFQGKQ-----NTENQIQILKSWTQVRTTLEHF---NFEATY-------------
A0A353WYK7      FRSF--DEDIN-----NLSKEIELLKSKLFFTRVAEVI---NNDVNV-------------
A0A355BP94      IKQFAEDQNRN-----LVAGEIEQMKSKLFFSRVLDSL---DLGISY-------------
A0A136LSC7      IKTYMEDQNVN-----QVSGEIEQIKSKIFFNQVLDSL---DFEVSY-------------
A0A5C7N8Q5      IKTYIEDQNMN-----VVSGEIEQIKSKLFFNKVLDSL---DLSVSY-------------
A0A2W4RDE8      LKGMELFQSAT-----DLEDEIGIIKSFSNVESAIKRL---NFGISY-------------
A0A0L8VEV2      LPFSNAMGGNI-----NLLNHIGILTSHSINRQVLENL---DWTTSW-------------
A0A1I2A9Z9      FPLPSAFGGNI-----NLQNNIGIITSYSINRQVMENL---DWSTSW-------------
A0A212J9Z9      AGSVPTGTLLR-----NTENQQIVLKSYGLTERTVKSLPA-KMRIEY-------------
F5IV23          AGSVPTGTLLR-----NTENQQIVLKSYGLTERTVKSLPA-KMRIEY-------------
F8X2T0          -GAVPLGSILR-----NTENQQIVLESYGLTERTVKNLPK-KMHIDY-------------
A0A1M3LAG1      -GAVPLGSILR-----NTENQQIVLESYGLTERTVKNLSK-KMHIDY-------------
A0A212K6G4      -GAVPLGSILR-----NTENQQIVLESYGLTERTVKNLPK-KMHIDY-------------
A0A4Y9IPG7      -GAVPLGSILR-----NTENQQIVLESYGLTERTVKNLPK-KMHIDY-------------
A0A2V3PNY7      IGSVQLGTLVQ-----NSINQQMLLNSYDMVVRAVAKLP--QMRVDY-------------
A0A6G7WQ31      MGAVQLGSLVQ-----NSVNQQMILNSYDMVVRTIAKLP--QMRVDY-------------
A0A6G7X5K8      MGAVQLGSLVQ-----NSVNQQMILNSYDMVVRTIAKLP--QMRVDY-------------
A0A1M5DFS8      MGAVQLGSLVQ-----NSVNQQMILNSYDMVVRTVAKLP--QMRVDY-------------
A0A4Y8KZS5      MGSVQLGSLVQ-----SSVNQQMILNSYDMVVRTVGKLP--QMRVDY-------------
A0A142HHS5      LGLGMAMGGAENNQASQLAGEVELIKSGLTYKRLKQTV---PLDINY-------------
A0A660LQT8      SIDQQLAQIGVGKAS-NVNNEMLAFQSPALTENVVRRL---KLDVNY-------------
A0A350PNH9      FSDMGISGGKS-----NVNNELIAIQSPAVLLEAGKQL---KLDVNY-------------
A0A354LNT9      FSDMGISGGKS-----NVNNELIAIQSPAVLLEAGKQL---KLDVNY-------------
A0A2M6GH67      GLGGPLGNAAAEQNMVSLSGEVELINSDIIYRDLKENL---NLKVNY-------------
A0A389LWV6      TTGFAVSQGLR-----NVNNQMIMYGSYDLISKSVDKL---DISTDI-------------
A0A1G9B1T9      MEGIGLFEPQT-----KISDQTAMLTSFDIIRRTLEKL---DFGVTY-------------
A0A161LWY6      SQQMVMQGVNLNMAYKNNDNQMIMFTSNDLVERAINKI---NANVDY-------------
A0A6I3N9U6      SQQMVMQGVNLNMAYKNNDNQMIMFTSNDLVERAINKI---NANVDY-------------
A0A3D0FMX4      ASNALMQGFGVDVGYRNVNNQVIMMGSYDLMCRVVDSLP--FMRTDY-------------
A0A1M3MEI8      SAQVMMQGFGIQDAYRNVNNQVIMLGSYDLLGRVVDSLP--ALSIDY-------------
A0A1J5HQM0      NTQAMMQGFGVDAGYKNTRNQIIMLSSYDLIGRVVDSLP--QMRVDY-------------
A0A653AC35      GSQVLMQGFGVQSGYRSLENQRYILTSYDFISRVVDSMP--SLNIDY-------------
E4T131          SSQALMQGFGIQSGYKNAKNQIIMLGSNDLFSKVVDSLP--FLKVDY-------------
A0A521H707      LNIQNSQALDILGSNQ-FAGDIELLRSRVMISRVLDRM---PLDVGY------FAHGKVI
A0A1F3D6P8      TSNDLFMGLKALQSNRNLESGISNFISFPTVSSTISSM---NLEIGY------FREKHHL
A0A356Z058      TSNDLFMGLKALQSNRNLESGISNFISFPTVSSTISSM---NLEIGY------FREKHHL
A0A3D1BT36      ESSDIFSGLGSLSQSRNLENDINSLKSFSLISETIKNL---ALEIGY------FIESDDI
A0A352ME00      KSNELFSGIQSLESLRNIENDIKNLSSFELVYSTVNSM---NLEVSY------FSESKKL
A0A3D3HL11      GSNDLFSGLGALAESRNLENDINSLNSFSLVATTIRSM---NLEVGY------FAGKNTI
A0A5R9QZP0      ESSRQFSVLGSQSQTSNLENDMNSLSSFSLVSKTIKDL---GLEISYYEQPVRFANKKSL
A0A2W7RD29      FEKLQNVTNSQNV---LLDNEVVIIKSNPVIKSTLEVL---DLKVGY-------------
A0A3N2NDY8      LVSSNT----------NVNNELISLSSPAVMYEVVKNL---GLDVNY-------------
D7JEV9          GQGFNSVMNRLDQT--NIENQILLLQSQDLIGRTIDSLP--KFRVDF-------------
A0A4R6H3B7      FPLSSAFGGNI-----NLQNNIGVITSYSINRQVMENL---DWSTSW-------------
A0A2W7QSQ0      VSDLENMKSTI-----TVENELEKLKSKSLLMDAVIKN---KGFINY-------------
R7F6L5          LSEVGVMPKYA-----NLENEIAIFTSPDLMENVVKAY---NLNNFY-------------
A0A553GA49      MPGSELFSGRN-----TFQNSLISLNARPLLEQVVNKL---NIDVFY-------------
A0A497D6F6      FQGFGITDSDR-----NIFNQLIVLTSTPILNRTLEEL---DFDINY-------------
A0A5M4AAB9      FQGFSLFNGNQ-----NIENQIQILKSWSLIYNTLEHF---NFEVTY-------------
F4KR18          KQNINFAAAAE-----DASNEIEMLTSFALMKAVVEDL---GLETRY-------------
C9LKL0          LNTMMDFNGVTIGD--NLSNELFILTTRRLMRKVVDSL---GLDVDY-------------
A0A3D0QPV7      MKQVIPGINSFEDEQSGVDKALELMRSEFLFKKSIEKL---DFTVSF-------------
A0A496KT23      QLLARQRMIVEGASDAQMTNEILALSSATITRTVAERL---NLDVEY-------------
L1M9T3          ELLAR-RMNVESGLDAQMTNEMLSLKSVTITRAVAERL---NLDVEY-------------
A0A3C0I8F1      PIQTAPINNNA-----HLLGEIEFIKSELLHEEVIKKM---NLGLTI-------------
R5JJI4          ----------------NVDNEVLVFQSRHLMEKVARRL---HLDMSY-------------
A0A3D2HF71      FPGMEAFRSQQ-----NLKNEMGILRSFTLNYRVMQEMPDFHVDYTA-------------
A0A0A2DQN2      DFINPRQRGRA-----NIENERLILRSQRIIENALKKI---DAQVSY-------------
A0A0A2F2N5      DLVG--RRSRV-----NIENERLQLRSRVVIANAIKAI---NGHVHY-------------
L1NGW4          DVLRYMRSFRL-----NMDNEKMQMSSRRVLERAVKTV---NANVYY-------------
Z4WRA0          DVLRYMRSFRL-----NMDNEKMQMSSRRVLERAVKTV---NANVYY-------------
U2K8K9          NMLRYMRNTRL-----NVSNERIQLSSRRVMQRTVRLS---GANVFY-------------
A0A069ZM60      EMLRYARAARL-----NMDNEHVQLVSRRVLERTVKMA---NANVFY-------------
J6GV98          EMLRYARAARL-----NMDNEHVQLVSRRVLERTVKMA---NANVFY-------------
A0A134B4F8      DVLRYTRSTRL-----NMDNERMQLVSRRVMERTVKMA---NANVLY-------------
A0A134B8C7      DVLRYTRSTRL-----NMDNERMQLVSRRVMERTVKMA---NANVLY-------------
A0A4Z0EKR0      ADVLNDLSTFKATR--NIDNEIQVLRSKSLMTRVVTEL---GLFTKY-------------
A0A229I3A5      DVASMFSDMGMGNMKSNVNNELIAIQSPAVLLETGKRL---KLDVDY-------------
A0A3R6HJB3      DVASMFSDMGMGNMKSNVNNELIAIQSPAVLLETGKRL---KLDVDY-------------
B5CTK0          AVFEDIATVRAER---NVSNEMLVFKSNRLMQIVARRL---HLDVNY-------------
A0A1M6B6D5      TSLVFNWGGTSD----KVNTSVITLRSRSHNEKVVERT---QYYLTY-------------
A0A451FS66      TSLTFNWGGTTD----KVNTSVITLQSRSHNEKIVERL---QFYLTY-------------
A0A2E3GN39      LDKTLPNQDFTPT---DFQQDVRVITSPIIVNKAFSQK---GLNYVF-------------
A0A3D1MEL0      LDKTLPSQNFTPT---DFQQDVRVITSPIVVNTAFSQK---GLNYIF-------------
F0R0C9          DVGSTFADMGLFQANTNVNNELLSLQSPAVMLDVVKRL---HLHTDY-------------
A0A2A4N9A6      TFVNFLEKDKNKMLLEELQEEIAILKSVFMIKKTLTTM---NYGVSY-------------
A0A6C0GGI1      ELLEVIDAQKKYI---EVEDQIGLLTSFNMVQKAIARL---DFGVSY-------------
A0A368D1N7      LDKTLPSQNFTPT---DFQQDVRVITSPIVVNKAFRQK---GLNYIF-------------
A0A3B8TU58      FDRDFQKQ-FTNT---DFQQDIRVLTSPLVINNAYSDK---GLNLLF-------------
A0A1T5IIR6      LETYDQMINKV-----SVTNEQLQLRSLTIMTEVVKAL---DADVNY-------------
A0A3E0QD27      SNQALEVLGSN-----QLAGDVELIRSRVIVSRVVGAL---PLDVSY-------------
A0A0M1W1I6      LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
A0A4R4GHU2      LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
I8WPR6          LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
A0A0K2HKS3      LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
B6W3W8          LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
A0A4R4GSI6      LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
A0A076IRY8      LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
A0A3A6AD54      LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
A0A3A6MIU7      LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
I8WPP8          LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
A0A372Y7D2      LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
A0A3E4JJC9      LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
A0A3E4WDQ0      LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
A0A414H9P2      LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
C3R5A8          LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
A0A1C5XJA7      LDRFDNFINKV-----NVANEMLQFNSKRLIREVVSRT---HADVSY-------------
A0A3E5BU42      LDRYDNYINKV-----NVANEILQFRSKRLMREVVQRL---HADVDY-------------
R7CUW4          LDRYDNFINKV-----NVANEILQFRSKKLMREVVQRV---HADVDY-------------
A0A416GGJ1      FDRYDNYINKV-----NVANEILQFRSKRLMREVVQRM---HGDVDY-------------
D1JY72          LDRFNTY-SYT-----NVSNEILQFQSHKLMRDVVNRL---HANVCY-------------
D7J4K6          LDRYDNYINKV-----NVANEILQFRSKRLMREVVQRL---HADVDY-------------
Q8ABP9          LDRYDNYINKV-----NVANEILQFRSKRLMREVVQRL---HADVDY-------------
A0A5M6AHF7      LDRYDNYINKV-----NVANEILQFRSKRLMREVVQRL---HADVDY-------------
D6D2Z5          LDRYDNYINKV-----NVANEILQFRSKRLMREVVQRL---HADVDY-------------
A0A1T3EDR4      FLQSAE--SPV-----NIKDEMLQLQSKELLRQVIPYM---GGDKSY-------------
A0A174SDD8      LNNSDFA-GQV-----NVASEILQFKSKELMRKVIDRL---QANICY-------------
A0A1H7RFH3      LNNSDFT-GLV-----NVASEILQFKSKELMRKVIDRL---QANISY-------------
A0A139L1N2      LNNSDFT-GLV-----NVASEILQFKSKELMRKVIDRL---QANISY-------------
A0A174TVL8      LNNSDFT-GLV-----NVASEILQFKSKELMRKVIDRL---QANISY-------------
A0A1H8BJR6      LNNSDFT-GLV-----NVASEILQFKSKELMRKVIDRL---QANISY-------------
R9H6G0          LNNSDFT-GLV-----NVASEILQFKSKELMRKVIDRL---QANISY-------------
A0A412GR09      LNNSDFT-GLV-----NVASEILQFKSKELMRKVIDRL---QANISY-------------
A0A6I0S0M4      LNNSDFT-GLV-----NVASEILQFKSKELMRKVIDRL---QANISY-------------
A0A081PBV5      ITRANYY-NTV-----NVASEILQLRSKELMRKTIDRI---EGDISY-------------
A0A1I2AN85      ITRANYY-NTV-----NVASEILQLRSKELMRKTIDRI---EGDISY-------------
A0A4U0GMP3      ISRSNSY-NVV-----NVAGEILQLRSKELMRRTISRL---NADVSY-------------
A0A1H6CKR6      ITRPNNIYNSV-----NVNSEILQLRSKELMRNTIGAL---DANISY-------------
A0A235E1C0      ITRPNNFYNIV-----NVNSEILQLRSQELMRNTISLL---NADVSY-------------
R6D982          LIRSGDYMGQV-----NMATERLQFQSKALMRKVISRL---NADVSY-------------
A0A1F0I8C4      LYGSNDFMGQI-----NVASEILQFKSKELMRKVIDRL---QANVSY-------------
A0A3A5RIJ2      LYGSNDFMGQI-----NVASEILQFKSKELMRKVIDRL---QANVSY-------------
A0A515IZJ5      LYGSNDFMGQI-----NVASEILQFKSKELMRKVIDRL---QANVSY-------------
A0A5M5NLR3      LYGSNDFMGQI-----NVASEILQFKSKELMRKVIDRL---QANVSY-------------
A0A0D5BSQ0      ITRSSSA-NVI-----SVKDEILQLKSKELMRQTIDRI---GADISY-------------
A0A1T3F6P5      ITRSFGA-NSI-----SVKDELLQLKSKELMRLVVDRI---NADKSY-------------
A0A0W8EPA0      ITRSFGA-NSI-----SVKDELLQLKSKELMRLVVDKI---EADKSY-------------
A0A365UKN1      ITRSFGA-NTI-----SVKDELLQLKSKELMRLVVDRI---NADKSY-------------
A0A4R6WE41      FTRASAGYNSV-----SVASETLQLRSKELMRQAVEHL---GADISY-------------
A0A2T5RP38      ITRTNVS-SSV-----SVKDEILQLRSKELMRQTIDRL---GADISY-------------
A0A1A6CF06      ITRSFSG-GGV-----SVKDEILQLKSKELMRQVVDKV---GADKSY-------------
A0A1T3D6S8      ITRSFGG-GGV-----SVKDEILQLKSKELMRQVIDKV---GADKSY-------------
A0A1P8E011      ISRTNEAYNSI-----SVASEILQLKSKELMRQTVTRI---GAEMSY-------------
A0A1V3N3U3      ITNTNNAVGSV-----SVTSEILQLKSKELMRETIGRI---GAETSY-------------
C2FUH6          ITRTNSAFNSV-----SVAGEILQLNSKELMRRTIDRL---NADVSY-------------
A0A0B8T471      ATRLNSYYNTV-----NVAGEILQLRSKELMRNTISSL---RSDVSY-------------
A0A4R7D2K0      ATRLNSYYNTV-----NVAGEILQLRSKELMRNTISSL---RTDISY-------------
A0A2X2J8S4      LTRSGMSYNTV-----NLATEMLQLKSKELMRETVESI---KADVSY-------------
A0A3C0S618      LTRSGMSYNTV-----NLATEMLQLKSKELMRETVESI---KADVSY-------------
A0A4P7DRF9      IARPNNFYNAV-----NVNSEILQLRSKELMRNTIDSL---NTDISY-------------
A0A239XXC4      ITRPNNFYNMV-----NVNSEILQLRSQELMRNTISLL---NADISY-------------
A0A4U9K473      ITRPNNFYNFV-----NVNSEILQLRSQELMRNTISLL---NADVSY-------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A6A1IRV5      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A642EJV3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A519SD85      --ES-----KKGL-------RWTNTYP-NEPLKVS-------------TVK----TDKKS
A0A3M1TXY5      --YL-----KEGL-------KTRQTYH-YAPFEVQ-------------LDS----SHVQI
A0A2E0VQ27      --YR-----VGDV-------RLSEIYE-ERPFKID-------------YGV----NDDKA
R6U429          --VE-----KQFL-------RTRDLFT-NSPLAL--------------VRA----GDNNA
A0A5C8AF42      --FS-----KGQV-------LTEEKYL-SSSFYVT---------------------PFEL
A0A239K409      --YV-----EESL-------KERELYGSELPIKVV-------------AHS----LDSTA
A0A350V3E4      ---------LDSF----------QVLKGKIPFYL--------------------------
A0A1V5S1J9      --YT-----QGRF-------KSTNLYK-AAPILIT-------------KTF----VSPQA
A0A0A2EYC8      --YR-----KLKF-------KNRPMYG-RSPIDIE-------------IIS----TPDAG
A0A2G6H6Y4      --FK-----ILTF-------KQKALYE-NLPINVE-------------ILS----TYDNS
A0A1M3DPL8      --IS-----KGRF-------KTRNLYE-WTPISID-------------ADF----ISPQA
A0A1V5F519      --LT-----IGRF-------KTRNLYT-TTPIIIE-------------ADY----VAPEA
A0A2G6R1T9      --IS-----KGKF-------KTRNLYK-MSPIQIE-------------TNY----ISTEA
A0A1M6MYT6      --YS-----IGRF-------AATERYQ-DVPFMVV-------------WEE----DHPQI
A0A2P8CDS1      --YK-----IGRF-------RTIELYK-DVPFHIE-------------LDR----SHPQL
A0A353WYK7      --FA-----YGKV-------LFEERYQ-NSPFFVE-------------Y-K----IEPQY
A0A355BP94      --YS-----LGNV-------LEHEMYR-RSPFKAR-------------CIG----NVESF
A0A136LSC7      --YS-----LGKV-------LTDEMYK-RSPFRIK-------------ASH----INPKH
A0A5C7N8Q5      --YS-----LGKV-------LTDEMYK-RSPFLVT-------------TTQ----INPKH
A0A2W4RDE8      --YT-----EKNF-------KTAEHYG-NTPFTIH-------------LDS----SVHQL
A0A0L8VEV2      --YE-----ELLL-------RDDEMYG-NEPFEIL-------------YDR----QAMNL
A0A1I2A9Z9      --YH-----ELMF-------RNEELYK-NEPYDVL-------------FDR----NAMNL
A0A212J9Z9      --YI-----QTRF-------KYISLYT-DTPIEIE-------------MID----IKPEA
F5IV23          --YI-----QTRF-------KYISLYT-DTPIEIE-------------MID----IKPEA
F8X2T0          --FI-----QTRF-------KYISLYT-DSPIEIA-------------IDSLETDITPEA
A0A1M3LAG1      --FI-----QTRF-------KYISLYT-DSPIEIV-------------IDSLETDITPQA
A0A212K6G4      --FI-----QTRF-------KYISLYT-DSPIEIA-------------IDSLETDITPGA
A0A4Y9IPG7      --FI-----QTRF-------KYISLYT-DSPIEIA-------------IDSLETDITPQA
A0A2V3PNY7      --FK-----KSKF-------KVENWYG-VTPVTIE-------------AKY----VAPSA
A0A6G7WQ31      --FK-----KGKF-------KADNWYG-LTPVTIE-------------AKY----VAPSA
A0A6G7X5K8      --FK-----KGKF-------KADNWYG-LTPVTIE-------------AKY----VAPSA
A0A1M5DFS8      --FL-----KTKF-------KTENLYG-VTPITIE-------------AKY----VAPSA
A0A4Y8KZS5      --FL-----KTKF-------KTENLYG-MTPISIE-------------AKY----VAPSA
A0A142HHS5      --YT-----QGTV-------LETELFG-NCPYRVT-------------YVI----SDPAY
A0A660LQT8      --SV-----SGFF-------HDETLYGKTLPIQVQ-------------FLS----LSDER
A0A350PNH9      --SE-----DGTF-------HPVALYGRTLPVTVH-------------FYS----LNDMQ
A0A354LNT9      --SE-----DGTF-------HPVALYGRTLPVTVH-------------FYS----LNDMQ
A0A2M6GH67      --YA-----MGNV-------LNEELYN-NAPFKID-------------YEI----RDGSF
A0A389LWV6      --YH-----KGLL-------KSVSYYK-ASPILIK-------------SNF----ISEEA
A0A1G9B1T9      --YK-----HDQF-------IQHEIYK-RRPFDVE-------------LDS----LSDQL
A0A161LWY6      --YT-----TGHF-------KVSNLYG-YAPIEIK-------------GDN----ISDAV
A0A6I3N9U6      --YT-----TGHF-------KVSNLYG-YAPIEIK-------------GDN----ISDAV
A0A3D0FMX4      --IS-----RGRF-------KDTYLYR-YTPVVFE-------------PSE----IRPEG
A0A1M3MEI8      --IS-----QGRF-------KVRNLYG-QSPVVIH-------------TDY----IAPEA
A0A1J5HQM0      --IS-----KGNF-------KTRNLYN-ASPIQIN-------------PDY----IAPEA
A0A653AC35      --IS-----KGRF-------KTRNKYN-ESPIAII-------------ADF----VSPNA
E4T131          --IS-----KGSF-------KTRNLYK-TTPIIIQ-------------TDY----IAPEA
A0A521H707      ---------------------DHEMYT-KSPFSVE-------------YEL----TDSSY
A0A1F3D6P8      --FR----------------QVSELYL-RSPYVVI-------------MDK----SHIQP
A0A356Z058      --FR----------------QVSELYL-RSPYVVI-------------MDK----SHIQP
A0A3D1BT36      --LG----------------QVRQVYP-NSHYTVN-------------IDK----SHIQP
A0A352ME00      --LK----------------QTNELFG-TTPFTVS-------------IDK----SHIQP
A0A3D3HL11      --FQ----------------KPTQVYL-GNPFSVI-------------IDK----SHIQP
A0A5R9QZP0      GFIN----------------KPLQTYG-NNKYIVN-------------IDK----SHSQA
A0A2W7RD29      --YVPPETTSKNFWSFNKSNLPIEIYE-DAPFEIE-------------LKE----NDKSI
A0A3N2NDY8      --ST-----PGRF-------HEKTLYGSNLPVNVK-------------FHD----LEEQQ
D7JEV9          --YK-----KLQF-------KNRPMYA-TSPIDID-------------IIS----ISDIS
A0A4R6H3B7      --YH-----ELMF-------RNEELYK-NEPYDVL-------------FDR----NTMNL
A0A2W7QSQ0      --YN-----AEDFFK-----TKIDPFQSSIDITVD-------------SIS----KSFIS
R7F6L5          --SY-----NDGF-------KDVDIYH-QEPGIIS-------------SPD----AANAD
A0A553GA49      --YQ-----PKVL-------YDKNLYT-SSPFQVV-------------LDK----NYLQL
A0A497D6F6      --YS-----VGRV-------KSREIYK-ESPFEVI-------------WDY----EHPQL
A0A5M4AAB9      --SE-----RGFF-------RTTELYH-DLPFEIE-------------FDD----RHSQL
F4KR18          --YW-----KHKF-------SEYDAYG-NFPIVVD-------------------------
C9LKL0          --TT-----KNAL-------HRIALYD-NRPFDVS-------------FGT----KTSVP
A0A3D0QPV7      --FS-----EGQI-------LTENKYP-AKYLRFS-------------------------
A0A496KT23      --TH-----KGMF-------HDKVIYGSELPVKVE-------------FLN----IGEEQ
L1M9T3          --TH-----KGMF-------HPKVIYGSELPVKTE-------------FLN----ISEEQ
A0A3C0I8F1      --YA-----QGNI-------LDNELYG-NVPFEIK------------WWAT----ANNPW
R5JJI4          --KV-----KNGL-------REDELYT-HSPITVL-------------FPE----SEERQ
A0A3D2HF71      --VG-----RRGI-------VEKRIYN-KSPFIVI-------------YDS----LNKQT
A0A0A2DQN2      --KY-----KKEF-------RMIELYK-ASPIRVS-------------FVD----SLELY
A0A0A2F2N5      --GI-----IDGL-------RPIELYK-SAPIQVT-------------FAD----SLDQY
L1NGW4          --QV-----QSGL-------RTLELYT-AAPFSMR-------------FLD----SLEKV
Z4WRA0          --QV-----QSGL-------RTLELYT-AAPFSMR-------------FLD----SLEKV
U2K8K9          --NV-----KSGL-------RTLELYD-EAPFKVT-------------FLD----TLDVA
A0A069ZM60      --NV-----KSGL-------RTLELYS-DAPFSMK-------------FLD----TTERK
J6GV98          --NV-----KSGL-------RTLELYS-DAPFSMK-------------FLD----TTERK
A0A134B4F8      --NV-----KSGL-------RTIELYT-DAPFSMK-------------FLD----TLERG
A0A134B8C7      --NV-----KSGL-------RTIELYT-DAPFSMK-------------FLD----TLERG
A0A4Z0EKR0      --SI-----EGKV-------RDTEIYGNELPIKVI-------------LGK----LEPTA
A0A229I3A5      --AI-----DGRF-------HKEALYGADLPVTVD-------------FVG----FTDEQ
A0A3R6HJB3      --AI-----DGRF-------HKEALYGADLPVTVD-------------FVG----FTDEQ
B5CTK0          --LI-----EEGL-------HMKELYT-QAPISVR-------------FFD----VDEAE
A0A1M6B6D5      --LR-----DGEY-------QQEDAYK-QTPFFVEVDTAKSQMLNHQIKVV----FKDSL
A0A451FS66      --LR-----DGKF-------QLIDAYK-QTPFLIRVDTTKAQVLNQQFKVV----FKDSV
A0A2E3GN39      --YE-----VGDF-------RSLEIYP-NPYFTID-------------SFY----QDPKM
A0A3D1MEL0      --YE-----VGDF-------RSLEIYP-NPYFTID-------------SFY----QDPKM
F0R0C9          --LT-----DGTF-------YKQVLYGQTLPFSIS-------------FFG----LQDNE
A0A2A4N9A6      --FA-----EGDL-------LTQELYK-SSNYKVD-------------FMV----KDPII
A0A6C0GGI1      --YL-----IPDILINNLGDQVVEEKV-TEEFPFR-------------VIL----DPSSN
A0A368D1N7      --YE-----VGDF-------RSLEIYP-NPYFTID-------------SFY----QDYKM
A0A3B8TU58      --YD-----VGNF-------RSLEIYP-NPYFSVD-------------SFY----QAPEL
A0A1T5IIR6      --LD-----RIKF-------RDVELYTSQSPVRMA-------------FNR----EKSDP
A0A3E0QD27      --YA-----HGKV-------IDHEMYL-SSPFRIEYEIEDSAIFSIPFYLD----FESEK
A0A0M1W1I6      --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
A0A4R4GHU2      --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
I8WPR6          --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
A0A0K2HKS3      --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
B6W3W8          --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
A0A4R4GSI6      --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
A0A076IRY8      --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
A0A3A6AD54      --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
A0A3A6MIU7      --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
I8WPP8          --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
A0A372Y7D2      --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
A0A3E4JJC9      --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
A0A3E4WDQ0      --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
A0A414H9P2      --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
C3R5A8          --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
A0A1C5XJA7      --KM-----KDGL-------RNVELYT-KSPVAVS-------------FAD----MLPEQ
A0A3E5BU42      --RV-----EEGL-------RMNELYN-QSPINVS-------------FIN----VMPER
R7CUW4          --LI-----QDGL-------RYNELYT-QSPVRLS-------------FPD----AMPEQ
A0A416GGJ1      --LI-----EDGL-------RHIELYT-KAPVTVS-------------FPG----MSPNG
D1JY72          --LI-----MDDL-------REEELYT-QAPVKVS-------------FPE----EEDHL
D7J4K6          --RV-----ESGL-------RMNELYT-LSPVNVS-------------FIN----VLPER
Q8ABP9          --RV-----ESGL-------RMNELYT-LSPVNVS-------------FIN----VLPER
A0A5M6AHF7      --RV-----ESGL-------RMNELYT-LSPVNVS-------------FIN----LLPER
D6D2Z5          --RV-----ESGL-------RMNELYT-LSPVNVS-------------FIN----LLPER
A0A1T3EDR4      --KI-----SKGL-------RDYELYT-DSPVEVI-------------LLG----ETSLS
A0A174SDD8      --TV-----HEGL-------RPVELYT-ESPVRVA-------------FLE----AGTDE
A0A1H7RFH3      --TV-----YDGL-------RPVELYT-ESPVRVT-------------FLD----AGMDE
A0A139L1N2      --TV-----YDGL-------RPVELYT-ESPVRVT-------------FLD----AGMDE
A0A174TVL8      --TV-----YDGL-------RPVELYT-ESPVRVT-------------FLD----AGMDE
A0A1H8BJR6      --TV-----YDGL-------RPVELYT-ESPVRVT-------------FLD----AGMDE
R9H6G0          --TV-----YDGL-------RPVELYT-ESPVRVT-------------FLD----AGMDE
A0A412GR09      --TV-----YDGL-------RPVELYT-ESPVRVT-------------FLD----AGMDE
A0A6I0S0M4      --TV-----YDGL-------RPVELYT-ESPVRVT-------------FLD----AGMDE
A0A081PBV5      --TV-----KKGL-------REYELYK-DAPVKVQ-------------FID----AKPEV
A0A1I2AN85      --TV-----KKGL-------REYELYK-DAPVKVQ-------------FID----AKPEV
A0A4U0GMP3      --SV-----RQGL-------RNTELYT-DAPIQIS-------------FED----VRTED
A0A1H6CKR6      --KR-----QNGL-------RTLELYK-TSPFLVK-------------FVD----ANPNM
A0A235E1C0      --TK-----EEGL-------RTIELYK-TSPFIVR-------------FVN----APANA
R6D982          --AV-----RDGL-------RQKELYM-AAPVRVH-------------FLV----SEPEA
A0A1F0I8C4      --MV-----YDGL-------RPRELYT-EAPIRVA-------------FMD----AIPGE
A0A3A5RIJ2      --MV-----YDGL-------RPRELYT-EAPIRVA-------------FMD----AIPGE
A0A515IZJ5      --MV-----YDGL-------RPRELYT-EAPIRVA-------------FMD----AIPGE
A0A5M5NLR3      --MV-----YDGL-------RPRELYT-EAPIRVA-------------FMD----AIPGE
A0A0D5BSQ0      --KI-----RKGL-------RDYELYK-KSPVQVK-------------VEG----KSSED
A0A1T3F6P5      --KV-----HRGL-------RDYELYK-KSPVQVQ-------------VEG----KSSED
A0A0W8EPA0      --KV-----HKGL-------RDYELYK-KSPVQVK-------------VEG----KSSED
A0A365UKN1      --KV-----HRGL-------RDYELYK-KSPVQVQ-------------VEG----KSSED
A0A4R6WE41      --SH-----KVGL-------RVYELYD-KSPIKVK-------------ILK----GLPQD
A0A2T5RP38      --KV-----HRGL-------RDYELYK-KSPVKVV-------------FSN----KSPES
A0A1A6CF06      --KI-----HSGL-------RDYELYK-KSPVQVK-------------VEG----KTQAD
A0A1T3D6S8      --KI-----HSGL-------RDNELYK-KSPVQVK-------------VEG----KTHAD
A0A1P8E011      --TV-----GDGL-------RRKELYT-ASPIKVI-------------VPQ----TKPED
A0A1V3N3U3      --SI-----RKGL-------RDIELYR-TSPVKVD-------------LAG----AGPTS
C2FUH6          --VI-----RNGL-------RDQELYT-QSPVKVT-------------WMD----KKPDQ
A0A0B8T471      --SV-----QHGL-------RTVELYR-NSPFEVK-------------FLN----IKPES
A0A4R7D2K0      --SV-----EQGL-------RKVELYR-KSPFEVK-------------FLN----IKPES
A0A2X2J8S4      --VV-----RRQL-------RDYELYN-ESPVLVQ-------------FVN----YNPSG
A0A3C0S618      --VV-----RRQL-------RDYELYN-ESPVLVQ-------------FVN----YNPSG
A0A4P7DRF9      --SV-----KSGL-------RTLELYR-KSPYLVE-------------FEG----INQNA
A0A239XXC4      --SR-----KEGL-------RSVELYK-TSPFIVR-------------FRN----AAPQS
A0A4U9K473      --GR-----KDGL-------RSVELYK-TSPFIVR-------------FIN----VPSSA
A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      -----------------------------------------------------------G
A0A661XXA6      --YK----------------FSSPVINEDFEFNMV--------------------LSPSW
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A6A1IRV5      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      --------------------------SAAPALQPA--------------------PAAAS
A0A519TAP8      ---------------------------MQLLVDSV--------------------PGRAL
R5DEG6          ------------------------------MVVVP--------------------SLYYG
A0A3N2LCI3      ------------------------------------------------------------
A0A642EJV3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A2K8ZAP1      --MK--------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A519SD85      SSYYFQ----FSQLDNEKFELYINDEKRIY-----------------------------K
A0A3M1TXY5      VGAKFF----VRPISDTEYEIEADEKSAEIWNIAEDALVHELEPFVFNKRL--------R
A0A2E0VQ27      LDKTIY----FDYLGEGRFRF----------------FDGSPKDSAHATIV--------D
R6U429          SSFSFE----IMKEGEDAFVI--------------KDWHVAGEEMEYAKIKG-------R
A0A5C8AF42      KDSSLINVPIFVAFDGKSISV-------------------------NYAHLGKNYALKGK
A0A239K409      YGREVT----VSFNGGKSYNL----------------------EEGGKTFKF-------E
A0A350V3E4      ----------LSATPENQVDP---------------------------------------
A0A1V5S1J9      YEREFT----IQDLGNNNFEI----------------SAPGTKQLPELKISG-------K
A0A0A2EYC8      FWQYYL----YQKQNDNEFTI----------------KIFDNEDVELETVKG-------R
A0A2G6H6Y4      FDNYYR----FEVTGEKSFNI----------------SVLDEHDEVLEVVDG-------E
A0A1M3DPL8      YDILFK----LNIKPDGTFTV----------------TEDEESMPKGFNING-------R
A0A1V5F519      YELLFK----ISLHPNGTFTI----------------SPHNNNSMPSSPING-------H
A0A2G6R1T9      YGVLFK----IEINEDGSYVI----------------SDDKGVIDEDLEIRG-------K
A0A1M6MYT6      INADFY----LTIQPDGKLELKIEEEDEVMVFNYKDKTVLDELDSYSYSEEA-------T
A0A2P8CDS1      LDANFD----LHFLPNNRVEMTIQGKKAVR-YDYRNEKELQPEKEIEETRTF-------P
A0A353WYK7      FDHPFD----VDILNSKKFIL-------------------------RLKKGDQVIENTYS
A0A355BP94      QDQPIF----VDFVEGNKYQL-------------------------WV--GENGTKQTGT
A0A136LSC7      YDQPIY----FDFLDNNEVSL-------------------------RL--KGAVST-RGS
A0A5C7N8Q5      YDQSIF----LDFQDNNQFTL-------------------------RL--GDAGPTVSGT
A0A2W4RDE8      INVPIY----IERLSSSKYMVSVRGKEVPTYDVITNTVKDRVPVVDIQEVV--------D
A0A0L8VEV2      EGIPIH----IQMLDTSNFQIEVKGKKMVYGKEVEIEFSQKG-----------------K
A0A1I2A9Z9      EGIPVY----VQMLDSTNYRIIVDEKTMYYGREIEIKIDQRG-----------------V
A0A212J9Z9      YNYAYE----VTYIDQEKCEI---------------SYKENPESETKISLIA-------P
F5IV23          YNYSYE----IAYIDQEKCEI---------------SYKENPESETKISLIA-------P
F8X2T0          YSKVFD----VSYVSDSQIRV---------------SYKDGLDGEPEEAFNV-------V
A0A1M3LAG1      YSKVFD----VAYVSDSQIRV---------------SYKDGLDGEPEEAFNV-------V
A0A212K6G4      YSKVFD----VAYVSDSQIRV---------------SYKDGLDGEPEEAFNV-------V
A0A4Y9IPG7      YSKVFD----VAYVSDSQIRV---------------SYKDGLDGEPEEAFNI-------V
A0A2V3PNY7      YSIVFE----IEPINSEKCRI---------------FY-EGSETTQPFSMEV-------P
A0A6G7WQ31      YSIVFE----IEPINSEKCRI---------------FY-AGSETTAPFSMEV-------P
A0A6G7X5K8      YSIVFE----IEPINSEKCRI---------------FY-PGSETTAPFSMEV-------P
A0A1M5DFS8      YSIVFE----VEPIDSDKCRI---------------FY-PGSENTAPFSMEV-------P
A0A4Y8KZS5      YSIVFE----IEPINADKCRI---------------FY-PGSESTPPFSMEV-------P
A0A142HHS5      YNHKFD----VEYIDAKHYRL-------------------------NVTVGNAKLGGNYE
A0A660LQT8      -SAMLD----ITYERDGHFEL--------------TNFVTNLDRKIEKTQVVKG-----H
A0A350PNH9      -SANLD----VEVKHGNLFSI----------VHVSGTDKAGNQVESDEEVQG-------K
A0A354LNT9      -SANLD----VEVKHGNLFSI----------VHVSGTDKAGNQVESDEEVQG-------K
A0A2M6GH67      YDKEFK----VNFIDNNTFKL-------------------------VYLIGEEEITGEYK
A0A389LWV6      ASLDFR----IRGIDTTAYEI----------------TFDGAKNIAPFSIVG-------N
A0A1G9B1T9      IGVPIY----VRFLSSNRYEISVEADEASVYQMAEEKFAPTKARDVLIQNVQ-------K
A0A161LWY6      SGLEFD----FRDIDGVTYEI----------------AHQKDKQLDELRYTG-------R
A0A6I3N9U6      SGLEFD----FRDIDGVTYEI----------------AHQKDKQLGELRYTG-------R
A0A3D0FMX4      YEHLYK----LDIGTNGQLTV----------------SIADEDTKNPMTFNT-------I
A0A1M3MEI8      YGILFK----LSISEDGTFLI----------------TEEEENLRKGFALRG-------R
A0A1J5HQM0      FNLTFK----LDLNANGTFTI----------------TVDENKQYENFKLNG-------N
A0A653AC35      YGILFK----VNVKTDGSYII----------------TDENS---LNIKIKG-------Y
E4T131          YGVLFK----IKLHSNGSYTI----------------SVDDKNLFSKFQING-------R
A0A521H707      FDRRFF----IDFEGDSKFRLS-----------YSTALSKQSGTFPVNTWI---------
A0A1F3D6P8      IDVKLR----VFILSDTTFRLVIDQNTVSLYNYLDNQIVIENVPLKVDTIC--------R
A0A356Z058      IDVKLR----VFILSDTTFRLVIDQNTVSLYNYLDNQIVIENVPLKVDTIC--------R
A0A3D1BT36      INARFY----INIVSDTTYRLTVSEDDVSFYNYLDNKVISAGHMLNIDTVY--------K
A0A352ME00      IGANIY----VSILDESSFRLTASQKKVSYYNYVDNQIISEDNFFEIDTIC--------K
A0A3D3HL11      INTRFR----VDILDDQSYRLTASEDEASYYNYIDNAVVSTENRVRIDTIC--------R
A0A5R9QZP0      INTRYY----IEILDESRFRLSVYDDGAKLYNYLDNKVTSRGNRIEFDSIC--------T
A0A2W7RD29      EEKFFR----ISWVDSLSYSV-----RFVGDEPTTSMFNSNQDEGSGKSYVC-------K
A0A3N2NDY8      -CAGFR----IELGKDGNVVL--------------SKFHLE-TP--DGDEEIEKEVKAKI
D7JEV9          YGKYYL----YQRKDNDYFTI--------------KVFDNEDVE--LETVEG-------R
A0A4R6H3B7      EGVPVY----VQMLDSTNYRI----------------IVDEKTMYYGREIEVKIDQRG-V
A0A2W7QSQ0      PSESFE----IQPISETKFLL---------------------ILDEDKQKEF-------E
R7F6L5          ASYSFK----YIVKPDGTVIL--------------KDFNKGGTELPDKPLSC-------K
A0A553GA49      TGAEFY----VEILSKDLFTL--------KVEVDEGELHNFLNASSEQLVEDWEFKHTYR
A0A497D6F6      IYADFL----LEILPDGKLLIKVEDEHAAIFDFLNSEIVTY-VTNLSFSKEA-------A
A0A5M4AAB9      IDTNFD----LKFLSDNKVKIKTKSRKAIRYDYLRKTELSE-PHAVNNSRTF-------D
F4KR18          ---TFK----LNPSAESTFKITPLNNYSFRFSQGSKTE-TQ-RFGTLFSNQF-------G
C9LKL0          ANFQAE----IMPGGKVRLFD---------FKLNGEEYSDDIET---------------A
A0A3D0QPV7      -DLTII----DSTIFGERIDI-------------FSNSNQITLNCRNQTFTT-------E
A0A496KT23      -RASFG----LSLQADGRVIL--------------DNFTKDGASLSGTVMG--------K
L1M9T3          -TASLS----LTLMADGRVLL--------------ENFVRDGQNLGGSVLS--------Q
A0A3C0I8F1      FDKRFD----VQIVDPKHFVL---------------AFEQGRGVIKQKY----------Q
R5JJI4          -VIEMT----VTPVDSATVRL--------------SDFSLSIAGEEIRSAEVVDA----R
A0A3D2HF71      IGEKVN----VKILSAKKYKI---------EIDGERNFSKEM-----------------N
A0A0A2DQN2      DSFFVS----YKDENQVSVS----------------YNEEEHIF---------------L
A0A0A2F2N5      HQFEVT----YKDASSI-VLS--------------REGGETKQV---------------Q
L1NGW4          ATYEVR----FKDAGHVSIQP--------------QGSSKAQDV---------------P
Z4WRA0          ASYEVR----FKDAGHVSVLP--------------QGSSKAQDV---------------P
U2K8K9          NTFRVS----YQDASHVSIKL--------------GKDGRTQVI---------------P
