BYKdb

Dataset for cluster orphancd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

220 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A7C7CKY6      ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ------------------------------------------------------------
A0A519SD85      ------------------------------------------------------------
A0A3M1TXY5      ------------------------------------------------------------
A0A2E0VQ27      --------------------------------------MTFNKEYKMIIRPLLK------
R6U429          ------------------------------------------------------------
A0A5C8AF42      ------------------------------------------------------------
A0A353WYK7      ------------------------------------MEQNQQFDFDKLQMVFKR------
A0A355BP94      ---------------------------MSKQLNSPTTDPIEGFDLDKLWVLLKK------
A0A136LSC7      ---------------------------MLQPKEIGP--QVQSIDTEKLSAVIRK------
A0A5C7N8Q5      --------------------------MLKEPKDIGPLTEVQSIDTEKLAAVFRK------
A0A239K409      ------------------------MVMIDKEAQKMGNRQNEQESFIDSFFKYVR------
A0A1V5S1J9      --------------MDNNQQYTQNQYTSQANAFSDDDGGGQKFDIMLWVLRFLK------
A0A0A2EYC8      -------------------MENTNN-IPNIQTFSEEE-ASS-FNLMEWVMRFLK------
A0A2G6H6Y4      -------------------METSNNQIQSMQQFSEEDNTSS-LSVMEWIMRCVR------
A0A1M3DPL8      -------------------MNMEEENKDIKTSDFTDEESS--FDIMEWVMLFVS------
A0A1V5F519      ----------------------MNPDTGSINQNFTEEESS--FDFQKWLHLFIK------
A0A2G6R1T9      ----------------------MEENSLNQQQFDDSEESG--FDFMSWVILLVQ------
A0A350V3E4      ------------------------------------------------------------
A0A6J4K208      ---------------------------------MKNSSSREKMGWTYVLRNLRR------
A0A2W4RDE8      -------------------------------------MEEEKINIKKIFHKLIS------
A0A0L8VEV2      --------------------------MKTMEDFSKSLEREDMLAIKKFFHKLKR------
A0A1I2A9Z9      --------------------------MKTMEEYSNSLEREDMLSVKKFFHKLVR------
A0A212J9Z9      ---------------MDNN--NKKVIESDPYFEEVKTKTNISFDFVLWFYRILK------
F5IV23          ---------------MDNN--NKKVIESDPYFEEVKTKTNISFDFVLWFYRILK------
F8X2T0          ---------------MDIN--NKPGADTDPYFEEIKSKTTLSFDFVLWFYRILK------
A0A1M3LAG1      ---------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVLWFYRILK------
A0A212K6G4      ---------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVLWFYRILK------
A0A4Y9IPG7      ---------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVLWFYRILK------
A0A1M5DFS8      -------------MEQNINTTRPNDYGADPYFDEVQAKSKFSFDFVLWFYRILK------
A0A4Y8KZS5      -------------MEQSLN--KPNDFGTDPYFDEIQAKTKFSFDFVLWFYRILK------
A0A2V3PNY7      -------------MEQNIN--RPADFGTDPYFDEVQAKTKFTFDFVLWFYRILK------
A0A6G7X5K8      -------------MEQNIN--RSPDFSTDPYFDEVQAKTKFSFDFVLWFYRILK------
A0A2P8CDS1      ------------------------MDTQNPLTPNQPTTFSRPRNYRKYFFLLLS------
A0A660LQT8      --------------------------MEDKDNITPSQETKNGVDIVDVLYLCLD------
A0A389LWV6      ----------------MESTNTKSTNFSIDDTNFQHPGNTSSFDLVLWIFRILK------
A0A1G9B1T9      --------------------------METSRYSHTQALKSDPIDLSVITKKIIR------
A0A350PNH9      -------------------MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYLCLV------
A0A354LNT9      -------------------MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYLCLV------
A0A161LWY6      -----------------METNNNNQYQNYPLSNSDMEEDESGFDIIEWLFKILR------
A0A6I3N9U6      -----------------METNNNNQYQNYPLSNSDMEEDESGFDIIEWLFKILR------
A0A3D0FMX4      ----------------------MATDTNVQNQDFTNQDDRIQFDVMEWVFKFLS------
A0A1M3MEI8      -----------------------MEQPVKPRERVIPEEEESGFDIMEWVAHFIG------
A0A1J5HQM0      -----------------------MEQNKPANP--FSEEEESSFDIMEWVNIFLH------
A0A653AC35      ---------------------MEENPYNTQYPQQFTEEEESSFDIKEWAFLFLH------
E4T131          -----------------------MDKFNLEKP--FNSEEESGFDIMEWVSYFLN------
A0A2W7RD29      --------------------------MNNKSESDPLLLSSQKIDFSVFFKRLGK------
A0A3N2NDY8      --------------------------MSDNINVTQESEAAEEFSLKDFLACCLS------
D7JEV9          -----------------------MEQNNNISNNTFNEEETSSFNFMEWAIRFLK------
A0A4R6H3B7      --------------------------MKTMEEYSNSLEREDMLSVKKFFHKLVR------
A0A521H707      ------------------------------MAKKKISNLNEEFDFKLFTIIARK------
A0A1F3D6P8      ---------------------------------MTKETDSGIALIKHYLQDIAY------
A0A356Z058      ---------------------------------MTKETDSGIALIKHYLQDIAY------
A0A3D1BT36      -------------------------------MSKNNETKSESLKIKEFIFKVFS------
A0A5R9QZP0      -------------------------------MSLNNNHPEEGFNIKEFILLTFR------
A0A3D3HL11      ----------------------------MQLMTNNNDSQSEAFNIKEFLAEALS------
A0A6L8U6G9      ------------------------------MTNNQNDSQSEAINIKEFITEALS------
A0A352ME00      -------------------------------MLKTIEPDSSIAPLKYFILKVAS------
A0A6L8UH35      -------------------------------MLKTNDSDASIAPIKYFIFKVAS------
A0A3P1Z8V4      -----------------------MIQSSSSHPDYPHLPSDSDTNILPVLLKCWGIFRR--
A0A1M6MYT6      --------------------MKKQQNDKDILNFYGQLEEESLISKKTLFKCFR-------
A0A2W7QSQ0      ----------------------------MRKINKKVNSNEEPINIKLILRTILK------
A0A3D5KRY6      ----------------------------------------------FIKATLLK------
R7F6L5          -----------------MANQIKENEAANISPYYEQAAPASLVSVQGFLSFVRH------
A0A7C5MRV2      ----------------------------MRPVLKSRGTGNEEINLSKIWDLFEN------
A0A229I3A5      -------------------------------MARP-NQEEDFIRIQDLLYLCLT------
A0A3R6HJB3      -------------------------------MARP-NQEEDFIRIQDLLYLCLT------
R6NN15          -------------------------MSETQQHTRPAAKADDFIRIQDLYYLCLA------
A0A553GA49      ----------------------------------MNLENDQSNDLKNVLHKVGK------
A0A497D6F6      ------------------------------------------------------------
A0A5M4AAB9      ------------------------------------------------------------
F4KR18          ------------------MNEFEYPKAILLNSNLKDSSDSQVDYWGLLHKFILS------
A0A2M6GH67      --------------------------------------------FITLLVVTRK------
A0A7K1TE30      MASNENAELEELIRRATSGQEGPPAAGGPIASDAGESEPGEGLDIPTLVLVAKR------
A0A7D4BE70      ------------------------------------------------------------
A0A142HHS5      MASTENAELEELIRRASTGGEAAPPTGASFAEE--DTEDGDNFDLSTLVLVARR------
A0A7D4C435      MALSENAELEELIRRTTTGTEATLPVSGGTGED--ESGGESSFDLTTLVLAARK------
C9LKL0          ---------------------------MEYSQKNEVQNSEFKIVPFLLLCYHVFLA----