A0A069ZM60      STYEVA----FQDAGHVRVTP--------------VHTGKSQVV---------------P
J6GV98          SVYEVA----FQDAGHVRVTP--------------VHTGKSQVV---------------P
A0A134B4F8      SSFDVA----FQDASHVRVTP--------------ASTGKSQVI---------------A
A0A134B8C7      SSFDVA----FQDASHVRVTP--------------ASTGKSQVI---------------A
A0A4Z0EKR0      GGVNFT----VRPKSVDTFEL--------------DDYSGHMYSY--------------H
A0A229I3A5      -SGSFK----LQLKGDGSYVI--------------SKLKGV-TR--DNLPVDDSDEITGR
A0A3R6HJB3      -SGSFK----LQLKGDGSYVI--------------SKLKGV-TR--DNLPVDDSDEITGR
B5CTK0          -TLSLT----VLPHSEKEVTI--------------TDIITSSGESVNKSFYI-------P
A0A1M6B6D5      -TFNLS----VSFEEAKNINL--------------QNYNSKEKK--SLFVEAGDFSKDFK
A0A451FS66      -NFNLS----VSFEEGKNINL--------------QNYTTKEKS--SLFIDTDVFSKDYK
A0A2E3GN39      RRVSID-YSVLINQQKDSVRL-----DYIYQGKSWGGFLKPGKPYSDENIYL-------A
A0A3D1MEL0      RRVSID-YSILINQQKDSVRL-----DYIYQGKSWGGFLKPGKPYVDENIYL-------D
F0R0C9          -TASLT----LRQGASGKLEL--------------SDFTRN-GEKVEGISEG-------K
A0A2A4N9A6      YQVRFN-IEILNTREFKLLYSIDKKYDNIYN-----------------------------
A0A6C0GGI1      QLLNVPIYVKILSKNKYQVQVVGGETAYIYNISTNKTIGETTTP--EINKIV-------N
A0A368D1N7      RRVSID-YSILINQQKDSVRL-----DYIYQ---GKSWGGFLKP----------------
A0A3B8TU58      TKINID-YHMFLSRKKDSIRL-----EYIYK---GSTWGGHLKP----------------
A0A1T5IIR6      GSVSVT----VIPEDAGHIRL--------------QTSAGS-QL-------V-------A
A0A3E0QD27      -VFHLR----YPTHEGEKVKA--------------FQTNVW-NKVPGLKFRM-------T
A0A0M1W1I6      -DFSLT----VRIQNRKQVRL--------------SDFSTD-AT--SITLTA-------N
A0A4R4GHU2      -DFSLT----VRIQNRKQVRL--------------SDFSTD-AT--SITLTA-------N
I8WPR6          -DFSLT----VRIQNRKQVRL--------------SDFSTD-AT--SITLTA-------N
A0A0K2HKS3      -DFSLT----VRILNRKQVRL--------------SDFSTD-AT--SITLTA-------N
B6W3W8          -DFSLT----VRILNRKQVRL--------------SDFSTD-AT--SITLTA-------N
A0A4R4GSI6      -DFNLT----VRILNRKQVRL--------------SDFSTD-AT--SITLTA-------N
A0A076IRY8      -DFSLT----VRILNRKQVRL--------------SDFSTD-AT--SITLTA-------N
A0A3A6AD54      -DFSLT----VRILNRKQVRL--------------SDFSTD-AT--SITLTA-------N
A0A3A6MIU7      -DFSLT----VRILNRKQVRL--------------SDFSTD-AT--SITLTA-------N
I8WPP8          -DFSLT----VRILNRKQVRL--------------SDFSTD-AT--SITLTA-------N
A0A372Y7D2      -DFSLT----VRILNRKQVRL--------------SDFSTD-AT--SITLTA-------N
A0A3E4JJC9      -DFSLT----VRTLNRKQVRL--------------SDFSTD-AT--GITLTA-------N
A0A3E4WDQ0      -DFSLT----VRTLNRKQVRL--------------SDFSTD-AT--GITLTA-------N
A0A414H9P2      -DFSLT----VRTLNRKQVRL--------------SDFSTD-AT--GITLTA-------N
C3R5A8          -DFSLT----VRTLNREQVRL--------------SDFSTD-AT--GITLTA-------N
A0A1C5XJA7      -YVAFT----VTLLNKDSVEI--------------TDFSMA-EN--GERQVV-------E
A0A3E5BU42      -YISFT----VTPKNAKQVLL--------------SDFTGI-PAANDKTYTM-------R
R7CUW4          -GLALT----VQPKSERSVTL--------------SRFSWM-EA--DSTCTV-------A
A0A416GGJ1      -AVQFK----LKMLNLKEAQI--------------TTLGDA-GK----TYKV-------Q
D1JY72          -DFSLT----VRILNRKQVRL--------------SDFSTD-AT--SITLTA-------N
D7J4K6          -HISFV----VTPKDDATVTL--------------SGFGGLPAA--KDSYDV-------R
Q8ABP9          -HISFV----VTPKDDATVTL--------------SGFGGLPAA--KDSYDV-------R
A0A5M6AHF7      -HISFV----VTPKDDATVTL--------------SGFGGLPAA--GESYEV-------R
D6D2Z5          -HISFV----VTPKDDATVTL--------------SGFGGLPAA--GESYEV-------R
A0A1T3EDR4      -GYSLK----VEPLDGGSVLI--------------REWQSK-KL--EKPFKL-------S
A0A174SDD8      -AHSLS----VTPKSNVQVEL--------------SDFSRG-ME--QRKV-V-------K
A0A1H7RFH3      -AHSLS----VTPKSRQQVEL--------------ADFSRG-ME--QRKV-V-------N
A0A139L1N2      -AHSLS----VTPKSRQQVEL--------------ADFSRG-ME--QRKV-V-------N
A0A174TVL8      -AHSLS----VTPKSRQQVEL--------------ADFSRG-ME--QRKV-V-------N
A0A1H8BJR6      -AHSLS----VTPKSRQQVEL--------------ADFSRG-ME--QRKV-V-------N
R9H6G0          -AHSLS----VTPKSRQQVEL--------------ADFSRG-ME--QRKV-V-------N
A0A412GR09      -AHSLS----VTPKSRQQVEL--------------ADFSRG-ME--QRKV-V-------N
A0A6I0S0M4      -AHSLS----VTPKSRQQVEL--------------ADFSRG-ME--QRKV-V-------N
A0A081PBV5      -GFSLQ----IEAVDQDHVAL--------------SSFSKG-NT--SQVLKI-------K
A0A1I2AN85      -GFSLQ----IEAVDQDHVAL--------------SSFSKG-NT--SQVLKI-------K
A0A4U0GMP3      -NFSFT----VSRNDDSTVLM--------------SGFSKG-DM--EQRFIV-------K
A0A1H6CKR6      -PQEFT----LKSLGKNQLEL--------------SEFSNQEEA--GKPLVV-------A
A0A235E1C0      -GFSFN----LKYKGNNQVEL--------------SNFSNT-DP--EKTVTV-------K
R6D982          -ELSLL----VTPKNERQVEL--------------SDFSRG-AE--SRKT-V-------N
A0A1F0I8C4      -RCFLS----VIPKNQQQVEL--------------AEFSKG-TE--LRRV-V-------N
A0A3A5RIJ2      -RCFLS----VIPKNQQQVEL--------------AEFSKG-TE--LRRV-V-------N
A0A515IZJ5      -RCFLS----VIPKNQQQVEL--------------AEFSKG-TE--LRRV-V-------N
A0A5M5NLR3      -RCFLS----VIPKNQQQVEL--------------AEFSKG-TE--LRRV-V-------N
A0A0D5BSQ0      -NYAFT----VIPVDMKHVVI--------------KNWSNT-NK--NEEFKV-------V
A0A1T3F6P5      -SYNFT----VVPLDANNVII--------------KNWNPS-NK--DKEIKI-------A
A0A0W8EPA0      -SYNFT----VVPVDANNVII--------------KNWNPA-SK--DKEIKV-------A
A0A365UKN1      -SYSFT----VVPVDANNVII--------------KNWNPE-NK--DKEIKV-------A
A0A4R6WE41      -TWSLL----ITPISKDSVEI--------------GGWKDN-TD--RAPVRL-------A
A0A2T5RP38      -RYGFT----IIPIDAKNVIV--------------KDWNKN-VD--GQEVKV-------V
A0A1A6CF06      -SYGFT----VTPIDTRYVLL--------------KKWNET-SE---EELKI-------E
A0A1T3D6S8      -SYGFT----VTPVDTRYVLL--------------KKWNET-SD---EELKI-------E
A0A1P8E011      -SFSFT----VTPVGGKEVVL--------------SNWSEG-DA--ALEVDA-------T
A0A1V3N3U3      -QYNLL----IIPLDAQTVLL--------------SGRIAG-KE--QQEIRV-------P
C2FUH6          -SFSFT----LTPLDGKYVLL--------------KKWSNG-DR--AKELKI-------E
A0A0B8T471      -NFSFT----LTAIDSTKVRF--------------AT-VDG-DV--ENYTTI-------P
A0A4R7D2K0      -NFSFT----LTAIDSTTVRF--------------AT-VDG-DV--ESYTTI-------P
A0A2X2J8S4      -SFSFT----ITPRDNKSVLV--------------VENVGK-DK--EKVYIA-------P
A0A3C0S618      -SFSFT----ITPRDNKSVLV--------------VENLGK-DK--EKVYIA-------P
A0A4P7DRF9      -GFSFN----LRRKDANEVEL--------------SDFSTN-KE--AKSIIV-------P
A0A239XXC4      -GFSFN----LKYKGNNQVEL--------------SSFSNS-DP--DKTITV-------K
A0A4U9K473      -GFSFN----LKYKGNNQVEL--------------SMFSND-EL--AKPIIV-------K
A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      PASLAA------------------------------------------------------
A0A661XXA6      NSSMGT------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A6A1IRV5      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      WPPNEP------------------------------------------------------
A0A519TAP8      PVGDDP------------------------------------------------------
R5DEG6          DKYFNT------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A642EJV3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A519SD85      FDQVIIHENLQIKVQRPLVRVLN-----------TIRFKYLSTPEFVNQIRK-SLKVDDS
A0A3M1TXY5      FGQPYTDQNLSFTLHRNPDFEVKKGQ--------RFYFVIHGLKDLAERYQS-ALKVEAV
A0A2E0VQ27      QGQLIEKNGLLLTI--EPDSAFLKLKPNSLKPGDLFALKVNSEDALIGQYKSDKLFVKPV
R6U429          LNDTLDTPVGKLVI--APTMLYDQWKK-------PIVISWVNAKKLAKAYNK-SLSVSLS
A0A5C8AF42      LNERLSNTHFEISIDSPIPSEFKDESSDN-----ELYFVFNSVESYAARLLP-SLQIVPV
A0A239K409      FGEVVRRPYGTFTI--LTSDAFPQKSPKQK----KIIVVFENINTLAKYYSD-WLKVEPI
A0A350V3E4      ----------------------------------------KSKNQIANVLSA-VTEISQK
A0A1V5S1J9      YGIPIQNSSFFIQV--DKSAIYRRNF--------NICFKLLNPENLAITYSA-KLSFDFL
A0A0A2EYC8      YNEPVGCKYFLIKV--TKNSNYHSAN--------SVNFVFRNRDNLVMEFAS-KLQIN-L
A0A2G6H6Y4      YGEPIGCKYFLVKV--LRDERYNEIP--------QFYFRFRTRMSLIQEFVG-RLEVA-P
A0A1M3DPL8      IGYPLQHHLMFITI--NDISGNNSAK--------DLYFKFRTKESLIGEFSS-KLALNFV
A0A1V5F519      IGVPLQHNLFFMTV--NSVSDNVKEF--------EMYFRFRTRETLIEDFKS-RLSSRYV
A0A2G6R1T9      IGVPVKSKLFVINV--TKDIEFSNK---------TMFFRFRTKTSLVNEFSG-LYPE--F
A0A1M6MYT6      PGTRISTDEFAFKILLNEHFNPESDN--------EFKFRFHSPQELIRQYQN-QLEVALK
A0A2P8CDS1      IDSFVASDDYAFRIIPAA--DSKLEG--------NYRVVFHSLDELTADYLN-RLTVAPI
A0A353WYK7      FGEEIVCDGFVFML--ALSPHYR-KDNDNV----HYFFKINSPQSNIRYLMD-NTEVKPL
A0A355BP94      LGEPVVVSDANFVI--ELSPNAT-PDFKN-----HFFFVMNSRNRLLDFLSS-NLRIEPI
A0A136LSC7      MGNPVEFDGTVLTI--TKTNYFT-ENDGN-----NYYFVLNSRKSLIEYLSK-NIQVDPL
A0A5C7N8Q5      MNKPVELDKTILIV--NKTIFFT-ENDGN-----NYFFVLNSRKTLIDYLSK-NIQVDPL
A0A2W4RDE8      INKPFQSKNLSFSITFNDAFKLEPDS--------KMFFRINNQVSLAERYRN-QLNIEPI
A0A0L8VEV2      FGELFSNDYFNFTLYPKYAKRGN-----------QYYFTFNNFENQVKKYMN-RLVIEEP
A0A1I2A9Z9      FGEIFENDYFHFTLYPKNVKRGE-----------TYFFTFNNFEGLVRNYSG-RLMIEET
A0A212J9Z9      FDQEIDYKLFRIKLHKTPNFRKDVKGAFKPDIS-TFNFRFLSEAQLIGMYSG-RIGSAL-
F5IV23          FEQEIDYKLFKIKLHKTPNFRNDVKGAFKPDIS-TFNFRFLSEGQLIGMYSG-RIGSDL-
F8X2T0          FDSPVENKFFKGTIRKTKN--------FKRDFL-PFSFRFFTNSQLTGMFSG-RVSTALK
A0A1M3LAG1      FDSPVENKFFKGTIRKTKN--------FKHDFL-PFSFRFFTNSQLTGMYSG-RVSTALK
A0A212K6G4      FDSPVENKFFKGTIRKTKN--------FKRDFL-PFSFRFFTNSQLTGMYSG-RVSTALK
A0A4Y9IPG7      FDSPVENKFFKGTIRKTKN--------FKRDFL-PFSFRFFTNSQLTGMYSG-RVSTALK
A0A2V3PNY7      YDQFVQEPRFYIKITKSPR--------FAPNFE-PFSFRFVSKEELIGRYSG-RISSGLV
A0A6G7WQ31      YGQFVQEQRFYIKINKSPR--------FAANFE-PFSFRFVSKEELIGRYSG-RISTGMI
A0A6G7X5K8      YGQFVQEQRFYIKINKSPR--------FAANFE-PFSFRFVSKEELIGRYSG-RISTGMI
A0A1M5DFS8      YNQYVQESRFYIKINKTDR--------FTPNFT-PFSFRFISKEELIGRYTG-RTSSGYQ
A0A4Y8KZS5      YNQFVQESRFYIKINKTDR--------FTPNFT-PFSFRFISKEELIGRYTG-RTSSGYQ
A0A142HHS5      FGQLVKLPGISLRLLSASSPAELDA---------IYHFVIVDDNTINSYLDH-NLKAEVL
A0A660LQT8      FGQIVNTPVGRVRV--TPTNHFDVVEHQ------PIHVLRTTMRKAIEHY-N-NVEITLA
A0A350PNH9      LGQTVRTAMGHVCVDQAPGYSAFINGHESR----KLHVTRTNLYAMTNHIKA-SLSASIS
A0A354LNT9      LGQTVRTAMGHVCVDQAPGYSAFINGHESR----KLHVTRTNLYAMTDHIKA-SLSASIS
A0A2M6GH67      VGEPINKKEIYLVL--NRTPNFN-PFVLEQ----NYHFVINSDGALNNYFRS-NLAVEII
A0A389LWV6      YGTSLQHNLFFVTV--DKTDQFPHTVKY------ELNFNFLSRGQQIADYNN-RLNCSFL
A0A1G9B1T9      VGQPVRTPYLNFTLIRNEQEPLDTLS--------QYSFMIHPLERVTEQYQK-KLVVAPF
A0A161LWY6      YGSLLNTPYFSVVV--NKTDNFEPRK--------KINFAFLSNAYLIDYFTP-RISLSFV
A0A6I3N9U6      YGSLLNTPYFSVVV--NKTDNFEPRK--------KINFAFLSNAYLIDYFTP-RISLSFV
A0A3D0FMX4      YGQTFDCGLFSGLFMPTEY-MTEKT---------TIYFRFRSQESLVADFSS-RLTLNFV
A0A1M3MEI8      LGKTFQHNLFFITVNMAEGVVHGKK---------EVYFRFRSRESLISDFSG-RLRLNFV
A0A1J5HQM0      IGEPISNNLFFITINNTNS-YYAER---------ELYFQFRSRESLISDFAS-RLTFNFV
A0A653AC35      LNQPIQHNLFFLTIAPTNQ-NRQEY---------DTYFIFRTRESLIGDFMS-RLNVNYV
E4T131          YGRPLQHNLFFLTVHNVNK-YMGNT---------EMYFKFRTKESLVNDFIS-RFSTSYV
A0A521H707      ---TIPGLKFKITI--KDYGQIKKQILATTNDEP-YYIIFYNPETVIDQYYA-DATVTVM
A0A1F3D6P8      FNETIRGKTFKFSV--SFNRDFYTR--ETNMEDF-YYFSFFHLDYLTKDYLK-KLEVEPI
A0A356Z058      FNETIRGKTFKFSV--SFNRDFYTR--ETNMEDF-YYFSFFHLDYLTKDYLK-KLEVEPI
A0A3D1BT36      FNQTIASPYFRFSV--SKNQDYLNQ--RPVDEER-SFFMMNHIDIITEQYLN-RLTVESV
A0A352ME00      FNETISNKVVRFSV--ALNKDFPLK--KTEDKSR-YYFKFNHLDYLAKGYLK-QLEIEKA
A0A3D3HL11      FNETVTSYNYKFSI--GFNKEYYNP--KLSGETD-YYFEFYHLDQLTRTYLR-RLKVEPV
A0A5R9QZP0      FNETITTPYFKFSV--NLNKDLYKG--TQASKTKAHFFEFNHLDVISRRYLR-KLAIAPV
A0A2W7RD29      FNEWCGLPFLTLRTRLLEAKNDG-----------NFLFKIRNEESLISEFSG-NLAIYPA
A0A3N2NDY8      GAGPIETPVGKVSI--AANGNYTAPKGKKNKPVTEIIVERDGMQSTVETYGG-LVKADLA
D7JEV9          YNEPVGCKYFLIKV--IENKAFR----DVD----KVHFRFRHRQELIAEFSS-KLAIQLI
A0A4R6H3B7      FGEIFENDYFHFTL-------YPKNVKRGE----TYFFTFNNFEGSVRSYLE-RLMIEET
A0A2W7QSQ0      YGQKIKFSFGIISI--QKKPASDDFATEMG----NVLVELVNPQVAAENYSR-VLEFQNP
R7F6L5          LGATVKTPVGAIAI---DRPEWV-SDYVDK----TIHYSHVPVRPVAESIVG-GLKATYE
A0A553GA49      FGESIENENFNFTV--LLKEGLNIDKLVGK----KLFFVIKSNRQVVDESKD-NLKIEAT
A0A497D6F6      YNEVIKTDYFSFII--KPKRER--NKIETA----TYKFRFNIRSDLLKQYKN-DLSVNML
A0A5M4AAB9      IDEQIKSADYSFRI--IPISSL--PL--QG----RYRINFNSLNELTNEYLE-KLTVYQV
F4KR18          V----------FRI--NRIGAL--PISSDS----SMYVSFQDTKGLARNYQH-NLSVELS
C9LKL0          PEQAVKTPLGVLKI--SKNATFE-EFSKGK----VITVDYIPADLAARRYQG-EISATVQ
A0A3D0QPV7      SGGLLQSPWFRARITVADPQTIQ-AIQSEN----KLYFVFNHPDQLLTQYFP-AINVQVL
A0A496KT23      VGERCVTPVGLVKF--VANTGY--RRGMTD----EYKVTRSPISAVAAVVRG-SFNIALS
L1M9T3          VGKRCATPIGLLKL--TPTNAY--RKGMTD----EYDIKRSSISTTAAIVRS-RFDVQLS
A0A3C0I8F1      FNDTIHLSGMSLVL--IPKPAIN----ISK----NYYFIINSRYALLSYLQS-KLKVDII
R5JJI4          LNDTISTPVGTMVV--TPTLYYT-DTYYGK----PVYITKSNMEKVVEGYLR-RINISLA
A0A3D2HF71      FGDRFNEQGFDFIIELRDKNNFVFDPNASN----RYYFYFVSPQSLANIYRS-KLSVSPV
A0A0A2DQN2      LGDTISIGKNRLII--EPNPNYT-SPWIAR----QIQVSRVPVPALAVAYQG-SLSIGQP
A0A0A2F2N5      LGEEVTYEKSRLIV--VPSKGYN-EPWPNK----AIKITRLPVKDLAASYQG-RLFIGQP
L1NGW4          LNVPVQLGPDRFII--EPRSNFN-SPWEHK----TINVIRHPLVGTARYYQN-AVAISQP
Z4WRA0          LNVPVQFGPDRFII--EPRSNFN-SPWEHK----TINVIRHPLVGTARYYQN-AVAISQP
U2K8K9          VGEPIRIGETRFIV--EARKTFN-APWAYS----EIQVSRIPFVDAVRFYQH-SVAITQP
A0A069ZM60      LNVPVQLGDERFII--EPHQNFN-TPWEYK----HIEVNRMPFTQTVRYYQH-AILVAEP
J6GV98          LNVPVQLGDERFII--EPHQNFN-TPWEYK----HIEVNRMPFTQMVRYYQH-AILVAEP
A0A134B4F8      LNVPVQLGEERFII--EPRQNFN-APWEHK----HIEVTRMPFTQTVRYYQH-AIMVAEP
A0A134B8C7      LNVPVQLGEERFII--EPRQNFN-APWEHK----HIEVTRMPFTQTVRYYQH-AIMVAEP
A0A4Z0EKR0      FGEQIQKPYGTFSIIAGGA-----NKWLGT----KIIVQFQDINQVANYYNS-AIGIAPV
A0A229I3A5      IGQIIRTPLGKIKVDKAPAFTQFVSGEDES----VLYVSRSNVYAMTDRIKG-SLSASLS
A0A3R6HJB3      IGQIIRTPLGKIKVDKAPAFTQFVSGEDEP----VLYVSRSNVYAMTDRIKG-SLSASLS
B5CTK0          LNDTVSTPIGRILI--SPTLYYG-KGEFS-----PLIVRKVNLKSIANSFAA-RLTIAQA
A0A1M6B6D5      IGEPVNTPFFNGIF--VPNPDVI--SKMGT----PYYLVFSEYDATVKRYL--DINIAPL
A0A451FS66      LGESISTPFFSGTF--IPNEEVI--SNPGT----PYYFIFQDYDTTVKNYL--NTKVTPE
A0A2E3GN39      ISN-------------LDQKLLEGSAESQK----SILFKVYTDEQLSNELMA-ITSIEP-
A0A3D1MEL0      ISN-------------LDQKLLDESAENQK----SILFKVYTDEQLSNELMA-ITSIEP-
F0R0C9          LNDTIASPVGKLLV--EPTPYYN--IGFHE----PVYVSRSSLHGATGAYSS-RLSVVLS
A0A2A4N9A6      FGTWIRTEFADFKVSLKESDAIITDSKSNI----YYFLINNLDEQARFKFAP-AIQTLIT
A0A6C0GGI1      LGDPFKDEHLNFKI--FLNPYYETYLTKGK----KFFFIINNIGNLTKGYQA-KISAKPI
A0A368D1N7      -GKPYADENIYLAISNLDQKLLEGNAENQK----SILFKVYTDEQLSNELMA-ITSIEP-
A0A3B8TU58      -GKPFIDENIFISISNFDESLLTDEFEGEK----NIFFNVYDNNRLADEMLS-NIKIEP-
A0A1T5IIR6      LGDTVALGRGKVVF--LPTARYS-PDQYGQ----SIRIQKIPVNWAAQAYIS-RLSIAH-
A0A3E0QD27      VQNWAAIQKQEINL--QDEAYYF---------------IINNSTTLVERYFK-NLTVVLM
A0A0M1W1I6      LGDTIQSPIGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
A0A4R4GHU2      LGDTIQSPIGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
I8WPR6          LGDTIQSPIGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
A0A0K2HKS3      LGDTIQSPIGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
B6W3W8          LGDTIQSPIGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
A0A4R4GSI6      LGDTIQSPIGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
A0A076IRY8      LGDTIQSPVGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
A0A3A6AD54      LGDTIQSPVGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
A0A3A6MIU7      LGDTIQSPVGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
I8WPP8          LGDTIQSPVGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
A0A372Y7D2      LGDTIQSPVGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDIMASLFRS-NLNISQA
A0A3E4JJC9      LGDTIQSPVGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
A0A3E4WDQ0      LGDTIQSPVGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
A0A414H9P2      LGDTIQSPVGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
C3R5A8          LGDTIQSPVGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
A0A1C5XJA7      LNDTISLNEGKVVV--VPTNYMT-ESWIGV----PVKVSKMPLDAVVSVYRN-SIAVKQE
A0A3E5BU42      LNDTLTIGSERILI--TGTDRWG-QAWTER----DIRVSKNPLNAVAGRFQG-SMGIRQE
R7CUW4          MGDTVRVHGQRLVV--TPTNYYA-ASWTDV----PIRVQKRPLESVVNRYKG-ALGIQQE
A0A416GGJ1      LRDTTAIGNFKIAV--TPTNFLN-KSWIGQ----EITVRKNPLESVVSYYSG-NFAIRQE
D1JY72          LGDTIQSPIGKIVV--SPTLYYT-DKWFNT----PITIRRQSTDTMASLFRS-NLNISQA
D7J4K6          LNDTLAVGGERILV--TGTDHWG-KSWTGR----EIHVVKNPLNAVAGRLQG-SMGIRQE
Q8ABP9          LNDTLAVGGERILV--TGTDHWG-KSWTGR----EIHVVKNPLNAVAGRLQG-SMGIRQE
A0A5M6AHF7      LNDTLAVGGERILV--TGTDHWG-KSWTGR----EIHVVKNPLNAVAGRLQG-SMGIRQE
D6D2Z5          LNDTLAVGGERILV--TGTDHWG-KSWTGR----EIHVVKNPLNAVAGRLQG-SMGIRQE
A0A1T3EDR4      LNKPTRLPFGELLV--KGSPHYG-TPYYGK----SIRVEKLPLERSVVYFLG-QLKIKHL
A0A174SDD8      LNDTIQTALGKLVV--FAAENYG-ESCFGK----PIVVTCKPLEEMVSFWLN-NLSIRQM
A0A1H7RFH3      LNDTIHTALGRLIV--FAAENYG-ESSFGK----PVLVTCKPPEEMVSFWLY-NLAIKQM
A0A139L1N2      LNDTIHTALGRLIV--FAAENYG-ESSFGK----PVLVTCKPPEEMVSFWLY-NLAIKQM
A0A174TVL8      LNDTIHTALGRLIV--FAAENYG-ESSFGK----PVLVTCKPPEEMVSFWLY-NLAIKQM
A0A1H8BJR6      LNDTIHTALGRLIV--FAAENYG-ESSFGK----PVLVTCKPPEEMVSFWLY-NLAIKQM
R9H6G0          LNDTIHTALGRLIV--FAAENYG-ESSFGK----PVLVTCKPPEEMVSFWLY-NLAIKQM
A0A412GR09      LNDTIHTALGRLIV--FAAENYG-ESSFGK----PVLVTCKPPEEMVSFWLY-NLAIKQM
A0A6I0S0M4      LNDTIHTALGRLIV--FAAENYG-ESSFGK----PVLVTCKPPEEMVSFWLY-NLAIKQM
A0A081PBV5      LNQTVRTPIGLLKV--TRSPGYK-VSDFDK----PVIVRKYPREAMVGYYMA-NLKIQQM
A0A1I2AN85      LNQTVRTPIGLLKV--TRSPGYK-VSDFDK----PVIVRKYPREAMVGYYMA-NLKIQQM
A0A4U0GMP3      FNEKVRTPVGVLAV--RPTDAYS-LAAFTN----EIRVSKNPREAMVGYFMG-RMNIRQM
A0A1H6CKR6      LNQTVNTPIGKVII--TPNPESKYRVNVSE----PIQVSKTPIDAMVGYFLS-NLEIVQM
A0A235E1C0      LNAETKTPVGNLII--SANSDKKFRVNLSE----DITITKSPIESMVGYFLG-NLDIVQM
R6D982          INDTVETALGRLVV--SATENYD-SSCWGK----PVKVSKQAREKMVYFFLS-NLSIKQV
A0A1F0I8C4      LNDTVHTALGKLVV--FAAENYG-GDWMER----AVKVISHPQEDMVSFWLS-NLTIRQM
A0A3A5RIJ2      LNDTVHTALGKLVV--FAAENYG-GDWMER----AVKVISHPQEDMVSFWLS-NLTIRQM
A0A515IZJ5      LNDTVHTALGKLVV--FAAENYG-GDWMER----AVKVISHPQEDMVSFWLS-NLTIRQM
A0A5M5NLR3      LNDTVHTALGKLVV--FAAENYG-GDWMER----AVKVISHPQEDMVSFWLS-NLTIRQM
A0A0D5BSQ0      LNQSVVTPIGKVLI--KPSKFYK-KDYYGT----EIQVTKSPRESMTGYFVG-NLVVKQM
A0A1T3F6P5      LGKLTSTPIGKLLI--NPSRYYK-KDYYGV----EIQVVKSPRESVMGNFVG-NLSIKQM
A0A0W8EPA0      LNSLTSTPVGKVLI--TPSKYYK-KDYYGV----EIQVTKFPREAVMGNFVG-NLSIKQM
A0A365UKN1      LNRLTLTPVGKVLI--TPSKYYT-KDYYEV----EIQVAKLPREAVMGSFVG-NLTINQI
A0A4R6WE41      IGQAFRTPLGEIQL--DSTSHYL-PGSFGK----SIRVEKFAREYMVNFFLS-NLKIKQM
A0A2T5RP38      LNQLTKTPFGEIII--VPSKYYH-KDNYGE----SILVTKYPREEMMLGLMG-NLKVKQM
A0A1A6CF06      LNRWVVTPAGKVFI--TPTKFYN-KDYYGK----DIQVTKSPREAVMGYFIA-NLKIKQM
A0A1T3D6S8      LNRWVVTPVGKVFI--TPTKFYS-KDYYGK----DIQVTKLPREAVMGYFIA-NLKIKQM
A0A1P8E011      LDKPVNTPFGQVIV--QSALKPN-KALPQQ----EVKVEKFALEGMVNYFIS-TISITQM
A0A1V3N3U3      LNKTVNTTLGRLTV--RPTKFYK-AGVFGE----EIQVRKYDREDIVGYFLG-NLKITQL
C2FUH6          LNKESNTPVGRIVV--TAEKQFT-ASTVGE----DIQVTKYAHEAMVGYIMG-NLKIQQM
A0A0B8T471      IGKEIKTPFGNMVV--DTTAKFT-SSYYGE----QVTVSKNAMESMVGYFLS-RMRIEQM
A0A4R7D2K0      IGKEIKTPFGNMVV--DSTKHFT-PSYYGE----QVTVSKNAMESVVGYFLS-RMRIEQM
A0A2X2J8S4      LNKAIKTSFGGIRI--LATPYYT-KAAYDQ----EISVNKLSSIDMANALLG-RLSITQT
A0A3C0S618      LNKAIKTSFGGIRI--LATPYYT-KAAYDQ----EISVNKLSSIDMANALLG-RLSITQT
A0A4P7DRF9      LNQLVNTPVGKMII--QFNPNLNYRKSSDE----QITITKSPIDAMVGYFLG-KLQIRQ-
A0A239XXC4      LNSEVKTPVGNLII--SANSDKSYRVNLSE----QITITKNPIESMVSYFLG-NLKILQ-
A0A4U9K473      LNAETKTPVGNVII--SANPDKKYRVNLTE----DITITKTPINAMVGYFLG-NLKITQ-
A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      ----------------------------------KYHFTIQDQGTVNAYLEK-NLAVDIS
A0A661XXA6      ----------------------------------EFYFIIRSHDALMDYIEA-NLSVEPV
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A4Q3SEI4      --------------------------------------------------SD-NIRATPA
A0A6A1IRV5      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ----------------------------------DTRGAALE-------LDL-DLSEAPH
A0A519TAP8      ----------------------------------QYHFVILNDGAVINYLDK-NLDVTVV
R5DEG6          ----------------------------------TVQVTKSPLQNVALRFQS-GLQATLA
A0A3N2LCI3      ------------------------------------------------------------
A0A642EJV3      ------------------------------------------------SCSS-NLSVSLN
A0A6H9Q899      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A519SD85      QAN---NILSLRYSNSNIYLSADILNAILASYLKFDKDQREISLTQTSKFITSLSDQLS-
A0A3M1TXY5      SKE--ARLLNITSEGPVVSMQNQFINTLLNTYIQNDLEKQREIGRKMLMLIDEQLTGVT-
A0A2E0VQ27      DKE--VSIIKVYFNHELPEKAQTFVNTLMKTYIEEGRKSREQQVAETLEYLEKQLEVVK-
R6U429          GKE--STVLVLTLTDRFPSRADNILSTLIDVYNEQWVEDKNRSARNTTAFINDRLVVIE-
A0A5C8AF42      DPE--AKTIQITFQGNNPQLCHDISLAVAEAFIEYDEEVKRKGSENILQFIDQQLDSLA-
A0A239K409      NAK--ASVLNISITDPVPERGRDVINKLMQDYREEELEGKNLIAASTIKLIDDRLNGLS-
A0A350V3E4      RG---LDIVSIKTESPSPQEAALISNCYAEAYADYSMKFNRGHLTLNREFLEKQVQEKY-
A0A1V5S1J9      MTG--ASVVQASISGTVPERDCDFLNGLCEEFLADNLARKNDAAIKTIEFIDEQLSTIA-
A0A0A2EYC8      LPN--TSVLNISVASDNPIRDVDFLSKHAKSFLDDNLDKKNYEADKTIQFINDQLSVIS-
A0A2G6H6Y4      IDK--TSVLNLSLASNNPARDIDFLNQHSKSFLSNNLDRKNSEAEKTIHFINDQLSNVS-
A0A1M3DPL8      MDG--SSVLEISMVSETPRRDVDFINKLCDIYLMSNLERKNDAATKTIQFIDEQLENVS-
A0A1V5F519      IEG--SSILEISLISETPDRDVDFINKLSEIYLEENLKKKNDVASKTIQFINEQLSEVS-
A0A2G6R1T9      INK--SSVLSISLQSPTPQRDVDFINKLFEVYLANNLERKNEQARKTIKFIDEQLTGIK-
A0A1M6MYT6      SDE--TTILDLTLRDRNVRKGMAFLNKLTEVYQLDNLEKKNENANRTIQFINSQLASIS-
A0A2P8CDS1      SKE--GTIVKLSTTCENPQKGIDFLNEMMQVYQTHNLDKKNIIATKTIFFITSQLANVS-
A0A353WYK7      DFK--AKTISVTFKDFNKYKAQDILMAIDTLYIYYTQLEKNRVNDQKIKFLNEQLHQTE-
A0A355BP94      NFD--ANTIRVTFRDFNPLKVYTVVNKIDSVYLYYSNEQKNQANRQKIDWLNQELHQVE-
A0A136LSC7      NFN--ANTIRVSFRDHNAHKAYDVVNKIDSLYIVYSNQQKNLANKQKIEWLNNELVQVE-
A0A5C7N8Q5      NFN--ANTIRVSFRDHNALKAYDVVNKIDSLYIIYSNQQKNLANKQKIDWLNNELVQVE-
A0A2W4RDE8      SKE--SNIVQLTIEQAVPQKGVDFINAVMRVYLDNELYKKNQLGLRTIAFIDEQLMGVS-
A0A0L8VEV2      EDK--ADLIYLSLIDQVPQKGADYLNELSRVYLAYELREKNHTSATTIDFIDSQLKDVI-
A0A1I2A9Z9      EEQ--ADLIRLSMVDEVPQKAADYLNELSRVYLTYELREKNHASATTIDFIDSQLKDVI-
A0A212J9Z9      QNN--SSILSISMSGTNPAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLIN-
F5IV23          QNN--SSILSISMSGTNPAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLIN-
F8X2T0          TEN--STALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVIN-
A0A1M3LAG1      TEN--STALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVIN-
A0A212K6G4      TEN--STALTVSMYGTDPAKDMDYLKALLDKFQDYNLALKNQQADLTIKFLDAQITVIN-
A0A4Y9IPG7      TEN--STALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVIN-
A0A2V3PNY7      RDG--STALGISIFGSSPAQDVDFLRALLQEFEEYNLTLKNEAADRTIAFIDKQMGIIA-
A0A6G7WQ31      REG--STALGVSIYGSSPAQDVDFLRALLKEFEDYNLTLKNEAADRTIAFIDRQMGIIA-
A0A6G7X5K8      REG--STALGVSIYGSSPAQDVDFLRALLKEFEDYNLTLKNEAADRTIAFIDRQMGIIA-
A0A1M5DFS8      REG--SSALAISIYGTSPAQDVDFLKALLKEFEEYNLTLKNEAADRTIAFIDRQMTLIS-
A0A4Y8KZS5      REG--STALAVSIFGTSPLQDVDFLRALLKEFEDYNLTLKNEAADRTIAFIDRQMALIS-
A0A142HHS5      NPI--ANTIQISFLDNNRFKAQRIVNALDTVYRDVKLAYKQETTENSLAYLDKQLEENG-
A0A660LQT8      DKG--AEILNMSFNDVSQERAEDVLRMLIDAYNEAWLADKNQIAVNTSKFINERLQVIE-
A0A350PNH9      EEK--ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIE-
A0A354LNT9      EEK--ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIE-
A0A2M6GH67      NPS--ANTISISFTDFNPRKAQDIINRVDSAYLVQKLLVKNQATQQQLKFLDEQIQATK-
A0A389LWV6      LDG--ASVMEISLVGKVTQRDIDFLKILNQEFFDDNLKRKNATAERAIEFINEQLLILK-
A0A1G9B1T9      EEG--SDILVLTTTGEIVEKELMFLNSLMETYIEDEVKNKNLLGLRTINFIDKQIATVA-
A0A161LWY6      TQN--STVLAVSLVGTVYQRDIDFLNALCDEFLLDNLNRKNEEANRTISFIDKQLSDIS-
A0A6I3N9U6      TQN--STVLAVSLVGTVYQRDIDFLNALCDEFLLDNLNRKNEEANRTISFIDKQLSDIS-
A0A3D0FMX4      AEG--SSVLTIQLVSETPERDKEFIDKLCDIYLLQSLERKNKVAESTIQFIDQQLDTIR-
A0A1M3MEI8      MEG--SSVLEISLASATPARDVDFINKLCEVYLISNLERKNDAASKTITFIDKQLESVA-
A0A1J5HQM0      QEG--SSVLEIAMNSETPERDIDYINKHVTMSLLQNLERKNDAANKTINFIDEQLQNVS-
A0A653AC35      SDG--SSVLAVSLVSPTPQRDIDFLNKLSELFLAENLERKNDAANKTMRFIDEQLSDVK-
E4T131          TEG--SSVLRINFVSDTPDRDIDFINKLCETFLADNLSRKNDAANKTIQFIDEQLKGVS-
A0A521H707      NQY--AQTVRISFKDQNSQKASDFVNTMVDEFNRYDKERKSEGADKSLQFIDETVLGID-
A0A1F3D6P8      SPK--TSLIILKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEIS-
A0A356Z058      SPK--TSLIILKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEIS-
A0A3D1BT36      SLK--STLINVFFQGENLDLTVDFLNTFLQTYLDNNLSKKNTIALNTVNFIDSQISEIS-
A0A352ME00      SPL--ASIINVRFSENNLDKTINFLNRYLSTFLEGNLAKKNNMASKTVNFIDSQVSDMA-
A0A3D3HL11      SIR--SSLINVLFHGENRRLTIDFLNKFIQSYLDENLAKKNKIAINTIDFIDSQISEIS-
A0A5R9QZP0      NIR--STLININFKGENLDLTVDFLNNYLQTYLNDNLSKKNNVAFNTINFIDAQISDIS-
A0A2W7RD29      TTG--GSILDIRLITNNPAKGEDFLNQLMNNYLFIELDDKNSIATNTINFISNQIQNVS-
A0A3N2NDY8      DKD--ADVIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIE-
D7JEV9          PN---TSVLNISVLSDNPLRDVDFLTRHAQSFLDDNLDKKNYEADKTIQFINDQLGIIS-
A0A4R6H3B7      EEK--ADLIRLSMVDEVPQKAADYLNELSSVYLTYELREKNHASATTIDFIDSQLKDVI-
A0A2W7QSQ0      SVK--SSTLYIRLYDTSPEMGKQIMSSVIEGYNQRIINQKNETALKTINFINERLGIVK-
R7F6L5          AKE--GTLIALSYTSTSPYRCEDVLNGVVQAYNDQWINDKKAIADATSDFISERLSVIE-
A0A553GA49      QLD--ATAISINLVSTNFNMGKEFLDKYIETVIEYDLQRKNHIAFSTIDFIDDHLSDVF-
A0A497D6F6      SQE--TSIIELSLKTLNVAKGIDFLNTLVAVYQAYTLERKNENASRTINFISTQLQTVS-
A0A5M4AAB9      SLK--SSILKLKTTCENTEKGIAFLDMLMRVYQEHNLKKKNTIATKTIFFITSQLSEVR-
F4KR18          DEKNHSSVLILGLRDVVPQRGIDIVNRLVDKFNQLKSEVNTEITLKTLELIDGRLANIS-
C9LKL0          DQE--SSLIVLTCQDINIARATDIINTLFSCYKQDVVDNKNRVGQNTAHFIDERLSLIG-
A0A3D0QPV7      NAS--AKTLQISMRDHNKAIAHDIVYAITHAFNEFALERKNESSKKILDFIDSQIDTVY-
A0A496KT23      NKA--STIIDIQYSDVNTARAKDAIDMLISVYNENWVRDRNQISVSTNEFIKERLAVIQ-
L1M9T3          DKA--STIIDIRYSDVNTARAKDAIDMLISVYNENWVKDRNQISVSTNEFIKERLSVIQ-
A0A3C0I8F1      NHN--AGIIRISFKDHNAEKVRDIVNVIDTVYLEKTLAAKSQATLQQTNYLNEQLEKVD-
R5JJI4          SKT--ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIE-
A0A3D2HF71      EEE--ASLVTLTVTGTNPEQEADYLNKLMDVYIEFGLENKNRTADQTIDFIEKQLAIIS-
A0A0A2DQN2      EGR--ATILSLSITEASKQKATDLLGALVEAYNEEVNTLRTQISVNTTEFINNRLISLE-
A0A0A2F2N5      ENR--ATVLSLTLTDNSKQRATDLLEAIVDAYNTETSSVRNQIAVNTARFINERIANLS-
L1NGW4          QEK--SSTLMLSLQDRTKQRALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLS-
Z4WRA0          QEK--SSTLMLSLQDRTKQRALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLS-
U2K8K9          EAQ--TSTLTLTLRDKTLKRALDILAAQVMAYNQEEVEMRNQVSKNTAEFVNERLEALS-
A0A069ZM60      ENR--ASTLTLRLQDRTKKRALDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALG-
J6GV98          ENR--ASTLTLRLQDRTKKRALDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALG-
A0A134B4F8      ENR--ASTLAIRLQDRTKKRALDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALG-
A0A134B8C7      ENR--ASTLAIRLQDRTKKRALDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALG-
A0A4Z0EKR0      NTR--ASVLNLTLTDPIAGKAKDVLNKLMDVYNREAIEEKNLTTANTLKFLDDRLEKLA-
A0A229I3A5      DVK--STVIDLTYKDVLAKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIE-
A0A3R6HJB3      DVK--STVIDLTYKDVLAKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIE-
B5CTK0          LAG--STMLNLSIIDSSVARADDVLNTLIAVYNEDLINDKNQIAINTSNFISERLNIIE-
A0A1M6B6D5      SSG--SSVLQMRMTGHNKAKLVDYLNMSVQVLSEDMLERKNLFATKTIRFIDSSLAEKS-
A0A451FS66      SKG--SSVLRLTVIGSNKAKLVDYLNTSIQILSEDMLERKNLYATKTIQFIDSSLAKKS-
A0A2E3GN39      NKE--TFAILVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSISFLDKQIDSIK-
A0A3D1MEL0      NKE--TFAIQVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLDQQIDSIK-
F0R0C9          DEK--STVINLSFQDVCIQRAEDVLNTVIAVYNENWVKDKNQIAVSTSMFINERLGVIE-
A0A2A4N9A6      NLS--ARTMILNFRDPNPAKAADFLNNLVQSYMEYGLDKRKESIINSANFIEDQLQKIEI
A0A6C0GGI1      SRD--SRILNLYAEGTVAAKEAKFLDTLISVYLETDLIEKQEANIKAIAFINSQLSTVA-
A0A368D1N7      NKE--TFAIQVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLDQQIDSIK-
A0A3B8TU58      NKE--TFSVAITGKHPSKAKALVMVDLLIESFLNFHLYQKTESIKQSISFLDEQIDSIK-
A0A1T5IIR6      --D--KQILTLVEQDYNAQRAADIINMLVVKYNEAAIREKNRVAVHTEDFINERLAIIE-
A0A3E0QD27      NQV--AQTILIKFNDNNAVKASDFVNSIMDEFNEYDRERKSEGAIKSLDFINETVAGID-
A0A0M1W1I6      END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-
A0A4R4GHU2      END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-
I8WPR6          END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-
A0A0K2HKS3      END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-
B6W3W8          END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-
A0A4R4GSI6      END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-
A0A076IRY8      END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-
A0A3A6AD54      END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-
A0A3A6MIU7      END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-
I8WPP8          END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-
A0A372Y7D2      END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-
A0A3E4JJC9      END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-
A0A3E4WDQ0      END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-
A0A414H9P2      END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-
C3R5A8          END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-
A0A1C5XJA7      EEE--SSILTLALKDNSSERAEDILNMLVNVYNEETIRDKNQVAVNTANFINERLIIIG-
A0A3E5BU42      EDE--SSILVLSLKDDSPLRAEDVLNTLVNVYNEEALNDKNQVAVNTSEFINERLLIIE-
R7CUW4          EEE--SSILTLALKDSSPVRAEDVLNMLITVYNEEAIKDKNQVAVNTANFINERLIIIE-
A0A416GGJ1      EDE--SSILTLALRDFSPERAEELLNTMINVYNEEAIEDKNQVAINTANFINERLIIIE-
D1JY72          END--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-
D7J4K6          EDE--SSILVLSLKDGSPLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIE-
Q8ABP9          EDE--SSILVLSLKDGSPLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIE-
A0A5M6AHF7      EDE--SSILVLSLKDGSPLRAEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIE-
D6D2Z5          EDE--SSILVLSLKDGSPLRAEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIE-
A0A1T3EDR4      GED--TSVLELSIEDSSSKRGVSFLKSLVAVYNALYLDDKKRIAQSTGEFIADRLKIVE-
A0A174SDD8      SGD--AALLRIAMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-
A0A1H7RFH3      SGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-
A0A139L1N2      SGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-
A0A174TVL8      SGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-
A0A1H8BJR6      SGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-
R9H6G0          SGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-