A0A3D0QPV7      ----------------------MIDEKIQRQSESFSQYKERITNFSNEFELGLFLYIARK
A0A496KT23      ------------------MQRSAENFSQNSSFISQTSSVSILELLRDAWLLCLA------
L1M9T3          -------------------------------------------MVRDGFYLCLA------
A0A3C0I8F1      -----------DYFVKKIIPPTTVFLERNHENINKILEESEGMDIVNDFDFEKFVEILRG
R5JJI4          ------------------------------------------------------------
A0A0A2DQN2      -----------------------------------MIRQVSDVNLLDVLRYLVS------
A0A0A2F2N5      -----------------------MTPQSSSKQTKSAGTVVADINLIDLFFYLLG------
L1NGW4          ------------------------MANTQETTSTQPAEKGLEVNLVDIFFYLLR------
Z4WRA0          ------------------------MANTQETTSTQPAEKGLEVNLVDIFFYLLR------
U2K8K9          --------------------------MPEQQITNRPSDKGADLNLVDIFMYLYR------
A0A069ZM60      -------------------------MSTQTNRSNQAGEKAAEVNLLDIFFYLLR------
J6GV98          -------------------------MSTQTNRSNQAGEKAAEVNLLDIFFYLLR------
A0A134B4F8      -------------------------MSTQTNRSNQAGEKTAEVNLLDIFFYLLR------
A0A134B8C7      -------------------------MSTQTNRSNQAGEKTAEVNLLDIFFYLLR------
A0A3D2HF71      --------------------MTSPSPLNNPSQPYYIPPEEEGLDFKRYLSLFIS------
A0A4Z0EKR0      --------------------------MTNDELFPLKTEQPETADLKSVLLSYAR------
B5CTK0          -------------------------MAEKKQATDLLKGEDSSFNIGEILHMFLS------
A0A1M6B6D5      -----------------------------MSEEFETNEAGTTFDFKGFLIRLLR------
A0A451FS66      -----------------------------MNQEFDIKQADGSFDFKGFFDRLLR------
A0A2E3GN39      ------------------------------------------------------------
A0A3D1MEL0      ------------------------------------------------------------
A0A519UDD1      --------------------------MANDDLFPVSREQPGTFDARRILLQYTR------
A0A2A4N9A6      ------------------------------MKENQIQNPLPDLDIGLLIGIFRK------
A0A6C0GGI1      ---------------------------------MANQPNESKLDLKQLFSRYFT------
A0A368D1N7      -------------------------MSEPSKKKQQSSVLYDKFNVGLLLYVLRK------
A0A3B8TU58      ------------------------------------------------------------
A0A1T5IIR6      -----------------------------MKTAPRKVTRNEQVNLVDLFYYLIG------
A0A3E0QD27      ----------------------------MGKKKITNLNEEFDFKLFSIIAKKNA------
A0A6N8DCX3      --------------------------MDLLLQELQGGKPDDALRVKEFFYLCLA------
F0R0C9          --------------------------MAIPNNPTRPKQGDDFIRIQDLFYLCLA------
A0A0M1W1I6      --------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS------
A0A4R4GHU2      --------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS------
I8WPR6          --------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS------
A0A0K2HKS3      --------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS------
B6W3W8          --------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS------
A0A7M3EEL4      --------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS------
A0A076IRY8      --------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS------
A0A3A6AD54      --------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS------
A0A3A6MIU7      --------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS------
I8WPP8          --------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS------
A0A372Y7D2      --------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS------
A0A7K3KFI2      --------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLS------
A0A3E4JJC9      --------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLS------
A0A3E4WDQ0      --------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLS------
A0A414H9P2      --------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLS------
A0A7K0JKU9      --------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLS------
C3R5A8          --------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLS------
A0A1C5XJA7      -----------------------------MQNNIQSNKNDQNINLLDLLMYLAS------
A0A285T4L1      -----------------------------MQNNTLSNKNEQSINLVDLFVYLLS------
A0A3E5BU42      -----------------------------MQNNTLSNKNEQSINLVDLFVYLLS------
R7CUW4          -----------------------------MQTTSNNNRNEQGINVVDLLVYFAS------
A0A416GGJ1      -----------------------------MQTNKKVDSG---LNLIDVFSFLAS------
D1JY72          -----------------------------MSGDKTLSGGGFNINPVDIIMYLLS------
A0A7G5NJU1      -----------------------------MQNNSLSNKNEQGVNLVDLSVYLLS------
D7J4K6          -----------------------------MQNNSLSNKNEQGVNLVDLSVYLLS------
Q8ABP9          -----------------------------MQNNSLSNKNEQGVNLVDLSVYLLS------
D6D2Z5          -----------------------------MQNNSLSNKNEQGVNLVDLSVYLLS------
A0A1T3EDR4      -------------------------MIRNSKYINIRGTWGENFHILDLFKYALG------
A0A6N8KXI9      -----------------------MSNTANNYQPIEGLNAHKTINLLDIVNYLLH------
A0A174SDD8      ---------------------------MEKHKKLAVTEEEKSINIVDLFIYLLV------
A0A1H7RFH3      ---------------------------MEKHKKLAVTEEEKSINIVDLFVYLVV------
A0A139L1N2      ---------------------------MEKHKKLAVTEEEKSINIVDLFVYLVV------
A0A174TVL8      ---------------------------MEKHKKLAVTEEEKSINIVDLFVYLVV------
A0A1H8BJR6      ---------------------------MEKHKKLAVTEEEKSINIVDLFVYLVV------
R9H6G0          ---------------------------MEKHKKLAVTEEEKSINIVDLFVYLVV------
A0A412GR09      ---------------------------------MAVTEEEKSINIVDLFVYLVV------
A0A7J5JXN6      ---------------------------------MAVTEEEKSINIVDLFVYLVV------
A0A081PBV5      ------------------------MDNLNNINLMPKAKEEKSINLLDILKYLLF------
A0A1I2AN85      ------------------------MDNLNNINLMPKAKEEKSINLLDILKYLLF------
A0A4U0GMP3      ------------------------MENSAATNYLVQEKEEKSINVIDILKYLLF------
A0A1H6CKR6      ----------------------------MNKDFLIKDKQTQSINVLDVLKYLLS------
A0A235E1C0      -----------------------MVNHSTNKPFQGKGKQDQSLYVLDILRYLLA------
R6D982          ---------------------------MEKQVKKILAEEDKSINLVDILMYLLS------
A0A1F0I8C4      ---------------------------MEKQRKLALTEEEKSVNIVDVFMYLIA------
A0A3A5RIJ2      ---------------------------------MALTEEEKSVNIVDVFMYLIA------
A0A515IZJ5      ---------------------------------MALTEEEKSVNIVDVFMYLIA------
A0A7J4Y2H6      ---------------------------------MALTEEEKSVNIVDVFMYLIA------
A0A0D5BSQ0      --------------------------MINQNKQNV--QKDGIINVLDILKYFLF------
A0A1T3F6P5      ------------------------MDTINQKNQVVGNKKEHSVNVLDILKYLLH------