A0A412GR09      SGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-
A0A6I0S0M4      SGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-
A0A081PBV5      EED--ASLLQVFVEDSSLQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQ-
A0A1I2AN85      EED--ASLLQVFVEDSSLQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQ-
A0A4U0GMP3      EDD--AALLQISMEDNSPRRAEDVITMLITVYNEEAIDDKNRIAVNTADFIRERIDIIE-
A0A1H6CKR6      -ED--VAILQMTMEDTSPMRAAEMITNLITVYNNMTINDKKALGDTTANFIRDRIAIIE-
A0A235E1C0      -ED--VEILKMTLEDASPLRAEDMVTKLIEVYNQMTIEDKKTVANNTADFINDRIVIIE-
R6D982          NGD--VALLNIMMDDFSPLRAGDVLNMLITVYNEEAIEDKNRIAVNAAQFIRERIEIIE-
A0A1F0I8C4      SGD--AALLRITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-
A0A3A5RIJ2      SGD--AALLRITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-
A0A515IZJ5      SGD--AALLRITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-
A0A5M5NLR3      SGD--AALLRITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-
A0A0D5BSQ0      EED--TSLLQITLSDNSSERASDILTLLVQVYNEVYLQDKNKIAVNTAKFIKDRLVIIE-
A0A1T3F6P5      EEE--ASLLQVTITDDSPERAADILTSLIIVYNEVYLQDKGKIAENTANFIKDRLAIIE-
A0A0W8EPA0      EEE--ASLLQVTISDDSPDRAADILTSLITVYNDVYLQDKGKIAENTANFIKDRLAIIE-
A0A365UKN1      EEE--ASLLQLTIKDDSPERAADILTSLITVYNDVFLQDKGKIAENTANFIKDRLAIIE-
A0A4R6WE41      EDD--AFLLQMHLEDRSARRAGDILTELITVYNRTALEDLNQTAVNTADFIKNRLQIIE-
A0A2T5RP38      EED--ASLLQVSLDDLSSERADDILGTLIKMYNEIYLQDKNKIAVNTANFIKDRLAIIE-
A0A1A6CF06      DED--TSLLQVSIEDVSSDRADDMLTTLINVYNEVYLQDKNKIAVNTADFIKERLAIIE-
A0A1T3D6S8      DED--TSLLQVSMDDVSSDRADDMLTTLINVYNEVYLQDKNKIAINTADFIKERLAIIE-
A0A1P8E011      EED--ASLLQIVAEDTNPLRATALIAEMINVYNEVALQDKNQIGVNTANFIRERLAIIE-
A0A1V3N3U3      EED--ASLLQIVIEDQNPQRAAALIAEMITVYNEISLKDKNQIGVNTANFIKERLAIIQ-
C2FUH6          EED--ASLLQITLEDQSIKRANDIITTLITVYNEFSLEDKNQIAINTAQFIRERLQIIE-
A0A0B8T471      EDD--ASLLQMSLEDVSAERAADMLSTLVTVYNKETVEDKNRVAKNSAEFIKERIAIIE-
A0A4R7D2K0      EDD--ASLLQMSLEDVSAERAADMLSTLVSVYNQETVEDKNRVAKNSAEFIKDRIAIIE-
A0A2X2J8S4      TDD--ASLLQIAMEDSNPQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILS-
A0A3C0S618      TDD--ASLLQIAMEDSNPQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILS-
A0A4P7DRF9      LED--VELLQVTMEDSNPLRAADMITKLIKVYNVMTIKDKNMIAHNTADFIRDRIAIIE-
A0A239XXC4      MED--VEILQMTLEDASPLRAEDMITKLIEVYNQMTIEDKKTVANNTADFINDRIVIIE-
A0A4U9K473      MED--VEVLQMTMEDSSPMRAEEMISKLIEVYNEMTVQDKKKIANNTANFINDRLVIIE-
A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      SAD--ANTIQISFTDFNPRKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNY-
A0A661XXA6      NVE--ANIFKVSFKDYNVNKAHALISAIDTLYYKYSLNEKNRANKNKIEYLNTQLTETE-
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------MKQLISRYQKASIGEKNKVADNTIAFINANLARIS-
A0A2P8G5K0      ----------MSVQDVLPRKGEAILNQLIARYQKASIGEKNKVADNTIAFINNNLARIS-
A0A4Q3SEI4      GKL--STVINLTMNDEVPERGENILDNLLTVYNKAAISDKNVMSSNTLDFVEERIRFVV-
A0A6A1IRV5      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ----------IAFQSANARKAHDIVTALANEFTKYDIEERSKSSRNVLGFIDKQLDKYY-
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      LTL--SDLPPVPVTPPPPAGQA--------------------------------------
A0A519TAP8      NPS--ANTIQISFTDNNPEKAAHIINNIDTVYLQEKLDRKKQSSALSLEFIDQVIADND-
R5DEG6          SKT--ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIE-
A0A3N2LCI3      ------------------------------------------------------------
A0A642EJV3      SEK--ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIE-
A0A6H9Q899      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A519SD85      LKTIASSVALQKFKEVDNDIISPLAISH------NVKAYSDLNEELKRISIAEQTLKFVY
A0A3M1TXY5      DSLRKAEFSLRGFRAGTNIVDIGVTSKD------LTDQLTELERQRAALAVAGQYYEYVL
A0A2E0VQ27      KRLGDAEAGLAGYRSENQLINSTQETDA------VLRELTQLNLQKVDLDMKTSELKRLQ
R6U429          KELGGVEEHLKDYKAEHNITDIQSLSAA------YLGESTEYKSMSFEVNNQLAIAKFIK
A0A5C8AF42      GELKSSKDSLMLYQRQSNLPDPEAVGTT------ISENISKLQDQQFEIDEEIRSLNLVS
A0A239K409      AELIEIEKDVEQYKRQNKLADVASQSKV------YVEESNTYQKQLAEWSVQIDVLETIE
A0A350V3E4      NSLLQTEDKLTNFLRTENVVELNAQANS--IISSLSGIEGDYNRSLIDVQSTTRALTDIK
A0A1V5S1J9      DSLRISEGRLKDYKANNFVVA-SVGGSN------LMGQYTQLDAMQTDLRLKESYLNYLT
A0A0A2EYC8      DSLSRSESNLNSFKIANKMYG-QNNSIL------LTNKMEALEEQGKIIKLRDEYFKYLR
A0A2G6H6Y4      DSLSRSEAKLNSYKIEHKIYS-SDMTSV------LVGQMEKLKNQGKQIKLRDEYFKYIK
A0A1M3DPL8      KSLATSEDNLSDFRKRNQLINVSSLTDE------LLSKAASFDEELNQIRLKETYIAYVE
A0A1V5F519      KSLSVSEDEMTRFRRDNQIIDISSHGSE------LMSKANSLDEKKAELKLKETYLNYLT
A0A2G6R1T9      QTLKGSENDITEFRRSNQIVDITTHTSE------IVEKSTEYNERKSALRLKEKYLNYLA
A0A1M6MYT6      DSLSVSESRMEDFQSEHQIVNISAQSEQ------LLERMRELDQERIAMETQNKYYHYLR
A0A2P8CDS1      DSLSASQKIRERFQSRNNLLDVSYQSQQ------LLDQLVKLEDQKSLLETQHQYYQYLE
A0A353WYK7      STLSELENYFENFTIDNRTTDMNVSLSR------TITMLEELDSIKMKLNDQLDNFNEIY
A0A355BP94      NKMEGFENYFEDFTLKNKSSDLTTELRQ------TIYALNQVDSQRFSLNKRILELNGYI
A0A136LSC7      EKMEGYENYFESFTLQNKSSDLTLDLKK------TIAAINVVDSQRYSLNKQLAELNTLI
A0A5C7N8Q5      RKMEGYEDYFESFTLQNKSSDLTLDLKN------TIATINRVDSQRFNLNKRLIELNALI
A0A2W4RDE8      DSLRRVEGTLESFRARSNVIDIRTSAQT------LTNNLDKLETERANLEVKLKYYQYIL
A0A0L8VEV2      DTLQVAGNKFTSFRSQNQIVDIGQEGGI------IVQRLVDLDKERSLAQSHLDYYRNLQ
A0A1I2A9Z9      DTLKVAGNNFTSFRSRNQIVDMSQEGGI------IVQRLVDLDTERSMIQSHLDYYKNLQ
A0A212J9Z9      DSLDISRFKLERFQKETGVYDVSSQSLR--------IALDSADREKDALALREKSVLLLT
F5IV23          DSLDISRFKLEKFQKETGVYDVSSQSLR--------IALDSADREKDALALREKSVLLLT
F8X2T0          DSLNISRLKLEQFQKETGVYEVSSATVR--------RELDVADVDRDQVAMREKTVLFTT
A0A1M3LAG1      DSLNISRLKLERFQKETGVYEVSSATVR--------RELDVADVDRDQVAMREKTVLFTT
A0A212K6G4      DSLNISRLKLERFQKETGVYEVSSATVR--------RELDVADVDRDQVAMREKTVLFTT
A0A4Y9IPG7      DSLNISRLKLERFQKETGVYEVSSATVR--------RELDVADVDRDQVAMREKTVLFTT
A0A2V3PNY7      DSLQQSEIIFKDFQDETGLYRITKSDGR--------VELESVMKSIGEVKAQEDLILRLT
A0A6G7WQ31      DSLQQSEASFKDFQDETGLYRLTKTDGR--------SELENVMQSIGEVKAQEDMILRLT
A0A6G7X5K8      DSLQQSEASFKDFQDETGLYRLTKTDGR--------SELESVMQSIGEVKAQEDMILRLT
A0A1M5DFS8      DSLEQSEQTFKTFQDETGLYRIQGGDQR--------ADRDAVLQGIAENKAQEELILRLT
A0A4Y8KZS5      DSLQQSETTFKRFQDETGLYKIEGGDKR--------LERNDILTAMAENKAQEDIILRLT
A0A142HHS5      QNLAKAEDNLKIFVQQNGTYDAKGELGT------ITNKLEKIEEDRFKLEQKLTLLADVS
A0A660LQT8      NELGNVDKNISSYKSANLLSDTDEASKL------YIKKTEENTDKMMDLNNQIYMTRYVS
A0A350PNH9      RELGDVDKDISSFKSRNLLPDVETAAQQ------YMQKSGDVDKQILELNSRLSMARYLR
A0A354LNT9      RELGDVDKDISSFKSRNLLPDVETAAQQ------YMQKSGDVDKQILELNSRLSMARYLR
A0A2M6GH67      DDVTRYEKAMQDFAIQNKTYDVRGEIAK------SMARLEELYKERSDLGLQINLLRDIH
A0A389LWV6      DSISSAESKLNAYQSQAGIFSSDNSLRS-------STELVDLDKKKAEIRLRKEYTKFLQ
A0A1G9B1T9      DSLSQVEQSLRSFRDRTRTVDIGTTARD------LNTKLDELQKTREDLLIDYRSYQNLF
A0A161LWY6      DSLRTSESHLQHFRKANQILDLNAYGST------ILGHLTSYDEKRLQYNLKESYLNYLA
A0A6I3N9U6      DSLKTSESHLQHFRKANQILDLNAYGST------ILGHLTSYDEKRLQYNLKESYLNYLT
A0A3D0FMX4      KSLASSESAMTDFRKRNEIVDIQSYSSE------LLGKVNAYDQERLAMRLKETYFEYLT
A0A1M3MEI8      EELSMSEDEFTSFRRRNQIIDVGSFSGD------LLSKAAAYDTEINQLKLKESYLDYLV
A0A1J5HQM0      KSLTVSQGEMTDFRQRNQIINVDTHAGE------LLGKSNSYESQFSTLKLKETYLDYLT
A0A653AC35      KSLEASEGAMTQFRQSNQIVDMSSHSTE------VLGKATAYDEKQNELQLRESYFNYLT
E4T131          KSLTTSESQMTNFRQSNKIVDVSSHTSD------LLGKATKYDGQQAELKLREDYLTYLT
A0A521H707      TQLRLSEYSVEAFKKEHLIIDPLQNAED------ALAHINLLIDQRIEVQLQLAVLQRIE
A0A1F3D6P8      DSLVISESKLRNYRSANQVMDLSFQGKS------LYEKLEQIETERANLQIQERYYNYII
A0A356Z058      DSLVISESKLRNYRSANQVMDLSFQGKS------LYEKLEQIETERANLQIQERYYNYII
A0A3D1BT36      ESLSSSQSELRDYRSTHQVTDLSYQGQQ------ALNQMEQIDNEKATLQAQQRYYNYII
A0A352ME00      DSLVRSESALKNYRSANQVMDLSFQGQR------VYEQMTDIDNERANLKVQERYYNYVI
A0A3D3HL11      DSLTQSESKLRDYRSANQVTDLSYQGQQ------ALEQMRQIENERSMLQVQERYYNYIL
A0A5R9QZP0      DSLVKSESELRNFKASNQVTDLSYQGQQ------ALTQITAVDNEISSLNVQEKYYNYIL
A0A2W7RD29      DTLGVIENELQNFRAANQTTNISSEGEV------IFGRLQSMGEELAKEKIKKEYLLSLD
A0A3N2NDY8      RELGNVDNEIFDFKRDHRVPNLEEAAKT------QMKQSVEMSNKMLEVTNQMSMSIYLR
D7JEV9          DSLSRSESNLNSFKVANKMYGQNNTSIL-------TERMESLENQGKQIRLRDEYFKYLR
A0A4R6H3B7      DTLKVAGNNFTSFRSRNQIVDMSQEGGI------IVQRLVDLDTERSMIQSHLDYYKNLQ
A0A2W7QSQ0      NDLEEFEKSGENFKTRNNITDISMNSKI------YLENTAETRKQVAEVSGKIDILESIE
R7F6L5          QELGNVDSDISSYKARTMSPDLEAQAQI------NMARSSELQNQQYDLSNQIQILNYVR
A0A553GA49      DSLSIAEQSLQDFKTDQQVVDVNLKAGQ------IYENLRAIGIEKDQLEAHVNNLEFLN
A0A497D6F6      DSLGISENAMQAFQSKHKLLNISIQSEQ------LLDQVNELEKEKVVLETKNKYYKYLR
A0A5M4AAB9      DSLKASQKIRERFQSNNQLLDVGYQSQQ------LLDQLVKLEDQKNLLETQHQYYKYLE
F4KR18          AELASAESTVESYKLNNDII-----AET------TTDLSITLEDVNNLVKEQRKVELQQK
C9LKL0          SELAGVEGRLASLKESNRIVDFKTAADQ------YSSMSVTARQSSVDLQSQVSVARYLK
A0A3D0QPV7      TKLKNSELELQAFRQLNKVQNFEGVSKN------YLERLTELEGQLLKVDIDEELIIEVE
A0A496KT23      RELGSVDQNIAGYKSANLLPDVEQSGNM------AVNQANEAEAKARELSTQVYMTRHVK
L1M9T3          RELGNVDQNIAGYKSANLLPDVEQSGSM------AMAQANDAEIKARELSTQTYMTRHVR
A0A3C0I8F1      EELTKYESLLEGSLIENKTTDLLSKFST------SVKESENFGEKKAEITNLLNLLDQLE
R5JJI4          RELGSVDANIESFKRENQLTDITSETGM------YLQNTSRYKQEGLSLENQLSIVKYIK
A0A3D2HF71      DSLHLAENSLESFRLANRLIDLSREGVA------IQNRLEEIDKEKTSLMLQKNYYEYLK
A0A0A2DQN2      EELESMENNREELLIENQFINPASLAES------YMNRTQTNQNGRIELEAQERLIAYMQ
A0A0A2F2N5      EELDALASNIDSFQRANNFIAPEVVAGA------YTSRAQTGHEASFEIDAQKRLARYFL
L1NGW4          KELGIVENEMESFLVTNRTLDFDAKMGR------YNTRSVDYEVQAMEIETQLKLVSFML
Z4WRA0          KELGIVENEMESFLVTNRTLDFDAKMGR------YNTRSVDYEVQAMEIETQLKLVSFML
U2K8K9          RELGVVEQDMTRFSARNKTIDFTSKVES------YNARSLEEEDASIKIEKQLKLVSYML
A0A069ZM60      KELGLVEGDMERFLMNNRTLDFEGKVGV------YNSRSLESEAEALQIETQLKLISYML
J6GV98          KELGLVEGDMERFLMNNRTLDFEGKVGV------YNSRSLESEAEALQIETQLKLISYML
A0A134B4F8      KELGLVEGDMERFLMNNRTLDFEGKVGV------YNSRSLESEAEALQIETQLKLISYML
A0A134B8C7      KELGLVEGDMERFLMNNRTLDFEGKVGV------YNSRSLESEAEALQIETQLKLISYML
A0A4Z0EKR0      YGLSGTEKVVEKFKSANQLTDITTQASN------YTSQANSYDKQLSEWAIQIDVLESIE
A0A229I3A5      RELGDVDKNISAFKSSNLLPDVEAAAQQ------YMQKSTEVDKQIMDLNSRLAIAQYIR
A0A3R6HJB3      RVLGDVDKNISTFKSSNLLPDVEAAAQQ------YMQKSTEVDKQIMDLNSRLAIAQYIR
B5CTK0          KELGNVDSNIETFKRQNRLTDVNSEASM------YLASSSSYQQEGVGIENQLTLAKYIK
A0A1M6B6D5      IELSLVEDELNDFRRNNVIFDLNIEGAE------LNEKLNALDLRKEAAARELDYYNTLQ
A0A451FS66      AELNSVQDELNKFRNKSAVYDLATEGSE------LNSKLNALDLRKEAVNRELNYFITLQ
A0A2E3GN39      PLYDDALIAVRNAEAQKGYRNIEALGGG------LYKDIKDLQKKLVRIEYVTSVLEWFA
A0A3D1MEL0      PLYDDALIAVRNAEAQKGYRNIEALGGG------LYQDVKELQKKLVRIEYVTSVLEWFA
F0R0C9          GELGNVDENISSYKSEHLLPDVQAASNL------YMAQSSETNAQILALNTQLSMARYIR
A0A2A4N9A6      QLLNSTNKLMNINLDTKTIANISRVFQSEGKYIINDNPEFLIAQKINDLKLEINIIDTVN
A0A6C0GGI1      NQLENS------KQALEGYKRTYGTERGVAKLNAYERLEALQLQRSDYTTRLRSLNNTLD
A0A368D1N7      PLYDGALIAVRNAEAQKGYRNIEALGGGL-----YEDVKELQRK----LVRIEYVTSVLE
A0A3B8TU58      PLYDEALVAVRNAEAQKGYRNIEALGGGL-----YADVKNLQQK----LVRLDYLISVLG
A0A1T5IIR6      EELGGVEGELARFKSSNKIMDVDYTANM------YLGDSRGYNAEIVAVETKLALSNYLK
A0A3E0QD27      VELRASEGSLEQFKKDNMIIDPRQNASE------ALTHINKLIEQRVEMQLQLAVMNRLE
A0A0M1W1I6      KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
A0A4R4GHU2      KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
I8WPR6          KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
A0A0K2HKS3      KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
B6W3W8          KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
A0A4R4GSI6      KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
A0A076IRY8      KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
A0A3A6AD54      KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
A0A3A6MIU7      KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
I8WPP8          KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
A0A372Y7D2      KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
A0A3E4JJC9      KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
A0A3E4WDQ0      KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
A0A414H9P2      KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
C3R5A8          KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
A0A1C5XJA7      QELGDVESDLESFKRENQTLDISSSASM------YMGESQKYNSSALELETQLRLAQYIK
A0A3E5BU42      RELGGVETELEAFKQSNQLMDIGSLAGQ------YMGEAQTYSADALEQETQLKLAQFIK
R7CUW4          RELGGVESDLESFKRSNQIVDISSAAGM------YMTESQKYNADALELETQLRLANFIK
A0A416GGJ1      KDLGVVESDLETFKSSNQLMDVSSTAGM------YMSESQKYGADGMELETQLRLAQYIK
D1JY72          KELGGVENELQSYKQNNDIIDIGSAASM------SMSDKRQYSSTTQELELQARMARYIK
D7J4K6          RELGGVETELESFKQHNQVMDIGSLAGR------YMGEAQAYSADALEQETQLKLARFIK
Q8ABP9          RELGGVETELESFKQHNQVMDIGSLAGR------YMGEAQAYSADALEQETQLKLARFIK
A0A5M6AHF7      RELGGVETELESFKQHNQVMDIGSLAGR------YMGEAQAYSADALEQETQLKLARFIK
D6D2Z5          RELGGVETELESFKQHNQVMDIGSLAGR------YMGEAQAYSADALEQETQLKLARFIK
A0A1T3EDR4      GELSGVEQKIEDFKLSNQGMDAQSLKSL------SLSEQGENKSQGMKIDMDISLLEMLS
A0A174SDD8      HELGSVETDIEDLKKANNGVDINMAAGM------YIQDSRQYESSIKELDTQLQLVTFIK
A0A1H7RFH3      HELGSVETDIEDLKRANNGVDIDMAAGM------YIQDSREYESSIKELDTQLQLVTFIK
A0A139L1N2      HELGSVETDIEDLKRANNGVDIDMAAGM------YIQDSREYESSIKELDTQLQLVTFIK
A0A174TVL8      HELGSVETDIEDLKRANNGVDIDMAAGM------YIQDSREYESSIKELDTQLQLVTFIK
A0A1H8BJR6      HELGSVETDIEDLKRANNGVDIDMAAGM------YIQDSREYESSIKELDTQLQLVTFIK
R9H6G0          HELGSVETDIEDLKRANNGVDIDMAAGM------YIQDSREYESSIKELDTQLQLVTFIK
A0A412GR09      HELGSVETDIEDLKRANNGVDIDMAAGM------YIQDSREYESSIKELDTQLQLVTFIK
A0A6I0S0M4      HELGSVETDIEDLKRANNGVDIDMAAGM------YIQDSREYESSIKELDTQLQLVTFIK
A0A081PBV5      SELGSVESNLENLKVSNQGIDVNAASQM------YVSEGMMHESAGNDVQTQLKLVEMMQ
A0A1I2AN85      SELGSVESNLENLKVSNQGIDVNAASQM------YVSEGMMHESAGNDVQTQLKLVEMMQ
A0A4U0GMP3      SELGLVESDLERLRIANQGLDLASSRQM------YSSESQTYYAEGNAAETQMKLVELMK
A0A1H6CKR6      TELSGVESQIEGMKTSNQGLDVKSAGEQ------YWSDSRGYDASSKEIETQMKLVEIMR
A0A235E1C0      KELSSVESSLEGMKTQNQGLDVKSAGEQ------YWTESRTYQSSSKELATQMKLVEIMR
R6D982          DELGSVETDIEVMRKESDWGDINTAASM------YVSDGRKYESSLKELDTQLQLVSFIK
A0A1F0I8C4      HELGSVETDIEDLKRANNGVDINTVAGI------YIQDSRQYELLIKELDTQLQLVTFIR
A0A3A5RIJ2      HELGSVETDIEDLKRANNGVDINTVAGI------YIQDSRQYELLIKELDTQLQLVTFIR
A0A515IZJ5      HELGSVETDIEDLKRANNGVDINTVAGI------YIQDSRQYELLIKELDTQLQLVTFIR
A0A5M5NLR3      HELGSVETDIEDLKRANNGVDINTVAGI------YIQDSRQYELLIKELDTQLQLVTFIR
A0A0D5BSQ0      AELGAVESNIENLKVANQGIDVETAGSM------YLAEKNQYKTDRTKVETDIRLAEMMR
A0A1T3F6P5      GELGAVESNVENLKVANQGIDVATAGGL------YLNEKNQYKTEGAKIETDIRLAEMMR
A0A0W8EPA0      GELGAVESNVENLKVANQGIDVATAGGL------YLNEKSQYKSEGAKIETDIRLAEMMR
A0A365UKN1      GELGAVESNVENLKVANQGIDVATAGGL------YLNEKNQYKTEGAKIETDIRLAEMMR
A0A4R6WE41      EELYEVETDIEKLKVNNQGVDVGTAGQL------YVAEGRAFQTQRTQIETDKRLVEMMR
A0A2T5RP38      SELGAVEANIENLKIDNQGLDIETAGGM------YLSESNQYKTEKTKTETDLRLAEMMR
A0A1A6CF06      GELGAVESNIENLKIANQGIDIATAGGM------YLSESSQYKTEGTKIETDIRLAEMMH
A0A1T3D6S8      GELGAVESNIENLKIANQGMDVATSGNM------YLSESNQYKTEGTKIETDIRLAEMMH
A0A1P8E011      QELGSVESSIEDLRTQNQGMDASTVGTA------YFEDSRLYQSERNKVETDINLAQMMR
A0A1V3N3U3      QELGSVESNIEQLRQSNQGVNIETAGEM------YLNDSRQFQSARTKIETERKLTQLMQ
C2FUH6          SELGNVENNIEQLKTANQGVDVNVAGEM------YLSESRQHLEERNKLETDIRLVDMMR
A0A0B8T471      TELGGVETDLEQMKARNEGMDVNTATGV------FWGESREYQSTTRGIETQLRLVELMR
A0A4R7D2K0      DELGGVETDLEQMKARNEGMDVNTATGV------FWGESREYQSTTRGIETQLRLVELMR
A0A2X2J8S4      EELGSVEGDLEKIKVNNNGMDVAEVGGM------YIEDSRSYRLEATKIDTDLKLAEMMS
A0A3C0S618      EELGSVEGDLEKIKINNNGMDVAEVGGM------YIEDSRSYRLEATKIDTDLKLAEMMS
A0A4P7DRF9      EELSSVESDIEGMKIQNQGLDVKAAGEQ------YWSESRGYQSTSKDIETQKKLVEIMR
A0A239XXC4      KELSSVESSLEGMKTQNQGLDVKSAGEQ------YWTESRTYQSSSKELETQMKLVEIMR
A0A4U9K473      KELSSVESDLEGMKTQNQGLDVKSAGEQ------YWTESRGYQSSSKELGTQMKLVEIMR
A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      DNLERAENRYQGFVEQTKTYDVRSEVAA------LAAKGEDLEEQRLKLNQNLVLLSDIS
A0A661XXA6      NKLDDFEKYFEDVTISNRTVSLDEDVKR------TVTIMNNLDSQQVRLQDRLADLNSII
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      SELVQVETRIEHFRKRHRVIDMAEDSRQ------ALQNLNTNASEEKQLAVHLKIVKLLE
A0A2P8G5K0      SELALVETNIEHFRKRHRIIDMAEDGRQ------ALQKSATNALEEKELAIRLKIVRLLE
A0A4Q3SEI4      KELDSIETKLQNYRTKTGVVDLSEQGKL------YLQSVGENDRMMTDLHIQTAMLDEVE
A0A6A1IRV5      --------------------------------------------YMAQSAENNKELSTLN
A0A519SYE7      ------------------------DISG------LKDRLEQQQLTREKLIQNLRLLDDVQ
A0A5Q4EKA0      -----------------------------------------------MLQMEFNILTEIA
A0A3D4CJE1      NKLKVSENKLQKFQKENKISGSSEFSAM------YMEKLNRLENQLIDLDLQINVLKEIQ
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      -----------------VGFGMDNDLVE------L----------RLELEQNLELLDEVG
A0A519TAP8      KRWRAAEEAHTEFVRRNKTYDVKGDMAT------LKNGLEQQQEARQKLQDKLRLLSDIN
R5DEG6          KELGDVDSDIESYKREHQLTDISSETGM------YLQTSSQYRQEGLSLENQLSLAKYIK
A0A3N2LCI3      ------------------------------------------------------------
A0A642EJV3      RELGNVDEDISSYKSEHLLPDVQAASSM------YMAQSSAANAQILSLNNQLYMTRYIR
A0A6H9Q899      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A519SD85      KD-LTKGIPD--------RLSYDV--------QDI--PDV-QLQDMTSKYQDL-------
A0A3M1TXY5      ED-IQADNSLAEV-----VAPAST--------G-I--EDP-LLTSLLVDLARL-------
A0A2E0VQ27      EY-LLSGNSLSD------FSPNFE--------A-L--SDP-IFRGSYLKAQSY-------
R6U429          EY-LENPAHDGA------LIPANS--------G-L--TNS-TVESQIGEYNQL-------
A0A5C8AF42      SK-LKSDPNRLEIYR---LLPEML--------GKS--YEQ-SLTGQIASLYDL-------
A0A239K409      TY-ISNSKENSYR-----LVPSTL--------S-I--EDP-TLQELISRFNEL-------
A0A350V3E4      GELDKYDPKATD------YFESKI-------------TDP-YVAELQGEIARL-------
A0A1V5S1J9      NY-LKSNVEEGAI-----IAPDNL--------G-V--SDA-NLSSLVSQFTEM-------
A0A0A2EYC8      NY-LKNNIDSESL-----ASPTTI--------G-I--QEP-RLIALVDKYNEL-------
A0A2G6H6Y4      RY-LNKNIQTESL-----ASPTTI--------G-I--QEP-RLISLVDKYNEL-------
A0A1M3DPL8      KY-IQTNLNEGAI-----IAPSNI--------G-L--NEP-MLMTIVQQINDL-------
A0A1V5F519      KY-LTGNFEEGTV-----VAPSNL--------G-L--NEP-LLMQLVQQINEL-------
A0A2G6R1T9      DY-IKTNLSSGNI-----IIPTNT--------G-L--NES-TLVVLAQQFNEL-------
A0A1M6MYT6      DY-INTTASRELETV---IAPSAM--------G-I--EDP-LLNNLILQLNDL-------
A0A2P8CDS1      TY-LSRNDN--LQSL---VAPTTV--------G-I--DDP-LLVNLLQELSQL-------
A0A353WYK7      DKLLDTADLQLG------NSELRM-------------LSS-EVAQDINRLEEL-------
A0A355BP94      EE-LSTGKLVQV------A-PRNF-------------LPE-YLNTRIEEYLKL-------
A0A136LSC7      DQ-ITASDFANA------IRPANS-------------FPE-SILQRIEELHKK-------
A0A5C7N8Q5      EH-ITTEDFSST------SRPTRS-------------LPE-SINQRMEELYKQ-------
A0A2W4RDE8      QS-LQSGKNTDI------VAPSTF--------G-V--DDP-LLSNLLIELSKL-------
A0A0L8VEV2      KY-LSDTEKMQEV-----VAPSVV--------G-I--VDE-SLNNLVTQLSDL-------
A0A1I2A9Z9      QY-LDDTEKMKQV-----VAPSVV--------G-I--VDD-ALNNLVVHLSDL-------
A0A212J9Z9      EK-MKEKILGTDDL----MDPASM--------N-I--RNP-KLSEFVVTYNEL-------
F5IV23          EK-MKEKILGTDDL----MDPASM--------N-I--RNP-KLSEFVVKYNEL-------
F8X2T0          QK-IKEGIMGSSEL----IDPVSI--------G-L--TDEIKLSRYVEEYNQE-------
A0A1M3LAG1      QK-IKEGIMGSAEL----IDPISI--------G-L--TDEIKLSRYVEEYNQE-------
A0A212K6G4      QK-IKEGIMGSAEL----IDPISI--------G-L--TDEIKLSRYVEEYNQE-------
A0A4Y9IPG7      QK-IKEGIMGSAEL----IDPISI--------G-L--TDEIKLSRYVEEYNQE-------
A0A2V3PNY7      DE-ISNSILNKTEL----IDPTAL--------G-L--NEP-KLARSIGEYNNL-------
A0A6G7WQ31      DE-INSSILNRTEL----VEPSAL--------G-I--TEA-KLTQSIGEYNSL-------
A0A6G7X5K8      DE-INSSILNRTEL----VEPSAL--------G-I--TEA-KLTQSIGEYNSL-------
A0A1M5DFS8      DE-INNSILSNTEL----IDPSAF--------G-I--SDT-KLSQSVGEYNKI-------
A0A4Y8KZS5      DE-IKSSILNSTEL----VSPNAF--------G-I--NEP-KLSQSIADYNNI-------
A0A142HHS5      QR-AAAER----------LTPSDEVTVDQTIPGLALLEDP-ALSQQLNNLNAL-------
A0A660LQT8      QL-ISNDKKKYD------LLPVNS--------G-I--NST-AIESMIGDYNSN-------
A0A350PNH9      DF-LTGKVGKNQ------LLPANI--------G-I--DSP-GIEQQITEYNKQ-------
A0A354LNT9      DF-LTGKVGKNQ------LLPANI--------G-I--DSP-GIEQQITEYNKQ-------
A0A2M6GH67      NL-VAHDSDLEQ------IIPSLK--------Q-I--EDA-ELSTKIAELSSL-------
A0A389LWV6      DN-LKKEDGN--------LVPPSS----------MGIQDV-ELAVLVSKYNDI-------
A0A1G9B1T9      QY-LEQNDYTEV------IAPSVR--------N-I--NDE-VMSGLLRNLIEL-------
A0A161LWY6      DY-IKKNVNNQEL-----LTPSSL--------G-I--VDP-VLTGLLTQYNET-------
A0A6I3N9U6      DY-IKKNVNNQEL-----LTPSSL--------G-I--VDP-VLTGLLTQYNET-------
A0A3D0FMX4      NY-LNTTMEQGTV-----IAPSTM--------G-L--DAQ-ALGTLVTQLNDL-------
A0A1M3MEI8      KY-VKTNLQDGSI-----VAPTNL--------G-L--NEP-MLMALVQQINEL-------
A0A1J5HQM0      KY-LRTNMEDGSI-----IAPSSL--------G-L--NEP-MLMGLVSQINDL-------
A0A653AC35      DY-LKTNLEAGAI-----VAPASL--------G-L--NEP-MLMTLVQQFNDA-------
E4T131          KY-LKTNLEDGAI-----VAPSSL--------G-L--SEP-MLMKLVEQVNDL-------
A0A521H707      KN-INSDENTES------LLPLLS--------GTY--IDG-VIQGLITKIQAL-------
A0A1F3D6P8      NN-FKSSNDMSG------VVPPSA--------MNV--ADP-IMNQLITQLLLL-------
A0A356Z058      NN-FKSSNDMSG------VVPPSA--------MNV--ADP-IMNQLITQLLLL-------
A0A3D1BT36      DY-FNNNQDIAG------LAPPSA--------ANV--SDP-IMNTLVLELLDL-------
A0A352ME00      NY-FKMNADVSG------LAPPSA--------MNV--SDP-IINQMITNLNDL-------
A0A3D3HL11      DY-FDKNQDMTS------LAPPSS--------SNV--VDP-ILSSMIMELQQS-------
A0A5R9QZP0      DY-FDQNQDITG------LSPPSS--------ANV--IDP-IMNSMILELLEL-------
A0A2W7RD29      RY-LRNNDFDNI------VVPSLV--------G-I--TDP-TINSLIDELINL-------
A0A3N2NDY8      DY-LNNPGNAKS------VIPVNT--------G-I--GSP-TLEAQISNYNNL-------
D7JEV9          NY-LKNNIDNES------LASPTT----------IGIQEP-RLIALVDKYNEL-------
A0A4R6H3B7      QY-LDDTEKMKQV-----VAPSVV--------G-I--VDD-ALNNLVVHLSDL-------
A0A2W7QSQ0      LT-MNNQSGQFD------LIP-----------GGLADLDP-SLSGLLTQYNTL-------
R7F6L5          GE-LSREGIDET-------LPSNM--------G-I--ANT-GLESQIQVYNQQ-------
A0A553GA49      EN-FQKDEDFSA------HSVTLM--------SNL--NNE-VLNDLLNEYIGL-------
A0A497D6F6      EY-IINNQELETI-----IAPSAM--------D-I--DDP-LLNALILELNNL-------
A0A5M4AAB9      NY-LLQNGDLESL-----VAPSTV--------G-I--DDP-LLVNLLQDLNQL-------
F4KR18          ML-QAMKSDLQDTSSKFKLIPINP--------A-L--YDG-KIRDLIQPYNDL-------
C9LKL0          DF-MQNNSNKHQ------LIPVLN----------L--PDA-TFAGLVNEYNTM-------
A0A3D0QPV7      RA-LKEYHNESD------IYNVLSILS-----GTR--FES-ELSGMVKELHVL-------
A0A496KT23      EY-LTDGRHENQ------VLPSNS--------G-I--NNA-SIQSQINDYNTR-------
L1M9T3          EY-LTDGRHENQ------VLPSNS--------G-I--NNP-SIQAQINDYNSK-------
A0A3C0I8F1      VQ-AQNDSIITT------LMPEVN----------L--PGI-DFNSLILKINAL-------
R5JJI4          EY-LVDPQKGSD------LIPANT--------G-I--SDN-SVESQIKEYNDM-------
A0A3D2HF71      DY-IDTKKESGE------IIAPSV----------MGVTDQ-LLIRLVEELSQL-------
A0A0A2DQN2      SY-LKDASKTNE------FLPLNI--------G-I--MSP-ALDESIGQFNQI-------
A0A0A2F2N5      DF-INNPSKRSE------YLPQNI--------G-L--NNA-ALETAITAYNQV-------
L1NGW4          SN-LSSPQKQTE------YMPLNI--------G-V--SDP-NLDGYIAKYNQL-------
Z4WRA0          SN-LSSPQKQTE------YMPLNI--------G-V--SDP-NLDGYIAKYNQL-------
U2K8K9          SQ-LNSPSKRNE------LMPLNI--------A-M--PDP-ELDGYITQYNQL-------
A0A069ZM60      SE-FSNSHRKNG------YLPLNV--------G-V--PDQ-ALDGYIAQYNQL-------
J6GV98          SE-FSNSHRKNG------YLPLNV--------G-V--PDQ-ALDGYIAQYNQL-------
A0A134B4F8      SE-FSNSHRKNG------YLPLNV--------G-V--PDQ-ALDGYIAQYNQL-------
A0A134B8C7      SE-FSNSHRKNG------YLPLNV--------G-V--PDQ-ALDGYIAQYNQL-------
A0A4Z0EKR0      GY-LEKNAGNYS------AVPSTL--------G-I--KDE-TLLALIGKFNEL-------
A0A229I3A5      NY-LTGKVGKNQ------LLPTNT--------G-I--ESP-GIEQQITEYNKS-------
A0A3R6HJB3      NY-LTGKVGKNQ------LLPSNT--------G-I--ESP-GIEQQITEYNKS-------
B5CTK0          SY-LTDPSKNFN------LIPTNT--------G-ISGADV-NIESSIATYNAM-------
A0A1M6B6D5      EY-LVTRSDYRD------VPAPSV--------AGI--SES-SVVAGVGKIVSL-------
A0A451FS66      EY-LTTRTDYRD------VPAPSV--------AGI--SEG-SIIAGVGKIVAL-------
A0A2E3GN39      VM-IQ---QEED------LSLASTQLSGEEFDGIT--RAL-SVDEILK----L-------
A0A3D1MEL0      VM-VQ---QEED------LSLVSTQLSGEEFDGVT--RAL-SVDEILN----L-------
F0R0C9          NY-LTAASSRNQ------LLPANS--------G-I--ESA-NIEQQIGEYNTM-------
A0A2A4N9A6      YY-L-----NNN------ISLENIILLPKE-------AYV-TIIGQLRELEL--------
A0A6C0GGI1      YM-IT----GQD------LEMSQVPITA----G-I--NDQ-IIIDLVRQLDIL-------
A0A368D1N7      WF-AVMVQQEED------LNLASTQLSGEDFDG-V--TRA-LSVDEILKLEY--------
A0A3B8TU58      WF-AVMVEQEED------LSLASTQLSGADFEG-I--ING-LSVSEILNLEA--------
A0A1T5IIR6      DH-VVSGAESYR------LIPGNM--------G-L--EDN-SMDEVIARYNDL-------
A0A3E0QD27      RD-ITSDSEVES------LLPFLS--------GSY--SDG-VILSIVSKIHEL-------
A0A0M1W1I6      GY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQIAAYNAN-------
A0A4R4GHU2      GY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQIAAYNAN-------
I8WPR6          GY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQIAAYNAN-------
A0A0K2HKS3      GY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQIAAYNAN-------
B6W3W8          GY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQIAAYNAN-------
A0A4R4GSI6      GY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQIAAYNAN-------
A0A076IRY8      SY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQITAYNAN-------
A0A3A6AD54      SY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQITAYNAN-------
A0A3A6MIU7      SY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQITAYNAN-------
I8WPP8          SY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQITAYNAN-------
A0A372Y7D2      SY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQITAYNAN-------
A0A3E4JJC9      SY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQITAYNAN-------
A0A3E4WDQ0      SY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQITAYNAN-------
A0A414H9P2      SY-LVDPSKETE------LISSNT--------G-I--ADI-NIETQITAYNAN-------
C3R5A8          SY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQITAYNAN-------
A0A1C5XJA7      EY-LTDPKKEAD------LIPSNT--------G-I--SDM-NIENQIGMYNAA-------
A0A3E5BU42      EY-LTDPTKNRD------LIPSGT--------G-I--SDA-SVEGQINQYNAL-------
R7CUW4          DY-LTDPSKETD------LIPSNT--------G-L--SDM-NIESQINLYNTA-------
A0A416GGJ1      EY-LIDPAKETD------LIPANT--------G-L--SDA-SVESQINTYNEL-------
D1JY72          GY-LVDPSKETE------LIPSNT--------G-I--ADI-NIETQIAAYNAN-------
D7J4K6          EY-LTDPTKSRD------LIPSGT--------G-I--SDA-AVEGQINQYNAL-------
Q8ABP9          EY-LTDPTKSRD------LIPSGT--------G-I--SDA-AVEGQINQYNAL-------
A0A5M6AHF7      EY-LTDPTKSRD------LIPSGT--------G-I--SDA-AVEGQINQYNAL-------
D6D2Z5          EY-LTDPTKSRD------LIPSGT--------G-I--SDA-AVEGQINQYNAL-------
A0A1T3EDR4      SY-LKDADKSKG------LLPSNM--------G-L--SGG-NIEQQIQAYNSF-------
A0A174SDD8      QY-LQDSSKDDE------LIPSNI--------G-L--EDL-NIESQIARYNET-------
A0A1H7RFH3      QY-LQDSSKEDE------LIPSNI--------G-L--EDL-NIETQISRYNET-------
A0A139L1N2      QY-LQDSSKEDE------LIPSNI--------G-L--EDL-NIETQISRYNET-------
A0A174TVL8      QY-LQDSSKEDE------LIPSNI--------G-L--EDL-NIETQISRYNET-------
A0A1H8BJR6      QY-LQDSSKEDE------LIPSNI--------G-L--EDL-NIETQISRYNET-------
R9H6G0          QY-LQDSSKEDE------LIPSNI--------G-L--EDL-NIETQISRYNET-------
A0A412GR09      QY-LQDSSKEDE------LIPSNI--------G-L--EDL-NIETQISRYNET-------
A0A6I0S0M4      QY-LQDSSKEDE------LIPSNI--------G-L--EDL-NIETQISRYNET-------
A0A081PBV5      NY-MRDADKKDD------LIPNNT--------G-L--VDV-NIENRINEYNTA-------
A0A1I2AN85      NY-MRDADKKDD------LIPNNT--------G-L--VDV-NIENRINEYNTA-------
A0A4U0GMP3      QY-LEDAERRND------LIPNNT--------G-L--VDM-NIESQINEYNVA-------
A0A1H6CKR6      QR-LDDPSKRDE------LIPSNT--------G-L--VDQ-SIESIITEYNTL-------
A0A235E1C0      QR-LSDPSRVDD------LIPSNT--------G-L--VDN-NIEDIISEYNTL-------
R6D982          QY-LQDAAKEDE------LIPGDI--------G-L--TDA-VIEGQIARYNEA-------
A0A1F0I8C4      QY-LQDSGKEEE------LIPGNI--------G-L--TDI-NIESQIARYNET-------
A0A3A5RIJ2      QY-LQDSGKEEE------LIPGNI--------G-L--TDI-NIESQIARYNET-------
A0A515IZJ5      QY-LQDSGKEEE------LIPGNI--------G-L--TDI-NIESQIARYNET-------
A0A5M5NLR3      QY-LQDSGKEGE------LIPGNI--------G-L--TDI-NIESQIARYNET-------
A0A0D5BSQ0      SY-LGSRDQKNA------LIPNST--------G-L--VDA-NVETQITEYNTA-------
A0A1T3F6P5      SY-LTNRGKQNN------LIPNNT--------G-L--VDS-GVEGQIAEYNKA-------
A0A0W8EPA0      SY-LTNKGKQNN------LIPNNT--------G-L--VDS-GVEGQIAEYNKA-------
A0A365UKN1      SY-LNNRGKQNN------LIPNNT--------G-L--VDS-GVEGQIAEYNKA-------
A0A4R6WE41      DY-LTADGKSKE------LIPNNT--------G-L--VDA-NVEGQIVEYNKA-------
A0A2T5RP38      SY-LNNKN-RNE------LIPNNT--------G-L--VDA-SVESQIAEYNMA-------
A0A1A6CF06      SY-LNNKNKRNA------LIPNNT--------G-L--VDT-GVESQIADYNTA-------
A0A1T3D6S8      SY-LTNKNKRNA------LIPNNT--------G-L--VDT-GVESQIAEYNTA-------
A0A1P8E011      GY-LSDGSKKNE------LIPNNT--------G-L--VDA-SVETQINDYNTT-------
A0A1V3N3U3      RQ-LHDANKRNE------LIPNNT--------G-L--VDG-GVEAQITEYNRA-------
C2FUH6          SH-LDNKTKRNE------LIPSNT--------G-L--VEA-NIENQITDYNTT-------
A0A0B8T471      QR-IDNTESRND------LIPSNT--------G-L--VED-NIEAQITEYNEV-------
A0A4R7D2K0      QR-IENDVDRND------LIPSNT--------G-L--VED-NIESQITEYNEV-------
A0A2X2J8S4      DY-LSKSDKQTA------LIPNNT--------G-L--IDG-NIEGQIQAYNTL-------
A0A3C0S618      DY-LSKSDKQTA------LIPNNT--------G-L--IDG-NIEGQIQAYNTL-------
A0A4P7DRF9      QR-LNDPARARD------LIPSNT--------G-L--VDG-NIESIISEYNSV-------
A0A239XXC4      QR-LSDPSRVDD------LIPSNT--------G-L--VDN-NIEGIISEYNTL-------
A0A4U9K473      QR-LSDPSRVDD------LIPSNT--------G-L--VDG-SIEEIIAEYNTL-------
A0A3M1Y2F5      --------------------------------NIN---DP-FLQSLMGKLTEL-------
A0A1G1TG88      RMVQQTHITRNEEETVEQSIPGLG--------DIN---DP-VLSQLLGQLNGM-------
A0A661XXA6      NEIKDGQIV---------IMPTLD--------DKF---PA-HIISLINELNLL-------
A0A3D4RLG4      --------------------------------------MH-KYKATSKICRKKNWRWSLS
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A1H6Z2F8      GHLRAK---------PSAAIPSAL--------YPQ---EG-NFEALIGKYNEM-------
A0A2P8G5K0      AHLLEK---------PAAAIPSAL--------YPQ---EG-TFEALAGKYNEM-------
A0A4Q3SEI4      KYVLAKDR-------QIGVVPAIT--------SVK---DP-MLGQLLNSLFES-------
A0A6A1IRV5      NQLSTAQYIRRELNT--KQLDQTL--------PAN---SG-IVSANIETQISEYNNL---
A0A519SYE7      QMVARGQLTRSENETVANNLPGLT--------ELN---DP-LLAGMLNELDEQQRSLRLT
A0A5Q4EKA0      KSL--------EQDNEVDIYRLIA--------ILA---GS-EFSGMVSRMLQNLQDL---
A0A3D4CJE1      NKAKNANDNMQ----VYDLLSILA--------GTD--YES-TINGLITNLQRL-------
A0A4Q5ZQ60      ---------------VESFLPSLS--------LVN---DQ-MLGEQMKALVEL-------
A0A519Q885      ALAEQERLTVRENQTVTQNIPGLV--------DLS---DP-VLVQLLEQLNKE-------
A0A519TAP8      GLMNRDQLTRNEDETVADNLPGLT--------ELE---DP-VLVGLLDLLDSQ-------
R5DEG6          NYLTDPGK-------NSDLIPANT--------GIS---DV-NIESQIGEFNEM-------
A0A3N2LCI3      -----------------KMLPMNS--------GVA---NV-DIQSQITDYNNL-------
A0A642EJV3      NYLANDAN-------RTQLLPANS--------GIE---SA-NIESQIAEYNKQ-------
A0A6H9Q899      -------------------LPANS--------GIE---SV-NIESQIAEYNKQ-------
A0A2K8ZAP1      -----------------------------------------NTNAAISENIET-------
A0A2T4XEQ1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A519SD85      VIKRNHLLK--QYTI---SSKFVT----DIDQEIEIFRNSITNNLLLQHKLLT-------
A0A3M1TXY5      KQERAAIRL--TAKE---RSPKVQ----NIDAKINNVRQAILKNVNTSIRANN-------
A0A2E0VQ27      EEQRQDYLQ--KYTL---QHPLIL----NLDQKIKETRAFLNESVNSTLENLQ-------
R6U429          VLSRDRLVS--GSSS---ENPLVL----DYNNSIAALKIAINRSIENLISTLK-------
A0A5C8AF42      LEKKEDLLY--RVTD---ENSEVK----ALNSKIQTKLNSIRKSVAAILERLY-------
A0A239K409      QLERERLLR--TTEK---INPIIL----SIDQQLQSLRVNILENIHNIKGGLV-------
A0A350V3E4      EIQRDLAKT--GNDELVKNSKSLK----DINNKVAELKRSLDEKLNILKEGANSNSPEEM
A0A1V5S1J9      QLKRKEIGV---------KSPLYA----KYTRDIDAVKAQMYEALKNIRVGLD-------
A0A0A2EYC8      QIKLLDLGV---------KNPQYD----IVFNQISQTKAQLNELISSVSDIYK-------
A0A2G6H6Y4      QLQLIDLGV---------KNPQYE----IVIAQIEQIKKQLKELIASVSDVYS-------
A0A1M3DPL8      LLKRSELTE---------KNIFHS----KYTREIDNLKTAINEVIKNTKASIN-------
A0A1V5F519      YLQRSELTE---------KNLYYA----KYTKAIENVKTSIFELIKNMRASLE-------
A0A2G6R1T9      LEERNSTSR---------KNPVYK----KLTREINNIKASINEAIKSMRKSIQ-------
A0A1M6MYT6      INERLSQTS-IRQNS---EHPTIV----RLNAQIASVKNSLRENVDNIISQSD-------
A0A2P8CDS1      NIEKTTLSA-TVKDP---DHPRMR----QLNIQMETTKRTLLENSRNIMHQSE-------
A0A353WYK7      KKEMNILKG--AYKT---NTFAYR----KKKEEINFLRERIIGYVEESRKGIY-------
A0A355BP94      VRGKERLAL--SYKD---NTFAYQ----QKDQELNAARTALFTQLAEIKKQWL-------
A0A136LSC7      TRERDKLAL--AYNE---NTFAFR----QKEREVSLVKDELFNQLSTLKKEWL-------
A0A5C7N8Q5      ARERDKLGL--AYNE---NTFAFR----QKQKEVTLLKDELFSQLSTLKKDWL-------
A0A2W4RDE8      NQERSGLNY--SARE---GNPLAQ----VIELKITNLKASITENVSNIIDATN-------
A0A0L8VEV2      YRQREVFSY--TVQE---KNPKLI----LVNNQIEMVKRNLQENLKNLINNAI-------
A0A1I2A9Z9      YRQREVISY--TAQE---KNPKLI----LIGNEIEMVKRNLRENLKNLINNAI-------
A0A212J9Z9      LQKARNLGA---------KNPLYN----KTIDELNDLRVKILQEIQVSQINLQ-------
F5IV23          LQKARNLGA---------KNPLYN----KTIDELNDLRVKILQEIQVSQINLQ-------
F8X2T0          LRKSKNLGP---------KSPIYM----TAINKLNESRVQILRELQLIQVKLQ-------
A0A1M3LAG1      LRKSKNLGP---------KSPIYM----TAINKLNESRVQILRELQLIQVKLQ-------
A0A212K6G4      LRKSKNLGP---------KSPIYM----TAINKLNESRVQILRELQLIQVKLQ-------
A0A4Y9IPG7      LRKSKNLGP---------KSPIYM----TAINKLNESRVQILRELQLIQVKLQ-------
A0A2V3PNY7      VNKLSSMGS---------AHPMYA----KSEQSLTNLRINILEELRALQDRVQ-------
A0A6G7WQ31      INKLASMGS---------AHPMYA----KSEQSLTNLRIKILEELRGLQDRIQ-------
A0A6G7X5K8      INKLASMGS---------AHPMYA----KSEQSLTNLRIKILEELRGLQDRIQ-------
A0A1M5DFS8      VKKLASMGE---------AHPLYA----KSEQSMNNLRIKILEDLRNAQDKVQ-------
A0A4Y8KZS5      IKKLASMGE---------AHPLYS----KSEQSMNSLRIKILEDLRTAQDKIQ-------
A0A142HHS5      QQNLRRIRR--SYQD---RLEAVQ----GPLAQLKFAQATLQHQLVQAQKQLR-------
A0A660LQT8      VLQRNRLVM--NSST---SSPLIA----DLEDRISKQRQVIGVSINNWLLTLQ-------
A0A350PNH9      QLERNNLVA--NSSE---QNPLVA----DYDQSLASMRHSIVTSIDNFVVTLN-------
A0A354LNT9      QLERNNLVA--NSSE---QNPLVA----DYDQSLASMRHSIVTSIDNFVVTLN-------
A0A2M6GH67      QRSYKILLL--SYKK---TTQTVK----IREEEMRLTKEAVTELLQQNIDLLQ-------
A0A389LWV6      FFEIK------GLGS---ENPIYK----RYKLQLTDIKSSINQSIVSMKNSIG-------
A0A1G9B1T9      NQQRAQLKT--SVRQ---SLPAIE----ELDAKVKSIRAQLHENVNNLIATTK-------
A0A161LWY6      IRKLL------QTTP---QNPFYA----KYQEELNKLKGSLTDALRNVRAAFS-------
A0A6I3N9U6      IRKLL------QTTP---QNPFYA----KYQEELNKLKGSLTDALRNVRAAFS-------
A0A3D0FMX4      QIKRAELSE---------KNIYYD----KYTTDMQNIKVAILEVLSSMRASMD-------
A0A1M3MEI8      IMKRAELPE---------KSMFHS----KYTREIETVKNAINEMVRNMQVSMD-------
A0A1J5HQM0      NLKRSELSE---------KNMYYA----KYTRDIDHIKVAINEVTKNMRASLE-------
A0A653AC35      VTLRNETTE---------KNPLYS----KYNREVEALRTSINEVLKNMKTSLA-------
E4T131          YNQRSDLTE---------ANPYYA----KFTKQIETSKLTILEVIKSMRASLE-------
A0A521H707      EDQKTTLKF--LATE---HNAAVI----SLEKDIAFQRSNLILSLNNAREALI-------
A0A1F3D6P8      YSQRSGIAS--NNAE---KNLFLG----QIDNKIKVQKQAIIETVTNNLNTLN-------
A0A356Z058      YSQRSGIAS--NNAE---KNLFLG----QIDNKIKVQKQAIIETVTNNLNTLN-------
A0A3D1BT36      NSQRSAILS--NNVQ---KSLFLE----QIENKINLQKQTIIENVKNNLNTLS-------
A0A352ME00      NAQRSTIIA-GSNPQ---KNIFIG----QIDSKIDFQKQIILENFTNNLNTLT-------
A0A3D3HL11      SAERANILS--NNAE---KNLFLG----QIENKIRLLKQAIIENVKNNLNTLN-------
A0A5R9QZP0      NAERSAILS--SKAE---KSLFLG----QIENNIRLQKQSIVENVKNNLNALN-------
A0A2W7RD29      QNEKSNQLV--TLTD---SSPIVI----EQQKRIVISKKNTLELVKSAISNID-------
A0A3N2NDY8      LLTRNTLAA--SSSD---TNPLVV----DYDGQIKGLREAIVNAINGQIVALN-------
D7JEV9          QIKLLDLGV---------KNPQYD----VVISQIRQIKTQLNELINSVSDVYK-------
A0A4R6H3B7      YRQREVISY--TAQE---KNPKLI----LIGNEIEMVKRNLRENLKNLINNAI-------
A0A2W7QSQ0      QRDKQRIIR--IVQP---NNPQLL----SLNDQIVNVKSNILANISSIKSNLL-------
R7F6L5          VIERNRLLK--TTGA---NNPQVV----EKDEALRTMKRNIQHTAATYATSLN-------
A0A553GA49      VGRKQHLLE--NKQA---KSPQLR----ELTFQISNLKNTILVNLQYELDASR-------
A0A497D6F6      SIEKSSM-T-SVKNT---EHPKLK----RLNAQIENAKSNLLENVNNIISQSE-------
A0A5M4AAB9      NIELSTLAA-TVHDP---EYPRMR----QLRIQMETTKRTLLENSRSIMHQSE-------
F4KR18          VMERERFLT-KGQTS---N-PVVQ----SNNQKLKSLQSSINLAIDHMQDDLN-------
C9LKL0          MIERNSTEK--NSSP---NSPLVK----DLDSKLTTMRNTILSSVRSYVKTLE-------
A0A3D0QPV7      ILTKEKEKF--SSTS---KSTYMK----SLDYQIDIQLKMINQAITSLKNQFS-------
A0A496KT23      LLERNRLLA--TSSA---QNPAVM----DLETQLGSIRRGIIQSLDNELDMLK-------
L1M9T3          LLERNRLLA--TSSA---QNPAVM----DLETQLGSIRRGIIQSLDNELDMLK-------
A0A3C0I8F1      FSEIASISY--YKTD---NNATLK----VKRTQLIKYQKELRAQINEAQRMLN-------
R5JJI4          LLKRDKLVA--GSSN---KNPIVI----DLNNSLGAMKQTIIRSVDNLIVGLN-------
A0A3D2HF71      QKQKKQLSL--NLLE---STGPLR----VLEGNIANTRIAISNNIADGLANIE-------
A0A0A2DQN2      KQERDLWMQATGASQ---DNPIVE----RYNQSMHVARAAVARALKDAAAAIS-------
A0A0A2F2N5      KPEYDRWLATTGGME---DHPMVQ----KYAKAMEQTRMSISHTLEGYIKSLD-------
L1NGW4          KGDRDRLVKASEGST---ENPVIA----EYDRGLAQIRQNAISSLNQYANVLR-------
Z4WRA0          KGDRDRLVKASEGST---ENPVIA----EYDRGLAQIRQNAISSLNQYANVLR-------
U2K8K9          KFQRDKLVESSGGST---QNPVIA----EYDATLDQLRKSATEILNQQASALR-------
A0A069ZM60      KSQRDKLVEGAGGST---ENPVIT----EYDNALSQLRKNAIESLNQQAAVLR-------
J6GV98          KSQRDKLVEGAGGST---ENPVIT----EYDNALSQLRKNAIESLNQQAAVLR-------
A0A134B4F8      KSQRDKLVEGAGGST---ENPVIT----EYDNALSQLRKNAIESLNQQAAVLR-------
A0A134B8C7      KSQRDKLVEGAGGST---ENPVIT----EYDNALSQLRKNAIESLNQQAAVLR-------
A0A4Z0EKR0      QQERKRMLR--TTEP---SNPIVQ----NINEQLASLRISILENLRNIKKGLQ-------
A0A229I3A5      QLERNNIVA--NSSE---QNPLVA----DYDQSLTSMRKSISASLDNFVVTLK-------
A0A3R6HJB3      QLERNNIVA--NSSE---QNPLVA----DYDQSLTSMRKSISASLDNFVVTLK-------
B5CTK0          LLKRDKLID--SSSD---KNPVVV----NLNNSLSALKQTIIRSIDNTIVALN-------
A0A1M6B6D5      AEQRNKLQY--SFKE---DAPVFN----DIDRQIDAVKIVLLENIRSSKSLMN-------
A0A451FS66      AQERNKLQY--SFKE---GAPVFN----DIDRQINAVKSVLLENIRSSRSLKA-------
A0A2E3GN39      EYEKESALM--QVTP---EHPTVV----LIERNLDKARATLIAQVEINIDKFQ-------
A0A3D1MEL0      EYEKESALM--QVTP---EHPTVV----LIERNLDKARATLIAQVEINIDKNQ-------
F0R0C9          QLQRNNLVA--NSSE---QNPLVK----DLDQSLASMRRAIITSVDNLMVTLD-------
A0A2A4N9A6      --QKKFLAQ--HETE---LGPNTK----LINGQIKANKKILLYSIKAIRATLF-------
A0A6C0GGI1      YQERAKLAL--SIRS---DNPLYQ----QQQEKIVNTRNTIIENLRRLVSVVN-------
A0A368D1N7      --EKESALM--QVTP---EHPTVV----LIERNLDKARATLIAQVEINIDKNQ-------
A0A3B8TU58      --EKEKALM--QVTP---EHPAIV----LIERNLDKARVTLVAQVRINIERYQ-------
A0A1T5IIR6      VLQRDRLVA--ASST---TSPAVL----KLENTLGSLRSNILGMISNLQTSLE-------
A0A3E0QD27      EDKRSNLRF--IATD---KNAAVI----SLEQDIDFQKKNLVMSIQNARLSIR-------
A0A0M1W1I6      KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
A0A4R4GHU2      KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
I8WPR6          KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
A0A0K2HKS3      KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
B6W3W8          KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
A0A4R4GSI6      KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
A0A076IRY8      KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
A0A3A6AD54      KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
A0A3A6MIU7      KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
I8WPP8          KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
A0A372Y7D2      KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
A0A3E4JJC9      KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
A0A3E4WDQ0      KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
A0A414H9P2      KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
C3R5A8          KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
A0A1C5XJA7      KLKRDRLIS--DSSD---KNPVVE----ELNSSLRAMKQSIIRAVDNMIVSIN-------
A0A3E5BU42      KLKRDKLIA--DSSE---SNPVVE----ELNNAIHALRQSIIRAVDNMIVSIN-------
R7CUW4          KLKRDRLIS--DSSE---KNPVVE----ELNNSLRAMKQTIIRAVDNMIVSLN-------
A0A416GGJ1      KLRRDKLID--DSSD---KNPVVE----EMNNSLRAMKQNIVRAVDNLIVSLN-------
D1JY72          KLKRDKLIE--GSSD---KNPIVQ----ELNKNLIAMRQNIIRAIDNMIVSID-------
D7J4K6          KLKRDKLIA--DSSE---SNPVVE----ELNNSIHALRQSIIRAVDNMIVGIN-------
Q8ABP9          KLKRDKLIA--DSSE---SNPVVE----ELNNSIHALRQSIIRAVDNMIVGIN-------
A0A5M6AHF7      KLKRDKLIA--DSSE---SNPVVE----ELNNSIHALRQSIIRAVDNMIVGIN-------
D6D2Z5          KLKRDKLIA--DSSE---SNPVVE----ELNNSIHALRQSIIRAVDNMIVGIN-------
A0A1T3EDR4      FLKRNRLME--GGNN---KNPVVR----DLDASLVSLRQEIQRSLDHSIRGLV-------
A0A174SDD8      LLRRNRLMN--GSSS---NNPVVQ----ELNRTMQTMKQNIYRALDNLSTTLR-------
A0A1H7RFH3      LLRRNRLMN--GSSS---NNPVVQ----ELNRTTQTMKLNIYRALDNLSASLR-------
A0A139L1N2      LLRRNRLMN--GSSS---NNPVVQ----ELNRTMQTMKLNIYRALDNLSASLR-------
A0A174TVL8      LLRRNRLMN--GSSS---NNPVVQ----ELNRTMQTMKLNIYRALDNLSASLR-------
A0A1H8BJR6      LLRRNRLMN--GSSS---NNPVVQ----ELNRTMQTMKLNIYRALDNLSASLR-------
R9H6G0          LLRRNRLMN--GSSS---NNPVVQ----ELNRTMQTMKLNIYRALDNLSASLR-------
A0A412GR09      LLRRNRLMN--GSSS---NNPVVQ----ELNRTMQTMKLNIYRALDNLSASLR-------
A0A6I0S0M4      LLRRNRLMN--GSSS---NNPVVQ----ELNRTMQTMKLNIYRALDNLSASLR-------
A0A081PBV5      SLRRNRLLE--GSSS---ENPIVQ----DLNITLAAMRKNIYRAMENAVSGLQ-------
A0A1I2AN85      SLRRNRLLE--GSSS---ENPIVQ----DLNITLAAMRKNIYRAMENAVSGLQ-------
A0A4U0GMP3      LLKRNRLVE--GGSF---SNPIIQ----DLDNALQAMRKNIDRSIENTLAGLR-------
A0A1H6CKR6      LLRRNRLTA--GNSS---ENPIVQ----DLNTALNALRDNISRAVDNVLTGYR-------
A0A235E1C0      LLRRNRLMS--GNSS---ENPIVQ----DLNNALSQVRQNIARAIDNVISGFR-------
R6D982          LLRRNRLRS--GSGG---NHPVVQ----ELTRSVETMRQNINRSINNQVTSLK-------
A0A1F0I8C4      LLRRNRLVS--GSSS---NNPVVQ----ELDRSMQTMRQNIFRALDNLSASLK-------
A0A3A5RIJ2      LLRRNRLVS--GSSS---NNPVVQ----ELDRSMQTMRQNIFRALDNLSASLK-------
A0A515IZJ5      LLRRNRLVS--GSSS---NNPVVQ----ELDRSMQTMRQNIFRALDNLSASLK-------
A0A5M5NLR3      LLRRNRLVS--GSSS---NNPVVQ----ELDRSMQTMKQNIFRALDNLSASLK-------
A0A0D5BSQ0      LLKRNRLAE--GGNT---SNPVVL----DLDEALKAMRNNIGRAVDNTLRGLN-------
A0A1T3F6P5      LLKRNRLAE--GGNT---ANPVVL----DLDDALAAMRTNIGRAVDNALRGLN-------
A0A0W8EPA0      LLKRNRLAE--GGNS---SNPVVL----DLDDALGAMRTNISRAVDNAVRGLN-------
A0A365UKN1      LLKRNRLAE--GGNS---SNPVVL----DLDDALAAMRTNISRAVDNALRGLN-------
A0A4R6WE41      LLRRNRLEE--GSSM---ANPVVQ----ELDQGLDAMHTNILRAINNTLSGLQ-------
A0A2T5RP38      LLKRNRLAE--GGNT---LNPVVV----DLDEALKSMRNNINRAVDNALRGLT-------
A0A1A6CF06      LLKRNRLAE--GGNS---ANPVVL----DMDEALNSMRNNISRAVDNALKGLN-------
A0A1T3D6S8      LLKRNRLAE--GGNS---ANPVVL----DMDESLNAMRNNISRAVDNALKGLN-------
A0A1P8E011      LLRRNRLIE--GSSD---ANPVVQ----DLDRALQAMRGNIGRAVDNAIGGLK-------
A0A1V3N3U3      LLRKNRLVE--GSST---ANPVVQ----DLDKALAAMHENISSAVDNAVAGLD-------
C2FUH6          LLRRNRLVE--GSST---ENPIVQ----DLDKALGAMRGNIDRAVENATEGLR-------
A0A0B8T471      LLKRNRLVG--GDNS---ANPIVK----DMDAALRAIRDNISRSVDNAAMGLR-------
A0A4R7D2K0      LLKRNRLVS--GDNS---ENPIVK----DMDAALRAIRDNISRSVDNAAMGLR-------
A0A2X2J8S4      QIRKNKLME--DGNS---ENPIVK----EIDKSLNTMRSGIERTLGNTISGLQ-------
A0A3C0S618      QIRKNKLME--DGNS---ENPIVK----EIDKSLNTMRSGIERTLGNTISGLQ-------
A0A4P7DRF9      LLKRNRLQA--GENS---NNPIVQ----DMDNALVAMRENIVRAVDNVITGFN-------
A0A239XXC4      LLRRNRLMS--GNSS---ENPIVQ----DLNNALSQVRQNIARAIDNVISGFR-------
A0A4U9K473      LLRRNRLMS--GNSS---ENPIVQ----DLNNALTQVRQNIARAIDNVISGLR-------
A0A3M1Y2F5      VSERAELDF--SVTA---DNPNID----RINLEISRVKSSLLENINNRVSSTE-------
A0A1G1TG88      QWDQERVRR--SYTG---ATEAVQ----QKNAQMDYTLSSILRQITQARKALA-------
A0A661XXA6      INDREKLGL--SYRE---NTYTYK----ARQKEIDLLKSDLLGQIENAKENTI-------
A0A3D4RLG4      NAITELMTT--TXTQ---KNVYYA----KYTKDIENVKTAINEVVGSMRASLE-------
A0A2T2UAJ4      ------------GGK---GVGYVA----EQRRGLAQSRIELNGLQARLDV----------
A0A6I0DZQ5      ----------------------------KYTREIETVKNAINEMVRNMQVSMD-------
A0A1H6Z2F8      ELSRTRALA--SLAP---GHPDIR----SIEKQMEVLRTNLFDAIQNQKQELA-------
A0A2P8G5K0      QMARIMALA--TLAP---EHPQLR----SLEKQIEVLRNNLLDAIGLQIQELT-------
A0A4Q3SEI4      EMQYEKLKK--TIPG---GNPTMY----TLKTQIENLRPAILESIQNQRASLN-------
A0A6A1IRV5      VLDRNRLIA--NSSE---KNPLVK----NMASSLQSMQRTIIQSVDNLIVSLN-------
A0A519SYE7      LLSQTNKTF--AVQR---DQADIQETRAALERQLSRDQALVRQQLARL-DKLD-------
A0A5Q4EKA0      LIEREQLLY--QVTP---ESSQIQ----ALNHQINIQRKLVVESITTLKNNLD-------
A0A3D4CJE1      LDKKQQLQN--EVTP---DSEILK----TLNLQIEAQRDLIIESLRSLLDKLL-------
A0A4Q5ZQ60      QKQHALLMG--SAKK---ATFAVK----SKEEEITFVKNNIAESVKKNKKLAQ-------
A0A519Q885      QINLARVKR--SYKE---STFAVE----DQEANIIITRQAVRKQLIQARKLLQ-------
A0A519TAP8      QRSLRLTLK--SQTD---KTFAVQ----RNQAVIRDTRELLQR-----------------
R5DEG6          LLKRDKLIS--NSSS---KNPVVQ----DLNNSLIAMKQTIIRSVDNLIVGLN-------
A0A3N2LCI3      VLQRNSLLA--KSSD---KNPLVV----QLNEQMDQMRHAILASVDNSINALN-------
A0A642EJV3      LLQRNSLVA--NSST---ENPLVV----DMDQALASMRGAIIRSIDNQIVTLN-------
A0A6H9Q899      LLQRNSLVA--NSSA---ENPLVV----DMDQALASMRGAIIRSIDNQIVTLN-------
A0A2K8ZAP1      ------------------IRQQLI------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A6A0Y068      ----------------------------------------------------SQAF----
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ---------------------------------------------------MLTAG----
A0A519SD85      ------------------EKGNLIRKTSDSIQRKLSQLP--NKERLLGE--LQSRF-DVD
A0A3M1TXY5      ------------------IAISNVNERIEALRTRLRRLP--ESERILTN--IKRNF-DHS
A0A2E0VQ27      ------------------QKTLELESQIAEVNQKVERFP--EKERQLVV--LQRQV-ALN
R6U429          ------------------LQADKVAAEETNIMNKISNTS--GQELQLLS--IERQQ-KIK
A0A5C8AF42      ------------------ANSRSVQGKIQGFESEFFELP--EKKMEFSR--LKNIQ-DLN
A0A239K409      ------------------LTRRNLKDRTNLYDAKINSVP--LVERELQE--IDRQR-GIK
A0A350V3E4      RSLTSKYFETKVLNNQNKIKESLLRGYLNKYQEKFNKLP--AQSIEYAN--LERER-LAN
A0A1V5S1J9      ------------------IQKADMQNRLQKLSAGMQELP--YKEQQLLN--IQRKF-KIN
A0A0A2EYC8      ------------------IESDAYQKDLNELNNLLIAAP--NKELRMLD--YERRY-KIN
A0A2G6H6Y4      ------------------IETDLYKKDLNTLKSELVEAP--SKELRMLD--YQRRF-RIN
A0A1M3DPL8      ------------------IQKDDLNTRLASVQKQIETLP--EQELEMVG--IERNY-RMN
A0A1V5F519      ------------------IEKNEVNRLLADVNSQIAELP--KKELEIIG--IERNY-KVN
A0A2G6R1T9      ------------------IEKQDIDSKIAAVRSKMNMLP--KKETQMTA--LTRQY-KID
A0A1M6MYT6      ------------------MALENLNQRIRQFEAQVRRLP--ATERNYVN--IERKY-KLN
A0A2P8CDS1      ------------------ITLNDLTKRIDNLQQRTRNLP--SVERNYVN--IERRY-QLN
A0A353WYK7      ------------------DKLDEINLKKNRLETDFSSLP--SKSTEYAK--TERYY-DLY
A0A355BP94      ------------------GAMLELNQKKESLEKKFASMP--DKSTQYSK--NQRFY-KLY
A0A136LSC7      ------------------ADMAELGKRKEKLERAFAEMP--DKNTQFSK--NQRYY-KLY
A0A5C7N8Q5      ------------------ADMAELGRRKEKLEREFAEMP--DKNTQFSK--NQRYY-KLY
A0A2W4RDE8      ------------------IALNDLNQRIARLNAQLERLP--RNERELVK--IQRRY-DFS
A0A0L8VEV2      ------------------VQIQGLDRRVDQVNRQLSAHP--KTEQQMMN--MQRMY-DLN
A0A1I2A9Z9      ------------------IQVQGLDRRIEKVNQQLTAYP--KTEQQLMN--MKRMY-DLN
A0A212J9Z9      ------------------NQKDALVRKYEVLQLKIDNLP--PQERDLIK--FQREF-RVN
F5IV23          ------------------NQKDALVRKYEVLQLKIDNLP--PQERDLIK--FQREF-RVN
F8X2T0          ------------------DQKDLLVKKYQNLDLKLDNLP--PQERDLIK--YQREY-NVN
A0A1M3LAG1      ------------------DQKDLLVKKYQNLDLKLDNLP--PQERDLIK--YQREY-NVN
A0A212K6G4      ------------------DQKDLLVKKYQNLDLKLDNLP--PQERDLIK--YQREY-NVN
A0A4Y9IPG7      ------------------DQKDLLVKKYQNLDLKLDNLP--PQERDLIK--YQREY-NVN
A0A2V3PNY7      ------------------NKKESLDNNTKEIEDKMATLP--AQEREYIR--YEKRY-QVN
A0A6G7WQ31      ------------------NKKEDLNNSTREIESRMSTLP--AQEREYAR--YEKKY-QVN
A0A6G7X5K8      ------------------NKKEDLNNSTREIESRMSTLP--AQEREYAR--YEKKY-QVN
A0A1M5DFS8      ------------------EKKENLNSRLASVESEMSTLP--AQEREYAR--YEKRY-QVN
A0A4Y8KZS5      ------------------EKKELLNASLSSVETEMTTLP--AQEREYAR--YEKVY-KVN
A0A142HHS5      ------------------GQIALLDTQQGKLSNELQLIP--GKETELER--LKRPL-GLY
A0A660LQT8      ------------------NQVKSLTSQEGTLTSKMAQAP--NQASYLQS--ISREQ-KVK
A0A350PNH9      ------------------SQLGNLQANEAQTTSQIASNP--SQAKYLQT--VGRQQ-KVK
A0A354LNT9      ------------------SQLGNLQANEAQTTSQIASNP--SQAKYLQT--VGRQQ-KVK
A0A2M6GH67      ------------------NQTATLTRDINAIEAELKQMP--ARVTEWAR--LQRPF-ENV
A0A389LWV6      ------------------IEEADLNQRYSKLSAEVASLP--DKERKLLT--HERDF-KIN
A0A1G9B1T9      ------------------YKIESVENQIEELDSQINLLP--KNEQELIN--IERKF-QFS
A0A161LWY6      ------------------IEKKDIDTQSRKASGQLATLP--DIETQMNS--FERQF-KMN
A0A6I3N9U6      ------------------IEKKDIDTQSRKASGQLATLP--DIETQMNS--FERQF-KMN
A0A3D0FMX4      ------------------IEKKDLELRFSEVRAGINALP--EKELEMVA--LERNY-RID
A0A1M3MEI8      ------------------IQKKDLNRRYAEVQQEINQLP--AKELEMIG--IERRY-KMN
A0A1J5HQM0      ------------------IEKNDLKEKNDKVNKEIEQLP--SKEIEMTS--IARKY-KMD
A0A653AC35      ------------------LDKEDLNKKLYAVKQQITALP--QKEMEMVT--LERKY-RVD
E4T131          ------------------IEKSDFNKRLSVVNKQIEELP--EKELEQIA--IQRKY-KMD
A0A521H707      ------------------QKIKSLDERMNEFEQIFLTLP--AQEAELAR--LNRLY-LVN
A0A1F3D6P8      ------------------LSLNELNYRADKLSREISQLP--RTELNMVG--LQRKF-DLS
A0A356Z058      ------------------LSLNELNYRADKLSREISQLP--RTELNMVG--LQRKF-DLS
A0A3D1BT36      ------------------LTLNELDYRAEKLSSQIARLP--RTELNMVS--MQRQY-NIT
A0A352ME00      ------------------LSLNELDYRQNKLSKEASSLP--RTEMNMVS--MKRKF-DLN
A0A3D3HL11      ------------------LTQNELDYRESKLSGEISRLP--RTELNMVS--MQRQF-NLT
A0A5R9QZP0      ------------------LKINELNYRRNKLSREISRLP--KTELNMVS--MQRQF-NIT
A0A2W7RD29      ------------------ISIDDLNYRISEISKDFRKLP--FTEQNLIK--IEREF-TLN
A0A3N2NDY8      ------------------KSLRNMEGAKGAAESQLASGS--TQAKYLLS--VERQQ-KVK
D7JEV9          ------------------IEKSSYQSDLSALNKLLVEAP--NKELRMLD--YERRY-KIN
A0A4R6H3B7      ------------------IQVQGLDRRIEKVNQQLTAYP--KTEQQLMN--MKRMY-DLN
A0A2W7QSQ0      ------------------ISKRNFETTLNENSYKAQSIP--GIERELVE--ISRNT-DLK
R7F6L5          ------------------TRLSGVRSQESVTNSRLATAP--RQANYLLS--VERQQ-KVK
A0A553GA49      ------------------LALQQIRSKISTLNVELNRLP--ETQRNLTT--YERNF-RLN
A0A497D6F6      ------------------LALTDVKNRLWRYERRIQTLP--ETERNYIN--IERKY-QLN
A0A5M4AAB9      ------------------LTLQDISKRTDSLRKQTRSLP--AVERDYVN--IERSY-QLN
F4KR18          ------------------MQQNKLKYHYDQSSNHLRSVP--SKERGLSD--RVRIQ-SIK
C9LKL0          ------------------MRAKSARSNESVINGEVSRAP--GLERRALS--IGRQQ-NLK
A0A3D0QPV7      ------------------KRKGSLKDKIRQYETIYYGLP--EKEIEHAR--MERMF-AIN
A0A496KT23      ------------------TQQRVTESSHSEATSKISANP--RQASYLLS--VERQQ-KVK
L1M9T3          ------------------TQQRATEASHSEATSRISANP--RQASYLLS--VERQQ-KVK
A0A3C0I8F1      ------------------KEIGALQSKFSRAQGEFLKIP--SKETELKR--IKRLH-TIY
R5JJI4          ------------------IQLKNIREQEEQTTKRIEAVP--TQQKYVLT--VERQQ-KIK
A0A3D2HF71      ------------------KSISEADKRLNEVEREIMKLP--STERQMIN--IQRKF-DIN
A0A0A2DQN2      ------------------IKLKEMRYQDNQAYAELVTLP--PKERQWLD--AERQY-KMK
A0A0A2F2N5      ------------------LQLREIEIRNRQGLAEMMAVP--NKQRQWLD--IERQQ-RMK
L1NGW4          ------------------VRLKDAQGTQSSLLSQLPDVS--NKGREKAE--IDRKI-AIR
Z4WRA0          ------------------VRLKDAQGTQSSLLSQLPDVS--NKGREKAE--IDRKI-AIR
U2K8K9          ------------------ARLKSVERDQSALFSKLPGVT--EEGRTKAD--IDRRL-AIQ
A0A069ZM60      ------------------MRLKDIQGQQSSLLSKLPEVS--NQGREKAD--IDRRL-EIR
J6GV98          ------------------MRLKDTQGQQSSLLSKLPEVS--NQGREKAD--IDRRL-EIR
A0A134B4F8      ------------------MRLKDAQGQQSSLLSKLPEVS--NQGREKAD--IDRRL-EIR
A0A134B8C7      ------------------MRLKDAQGQQSSLLSKLPEVS--NQGREKAD--IDRRL-EIR
A0A4Z0EKR0      ------------------ITSNSLKASSGQFQSKIKKVP--GMERELLE--INRQK-SIK
A0A229I3A5      ------------------TQLGTLQANEAATTSQIASNP--NQAKYLQT--VGRQQ-KVK
A0A3R6HJB3      ------------------TQLGTLQANEAATTSQIASNP--NQAKYLQT--VGRQQ-KVK
B5CTK0          ------------------VKLKNLQAQEARTASRIAAVP--THQKYILS--VERQQ-KIK
A0A1M6B6D5      ------------------EEIRTINRDIGRYEAEIRKLP--KEQQELLK--IERRY-NLS
A0A451FS66      ------------------DEINSINQDIGRYESEIRKLP--KEQQDLLN--IERRY-NLS
A0A2E3GN39      ------------------QEKDAVVAEINKLLEELDLLP--LFEAEYLR--LKRDY-EVK
A0A3D1MEL0      ------------------QERDAVVAEINKMLEELDLLP--LFEAEYLR--LKRDY-EVK
F0R0C9          ------------------TRIRSLQRSEQQTTERLAANP--SQAKYLLS--VERQQ-KVK
A0A2A4N9A6      ------------------AQLALIDKAVRQ-KQKLDSEVNFDAAIEYLR--VSTAY-KME
A0A6C0GGI1      ------------------SSLAVTNQSISQLENNIFRLPQDQRQLEQLQ--SKKDYNEQT
A0A368D1N7      ------------------QERDAVVAEINKLLEELDLLP--LFEAEYLR--LKRDY-EVK
A0A3B8TU58      ------------------QERQLMIDEINKILEELDVLP--LFEAEYLR--LKRDY-ETK
A0A1T5IIR6      ------------------IQRRDLSDRERNAVAKFSSMP--TKERQMLE--IQRQQ-SIK
A0A3E0QD27      ------------------EKINNIDERIREFEGNFLKLP--SQEAELSR--LSRLF-EIN
A0A0M1W1I6      ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
A0A4R4GHU2      ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
I8WPR6          ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
A0A0K2HKS3      ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
B6W3W8          ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
A0A4R4GSI6      ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
A0A076IRY8      ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
A0A3A6AD54      ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
A0A3A6MIU7      ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
I8WPP8          ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
A0A372Y7D2      ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
A0A3E4JJC9      ------------------VKLNEARSRAGEAQWRGTNIP--RQQQQMLS--IERQQ-RIK
A0A3E4WDQ0      ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
A0A414H9P2      ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
C3R5A8          ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
A0A1C5XJA7      ------------------VKRNDAQNREMRVQERLSAMP--TKERQMLS--IERQQ-KIK
A0A3E5BU42      ------------------MKRNDARSRQAQAQARFTTVP--TKERQMLS--IERQQ-KIK
R7CUW4          ------------------VKRNDAQNREMRAQSRVTSIP--TKERQMLS--IERQQ-KIK
A0A416GGJ1      ------------------VRRRDALSRETRAQVRFSSIP--KKERKMLS--IERQQ-KIK
D1JY72          ------------------VKLNEARSRAGEAQWRVTNIP--RQQQQMLS--IERQQ-RIK
D7J4K6          ------------------MKRNDARSRQEQAQARFTTVP--TKERQMLS--IERQQ-KIK
Q8ABP9          ------------------MKRNDARSRQEQAQARFTTVP--TKERQMLS--IERQQ-KIK
A0A5M6AHF7      ------------------MKRNDARSRQEQAQARFTTVP--TKERQMLS--IERQQ-KIK
D6D2Z5          ------------------MKRNDARSRQEQAQARFTTVP--TKERQMLS--IERQQ-KIK
A0A1T3EDR4      ------------------QRRRQASALEQRALGQMLKVP--SKEREQYS--IYRSH-AVK
A0A174SDD8      ------------------LKKQDYSLQENQVRQKVQAVP--RKQREMLS--VERQQ-KVK
A0A1H7RFH3      ------------------LKKQDYSLQENRVRQKVQAVP--RKQREMLS--IERQQ-KVK
A0A139L1N2      ------------------LKKQDYSLQENRVRQKVQAVP--RKQREMLS--IERQQ-KVK
A0A174TVL8      ------------------LKKQDYSLQENRVRQKVQAVP--RKQREMLS--IERQQ-KVK
A0A1H8BJR6      ------------------LKKQDYSLQENRVRQKVQAVP--RKQREMLS--IERQQ-KVK
R9H6G0          ------------------LKKQDYSLQENRVRQKVQAVP--RKQREMLS--IERQQ-KVK
A0A412GR09      ------------------LKKQDYSLQENRVRQKVQAVP--RKQREMLS--IERQQ-KVK
A0A6I0S0M4      ------------------LKKQDYSLQENRVRQKVQAVP--RKQREMLS--IERQQ-KVK
A0A081PBV5      ------------------IKINNLKKEQTQARNKAMAVP--AKQRMMLS--VERQQ-KVK
A0A1I2AN85      ------------------IKINNLKKEQTQARNKAMAVP--AKQRMMLS--VERQQ-KVK
A0A4U0GMP3      ------------------IKLRNAQREGGAARSKVQSIP--PKERVMLS--VERQQ-KVK
A0A1H6CKR6      ------------------IKVRNLRQEENAAIGRARSMP--AKQRMMLS--VERQQ-KVK
A0A235E1C0      ------------------IRMSNMKDEENAAIGKARSLP--SKQRIMLS--AERQQ-KVI
R6D982          ------------------LKRTEISGQERLARRKVRDVP--GKQREMLS--VERQQ-KVK
A0A1F0I8C4      ------------------QKKNDYTVQENRVRQKVQAVP--RKQREMLS--VERQQ-KVK
A0A3A5RIJ2      ------------------QKKNDYTVQENRVRQKVQAVP--RKQREMLS--VERQQ-KVK
A0A515IZJ5      ------------------QKKNDYTVQENRVRQKVQAVP--RKQREMLS--VERQQ-KVK
A0A5M5NLR3      ------------------QKKNDYTVQENRVRQKVQAVP--RKQREMLS--VERQQ-KVK
A0A0D5BSQ0      ------------------VRLNNAKQEEATAQSKTLQIP--QQERAILS--IERQR-KIK
A0A1T3F6P5      ------------------IKLNNTRQEEGVAQSKMLQMP--QKERTMVS--VERQR-RVK
A0A0W8EPA0      ------------------IKLNNTRQEESIAQGKMLQMP--QKERTMVS--VERQR-RVK
A0A365UKN1      ------------------VKLNNTRQEEGIAQGKMLQMP--QKERTMVS--VERQR-RVK
A0A4R6WE41      ------------------VKINNVQREENQVKGQVMQIP--GKQRMILE--VERKQ-KVK
A0A2T5RP38      ------------------IKMRNAQREEEQAIGKTLQMP--KKQRAMLS--VERQH-KVK
A0A1A6CF06      ------------------IKLNNARQEGRTAQAKVLQMP--QKERTMLS--IERQH-KVK
A0A1T3D6S8      ------------------IKLNNARQEGRTAQAKVLQMP--QKERTMLS--IERQH-KVK
A0A1P8E011      ------------------IKAGNMKKEENVARGKAMQVP--QKQRVMLS--VERQQ-KVK
A0A1V3N3U3      ------------------LKIRNAQQEESMAKGKALQVP--KKQRIMLS--VERQQ-KVK
C2FUH6          ------------------VKMQKARSEEQQARGKVIQMP--QKQRIMLS--VERQQ-KVK
A0A0B8T471      ------------------IRIRNLQQEEAASRAKAQSLP--AKQRMMLS--IERQQ-KVK
A0A4R7D2K0      ------------------IRIRNLQQEEAASRAKAQSLP--AKQRMMLS--IERQQ-KVK
A0A2X2J8S4      ------------------VKKNNAVKEENRASGKSRQMP--QKQRLVLS--IERQQ-KVK
A0A3C0S618      ------------------VKKNNAVKEENRASGKSRQMP--QKQRLVLS--IERQQ-KVK
A0A4P7DRF9      ------------------IKIRNLQQEENAAIRKAQSLP--TKQRMMLS--VERQQ-KVK
A0A239XXC4      ------------------IRMSNMKDEENAAIGKAKSLP--SKQRIMLS--AERQQ-KVI
A0A4U9K473      ------------------IRMSNLRDEENAAIGKARSLP--SKQRIMLS--AERQQ-KVI
A0A3M1Y2F5      ------------------FELESVEDQIRTANGRLSRLP--RNERMLTQ--MGRTY-ESI
A0A1G1TG88      ------------------NRIALLDRQQNKLDAKQQGLP--SRATEQAR--LQRPL-ALA
A0A661XXA6      ------------------EDESDLVNQKIQLNQQLKKLP--SKSTEYNK--VKRFY-TLY
A0A3D4RLG4      ------------------IEKKDLQNRYKEVEKEIPNLP--TKELQMVA--IERNY-RID
A0A2T2UAJ4      -----------------------LNERLRENRQKLEQIP--TQSIKLAQ--PQRER-RST
A0A6I0DZQ5      ------------------IQKKDLNRRYAEVQQEINQLP--AKELEMIG--IERRY-KMN
A0A1H6Z2F8      ------------------LSISAIHAYGKGFEAEISRLP--GHQRALLS--QSREQ-GIQ
A0A2P8G5K0      ------------------VNAAAIRKYGKESEAEISKLP--AHQRAFLA--QSREQ-GIQ
A0A4Q3SEI4      ------------------ANRSKLGAGTGMYTSILKGIP--KKERDLLD--ISRQQ-AIK
A0A6A1IRV5      ------------------TQIRSLRRQEEATTNRLASNP--NQAKYLLS--VERQQ-KVK
A0A519SYE7      ------------------ATLNTRLMAMPDLA--------------TQQDRLKRPL-DLY
A0A5Q4EKA0      ------------------ARIKEILSKIESYEGILLNHG--GRYSLIEYSMLQRVH-TIN
A0A3D4CJE1      ------------------TQRNEVAQKIKEFEQKFYNIP--AKELEYAR--LERMF-SID
A0A4Q5ZQ60      ------------------DKIASLSNTIMQAENELLKLP--SKETDLTR--LRRFY-NLY
A0A519Q885      ------------------KKLGLLGDQDSKLENKRRVLP--LLATQEAR--LQRPL-ELY
A0A519TAP8      ---------------------------------------------------------SLY
R5DEG6          ------------------IKIKNIRAQEEQTSRRISAVP--TQQKEVLS--VERRQ-KIK
A0A3N2LCI3      ------------------MQISSLQGSQASTTSKIASNP--SQAKYLLS--VERQQ-KVK
A0A642EJV3      ------------------SQIKSLRQTEQQTTSRIAANP--TQAKYLLS--VERQQ-KVK
A0A6H9Q899      ------------------SQIKSLRQTEQQTTSRIAANP--TQAKYLLS--VERQQ-KVK
A0A2K8ZAP1      ------------------SNRNQLVANNQRMEGMIRTVP--GKERALLN--ITRQQ-GIK
A0A2T4XEQ1      ------------------------------------------------------DV-NIA
A0A348PT57      -----------------------------------------SKEIEYAR--IERVY-NSN
A0A3D3LSK1      ------------------NKIGIVNSLSSQYNAQIKTLP--SQVIEYAK--LERDK-LAA
A0A496L711      ----------------------------------------------MLD--YERRY-KIN
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          --------------------------------------------------------MAIP
A0A1V5S5I3      -------------------------------------MIPTAPVKKNIALVAIVLGLLIP
A0A2M7VVW6      ----------------------------------------------MIMATGVLLGIVIS
A0A413V760      --------------------------------------------------------LGIP
A0A656PYT8      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A6A0Y068      -----------------------TAYNTRIVTPPHGSMLPTSPVHKNIFMVAFALGLLIP
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      -----------------------TTADFQILSAASAPDAPISPKKMLVYAIGLAGGLVLG
A0A519SD85      RKVYNYLSEKKLEAEIARAAVI-PGAVIIDKA-DYP-EEPNLPLPVTLYTSSALFGLAGG
A0A3M1TXY5      SEVHKYLLQKRAETAIALATDI-ANKFVVDEAKQVG-SGPVSPKVGLIYAVAFVLSLGLP
A0A2E0VQ27      EALYNYLMRKYTELSIMQQSDL-FPHKIIEHA-VRP-KATVAPNKSLYYGMAFLLALLAG
R6U429          EELYIYLLQKREENEIASLVNV-GNTRLVMEP-AGE-DMPQSPNKKMIMLIALILGAGIP
A0A5C8AF42      EKYFTLLTEKKVLYSISDAGYA-SNNRILSRP-AVN-NTPVSPNRKLIYVTFVFFGIVIG
A0A239K409      QQLYKYLLEKREESSLALATSA-PNSLVLRPA-IIE-GVPVEPKKQTVFLLAFIAGLGVP