A0A0W8EPA0      ------------------------MDTINQKNQVIGNKKEHSVNVLDILKYLLH------
A0A365UKN1      ------------------------MDTINQKNQVIGNKKEHSVNVLDILKYLLH------
A0A4R6WE41      ------------------------MVKNKDTEGVVQEQRDPSLNVLDVLKYLLS------
A0A2T5RP38      ------------------------MNTLNQKEYRIGERKEQTINVLDLLKYLLH------
A0A1A6CF06      ------------------------MNQYSKNSV----QKENTINVLDIFKYLLF------
A0A1T3D6S8      ------------------------MNQYNKHSV----QKENTINVLDIFKYLLF------
A0A1P8E011      ----------------------------MKTTHYNQLQKDKSINVLDVLAHLLY------
A0A1V3N3U3      ------------------------MNNILERTGAGAERKNNSVNVLDIFKYLLF------
C2FUH6          --------------------------MVNNQITQNITKADKSVNIIDLFKYLMI------
A0A0B8T471      -----------------------MDNTNYNPYIESREKEGKSLNLIDLIKYLLL------
A0A4R7D2K0      -----------------------MDNTNYNPYIESREKEGKSLNLIDLIKYLLL------
A0A2X2J8S4      ---------------------MENRPEVVNNQFFGA-KNNSTFNVLDIIKYLLF------
A0A3C0S618      ---------------------MENRPEVVNNQFFGA-KNNSTFNVLDIIKYLLF------
A0A4P7DRF9      -------------------------MSKISNTYMQK-QQEKSINILDLFRYLLA------
A0A239XXC4      ----------------------------MNKSFQGKGKQDQSLYVLDILRYLLG------
A0A4U9K473      ----------------------------MSKPFQGKGKQDQSLHVLDILRYFLS------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A7C7CKY6      ------------------------LGKTTYQKPVEIGVWQKL------------------
A0A1G1TG88      ---------------------------------------MKV------------------
A0A661XXA6      ---------------------------------------ISL------------------
A0A519SD85      ------------------------------------------------------------
A0A3M1TXY5      ------------------------------------------------------------
A0A2E0VQ27      --ASPVLIGLITIAILVTRRAVT-YMTPEYRAGGAIKINNLNYTQAAINLFGEENEKNLP
R6U429          ------------------------MRDLASFTGGLSRMRSSG------------------
A0A5C8AF42      ------------------------VIQLDNQDNAKDIIELEN------------------
A0A353WYK7      --SLPVLIMLLIFSVATAYLTIR-YTKDLYQSESVLQLDIKS------------------
A0A355BP94      --NALIIILLFLSTNLIAYLKIR-WTKDEFESYSELKLEVKQ------------------
A0A136LSC7      --NLVWIVLIFIAVNLAAYLTIR-YTKDLFESESEMKLDIKR------------------
A0A5C7N8Q5      --NLIWIILIFIAANLAAYLTIR-YTKDLFESESEMKLDIKR------------------
A0A239K409      --YWYLFLLGLLITVGTAYVYIQ-HATPLYLISGTLLIKTSG------------NEGQLS
A0A1V5S1J9      --SWYLFVISLAIFLSIAYVKNR-SWQPNYKSSALVIIEENK-------------GLSGA
A0A0A2EYC8      --YWYLFAIGVVIALTIAYYQNR-SFVPIYNSSLRLLLK-QE----------------SG
A0A2G6H6Y4      --YWYLFVIGASIGFGLAFYKNQ-KVVPNYLSYSQILLEDKK----------------AD
A0A1M3DPL8      --HWYLILISVFVFMFLAYMQNR-KWLPSFKSSATVIIDESR-------------GSMNS
A0A1V5F519      --NWYLFLIFIPFFLIGGYLKNR-SWMPLYQSVGTIIINENK-------------YR-SS
A0A2G6R1T9      --YWYLFVIFGVLAFGASYLKNR-SWVPVYFSSGKLMIDPNA-------------GQ-NN
A0A350V3E4      ----MPILLSLAVGLVVSYFYAY-SQVDIYASASSMRLSKPK--------------ENVL
A0A6J4K208      --RWYLFALALAFAVAGAYLYLQ-FTPRVYNLTATLLVDGPG------------------
A0A2W4RDE8      --KWYYFPLGLLITMPLAYAYIQ-LTEPRYLVRASMLLKGEK---------DKGPSQFLK
A0A0L8VEV2      --NWYWFMIAGIIGGAGGYLLTQ-VTPPSYELNSLFLIKKKD---------NAQVQLDLP
A0A1I2A9Z9      --NWYWFMIVGIIGVGLGYLKTQ-VTAPAYKLESLFLIKTDN---------KGGLRMDFP
A0A212J9Z9      --YWYLFIISVALFLGYAYIKNK-SWVPVFYVQALMILEDRN-----------------T
F5IV23          --YWYLFIISVALFLGYAYIKNK-SWVPVFYVQALMILEDRN-----------------T
F8X2T0          --YWYLFVISVVLFMAYAFIKNK-SWVPLYGIQAMIILEDRG-----------------S
A0A1M3LAG1      --YWYLFVISIALFMAYAFIKNK-SWVPFYGIQAMIILEDRG-----------------S
A0A212K6G4      --YWYLFVISIALFMAYAFIKNK-SWVPFYGIQAMIILEDRG-----------------S
A0A4Y9IPG7      --YWYLFVISIALFMAYAFIKNK-SWVPFYGIQAMIILEDRG-----------------S
A0A1M5DFS8      --YWYLFVLSLALFLGYAYLKNK-SWTPLYRSGAVLMMESRG-----------------N
A0A4Y8KZS5      --YWYLFILSLALFLGYAYLKNK-SWTPLYRSSATLMMEPRG-----------------N
A0A2V3PNY7      --YWYLFALSLALFLGYAYIKNK-SWTPLYQSGAVLMMESRG-----------------N
A0A6G7X5K8      --YWYLFAISLALFLGYAYLKNK-SWTPLYQSGAVLMMEQRG-----------------N
A0A2P8CDS1      --HWYWFVIAFILTVTGIWLYYR-YSHPVYAVSSTMLIHEQQ-------NQNPLTTQKDP
A0A660LQT8      --RWYWFVVSVLLFLGLGMYMIL-RTPPVYNRYASVLIKDNQ------SSKNTSIDQQLA
A0A389LWV6      --YWYLFLVVILLSLSLALLKNK-TWTPTYKTSSTILINENK---------------GQQ
A0A1G9B1T9      --KWYLLLGSLLLTLALAYVVIL-TTPEVYKVSSSMLVRDES---------------ATG
A0A350PNH9      --RWRWFVISLVVTLGIATYHLL-STPCVYQRTASILIKEDG----------KSQSINSD
A0A354LNT9      --RWRWFVISLVVTLGIATYNLL-STPCVYQRTASILIKEDG----------KSQSINSD
A0A161LWY6      --HWYLFVIALAISLSISFIANR-TWKPSYQVSARVILGGGQ--------------ASAS
A0A6I3N9U6      --HWYLFVIALAISLSVAFIANR-TWKPSYQVSARVILGGGQ--------------ASAS
A0A3D0FMX4      --VWYLYVICLAIAFGISIYSNR-KWVPTYRTAGTLIINEY---------------GSQA
A0A1M3MEI8      --HWYLFVIGLVIAFGLSYMQNR-KWLPEYKSTGSVIIDDS-------------RTMMNS
A0A1J5HQM0      --FWYLFVIFVIISLGMAYLKNR-TWIPSYKSAGTMLIEEY--------------KITNN
A0A653AC35      --YWYLFVIFIALALGAAYLKNR-SWIPSYQSTGTLMIEES-------------SRNNSG
E4T131          --NWYLFVIGIILSLGLAYIENR-SWLPTFQTEGRVLIDENR------------SSNANS
A0A2W7RD29      --KWPLFLLTGIICLFIAHTSYK-STVTTYEINSKLFIYTEGQSINFFEKLQNVTNS---
A0A3N2NDY8      --KWRWFTVSIVLFCCLGVLYVL-RQQPVYSRSMELLIKDQDGGGGVADISNAFSSLGLV
D7JEV9          --YWYLFVLGVFISLAIAYYQNR-SFVPIYNSSLRMLLKQEA------GSLSYMQGQGFN
A0A4R6H3B7      --NWYWFMIVGIIGVGLGYLKTQ-VTAPAYKLESLFLIKTDN--------KSSNLRMDFP
A0A521H707      --NAYWLFLLLTISSTFAFLYLR-YTHPIYLSQATLKIGTVN------------TASAVL
A0A1F3D6P8      --FKYFYIICLVILLTVAFLFNK-YSSRLYEVKASIGPVQND------------ASSLLT
A0A356Z058      --FKYFYIICLVILLTVAFLFNK-YSSRLYEVKASIGPVQND------------ASSLLT
A0A3D1BT36      --YKYYFISSIILLGLMAFLLNK-FTPAVYEVNSIIGPVENK------------QSSLLE
A0A5R9QZP0      --YKYLYLLSIVVFLLLGYTYNK-FVPTVYQVNSVIGPVEDR------------RTTFLE
A0A3D3HL11      --YKYFYIASFFICLLIAFLVNR-FSPTVYEVNSVIGPVEDR------------RSSMLG
A0A6L8U6G9      --YKYFYIASFFICLLIAFLVNK-FSPTVYQVNSVIGPVEDK------------RSSMLG
A0A352ME00      --LKYLYMALIVLCLAIAFFYNH-FSKKVYEASASLSPVEDK------------TSSLLK
A0A6L8UH35      --LKYLYIFVLILCLAIAFFFNK-YSSKVFEASATLSPVENK------------TSSILS
A0A3P1Z8V4      --YWYWFALSTVLSLIAGYVYQQ-MQDRVYSGEAVILIDSSS-----DSSHGGMRSRSKN
A0A1M6MYT6      --NWYWYVVAVIVAGALAWLYVQ-YTTSVYEIKSSMLVEEGK-------SGSPLGSGGAN
A0A2W7QSQ0      --SWYLFPIFILLFCGVAYYYIK-TITPEYLISSVIIIKEGE------------RNNNVT
A0A3D5KRY6      --NWYW-LAAFSFAGMVGGYAYNKVVLPYYRISTTVLVHDES---------KTTDLNNIY
R7F6L5          --RWYWYVISVAVCVGIAWLMLA-RSPRLYTKSETILIKDPT-------FGNSASSVDLS
A0A7C5MRV2      --SWYYVVVTLAISILACWLYLR-YTKPLFMAVTTVRVEEDK---------SPGRGLGML
A0A229I3A5      --QWRWFILSLVVTCGIAIYYNL-TTPNVYQRTASLMIKDES----KAQGIGGDVASMFS
A0A3R6HJB3      --QWRWFILSLVVTCGIAIYYNL-TTPNVYQRTASLMIKDES----KAQGIGSDVASMFS
R6NN15          --KWRWFVLSLVICLGIAFIYLL-KTPPVYTRTASLLIKEES----KGQSLSGDVGASFS
A0A553GA49      --HWKLYVISITLFLGIGVLFNKFSEPKVNISAKLVVHESRR--------------NMID
A0A497D6F6      --------------VSIAYVYKR-YATPIYEITSSLLLEVGN-------SNSPLTNKNAN
A0A5M4AAB9      -------------------MYYK-YTHPIYEVSASILIEEQQ-------NQNPLITAADK
F4KR18          --KWYLYLAFSIICIGLAYVYYK-NQQPVYAITSKLLIRERE-------RDY-----GPG
A0A2M6GH67      --SLIWIVFLIMLGLGASYLFLR-YTKPVYRSSSTLKIDERSQAGALGLGGPLGNAA--A
A0A7K1TE30      --SLPWVLLLLIIGLTASWLYLR-YTKPIYKASSILKIDERSDVNTIGLGAALGAAAPDN
A0A7D4BE70      --------------------------------------------------MNAAGV---D
A0A142HHS5      --SLPWVIFLLTLGITSSWLYMR-YTKPIYEATSILKIDDHSDASALGLGMAMGGA---E
A0A7D4C435      --SLPWAVLLVSLGLLSSWLYLR-YTKPVYKASSVLKIDERSDARDLGLASVSG-----E
C9LKL0          --KWRWFAFSIIVCVACGWYYQQ-IQPRVYTRQATMLIEGGNGSGRGGFSSSRNRGSGLN
A0A3D0QPV7      SLRWVLLFLITSLLAAWLYLRYT---PPVYESLSVIQISEENN--------MKQVIPGIN
A0A496KT23      --HWKWFLLSVIVCLGGAYYHLL-RTPKTYVASASILIKPDNNRG----NSPDQLLARQR
L1M9T3          --HWKWFVLSLLVCLSSATYYLL-RTPKTYVASASILIKPDSNKG----NTPDELLAR-R
A0A3C0I8F1      SIPFIILIVGLSLGGSYLFLRYT-KALFQSSSDLRLSIRDEAQPG----GLPIQTAPINN
R5JJI4          ------------------------------------MIRDDS------------KGGSIS
A0A0A2DQN2      --YWKWFVLSVLICAGYMYYRSA-QQPYTYMSEVTVIIQDPSQRT----SIDFDFINPRQ
A0A0A2F2N5      --YWKWFLLSILLCTGYMYYKSA-KQAYTYESVVTVIVRDPAQRT----SIDLDLVG--R
L1NGW4          --FWYLYVICVGIVVAFALYRTA-KQPYIYEASVKVFIKDASQRS----MMDADVLRYMR
Z4WRA0          --FWYLYVICVGIVVAFALYRTA-KQPYIYEASVKVFIKDASQRS----MMDADVLRYMR
U2K8K9          --YKFLYILCVGIVVALALYRNA-RQPFTYEGVVKIFIRDASQRT----MVDDNMLRYMR
A0A069ZM60      --FWWLYLLSVGVVLAVALYRNA-KQPYVYESSVKIFIKDASQRA----MMDTEMLRYAR
J6GV98          --FWWLYLLSVGVVLAVALYRNA-KQPYVYESSVKIFIKDASQRA----MMDTEMLRYAR
A0A134B4F8      --FWWLYLLSIGVVLAVALYRNA-KQPYVYESSVKIFIKDASQRA----MMDADVLRYTR
A0A134B8C7      --FWWLYLLSIGVVLAVALYRNA-KQPYVYESSVKIFIKDASQRA----MMDADVLRYTR
A0A3D2HF71      --NWYWFAGALLIALSIAYSINR-WSEDVYSVSSTLLIKDEQLMG----GLSSGTTTLFP
A0A4Z0EKR0      --YWYLFLIAVALCLGAAFIYLRYYTVSVYSVYSTLLIK------------DEKTGQNLS
B5CTK0          --NWYWFLVSVILCLFFGWYTLQ-KAIPTYKRMATVLIKDNS-------------SGSMS
A0A1M6B6D5      --NWPLFLIFLAITFSIAYYINV-RKLPVYLIENLVSIRDDQ---------NPFFTSNTS
A0A451FS66      --SGPLFLISFLITFSIAYYFNI-RKLPIYQMENLVAIKDDQ---------NPFFTTTTS
A0A2E3GN39      ----------MLLSSGVAHIFLH-FSTRIYSSKGVLIHIAGE---------EKQSLLGLD
A0A3D1MEL0      ----------MLLSSGIAHIFLH-FSTRIYSSKGVLIHIAGE---------EKQSLLGLD
A0A519UDD1      --YWYLFLIGAILGVTAAFVHLHYYAVPQYTVYSTMLIKDDK---------SGQSLSSAD
A0A2A4N9A6      --SFLLFCLIFAMAMFGVWLFLR-YTPPIY--QAVTHIRAAS---------NKAVELGTF
A0A6C0GGI1      --KWYYFLISLAIALTVAYFHIK-LSKRVYGVSATVLIENES---------AGNKAAGEL
A0A368D1N7      --SFKWFFLFMLLSSGIAHIFLH-FSTRIYSSKGVLIHIAGE---------DKQNLLGLD
A0A3B8TU58      ----------MLLSSGVAHIFLH-FATRVYDSKGVIIHIGGE---------QKQNLLGFD
A0A1T5IIR6      --NWYWFLLCVLLALGVAYYRYS-RMPFVYSSGVTAIIKNPG---------DELRTARLE
A0A3E0QD27      --YWLFVILTICFTSAFLYLRYT-LPIYESRGILKIGTVNTA---------NAVLNIGSN
A0A6N8DCX3      --KWRWFVVSVLSCVCVAVFYIL-CTPPLYTRSAFLMVKEDTKGK----AIGSDVASMFA
F0R0C9          --KWRWFVVSLVLTLGIAVYYLL-TTPPVYTRAASLLIKEDSKGQ----SLSGDVGSTFA
A0A0M1W1I6      --KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A4R4GHU2      --KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
I8WPR6          --KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A0K2HKS3      --KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
B6W3W8          --KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A7M3EEL4      --KWYWFVLSVSLFGGYTWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A076IRY8      --KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A3A6AD54      --KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A3A6MIU7      --KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
I8WPP8          --KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A372Y7D2      --KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A7K3KFI2      --NWYWFILSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A3E4JJC9      --NWYWFILSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A3E4WDQ0      --NWYWFILSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A414H9P2      --NWYWFILSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A7K0JKU9      --NWYWFILSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
C3R5A8          --NWYWFILSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A1C5XJA7      --KWKWFIMSVLIFGGIAWYKYA-TAPLVYFGSATVIIKDPS---------SKTTTTGLD
A0A285T4L1      --KWKWFVLSVLLFGGLAWYHYA-TSPLVFFRNVTVIIKDPS---------NKTSTAGLD
A0A3E5BU42      --KWKWFVLSVLLFGGLAWYHYA-TLPLVFFRNVTVIIKDPS---------NKTSTAGLD
R7CUW4          --KWKWFLISVLVCGGLAWLSYA-RSPLVYFRSATVIIKDPS---------NKTSTAGLD
A0A416GGJ1      --KWKWFLLSVLVFGSAAWLYYA-RKPFVYFRSATVIIKDPS---------NKTTTAGFD
D1JY72          --KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAY---------SNNIGRGLD
A0A7G5NJU1      --KWKWFVLSVLLFGGMAWYHYA-KSPLVFFRSVTVIIKDPS---------NKTSTAGLD
D7J4K6          --KWKWFVLSVLLFGGMAWYHYA-KSPLVFFRSVTVIIKDPS---------NKTSTAGLD
Q8ABP9          --KWKWFVLSVLLFGGMAWYHYA-KSPLVFFRSVTVIIKDPS---------NKTSTAGLD
D6D2Z5          --KWKWFVLSVLLFGGMAWYHYA-KSPLVFFRSVTVIIKDPS---------NKTSTAGLD
A0A1T3EDR4      --YWYWLVLSCIFFGGYYYYRYS-KSLYVYRDKEVVMIKKQS---------SAPITSAFL
A0A6N8KXI9      --YWKWYVLSILVFTSYFYYQYS-KSPYVFRRAETVMIKTPE---------NTPTSSRVT
A0A174SDD8      --HWKWFVLSILLFGGCFWYIYC-KTPFEYSRVAIVMIKTPA---------NSRSTMQLN
A0A1H7RFH3      --HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPA---------NSRSTMQLN
A0A139L1N2      --HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPA---------NSRSTMQLN
A0A174TVL8      --HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPA---------NSRSTMQLN
A0A1H8BJR6      --HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPA---------NSRSTMQLN
R9H6G0          --HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPA---------NSRSTMQLN