A0A350V3E4      EKVYLMLLEKYQEALINEESQP-NNVKIIDYG-KVP-KAPSKPNRFLIITIGLLIGLGLG
A0A1V5S1J9      DDYYTFLVQKRADAQIQKASNS-PDNIILDKA-RLA-SMTNAGEKNKAYTMFLAIGLLVP
A0A0A2EYC8      DSYYTFLLQKRSEAQIRKASNS-PDNAVMQKA-RTM-SLINAKEKQNKYIVFLLIGLAVP
A0A2G6H6Y4      DEYYTYLLQKRAAAEILKASNT-PDNTVLQTA-MIS-GQLNDKEKRTNYLIFIVLGLMIP
A0A1M3DPL8      DSYYTMFLQKRAEAQILKASNT-PDNNILDRA-RTT-SVTNQGTKSKTIMMYFLIGILLP
A0A1V5F519      DNYYTFFLQKRAEAEIQKASNT-PDNNILDQA-RTV-SLINADVKSNTMFMFILLGILIP
A0A2G6R1T9      DNYYNFFISKKAEAQIQKAANS-PDNEVVEQA-RVR-FVVNGGKKKETTMTYLLFGLMIP
A0A1M6MYT6      NETYIFLMQKLSEAQIAKASNI-PDSQMIEEAKMAG-TGPVEPQKRKIYALALLLALAFP
A0A2P8CDS1      NDTYTFLLQKLSEAQIAKASNM-PDNEIIDPARMEG-NTPISPNNMTIYLVALLFGIFLP
A0A353WYK7      EEFYLSLMKNKAQFELAQAGTV-TDFKILSSA-SLP-SNPIAPNKILIWAGAIIASVILS
A0A355BP94      EEFYLSMMQAKAEFEIAQAGST-PDLKILSSA-ILP-GRPVAPNRYLILGIGLVAGLVIN
A0A136LSC7      EEFYLTMMQSKAEFEIAQAGST-PDFKILSPA-TLP-IKPISPSKVMVLGIGFVAAIVLC
A0A5C7N8Q5      EEFYLTMMQSKAEFEIAQAGST-PDFKILSPA-TLP-TTPISPSKIMVLGIGFVAGIVLS
A0A2W4RDE8      DNVYNYLLEKRAEAGIAIASNV-VEKSVVDEAMMVG-SAPVSPNKRMIYAAAFILGFGGA
A0A0L8VEV2      NELYTFLLKKRAEAAITHASNV-SDTEVLDEARPEL-AELMGPYLTFNVAGGLLAGLFVP
A0A1I2A9Z9      NELYTFLLKKRAEAAITHASNV-SDTQVLDEARPEL-ASRLGPNLVINVAGGMLAGLFIP
A0A212J9Z9      EMYHQYLTQRQYEAKIQKASNT-PDNFIWEAPRQMG-GAVNGGEIGKNYTYYFIIGLILP
F5IV23          EMYHQYLTQRQYEAKIQKASNT-PDNFIWEAPRQMG-GAVNGGEIGKNYTYYFIIGLILP
F8X2T0          EMYHQFLTQRQYEAKIQRASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIP
A0A1M3LAG1      EMYHQFLTQRQYEAKIQRASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIP
A0A212K6G4      EMYHQFLTQRQYEAKIQRASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIP
A0A4Y9IPG7      EMYHQFLTQRQYEAKIQRASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIP
A0A2V3PNY7      DAYYTYLRQRRYEATIQKASNI-PDNFIMEAPRQKG-GPVNGDEKRKNYTFYFFIGLGLP
A0A6G7WQ31      DAYYTYLRQRRYEATIQKASNI-PDNFIMEEPRQKG-GPVNGDEKSKNYTFFFLIGLALP
A0A6G7X5K8      DAYYTYLRQRRYEATIQKASNI-PDNFIMEEPRQKG-GPVNGDEKSKNYTFFFLIGLALP
A0A1M5DFS8      DAYYTYLRNKRYEATIQKASNI-PDNFVLEEPRQLG-GPVNGDEKKKTYTFYLAIGLAIP
A0A4Y8KZS5      DAYYTYLRNKRYEATIQKASNI-PDNFVLEEPRQMG-GPINGDEKNKTYTFYLAIGLAIP
A0A142HHS5      GNSYQMLLEKKVEYNIKNAGTT-ADFQILSPA-FAP-EEPISPKKLLVYAIGLAGGLILG
A0A660LQT8      ESLYIFLLQKREENELSIAFTA-YNTRIITPP-MGS-NKPISPVKRNILLIALGLALALP
A0A350PNH9      EALYLFLLQKREENELSKAFTA-YNTRIITPP-TGD-TKPVQPVRRNIILVAFVLGVLIP
A0A354LNT9      EALYLFLLQKREENELSKAFTA-YNTRIITPP-TGD-TKPVQPVRRNIILVAFVLGVLIP
A0A2M6GH67      EGAYRQLINRRLDFNIAKAGTT-ADFQILQPA-SLP-AAPIKPDKLMVYAIGLASGLFLG
A0A389LWV6      DSYNTYLLQRRIESQIQLASNM-PDNLVLDNA-RTT-GLVNAGDISNTYVYFVVTGLILT
A0A1G9B1T9      DNQYNYLLQKRTEVGIAVASNA-STKKVVEEARLDG-RTPVSPNKILILLTAIVLGLALP
A0A161LWY6      DTYYTYLLQKRAEAQIQRASNV-PDNTILERA-RMI-SITNGGDKKKSMMMALALGLIIP
A0A6I3N9U6      DTYYTYLLQKRAEAQIQRASNV-PDNTILERA-RMI-SITNGGDKKKSMMMALALGLIIP
A0A3D0FMX4      DNYYTFFLQKRAESEIQKASNT-PDNDRLDKA-RIL-ECTNAGAKNANRTKYLLLGLIIP
A0A1M3MEI8      DSYYTLFLQKRAEAEILKASNT-PDNNILDRA-RVI-NVVNQGEKSKTTLLFLLLGLVVP
A0A1J5HQM0      DNYYTFFLQKRAESEILKSSNT-PDNNILDRA-RII-AVTNDGTQSKTTLTFLIIGLLIP
A0A653AC35      DNYYTFFLQKRAEAAIQKASNS-PDNNILDKA-RIM-GVTNGKVISKNYMTYGLIGFLIP
E4T131          DNYYTFFLQKRAESEILKASNT-PDNDILDKA-RIV-GVTNSDKRSKTTMVFLLFGLLIP
A0A521H707      EKFYQLLLEKKVEFAITKAGII-TNNIVLEQGKPAL-NPL-SPNRKLILAGSLLVGFILS
A0A1F3D6P8      DVIYTYLLQKRSEAAITMASNY-PDFEVIEPAREFT-KKIIVPRPKLSYLLAIFFGLAIP
A0A356Z058      DVIYTYLLQKRSEAAITMASNY-PDFEVIEPAREFT-KKIIVPRPKLSYLLAIFFGLAIP
A0A3D1BT36      DAIYTFMLQKRSEAGIAMASNH-PDYEVLESARSIT-SSIIKPKKMINYIASFFLGLLIP
A0A352ME00      DEIYTFLLQKRSEAQISLASTR-PDYEIVEPARTIT-SRIVAPKSAINYMMALFFGLLLP
A0A3D3HL11      DQIYTFLLEKKAEAAIAMASNY-PDYEILEPARDVT-ASIIAPRTNLNWLIALFMAFMVP
A0A5R9QZP0      DAMYTFLLQKRSEAAISMASNY-PDYEILEPARLVT-SSVISPKTTINYLLSLFIGFIIP
A0A2W7RD29      EGIYNFLLQKRAEAAISKASNI-NNNKIIEQA-KAN-ALPIGPRKLNFYGYAIIITFLLP
A0A3N2NDY8      ESLYLYLLQKREENELTQKFTA-DNTRIITPP-TGS-LQPVAPKVKFILAICMFFGLCVP
D7JEV9          DSYYTFLLQKRSEAQIRKASNS-PDNAVMQKA-RTS-QLVNANQKQKKYMIFFFIGLAIP
A0A4R6H3B7      NELYTFLLKKRAEAAITHASNV-SDTQVLDEA-RPELAFRLGPNLVINVAGGMLAGLFIP
A0A2W7QSQ0      QEQYQYLLRKRDEAVLTLEVTGVSSAQMVDPP-IAS-LKPVKPNKLMIMAAALGLGLSLP
R7F6L5          ESLYLFLLQKREENELAQAFKS-YNTQVVRQP-AGP-GAPISPVSTNTYLIAVLIGLIIP
A0A553GA49      DAIYTFLIQKRSEAQIAKASNL-PAFELIDYP---AFDGRAAPKKSRNLILMVFFGLLLP
A0A497D6F6      NETYTFLLQKLTDAQIARASNV-SDSRVIEDA-HIKGIGPVEPKKSRIYLIALFLGLFVP
A0A5M4AAB9      NNNYNFLLQKLSEAQIAKASNT-PDNEVIDPA-RIIGDKPVKPNNIKTGIAALLLGIFFP
F4KR18          ENLYVYLLQKREETALALVSNY-ANALLFDPPYSSIG--PVGPNKIKIFAAAGMGGLAIP
C9LKL0          EALYTYLMNKREEVALQLAVND-ANVRLVEDP-LGS-NTPISPSRSTIILISLLIGLLIP
A0A3D0QPV7      EKYHTMLLEKKTEYEISLAGQT-TGNQILEQA-TIP-KLPVSPKKRMIVIAFFFIGILFS
A0A496KT23      ESLYLFLLQKREENELSQAFTA-YNTQIIETP-HIT-GIPPQPVSRNILLTAFLIGLAIP
L1M9T3          ESLYIFLLQKREENELSQAFTA-YNTQIIETP-HVT-GTPATPVSKKILGIALLLGLGIP
A0A3C0I8F1      EAFYSQMLNKKAEIGISRSAIV-PEFVILAPA-SQP-TKPIYPVPTNIYSLGLAAGVVLS
R5JJI4          EELYLYLLNKREENALTQAITE-SNARIIDPA-SGS-SVPVAPKSMMILLAAIVLGGTIP
A0A3D2HF71      NTVYTFLLEKRAEAGIARASTV-SDNRIIDYAGVYS-STMIKPKERQNFMLAIILGLFFP
A0A0A2DQN2      EALYTQLLSKREENLFAQTITN-NNAYILDLG-VGT-SAPISPVPSRSILLGIVLGLFIP
A0A0A2F2N5      EALYTQLLSKREENTLAQTAQS-NNAYVMDFD-TGS-NSPISPNTTRTLLISFAIGLFIP
L1NGW4          ERLYTELLNKREEYALMQAMTQ-DSAYILDMN-DAP-APPVSPNKTRTVLLAILIGLALP
Z4WRA0          ERLYTELLNKREEYALMQAMTQ-DSAYILDMN-DAP-APPVSPNKTRTVLLAILIGLALP
U2K8K9          EGLYTELLSKREEYALRQSMTQ-DSAYILDMN-DAPNTPPVSPNTLRTIVLAFLLGLALP
A0A069ZM60      QRLYTELLNKREEYALRQAMTQ-DSAYVLDMD-DAP-SKPISPNTLRVVLIAILIGLVLP
J6GV98          QRLYTELLNKREEYALRQAMTQ-DSAYVLDMD-DAP-SKPVSPNALRVALIAILIGLVLP
A0A134B4F8      QRLYTELLNKREEYALRQAMTQ-DSAYVLDMD-DAP-SKPVSPNTLRVVLIAILIGLVLP
A0A134B8C7      QRLYTELLNKREEYALRQAMTQ-DSAYVLDMD-DAP-SKPVSPNTLRVVLIAILIGLVLP
A0A4Z0EKR0      QNIYSYLLQKREEAALSLAATT-AIARVIDPA-TGG-DYPISANSRTIYLMALLLGLAIP
A0A229I3A5      EALYLFLLQKREENELSKAFTA-YNTRIITPP-TGD-NTPVEPVRRKILLIALVLGFLIP
A0A3R6HJB3      EALYLFLLQKREENELSKAFTA-YNTRIITPP-TGD-NTPVEPVRRKILLIALVLGFLIP
B5CTK0          EELYLYLLNKREENALAQSITE-SNVRTIDPA-SGS-NTPIAPDRMRIWMISFLIGIGIP
A0A1M6B6D5      EGTYNMFLAKRSEAGLVKAANV-SDVLVIDPAKDTG-GGQIGPNTQLNYMMAGLIGFFVP
A0A451FS66      EGTYNLFLAKRSEAGLVKAANV-SDVVIIDTAKDTG-GGKIGPNTQLNYVMAGLLGLFIP
A0A2E3GN39      SSFYNSLLDRKASFTLSRAGIV-SDYIILEMP-KIA-EKHVAPDDSFIRFVGLAIGAILS
A0A3D1MEL0      SSFYNSLLDRKASFTLSRAGIV-SDYIVLEVP-KIA-EEHVAPDDSFIRFVGLAIGAILS
F0R0C9          EALYLFLLQKREENELSQAFTA-YNTRVITPP-TGS-MLPTAPVRRNILLVAFALGLLIP
A0A2A4N9A6      KKYYERLLEKHANLQIHAAGII-NDVVILAEA-SVP-KIQEYPSPVYAMLTGIISFLMLS
A0A6C0GGI1      VAFYEQ--KRAAAEILLATNAP-SKKRVDYAK-MVG-NGPMSPKTNAIYLIAFLVGLFIP
A0A368D1N7      SSFYNSLLDRKASFTLSRAGIV-SDYIILEMP-KIA-EQHVAPDDSFIRFVGLAIGAILS
A0A3B8TU58      AMFYNNLIERKSSFSLSKAGIV-SDYTILENP-KIA-KNHISPNDSFIRFVGLAIGAILS
A0A1T5IIR6      QELYLFLLNKREENALSQAMAD-DNIRVVDPA-VAN-LTPTSPQRMKIVMLAILIGLLIP
A0A3E0QD27      QKFYQLLLEKKVEFSITKAGII-SNNIVLERG-KPA-VNPLSPNRRLVIAGSLLLGFIIS
A0A0M1W1I6      EELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALP
A0A4R4GHU2      EELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALP
I8WPR6          EELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALP
A0A0K2HKS3      EELYLYLLNKREENALGQATTE-TDARVLDPA-GGG-DTPISPNGRSMIMAGIMKGIALP
B6W3W8          EELYLYLLNKREENALGQATTE-TDARVLDPA-GGG-DTPISPNGRSMIMAGIMKGIALP
A0A4R4GSI6      EELYLYLLNKREENALGQATTE-TDARVLDPA-GGG-DTPISPNGRSMIMAGIMKGIALP
A0A076IRY8      EELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALP
A0A3A6AD54      EELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALP
A0A3A6MIU7      EELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALP
I8WPP8          EELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALP
A0A372Y7D2      EELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALP
A0A3E4JJC9      EELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALP
A0A3E4WDQ0      EELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALP
A0A414H9P2      EELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALP
C3R5A8          EELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALP
A0A1C5XJA7      ESLYLFLLNKREENALSQAMAD-NNARVIDSA-EAT-KYPISPNRNKILALGILLGLALP
A0A3E5BU42      ESLYMFLLNRREENALSQAMAD-NNARTIDSV-DGP-VGPIAPVRNRILLLGVLVGLAVP
R7CUW4          ESLYLFLLNRREENALSQAMAD-NNARIIDSA-EGG-DSPISPRRNRILLLGLLVGIALP
A0A416GGJ1      ESLYMFLLNRREENALTQAMAD-NNARLIDEA-DKG-SGPIAPVRNRILILGLLAGIALP
D1JY72          EELYLYLLNKREENALGQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGIMKGIALP
D7J4K6          EALYMFLLNRREENALSQAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVP
Q8ABP9          EALYMFLLNRREENALSQAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVP
A0A5M6AHF7      EALYMFLLNRREENALSQAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVP
D6D2Z5          EALYMFLLNRREENALSQAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVP
A0A1T3EDR4      ENLYLYLLNKREENALNAAIGE-AKLHVVDHA-VIS-HVPISPNILISVFTGLGIGFLVW
A0A174SDD8      ESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLMLGVGCGVIVP
A0A1H7RFH3      ESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVP
A0A139L1N2      ESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVP
A0A174TVL8      ESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVP
A0A1H8BJR6      ESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVP
R9H6G0          ESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVP
A0A412GR09      ESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVP
A0A6I0S0M4      ESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVP
A0A081PBV5      EELYLLLLNKREENAINQAMTE-DNVRIIDPA-SGS-DAPIYPSRIKKLALGVGIGIALP
A0A1I2AN85      EELYLLLLNKREENAINQAMTE-DNVRIIDPA-SGS-DAPIYPSRIKKLALGVGIGIALP
A0A4U0GMP3      EELYIFLLNRREENSLNQAMTD-DNVRIIDPA-SGS-SAPIYPSRFSKVALGVGIGAAIP
A0A1H6CKR6      EELYIFLLNKREENAINQAMTD-DNIKVIDSA-NTS-NYPFYPSLLKKLALGIGIGLAIP
A0A235E1C0      EELYIFLLNKREENAINRAMTD-DNIRVIDSA-SGS-DAPFYPSKFKKVAIGVAIGIAVP
R6D982          ESLYLFLLNKREENALNQSMVD-NNARIIDSA-SGS-NAPFYPNKYKKLLLGGGMGILIP
A0A1F0I8C4      ESLYVFLLNKREENALNQAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVP
A0A3A5RIJ2      ESLYVFLLNKREENALNQAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVP
A0A515IZJ5      ESLYVFLLNKREENALNQAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVP
A0A5M5NLR3      ESLYVFLLNKREENALNQAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVP
A0A0D5BSQ0      EELYLFLLNKREENALNEAIAE-SNLRIVDPP-TGL-DFPVSPNKLKKLSIGVAIGAVLP
A0A1T3F6P5      EDLYMFLLNKREENALNEAVTE-ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAIGTVLP
A0A0W8EPA0      EDLYMFLLNKREENALNEAVTE-ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAIGAVLP
A0A365UKN1      EDLYMFLLNKREENALNEAVTE-ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAMGAVLP
A0A4R6WE41      EDLYLFLLNKREENALNQAMTE-DNIRIVDPA-YGS-EAPMYPSRLRKVGMGLAVGTVLP
A0A2T5RP38      EELYLYLLNKREENALNEAMTD-ENIRVVDPA-SGP-DVAVYPNRLKKIFTGVALGTAVP
A0A1A6CF06      EELYLFLLNKREENALNEAITE-ANLRIVDPP-VGD-AYPIYPNRLKKVFTGVAIGTVLP
A0A1T3D6S8      EELYLFLLNKREENALNEAITE-ANLRIVDPP-VGD-AYPIYPNRLKKLFTGVAIGTVLP
A0A1P8E011      EELYLYLLNKREENAINQAMTE-DNIRVIDPA-IVS-FDPVAPSRMRKLGLGMAIGFILP
A0A1V3N3U3      EELYLYLLNKREENALNLAMTE-DNIRIIDRA-SVA-TSPIFPSKFRKVATGIGIGLILP
C2FUH6          EELYVFLLNKREENALNKAMTD-DNIRIIDPA-SGS-DAPVYPVRFKKVMTGVGIGIVLP
A0A0B8T471      EELYILLLNRREENALNQAMTD-DNLRVVDPP-SGS-EAPIYPSKARKVMTGVGFGVVLP
A0A4R7D2K0      EELYILLLNRREENALNQAMTD-DNLRVVDPP-SGS-EGPIYPSKARKVMTGVGFGVVLP
A0A2X2J8S4      ESLYVFLLNKREENAINQAMTD-DNIKVIDPA-SGS-FAPVYPNKFKKVGLGVAIGLVIP
A0A3C0S618      ESLYVFLLNKREENAINQAMTD-DNIKVIDPA-SGS-FAPVYPDKFKKVGLGVAIGLVVP
A0A4P7DRF9      EELYIFLLNKREENAINQAMTD-DNIRIIDSA-SGS-DWPIYPNKLKKLAIGIGIGLAIP
A0A239XXC4      EELYIFLLNKREENAINRAMTD-DNIRVIDSA-SGS-NLPFYPSKLKKVAIGVAIGIAVP
A0A4U9K473      EELYIFLLNKREENAINREMTD-DNIRVIDSA-SGS-DLPFYPSKFKKIALGVAIGIAVP
A0A3M1Y2F5      NELYSYLQKKKTEAEIALANLT-VDLMIIDPA-RYT-GKESRNSRMLIMALALILAIGLP
A0A1G1TG88      EGTYTMLMGKKVDYNIQKAGTT-ADFQILFPA-SEP-RVPISPVRLMVYAIGLAGGLFLG
A0A661XXA6      EEIYLSLMQSKNEFEIAIAGST-TKIKILSPA-TMP-DSPIKPNKTIIYMAGGVSFIVLS
A0A3D4RLG4      DNYYTFFLQKRAETEIQKASNT-PDNAVLDKA-RTT-YITNAKQQRKTMISYLALGFLLP
A0A2T2UAJ4      EQIYSFVQEKLQEARLAEQSEI-GYAEIIRSA-APG-RPVGPDTR-RNLLLGLMLGLVAG
A0A6I0DZQ5      DSYYTLFLQKRAEAEILKASNT-PDNNILDRA-RVI-NVVNQGEKSKTTLLFLLLGLVVP
A0A1H6Z2F8      QELYLFLLKKRMETAISRSANI-ANARVIDPP-KAS-PLPVSPNRQLTILVAFLAGLLAP
A0A2P8G5K0      QELYLFLLKKRVETAISRSANI-ANARVIDPP-KAS-RLPVYPNRELTILIAVFTGILTP
A0A4Q3SEI4      NDAYSFLLQKREEAAISYAAVV-ADSRTINHA-TAS-FLPISPEKTFVYLVSIVIGLLIG
A0A6A1IRV5      EELYLYLLQKREENELSQAFTA-YNTRLITAP-RGS-MFPTAPRKMNILLVAFAVGLLVP
A0A519SYE7      ANTYSQLLNQKLNFGIQQAGTT-ANFQILSPA-YPP-GEPISPVRALVYAIGLASGLALG
A0A5Q4EKA0      ERFYNQLVEKKAEYSISKAGYV-SQSVILERS-RVP-GQPISPKPRGVYASSLLAALFLG
A0A3D4CJE1      EKFFTLLLEKRTEYSISEAGFV-PQHTILEQA-EIP-NVPIKPNKKLIFVVFVFGSLVLG
A0A4Q5ZQ60      EQSYLLLMEKKIQFGIAKAGTT-DNSQILSPA-SLP-TLPIYPNKMLVYAIGIAASFFLS
A0A519Q885      SGAVRDLMQKQLEYEIQNAGTI-PDFQILSAA-ATP-DEPISPKKILVYAIGLAGGLILG
A0A519TAP8      ASTYQRLVDRKMDFNIQQAGTT-PEFQILSPA-SPP-SEPITPVRLLVYAIGLAGGLILG
R5DEG6          EELYLYLLNKREENELTQRMTE-SNARIIDPA-AGS-NAPVAPKAMMILLASVVLGCAIP
A0A3N2LCI3      ESLYLFLLQKREENELSQAFTA-YNTRVVNKP--AS-FGPTAPNTRNILMMSFLLGLAIP
A0A642EJV3      EALYLFLLQKREENELSQAFTA-YNTRIVTPP-HGS-MLPTSPVHKNIFMVAFALGLLIP
A0A6H9Q899      EALYLFLLQKREENELSQAFTA-YNTRIVTPP-HGS-MLPTSPVRKNIFMVAFALGLLIP
A0A2K8ZAP1      NNLYTYLLQKREETALSAASRV-SDSRIVDPA-HTT-SQPVKPVKLMIFALFAVVGLVIP
A0A2T4XEQ1      ESIYLTISRQYAETALWEQTQF-GLGRPLDYA-VAP-LSPFKPNKRLFILIGIFLGGAVG
A0A348PT57      EKYYTLLLEKKTEYAISEAGFI-SENRVLRRA-STS-RIPISPVKPIIYASFLALGLILS
A0A3D3LSK1      EKLYAALESNYQESLINERTQT-IKSYVIDPG-YDD-NSPIGPDRRNMNIFGIIAGLIIG
A0A496L711      DSYYTFLLQKRSEAQIRKASNS-PDNAVMQKA-RTS-QLVNANQKQKKYMIFFFIGLAIP
                                                                            

A0A1T4NDR5      --------------------------------------------MTN-------------
A0A3D5KRM7      --------MVENSESDSLDNI--R-YSKTRIMPLDAEVL---------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
R7JFY1          AGILWLR-WANDTRIRSMKDV--Q-DRT--ALPLLGEIP---------------------
A0A1V5S5I3      VVIVFIR-ENMNTKVRGRKDL--E-SL---SLPFAGEIPLAVSGKGK-------------
A0A2M7VVW6      LIILILK-YVLKNTISTMDEI--T-KFSNGAVGILGTVP----TYNR-------------
A0A413V760      MGVFWLL-NVTDTKVRTRKEL--D-GVL--TIPFLGNIP----RHGN-------------
A0A656PYT8      ------M-EILDTTIRGRKDI--E-DKL--SIPFLGDIP----EYHG-------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      --------------------------------------------MLK-------------
A0A6A0Y068      IVIIFMR-ENMNTRVRGRKDL--E-NLTIPFIGEIPLFTRKKKGILG-------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      LGLIGVR-YLMHNTVTSIGEL--E-RNTKASVLGV-------IPTYS-------------
A0A519SD85      ITFIFLK-RKINPFVNIAEDI--L-QHTITPV--LATLRR------------------ST
A0A3M1TXY5      LAIMLVY-DFFNEKISGDQDI--E-ACTNIPI--LGYIAR--------------------
A0A2E0VQ27      MFYAYLR-SYVKETVSSKDEL--EEKLPQYPI--IGEVYR--------------------
R6U429          FGIFFMI-NQLDTRVKTRNDL--T--NMQVPF--LAEIPQ-------LGQGAGILNKMRK
A0A5C8AF42      LGIMFFK-YLTFNEINMLDDL--K-KLLPSRASILGGVPL--------------------
A0A239K409      LASIFIK-NAFNRKVQQRADV--E-RATTAPV--LGEVSY--------------------
A0A350V3E4      YGFALLR-NILDVSVKSPEDL--E--NIGISL--IGWVPT-------------FMREPKA
A0A1V5S1J9      VAIIVLL-ELMVPYIRTESEV--I-SMAPKQYQLLGVIMH--------------------
A0A0A2EYC8      AALIILK-ELLNNAIRTEKDI--E-KAIKNKFQIIGTVRH--------------------
A0A2G6H6Y4      VVLIVLK-EFMNSAVRTEKDV--D-IATKNRFDIIGSVLH--------------------
A0A1M3DPL8      SVFIILK-ELLNNTIRTSRDV--E-K--MSAFPLIGLVRH--------------------
A0A1V5F519      SLIIVLK-EVLNNTIRSIKDI--E-K--RSVFPVIGMIRH--------------------
A0A2G6R1T9      AIFLIAR-ELLNNTIRGQKDV--E-K--NSKFPIIGNIRH--------------------
A0A1M6MYT6      TGIIILL-DLLNTKILSKDDV--E-ALTDYPI--IGHVFN--------------------
A0A2P8CDS1      AGGIILK-NEFDNKVRTPEDL--E-NLTKYPI--LGHIIH--------------------
A0A353WYK7      FLFIIIR-YLLHNSVSSEKDI--E-HITPTSI--LGSIPF------------------VE
A0A355BP94      FFFISIV-YLLSNKITSLQEI--E-RTIHVPV--LGVIP---------------------
A0A136LSC7      LFFIGLV-YLLNNKITSVKEV--E-RGINLPM--LGAIP---------------------
A0A5C7N8Q5      IFFIGLV-YVLNNKITSVKEV--E-RGINLPM--LGAIP---------------------
A0A2W4RDE8      LGLLILK-DFLNDNIVTHEDL--E-QYTRIPF--LGVVSH--------------------
A0A0L8VEV2      FMVIMLA-TYFYDRIKSAEDI--E-EYTDIPV--IGNIV---------------------
A0A1I2A9Z9      FVVIMLA-TYFYDRIKSAEDI--E-EYSDIPV--IGNIV---------------------
A0A212J9Z9      LCFVVLKEEILNFSITTKEEC--E-KISGFPV--IGTIEN------------------VS
F5IV23          LCFVVLKEEILNFSITTKEEC--E-KISGFPV--IGTIEN------------------VS
F8X2T0          LIFVVVKEEVLNFAITSKEEC--E-KISGLPV--IGTIEN------------------IS
A0A1M3LAG1      LIFVVVKEEVLNFAITSKEEC--E-KISGLPV--IGTIEN------------------IS
A0A212K6G4      LIFVVVKEEVLNFAITSKEEC--E-KISGLPV--IGTIEN------------------IS
A0A4Y9IPG7      LIFVVVKEEVLNFAITSKEEC--E-KISGLPV--IGTIEN------------------IS
A0A2V3PNY7      LLFVIAKEEIFNLVISTKEDC--E-RLSGLPV--IGTIEN------------------IS
A0A6G7WQ31      LAFVVCKEEIFNHAISTKEDC--E-RLSGLPV--IGTIEN------------------IS
A0A6G7X5K8      LAFVVCKEEIFNHAISTKEDC--E-RLSGLPV--IGTIEN------------------IS
A0A1M5DFS8      LIFVICKEELFNYAISTKEDC--E-RLSGLPV--IGTIEN------------------IS
A0A4Y8KZS5      LIFVICKEELFNYAISTKEDC--E-RLSSLPV--IGTIEN------------------IS
A0A142HHS5      LGLIGTR-YLMHNTITSVNEL--E-RNTKASV--LGVIPTYD------------------
A0A660LQT8      FGIFYLR-EMLDTRVRGRRDM--E--NLDIPH--IGEIPHMDASVESWTSKLLVKLGLKK
A0A350PNH9      VVVIFIR-ENMNTTVRGRNDL--K--NITIPF--LGEIPY----CISRKNRPTLLQRIQF
A0A354LNT9      VVVIFIR-ENMNTTVRGRNDL--K--NITIPF--LGEIPY----SISRKNRPTLLQRIQF
A0A2M6GH67      IGLIAAR-YFMHNTITNLGEV--E-RNTKAPV--LGVVPR----YT--------------
A0A389LWV6      IIFIFLKEVLLKTSIQSRSEV--E-KISELPI--LGTI----------------------
A0A1G9B1T9      VGALILA-DMFQDKISSREEV--A-NIISMPL--VGEVPR----L---------------
A0A161LWY6      LLIIILK-EYLKTKVMDKRDI--E-KLSPFPY--IGSLP---------------------
A0A6I3N9U6      LLIIILK-EYLKTKVMDKRDI--E-KLSPFPY--IGSLP---------------------
A0A3D0FMX4      FLFVILR-ELLNNKVRTTREA--E-ALSHYKL--LAQV----------------------
A0A1M3MEI8      AGFVVVK-ELLNVRIMTNRDV--E-KYSSFPL--IGMI----------------------
A0A1J5HQM0      AAFVALR-EFSNGTIRSNKDI--E-KNSKFTM--IGSV----------------------
A0A653AC35      FLIVLLT-ELLNNTIRNAKDV--E-KNSPFSL--IGAV----------------------
E4T131          TFIVILI-ELLNNTVHSTKDV--E-KNSVFPL--IGAV----------------------
A0A521H707      FVIIFVK-YLFYNEITSLDEI--N-LYTNAAL--LGIIPK----Y---------------
A0A1F3D6P8      TTFIFIR-NFFNNKISSIYDL--E-SLINQSG--MGVIFN----N---------------
A0A356Z058      TTFIFIR-NFFNNKISSIYDL--E-SLINQSG--MGVIFN----N---------------
A0A3D1BT36      SLIIILK-DFFNEKITRAYEI--E-DVLGKPV--LSTIYN----N---------------
A0A352ME00      TLYLMIR-DFFDDKIRSINDA--E-YMLHRSV--MSVIYS----N---------------
A0A3D3HL11      TIYIILK-NFFNEKISSVRDV--E-HMIGQPV--MNLIYT----N---------------
A0A5R9QZP0      SIFTLLK-VFFSQKVSSVRDI--E-RVIHQPI--LNLIYT----N---------------
A0A2W7RD29      VIITFLQ-ETVFKKLVDPSEI--E-KLLNIPV--IGSIPV--------------------
A0A3N2NDY8      GVAIYII-SATDTKVRSRKDL--D--RMSAPF--AGEIPF----VGKKSIKDRMARLLPA
D7JEV9          AVLIILK-ELLNNAIRTEKDI--E-RATRNRFPTIGSVR---------------------
A0A4R6H3B7      FVVIMLA-TYFYDRIKSAEDI--E-EYSDIPV--IGNIV---------------------
A0A2W7QSQ0      LGLILVN-YLVTSKVTSKRVI--E-KILNAQI--LGEI----------------------
R7F6L5          SGVYVVK-ANLDNKVRSREDV--E--NIGIPF--IGEIPQ----KGRKKLG---------
A0A553GA49      TIYVLLN-ESYFEKISDIEDY--R-FSFKAPV--LGQI----------------------
A0A497D6F6      ALIILMK-YFSTNKITTVDDI--K-EITNAPV--VGLVFN--------------------
A0A5M4AAB9      STLIIIR-NALDNKVRTLDDL--K-LLTDSPV--LGQIPH--------------------
F4KR18          FFLILVL-ELLKNSVQTEEDL--KSMLPEKTI--MGVINH--------------------
C9LKL0          TLILTIR-RLMDITVSGRHDV--E-EATTIPL--VGELP---------------------
A0A3D0QPV7      SVMIVIR-YLMHNEITTLHEI--T-RISNASLGILGIIPK----Y---------------
A0A496KT23      AAFVFGR-EALNSTVRGRKDL--E-D-YSMPL--VGELPL----KGKKRPVWKRWRK---
L1M9T3          AALIFAR-EGFNTTVRGRKDL--E-D-MSVPL--VGELPF----KGKKRPVWQRWRK---
A0A3C0I8F1      LLLVAIR-YLLNNTVANQKEL--E-KIIIAPV--LGVIPF----HNK-------------
R5JJI4          MIVLWLL-NVTDTKVRTRKEL--D-NILTIPF--LGDIPR----HGT-------------
A0A3D2HF71      GIGILLL-DYFNNKIIDKKDI--E-KRTSAPI--IGFI----------------------
A0A0A2DQN2      AAYAILK-LLTDTKIHSRRDV--V-DQVSLPF--LGEIPL----NTT-------------
A0A0A2F2N5      TAFFLLK-LLADTKVRTRKDV--L-ERVSIPY--LGDIPQ----SDT-------------
L1NGW4          TIGLIIR-LLADNKVRTRKDI--L-DRLTIPF--LGDIPK----EDA-------------
Z4WRA0          TIGLIIR-LLADNKVRTRKDI--L-DRLTIPF--LGDIPK----EDA-------------
U2K8K9          TIFLIVR-LLTDNKVRTRKDI--L-DRLTIPF--LGDIPK----EER-------------
A0A069ZM60      SVYLIIR-LLADNKVRSRKDV--M-DRVSIPF--LGDIPR----EEK-------------
J6GV98          SVYLIIR-LLADNKVRSRKDV--M-DRVSIPF--LGDIPK----EEK-------------
A0A134B4F8      SVYLIIR-LLADNKVRSRKDV--M-DRVSIPF--LGDIPR----EEK-------------
A0A134B8C7      SVYLIIR-LLADNKVRSRKDV--M-DRVSIPF--LGDIPR----EEK-------------
A0A4Z0EKR0      FGGIYTN-NLLDNKVQSQQDV--S-AMTPTPI--LGEI----------------------
A0A229I3A5      MVVIYIR-EKANTTVRGRKDL--K-K-VNVPF--LGEIPF----SISRKNRPTLEQRIKF
A0A3R6HJB3      MVVIYIR-EKANTTVRGRKDL--K-K-VNVPF--LGEIPF----SISRKNRPTLEQRIKF
B5CTK0          AVFLMLL-KMTDTKVRTKKDI--E-NKLSIPF--LGEIPK----Y---------------
A0A1M6B6D5      ILLIFVR-AFFDTKVESVKDL--E-AITPIPM--IGVIGK----N---------------
A0A451FS66      LFIIFGM-AFFDTKVEYVKDL--A-KITPIPL--FGVIGK----N---------------
A0A2E3GN39      LILVVFR-YVTHKEIINIEDI--T-SQTETSL--LGVIQR------------------Y-
A0A3D1MEL0      LILVVFR-YITHKEIINIEDI--T-SQTETSL--LGVIQR------------------Y-
F0R0C9          VVIVFVR-ENMNTKVRGKKDL--E--CLSMPF--AGEIPL----AGESRRKHLFA---S-
A0A2A4N9A6      LITVIFR-YMLHNKISHLSDI--D-RSTNATV--LGIIPQ----F-------------K-
A0A6C0GGI1      AGGILAY-DLVNNTIKSKDDV--R-GVTNIPV--LGLIGH----S-------------D-
A0A368D1N7      LILVVIR-YITHKEIINIEDI--T-SQTETSL--LGIIQR----Y-------------S-
A0A3B8TU58      LILVVFR-YITHKEIINIEDV--T-SQTETAL--LGVIQR----Y-------------S-
A0A1T5IIR6      GVILIAR-LFLDTKIRTRKEI--E-ENIDVPF--LAEIPL----NGTLRGIVFKQGKHK-
A0A3E0QD27      FLIIFVK-YLFYNEITTLDEI--N-LYTDAAL--LGIIPK------------------Y-
A0A0M1W1I6      AIVLLLF-LFFDTRIRNRKDI--E-DVVTVPF--LGEIPK----DSS--------KRKI-
A0A4R4GHU2      AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KRKI-
I8WPR6          AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KRKI-
A0A0K2HKS3      AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KRKI-
B6W3W8          AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KRKI-
A0A4R4GSI6      AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KRKI-
A0A076IRY8      AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KGKT-
A0A3A6AD54      AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KGKT-
A0A3A6MIU7      AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KGKT-
I8WPP8          AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KGKT-
A0A372Y7D2      AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KGKT-
A0A3E4JJC9      AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KGKT-
A0A3E4WDQ0      AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KGKT-
A0A414H9P2      AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KGKT-
C3R5A8          AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KGKT-
A0A1C5XJA7      TVSFLVI-MFMDTRIHSRKDI--L-GAVSVPF--LGEIPL----D-------------K-
A0A3E5BU42      GVVFLMI-LFMDTRVRSRKDL--K-GAVSIPF--LGEIPQ----D-------------K-
R7CUW4          GVGCLLV-LFLDTRVHGRKDI--E-KAVSVPF--LGEIPL----D-------------K-
A0A416GGJ1      GVACLLI-LFLDTRVHGRKDL--E-GVVTAPL--LGEIPL----D----------KKLA-
D1JY72          AIVLLLF-LFFDTRIRNRKDI--E-DAVTVPF--LGEIPK----DSS--------KRKI-
D7J4K6          GVVFLMI-LFMDTRVHSRKDL--K-GAVSIPF--LGEVP-------------------Q-
Q8ABP9          GVVFLMI-LFMDTRVHSRKDL--K-GAVSIPF--LGEVP-------------------Q-
A0A5M6AHF7      GVVFLMI-LFMDTRVHSRKDL--K-GAVSIPF--LGEVP-------------------Q-
D6D2Z5          GVVFLMI-LFMDTRVHSRKDL--K-GAVSIPF--LGEVP-------------------Q-
A0A1T3EDR4      VALLLLR-LFLNTTVKSREEI--E-SALNIPF--LGEIPY----S-------------R-
A0A174SDD8      SVILLLM-LILDTGVHNRKEV--E-SIVSAPF--LADIPQ----T-------------P-
A0A1H7RFH3      SVILLLM-LMLDTGVHNRKEI--E-SIVSAPF--LADIPQ----T-------------P-
A0A139L1N2      SVILLLM-LMLDTGVHNRKEI--E-SIVNAPF--LADIPQ----T-------------P-
A0A174TVL8      SVILLLM-LMLDTGVHNRKEI--E-SIVSAPF--LADIPQ----T-------------P-
A0A1H8BJR6      SVILLLM-LMLDTGVHNRKEI--E-SIVSAPF--LADIPQ----T-------------P-
R9H6G0          SVILLLM-LMLDTGVHNRKEI--E-SIVSAPF--LADIPQ----T-------------P-
A0A412GR09      SVILLLM-LMLDTGVHNRKEI--E-SIVSAPF--LADIPQ----T-------------P-
A0A6I0S0M4      SVILLLM-LMLDTGVHNRKEI--E-SIVNAPF--LADIPQ----T-------------P-
A0A081PBV5      AIVFLLM-LMLDTGVRSRKDI--E-EVLSVPF--LGEIPF----T---------------
A0A1I2AN85      AIVFLLM-LMLDTGVRSRKDI--E-EVLSVPF--LGEIPF----T---------------
A0A4U0GMP3      AVVLLLM-LLLDTGVRNRKDI--E-GAVTTPF--LGEIPF----S------------DK-
A0A1H6CKR6      TAILLLI-LMLNTKIRYRKDI--E-DNISVPL--VGEIPF----S-------------T-
A0A235E1C0      AAILLLM-LLLNTKIRNRKDI--E-DAVSVPF--LAEIPF----S-------------T-
R6D982          TVILLLI-LIVDTRVRNRKDM--E-AVVSAPF--LAEIPK----S-------------A-
A0A1F0I8C4      TVVLLLI-LVLDTRVHSRKEI--E-ASVSAPF--LADIPQ----V-------------S-
A0A3A5RIJ2      TVVLLLI-LVLDTRVHSRKEI--E-ASVSAPF--LADIPQ----V-------------S-
A0A515IZJ5      TVVLLLI-LVLDTRVHSRKEI--E-ASVSAPF--LADIPQ----V-------------S-
A0A5M5NLR3      TVALLLI-LVLDTRVHSRKEI--E-ASVSAPF--LADIPQ----V-------------S-
A0A0D5BSQ0      AVVLLSM-LMLNTGVRGRQDL--E-DVLSVPF--LGEIPL----M-------------R-
A0A1T3F6P5      AVVLLSM-LMLNTGVRGRQDL--E-NVLTVPF--LGEIPL----A-------------K-
A0A0W8EPA0      AVVLLSM-LMLNTGVRGRQDL--E-NVLTVPF--LGEIPL----A-------------R-
A0A365UKN1      AVVLLSM-LMLNTGVRGRQDL--E-NVLTVPF--LGEIPL----A-------------R-
A0A4R6WE41      AVVLLLM-LMLDTGVRSRQDI--Q-KVVTAPF--LGELPM--------------------
A0A2T5RP38      AVILLSM-LVLNTGVRGRQDL--E-NVLSVPF--LGEIPL----A-------------R-
A0A1A6CF06      MIVLLSL-LLLNTAVRGRQDL--E-NVLSVPF--LGEIPL----A-------------R-
A0A1T3D6S8      MIVLLSL-LLLNTAVRGRQDL--E-NVLSVPF--LGEIPL----A-------------R-
A0A1P8E011      AIVIMTL-SILDTGVRRRQDI--E-EAIDVPL--LGEIPL----A-------------T-
A0A1V3N3U3      TVILLFL-LVFNTGVRSRQDV--E-TVLSVPF--LGEIPL----S-------------K-
C2FUH6          AAVLLCL-LIFNTGVRGRQDI--E-SVLDIPF--LGEIPQ----A-------------G-
A0A0B8T471      TVVLLLL-LLLDTKVNGRKDI--E-EAVSVPF--LGEIPF----S-------------K-
A0A4R7D2K0      AVVLLLL-LLLDTKVNGRKDI--E-EAVTVPF--LGEIPF----S-------------R-
A0A2X2J8S4      SLLLILM-LVVDSGVRNRKDL--E-EGLSVPF--LGEIPL----A-------------K-
A0A3C0S618      SVILILL-LIVDSGVRNRKDL--E-DGLSVPF--LGEIPL----A-------------K-
A0A4P7DRF9      AIVLLLM-LLFNTKIRNKRDI--E-SEVSIPF--AGEIPF----S-------------T-
A0A239XXC4      AAILLLM-LLLNTKVRNRKDI--E-DAVSVPF--LAEIPF----S-------------T-
A0A4U9K473      AAILLLM-LLLNTKVRNRKDV--E-DAISVPF--VGEIPF----S-------------T-
A0A3M1Y2F5      AGFLVVL-SYFSDKVSTYQEL--K-KATPIPV--LGTVIKND------------------
A0A1G1TG88      LGLIAVR-YLLHNTITNTREL--E-RSTQAAV--LGVIPTYD-----------KEKM---
A0A661XXA6      FIFIVIS-YLAHDKIDGIADV--E-RNTAATL--LGSVPKYK-----------SAK----
A0A3D4RLG4      LVLSVLI-ELIYNKLRIPKEV--E-RLSSFPL--IGSLRHVRS-----------------
A0A2T2UAJ4      GGLVVLR-EQLDTRIYQPDDL--R-EHGHH-V--LGVVPSMTPLIDDEFGGQETIEI---
A0A6I0DZQ5      AGFVVVK-ELLNVRIMTNRDV--E-KYSSFPL--IGMIRHTNS-----------------
A0A1H6Z2F8      ACVIYVG-QIFNNKITSKDDI--S-RQCDVTI--IGEISQQS-----------RADR---
A0A2P8G5K0      LGVLYTS-QIFNNKITSKEDI--Q-RQCDVMI--LGEISQQS-----------RTGL---
A0A4Q3SEI4      FSFVIIK-ELLTHKVQFRHDI--E-RLTTIPV--VAEVI--------------KVKA---
A0A6A1IRV5      AVGIFMK-ENMNTKVRGRKDL--E-NLS-IPF--IGEIPQYSGTKKKWWEFKHRKRQ---
A0A519SYE7      LGLIATR-YLMHNTITSVQEL--E-RGTRAAV--LGVIPTYD-----------KEKL---
A0A5Q4EKA0      IGVFLLK-YLFYNEIPSLHDI--L-KYTQAPV--IGVIPKY------------KSEI---
A0A3D4CJE1      IGFVVIK-YLFHNEITSVADITQE-GKAKLGV--LGVIPKYK-----------KEIP---
A0A4Q5ZQ60      IVLVTAR-YFLHNTITNLKEL--E-RNTMAPL--LGIVPSYT-----------KEKL---
A0A519Q885      LGLIGVR-YLMHNTVTSVAEL--E-RNTKATV--LGVIPSYT-----------KEQM---
A0A519TAP8      LGLIATR-YLMHNTVTGVAEL--E-RGARAAV--LGVIPTYD-----------KEKL---
R5DEG6          AGILWLL-MVSDTKVRSRKDV--E-GVLSVPF--LGEIPMRD-----------KKDK---
A0A3N2LCI3      FGVVYLM-ESNNTKVRGRKDV--E-H-LAVPF--LGELPQDG-----------HEKK---
A0A642EJV3      IVIIFMR-ENMNTRVRGRKDL--E-N-LTIPF--IGEIPLFT-----------RKKKGIL
A0A6H9Q899      VVIIFMR-ENMNTRVRGRKDL--E-N-VTVPF--IGEIPLFT-----------RKKKGIF
A0A2K8ZAP1      IGVITAK-DTVNNHVLRRSDV--E-EV--TQIPIIGEV--IK------------------
A0A2T4XEQ1      VGLAFGR-EFLNRTIDGLDKL--K-GSGYPILAVIPDFTEYV------------------
A0A348PT57      FLLIGIR-YILNNDISGVHDL--S-RLMNPRISLLGVVPKYS------------------
A0A3D3LSK1      LAFALMR-IYFNKNLSTPEEL--E-SKGVSLLSWIPNIEQIT------------------
A0A496L711      AVLIILK-ELLNNAIRTEKDI--E-RATKNRFQIIGSVRHTK------------------
                                                                            

A0A1T4NDR5      -VENKMLKDLISIY------------DSS-NP-ATEAYRALRTNI--------MYK---N
A0A3D5KRM7      ------QDNRIIMG------------LYN-DQ-RADLFRVLRTNI--------L---KQL
A0A2T2TDL4      -------------------------------------------------------LQLGR
A0A3D1AEJ6      --------------------------------------------M--------DFM--RV
R7JFY1          -ALEKNQEKLVVKE------------GSR-DA-VSEAFRILRANM--------DFM--RG
A0A1V5S5I3      -KKVHNAKKIVIRQ------------GNR-DI-VNEAFRVLRTNL--------EFMLDAK
A0A2M7VVW6      -EIPISQ--LVINR------------DPK-SV-ISEAFRTIRTNL--------QFI--S-
A0A413V760      -NKGEDSDGIVVRE------------NSR-DS-VSEAFRIIRTNM--------DFM--RV
A0A656PYT8      -STRQGS--VVVRD------------NGR-DS-VSEAFRLIRSNL--------GFM--SV
A0A3M1NUH2      ----------------------------M-SP-VVESYRHLRTNI--------QFS-RPD
A0A359ATS6      ----------------------------R-DV-INEAFRVVRTNL--------EFM-DGS
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      --------------------------------------------M--------QFI-ANN