A0A412GR09      --HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPA---------NSRSTMQLN
A0A7J5JXN6      --HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPA---------NSRSTMQLN
A0A081PBV5      --QWKWFLLSIFIFGGYYLYQYS-KTPFIYSRSETIMIKTPL---------NTMPGTRIT
A0A1I2AN85      --QWKWFLLSIFIFGGYYLYQYS-KTPFIYSRSETIMIKTPL---------NTMPGTRIT
A0A4U0GMP3      --HWKWFVLSILIFGGYYLYQYN-KTAFIYSRTQTVMIKTPA---------NTVSTARIS
A0A1H6CKR6      --NWRWYLLSILIFGGYFYYQYN-KTPFLYKSSQTVMIKTAS---------NTISSSRIT
A0A235E1C0      --NWKWFLLSILVFGGFYYYQYS-KTPFLYKKEQTVMIKTAT---------NSMSASRIT
R6D982          --YWKWYVLSILICGGYFWYDYS-RTPFVYSRSATVMIKTPA---------NTPSAIRLI
A0A1F0I8C4      --HWKWYFLSILLFGGCFWYFYC-KTPFVYSRVAIVMIKTPT---------NSRSAMQLY
A0A3A5RIJ2      --HWKWYFLSILLFGGCFWYFYC-KTPFVYSRVAIVMIKTPT---------NSRSAMQLY
A0A515IZJ5      --HWKWYFLSILLFGGCFWYFYC-KTPFVYSRVAIVMIKTPT---------NSRSAMQLY
A0A7J4Y2H6      --HWKWYFLSILLFGGCFWYFYC-KTPFVYSRVAIVMIKTPT---------NSRSAMQLY
A0A0D5BSQ0      --HWKWFALSVLIFGGYYYYQYS-KTPFVYNRSEVVMIRTPS---------NTPTTARIT
A0A1T3F6P5      --NWKWFALSILVFGGYYYYQYS-KTPFVYNSSETVIVKTPS---------NTPTTARIT
A0A0W8EPA0      --NWKWFALSILLFGGYYYYQYS-KTPFVYNSSEIVIVKTPS---------NTPTTARIT
A0A365UKN1      --NWKWFALSILVFGGYYYYQYS-KTPFVYNSSEIVIVKTPS---------NTPTTARIT
A0A4R6WE41      --YWPWFLASILLFGGYYLYDYS-KTPFMYGQAQTVLIKTPA---------NTPATARFT
A0A2T5RP38      --NWKWFALSILVFGGYYYYQYC-KTPFVYSRSEVVMIKNSS---------NTPTTARIT
A0A1A6CF06      --HWKWFALSILIFGGYFYYQYS-KSPFIYNRSEVVMIKTPS---------NTPTTARIT
A0A1T3D6S8      --HWKWFALSILIFGGYFYYQYS-KSPFIYNRSEVVMIKTPS---------NTPTTARIT
A0A1P8E011      --HWKWFALSILLFGSYYYYQYA-KSPFIYRSAETIIIKTPM---------NTPRTARIS
A0A1V3N3U3      --HWKWFVLSVLCFGLYFYYGYS-KSPFIYRSTEMVMIKTPL---------NTPATARIT
C2FUH6          --HWKWFALSVLLFGGYYYYQYS-RSTFMYRSSEMVMIKTPM---------NTPSTARIT
A0A0B8T471      --HWYWFVLSVLLFGGYYYYQYS-KTQFLYSRSQTVMIKSTT---------NTLSVSRAT
A0A4R7D2K0      --HWYWFVLSVLLFGGYYYYEYS-KTQFLYSRSQTVMIKSTA---------NTLSVSRAT
A0A2X2J8S4      --HWPWFLLSVCIFGGYYYYQYS-KTTFSYRQASTVMIKTPA---------NTPSSATLT
A0A3C0S618      --HWPWFLLSVCIFGGYYYYQYS-KTTFTYRQASTVMIKTPA---------NTPSSATLT
A0A4P7DRF9      --NWKWFLLSVLIFGGYYYYQYS-KTPYLYSQSETVMIKTAS---------NTMVATRIA
A0A239XXC4      --NWKWFLLSILIFGGYFYYQYS-KTPFLYKKDQTVMIKTAT---------NSMSASRIT
A0A4U9K473      --NWKWFLLSILLFGGYYYYQYS-KTPFLYKKDQTVMIKTAN---------NSISASRIT
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A7C7CKY6      -------------------------------------------EHAEILITVHDF-----
A0A1G1TG88      -------------------------------------------TPTQYF-----------
A0A661XXA6      -------------------------------------------LDTSRFILSYNL-----
A0A519SD85      -------------------------------VLLSAVNSL---KYKIVFESKKGL-----
A0A3M1TXY5      ---------------------------------------L---DFGISYYLKEGL-----
A0A2E0VQ27      RQ--------------NENFLAEVEVFQTRDLIRKTLENL---HWELTTYRVGDV-----
R6U429          -----------------SNVYNEMEAFSSPDLMCSVVKRL---GLETSYVEKQFL-----
A0A5C8AF42      ------------INSKQDDISSEIELMRSQFMFERAIKRT---SYNVSLFSKGQV-----
A0A353WYK7      -EAQVLGFRSF--DEDINNLSKEIELLKSKLFFTRVAEVI---NNDVNVFAYGKV-----
A0A355BP94      -DATALGIKQFAEDQNRNLVAGEIEQMKSKLFFSRVLDSL---DLGISYYSLGNV-----
A0A136LSC7      -DATELGIKTYMEDQNVNQVSGEIEQIKSKIFFNQVLDSL---DFEVSYYSLGKV-----
A0A5C7N8Q5      -DATELGIKTYIEDQNMNVVSGEIEQIKSKLFFNKVLDSL---DLSVSYYSLGKV-----
A0A239K409      ESAAFSDLN---TFKTSKNFDNEIEVLKSYRLMRRVLSKL---PVNISYYVEESL-----
A0A1V5S1J9      QAALMQGFS---VERGYRNVNNQVIMFGSYELISRVIAKQP--ELTIDYYTQGRF-----
A0A0A2EYC8      SFLSMQNFNSGFSRQDQTNIENQILLLQSQDLIGRTIDSLP--NFKIDFYRKLKF-----
A0A2G6H6Y4      SFATLQNYS---SRGSGKGVENQIVILKSWDMVTRTIDSLP--QFKIDFFKILTF-----
A0A1M3DPL8      AQVLMQGFG---IQESYRNVNNQVIMISSYDLMSRVVDSLP--EFQIEYISKGRF-----
A0A1V5F519      SQGFMQGFG---LEEAYQNVNNQVIILNSYDLIGKVVDSLP--FMKVDYLTIGRF-----
A0A2G6R1T9      PQ-FMQGFG---VESGHKNMANQVILLTSRDLISQVVDNLP--EMRVEYISKGKF-----
A0A350V3E4      ENKIFSDIE---GELPERYINNEVEILKSFAIREKTAASL--------------------
A0A6J4K208      ----PAVPG---SDAPPAGLEDEKNLLSSFRRIRTAVEGL---HFQVSYFHTHWF-----
A0A2W4RDE8      GM------E---LFQSATDLEDEIGIIKSFSNVESAIKRL---NFGISYYTEKNF-----
A0A0L8VEV2      FS------N---AMGGNINLLNHIGILTSHSINRQVLENL---DWTTSWYEELLL-----
A0A1I2A9Z9      LP------S---AFGGNINLQNNIGIITSYSINRQVMENL---DWSTSWYHELMF-----
A0A212J9Z9      ASVVAGSVP---TGTLLRNTENQQIVLKSYGLTERTVKSLPA-KMRIEYYIQTRF-----
F5IV23          ASVVAGSVP---TGTLLRNTENQQIVLKSYGLTERTVKSLPA-KMRIEYYIQTRF-----
F8X2T0          SMIS-GAVP---LGSILRNTENQQIVLESYGLTERTVKNLPK-KMHIDYFIQTRF-----
A0A1M3LAG1      SMIS-GAVP---LGSILRNTENQQIVLESYGLTERTVKNLSK-KMHIDYFIQTRF-----
A0A212K6G4      SMIS-GAVP---LGSILRNTENQQIVLESYGLTERTVKNLPK-KMHIDYFIQTRF-----
A0A4Y9IPG7      SMIS-GAVP---LGSILRNTENQQIVLESYGLTERTVKNLPK-KMHIDYFIQTRF-----
A0A1M5DFS8      SGVAMGAVQ---LGSLVQNSVNQQMILNSYDMVVRTVAKLP--QMRVDYFLKTKF-----
A0A4Y8KZS5      NGVAMGSVQ---LGSLVQSSVNQQMILNSYDMVVRTVGKLP--QMRVDYFLKTKF-----
A0A2V3PNY7      AGVAIGSVQ---LGTLVQNSINQQMLLNSYDMVVRAVAKLP--QMRVDYFKKSKF-----
A0A6G7X5K8      SGVAMGAVQ---LGSLVQNSVNQQMILNSYDMVVRTIAKLP--QMRVDYFKKGKF-----
A0A2P8CDS1      ESNVFQGFG---LFQGKQNTENQIQILKSWTQVRTTLEHF---NFEATYYKIGRF-----
A0A660LQT8      QI----------GVGKASNVNNEMLAFQSPALTENVVRRL---KLDVNYSVSGFF-----
A0A389LWV6      VSDLTTGFA---VSQGLRNVNNQMIMYGSYDLISKSVDKL---DISTDIYHKGLL-----
A0A1G9B1T9      NQQFMEGIG---LFEPQTKISDQTAMLTSFDIIRRTLEKL---DFGVTYYKHDQF-----
A0A350PNH9      VASMFSDMG---ISGGKSNVNNELIAIQSPAVLLEAGKQL---KLDVNYSEDGTF-----
A0A354LNT9      VASMFSDMG---ISGGKSNVNNELIAIQSPAVLLEAGKQL---KLDVNYSEDGTF-----
A0A161LWY6      QQMVMQGVN---LNMAYKNNDNQMIMFTSNDLVERAINKI---NANVDYYTTGHF-----
A0A6I3N9U6      QQMVMQGVN---LNMAYKNNDNQMIMFTSNDLVERAINKI---NANVDYYTTGHF-----
A0A3D0FMX4      SNALMQGFG---VDVGYRNVNNQVIMMGSYDLMCRVVDSLP--FMRTDYISRGRF-----
A0A1M3MEI8      AQVMMQGFG---IQDAYRNVNNQVIMLGSYDLLGRVVDSLP--ALSIDYISQGRF-----
A0A1J5HQM0      TQAMMQGFG---VDAGYKNTRNQIIMLSSYDLIGRVVDSLP--QMRVDYISKGNF-----
A0A653AC35      SQVLMQGFG---VQSGYRSLENQRYILTSYDFISRVVDSMP--SLNIDYISKGRF-----
E4T131          SQALMQGFG---IQSGYKNAKNQIIMLGSNDLFSKVVDSLP--FLKVDYISKGSF-----
A0A2W7RD29      ---------------QNVLLDNEVVIIKSNPVIKSTLEVL---DLKVGYYVPPETTSKNF
A0A3N2NDY8      SS--------------NTNVNNELISLSSPAVMYEVVKNL---GLDVNYSTPGRF-----
D7JEV9          SV------M---NRLDQTNIENQILLLQSQDLIGRTIDSLP--KFRVDFYKKLQF-----