A0A2M7KCE1      ----------------------------------SEAFRSVRSSL--------EFI-KNI
A0A523GUD4      -SPITDIEHLKEAR------------NDT-PG-NAEIMRLLSKLD--------TFR-NGT
A0A6A0Y068      -KKPQEVKAVIVKE------------GNR-DI-INEAFRVLRTNL--------EFM-TGK
A0A641X2Z6      ----METITLIADR------------DAK-SP-VAEAYRTIRTNI--------QFS-NVG
A0A519PJW5      -----------------------------------EAIRSIRTNL--------DFI-SPS
A0A519T3R9      -KEQMSVSRLVVDK------------NPK-SS-VSEAIRSIRTNL--------DFI-SPA
A0A519SD85      DSNDLLSKNLILQE------------APR-SL-FSESLRSLRSNL--------FSLIN--
A0A3M1TXY5      ---YEKSNNYIIEK------------DSR-TS-FAESFRSLRVKM--------LFVVEG-
A0A2E0VQ27      -LTRKTPPGFSLVS------------G------LTANLRDLPKPE--------TK-----
R6U429          KMCDDANTKIVVAP------------SNR-NS-INEAFRVLRTNL--------DFMTGGQ
A0A5C8AF42      FKSEMEFSQLVVHE------------SPK-SM-LAESMRKIRTNL--------SYIK---
A0A239K409      ---NDTKDVIVVSE------------SSK-TA-IAELFRLIRTNL--------QFVVQG-
A0A350V3E4      GRHTHTEQELVLAY------------NSD-SV-PAEAFRTLRTRL--------QFSKLEP
A0A1V5S1J9      -TDRKT--PVIVDK------------YPK-SA-ITEAFRVIRTRI--------EFLSGK-
A0A0A2EYC8      -TKHKADEKVIAAK------------YPN-SY-FVEQLRVIRTKI--------ELILKR-
A0A2G6H6Y4      -TKHKTEDKVIAPK------------YPN-SY-FVEQLRVIRTKV--------EIILGR-
A0A1M3DPL8      -TNSTD--PYLIVN------------NPR-SS-FTEMFRIIRTRI--------EFIAKR-
A0A1V5F519      -AKNDL--PDLTLK------------NPK-SS-FTEMFRVIRTRV--------EFVVRR-
A0A2G6R1T9      -TKKAN--PLLTLK------------HPR-SS-FTEMFRVIRTRI--------EFIVQR-
A0A1M6MYT6      -NRKESESHTLVLD------------KPN-SP-ASEPYSAIRTKL--------ELITKG-
A0A2P8CDS1      -DDQAAISHTALLD------------HPN-SP-VGETYRALRMKL--------KFMLNG-
A0A353WYK7      KLKGRDSDRLVIDK------------VPK-SE-ISEAFRSIRTNL--------EFIKRT-
A0A355BP94      EMRRNTTSPFYIVE------------NPR-SI-VSEAIRTLRTNL--------DFFTSS-
A0A136LSC7      ASHHTVQSLFHVID------------NPK-SI-VSEAIRTLRTNL--------EFFNTG-
A0A5C7N8Q5      ASNHTVQSLFHVID------------NPK-SI-VSEAIRTLRTNL--------EFFNTG-
A0A2W4RDE8      -GSRREQSNVVANA------------LSP----VGESFRSLRVNL--------QYLTLG-
A0A0L8VEV2      -NSGIGSEYLAAID------------NPR-SA-IAESFRELRTNL--------QFIVPGL
A0A1I2A9Z9      -NTGIGAEFLAAID------------NPR-SA-IAESFRELRTNL--------QFVAPKK
A0A212J9Z9      KKLN--NGVVLVKN------------YPK-SS-FAESFRNMRVRI--------EYMAQR-
F5IV23          KKLN--NGVVLVKN------------YPK-SS-FAESFRNMRVRI--------EYMAQR-
F8X2T0          KKLA--GGVVLVKN------------FPK-SS-FAESFRNMRVRI--------EYMAQR-
A0A1M3LAG1      KKLA--GGVVLVKN------------FPK-SS-FAESFRNMRVRI--------EYMAQR-
A0A212K6G4      KKLA--GGVVLVKN------------FPK-SS-FAESFRNMRVRI--------EYMAQR-
A0A4Y9IPG7      KKLA--GGVVLVKN------------FPK-SS-FAESFRNMRVRI--------EYMAQR-
A0A2V3PNY7      KKLSSSGSTTLVKN------------FPK-SS-FAESFRNMRIRI--------EYIAQK-
A0A6G7WQ31      KKISSSGSTTLVKN------------FPK-SS-FAESFRNMRIRI--------EYMAQK-
A0A6G7X5K8      KKISSAGSTTLVKN------------FPK-SS-FAESFRNMRIRI--------EYMAQK-
A0A1M5DFS8      KKMSS-NSTTLVKN------------FPK-SS-FAESFRNMRIRL--------EYMAQK-
A0A4Y8KZS5      KKMPS-GNTTLVKN------------FPK-SS-FAESFRNMRIRL--------EYMAQK-
A0A142HHS5      -KEQLNISRLIVDK------------NPK-SS-VSEAIRSIRTNL--------DFISPS-
A0A660LQT8      LPQRLDKNEVVVKP------------QNA-NI-INEAFRVLRSNF--------EFCTNKF
A0A350PNH9      WKKPKETLQIVVKA------------GKR-DI-VNEAFRVLRTNL--------EFMIGTH
A0A354LNT9      WKKPKETRQIVVKA------------GKR-DI-VNEAFRVLRTNL--------EFMIGTH
A0A2M6GH67      -KEKLLVSKLIVHK------------NPK-SA-ISESIRSIRTNL--------DFISSA-
A0A389LWV6      -EHTERKEMMVLYK------------YPK-SS-FAENFRHLRSRM--------IYLTKR-
A0A1G9B1T9      ----RRKENALVYS------------RPR-SA-AAESFRTIRSNL--------LLQNHVN
A0A161LWY6      -HATHDDATITVLK------------RPK-SA-IAEAYRMVRTRI--------KFVSRQ-
A0A6I3N9U6      -HATHDDATITVLK------------RPK-SA-IAEAYRMVRTRI--------KFVSRQ-
A0A3D0FMX4      -RHTRGSNPTEVVD------------HPR-SS-YAEQLRALRTRI--------EFVVRR-
A0A1M3MEI8      -RHTNSDNPFIVAA------------NPR-SS-FTEMFRIIRTRI--------EFITQR-
A0A1J5HQM0      -RHTNSNDPLITIN------------NPR-SA-FTEMFRVIRTRI--------EFIVQR-
A0A653AC35      -RHTQNKDPMLAAH------------RPR-SS-FTEMFRVIRTRI--------EFIVQR-
E4T131          -RHTKSTDPLVVSK------------NPR-SA-YTEMFRIIRTRI--------EFIVQR-
A0A521H707      -KSEIPVSQLLVDK------------NPK-SA-ISESFRSVRTNL--------QFISNE-
A0A1F3D6P8      -NYK---SEAVVLE------------APK-SA-IAESFRNLRSSL--------FLKLKS-
A0A356Z058      -NYK---SEAVVLE------------APK-SA-IAESFRNLRSSL--------FLKLKS-
A0A3D1BT36      -SFK---YEDVVHK------------AVG-SP-IAESFRNLRSNL--------FFRSKT-
A0A352ME00      -NLK---SEAVVAE------------FPK-SA-ISESFRNLRSSL--------FLKSDH-
A0A3D3HL11      -FYK---TESVVKD------------YPG-SS-IAESFRNLRSSL--------FLKFRS-
A0A5R9QZP0      -YHN---TENVNTE------------FPN-SS-LAESFRNLRTNI--------FLKFKS-
A0A2W7RD29      -AEGKTNVQLVDYP------------NSK----VAESFRLLRTNL--------NFILPN-
A0A3N2NDY8      KKNSKELERVVVAV------------KEGSRDAVSESFRIVRGNI--------DFMIRGK
D7JEV9          -HTKHKADERVIAS------------KYP-NSYFVEQLRVIRTKI--------EFILKR-
A0A4R6H3B7      -NTGIGAEFLAAID------------NPR-SA-IAESFRELRTNL--------QFVAPKK
A0A2W7QSQ0      -AKNDQNGVIAISP------------KSI-SP-AAEQLRMIRSNL--------KFQSG--
R7F6L5          -KDSSSERQVVVRA------------DST-NV-INEAFRVVRTNL--------DFFLTSD
A0A553GA49      -TLCSNGSKKIFEP------------SNE-DAVVAESFRKLRTNL--------GFWPWKD
A0A497D6F6      -TRKDYKGNTLILD------------KPG-SP-ASEQYRSVKNKI--------NFISGK-
A0A5M4AAB9      -DEQVLPSQIPLLE------------HPN-SP-LGESYRALRTKL--------KFIQNG-
F4KR18          -QKG--KKQHSLLS------------KSQ-NT-LTERFRTLRTNL--------QFHQRE-
C9LKL0          -TWEEGGDDGLITT------------CSS-DAPIVEAFRMLRYGL--------NFMR---
A0A3D0QPV7      -KEDIPVSQLIVDK------------NPK-SL-ISEAFRTIRTNM--------QFLTAD-
A0A496KT23      -EKIVAAPNMVVAD------------QKR-DI-LNEAFRTVRTKL--------EFTLGFD
L1M9T3          -QTIVAQPNMVVAD------------QQR-DI-INEAFRTVRTKL--------EFSMGFD
A0A3C0I8F1      -QKNAKYSKLVILD------------NPK-ST-INEALRSVRTNL--------DFVLNKS
R5JJI4          -RKGEDTDAIVVHE------------SGR-DS-VSEAFRIIRTNM--------EFMRVKS
A0A3D2HF71      -GHNTFKTDLPAVE------------HTG-SS-LAESLRSVRTNL--------KYFMKD-
A0A0A2DQN2      -KKGG--EGIGVSE------------QGT-DL-TSEAFRILRSNM--------DFM-GQN
A0A0A2F2N5      -N-----LFVAVEP------------QGS-DA-ITEAFRVLRTNM--------GFMKKYG
L1NGW4          -PGRK--QPRGARE------------QGS-DE-TSESFRVLRENL--------RFMIGSG
Z4WRA0          -PGRK--QPRGARE------------QGS-DE-TSESFRVLRENL--------RFMIGSG
U2K8K9          ---AKSGHTRGVRE------------QGG-DE-TSEAFRVLRENM--------RFMIGSA
A0A069ZM60      -RGGKKSQPRGVRE------------QGG-DE-TSEAFRVLRENM--------RFMIGTG
J6GV98          -RGGKKAQPRGVRE------------QGS-DE-TSEAFRVLRENM--------RFMIGTG
A0A134B4F8      -RGGKKSQPRGVRE------------QGS-DE-TSEAFRVLRENM--------RFMIGTG
A0A134B8C7      -RGGKKSQPRGVRE------------QGS-DE-TSEAFRVLRENM--------RFMIGTG
A0A4Z0EKR0      -SHNNSNESVVVTN------------GNR-SP-IAEMFRLIRTNL--------HFAAVG-
A0A229I3A5      WKKPKEVRMIVVKA------------GKR-DI-VNEAFRVLRTNF--------EFTIGTH
A0A3R6HJB3      WKKPKEVRMIVVKA------------GKR-DI-VNEAFRVLRTNF--------EFTIGTH
B5CTK0          ----QGKDDIIIHE------------NGR-DS-ISEAFRIIRTNM--------DFMRMKK
A0A1M6B6D5      ----HSETVLAVLS------------KPK-SA-IAEAFRSLRSSL--------QFLYKQQ
A0A451FS66      ----HSGNILAVLS------------HPK-SA-IAEAFRSLRSSL--------QFLYKQH
A0A2E3GN39      -SEKLPMSSIVVTN------------RPK-SG-ISESFRGVRSNL--------EFLD-AD
A0A3D1MEL0      -SEKLPMSSIVVTN------------RPK-SG-ISESFRGVRSNL--------EFLE-AE
F0R0C9          -KTYDAPRGIVVKQ------------GKR-NI-INEAFRVLRTNL--------EFMTSEN
A0A2A4N9A6      -REEMPISQLVVEK------------NPK-AG-ITEALRSLRANL--------QFIS-TN
A0A6C0GGI1      --GKNGI--LAKTD------------NHK-SA-LSEAFRSLRVNL--------QYLA-AG
A0A368D1N7      --EKLPVSSIVVTN------------RPK-SG-ISESFRGVRSNL--------EFLE-EE
A0A3B8TU58      --EKLPMSSIVVTN------------RPK-SG-ISESFRGVRSNL--------EFLA-AE
A0A1T5IIR6      -QGHDDPSPFVYDP------------TSH-TV-FTEAMRMLCTNL--------SFLDSGK
A0A3E0QD27      -KNEIPVSQLLVDK------------NPK-SA-ISESFRSVRTNL--------QFIS-NE
A0A0M1W1I6      -ENKKTAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
A0A4R4GHU2      -ENKKTAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
I8WPR6          -ENKKTAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
A0A0K2HKS3      -ENKKTAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
B6W3W8          -ENKKTAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
A0A4R4GSI6      -ENKKTAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
A0A076IRY8      -ENKETAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
A0A3A6AD54      -ENKETAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
A0A3A6MIU7      -ENKETAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
I8WPP8          -ENKETAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
A0A372Y7D2      -ENKETAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
A0A3E4JJC9      -ENKETAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
A0A3E4WDQ0      -ENKETAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
A0A414H9P2      -ENKETAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
C3R5A8          -ENKETAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
A0A1C5XJA7      -N-YKSSRKGAANA------------YGYGDNVVTEAFRILRTNM--------SFMAKKD
A0A3E5BU42      -EAAK-----TGVA------------VGRDDGMLSESFRILRTNM--------AFMAKKD
R7CUW4          -EAARQHGRTAKAS------------VGQDDSIVSEAFRILRTNM--------AFMSRKD
A0A416GGJ1      -KKKKTVHGPRLFL------------DKQDDI-IAEAFRILRTNM--------AFMAKKG
D1JY72          -ENKKTAHGIAVRA------------QGR-DI-VSEAFRIIRTNM--------DFMRVKS
D7J4K6          -DKEAAKAGVAVGE------------ED--GM-LAESFRILRTNM--------TFMVKKD
Q8ABP9          -DKEAAKAGVAVGE------------ED--GM-LAESFRILRTNM--------TFMVKKD
A0A5M6AHF7      -DKEAAKAGVAVGE------------ED--GM-LAESFRILRTNM--------TFMVKKD
D6D2Z5          -DKEAAKAGVAVGE------------ED--GM-LAESFRILRTNM--------TFMVKKD
A0A1T3EDR4      -SKSESGMGVFVYH------------TGK-DA-LSEAFRILRTNI--------TFMVNSG
A0A174SDD8      -KAMANVHEVVGRA------------RGL-DA-LSESFRILRTNL--------GFMLSQT
A0A1H7RFH3      -KAMANVHEVVVRA------------RGL-DA-LSESFRILRTNL--------GFMLSQT
A0A139L1N2      -KAMANVHEVVVRA------------RGL-DA-LSESFRILRTNL--------GFMLSQT
A0A174TVL8      -KAMANVHEVVVRA------------RGL-DA-LSESFRILRTNL--------GFMLSQT
A0A1H8BJR6      -KAMANVHEVVVRA------------RGL-DA-LSESFRILRTNL--------GFMLSQT
R9H6G0          -KAMANVHEVVVRA------------RGL-DA-LSESFRILRTNL--------GFMLSQT
A0A412GR09      -KAMANVHEVVVRA------------RGL-DA-LSESFRILRTNL--------GFMLSQT
A0A6I0S0M4      -KAMANVHEVVVRA------------RGL-DA-LSESFRILRTNL--------GFMLSQT
A0A081PBV5      --LKDKGGEAVVEE------------KGR-DY-TSEAFRILRTNI--------GFMA-AG
A0A1I2AN85      --LKDKGGEAVVEE------------KGR-DY-TSEAFRILRTNI--------GFMA-AG
A0A4U0GMP3      -RRRSKEGNLVIEA------------QGG-DP-VTEAFRILRTNI--------GFMASAD
A0A1H6CKR6      -DLKTAKSDIVIKE------------QGT-DE-VTEAFRIFRTNL--------GFMSAGD
A0A235E1C0      -EMKSAKSEIVIKE------------QGV-DE-VTEAFRIFRTNL--------SFMSSGD
R6D982          -EKVTEINDIMVRA------------RGQ-DA-LSESFRILRTNL--------GFVASQS
A0A1F0I8C4      -KTEADAQEVMVRA------------RGL-DP-LSEAFRILRTNL--------GFMISQP
A0A3A5RIJ2      -KTEADAQEVMVRA------------RGL-DP-LSEAFRILRTNL--------GFMISQP
A0A515IZJ5      -KTEADAQEVMVRA------------RGL-DP-LSEAFRILRTNL--------GFMISQP
A0A5M5NLR3      -KTEADAQEVMVRA------------RGL-DP-LSEAFRILRTNL--------GFMISQP
A0A0D5BSQ0      -SRKQGKSDVLVSK------------SGR-DP-LTEAFRILRTNI--------NFMAKNG
A0A1T3F6P5      -GRRQGNGDILVSQ------------SGR-DP-LTEAFRILRTNI--------NFMTKDE
A0A0W8EPA0      -GRRQGNGDVLVSQ------------SGR-DP-LTEAFRILRTNI--------NFMTKDE
A0A365UKN1      -GRKQGNGDVLVSQ------------SGR-DP-LTEAFRILRTNI--------NFMTKNE
A0A4R6WE41      -EKKYDDKGIAVSK------------TGR-DP-LTEAFRILRTNI--------NFMAING
A0A2T5RP38      -GRRQGKGDILVSG------------SGR-DP-LTEAFRILRTNI--------NFMTKDD
A0A1A6CF06      -SRRQGKGDILVSK------------TGR-DP-LTEAFRILRTNI--------NFMTKDE
A0A1T3D6S8      -NRRQGNGDVLVSQ------------SGR-DP-LTEAFRILRTNI--------NFMTKDE
A0A1P8E011      -NKRTSQNNILVSA------------MGR-DP-LTEAFRILRTNM--------SFMAREG
A0A1V3N3U3      -RKSEQHAVFRVEK------------TGR-DP-LTEAFRILRTNI--------NFMSREG
C2FUH6          -KRKTDSNKVLVSK------------TGR-DV-LTEAFRIIRTNI--------GFMSRNG
A0A0B8T471      -QTIRANDDVVVNE------------QGR-DP-ATEAFRILRTNI--------GFMSSAE
A0A4R7D2K0      -QTMRANDDVVVNE------------QGR-DP-ATEAFRILRTNI--------GFMSSAE
A0A2X2J8S4      -KNKHTVGNVSVSQ------------TGR-DA-LTEAFRILRTNI--------NFMSRGG
A0A3C0S618      -KNKHTVGNVSVSQ------------TGR-DA-LTEAFRILRTNI--------NFMSRGG
A0A4P7DRF9      -DMQSAKQEVVVKE------------QGT-DE-VTEAFRIFRTNL--------GFMSSGD
A0A239XXC4      -EMKTAKSDIVIKE------------QGV-DE-VTEAFRIFRTNL--------SFMSSGD
A0A4U9K473      -EMKSAKSEIVIKE------------QGV-DE-VTEAFRIFRTNL--------SFMSSGD
A0A3M1Y2F5      -----DGLEVIKQS------------TSY-SP-LAECFRAVRVHIYNKLTNKREKIDVSE
A0A1G1TG88      -----EVSRLVVND------------NPK-SA-ISEAIRSIRTNL--------DFISSAK
A0A661XXA6      -----EHAKIIVNE------------HPK-SA-LSESMRSIRTNM--------QFMLPET
A0A3D4RLG4      ------QNPTLVQK------------NPR-SS-YTEMLRTIRTKI--------EFIVGRK
A0A2T2UAJ4      -DGRSVNTLLAMLV------------SPM-SA-AAEAYRRIRTNL--------RFAKPDD
A0A6I0DZQ5      ------DNPFIVAA------------NPR-SS-FTEMFRIIRTRI--------EFITQRK
A0A1H6Z2F8      ----------LSRN------------NVR-SL-LREQFRSLRTNI--------QFVVGER
A0A2P8G5K0      ----------LKVA------------DNR-SL-IKEQFRSLRTNI--------QFTTGER
A0A4Q3SEI4      -----KTADVYNNT------------KRQ-LS-FIEQFRQLRASV--------A-LNGRK
A0A6A1IRV5      -----DMKIIVVNE------------GNR-NI-INEAFRVLRSNM--------DFMASKD
A0A519SYE7      -----EVSRLIVDK------------NPK-SS-VSEAIRSIRTNL--------DFI-SPA
A0A5Q4EKA0      -----PPNQLLVLK------------KPK-SL-ISESLRAIRTNL--------QFI-NND
A0A3D4CJE1      ------VSQLIIDK------------NPK-SV-ISESFRTIRANL--------QFISNKP
A0A4Q5ZQ60      -----PVSRLIVDL------------SPK-SA-ISESIRSIRTNL--------EFISSSA
A0A519Q885      -----SISRLVVDK------------NPK-AS-VSEAIRSIRTNM--------EFINAAN
A0A519TAP8      -----EVSRLVVDK------------NPK-AS-VSEAIRSIRTNL--------DFISPSN
R5DEG6          -------NEVVVHE------------NGR-DS-VSEAFRIVRTNM--------DFMRVKE
A0A3N2LCI3      -KEAGEANTIVVKG------------GKL-DI-INEAFRVLRTNV--------EFMCNSS
A0A642EJV3      GKKPQEVKAVIVKE------------GNR-DI-INEAFRVLRTNL--------EFMTGKD
A0A6H9Q899      GKKPQEVKAVVVKE------------GSR-DI-INEAFRVLRTNL--------EFMTGKD
A0A2K8ZAP1      -ERQLGTESFVFKS------------RMH-SV-IGEQIRALRTNL--------LFLNGDA
A0A2T4XEQ1      -KKKYEEKSKVAVKGRLVSTNWFSLLDNI-SP-VTESYRRLHNNI--------IYS-QPD
A0A348PT57      --KNIPLSQLIIDK------------NPK-SV-MAEAFRTLRTNL--------DFF-QTD
A0A3D3LSK1      -DKSDPTNDFIVAK------------KPS-SQ-ISEAFKALRTRI--------TFSKLED
A0A496L711      -HKAD--ERVIASK------------YPN-SY-FVEQLRVIRTKI--------EFI-LKR
                                                                            

A0A1T4NDR5      FD----APIKVINITSATQGEGKSTTCLNLAVVFSQLNKK-VLVMDLDLRIPTIHKKLRI
A0A3D5KRM7      RE----NNWNSFFITSATPGAGKSWVATNLAIAIALEGNQTVLLVDADLRHPSICNHLGL
A0A2T2TDL4      PD----ETNTTVLVTSPGSGDGKSLTAANLATVTAQAGHS-TLLIDGDLRRPRLHEVFDV
A0A3D1AEJ6      KQ----DNIKVITTTSTSVGSGKTFVSSNLAASLAMTGKK-VLLMDMDIRKGTLGKGVDT
R7JFY1          GD----EHMQVLLFTSMNAGAGKTFISSNLAASLVLTHQK-VVLLDLDIRKGTLGKQAGY
A0A1V5S5I3      TG----GKAGVTLFTSFNPGSGKTFLAMNTAAVFALKGKR-ILVIDGDLRHGSASAYLGS
A0A2M7VVW6      KS----EESKLMAITSTISGEGKTFCAINLSGIIAMSGKK-VIILDLDMRKPKIHLGFGV
A0A413V760      KA----ANLQVVMFTSANPGAGKTFVSSNLAMSIAQTNKK-VVLVDVDIRKGTLSGIFSN
A0A656PYT8      KS----GKLQIIMVTSSNPHAGKTFVTTNLAMTLALADKK-VVIVDLDLRRRTLSKQMGQ
A0A3M1NUH2      TV----V--ETIVVTSPSVEEGKSTTAANLAVVMAEAGRR-TVLIDADLRRPRVHQLFGR
A0A359ATS6      GE----PDSNVLMLTSFNPGSGKTFLTMNMAISLAIKGKS-VLVIDGDLRRGSISDYVDT
A0A1V6HYH8      -------------MTSTISGEGKTFVAINLGGILALSNKK-VLIIDTDLRRPKMSITFNN
A0A2E0MDX6      EG----S--KIITVTSTISGEGKTFVAINLGGIIAFSEKK-VIILDLDMRKPKTHIGFNV
A0A2M7KCE1      KE----S--KTIAISSTISGEGKTFIALNLGGIYSFQGKK-TILIDLDLRKPRFHLCFNT
A0A523GUD4      HK-------QTVMITSALSGEGKSTISTNIAIASSRNRQRPSLIIDFDLRRPRLHHIFKV
A0A6A0Y068      DK----T-SNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKK-VLVIDGDLRHASASSYIDS
A0A641X2Z6      QE----L--KTIIVTSATPNEGKSTTISNLAVVMAQAGHK-VLLMDCDMRNPTQHKLFKL
A0A519PJW5      NK----K--RLISVTSTISGEGKTFVTVNLGGIIALSGQR-VIILDLDMRKPKVNLAFDA
A0A519T3R9      SK----K--RLISITSTISGEGKTFVTVNLAGIIALSGQR-VVVLDLDMRKPKVNLAFGA
A0A519SD85      ------KDCNMICITSEISGEGKSLISKNLAYAFAITGKK-VILVDADLRKPKLHESFNT
A0A3M1TXY5      ------DKKKVIGVTSSSSGEGKTFCATNLAATLAHAGKQ-TLLIDTDLRRPKVQTYFRT
A0A2E0VQ27      ------GQAQLFVLSSNMPNEGKTFVSARIAKAMAAYGYK-VLLLDLDVRKPELHEELGM
R6U429          ------EGCHKVMITSFNPTAGKTFVLMNMAATMALKGAK-VLLLDLDLRKGTLGKALEH
A0A5C8AF42      ------PDYKTIAISSSISGEGKTFVALNLAGIIAMSGKK-TILLDLDLRKPKVHLGLNT
A0A239K409      ------GERKVILVTSSVSGEGKTFFSLNLGASLALTGKN-VVVLDFDLRKQSILADLGL
A0A350V3E4      ------EPIKTILITSSIPREGKTIISSNLAASFALSS-R-VLLLDCDFRKPRMHNIFNM
A0A1V5S1J9      ------SKGISVMVTSSQSGDGKSYISANIAGVFAMTGRK-TILVDLDMRKPSINTGL--
A0A0A2EYC8      ------KERITMLVSSTESGDGKTYISLNLAGVFALQKKK-VLLIDFDIRKPNLTRNLGD
A0A2G6H6Y4      ------KEAITMLISSTESGDGKTYMSLNLAGVFGLQNKK-VLLIDFDIRKPNLTENLQE
A0A1M3DPL8      ------KTDITIMVTSSESGDGKTYFCINLACIYAMASPK-TLLVDMDIRKPSVYQTI--
A0A1V5F519      ------KTDIVMMVTSVDAGDGKTFFSTNMAGVYGMTGHK-TLLIDMDIRKPAINRRF--
A0A2G6R1T9      ------KTGIMMLGTSTESGDGKTYVNINLASVYGMTGKK-TLLIDMDIRKPSVGDRL--
A0A1M6MYT6      ------KEHAVIAVTSSFPSEGKTYNAINIASSVALSNKT-AVILDLDLRKSRINEDIGL
A0A2P8CDS1      ------TEQPVIAVTSTGSDEGKTFTAMNLAASFALLGQK-AVLLDLDLRNSKMAEMHNY
A0A353WYK7      ------DKNTVIAITSTVSGEGKTFVTVNLGGVISLLKSK-VVLVDLDMRKPRLQKVFYH
A0A355BP94      ------ETNKIIVISSTVSGEGKSFLAMNLGGILAMSNKK-VILLDLDMRKAKEILHARV
A0A136LSC7      ------EKCKVITITSTVSGEGKSFLAMNLGGVLALSRKR-VILVDLDMRKPKSEKYPTG
A0A5C7N8Q5      ------EKSKVITITSTISGEGKSFLAMNLGGVLALSRKR-VVLVDLDMRKPKSEKYPTG
A0A2W4RDE8      ------KEVNVIGITSSRESEGKTYCSVNLAAAMANSRRR-TILIDADMRRPKVASYFQL
A0A0L8VEV2      K-----NKSLVIGVNSVIPGEGKSFTAANLASMIALNNKR-VLLIDCDLRKPSLHNRLKY
A0A1I2A9Z9      N-----NECTIIGVNSVISGEGKSFTSANLASMIALNNKK-VLLVDCDLRKPSLHNRLKY
A0A212J9Z9      ------ENKITVLVTSTEPADGKTFIATNIASVYQLMGKK-VIIVDLDLRRPSVAKTLQI
F5IV23          ------ENKITVLVTSTEPADGKTFIATNIASVYQLMGKK-VIIVDLDLRRPSVAKTLQI
F8X2T0          ------ENKITILVTSTEPADGKTFIATNVASVYQLMGKK-VIIVDLDLRRPSVGKTLQV
A0A1M3LAG1      ------ENKITILVTSTEPADGKTFIATNVASVYQLMGKK-VIIVDLDLRRPSVGKTLQI
A0A212K6G4      ------ENKITILVTSTEPADGKTFIATNVASVYQLMGKK-VIIVDLDLRRPSVGKTLQI
A0A4Y9IPG7      ------ENKITILVTSTEPADGKTFIATNVASVYQLMGKK-VIIVDLDLRRPSVGKTLQI
A0A2V3PNY7      ------ETGISTLITSAEPGDGKTFIAGNIASVYQLTGKK-VVLIDFDLRRPSVGKLLSI
A0A6G7WQ31      ------ESGISILITSAEPGDGKTFIAGNVASVYQLTGKK-VVLIDFDLRRPSVAKLLNI
A0A6G7X5K8      ------ESGISILITSAEPGDGKTFIAGNVASVYQLTGKK-VVLIDFDLRRPSVAKLLNI
A0A1M5DFS8      ------ETGISVLVTSAEPGDGKTFIAGNIASVYQLTGRR-VVLIDFDLRRPSVAKLLNL
A0A4Y8KZS5      ------ETGISLLVTSAEPGDGKTFIAGNIASVYQLTGRR-VVLIDFDLRRPSVAKLLNT
A0A142HHS5      ------NKKRLISVTSTISGEGKTFVTVNLGGIIALSGQR-VVILDLDMRKPKVNLAFDA
A0A660LQT8      ------GKGAVTMVVSANPNSGKTFVTMNLAMSMVIKNKK-AVVVDLDLRKAATSLFVGR
A0A350PNH9      ------PEQNVIILTSFNPGSGKSHLAGNIAMSLAIKKKK-VLVIDGDLRRGATSMLVGS
A0A354LNT9      ------PEQNVIILTSFNPGSGKSHLAGNIAMSLAIKKKK-VLVIDGDLRLGSTSMLVGS
A0A2M6GH67      ------KKKRLISITSTVSGEGKTFVAVNLGGIIALSDQK-VVILDLDLRRPKVNLAFDA
A0A389LWV6      ------DSPIVMLITSTEPRDGKTFVACNLASAYQMTGKK-TLMIDFDLRRPALSKALDL
A0A1G9B1T9      ------GASKTLLVTSSVSNEGKTLCSVNLASSFAVANNR-TIIIDADLRRPRVHNILEK
A0A161LWY6      ------MDASCVIVTSTESGDGKTHFCLNYASMCAMTGEP-TILVDMDLRKPSVSKRLSL
A0A6I3N9U6      ------MDASCVIVTSTESGDGKTHFCLNYASMCAMTGEP-TILVDMDLRKPSVSKRLSL
A0A3D0FMX4      ------KTGIMVLTTSAQSGDGKTYLSTNLAALYAMSGKK-TLLMDMDIRKPNIHEKLGT
A0A1M3MEI8      ------KDKITIMVTSSESGDGKTYFSLNLASVYGLASPR-TLLVDLDIRKPSIHKRLGV
A0A1J5HQM0      ------KKNIMVAVTSSESGDGKTYFSINMAGVYSMASKK-VLLVDLDIRKPSIHERFNI
A0A653AC35      ------KTNISILTTSAESGDGKTYFCTNLASVYAMSGLK-TILVDMDIRKPSINERLSI
E4T131          ------KTNIIVMTTSTESGDGKTYFSINLASVYAMASKK-TILVDMDIRKPSVNQRFNI
A0A521H707      ------SGPKVIAITSTISGEGKTFIAINLAGVIAFSEKK-VVIIDLDMRKPKIHLGFNV
A0A1F3D6P8      ------EKSKVIVITSSQPKDGKSFISFNLAASIAIVGYK-TIIIDCDLRKPTLHEKFKE
A0A356Z058      ------EKSKVIVITSSQPKDGKSFISFNLAASIAIVGYK-TIIIDCDLRKPTLHEKFKE
A0A3D1BT36      ------NPLKVILVTSCQPQDGKSFVAMNLASSIASVGHK-TIILDCDLRRPTLHDKFKI
A0A352ME00      ------EKSKVILITSSQPQDGKSFVSLNLSSSIASVGYK-TVLIDCDLRRPTLHIKLKE
A0A3D3HL11      ------EPQKVIMITSAQPQDGKSFVSSNLAASIASVGHK-TVLLDCDLRRPTLHEKLKI
A0A5R9QZP0      ------KPLKVILVTSALPQDGKSFIAFNLATAIAAVGHK-TIIIDCDLRKPTLHMKLKK
A0A2W7RD29      ------SESTVLLVSSVLPAEGKSFTSVNLATAFALTELK-VLIIDCDLRKPKVSDYLGV
A0A3N2NDY8      ------EGGNVIMITSFNPGSGKSFISFNLSASFALKGKK-VLVVDGDLRHGSASQFVDM
D7JEV9          ------KEKITVLISSTESGDGKTYISLNLAGVFALQNKK-ILLIDFDIRKPNLTKNLGG
A0A4R6H3B7      N-----NECTIIGVNSVISGEGKSFTSANLASMIALNNKK-VLLVDCDLRKPSLHNRLKY
A0A2W7QSQ0      ------DNNKVILVSSSMSGEGKTFFCLNLAATLSIVDKK-VVVVDLDLRRPSIFKSLNI
R7F6L5          K-----KGAQVIMVTSANPGSGKTFITMNLAVALALKHKR-VLMIDFDLRRAALSNAFGS
A0A553GA49      T-----LEGRVVLFTSTMPGEGKTFCSYNLAQSLASLGKK-TVILDFDLRKGDLSENYFK
A0A497D6F6      ------KSNPVIAFTSSIANEGKSFSALNIASLYALSKKK-TVLLDLDLRMSSMAKNLEL
A0A5M4AAB9      ------NEHNVIAVTSTAAGEGKTFTALNLAASFALLGKK-TVFLDLDLRNSRIGKKMGY
F4KR18          ------KTKSIL-VTSSTSDEGKTFVATNLAMSFALAKKK-TIVVDFDLRKPSISKYFEG
C9LKL0          ------HSAKVCVVTSSTPGQGKSFISRNLAAIMGMANKR-VLLVDADIRKRTLSSKFGR
A0A3D0QPV7      ------KDAKLVSVTSTISGEGKTFVAINLAGMIAFSGKK-VVILDLDMRKPKIHIGFGT
A0A496KT23      ------GRNKVVMLSSLNPGSGKTFITANLSAAFSLKGKR-VLVMDLDLRKASLSDYVGQ
L1M9T3          ------NGCKVIMVTSMNPGSGKTFITANLSTAYALKGKR-VLVMDLDLRKASLSQYVGN
A0A3C0I8F1      GGLNDTSTSKVISITSTISGEGKTFVAANLAGIIAMLNLK-VLIIDFDMRRPKVHIAFDR
R5JJI4          ------DNLQVVMFTSANPGAGKTFVSSNLAMSIAQTNKK-VVLVDVDIRKGTLSGIFSN
A0A3D2HF71      ------ISNPVIAVSSTITGEGKTFVAVNLAAIIALPGKK-VLLIDLDLRKPKAHKILGN
A0A0A2DQN2      G-----VMPKRIVLTSFGAEAGKSYISYNLAKSLVFAGKS-VVLIDIDIRKRTLTRKLNF
A0A0A2F2N5      R-----TSGQRIMCVSFGANAGKTFTTYNLARSLIFADKK-VVIVDLDLRKGMMSKRLEM
L1NGW4          D-----TPSKKIIFTSFGESAGKSYVSYNLAKTLTFSGST-VVIVDLDLRKGTLSRRAHV
Z4WRA0          D-----TPSKKIIFTSFGESAGKSYVSYNLAKTLTFSGST-VVVVDLDLRKGTLSRRAHV
U2K8K9          A-----GKTKKIIFTSFGESAGKSYVSYNLAKTLTFSGHR-VVLVDLDLRKGTLSHRAGI
A0A069ZM60      G-----KKAKKVIFTSFGESAGKSYVSYNLAQTLTFAGHS-VVLVDLDLRKGTLSRRIGL
J6GV98          G-----KKAKKVIFTSFGESAGKSYVSYNLAQTLTFAGHS-VVLVDLDLRKGTLSRRIGL
A0A134B4F8      G-----KVAKKVIFTSFGESAGKSYVSYNLAQTLTFAGHS-VVLVDLDLRKGTLSRRIGL
A0A134B8C7      G-----KVAKKVIFTSFGESAGKSYVSYNLAQTLTFAGHS-VVLVDLDLRKGTLSRRIGL
A0A4Z0EKR0      ------RKKTVFLITSSMSGEGKTFFSINLGASLAITDKR-TLLLDLDLRNPKVAQRLAL
A0A229I3A5      ------PEQNVIVFTSFNPGSGKSHIAANMAMSLAIKKKK-VLLIDGDLRHGSTSMLIHS
A0A3R6HJB3      ------PEQNVIVFTSFNPGSGKSHIAANMAMSLAIKKKK-VLLIDGDLRHGSTSMLIHS
B5CTK0          ------DNMKVVTFTSMMPGAGKTFVSMNLALSFALTDKK-IILMDLDIRKGTLSAHSKR
A0A1M6B6D5      G----ITGAKTVLLTSSVSGEGKTFCSINLASIFALSDKK-TIIIDLDLRKPKVGAAFNI
A0A451FS66      G----VTGAKTVLFTSSVSGEGKTFCSINIASIFALSEKR-TVIVDLDLRKPKVSGAFNM
A0A2E3GN39      ------KGFRSIAVTSTIPGEGKTFVAINLAAIIAMQGKR-VLLVDVDLRKPRIHKIFDL
A0A3D1MEL0      ------KGFRSIAVTSTIPGEGKTFVAINLAAIIAMQGKR-VLLVDVDLRKPRIHKIFDL
F0R0C9          ------EKANVILLTSFNPGSGKTFLSLNIAGSLALKGKK-VLIIDGDLRKASVSAFIDS
A0A2A4N9A6      ------PGPKIMAITSTISTEGKTFVAINMAGIIALSGKK-VIILDLDLRKPRIHKAFEI
A0A6C0GGI1      ------MDQKAIGITSSVSGEGKTFCAINLSTVLALSGKR-TVLIDVDLRKPKVAAYLGL
A0A368D1N7      ------KGFRSIAVTSTIPGEGKTFVAINLAAIIAMQGKR-VLLVDVDLRKPRIHKIFDL
A0A3B8TU58      ------KNFRSIAVTSTIPGEGKTFVAINLAAIIAMQGKR-VLLVDVDLRKPRVHKIFNL
A0A1T5IIR6      ------KAPFVIATTSYSSSSGKTFITANMASCLADAQKR-VILVDTDMRKRSLSGVFAL
A0A3E0QD27      ------PGPKVVAITSTISGEGKTFVAINLAGVIAFSEKR-VVIIDLDMRKPKIHLGFNV
A0A0M1W1I6      ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
A0A4R4GHU2      ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
I8WPR6          ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
A0A0K2HKS3      ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
B6W3W8          ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
A0A4R4GSI6      ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
A0A076IRY8      ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
A0A3A6AD54      ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
A0A3A6MIU7      ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
I8WPP8          ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
A0A372Y7D2      ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
A0A3E4JJC9      ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
A0A3E4WDQ0      ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
A0A414H9P2      ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
C3R5A8          ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
A0A1C5XJA7      ------RPLQVITFTSFNSGAGKSFVAFNLADSLAYTKKK-VILIDLDIRKGSLSHRMHK
A0A3E5BU42      ------KPMQVITFTSFNEGAGKTFVSRNLAMSLVLTKKR-VVLVDLDIRKGTLSRHFSK
R7CUW4          ------RPTQVITFTSFNEGAGKTFISCNLAMSFVYARKR-VVVIDLDIRKGTLSRHLGE
A0A416GGJ1      ------VPVKVITFTSFREGAGKTFILRNLAVSLMAAKKK-VVVLDLDIRKRTLSRHFAK
D1JY72          ------KNMQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRL
D7J4K6          ------KPMQVVTFTSFNEGAGKTFISRNLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK
Q8ABP9          ------KPMQVVTFTSFNEGAGKTFISRNLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK
A0A5M6AHF7      ------KPMQVVTFTSFNEGAGKTFISRNLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK
D6D2Z5          ------KPMQVVTFTSFNEGAGKTFISRNLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK
A0A1T3EDR4      ------ISPQVITYTSFSAGVGKTFNTLNLAASFSYMKKR-VVLVDLDLRKGTLSTRVGL
A0A174SDD8      ------QERKVITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMSHC
A0A1H7RFH3      ------QERKVITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHC
A0A139L1N2      ------QERKVITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHC
A0A174TVL8      ------QERKVITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHC
A0A1H8BJR6      ------QERKVITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHC
R9H6G0          ------QERKVITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHC
A0A412GR09      ------QERKVITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHC
A0A6I0S0M4      ------QERKVITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHC
A0A081PBV5      ------KEQRVITFTSFNIGAGKTFTAINLAASFRYLNKK-VLLLDLDLRKGTLSNRVNA
A0A1I2AN85      ------KEQRVITFTSFNIGAGKTFTAINLAASFRYLNKK-VLLLDLDLRKGTLSNRVNA
A0A4U0GMP3      ------KTLQVITFTSFNIGAGKTFTAMNLAASFSFLQKR-VVLLDLDLRKGTLSKSLKG
A0A1H6CKR6      ------KSQKVITFTSFNVGAGKTFSVINLGVSLTYLKKR-VVLVDLDLRKGTLSNITKF
A0A235E1C0      ------KKQKVITFTSFNVGAGKTFSVINLGVSMTFLKKK-VVLVDLDLRKGTLSNITKF
R6D982          ------PGQKVVTLTSFNVSAGKTFVSVNLSASLVQADKK-VILIDLDLRKATLSLIAKA
A0A1F0I8C4      ------QEQKVITLASFNMGAGKTFVSVNLAASLVQAEKK-IIMIDLDLRKGRLSHFAHA
A0A3A5RIJ2      ------QEQKVITLASFNMGAGKTFVSVNLAASLVQAEKK-IIMIDLDLRKGRLSHFAHA
A0A515IZJ5      ------QEQKVITLASFNMGAGKTFVSVNLAASLVQAEKK-IIMIDLDLRKGRLSHFAHA
A0A5M5NLR3      ------QEQKVITLASFNMGAGKTFVSVNLAASLVQAEKK-IIMIDLDLRKGRLSHFAHA
A0A0D5BSQ0      ------EPPRVITFTSFSAGVGKTFSALNLATTLSYLEKK-VVVIDLDLRKGTLSSRIDL
A0A1T3F6P5      ------HPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKK-VVVLDLDLRKGTLSSRTGL
A0A0W8EPA0      ------HPPQVITFTSFSAGVGKTFSVLNLAATLSYLDKK-VVVLDLDLRKGTLSSRTGL
A0A365UKN1      ------HPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKK-VVVLDLDLRKGTLSSRTGL
A0A4R6WE41      ------APPQVITFSSFTIGAGKTFNVMNLSATVSYLKKR-VVMVDLDLRKGTLTRRMGI
A0A2T5RP38      ------APPKVLTFTSFSAGVGKTFSVLNLATTLSFLEKK-VVVIDLDLRKGTLSSRVDL
A0A1A6CF06      ------HPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKK-VVVIDLDLRKGTLSSRVDL
A0A1T3D6S8      ------HPPKVITFTSFSAGVGKTFSVLNLAATLSYLDKK-VVVLDLDLRKGTLSSRTGL
A0A1P8E011      ------KHPQTITLTSFIPGVGKTFTSLNLSSTLSFLNKK-VIVVDMDLRKGTLSERMGI
A0A1V3N3U3      ------RAPQVITFTSFGVEVGKTFSSINLSATLSFMEKR-TVVVDLDLRKGTLSSRLGL
C2FUH6          ------NSPQVITFTSFSIGAGKTFTALNLAATLSFLDKK-ILILDLDLRKGTISSRVNV
A0A0B8T471      ------REIRVITFTSFNVGAGKTFTAVNLAASLTFLLQN-VVLLDLDLRKGTLSDHLKL
A0A4R7D2K0      ------REIRVITFTSFNVGAGKTFTAINLAASLTFLLQN-VVLLDLDLRKGTLSDHLKL
A0A2X2J8S4      ------VPPKVITFSSARVGAGKTFSVINLATTLSFLNKR-VIMVDLDLRKGTLSSRIPV
A0A3C0S618      ------VPPKVITFSSARVGAGKTFSVINLATTLSFLNKR-VIMVDLDLRKGTLSSRIPV
A0A4P7DRF9      ------KEQKVLTFTSFNVGAGKTFSVINLGVSFTFLKKR-VVLVDLDLRKGTLSHKTKV
A0A239XXC4      ------KKQKVVTFTSFNVGAGKTFSVINLGVSMTFLKKK-VVLVDLDLRKGTLSNITKF
A0A4U9K473      ------KSQKVITFTSFNVGAGKTFSVINLGVSMTFLKKK-VVLVDLDLRKGTLSNITKF
A0A3M1Y2F5      ------RG-ILLGVCSTWSDEGKSFCAANLAASFGIGGYN-TLLVDLDLRNPSQPEYFRY
A0A1G1TG88      ------KK-RLISVTSTISGEGKTFVTVNLAGIIAMSGQR-VIVLDLDMRKPKVNLAFGA
A0A661XXA6      ------KS-KVYSITSTIGSEGKTFISTNMGALLAMAGKK-VIILDMDLRRPKVHKAFDK
A0A3D4RLG4      ------QN-IVLSITSTQSGDGKTFLATNLAALYGMTGKK-TLLIDLDIRKPNIHEKLGV
A0A2T2UAJ4      ------DL-QTMAVSSADKGDGKTTTCANLALALASAGKR-TIVVDADLRRPWMHEMLNV
A0A6I0DZQ5      ------DK-ITIMVTSSESGDGKTYFSLNLASVYGLASPR-TLLVDLDIRKPSIHKRLGV
A0A1H6Z2F8      ------QN-TVVLLTSSMADEGKSFVAMHLAHSLALASRK-VLLVDFDLRKPTLASLLNL
A0A2P8G5K0      ------PH-MVILLTSAMANEGKSFVAMHLAHSLALAGKK-VLLVDFDLRKPSLATLLNL
A0A4Q3SEI4      ------LKYRRILVTSSIAGEGKSFIANNLALSLAISGKK-VVLVDLDLRHPKTTTMHDL
A0A6A1IRV5      ------NNQHVFVLTSFNPGSGKSFLAINIAISFAIKKKK-ILVIDGDLRHRTVSSYVDS
A0A519SYE7      ------GKKRIISITSTISGEGKTFVAVNLSGIIALSGQR-VVILDLDMRKPKVNLAFGA
A0A5Q4EKA0      ------PGPKLVAVTSTISGEGKTFFAMNLAGILAFSNKK-VIVIDFDMRKPKIHLGFNV
A0A3D4CJE1      ------GS-KVMAITSTVSGEGKTFVAINIAGIIAYSGKK-VIILDLDMRKPKIHLGFNV
A0A4Q5ZQ60      ------KK-RIISVTSTIGGEGKTFVAVNLAGIIAQSGQR-VVILDLDMRKPKVNLAFEA
A0A519Q885      ------KK-RLISITSTISGEGKTFVAVNLAGIIALSGQR-VVILDLDMRKPKVNLAFGA
A0A519TAP8      ------KK-RIISVTSTISGEGKTFVAVNLGGIIALSGQR-VIILDLDMRKPKVNLAFDA
R5DEG6          ------KNMQVVMFTSFNPGAGKTFVSINLAMSFALTHKK-VVLVDLDIRKGTLSSHVQV
A0A3N2LCI3      ------EGNKVIAMTSFNPGSGKSFVSMNLGMAIALKGKK-VLIVDGDMRHGSTSAYMGS