A0A4R6H3B7      LS------S---AFGGNINLQNNIGVITSYSINRQVMENL---DWSTSWYHELMF-----
A0A521H707      NIQNSQALD---ILGSNQ-FAGDIELLRSRVMISRVLDRM---PLDVGYFAHGKV-----
A0A1F3D6P8      SNDLFMGLK---ALQSNRNLESGISNFISFPTVSSTISSM---NLEIGYFREKHH-----
A0A356Z058      SNDLFMGLK---ALQSNRNLESGISNFISFPTVSSTISSM---NLEIGYFREKHH-----
A0A3D1BT36      SSDIFSGLG---SLSQSRNLENDINSLKSFSLISETIKNL---ALEIGYFIESDD-----
A0A5R9QZP0      SSRQFSVLG---SQSQTSNLENDMNSLSSFSLVSKTIKDL---GLEISYYEQPVRFANKK
A0A3D3HL11      SNDLFSGLG---ALAESRNLENDINSLNSFSLVATTIRSM---NLEVGYFAGKNT-----
A0A6L8U6G9      SNDLFSGLG---ALAESRNLENDINSLNSFSLAATTIRNL---NLEIGYFAGKNS-----
A0A352ME00      SNELFSGIQ---SLESLRNIENDIKNLSSFELVYSTVNSM---NLEVSYFSESKK-----
A0A6L8UH35      SNQLFGGLN---PLQTIDNIENDISNLSSFGLVYSTVAKM---NLEVSYFSEEHK-----
A0A3P1Z8V4      SLNTLMQLN---GINVGDNLENELFILSSLRLMKQVVATL---GLEVDYTCREGL-----
A0A1M6MYT6      SENIFLGLG---MMNSMRNIHNQIAVLSSTPIVSRTLDEL---DFSVNYYSIGRF-----
A0A2W7QSQ0      ENSIVSDLE---NMKSTITVENELEKLKSKSLLMDAVIKN---KGFINYYNAEDF----F
A0A3D5KRY6      RQ-----LS---TIQGGPAIQDEVGVLQSYNLSLQTVKYF---NWRYSWYQKRFI-----
R7F6L5          EV------G---VMPKYANLENEIAIFTSPDLMENVVKAY---NLNNFYSYNDGF-----
A0A7C5MRV2      EN-----FG---FGPFRDNIQSEIQLLRSRSIVTVALSEM---DISAAYYLVGTL-----
A0A229I3A5      DM------G---MGNMKSNVNNELIAIQSPAVLLETGKRL---KLDVDYAIDGRF-----
A0A3R6HJB3      DM------G---MGNMKSNVNNELIAIQSPAVLLETGKRL---KLDVDYAIDGRF-----
R6NN15          DL------G---LFQPNTNVNNELVSLQSPAVMYDVVKRL---HLEVDYSTEGSF-----
A0A553GA49      PSSFMPGSE---LFSGRNTFQNSLISLNARPLLEQVVNKL---NIDVFYYQPKVL-----
A0A497D6F6      EDNVFQGFG---ITDSDRNIFNQLIVLTSTPILNRTLEEL---DFDINYYSVGRV-----
A0A5M4AAB9      QPNVFQGFS---LFNGNQNIENQIQILKSWSLIYNTLEHF---NFEVTYSERGFF-----
F4KR18          ADFVKQNIN---FAAAAEDASNEIEMLTSFALMKAVVEDL---GLETRYYWKHKF-----
A0A2M6GH67      EQ-------------NMVSLSGEVELINSDIIYRDLKENL---NLKVNYYAMGNV-----
A0A7K1TE30      NR-------------SITQLAGEVELIKSNLTYTRLKKII---PLNISYYTQGTV-----
A0A7D4BE70      NK-------------QAAQLAGEVELIKSGLTYKRLKQTV---PLDINYYTQGTV-----
A0A142HHS5      NN-------------QASQLAGEVELIKSGLTYKRLKQTV---PLDINYYTQGTV-----
A0A7D4C435      GS-------------HGSELAGEVELIKSGLTYKRLKELV---PLDVNYYTQGTV-----
C9LKL0          TM---MDFN---GVTIGDNLSNELFILTTRRLMRKVVDSL---GLDVDYTTKNAL-----
A0A3D0QPV7      SF-----------EDEQSGVDKALELMRSEFLFKKSIEKL---DFTVSFFSEGQI-----
A0A496KT23      MI------V---EGASDAQMTNEILALSSATITRTVAERL---NLDVEYTHKGMF-----
L1M9T3          MN------V---ESGLDAQMTNEMLSLKSVTITRAVAERL---NLDVEYTHKGMF-----
A0A3C0I8F1      NA----------------HLLGEIEFIKSELLHEEVIKKM---NLGLTIYAQGNI-----
R5JJI4          ESTAFADIS---FLGGKRNVDNEVLVFQSRHLMEKVARRL---HLDMSYKVKNGL-----
A0A0A2DQN2      RG--------------RANIENERLILRSQRIIENALKKI---DAQVSYKYKKEF-----
A0A0A2F2N5      RS--------------RVNIENERLQLRSRVVIANAIKAI---NGHVHYGIIDGL-----
L1NGW4          SF--------------RLNMDNEKMQMSSRRVLERAVKTV---NANVYYQVQSGL-----
Z4WRA0          SF--------------RLNMDNEKMQMSSRRVLERAVKTV---NANVYYQVQSGL-----
U2K8K9          NT--------------RLNVSNERIQLSSRRVMQRTVRLS---GANVFYNVKSGL-----
A0A069ZM60      AA--------------RLNMDNEHVQLVSRRVLERTVKMA---NANVFYNVKSGL-----
J6GV98          AA--------------RLNMDNEHVQLVSRRVLERTVKMA---NANVFYNVKSGL-----
A0A134B4F8      ST--------------RLNMDNERMQLVSRRVMERTVKMA---NANVLYNVKSGL-----
A0A134B8C7      ST--------------RLNMDNERMQLVSRRVMERTVKMA---NANVLYNVKSGL-----
A0A3D2HF71      GM------E---AFRSQQNLKNEMGILRSFTLNYRVMQEMPDFHVDYTAVGRRGI-----
A0A4Z0EKR0      NADVLNDLS---TFKATRNIDNEIQVLRSKSLMTRVVTEL---GLFTKYSIEGKV-----
B5CTK0          ESAVFEDIA---TVRAERNVSNEMLVFKSNRLMQIVARRL---HLDVNYLIEEGL-----
A0A1M6B6D5      LV-----FN---WGGTSDKVNTSVITLRSRSHNEKVVERT---QYYLTYLRDGEY-----
A0A451FS66      LT-----FN---WGGTTDKVNTSVITLQSRSHNEKIVERL---QFYLTYLRDGKF-----
A0A2E3GN39      KT----LPN---QDFTPTDFQQDVRVITSPIIVNKAFSQK---GLNYVFYEVGDF-----
A0A3D1MEL0      KT----LPS---QNFTPTDFQQDVRVITSPIVVNTAFSQK---GLNYIFYEVGDF-----
A0A519UDD1      NTGVLNDLS---TFKSTRNIDNETEVIKSKSLMNRVAKEL---GLFTSYYIEGQV-----
A0A2A4N9A6      VN-FLEKDK---NKMLLEELQEEIAILKSVFMIKKTLTTM---NYGVSYFAEGDL-----
A0A6C0GGI1      LE-VIDAQK---KYI---EVEDQIGLLTSFNMVQKAIARL---DFGVSYYLIPDI----L
A0A368D1N7      KT-LPSQNF---TPT---DFQQDVRVITSPIVVNKAFRQK---GLNYIFYEVGDF-----
A0A3B8TU58      RD-FQKQ-F---TNT---DFQQDIRVLTSPLVINNAYSDK---GLNLLFYDVGNF-----
A0A1T5IIR6      TY------D---QMINKVSVTNEQLQLRSLTIMTEVVKAL---DADVNYLDRIKF-----
A0A3E0QD27      QA------L---EVLGSNQLAGDVELIRSRVIVSRVVGAL---PLDVSYYAHGKV-----
A0A6N8DCX3      DL------G---LTQASANVNNELLAMRMPSAIKEVVKRL---GLDTDYRVNGFL-----
F0R0C9          DM------G---LFQANTNVNNELLSLQSPAVMLDVVKRL---HLHTDYLTDGTF-----
A0A0M1W1I6      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A4R4GHU2      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
I8WPR6          RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A0K2HKS3      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
B6W3W8          RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A7M3EEL4      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A076IRY8      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A3A6AD54      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A3A6MIU7      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
I8WPP8          RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A372Y7D2      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A7K3KFI2      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A3E4JJC9      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A3E4WDQ0      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A414H9P2      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A7K0JKU9      RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
C3R5A8          RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A1C5XJA7      RF------D---NFINKVNVANEMLQFNSKRLIREVVSRT---HADVSYKMKDGL-----
A0A285T4L1      RY------D---NYINKVNVANEILQFRSKRLMREVVQRL---HADVDYRVEEGL-----
A0A3E5BU42      RY------D---NYINKVNVANEILQFRSKRLMREVVQRL---HADVDYRVEEGL-----
R7CUW4          RY------D---NFINKVNVANEILQFRSKKLMREVVQRV---HADVDYLIQDGL-----
A0A416GGJ1      RY------D---NYINKVNVANEILQFRSKRLMREVVQRM---HGDVDYLIEDGL-----
D1JY72          RF------N---TY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCYLIMDDL-----
A0A7G5NJU1      RY------D---NYINKVNVANEILQFRSKRLMREVVQRL---HADVDYRVESGL-----
D7J4K6          RY------D---NYINKVNVANEILQFRSKRLMREVVQRL---HADVDYRVESGL-----
Q8ABP9          RY------D---NYINKVNVANEILQFRSKRLMREVVQRL---HADVDYRVESGL-----
D6D2Z5          RY------D---NYINKVNVANEILQFRSKRLMREVVQRL---HADVDYRVESGL-----
A0A1T3EDR4      QS------A---E--SPVNIKDEMLQLQSKELLRQVIPYM---GGDKSYKISKGL-----
A0A6N8KXI9      RS------S---MFYNTVSVASEILQLKSKELMRQTVTSL---HADISYSEKRGL-----
A0A174SDD8      NS------D---FA-GQVNVASEILQFKSKELMRKVIDRL---QANICYTVHEGL-----
A0A1H7RFH3      NS------D---FT-GLVNVASEILQFKSKELMRKVIDRL---QANISYTVYDGL-----
A0A139L1N2      NS------D---FT-GLVNVASEILQFKSKELMRKVIDRL---QANISYTVYDGL-----
A0A174TVL8      NS------D---FT-GLVNVASEILQFKSKELMRKVIDRL---QANISYTVYDGL-----
A0A1H8BJR6      NS------D---FT-GLVNVASEILQFKSKELMRKVIDRL---QANISYTVYDGL-----
R9H6G0          NS------D---FT-GLVNVASEILQFKSKELMRKVIDRL---QANISYTVYDGL-----
A0A412GR09      NS------D---FT-GLVNVASEILQFKSKELMRKVIDRL---QANISYTVYDGL-----
A0A7J5JXN6      NS------D---FT-GLVNVASEILQFKSKELMRKVIDRL---QANISYTVYDGL-----
A0A081PBV5      RA------N---YY-NTVNVASEILQLRSKELMRKTIDRI---EGDISYTVKKGL-----
A0A1I2AN85      RA------N---YY-NTVNVASEILQLRSKELMRKTIDRI---EGDISYTVKKGL-----
A0A4U0GMP3      RS------N---SY-NVVNVAGEILQLRSKELMRRTISRL---NADVSYSVRQGL-----
A0A1H6CKR6      RP------N---NIYNSVNVNSEILQLRSKELMRNTIGAL---DANISYKRQNGL-----
A0A235E1C0      RP------N---NFYNIVNVNSEILQLRSQELMRNTISLL---NADVSYTKEEGL-----
R6D982          RS------G---DYMGQVNMATERLQFQSKALMRKVISRL---NADVSYAVRDGL-----
A0A1F0I8C4      GS------N---DFMGQINVASEILQFKSKELMRKVIDRL---QANVSYMVYDGL-----
A0A3A5RIJ2      GS------N---DFMGQINVASEILQFKSKELMRKVIDRL---QANVSYMVYDGL-----
A0A515IZJ5      GS------N---DFMGQINVASEILQFKSKELMRKVIDRL---QANVSYMVYDGL-----
A0A7J4Y2H6      GS------N---DFMGQINVASEILQFKSKELMRKVIDRL---QANVSYMVYDGL-----
A0A0D5BSQ0      RS------S---SA-NVISVKDEILQLKSKELMRQTIDRI---GADISYKIRKGL-----
A0A1T3F6P5      RS------F---GA-NSISVKDELLQLKSKELMRLVVDRI---NADKSYKVHRGL-----
A0A0W8EPA0      RS------F---GA-NSISVKDELLQLKSKELMRLVVDKI---EADKSYKVHKGL-----
A0A365UKN1      RS------F---GA-NTISVKDELLQLKSKELMRLVVDRI---NADKSYKVHRGL-----
A0A4R6WE41      RA------S---AGYNSVSVASETLQLRSKELMRQAVEHL---GADISYSHKVGL-----
A0A2T5RP38      RT------N---VS-SSVSVKDEILQLRSKELMRQTIDRL---GADISYKVHRGL-----
A0A1A6CF06      RS------F---SG-GGVSVKDEILQLKSKELMRQVVDKV---GADKSYKIHSGL-----
A0A1T3D6S8      RS------F---GG-GGVSVKDEILQLKSKELMRQVIDKV---GADKSYKIHSGL-----
A0A1P8E011      RT------N---EAYNSISVASEILQLKSKELMRQTVTRI---GAEMSYTVGDGL-----
A0A1V3N3U3      NT------N---NAVGSVSVTSEILQLKSKELMRETIGRI---GAETSYSIRKGL-----
C2FUH6          RT------N---SAFNSVSVAGEILQLNSKELMRRTIDRL---NADVSYVIRNGL-----
A0A0B8T471      RL------N---SYYNTVNVAGEILQLRSKELMRNTISSL---RSDVSYSVQHGL-----
A0A4R7D2K0      RL------N---SYYNTVNVAGEILQLRSKELMRNTISSL---RTDISYSVEQGL-----
A0A2X2J8S4      RS------G---MSYNTVNLATEMLQLKSKELMRETVESI---KADVSYVVRRQL-----
A0A3C0S618      RS------G---MSYNTVNLATEMLQLKSKELMRETVESI---KADVSYVVRRQL-----
A0A4P7DRF9      RP------N---NFYNAVNVNSEILQLRSKELMRNTIDSL---NTDISYSVKSGL-----
A0A239XXC4      RP------N---NFYNMVNVNSEILQLRSQELMRNTISLL---NADISYSRKEGL-----
A0A4U9K473      RP------N---NFYNFVNVNSEILQLRSQELMRNTISLL---NADVSYGRKDGL-----
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A7C7CKY6      --------TRISY-QQ--------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      --------GEKEF-EQEYKFSSP-------------------------------------
A0A519SD85      ------R-WTNTY-PNE-PLKVS-------------TVK----TDKKSSSYYFQFSQLDN
A0A3M1TXY5      ------K-TRQTY-HYA-PFEVQ-------------LDS----SHVQIVGAKFFVRPISD
A0A2E0VQ27      ------R-LSEIY-EER-PFKID-------------YGV----NDDKALDKTIYFDYLGE
R6U429          ------R-TRDLF-TNS-PLAL--------------VRA----GDNNASSFSFEIMKEGE
A0A5C8AF42      ------L-TEEKYLSSS-FYVTP-------------FEL----KDSSLINVPIFVAFDGK
A0A353WYK7      ------L-FEERY-QNS-PFFVE-------------Y-K----IEPQYFDHPFDVDILNS
A0A355BP94      ------L-EHEMY-RRS-PFKAR-------------CIG----NVESFQDQPIFVDFVEG
A0A136LSC7      ------L-TDEMY-KRS-PFRIK-------------ASH----INPKHYDQPIYFDFLDN
A0A5C7N8Q5      ------L-TDEMY-KRS-PFLVT-------------TTQ----INPKHYDQSIFLDFQDN
A0A239K409      ------K-ERELY-GSELPIKVV-------------AHS----LDSTAYGREVTVSFNGG
A0A1V5S1J9      ------K-STNLY-KAA-PILIT-------------KTF----VSPQAYEREFTIQDLGN
A0A0A2EYC8      ------K-NRPMY-GRS-PIDIE-------------IIS----TPDAGFWQYYLYQKQND
A0A2G6H6Y4      ------K-QKALY-ENL-PINVE-------------ILS----TYDNSFDNYYRFEVTGE
A0A1M3DPL8      ------K-TRNLY-EWT-PISID-------------ADF----ISPQAYDILFKLNIKPD
A0A1V5F519      ------K-TRNLY-TTT-PIIIE-------------ADY----VAPEAYELLFKISLHPN
A0A2G6R1T9      ------K-TRNLY-KMS-PIQIE-------------TNY----ISTEAYGVLFKIEINED
A0A350V3E4      ------LDSFQVL-KGKIPFYLL-------------------------------------
A0A6J4K208      ------L-PREEY-GDL-PFRVV-------------LDS----TQGQAVGVPVYVKLIDE
A0A2W4RDE8      ------K-TAEHY-GNT-PFTIH-------------LDS----SVHQLINVPIYIERLSS
A0A0L8VEV2      ------R-DDEMY-GNE-PFEIL-------------YDR----QAMNLEGIPIHIQMLDT
A0A1I2A9Z9      ------R-NEELY-KNE-PYDVL-------------FDR----NAMNLEGIPVYVQMLDS
A0A212J9Z9      ------K-YISLY-TDT-PIEIE-------------MID----IKPEAYNYAYEVTYIDQ
F5IV23          ------K-YISLY-TDT-PIEIE-------------MID----IKPEAYNYSYEIAYIDQ
F8X2T0          ------K-YISLY-TDS-PIEIA-------------IDSLETDITPEAYSKVFDVSYVSD
A0A1M3LAG1      ------K-YISLY-TDS-PIEIV-------------IDSLETDITPQAYSKVFDVAYVSD
A0A212K6G4      ------K-YISLY-TDS-PIEIA-------------IDSLETDITPGAYSKVFDVAYVSD
A0A4Y9IPG7      ------K-YISLY-TDS-PIEIA-------------IDSLETDITPQAYSKVFDVAYVSD
A0A1M5DFS8      ------K-TENLY-GVT-PITIE-------------AKY----VAPSAYSIVFEVEPIDS
A0A4Y8KZS5      ------K-TENLY-GMT-PISIE-------------AKY----VAPSAYSIVFEIEPINA
A0A2V3PNY7      ------K-VENWY-GVT-PVTIE-------------AKY----VAPSAYSIVFEIEPINS
A0A6G7X5K8      ------K-ADNWY-GLT-PVTIE-------------AKY----VAPSAYSIVFEIEPINS
A0A2P8CDS1      ------R-TIELY-KDV-PFHIE-------------LDR----SHPQLLDANFDLHFLPN
A0A660LQT8      ------H-DETLY-GKTLPIQVQ-------------FLS----LSDER-SAMLDITYERD
A0A389LWV6      ------K-SVSYY-KAS-PILIK-------------SNF----ISEEAASLDFRIRGIDT
A0A1G9B1T9      ------I-QHEIY-KRR-PFDVE-------------LDS----LSDQLIGVPIYVRFLSS
A0A350PNH9      ------H-PVALY-GRTLPVTVH-------------FYS----LNDMQ-SANLDVEVKHG