A0A642EJV3      ------KTSNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKK-VLVIDGDLRHASASSYIDS
A0A6H9Q899      ------KTSNVIIVTSFNPGSGKSFLTMNIAMSFAIKGKK-VLVIDGDLRHGSASSYIDS
A0A2K8ZAP1      ------QKNQVILFTSSISGDGKSFMSLNLGASLALVNRK-TVIVDMDMRKPKLHKSLH-
A0A2T4XEQ1      ------LEVKTILVTSPGKGEGKTTTAVNLAGILAESGKR-VLIIDFDFRRPNLHKTLG-
A0A348PT57      ------NEKKIIAVTSTISGEGKTFVAINLGGILAFSDKK-VIILDLDMRKPRIHKGFN-
A0A3D3LSK1      ------KPLKTILVTSSLPSDGKTIVSVNLAGSFALDNKK-VILIDCDLRKPRVHTVFE-
A0A496L711      ------KEKITVLISSTESGDGKTYISLNLAGVFALQNKK-ILLIDFDIRKPNLTKNLSG
                               *     **:    . .           :.:* *.*          

A0A1T4NDR5      RNT-----MGITDLLNGRA--TVDN---VVKP---VFKNIDVITTGTKIIYHSEFIQSTA
A0A3D5KRM7      NCK-----FGLIDYLSGVT--SLEQ--ILIHP---KIENLVLLPGKESKVNYSELISSPK
A0A2T2TDL4      SRT-----PGITEALQ-----NDLDEHAMKRP---LIDNLCVLPAGTEVENPAKVLGSSR
A0A3D1AEJ6      HKNIEGYDIGLTSYLSKIV--TKVESLIIQDQ---DYPNIDIIRSGPEPPNPAELLLSPR
R7JFY1          RGE------GITNYLSGKV--TDVTSLICQDE---LVPGLDVIHAGPVPPNPAELLQNKR
A0A1V5S5I3      RHK------GLSDYLGKRE--NNLDGLIQENP---DIPGFFLLPAGTIPPNPTELLAEPM
A0A2M7VVW6      KND----K-GMSTILIDK---DQIKECIHHSE---L-TNLDFITSGPIPPNPSELIISGK
A0A413V760      SSN----RMGLTHYLSGST--DKLDDIIGRSE---EYDKLDVIFSGPVPPNPAELLLSER
A0A656PYT8      RDN----RNGVSGYISGTI--ANLNDIVFQSG---LHENLDIIFAGLQPPNPAEMLLSEK
A0A3M1NUH2      ELG-----PGLAHFLVQEP--RFDE--ELVAT---PIDNLWIIPAGKVVPRSSELFATRV
A0A359ATS6      PK------IGLSDYLGKRI--DTPEEIIVVDK---KHPTLHILPVGTIPPNPTELLVEER
A0A1V6HYH8      LND-----FGLSNYLLGEC--NIEQ--CIKGT---EINNLFYFPAGSLPEYPNELLTSSK
A0A2E0MDX6      QNT-----IGMSTLLIGQS--SLED--CIQKS---HLENLHFITAGPIPPNPAELIISNK
A0A2M7KCE1      DNS-----KGLSTILIGKN--KVHD--CIKKS---KIANLDYITAGPIPPNPSELTAGNE
A0A523GUD4      DKE-----PGVVDAVTNQI--SFQE--LIKDS---GFPNLKIITSGNLNDSPIKIFNAQN
A0A6A0Y068      PD------KGLSDYLGGRI--DNLDEIIVPDP---KHKSMDILPVGTIPPNPTELLFDER
A0A641X2Z6      TN------KGLSNCISASE--EVRE--VIQKT---GIENLELLASGPVAPNPSELLGSKR
A0A519PJW5      ENV-----RGISTILIDRH--SVAE--CVQHT---SIESLDFISAGPTPPNPSELILHPR
A0A519T3R9      ENI-----KGVSTILIDRH--SVAE--CVQHT---SIEALDFISAGPTPPNPSELILSPR
A0A519SD85      G----NQ-MGLTNYIHSDL---ALEQIIRKTS----IENLEFIPSGPLPINPSELLENEK
A0A3M1TXY5      E----HH-AGLSDFLCGEV--DYVNEIIHSTH----IENLHIIPAGNPSNNPTDLISNSR
A0A2E0VQ27      D----NS-DGFCEAIKSDR---HALDLVQNTS----DENLYFIPAGQYDDSLEGKVFSAK
R6U429          NK------SGISAFLNGKL-----ESIVPEIQ--NIKENLDLISVGSLPPNPAELLVSEK
A0A5C8AF42      N----NN-YGMSGLIINKF---TLEQCIQHST----IEDLDFITAGPIPPNPSELLLSDR
A0A239K409      A----CE-FGITDYLSFNT--VTVEEMLNQSD---QVPNLFIVGSGAIPVNPAELMMSNR
A0A350V3E4      K----RY-PGLCDYLFGTV---TIEEAVRETS----FPNLHIMTCGTIPTNPAELIASKH
A0A1V5S1J9      -YL--SVNKGISNYLANQI---SLDEAIVKHP----DYKFDILPVGVVPPNPGELIKSDN
A0A0A2EYC8      -II--KTKSGFVNYMIGDC---TIEEAIESTP-----YGFDFLKAGVIPPNPGEFVRRPQ
A0A2G6H6Y4      SLS--KHKVGFVNYMIGEC---SLEEAIDTTG-----YGFDFLKAGVMPPNPGEFVRSPK
A0A1M3DPL8      -GC--DNNMGVSNFLANQC---SLDEIIVRPD----GAEFDFITAGTVPPNAGELIRSDN
A0A1V5F519      -NV--NHPKGVTNYLINEC---TLDEIINVVP----EVNYDVIFAGTVPPNPAELIRSEK
A0A2G6R1T9      -GI--SEKAGVTNYLIGEN---ELDDLIIKND----DFSFDVLLGGTVPPNPGELIRSEK
A0A1M6MYT6      K----IE-KNVVDYILGKA---TLEEITHKTK----HPRLKVIPAGPHPPNPLQMLTDKN
A0A2P8CDS1      D----KN-RGVSNYLLGEM---RLEDITFRST----HPYMWLIPSGSFPPNPGELLADKK
A0A353WYK7      N----IQAKGVSTILIEKH---SVEECILKTN----LENLDYISSGPIPPNPSELIHTGS
A0A355BP94      T----DPSKGISTLLIHKT---TLEESITKTD----MAGFDYIPSGPHPPNPSELLLSKA
A0A136LSC7      N----DSSMGMSTILIKKN---NWQECVLKTS----LENFDFIPSGPHPPNPSELLLNGE
A0A5C7N8Q5      N----DSPLGMSTILIKKN---KWQECVVKTS----LENFDFIPSGPHPPNPSELLLNGE
A0A2W4RDE8      E----ND-KGLSNYLIGEA---SLKEIINETG----IKGYDVITSGPIPPNPLDLIGTPR
A0A0L8VEV2      K----NK-EGLSTYLTDFS---SFDDIFRQTR----VENLQFVSAGPIPPNPSELLENGK
A0A1I2A9Z9      K----NK-EGLSTYLTDFS---TFEDIFRQTR----VDNLQFVSAGPIPPNPSELLENGK
A0A212J9Z9      D----SQ-KGISNYLIGQV---TLDEIIYSHP----DYGFDIIPAGTLPPNPSELIKTAK
F5IV23          D----SQ-KGISNYLIGQV---TLDEITYSHP----DYGFDIIPAGTLPPNPSELIKTAK
F8X2T0          D----AQ-KGISNYLIGQV---TLEEIIISHP----DYGFDIIPAGTLPPNPSELIKTAK
A0A1M3LAG1      D----AQ-KGISNYLIGQV---TLDEIIISHP----DYGFDIIPAGTLPPNPSELIKTAK
A0A212K6G4      D----AQ-KGISNYLIGQV---TLDEIIISHP----DYGFDIIPAGTLPPNPSELIKTAK
A0A4Y9IPG7      D----AQ-KGISNYLIGQV---TLDEIIISHP----DYGFDIIPAGTLPPNPSELIKTAK
A0A2V3PNY7      E----SK-KGVSNYLIGQV---TLDEITITHP----EYEFDVITAGTLPPNPSELIKTKK
A0A6G7WQ31      E----SK-KGVSNFLIGQV---TLDEITLTHP----EYEFDIITAGTLPPNPSELIKTKK
A0A6G7X5K8      E----SK-KGVSNFLIGQV---TLDEITLTHP----EYEFDIITAGTLPPNPSELIKTKK
A0A1M5DFS8      Q----SK-KGVSNFLIGQV---SLDEITVTHP----EYEFDVITAGTLPPNPSELIKTKK
A0A4Y8KZS5      Q----TK-KGVSNFLIGQV---SLDEITITHP----EYEFDVITAGTLPPNPSELIKTKK
A0A142HHS5      E----NV-RGISTILIDRH---TVAECIQHTS----IESLDFISAGPTPPNPSELILNPR
A0A660LQT8      PK------YGIANYLNGQG---TLDEIVCKYR----DTDLDVIPVGIMPPNPTELLYAER
A0A350PNH9      PG------EGLSDYLNGRT--DDLEGIICHGEEYGLVKDFDVLPIGTMPPNPTELLFTDR
A0A354LNT9      PG------EGLSDYLNGRT--DDLEGIICHGEEYGLVKDFDVLPIGTMPPNPTELLFTDR
A0A2M6GH67      E----NN-IGISTILIERH---SVPECIQKTA----IPNLDFIPAGPTPPNPSELILNPK
A0A389LWV6      D----TQ-KGLSNFLIGKA---SLADVVISHP----DFGFDILPAGTIPPNPSELINSEM
A0A1G9B1T9      T----NG-VGLSNYLQGTA---DMSEIIQPTD----QENLYVITAGKSDGHPGEILLSER
A0A161LWY6      E----NE-TGITNCMLGQV---SLDDAIIKKS---PEINFDLLLAGTIPPNPGEMIRSPK
A0A6I3N9U6      E----NE-TGITNCMLGQV---TLDEAIIKKS---PEINFDLLLAGTIPPNPGEMIRSPK
A0A3D0FMX4      S----IE-KGLTNYLIGEI---SKQEMIQHDP----SYEFDIIYAGSIPPNPGELIRSDQ
A0A1M3MEI8      E----NS-LGLTNFLVGQC---KAQDIIMRPD----GAGFDFIPAGTIPPNAGELIRSEK
A0A1J5HQM0      N----PS-QGITNFLVGQA---TLDEVIIHIP----ELEYDFLPGGTVPPNAGELIRSEK
A0A653AC35      S----EK-DGVTNYLIGEK---PLDKLILKKD----GINFDILLAGTVPPNPGELIRSDK
E4T131          V----HP-LGVTNYLVGQC---ALDEIILKLP----KVDFDILPAGSIPPNPGELIRSEK
A0A521H707      E----NI-RGMSTILIGKD---TTDFCINKSS----LANLDFITAGPIPPNPSELILSQR
A0A1F3D6P8      D----NS-SGISNFMVKNA---TVTEIIRNTS----VENLSFIPAGPLLPNPSELIESGV
A0A356Z058      D----NS-SGISNFMVKNA---TVTEIIRNTS----VENLSFIPAGPLLPNPSELIESGV
A0A3D1BT36      D----NE-GGITKYLTDKN---VDNDIILKTF----VDNLDFIPAGPVLPNSSELIEAGA
A0A352ME00      D----NA-KGISNFMIKKA---TADEIIRNTA----ITNLDFISAGPVIPNPSELMESGI
A0A3D3HL11      V----NS-VGLSNYMVNNA---STKEIIKKTD----VDNLWFIPAGPILPNSSELIEAGV
A0A5R9QZP0      D----NP-FGISNFMNKEV---TAQEIIFDSG----IKNLSYIPAGPTLPNAAELIEAGK
A0A2W7RD29      D----NT-AGLSNYLSRR---VDDESTIVKAT---SIPGLSCITSGPYPPNPSELIANKE
A0A3N2NDY8      PS------KGLSNYLTGNT--DNWQSLVVPVA---GQNGMSVMPIGHRPPNPSELLDNGR
D7JEV9          MVK--NK-LGFVNYMIGDC---SLNEAIESTP-----YGFDFLKAGVIPPNPGEFVRSHK
A0A4R6H3B7      K----NK-EGLSTYLTDFS---TFEDIFRQTR----VDNLQFVSAGPIPPNPSELLENGK
A0A2W7QSQ0      K----SK-HSLFDYLNHDI--KDLKEIITPSG---INSNMDIIGLNKSIENASEIITSQK
R7F6L5          PR------EGIANYLCGAD---QMSDIVQHNV--NDVEGLDLIGVGNLPPNPSELLYSER
A0A553GA49      S----EN-KGISMFLSNQ---VELDDIIEKQE----GKNISYIAAGHLPPNPSELVESDK
A0A497D6F6      D----TD-KGVVSYLTGE---AGIDDITFSSK---H-PDLDIIPAGPIPSNPAELLIDER
A0A5M4AAB9      E----SN-RGASNYILNE---MSINDITFNTP---H-PYLHIIPAGSIPPNPGEMLADIQ
F4KR18          N----AE-IGLSSFLINQ---LEVEEVIQTSG---DLPNLDYISGGPFIPNVSEQLTEQQ
C9LKL0          S-------NGLTGWLVDEEEKLSLDEIIIKDG---VAKQVDFLPAGMLPPNPSELLMSSR
A0A3D0QPV7      D----NE-VGMSSLLIGRD---QLEQCIRKSE----MENLHFITAGPIPPNPAELIINGK
A0A496KT23      PK------VGISNYLSGQI--EDWHEIIT------PLDRVDVLPCGVIPPNPAELLSTER
L1M9T3          PQ------IGLSNYLSGQI--NDWHKIII------PLGQVDCLPSGVIPPNPAELLSTSR
A0A3C0I8F1      EEE--DNLKGTSTILIGRH--TPQECIQHTPI-----ENLDFIPSGPIPPNPSELILRPI
R5JJI4          PS---GR-MGLTHYLSGRT--DGLDDIIGASE---EYGKLDIIFSGPVPPNPAELLLSER
A0A3D2HF71      ND---NT-EGISKYLIGES---KIEDIIIKTE----VENLWYAPAGPIPPNPAELIESES
A0A0A2DQN2      E----HN-MGLTSYLSGMD--VSIDELIQQDP---NCEMLSIIPAGTIAPNPTELLLSKR
A0A0A2F2N5      S-----G-RGMTNYLSDDS--IKIEDVLRQDK---NCPSLHVIPIGSSAPNPAELLMSER
L1NGW4          A-----G-QGVTEYLVDKA--MPVEKIIHKDP---NFSKLAIIPAGAIPPNPAELLLGHR
Z4WRA0          A-----G-QGVTEYLIDKA--MPVEKIIHKDP---NFSKLAIVPAGAIPPNPAELLLGHR
U2K8K9          I-----G-KGVTEYLSDPT--VQVDQIIRKDP---NAPKLSVIASGAVPPNPAELLLGER
A0A069ZM60      A-----G-MGATEYLSNPD--VRLDQILRKDP---NAPKLQVITSGAVPPNPAELLLGER
J6GV98          A-----G-MGATEYLSNPD--VRLDQILRKDP---NAPKLQVITSGAVPPNPAELLLGER
A0A134B4F8      A-----G-MGATEYLSNPD--VRLDQILRKDP---NAPKLQVITSGAVPPNPAELLLGER
A0A134B8C7      A-----G-MGATEYLSNPD--VRLDQILRKDP---NAPKLQVITSGAVPPNPAELLLGER
A0A4Z0EKR0      P----AG-PGITDYLVSSD--ILISDIIRESE---QVPNLFIISSGPIPPNPAELLLSSK
A0A229I3A5      -----PG-EGLSDYLNGRI--ADIHDILYKGEENGLVKNFDVIPIGTIPPNPTELLFTPL
A0A3R6HJB3      -----PG-EGLSDYLNGRI--TDIHDILYKGEENGLVKGFDVIPIGTIPPNPTELLFTPL
B5CTK0          -----KE-LGVTDYLSGKI--ADLNQIIVKGK---LHANLDMIYAGAVPPNPAELLLSER
A0A1M6B6D5      Q----NS-MGVVNYLINEA---DLDGIIQKTE---I-DTLDVITSGPIPPNPSELLLGER
A0A451FS66      D----NS-IGVVNYLINEA---DLDTITQKTE---V-DYLDVIPSGPTPPNPSELLIGER
A0A2E3GN39      P----NS-AGMSTLLNKRS--TKED--ITFST---SEENLWAVPAGPIPPNPSELIGGEP
A0A3D1MEL0      P----NS-AGMSTLLNKRS--TKED--ITFST---PEENLWAIPAGPIPPNPSELIGGDS
F0R0C9          -----PK-TGLSDYLGRKT--DAIDTAVVEAP---QCPGLYILPVGTLPPNPTELLAEDR
A0A2A4N9A6      D----NA-KGMSTILIGKD--KV-EDCIFKSN---I-DTLHFIPSGPIPPNPAELIINQR
A0A6C0GGI1      K----NT-TGLSSYLIKSS--TL-EEIIQPTK---V-KNFDVISSGPIPPNPVEMIELKE
A0A368D1N7      P----NS-SGMSTLLNKRS--IK-EDIIFSTP---E-ENLWAIPAGPIPPNPSELIGGDS
A0A3B8TU58      P----NS-AGMSTLLNKRS--IK-EDVTFSTS---E-ENLWAIPAGPIPPNPSELIGGDS
A0A1T5IIR6      KH---KT-KGLSNYLYDLD--LTLDDILFKD----VKSGIDFIPAGAVPPNPTELLGRPR
A0A3E0QD27      E----NT-KGMSTILIGKD--EA-DNCIRKSN---L-TNLDFITAGPIPPNPSELILSRK
A0A0M1W1I6      HT---EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
A0A4R4GHU2      HT---EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
I8WPR6          HT---EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
A0A0K2HKS3      HT---EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
B6W3W8          HT---EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
A0A4R4GSI6      HT---EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
A0A076IRY8      HT---KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
A0A3A6AD54      HT---KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
A0A3A6MIU7      HT---KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
I8WPP8          HT---KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
A0A372Y7D2      HT---KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
A0A3E4JJC9      HT---KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
A0A3E4WDQ0      HT---KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
A0A414H9P2      HT---KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
C3R5A8          HT---KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
A0A1C5XJA7      -----HG-VGMTNYLADET--IALDDIIHDCG---KD--YDFINAGTSAPNPAELLMDSR
A0A3E5BU42      -----HP-VGVTNYLADES--IALDDIIHTDE---KSGGLDIISSGTVAPNPAELLMDSR
R7CUW4          -----HR-TGVTNYLADTT--VTVDDIIRKGE---H---FDIIASGPVAPNPAELLLDSR
A0A416GGJ1      H-----P-YGMTNYLSDAS--IRLEDILVKGN---GVDIPDAILAGPVAPNPAELLLENR
D1JY72          HT---EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENLDFIPAGPIAPNPSELLLSEQ
D7J4K6          -----HP-VGVTNYLADDS--IRLDDIIHTDG---KFDNLDIISSGTVAPNPAELLMDER
Q8ABP9          -----HP-VGVTNYLADDS--IRLDDIIHTDG---KFDNLDIISSGTVAPNPAELLMDER
A0A5M6AHF7      -----HP-VGVTNYLADDS--IRLDDIIHTDG---KFDNLDIISSGTVAPNPAELLMDER
D6D2Z5          -----HP-VGVTNYLADDS--IRLDDIIHTDG---KFDNLDIISSGTVAPNPAELLMDER
A0A1T3EDR4      E----GK-AGVSHYLSGLL--RDINTVIYHRE---IGLGVDVIPLGAIAPNPVELLLSKH
A0A174SDD8      T----QV-KGVAHYLSNPS--IEVNDIILRDA---FGEGLDLVPIGVIAPNPTELLLSKR
A0A1H7RFH3      R----QV-KGVAHYLSDSS--VEVTDIIVQDT---FGEGLDLVPIGVIAPNPTELLLSKR
A0A139L1N2      R----QV-KGVAHYLSDSS--VEVTDIIVQDA---FGEGLDLVPIGVIAPNPTELLLSKR
A0A174TVL8      R----QV-KGVAHYLSDSS--VEVTDIIVQDA---FGEGLDLVPIGVIAPNPTELLLSKR
A0A1H8BJR6      R----QV-KGVAHYLSDSS--VEVTDIIVQDA---FGEGLDLVPIGVIAPNPTELLLSKR
R9H6G0          R----QV-KGVAHYLSDSS--VEVTDIIVQDA---FGEGLDLVPIGVIAPNPTELLLSKR
A0A412GR09      R----QV-KGVAHYLSDSS--VEVTDIIVQDA---FGEGLDLVPIGVIAPNPTELLLSKR
A0A6I0S0M4      R----QV-KGVAHYLSDSS--VEVTDIIVQDA---FGEGLDLVPIGVIAPNPTELLLSKR
A0A081PBV5      QKE--KG-LGVTNFLANPK--VTVDDIIYQGL---VGGIIDVIPIGVIAPNPVELLLSTR
A0A1I2AN85      QKE--KG-LGVTNFLANPK--VTVDDIIYQGL---VGGIIDVIPIGVIAPNPVELLLSTR
A0A4U0GMP3      RRK------GVTHYLSDAN--VAWSDIVYKNE---FANSVDIVPIGTIAPNPVELLLGGR
A0A1H6CKR6      P----MP-IGATHYLSDSA--ITVDEIIYKDR---VDANIDIVPIGVIAPNPVELLLSER
A0A235E1C0      P----MP-IGVTHYLSDSA--ITVDEIIYKDR---TDAEIDIVPIGVIAPNPVELLLSDR
R6D982          RGN--GI-KGMAHYLSNKS--ISMDDIIMKDG---FGERIDLIPVGVIAPNPAELLLSGR
A0A1F0I8C4      K----RV-KGVAHYLSNPL--VSADDIILHDA---FGEGLDLIPIGVIAPNPTELLLNRR
A0A3A5RIJ2      K----RV-KGVAHYLSNPL--VSADDIILHDA---FGEGLDLIPIGVIAPNPTELLLNRR
A0A515IZJ5      K----RV-KGVAHYLSNPL--VSADDIILHDA---FGEGLDLIPIGVIAPNPTELLLNRR
A0A5M5NLR3      K----RV-KGVAHYLSNPL--VSADDIILHDA---FGEGLDLIPIGVIAPNPTELLLNRR
A0A0D5BSQ0      L----HG-KGVSHYLSSPS--VSVDEVLHKSE---VANGVDFVPIGAIAPNPVELLLSKR
A0A1T3F6P5      L----HG-KGTSHYLSNSS--IQISDILHKSE---VAEGVDFIPIGAIAPNPVELLLGKR
A0A0W8EPA0      L----HG-KGTSHYLSNSS--IKISDILHKSE---VAEGVDFIPIGAIAPNPVELLLGKR
A0A365UKN1      L----HG-KGTSHYLSNSS--IKISDILHKSE---VAEGVDFIPIGAIAPNPVELLLGKR
A0A4R6WE41      K----FR-KGVTHYLSDSS--VKIDDVLYKSD---LSEGVDCVPIGVLAPNPVELLLSQR
A0A2T5RP38      L----HG-KGSSHYLSSPS--ISIDEIIHKSD---VAEGVDFIPIGAIAPNPVELLLGKR
A0A1A6CF06      L----HE-KGTSHYLSNSS--ISVDEILQKSE---LLENVDVIPIGAIAPNPVELLLSKR
A0A1T3D6S8      L----HG-KGTSHYLSNPS--IKISEILHKSE---VAEGVDFIPIGAIAPNPVELLLGKR
A0A1P8E011      I----HG-KGLSHYLSDVN--LELEEIIHYNL---HGKNVDYISIGMEAPNPVELLLSKR
A0A1V3N3U3      L----DK-IGCSHFLADAT--VTLDTVIYPVK---GLEFLDCVPIGLIAPNPVELLLSAR
C2FUH6          K----SA-LGVSHYLSNSQ--VAIDDIICKSG---IADNVDIISIGMVAPNPVELLLGKR
A0A0B8T471      G----SV-KGVTHFLADPA--VSLDHITYKAN---VGNGVDVIPIGVIAPNPVELLLSKR
A0A4R7D2K0      G----SV-KGVTHFLADPA--VSLDHITYKAN---VGNGVDVIPIGVIAPNPVELLLSKR
A0A2X2J8S4      P----VR-KGITHYLSDKE--LNLSEVIYKTE---VSDNIDIIPIGVIAPNPVELLHSDR
A0A3C0S618      P----VR-KGITHYLSDKE--LNPSEVIYKTE---ISDNIDIIPIGVIAPNPVELLHSDR
A0A4P7DRF9      P----MP-VGITHYLADSN--TQIDDIIYKDR---IADGLDIIPIGVIAPNPVELLLSER
A0A239XXC4      P----MP-IGVTHYLSDSS--VTVDEIIYKDR---TDSEIDIVPIGVIAPNPVELLLSER
A0A4U9K473      P----MP-IGVTHYLSDSA--VTIDEIIYKDR---VDADIDIIPIGVIAPNPVELLLSER
A0A3M1Y2F5      P----RQM-GISNGLLGPE--RSHWKKWIIKD---VESQIDILPAGPHLPNSIDLLDTGA
A0A1G1TG88      E----NVK-GVSTILIDRH--SVAE--CIQHT---SIDALQFISAGPTPPNPSELILSPR
A0A661XXA6      E----SSDCGMSTLLIKKH--NLSE--CITKS---HIEDLDFIGAGPVPPNPSELILREA
A0A3D4RLG4      D----AGL-GVTNYLIGEC--EIED--ILHKD---TSYNFDFLLAGTIPPNPGELIRTDK
A0A2T2UAJ4      D----RDL-GLSQVLY-EG--ELDP--EAYAT---EVENLFVIPAGDTVPNPAELLGSNR
A0A6I0DZQ5      E----NSL-GLTNFLVGQC--KAQD--IIMRP---DGAGFDFIPAGTIPPNAGELIRSEK
A0A1H6Z2F8      R----P-E-GVTEHIALEK--DLL---IQQCA---NGPPFDFIAAGMQS--MDDTMLSPK
A0A2P8G5K0      R----P-N-GVTECIASGH--EPL---IQQNS---SETSFDFLAAGQQSPGTGEIILSPK
A0A4Q3SEI4      N----GQR-GVAEFLENNE--VPVST-IMYPT---SNEKIFVVPAGYSDVNPTELLLNGD
A0A6A1IRV5      P----N-K-GLSDYLNNQI--EDWKEIIVSYK---GYTNLHILPIGTIPPNPTELLEDNK
A0A519SYE7      E----NVR-GISTILIER----HTVAECIQHT---NIESLDFISAGPTPPNPSELILSPH
A0A5Q4EKA0      E----NIN-GVSTILSNI----DTIDDCIQPS---RVKNLDFITAGPVPPNPSELILTPR
A0A3D4CJE1      E----NDR-GMSTLLIGND--SLNN--CIKHS---ALKGLDFITAGPIPPNPSELIINGN
A0A4Q5ZQ60      E----NIR-GMSTILIEKH--SVQE--CIQHS---RLSNLDFISAGPTPPNPSELILNDK
A0A519Q885      E----NIQ-GVSTILINRH--TVAE--CIQHT---SIESLDFISAGPTPPNPSELILSPR
A0A519TAP8      D----NVR-GISTILIERH--TLEE--CIQHT---SIESLDFISAGPTPPNPSELILNPR
R5DEG6          S----D-M-GVTNYLSGRI--DNVDEIIQKGE---LYDKLDIIHAGPVPPNPAELLLSDR
A0A3N2LCI3      P----A-K-GLADYLGGAV--SEVDTLIVKTP---ECQNMQVLPIGSIPPNPTELLESPR
A0A642EJV3      P----D-K-GLSDYLGGRI--DNLDEIIVPDP---KHKSMDILPVGTIPPNPTELLFDER
A0A6H9Q899      P----D-K-GLSDYLGGRI--DKLDEIIVPDP---RHKSMDILPVGTIPPNPTELLFDER
A0A2K8ZAP1      -IE--NK-LGLSNYLTGEA---DLDNLLHPII---GHENYYIITAGSLPLNPSELLSSPR
A0A2T4XEQ1      -ES--QT-PGILELLFDGV---HFDDVIRE-T---AYPGIHCLTTGRRSPNPASVAQSDK
A0A348PT57      -ST--NE-YGMSTYLSNRD---NLKDIIRK-S---ELDGLHFITAGPIPPNPSELIISGN
A0A3D3LSK1      -FD--RF-PGLSDFLFHHV---NFEDIVRD-S---GFDNLSVITAGTIPPNPSEMLGSLQ
A0A496L711      MVK--NK-LGFVNYMIGDC---SLNEAIES-T---PY-GFDFLKAGVIPPNPGEFVRSHK
                         .    :                                             

A0A1T4NDR5      LMNFIERMKDEYD--IILLDCPPVGIVTDALIVSKYSDGTILVCES-DKNDKKTLIRVKY
A0A3D5KRM7      MIEFIKETKSRYESRIIIFDVPPLFVADDALLYMSYCDAALFVVED-EKNTVDEIKHSMK
A0A2T2TDL4      FRDFLQRAEQYFD--HVIVDSSPVLATADGPLLSDLCETTLCVARA-GTTTEAELDHAME
A0A3D1AEJ6      LDELIRELREMYD--FIVIDNVPAGMVADAMISNRVTDLTLYIIRA-GKMDRRMLPEIEQ
R7JFY1          LDAMIAELRTRYD--YILLDNVPAGLVADAQIVARLADLTICVIRA-GVLDRRQIPALEM
A0A1V5S5I3      FKEAIERLRGNYD--YIFIDCPPIDIVADTQIIEKLADRTVFVVRA-GLLERDMLPELQR
A0A2M7VVW6      LDEVIAELKKEYD--LVVLDNPPIGLVSDAMEMLKKADYPIYVFKS-EYSRKNFINNLNK
A0A413V760      FDRLITELRKRYD--YIIVDNVPAGMVADASIVNRVADLTIFVVRS-GVMDRRQLPELEN
A0A656PYT8      FDEFMADLRKRYD--YVVIDSVPAMAVADALITDRLADLTIYVIRE-GLLDRRQLPDIEK
A0A3M1NUH2      MRDFIESLRARFD--VIILDTPPVRVATDAALLATQCDLTLVVVRA-GQTREGELEFAME
A0A359ATS6      LKELINRMRSRYD--YILIDCPPIDVVADTAIIEKLADRTIFVVRA-GLLERSMLVELEK
A0A1V6HYH8      MDELLENLKKYYD--IIILDTPPIGLISDTTKFVLLADTTVYVFRS-EYSKKEFIVNLEK
A0A2E0MDX6      MTDVINELKNLYD--VIVIDTPPVGIVTDAFPIISKVDYPVYIVRA-HFSKKVFLKNIQM
A0A2M7KCE1      ILNVINELKQIYD--VIIIDTPPLGLVTDALNIFKSCDYPIYVVKA-HYSKRSFLYNLNH
A0A523GUD4      IKAFLETASSFYD--YIVVDAPPVIPVSDPLIIGKFVDNVILVAKA-GETPKRVIKRAVD
A0A6A0Y068      LKQTIDTVREQYD--YVLIDCPPVELVADTQIIEKLADRTVFVVRA-GLLERSMLAELEK
A0A641X2Z6      MEQLLEQLKPDYD--YILIDTPPIMPVTDAAVLSGKVDGLVMLVSS-GEVTPAAAKEAKQ
A0A519PJW5      FDLMLQELYRTYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRA-NYSRKAFLKNMNR
A0A519T3R9      FDQMLQELYRSYD--VIMIDTPPVGLVTDGILIMRKADVPIYIVRA-NYSRKTFLKNLNR
A0A519SD85      IDVLINSLKRMYD--IIIFDSAPVGIVTDSTPILKKADINLFILRC-GVSRQEYINTPEA
A0A3M1TXY5      MKELVEACMDEYD--HIIFDTPPIGLVSDYLILMHLTDYNIYVVRH-NVTEVADLKLINE
A0A2E0VQ27      ALDIIHDLRWHFD--MVIVDVAPIGLFDDSIVLMRKSTANLFLIRK-GTTRLRQLKPINE
R6U429          FDKMMDELSARYD--YIFMDCPPVDIVADTSIIAKHADYTVFVIRA-GLFDKRALPAVED
A0A5C8AF42      FKEIVEELKQTYD--VIIIDNPPIGLVSDGIKNLTEADIPIYVFKS-HYSKRNFAFRVKE
A0A239K409      VEQLFEELQKKFD--YILIDTAPVGQVSDAFSLSKYVDLTVCLVRY-NYTPKHEIENIND
A0A350V3E4      MQTFLNMMKPKYD--YILIDSPPLATVTDAELLSSYVDGTVVVSLA-SKTRLDLLVNTID
A0A1V5S1J9      MNNLISILKETYD--YIVFDTSPIGLVTDAYGIIESVDIILYAVRA-EQTNKSFYKKAMS
A0A0A2EYC8      LLEMINLLKEMYD--YVVIDSSPLGLVADAYALFSTVDIKLLIVRS-LKTNKVEFTDLAK
A0A2G6H6Y4      LEQMITELKSMYD--YIIIDTSPLGLVTDSYALFPMVDVKLLVVRS-FKTSKREFSELTR
A0A1M3DPL8      LKDMFDELRKRYE--YIIVDTSPIGVVADAYSFAALSDINLFVIRS-NKTNKQFVKTLSN
A0A1V5F519      IIEMMGELRKRYD--YIILDSSPIGLVTDSFSLASLADVNLLVVRN-NKTHKDFFKNVVN
A0A2G6R1T9      LKGMLKELRTRYE--YIIIDTSPI-------------------VRN-EKTNKAFFKRINE
A0A1M6MYT6      LSGLIDQLKKQYD--VVIVDTPPVGMVADFFLLRDMFDAAVFIVRH-KSTPKKPLKDILE
A0A2P8CDS1      LKELIELLKEEYD--VIVIDSSPL-LVADLFQYSHLCNAYLYVSRQ-GVTPQPAIKSALQ
A0A353WYK7      FDKMIGDLKSKYD--VVIIDTPPVGLVTDGILALKKSDIALFVVRS-GFSKKSFIQNIDR
A0A355BP94      FEDLLAELRTRYD--YIVIDTPPVGLVTDGIMAMKRADLSIYVVRA-NYSRKEFLSNLER
A0A136LSC7      FSDFLEELRATYD--YVVIDTPPVGLVTDGVMAMKRSDLSIYVFRA-NYSHKDFLQNLAR
A0A5C7N8Q5      FSDFLEELRANYD--YIVIDTPPVGLVTDGVMAMKRSDLSIYVFRA-NYSRKDFLQNLAR
A0A2W4RDE8      MAELLNELKQSYH--TIIIDSPPIGFVSEYIILMKYTDANIYVVRS-DYTTKYNLDRINK
A0A0L8VEV2      FEELIERCRDMFD--YIVFDNPPLSLVSDGIVIGQKVDINLFVTRQ-DYSKKNEVRFIDH
A0A1I2A9Z9      FEELIDRCRNIFD--YIVFDNPPLSIVSDGIIIGQKVDINLFVTRQ-DYSKKNEVKFIDH
A0A212J9Z9      TKQVLEHLKEMYD--YVIIDCSPVGLVSDAYILSEIADTTLFVVRR-AKTNKSFFKSVIT
F5IV23          TKQVLEHLKEMYD--YVIIDCSPVGLVSDAYILSEIADTTLFVVRR-AKTNKSFFKSVIT
F8X2T0          TKQLLEHLKEEYD--YVIVDCSPVGLVSDAYILSSMADTTLFVVRR-AKTNKAFFKSVIT
A0A1M3LAG1      TKQLLEHLKEEYD--YVIVDCSPVGLVSDAYILSSMADTTLFVVRR-AKTNKAFFKSVIT
A0A212K6G4      TKQLLEHLKEEYD--YVIVDCSPVGLVSDAYILSSMADTTLFVVRR-AKTNKAFFKSVIT
A0A4Y9IPG7      TKQLLEHLKEEYD--YVIVDCSPVGLVSDAYILSSMADTTLFVVRR-AKTNKAFFKSVIT
A0A2V3PNY7      TKDLLDHLKSKYD--YVIVDCSPIGLVSDAYILSKYVDTTLFVVRR-GKTNKAFFKSVVS
A0A6G7WQ31      TKDLIDYLKTKYD--YVIVDCSPIGLVSDAYILSKYVDTTLFVVRR-AKTNKAFFKSVVN
A0A6G7X5K8      TKDLIDYLKTKYD--YVIVDCSPIGLVSDAYILSKYVDTTLFVVRR-AKTNKAFFKSVVN
A0A1M5DFS8      TKDLIEYLKTKYD--YVVVDCSPIGLVSDAYILSKYVDTSLFVVRR-AKTNKAFFKSVVN
A0A4Y8KZS5      TRDLIEYLKTRYD--YVIVDCSPIGLVSDAYILSKYVDTTLFVVRR-AKTNKAFFKSVVN
A0A142HHS5      FDLMIQELYRTYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRA-NYSRKTFLKNMNR
A0A660LQT8      MDQLFTELKERYD--YIFLDCPPVEIVADAAIISRHADLTLFVVRA-HLLERSMLPEIND
A0A350PNH9      LEKMIRQMRGEYD--YVFIDCPPVEIVADTQIIEKLADRTIFVVRS-GLMQRSMLGDIEQ
A0A354LNT9      LEKMIRQMRGEYD--YVFIDCPPVEIVADTQIIEKLADRTIFVVRS-GLMQRSMLGDIEQ
A0A2M6GH67      FDEMLEELRQLYD--VIIVDTPPIGIVTDGTLVMRKADIPIYIVRA-DYSKKEFLKNINK
A0A389LWV6      TKKLLSFLSKEYE--YIILDCSPVGLVSDAHFLAKLADVVLYVVRN-EKTNRNFFKHTIS
A0A1G9B1T9      LPQLINKLKMEFK--FVVLDTPPVKIVTDALVLSAYSDINILVARR-GVTSKSQLMDVEE
A0A161LWY6      LLELINELKMRYH--YVIIDTSPVGIVSDAYPLAPISDCVIYITRS-RKTNKKFFKSVIN
A0A6I3N9U6      MLELIKELKSRYH--YVIIDTSPVGIVSDAYPLAPISDCVIYITRS-RKTNKKFFKSVIN
A0A3D0FMX4      VVELLEELRSEYD--YIVIDSSPIGLVTDAYALIERSDITLFVVRY-NKTQRNFCREVLA
A0A1M3MEI8      LRTLFAKLKEYYD--YIIVDTSPIGVVADAYSFADLSDINLFIVRS-DKTHKLFLRTLTA
A0A1J5HQM0      LVEMFQELRNRYE--FIVVDTSPIGIVADAYAIAHLSDINIFVARS-GKTSKSHFAKISK
A0A653AC35      LREMFKELESRYD--YVIVDTSPIGLVADAYSLAPLMDANIFVVRS-EKTNKSFFKKLNA
E4T131          LGKMFEELRTRYD--FIIVDSSPIGMVTDAYSLAQHSDVNLFVVRN-GKTNKTFFKKLCA
A0A521H707      MNELLDYLKSKYD--IIIIDTPPVGIVTDGVEIIQNADYPIYIIRA-HYSKRMFMQNLNK
A0A1F3D6P8      LDELMNFLKKEYD--YIIVDTSPVGLVADATQLIRYATHILLVTRI-NYTRKDILEHVLK
A0A356Z058      LDELMNFLKKEYD--YIIVDTSPVGLVADATQLIRYATHILLVTRI-NYTRKDILEHVLK
A0A3D1BT36      LDKLIQYLEDNYE--YIIIDTTPSGMVADAAQLIKYSSINLLVCRN-NHTRKDVFNSVLN
A0A352ME00      LDNLINYLKTKYD--YIIIDTTPVGIVADAILMMKYASKVLMVIRN-NYTRKDIFANVIN
A0A3D3HL11      LDSLIEELKQQFD--YVIIDSTPAGLVADATLMIKYASYILLVCRN-DYTRKDVFTDVLN
A0A5R9QZP0      LDSLITHVQNDFN--YVIIDSTPTGLVSDAVALMNYASHILMVCRN-NHTIKNVFFDVLN
A0A2W7RD29      IIKLLIKMKDQFD--IIILDTPPLGIVSDSMSLFPLVDVSLLAFKC-GYNNHKGIVELNK
A0A3N2NDY8      IGQFLDEARKEYD--YIFVDCPPTDVVVDTQIVEKYVDRTIFVVRA-GLLDRKALEEIDA
D7JEV9          LLEMLAELQSMYD--YIIIDSSPLGLVADAYALFSVVDIKLLVVRS-FKTNKMEFTDLSK
A0A4R6H3B7      FEELIDRCRNIFD--YIVFDNPPLSIVSDGIIIGQKVDINLFVTRQ-DYSKKNEVKFIDH
A0A2W7QSQ0      IIKLINSLKSSYD--HIIIDTSPIGLVADAYSLSEIVDLVVYVVRM-NYTRVDNLHALAE
R7F6L5          LKTLLSTMEQEYD--FIFFDCPPIEVVADSRILNEYVDTTIFVIRA-GLFDRRMLKSIRN
A0A553GA49      TLEMLAELKTRYD--FIILDAGPTSVTAESLVLGKMADLILVVMRV-NYTLKKEFKEIIE
A0A497D6F6      LEKLMDKLKSTYD--MIIVDTSPVGVVADTLQITSQFDIIIFVVRQ-RMTKKQVFKSAIE
A0A5M4AAB9      LMELTALLKQEYE--TIIIDSSPL-LVADVFQFSNLWDTLLFVTRQ-GITLKPAAKSALQ
F4KR18          LSVLFAYLKSKYD--VIIIDSSPIGVVSDGMLLNNYVDNTLFVVRS-NFTKKATIAKARE
C9LKL0          LEALVEEARELYD--FIIIDTTPILAVSDASIVDRVADVTLFVIRV-GVQVRAFLPELEK
A0A3D0QPV7      LDSILEELKRIYD--IVIVDLPPVGLVTDGIPIVQMADYPIYVFRA-NYSKKNFVQNADR
A0A496KT23      FAEMIKAAREEYD--IIFLDCPPVEIVADAEIINPHADLTLFIVRA-SLMERSYLKDIER
L1M9T3          FRDLIETVRQEYD--LIFIDCPPVEIVADAEIINPVADLTLFVVRA-GLMERSFLNDIER
A0A3C0I8F1      CDEFIKQLTLSYD--VIILDTPPIGLVTDGVLLMQKAEVPIYIFKA-NYSKKAFSKSINK
R5JJI4          FDRLITELRKRYD--YIIVDNVPAGMVADASIVNRVADLTIFVVRS-GVMDRRQLPELEK
A0A3D2HF71      MKEFIDKAKKDFE--FIIIDTPPAAVVTDALLLADLADFYIFVVRQ-RFSSKNTVELIEE
A0A0A2DQN2      LDSLIDELGRRYD--YVIMDNVPFGVVADASIVNRAADLTLFIIRA-ERMDRRMLPELER
A0A0A2F2N5      LDALMDELSARYD--YVLIDGVPFGIVADATIVNRVVDLTLFILRS-GTVDRRVLPDLQL
L1NGW4          LDDLAQELSDRFD--FVIFDNVPFGSVADAAIANRIADLTIFVLRA-ARLDKRALPELQR
Z4WRA0          LDDLAQELSDRFD--FVIFDNVPFGSVADAAIANRIADLTIFVLRA-ARLDKRALPELQR
U2K8K9          LDELADKLSEQFD--FVVFDNVPFGSVADAAIANRVADLTIFILRA-AKLDRRALPELQR
A0A069ZM60      LDELAAKLAEQFD--FVLFDNVPFGSVADAAIANRIADLTIFVLRA-GRLDRRALPELQH
J6GV98          LDELAAKLAEQFD--FVLFDNVPFGSVADAAIANRIADLTIFVLRA-GRLDRRALPELQH
A0A134B4F8      LDELAAKLAEQFD--FVLFDNVPFGSVADAAIANRIADLTIFVLRA-GRLDRRALPELQH
A0A134B8C7      LDELAAKLAEQFD--FVLFDNVPFGSVADAAIANRIADLTIFVLRA-GRLDRRALPELQH
A0A4Z0EKR0      FAQLIEELKENFD--YIIMDTPPVGQVADAFTFSAFADISIYLVRY-NMTIKSQLKIIRN
A0A229I3A5      LEQMIKTMREEYD--YVFIDCPPIEVVADTPIYEQFADRTIFVVRA-GLMERSMLPEVNA
A0A3R6HJB3      LEQMIKTMREEYD--YVFIDCPPIEVVADTPIYEQFADRTIFVVRA-GLMERSMLPEVNA
B5CTK0          LDQMIEELRTRYD--YIIVDNVPAGMIADAAIVNRIADWTLYIVRA-GVLDRKQLPDVDA
A0A1M6B6D5      LDQLLGLLKDQYD--YIILDSPPMGLVSDALVLTKHVDATLYMVRQ-NYTHKNMLTFVNE
A0A451FS66      MDEFMERLKERYD--YIILDSPPIGLVSDAMEIIKYADATLYMVRH-NRTRKNMLTFVNE
A0A2E3GN39      FINFIDEVKTSFD--VVIFDTPPIGLVTDSIPVISTVNNPIYVLRA-DYSHRSFVGHIES
A0A3D1MEL0      FVNFLDEVKTSFE--VVIFDTPPIGLVTDAIPVISGTNNPIYVLRA-DYSHRSFVGHIES
F0R0C9          FGKLVAGLRDRYD--YIFIDCPPIEIVADTQIIEKVADRTLFIVRA-GLLERSMLAELET
A0A2A4N9A6      TEELLAVLRKQYD--LIVIDTPPIGIVSDGIDIIRKADYPLYIFRA-DYSKKDFVKIMNK
A0A6C0GGI1      MRDLIAKLKAEYD--YVIVDTPPLSFVAEYMILKEYLDANIFVVRA-NYTKREVLDTINE
A0A368D1N7      FVNFLDEVKTLFE--VVIFDTPPIGLVTDAIPVISRANNPIYVLRA-DYSHREFVGHIES
A0A3B8TU58      FVNFIEEIKTSFD--VLVFDTPPIGLVTDSIPVISKVNNPIYVMRA-DYSHRSFVGHIES
A0A1T5IIR6      LEELIEALRQKYD--YILLDGVPIQMLADPIVLNRVVDINLFILRS-GQLDRRILPQLDE
A0A3E0QD27      MVELVEYLKSKYD--VVIIDTPPVGIVTDGVDVIQNADYPIYIIRA-QYSKRMFINNLNR
A0A0M1W1I6      LEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPELEK
A0A4R4GHU2      LEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPELEK
I8WPR6          LEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPELEK
A0A0K2HKS3      LEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPELEK
B6W3W8          LEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPELEK
A0A4R4GSI6      LEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVIRV-GKLDRRMLPELEK
A0A076IRY8      LEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPEVEK
A0A3A6AD54      LEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPEVEK
A0A3A6MIU7      LEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPEVEK
I8WPP8          LEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPEVEK
A0A372Y7D2      LEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPEVEK
A0A3E4JJC9      LEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPEVEK
A0A3E4WDQ0      LEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPEVEK
A0A414H9P2      LEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPEVEK
C3R5A8          LEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPEVEK
A0A1C5XJA7      LDSMMEELRKRYD--YIVVDNVPVGLVADATIANRIADITIFVVRA-GRLDKRQLPDIEK
A0A3E5BU42      LDTMMAELRKRYD--YVIVDNVPVGIVADATISNRISDLTIFVVRA-GKLDRRQLPDLEE
R7CUW4          LDTLIAELRTRYD--YIIVDNVPVGIVADATIANRIADLTVFVVRS-GRLDRRQLPDIES
A0A416GGJ1      LDELIEELKTMYD--YVIVDNVPIGIIADASIANRVADLTLFVVRA-GSVDRRLLPEIED
D1JY72          LEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRV-GKLDRRMLPELEK
D7J4K6          LDAMVEELRQRYD--YIIVDNVPVGIVADATITNRISDLTIFVVRA-GRLDRRLLPDMEE
Q8ABP9          LDAMVEELRQRYD--YIIVDNVPVGIVADATITNRISDLTIFVVRA-GRLDRRLLPDMEE
A0A5M6AHF7      LDTMVEELRQRYD--YIIVDNVPVGIVADATITNRISDLTIFVVRA-GRLDRRLLPDMEE
D6D2Z5          LDTMVEELRQRYD--YIIVDNVPVGIVADATITNRISDLTIFVVRA-GRLDRRLLPDMEE
A0A1T3EDR4      LDELIEALKLKYD--YVIVDGVPMGIVADANIIDRISELTLFIIRE-GKLDRRMLAELEN
A0A174SDD8      LDELVDKLRERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV-GKIDRRQLPELER
A0A1H7RFH3      LDKLVAELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV-GKIDRRQLPELER
A0A139L1N2      LDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV-GKIDRRQLPELER
A0A174TVL8      LDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV-GKIDRRQLPELER
A0A1H8BJR6      LDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV-GKIDRRQLPELER
R9H6G0          LDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV-GKIDRRQLPELER
A0A412GR09      LDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV-GKIDRRQLPELER
A0A6I0S0M4      LDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRV-GKIDRRQLPELER
A0A081PBV5      LDELIIELKKRYD--YIIVDNVPVNLVADASIVDRISELTIFVVRS-GKMDRRQLPEIQS
A0A1I2AN85      LDELIIELKKRYD--YIIVDNVPVNLVADASIVDRISELTIFVVRS-GKMDRRQLPEIQS
A0A4U0GMP3      LDELIAALKSNYD--YVIVDNVPVALVADAAIVDRISELTLFVVRA-GKMDRRQLPELDK
A0A1H6CKR6      LDRLFVELKERYD--YIIVDNVPLGIVADADIVNRITDVTIFVVRA-GKMDRRQLPDIQK
A0A235E1C0      LDTLINELKERYD--YIIVDNVPLGIVADADIVNRITDVTIFVVRA-GKMDRRQLPDIQK
R6D982          LDELIGHLRERYD--YIIVDGVPVGMVADVSISNRISDVTLFIVRA-GKLDKRQLPELER
A0A1F0I8C4      LDELIVKLRRRYD--YIIVDNVPIGVVADASVVNRISDLTLFIVRV-GKLDRRQLPELER
A0A3A5RIJ2      LDELIVKLRRRYD--YIIVDNVPIGVVADASVVNRISDLTLFIVRV-GKLDRRQLPELER
A0A515IZJ5      LDELIVKLRRRYD--YIIVDNVPIGVVADASVVNRISDLTLFIVRV-GKLDRRQLPELER
A0A5M5NLR3      LDELIVKLRRRYD--YIIVDNVPIGVVADASVVNRISDLTLFIVRV-GKLDRRQLPELER
A0A0D5BSQ0      LDELINELKERYD--YVIIDGVPVGIVADASIIDRVADLTLFIIRV-GKMDRRQLPEIEK
A0A1T3F6P5      LDELITELKGMYD--YVIIDGVPTGVVADASIIDRVADLTLFIIRI-GKMDRRQLPEIEK
A0A0W8EPA0      LDELITELKGMYD--YVIIDGVPTGVVADASIIDRVADLTLFIIRI-GKMDRRQLPEIEK
A0A365UKN1      LDELITELKGMYD--YVIIDGVPTGVVADASIIDRVADLTLFIIRI-GKMDRRQLPEIEK
A0A4R6WE41      LDELIGELKLRYD--YIIVDGVPVAIVADGSIISRISDLTLFVIRA-GKMDRRQLPELEK
A0A2T5RP38      LDELITKLKERYD--YVIIDGVPVGIVADASIIDRVADLTLFIIRI-GKMDRRQLPEIEK
A0A1A6CF06      LDELINELKNRYD--YIIIDGVPTGVVADASIIDRVADLTLFIIRI-GKMDRRQLPEIEK
A0A1T3D6S8      LDELITELKGMYD--YVIIDGVPTGVVADASIIDRVADLTLFIIRI-GKMDRRQLPEIEK
A0A1P8E011      LDQLISDLRNRYD--YIIIDGVPTGIVADATVVDRVSDLTLFVIRA-GKMDKRQLPEIQK
A0A1V3N3U3      LDELIAELRKRYD--YIVVDGVPLGIVADASIVDRISDLTLFMIRA-GKMDRRQLPEIEK
C2FUH6          LDELIADLRNRYD--YIIVDGVPVGLVADASIVNRISDLTIFMVRV-GKMDRRQLPEIEK
A0A0B8T471      LDVLIAQLKERYR--YIVVDNVPIDLVADAAVVNRISELTVFVVRA-GAMDRRLLPEIEK
A0A4R7D2K0      LDVLITKLKERYR--YIVVDNVPIDLVADAAVVNRISELTVFVVRA-GAMDRRLLPEIEK
A0A2X2J8S4      LDNLIAELKKQYD--YIIIDSVPVEIIADAYITDRVSELTIFVIRS-GKMDKRELPDIEK
A0A3C0S618      LDNLIAELKKQYD--YIIIDSVPVEIIADAYITDRVSELTIFVIRS-GKMDKRELPDIEK
A0A4P7DRF9      LDNLFAELKNRYD--YIIVDNVPLGIVADAKIVNRITDVTLFVVRA-GKMDKRQLPEVQK
A0A239XXC4      LDQLIAELKERYD--YIIVDNVPLGIVADADIVNRITDVTIFVVRA-GKMDRRQLPDVQK
A0A4U9K473      LDNLIAELKERYD--YIIVDNVPLGIVADADIVNRITDVTIFVVRA-GKMDRRQLPEIQK
A0A3M1Y2F5      FEELIEELPLHYQ--YVIVDLPPIMQASDYMLVEKWLDFTAFVVRH-QQTRLQDLERINE
A0A1G1TG88      FDQMLNELYESYD--VVMIDTPPVGLVTDGILIMRRADIPIYIVRA-DYSRKAFIKNMNR
A0A661XXA6      FDEILEKLRGLYD--VILLDTPPIGIVTDGLLAMQKADLPIYILRA-GYSKLSFIGNINR
A0A3D4RLG4      LVSLLQELRKQYD--FIIIDTSPIGQVPDAFALIEQTDLTLYVIRC-MQTNKYFCKNTLQ
A0A2T2UAJ4      MKEFVEALEAKFD--YVLIDTPPALLFSDVLGLAPRCDGTLLVVAA-GETDGRAFDHAAE
A0A6I0DZQ5      LRTLFAKLKEYYD--YIIVDTSPIGVVADAYSFADLSDINLFIVRS-DKTHKLFLRTLTA
A0A1H6Z2F8      IAGLIPALKAGYD--YVLLDSPPVGLVADARLLGPYADMTLYIVRQ-HFTFIHQLAELQK
A0A2P8G5K0      VADLISTLKIRYD--YVLLDSPPVGLVADARLLGAHADMTLYIVRQ-HFTFIHQLAEIQN
A0A4Q3SEI4      INGLLTKLEATFD--FVLIDTCPVDPVTDAYILSESCDLTVFVVRH-NFTPKSMIEMLEE
A0A6A1IRV5      LSMLIEALRPEYD--YIFIDCPPVDIVADAQIIEKWADRTIFVVRS-GLLDRSMLSELEN
A0A519SYE7      FDQMLAELHRTYD--VILIDTPPVGLVTDGILIMRKADVPIYIARA-NYSRKVFLKNLNR
A0A5Q4EKA0      MDEMINYLKSKYD--YVIVDNPPVGIVTDGMKSILMADYPIYIFKA-NYSKRMFIQNVNR
A0A3D4CJE1      LTEIIEELKQTYD--LVIIDNPPIGLVTDALYTISMADYPIYVLRA-NYSKKEYLKNAYR
A0A4Q5ZQ60      FDLVLQELKEIYD--VILIDSPPVGLVTDGILIMRKADVPLYIVRA-NYSKKVFLKNVNK
A0A519Q885      FDQMLQELHRHYD--VIMIDTPPVGLVTDGILIMRKADIPIYIVRA-NYSRKTFLKNLNR
A0A519TAP8      FDQMLAELHRSYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRA-NYSRKAFLKNLNR
R5DEG6          LEALIAELRERYD--YIILDNVPAGVVADAVIVNRVADLTIYVVRA-GRMDRRALPEVEK
A0A3N2LCI3      FGELIGELKSRFD--YVIIDCPPIEVVADAQIIDKFADRTFFVIRA-GLFDRSMLPELDR
A0A642EJV3      LKQTIDTVREQYD--YVLIDCPPVELVADTQIIEKLADRTVFVVRA-GLLERSMLAELEK
A0A6H9Q899      LKQAIDAVRERYD--YVLIDCPPIELVADTQIIEKLGDRTIFVVRA-GLLERSMLAELEK
A0A2K8ZAP1      LANLLQELKERFE--YILVDSPPIGLVTDSQVIAPYADATIFVVRH-DHTPKNYIKMVDA
A0A2T4XEQ1      LKSIVEGVKDQYD--YVVIDSAPYGIITDAAPMMKMADGIVVSVRFNKTQTNELAQTLEN
A0A348PT57      LTKGLDELKKIYD--IIIIDNPPVGLVTDGIASLKLADYPIYIFRN-EYSKKSFIDNINR
A0A3D3LSK1      MKKFLELVESKYD--IVILDSPPLISVTDSEILYNLTDGTVLVAQAEKTDKKAFFKTYNQ
A0A496L711      LLEMLAELQSMYD--YIIIDSSPLGLVADAYALFSVVDIKLLVVRSFKTNKMEFTDLSKR
                           :    :..*  *                                     

A0A1T4NDR5      QFDEVESK-VLGVVITKADF--------------GKK---------------YYS-HYNY
A0A3D5KRM7      ILEETNL---LGIVLNKSRQ--------------PIP-----SYKYGYGYG-YG------
A0A2T2TDL4      VLSGIGAN-VAGVVFNGFDI--------------SMA--------YGYKYR-YRH-YDQY
A0A3D1AEJ6      LYREERLK-NMAVILNGT------------------------GSGIGYGYG-YGY-GYGY
R7JFY1          L--SRRFP-KFSLVLNYVKG--------------HHG-----GYGYGYGYG-YGY-GYGY
A0A1V5S5I3      MYDEHRFK-NMALVLNGTDG--------------GNS---RYGYRYGYHYD-YGS-KSYY
A0A2M7VVW6      LIVENGIK-KLSIVLNGVDY--------------SNK-YYSYGYNYNYSYG-NKD-GYYY
A0A413V760      MYRQEQLR-NMSVILNGVPS--------------DHK---GYGYGYGYGYG-YGY-GYGY
A0A656PYT8      LYREKKFH-NMSIVLNGSTG--------------GARRGYGYGYGYGYGYG-YGY-GYGY
A0A3M1NUH2      SLAAVGAP-AIGTVFNGFDV--------------SMA------YGYKYRYRHYDR-YTQY
A0A359ATS6      IYNEQKYK-NMCVILNGTTG--------------NGG-----RYGYGYRYG-YKY-GYHY
A0A1V6HYH8      LKQELNPK-EIIIVLNGFND--------------K----------FIKQSK-YG--KYGY
A0A2E0MDX6      LRDKKKIK-NLSVILNGAGG--------------DKKYGGFRKYGYGYGYG-YGY-GYGY
A0A2M7KCE1      LLLEKHIE-NLSVVVNGIDI--------------EKS-----RYG---GYN-YGY-GYGY
A0A523GUD4      MIHNVEIE-ISGIILNNMRN--------------VLP--------YYYDHK-Y------Y
A0A6A0Y068      IYEEKKYK-NMSLILNGTEG--------------SGG-----RYGYRYGYR-YGY-HYGY
A0A641X2Z6      RLLQAGAH-ILGVILNKVEL--------------AHT------HGYGYYYY-YGS-DSTS
A0A519PJW5      LMQNNQFS-RMCTILNDAKA--------------AGS------YGYGYGYG-YGY-GYGY
A0A519T3R9      LLHNNQLS-RLCTILNDAQA--------------QGS--------YGYGYG-YGY-GYGY
A0A519SD85      IKQKLMLD-NIYIVFNDFLPDNFFSHYNKSKQILPYPN--------GYYSSYYQSI----
A0A3M1TXY5      LFETGKIQ-NIGLLLNGVAS-----------------------------LSDYGYLDTDY
A0A2E0VQ27      LLDSFQIP-NLYLVLNGVRQ--------------------------KAKKG-----AYAR
R6U429          AYERGVYN-HMAVILNGVDT---------TSKSYGYGH-------YGYGYG-YGY-GYGY
A0A5C8AF42      LFEMQQLN-QLNVILNGVQT---------SKRSSAY----------GYGYG-YNY-GYGY
A0A239K409      ILYNNKFK-QPMIVLNGAKK---------------------------FNSNKYGY-GYGY
A0A350V3E4      TLNKINDT-FIGVILNNFDY--------------QATY--------GSYYKYYYY-YYGS
A0A1V5S1J9      QLEANNVK-KVGLIFNDVNL---------KKLEYS---------RYYDSYG-----SYGK
A0A0A2EYC8      RLYADNVE-DIYVILNDVDK---------SKV------------GYGYGYS-----KYKK
A0A2G6H6Y4      RLYMDKVK-NVYIILNDVDR---------SKTGYGYGYG----YGYGYGYG-----GSKK
A0A1M3DPL8      QLKEDTKS-RFYSILNDVEI---------ESASYSQYYSRKYVYGRSKSYGLGTY-GYGY
A0A1V5F519      QIVTDKLS-NFYVVFTDVET---------D--------------GNYYSYK---Y-GYSS
A0A2G6R1T9      QIVSDKFN-NFYIVLNDINI---------TSKAYGR-------YGYGYGYG---Y-GYGY
A0A1M6MYT6      ELESHQIE-ELGIIVNNVYR---------TKSNRGYGY--------GYGYG-YGY-GYGY
A0A2P8CDS1      EISNQHIR-NVGILLNDI-----------RINNQPLGD--------RYNYS-YMY-GYGY
A0A353WYK7      LVKAHHLD-QSSIIFNANRS------------------------SKNYGYGSYGK-SYGY
A0A355BP94      IVSINKLS-HVAVVLNALPT------------------------SGKT----YG---YGY
A0A136LSC7      VVTLNKLT-HVSSVLNAIPL------------------------SGNY----YG---YGY
A0A5C7N8Q5      VVTLNKLV-HVSTVLNAIPL------------------------NGKY----YG---YGY
A0A2W4RDE8      LYDERKVT-NISILLNDVKY----------SRVNGYSY--------SYKYKQKKYKQRSY
A0A0L8VEV2      VNKKKAMK-NAGIILNDIHL---------SKHAHVGAY--------GADYSHRKNSSYYY
A0A1I2A9Z9      VHRKKSMK-NPGIVLNDIHV---------SKHAHVGSY--------GADYSYKKKSSYYY
A0A212J9Z9      QLKYDGVE-DIALVFNDVKG---------REGYYGTSR--------YYGDRTYYLKKNSY
F5IV23          QLRYDGVE-DIALVFNDVKG---------REGYYGTSR--------YYGDRTYYLKKNSY
F8X2T0          QLGFDGVE-NIALVFNDVKG---------REGYYGTSR--------YYGDKTYYLKKNSY
A0A1M3LAG1      QLGFDGVE-NIALVFNDVKG---------REGYYGTSR--------YYGDKTYYLKKNSY
A0A212K6G4      QLGFDGVE-NIALVFNDVKG---------REGYYGTSR--------YYGDKTYYLKKNSY
A0A4Y9IPG7      QLGFDGVE-NIALVFNDVKG---------REGYYGTSR--------YYGDKTYYLKKNSY
A0A2V3PNY7      QMRNDGLE-HAALVFNDVKG---------REGYYGTSR--------YYGDKSYYLKRNSY
A0A6G7WQ31      QMRNDGLE-HAALVFNDVKG---------REGYYGTSR--------YYGDKSYYLKRNSY
A0A6G7X5K8      QMRNDGLE-HAALVFNDVKG---------REGYYGTSR--------YYGDKSYYLKRNSY
A0A1M5DFS8      QMRNDGLD-HVAIVFNDVKG---------REGYYGTSR--------YYGDKSYYLKRNSY
A0A4Y8KZS5      QMRNDGLE-HVALVFNDVKG---------REGYYGTSR--------YYGDKSYYLKRNSY
A0A142HHS5      LMRNNQFT-RMTTILNDAKA------------QGSYGY--------GYGYG-YGY-GYGY
A0A660LQT8      FYRSNRYP-NMVTVLNGTLD----TYKSYGHHRYGYRY--------GYRYG-YGI-DYGK
A0A350PNH9      FYKDKKFK-NMSLILNGTKA---------QGGRYGHYY--------RYGYH-YGY-GYGY
A0A354LNT9      FYKDKKFK-NMSLILNGTKA---------QGGRYGHYY--------RYGYH-YGY-GYGY
A0A2M6GH67      VIKTNKFN-KLTVILNDAKA------------------------QGGYGYG-YAY-GYGY
A0A389LWV6      EFKGDVTSGKMAIIYNDVDL---------DGNYYASRN--------YYGKSSYYHKHNSY
A0A1G9B1T9      LHQNNTLH-NLYVVLNDVQA--------------------------TKGHGYYE------
A0A161LWY6      QLKTDRMQ-HVGVVLNDIDA---------NTG--GYGY--------NYSYQRYGYGTYGN
A0A6I3N9U6      QLKTDRMQ-HVGVVLNDIDA---------KTG--GYGY--------NYSYQRYGYGTYGN
A0A3D0FMX4      QMEEDGKQ-NIYIVFSDLPHERSGRYN-YNSKSYHYGYG------YGYGYGGYGY-GYGY
A0A1M3MEI8      QLKSDNVH-DFYSILNDVELKSNS-YSRYYSRKYAYGNSRRYGTKSGYGY-GYGY-GYGY
A0A1J5HQM0      QLKSDNV--EAYCILNDVMSEESR-YSRYYSRRYGYGYG------YGYGS-GYGY-GYGY
A0A653AC35      QLKADNIK-NLYLVINDVDSQKSSYYGRYSN--------------YGYGY-GYGY-GYGY
E4T131          QLKLDNIP-QLYTVLNDVLDDESK-YTKYKL--------------YKYAY-LFGF-SYGY
A0A521H707      LIEEYKIR-NLAVVLNGVET---------SKFKYGYGYGYGYGYGYGYGYGYYDDEARKN
A0A1F3D6P8      NFSSNRIT-NYDAVLNSLPL---------DTSPYR-----------------------HY
A0A356Z058      NFSSNRIT-NYDAVLNSLPL---------DTSPYR-----------------------HY
A0A3D1BT36      FYKTHNIE-NFDIIYNDVEI---------KESRYG-----------------------RY
A0A352ME00      NLKSNKLT-NYDIVYNDLNL---------HKSSYR-----------------------HY
A0A3D3HL11      LFRTNNIT-DYDIVFNDLNL---------KKSRYG-----------------------RY
A0A5R9QZP0      FFKANRID-NFDIVYNDLDK---------KKSTYG-----------------------GY
A0A2W7RD29      LKSNDFIK-KVYCILNGVDS--------------------------HYHIG-SNK-NYGY
A0A3N2NDY8      IYRNKRFK-QMSIVLNGTEA---------ASR---------------KSYGAYGYYG---
D7JEV9          RLYSDNIE-DIYIILNDVDK---------SKI--GYVY--------GYGYGMHKKMGNYY
A0A4R6H3B7      VHRKKSMK-NPGIVLNDIHV---------SKH--AHVG--------SYGAD-YSY-----
A0A2W7QSQ0      IIDENIFK-QNFVVLNDSNE-----------------------------YSGSKF-GYGY
R7F6L5          LYAERRYN-NMCLLLNGTSV----------GHNYGYGY--------GYGYG-YGY-GYGY
A0A553GA49      ELDGSFGK-KVTVVLNGVKV---------SRQ--------------RY----YNYSAYYA
A0A497D6F6      ELQNFNVD-KLGVLFNDVSS---------RDMKHGYGY--------TLGYG-YGL-GYGR
A0A5M4AAB9      EISSQNTN-RLGLLLNDISI---------NNQFDRYNN-------HSYGYG-YEN-NYKK
F4KR18          IFEQNKLV-NPAIIFNGVKK---------QNDAYGYSY-------KDYGYA---------
C9LKL0          MNKDKKYR-HLCIALNDVDV------------KAKYGY--------GYGYG-YGY-GYGY
A0A3D0QPV7      LVNENNIQ-RLSVVLNSVDT---------DRGSSGYNY--------GYGYG-YGY-GYGY
A0A496KT23      WYAEKKYN-NLTLLLNGTTD---------ALG--RYGYHKY-----GYGYGGYGY-GYGY
L1M9T3          WYLDKKFH-NLTLLLNGTTD---------ALG--RYGYHKY-----GYGYGGYGYGGYGY
A0A3C0I8F1      LILKNNFT-NLSVVLNAVNK--------------RFSY--------GYGYG-YGY-GAYY
R5JJI4          MYREEQLC-NMCVVLNGVSY---------ERRSYGYGY--------GYGYG-YGY-GYGY
A0A3D2HF71      LYRNETIG-RIGIVMNDISL---------TGY---YGYGLRYGYAGGYGYS-YGY-NYYG
A0A0A2DQN2      LYQEQVLT-NMAIILNGVNH---------NSSSYGYGY--------SYGYGYYGY-GYGY
A0A0A2F2N5      LYDEKILN-NMAIVLNGISS---------QNKGYGYGY--------GYGYG-YGY-GYGY
L1NGW4          LYDNEILR-NMSIVLNGASD---------GGHGYGYGY--------GYGYG-YGY-GYGY
Z4WRA0          LYDNEILR-NMSIVLNGASD---------GGH--GYGY--------GYGYG-YGY-GYGY
U2K8K9          LYDDHILT-NMAIVLNGATE---------SGH--GYGY--------GYGYG-YGY-GYGY
A0A069ZM60      LYDENILT-NMSIVLNGATE---------SGH--GYGY--------GYGYG-YGY-GYGY
J6GV98          LYDENILT-NMSIVLNGATE---------SGH--GYGY--------GYGYG-YGY-GYGY
A0A134B4F8      LYDENILT-NMSIVLNGATE---------SGH--GYGY--------GYGYG-YGY-GYGY
A0A134B8C7      LYDENILT-NMSIVLNGATE---------SGH--GYGY--------GYGYG-YGY-GYGY
A0A4Z0EKR0      IYKSKSLI-APMIVLNDAKQ--------------SNGN--------NYGFG-YGY-GYPV
A0A229I3A5      LYKEKKFK-NMTLILNGTKA---------HGGRYGSHY--------GYGYG-YGY-GYNY
A0A3R6HJB3      LYKEKKFK-NMTLILNGTKA---------QGGRYGSHY--------GYGYG-YGY-GYNY
B5CTK0          LYKSGQFT-NMALILNGVDF--------------KHAH--------KYGYG-YGY-GYGY
A0A1M6B6D5      KFRRGEVK-HISIVINEYVE--------------KSGK----------GYG-YGY-GYGY
A0A451FS66      KYKRGEIK-HISIVLNEYVE--------------KSGR--------GFGYG-YGY-GYGY
A0A2E3GN39      TKENLQVP-SLSIIMNDYGRGVSG-SYYNYGYGYGYGY--------GYGYG-YGY-GYGY
A0A3D1MEL0      TKDNLKVT-NLSIVLNDYGRGVSG-SYYN--YGYGYGY--------GYGYG-YGY-GYGY
F0R0C9          IYQEKRFK-NMAVILNGTLD---------GNNRYGYKY--------GYKYG-YHY-GYGS
A0A2A4N9A6      LMNDHKIS-KLALILNESGGGS------QYGYGYGYGY--------GYGYG-YGY-GYGY
A0A6C0GGI1      LYESKAIN-NLSIVIND----------------INFST--------VYGLS-YN----GK
A0A368D1N7      IKDNLKVP-NLSIVLNDYGRGVSG-SYYNYGYGYGYGY--------GYGYG-YGY-GYGY
A0A3B8TU58      TKENLQIP-NLSIIVNDYGRGVSG-SYYN----YGYGY--------GYGYG-YGY-GYGY
A0A1T5IIR6      LNDKHHLH-NMAIVFNGPQIKKRR-GYGFGSYGYGYGY--------GYGYG-YGY-GYGY
A0A3E0QD27      LIEESKVR-NLAVVLNGVET---------SRFRYGYGY--------GYGYG-YGY-GYGY
A0A0M1W1I6      IYRSGQLN-NMSLVLNGAIV---------KTS--GYG---------GYGYG-YGY-GYGY
A0A4R4GHU2      IYRSGQLN-NMSLVLNGAIV---------KTS--GYG---------GYGYG-YGY-GYGY
I8WPR6          IYRSGQLN-NMSLVLNGAIV---------KTS--GYG---------GYGYG-YGY-GYGY
A0A0K2HKS3      IYRSGQLN-NMSLVLNGAIV---------KTS--GYG---------GYGYG-YGY-GYGY
B6W3W8          IYRSGQLN-NMSLVLNGAIV---------KTS--GYG---------GYGYG-YGY-GYGY
A0A4R4GSI6      IYRSGQLN-NMSLVLNGAIV---------KTS--GYG---------GYGYG-YGY-GYGY
A0A076IRY8      IYRSGQLN-NMSLVLNGAIV---------KTG--GYG---------GYGYG-YGY-GYGY
A0A3A6AD54      IYRSGQLN-NMSLVLNGAIV---------KTG--GYG---------GYGYG-YGY-GYGY
A0A3A6MIU7      IYRSGQLN-NMSLVLNGAIV---------KTG--GYG---------GYGYG-YGY-GYGY
I8WPP8          IYRSGQLN-NMSLVLNGAIV---------KTG--GYG---------GYGYG-YGY-GYGY
A0A372Y7D2      IYRSGQLN-NMSLVLNGAIV---------KTG--GYG---------GYGYG-YGY-GYGY
A0A3E4JJC9      IYRSGQLN-NMSLVLNGAIV---------KTG--GYG---------GYGYG-YGY-GYGY
A0A3E4WDQ0      IYRSGQLN-NMSLVLNGAIV---------KTG--GYG---------GYGYG-YGY-GYGY
A0A414H9P2      IYRSGQLN-NMSLVLNGAIV---------KTG--GYG---------GYGYG-YGY-GYGY
C3R5A8          IYRSGQLN-NMSLVLNGAIV---------KTG--GYG---------GYGYG-YGY-GYGY
A0A1C5XJA7      LYQEKVLN-NMALILNGADL---------ERH--GYGY-------GSYGYG-YGY-GYGN
A0A3E5BU42      LYRDNKLC-NMSLILNGVDP---------SRR--GYG----------YGYG-YGY-GYGK
R7CUW4          LYEDKKLH-NMALVLNGVDP---------HRH--GYG----------YGYG-YGY-GYGR
A0A416GGJ1      LYENKKLN-NMAVVLNAVEH---------RTV---------------YGYG-YGY-SYQY
D1JY72          IYRSGQLN-NMSLVLNGAIV---------KTS--GYG---------GYGYG-YGY-GYGY
D7J4K6          LYRDNKLR-NMAIILNGVGP---------HRR--GYGY--------GYGYG-YGY-GYGY
Q8ABP9          LYRDNKLR-NMAIILNGVGP---------HRR--GYGY--------GYGYG-YGY-GYGY
A0A5M6AHF7      LYRDNKLR-NMAIILNGVGP---------HRRGYGYGY--------GYGYG-YGY-GYGY
D6D2Z5          LYRDNKLR-NMAIILNGVGP---------HRRGYGYGY--------GYGYG-YGY-GYGY
A0A1T3EDR4      IYQERKLS-NLGIVFNGVRI---------G----AFGY--------GYGYG---------
A0A174SDD8      LYQEHKLN-NMAVVLNGTEK---------GSS--GYGY--------GYGYN-YGY-GYAA
A0A1H7RFH3      LYQEHKLN-NMAVVLNGTEK---------GSS--GYGY--------GYGYN-YGY-GYAA
A0A139L1N2      LYQEHKLN-NMAVVLNGTEK---------GSS--GYGY--------GYGYN-YGY-GYAA
A0A174TVL8      LYQEHKLN-NMAVVLNGTEK---------GSS--GYGY--------GYGYN-YGY-GYAA
A0A1H8BJR6      LYQEHKLN-NMAVVLNGTEK---------GSS--GYGY--------GYGYN-YGY-GYAA
R9H6G0          LYQEHKLN-NMAVVLNGTEK---------GSS--GYGY--------GYGYN-YGY-GYAA
A0A412GR09      LYQEHKLN-NMAVVLNGTEK---------GSS--GYGY--------GYGYN-YGY-GYAA
A0A6I0S0M4      LYQEHKLN-NMAVVLNGTEK---------GSS--GYGY--------GYGYN-YGY-GYAA
A0A081PBV5      LYDQRKIS-HMAVLLNGVRL---------NKG--GYGY--------GYGYG-YGY-GYGY
A0A1I2AN85      LYDQRKIS-HMAVLLNGVRL---------NKG--GYGY--------GYGYG-YGY-GYGY
A0A4U0GMP3      LHRQGKLT-NMAILLNGIRK---------GKM--GYGY--------GYGYG-YGY-GYGY
A0A1H6CKR6      LYSSGSLT-NLAILLNGVKF---------TNT--GYGG--YGYGYGGYGYG-YGY-GYG-
A0A235E1C0      IYDSSALT-NMAILLNGVKF---------GSS-YGYGY--GGYGYGGYGYG-YGY-GYG-
R6D982          LYQEHKLN-NMAVVLNGTKQ---------GRR--GYGY--------GYGYG-YGY-GYSY
A0A1F0I8C4      LYQEHRLN-NLAVVLNGAKK---------GSR--GYGY--------GYGYG-YGI-----
A0A3A5RIJ2      LYQEHRLN-NLAVVLNGAKK---------GSR--GYGY--------GYGYG-YGI-----
A0A515IZJ5      LYQEHRLN-NLAVVLNGAKK---------GSR--GYGY--------GYGYG-YGI-----
A0A5M5NLR3      LYQEHRLN-NLAVVLNGAKK---------GSR--GYGY--------GYGYG-YGI-----
A0A0D5BSQ0      IYQEKKLS-NLAIVLNGMKL---------NGY--GY----------GYGYG--SY-GYGY
A0A1T3F6P5      LYQEKKLS-NLAIVLNGMKL---------NGY--GYGY-------GGYGYG--SY-GYGY
A0A0W8EPA0      IYQEKKLS-NLAIVLNGMKL---------NGY--GYGY-------GGYGYG--SY-GYGY
A0A365UKN1      LYQEKKLS-NLAIVLNGMKL---------NGY--GYGY-------GGYGYG--SY-GYGY
A0A4R6WE41      LYQSNKLA-RLGVVLNGVKL---------GSG--AYGY-------GRYGYG--NY-GYSY
A0A2T5RP38      IYQEKKLS-NLAIVLNGLKL---------NGY--GYGY-------GGYGYG--SY-GYGY
A0A1A6CF06      IYQEKKLS-NLAIVLNGLKL---------NGY--GYGY-------GGYGYG--SY-GYGY
A0A1T3D6S8      LYQEKKLS-NLAIVLNGLKL---------NGY--GYGY-------GGYGYG--S---YGY
A0A1P8E011      IYAEKRLS-NLAIILNGLKL---------GQS--------------GYGYG-YGY-GYGY
A0A1V3N3U3      IYRDRKLS-NLAVALNGIKL-----------H--GPGY--------GYGYG-YGY-GYGY
C2FUH6          IRQEGKLS-NMSVILNGLKQ---------GRR--GYGY--------GYGYG-YGY-GYGY
A0A0B8T471      IYRKGKLN-NMAILLNGIRK---------LKS--SYGY--------GYGYG-YGY-GYQK
A0A4R7D2K0      IYRKGKLN-NMAILLNGIRK---------LKS--SYGY--------GYGYG-YGY-GYQK
A0A2X2J8S4      IYQSKKLS-NMAILFNGVNS---------GKR--GYGY--------GYGYG-YGY-GYRY
A0A3C0S618      IYQSKKLS-NMAILFNGVNS---------GKR--GYGY--------GYGYG-YGY-SYRY
A0A4P7DRF9      IYESGDLT-NMAILLNGVKF---------NDT--RYGYGSYGYGYGGYGYG-YGY-GYGN
A0A239XXC4      IYDSSALT-NMAILLNGVKF---------GNN--PYGY--GGYGYGGYGYG-YGY-GYSA
A0A4U9K473      IYDSGSLT-NMAIVLNGVKF---------GNS--AYGS--YGYGYGGYGYG-YGY-GYGA
A0A3M1Y2F5      LFEQERIG-KIGLLINHVAN---PAQFRHGDASY-------------YTYG-KKY-AKVY
A0A1G1TG88      LMRTNNLT-RMCTILNDAQS---KGA---------------------YGYG-YGY-GYGY
A0A661XXA6      LMATGRYP-NLSVILNNVSN---KKT---------------------------GF-GYSY
A0A3D4RLG4      QMEADYKD-KVQLVFSDMPV---EKKRK-RLGRKSYGYAY-------NSYG-YGY-GYGY
A0A2T2UAJ4      MLADGEAD-VAGAVLNQFDA---SSSVL-------------------QSYG-YNY-GYAY
A0A6I0DZQ5      QLKSDNVH-DFYSILNDVEL---KSNSYSRYYSRKYAYGNSRRYGTKSGYG-YGY-GYGY
A0A1H6Z2F8      ASEQ--LP-DLQIVINGTRD-------L-------------------HRYQ-YNY-Y---
A0A2P8G5K0      ARNQSLLP-DLHVVLNGTRS-------L-------------------HRYQ-YNY-Y---
A0A4Q3SEI4      SHKVGALK-NISIVFNGIRS---RGFFK-------------------GKYG-YGY-GYGR
A0A6A1IRV5      MYTGKRFK-NLSMILNGTES---TGG-R-------------------YGYR-YGY-HYGY
A0A519SYE7      LMSNNQFT-KMCTVLNDAKA---QGSYG-------------------YGYG-YGY-GYGY
A0A5Q4EKA0      LIGESHIS-KLSVVLNAVDK---EYS-S-------------------YGYD-KGY-SYGY
A0A3D4CJE1      IYEENNIH-KLSLVLNSVDF---EQG-Q-------------------YGYG-YGY-GYGY
A0A4Q5ZQ60      LIKGHGFS-KLALILNDAQ----TSG-I-------------------YGYG-YGY-GYGY
A0A519Q885      LMRNNQFG-RMCTILNDAQ----AQG-S-------------------YGYG-YGY-GYGY
A0A519TAP8      LMSNNQFS-KMCTILNDAK----AQG-A-------------------YGYG-YGY-GYGY
R5DEG6          LYREGKLR-NMSLILNGTVY---KHG-T-------------------YGYH-YGY-GYGY
A0A3N2LCI3      LYEEKKYR-NMSFILNGSRN---DQG-R-------------------YGYS-HTY-RYGY
A0A642EJV3      IYEEKKYK-NMSLILNGTEG---SGG-R-------------------YGYR-YGY-RYGY
A0A6H9Q899      IYGEKKYK-NMSLILNGTEG---SGG-R-------------------YGYR-YGY-RYGY
A0A2K8ZAP1      LYKEQRFQ-KLSIVLNGVG--------------------------KGESLS-YSY-NYGD
A0A2T4XEQ1      LENIHV-S-ILGLSLVGYD--------------------------HKISSD-YYY-QNKY
A0A348PT57      IFIENKIT-NLSAVLNSVDL--------------SRARYGSYGRGYGAKYG-YGY-GYGY
A0A3D3LSK1      LKRINPHN-LLGAVLNNFK--------------------------FNTSYG-YYY-NYYY
A0A496L711      LYSDNIED-IY-IILNDVD---------------------------KSKIG-YVY-GYGY
                                                                            

A0A1T4NDR5      QYQPKARKRKKK------------------------------
A0A3D5KRM7      ------------------------------------------
A0A2T2TDL4      GPYDQYRSLPEEASA---------------------------
A0A3D1AEJ6      GNDKDK------------------------------------
R7JFY1          GNEKKRK-----------------------------------
A0A1V5S5I3      GK----------------------------------------
A0A2M7VVW6      DDTQKEKLTKRI---------------FKKKK----------
A0A413V760      GNESHGHKHGRYESLKNLFSR------FFKRS----------
A0A656PYT8      GEDESQKSSAVIDSRYNLTQRLKDFLGLNDKK----------
A0A3M1NUH2      TSEYGTYGYRDVKELLKDKES---------------------
A0A359ATS6      GSEKKKTWWGNKG-----------------------------
A0A1V6HYH8      EYKYDIYGYYTDNEEKQSNTKKSMKKYFNYFYKKNK------
A0A2E0MDX6      GYGGNH-GYYEEK-PQKEKTTFNKIFSKK-------------
A0A2M7KCE1      GNSEYHTDYYDESITKKKKNIFTKIISHL-------------
A0A523GUD4      GYDYYNYNTNDK------------------------------
A0A6A0Y068      GSGYH-------------------------------------
A0A641X2Z6      GGGHSSL-----------KVRWKLRRY---------------
A0A519PJW5      GYGSYGMGYYEE-PVQKPTLSQRIKGLFS-------------
A0A519T3R9      GYGTYGMGYYEEMDNRKLTVGQRLKRLFS-------------
A0A519SD85      ------------------------------------------
A0A3M1TXY5      GINGYVKKGKKRKRYEAIN-----------------------
A0A2E0VQ27      YLKKRKPAPALS------------------------------
R6U429          GYGNNVQD----------------------------------
A0A5C8AF42      Y--------EGDSEIEKGNLLNRLWSFISSKFRR--------
A0A239K409      VKK---------------------------------------
A0A350V3E4      EKGKESAGTNGKSTNGVNTNGSQKEKIIKPN-----------
A0A1V5S1J9      KSGYYY---YDKKFKSPRSQYLNYFDNTEEEL----------
A0A0A2EYC8      MGNYYVTEEFEQDDISMLEKIIDKIGEKTKRIRNIHSSRLFK
A0A2G6H6Y4      NNAYYVTAEFEKENTTAFQRVIEFVGDITKKIRNIKK-----
A0A1M3DPL8      GYGYTSSGRSKHKGN---NTYFQYYQDDEKDI----------
A0A1V5F519      KYGYYTS--KGQKNI---DEYRKYYDDNN-EI----------
A0A2G6R1T9      GYGYGYG--VKNKKD---NQYTHYYNDDDIDI----------
A0A1M6MYT6      GHDTDSNQ-----KKGKTKTKGRSIFKPS-------------
A0A2P8CDS1      KTQKPKNRPAAYWRKVNSKKQAQTT-----------------
A0A353WYK7      YEEPEYLESNLFATFKSLFSK---------------------
A0A355BP94      YHEDQKKRSLIRKIFRS-------------------------
A0A136LSC7      YEDKTPRRKRWIKIFGLK------------------------
A0A5C7N8Q5      YEDRTPRMRRWTKIFGLK------------------------
A0A2W4RDE8      KAV---------------------------------------
A0A0L8VEV2      FDSSPSYTG---------------------------------
A0A1I2A9Z9      FESSPSYTG---------------------------------
A0A212J9Z9      YHDDYFEN----------------------------------
F5IV23          YHDDYFEN----------------------------------
F8X2T0          YHDDYFES----------------------------------
A0A1M3LAG1      YHDDYFES----------------------------------
A0A212K6G4      YHDDYFES----------------------------------
A0A4Y9IPG7      YHDDYFES----------------------------------
A0A2V3PNY7      YHDDYFEK----------------------------------
A0A6G7WQ31      YHDDYFEK----------------------------------
A0A6G7X5K8      YHDDYFEK----------------------------------
A0A1M5DFS8      YHDDYFEK----------------------------------
A0A4Y8KZS5      YHDDYFEK----------------------------------
A0A142HHS5      GTKGMGYYDETEQKPTLGKRIKSLFS----------------
A0A660LQT8      S-----------------------------------------
A0A350PNH9      HYGSDKNGGAKIGK----------------------------
A0A354LNT9      HYGSDKNGDAKIGK----------------------------
A0A2M6GH67      S--------------------NSYYDLEEKEGVLTRLKRNFT
A0A389LWV6      YNNDEFVDEQNQN-----------------------------
A0A1G9B1T9      ------------------------------------------
A0A161LWY6      NPVTKDYIKDYYEEE---------------------------
A0A6I3N9U6      NPVTKDYIKDYYEEE---------------------------
A0A3D0FMX4      G--------YGSRKKGT----NHYYTDE-DE-----------
A0A1M3MEI8      T--------KVSDKKNSDGTYYQYYQDDAHDI----------
A0A1J5HQM0      G--------NTRKKKEASEKYFQYYQDD-REI----------
A0A653AC35      A--------QLKKKKEY-DKNTHYYEDD-DDI----------
E4T131          T--------SKKKKGDA-EKYFHYYQDD-TEI----------
A0A521H707      LSFFEKFKNRFSRK----------------------------
A0A1F3D6P8      TSYYLKK-----------------------------------
A0A356Z058      TSYYLKK-----------------------------------
A0A3D1BT36      HGYYKKPKAFTARK----------------------------
A0A352ME00      SNYYIKN-----------------------------------
A0A3D3HL11      DNYYKQ------------------------------------
A0A5R9QZP0      DTYYHNNPKRKK------------------------------
A0A2W7RD29      Y--------------------EVYKDNKGLVNRVKNYLRSSK
A0A3N2NDY8      ------------------------------------------
D7JEV9          V--------TEEFEQDDVSILEKLIYKISDMTKKIRNIKK--
A0A4R6H3B7      ---------KKKSSYYYFESSPSYTG----------------
A0A2W7QSQ0      YSGKDTDVVSTRA-----------------------------
R7F6L5          GYAYGDDNDKKKKKRKKS------------------------
A0A553GA49      K--------PNLN-----------------------------
A0A497D6F6      TAKK--------------------------------------
A0A5M4AAB9      KISKELKPQRRSQKTEV-------------------------
F4KR18          ------------------------------------------
C9LKL0          GNYSYGYGEQYNNRKSKKKLSGRLLSKLRK------------
A0A3D0QPV7      TYGGNYYTERTNATEKK----IRFFRRKNKK-----------
A0A496KT23      GS----------------------------------------
L1M9T3          GK----------------------------------------
A0A3C0I8F1      GKRSVAYYNDSESNYKPIRWINRIYKRAMSFRK---------
R5JJI4          G--------NEHHGNNKQGVAKRIINKLIAFFK---------
A0A3D2HF71      DYVYSRYGHSGEG--------KYYIEE---------------
A0A0A2DQN2      G----HLGKKSLR--------KRFVERMKMFFVS--------
A0A0A2F2N5      G----Y-GNKKER--------SGIFSRFRKS-----------
L1NGW4          G----Y-GN-KKK--------KGILYRLGLKK----------
Z4WRA0          G----Y-GN-KKK--------KGILYRLGLKK----------
U2K8K9          G----Y-GNKKKK--------KTLLQRLGIRR----------
A0A069ZM60      G----Y-GNKKKK--------KGLLRRLGLR-----------
J6GV98          G----Y-GNKKKK--------KGLLRRLGLR-----------
A0A134B4F8      G----Y-GNKKKK--------KGLLRRLGLR-----------
A0A134B8C7      G----Y-GNKKKK--------KGLLRRLGLR-----------
A0A4Z0EKR0      K------------------------EKMKKKATG--------
A0A229I3A5      N--------KEKNGGGKILNNWIIE-----------------
A0A3R6HJB3      N--------KEKNGGAKS------------------------
B5CTK0          G--------DTKT-------------KHKKKS----------
A0A1M6B6D5      GGSSYKSYGNGYHEAIKKPSLWKRMKKSITKK----------
A0A451FS66      GDGSYKSYGDGYHGPLGKKSLADRIKNIFKQT----------
A0A2E3GN39      GYGYYSDSDNTRKKER-----SSLFSIFRKKS----------
A0A3D1MEL0      GYGYYSDPDNTRKKER-----SILFSRFRKKT----------
F0R0C9          K------DYYNNE-----------------------------
A0A2A4N9A6      GYGYYAEDASRNKSLWERITNSKFISLLKN------------
A0A6C0GGI1      ANGYYKN-----------------------------------
A0A368D1N7      GYGYYSDPDNTRKK-----KRSSLISRFRKKS----------
A0A3B8TU58      GYGYYSDPDETREN-----ERTGFFSRFRKNS----------
A0A1T5IIR6      G-------DEPKK--------KRFLGIFKRK-----------
A0A3E0QD27      G-------YYDDEAKKPLTTWQAFKARLGKK-----------
A0A0M1W1I6      V--------DGSE--------SSWKRLFKKKS----------
A0A4R4GHU2      V--------DGSE--------SSWKRLFKKKS----------
I8WPR6          V--------DGSE--------SSWKRLFKKKS----------
A0A0K2HKS3      V--------DGSE--------SSWKRLFKKKS----------
B6W3W8          V--------DGSE--------SSWKRLFKKKS----------
A0A4R4GSI6      V--------DGSE--------SSWKRLFKKKS----------
A0A076IRY8      V--------DGSE--------SCWKRLFRKKS----------
A0A3A6AD54      V--------DGSE--------SCWKRLFRKKS----------
A0A3A6MIU7      V--------DGSE--------SCWKRLFRKKS----------
I8WPP8          V--------DGSE--------SCWKRLFRKKS----------
A0A372Y7D2      V--------DGSE--------SCWKRLFRKKS----------
A0A3E4JJC9      V--------DGSE--------SCWKRLFRKKS----------
A0A3E4WDQ0      V--------DGSE--------SCWKRLFRKKS----------
A0A414H9P2      V--------DGSE--------SCWKRLFRKKS----------
C3R5A8          V--------DGSE--------SCWKRLFRKKS----------
A0A1C5XJA7      N-------KNK-------------------------------
A0A3E5BU42      R-------KNK-------------------------------
R7CUW4          Y-------GYGNK--------KHGRN----------------
A0A416GGJ1      K--------GGE------------------------------
D1JY72          V--------DGSE--------SSWKRLFKKKS----------
D7J4K6          G-------KHGRR--------K--------------------
Q8ABP9          G-------KHGRR--------K--------------------
A0A5M6AHF7      G-------KHGRR--------K--------------------
D6D2Z5          G-------KHGRR--------K--------------------
A0A1T3EDR4      ---------QELK--------GGLWSRFLRMFRRV-------
A0A174SDD8      T--------QKKK--------GGWWRRKGKK-----------
A0A1H7RFH3      T--------QKKK--------GGWWRRKGKK-----------
A0A139L1N2      T--------QKKK--------GGWWRRKGKK-----------
A0A174TVL8      T--------QKKK--------GGWWRRKGKK-----------
A0A1H8BJR6      T--------QKKK--------GGWWRRKGKK-----------
R9H6G0          T--------QKKK--------GGWWRRKGKK-----------
A0A412GR09      T--------QKKK--------GGWWRRKGKK-----------
A0A6I0S0M4      T--------QKKK--------GRWWRRKGKK-----------
A0A081PBV5      G--------NETK--------KTIWDKLFGKR----------
A0A1I2AN85      G--------NETK--------KTIWDKLFGKR----------
A0A4U0GMP3      G--------NTKT-----------------------------
A0A1H6CKR6      ---------NRKK--------KSFFQKLLGR-----------
A0A235E1C0      ---------QPKK--------KGFFSRLFGKN----------
R6D982          G-------NDEKK--------KNWFFGKRKKESV--------
A0A1F0I8C4      ---------DVEK--------SGWWSRMKKRMKR--------
A0A3A5RIJ2      ---------DVEK--------SGWWSRMKKRMKR--------
A0A515IZJ5      ---------DVEK--------SGWWSRMKKRMKR--------
A0A5M5NLR3      ---------DVEK--------SGWWSRMKKRMKR--------
A0A0D5BSQ0      G--------EEKK--------KSVFDWFKRS-----------
A0A1T3F6P5      G--------EEKK--------KSVFDWFKRS-----------
A0A0W8EPA0      G--------EEKK--------KTIFNWFKRS-----------
A0A365UKN1      G--------EEKK--------KSIFDWFKRS-----------
A0A4R6WE41      G--------NEK---------KSIWKKIFG------------
A0A2T5RP38      G--------EEKK--------KSVFDWFKRS-----------
A0A1A6CF06      G--------EEKR--------KSIFSWFKRS-----------
A0A1T3D6S8      G--------EEKK--------KSVFDWFKR------------
A0A1P8E011      G--------REEG--------QNSWRKIARSIRTIFTRKIKH
A0A1V3N3U3      G--------NTEQ--------QVWYKRWWRKIKS--------
C2FUH6          S--------NEKR--------HNLFSSLLEKIKGL-------
A0A0B8T471      E--------KAGL--------RGFFNRLFRR-----------
A0A4R7D2K0      E--------KAGL--------TGFFRRLFQR-----------
A0A2X2J8S4      G--------DDK---------KSFWKKVFNK-----------
A0A3C0S618      G--------DDK---------KSFWKKVFNK-----------
A0A4P7DRF9      H--------KKK---------KSIFNIFKKR-----------
A0A239XXC4      Q--------QKR---------GFFSRLFGKK-----------
A0A4U9K473      Q--------KKK---------RFLL-----------------
A0A3M1Y2F5      GAMHT-------------------------------------
A0A1G1TG88      GSGTYG---------QGYYEDHGSAPPPTLAQKLGRLFK---
A0A661XXA6      GDVYTS---------SPYYQE---------------------
A0A3D4RLG4      GGKND----------YNYYSDDE-------------------
A0A2T2UAJ4      SYRRL----------YEYYRDEDKGAPEPSGIRAWWGG----
A0A6I0DZQ5      GYTKVSDKKNSDGTYYQYYQDDAHDI----------------
A0A1H6Z2F8      ------------------------------------------
A0A2P8G5K0      ------------------------------------------
A0A4Q3SEI4      KKVYG----D-----HVYKSEAVQRKA---------------
A0A6A1IRV5      ASYYGSKDK---------------------------------
A0A519SYE7      --GYGSYGMG-----Y--------------------------
A0A5Q4EKA0      --YYGGYGSG-----YGYYDDQINIVKRSFWKRILGLGSKKL
A0A3D4CJE1      GYGYG------------YYEDVPEKQVWWKAIFNKK------
A0A4Q5ZQ60      GYGYG-YGYG-----YGYYDE--QEKKGLLGRIKDKFKKA--
A0A519Q885      GYGYG--TYG-----MGYYEEPSQGKPSISQRFKRLFS----
A0A519TAP8      GYGSSGTGYG-----MGYYDEAVQ-PPTLGQKIKSFFS----
R5DEG6          GYGYG---YG-----QRKKK----------------------
A0A3N2LCI3      GYGYG---YG-----YNYGSGEKKEE----------------
A0A642EJV3      HYGYG---SG-----YHYGSD---------------------
A0A6H9Q899      HYGYG---SG-----YHYSSDEKRVGGG--------------
A0A2K8ZAP1      ----------YMDLTKKFD-----------------------
A0A2T4XEQ1      KYYSYNDYLEYTEEKEEVA-----------------------
A0A348PT57      GYGYTSGNGYYSEDNEEEE-----PKLNFLRNLRSKLKNDDN
A0A3D3LSK1      --------YYSGDSKKKNN-----------------------
A0A496L711      GMPKKMGNYYVTEEFEQDDVSILEKLIYKISDMTKKIRNIKK
                                                          

© 1998-2021Legal notice