A0A354LNT9      ------H-PVALY-GRTLPVTVH-------------FYS----LNDMQ-SANLDVEVKHG
A0A161LWY6      ------K-VSNLY-GYA-PIEIK-------------GDN----ISDAVSGLEFDFRDIDG
A0A6I3N9U6      ------K-VSNLY-GYA-PIEIK-------------GDN----ISDAVSGLEFDFRDIDG
A0A3D0FMX4      ------K-DTYLY-RYT-PVVFE-------------PSE----IRPEGYEHLYKLDIGTN
A0A1M3MEI8      ------K-VRNLY-GQS-PVVIH-------------TDY----IAPEAYGILFKLSISED
A0A1J5HQM0      ------K-TRNLY-NAS-PIQIN-------------PDY----IAPEAFNLTFKLDLNAN
A0A653AC35      ------K-TRNKY-NES-PIAII-------------ADF----VSPNAYGILFKVNVKTD
E4T131          ------K-TRNLY-KTT-PIIIQ-------------TDY----IAPEAYGVLFKIKLHSN
A0A2W7RD29      WSFNKSNLPIEIY-EDA-PFEIE-------------LKE----NDKSIEEKFFRISWVDS
A0A3N2NDY8      ------H-EKTLY-GSNLPVNVK-------------FHD----LEEQQ-CAGFRIELGKD
D7JEV9          ------K-NRPMY-ATS-PIDID-------------IIS----ISDISYGKYYLYQRKDN
A0A4R6H3B7      ------R-NEELY-KNE-PYDVL-------------FDR----NTMNLEGVPVYVQMLDS
A0A521H707      ------I-DHEMY-TKS-PFSVE-------------YEL----TDSSYFDRRFFIDFEGD
A0A1F3D6P8      ---LFRQ-VSELY-LRS-PYVVI-------------MDK----SHIQPIDVKLRVFILSD
A0A356Z058      ---LFRQ-VSELY-LRS-PYVVI-------------MDK----SHIQPIDVKLRVFILSD
A0A3D1BT36      ---ILGQ-VRQVY-PNS-HYTVN-------------IDK----SHIQPINARFYINIVSD
A0A5R9QZP0      SLGFINK-PLQTY-GNN-KYIVN-------------IDK----SHSQAINTRYYIEILDE
A0A3D3HL11      ---IFQK-PTQVY-LGN-PFSVI-------------IDK----SHIQPINTRFRVDILDD
A0A6L8U6G9      ---LFRK-PTQVY-LGN-PYTVS-------------IDK----SHIQPINARFEIDILDD
A0A352ME00      ---LLKQ-TNELF-GTT-PFTVS-------------IDK----SHIQPIGANIYVSILDE
A0A6L8UH35      ---FFKQ-TQEIY-GYL-PFTIT-------------IDK----SHIQPVNTKIYITHLDD
A0A3P1Z8V4      ------H-NVALY-RDR-PFTVH-------------FDR----PSKR--YTRMEAVINPD
A0A1M6MYT6      ------A-ATERY-QDV-PFMVV-------------WEE----DHPQIINADFYLTIQPD
A0A2W7QSQ0      K-----T-KIDPF-QSSIDITVD-------------SIS----KSFISPSESFEIQPISE
A0A3D5KRY6      ------G-KRDLY-KND-PLTLV-------------LPS----DFIQLENVPIHIKIISK
R7F6L5          ------K-DVDIY-HQE-PGIIS-------------SPD----AANADASYSFKYIVKPD
A0A7C5MRV2      ------V-TAEMY-KDDSPFIVS-------------YDS----TGKVAYNKMFSLFYLGG
A0A229I3A5      ------H-KEALY-GADLPVTVD-------------FVG----FTDEQ-SGSFKLQLKGD
A0A3R6HJB3      ------H-KEALY-GADLPVTVD-------------FVG----FTDEQ-SGSFKLQLKGD
R6NN15          ------Y-AQVRY-GQNLPVTVS-------------FAG----LADNE-TAALTVEPAQS
A0A553GA49      ------Y-DKNLY-TSS-PFQVV-------------LDK----NYLQLTGAEFYVEILSK
A0A497D6F6      ------K-SREIY-KES-PFEVI-------------WDY----EHPQLIYADFLLEILPD
A0A5M4AAB9      ------R-TTELY-HDL-PFEIE-------------FDD----RHSQLIDTNFDLKFLSD
F4KR18          ------S-EYDAY-GNF-PIVVD----------------------------TFKLNPSAE
A0A2M6GH67      ------L-NEELY-NNA-PFKID-------------YEI----RDGSFYDKEFKVNFIDN
A0A7K1TE30      ------L-EAELF-GTS-PFRVE-------------YTI----SDPAYYNRKFNVEYVDA
A0A7D4BE70      ------L-ETELF-GTS-PFQVE-------------YSI----SDPVYYNHKFSVEYLDA
A0A142HHS5      ------L-ETELF-GNC-PYRVT-------------YVI----SDPAYYNHKFDVEYIDA
A0A7D4C435      ------L-EAELF-GSC-PFRVE-------------YTI----SDQAFYNRKFNVSYVSA
C9LKL0          ------H-RIALY-DNR-PFDVS-------------FGT----KTSV--PANFQAEIMPG
A0A3D0QPV7      ------L-TENKY-PAK-YLRFS--------------------------DLTIIDSTIFG
A0A496KT23      ------H-DKVIY-GSELPVKVE-------------FLN----IGEEQ-RASFGLSLQAD
L1M9T3          ------H-PKVIY-GSELPVKTE-------------FLN----ISEEQ-TASLSLTLMAD
A0A3C0I8F1      ------L-DNELY-GNV-PFEIK------------WWAT----ANNPWFDKRFDVQIVDP
R5JJI4          ------R-EDELY-THS-PITVL-------------FPE----SEERQ-VIEMTVTPVDS
A0A0A2DQN2      ------R-MIELY-KAS-PIRVS-------------FVD----SLEL--YDSFFVSYKDE
A0A0A2F2N5      ------R-PIELY-KSA-PIQVT-------------FAD----SLDQ--YHQFEVTYKDA
L1NGW4          ------R-TLELY-TAA-PFSMR-------------FLD----SLEK--VATYEVRFKDA
Z4WRA0          ------R-TLELY-TAA-PFSMR-------------FLD----SLEK--VASYEVRFKDA
U2K8K9          ------R-TLELY-DEA-PFKVT-------------FLD----TLDV--ANTFRVSYQDA
A0A069ZM60      ------R-TLELY-SDA-PFSMK-------------FLD----TTER--KSTYEVAFQDA
J6GV98          ------R-TLELY-SDA-PFSMK-------------FLD----TTER--KSVYEVAFQDA
A0A134B4F8      ------R-TIELY-TDA-PFSMK-------------FLD----TLER--GSSFDVAFQDA
A0A134B8C7      ------R-TIELY-TDA-PFSMK-------------FLD----TLER--GSSFDVAFQDA
A0A3D2HF71      ------V-EKRIY-NKS-PFIVI-------------YDS----LNKQTIGEKVNVKILSA
A0A4Z0EKR0      ------R-DTEIY-GNELPIKVI-------------LGK----LEPTAGGVNFTVRPKSV
B5CTK0          ------H-MKELY-TQA-PISVR-------------FFD----VDEAE-TLSLTVLPHSE
A0A1M6B6D5      ------Q-QEDAY-KQT-PFFVEVDTAKSQMLNHQIKVV----FKDSL-TFNLSVSFEEA
A0A451FS66      ------Q-LIDAY-KQT-PFLIRVDTTKAQVLNQQFKVV----FKDSV-NFNLSVSFEEG
A0A2E3GN39      ------R-SLEIYPNPYFTIDSF-------------YQD----PKMRRVSIDYSVLINQQ
A0A3D1MEL0      ------R-SLEIYPNPYFTIDSF-------------YQD----PKMRRVSIDYSILINQQ
A0A519UDD1      ------K-DIEQY-GRNLPIKVL-------------LTT----ADSTAAG---KSFIVRV
A0A2A4N9A6      ------L-TQELYKSSNYKVDFM-------------VKD----PIIYQVRFN-IEILNTR
A0A6C0GGI1      INNLGDQ-VVEEKVTEEFPFRVI-------------LDP----SSNQLLNVPIYVKILSK
A0A368D1N7      ------R-SLEIYPNPYFTIDSF-------------YQD----YKMRRVSID-YSILINQ
A0A3B8TU58      ------R-SLEIYPNPYFSVDSF-------------YQA----PELTKINID-YHMFLSR
A0A1T5IIR6      ------R-DVELY-TSQSPVRMA-------------FNR----EKSDPGSVSVTVIPEDA
A0A3E0QD27      ------I-DHEMY-LSS-PFRIEYEIEDSAIFSIPFYLD----FESEK-VFHLRYPTHEG
A0A6N8DCX3      ------H-KETLY-GKELPVKAV-------------LPG----LEDAE-SVSFTIQLLPG
F0R0C9          ------Y-KQVLY-GQTLPFSIS-------------FFG----LQDNE-TASLTLRQGAS
A0A0M1W1I6      ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRIQNR
A0A4R4GHU2      ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRIQNR
I8WPR6          ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRIQNR
A0A0K2HKS3      ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRILNR
B6W3W8          ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRILNR
A0A7M3EEL4      ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFNLTVRILNR
A0A076IRY8      ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRILNR
A0A3A6AD54      ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRILNR
A0A3A6MIU7      ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRILNR
I8WPP8          ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRILNR
A0A372Y7D2      ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRILNR
A0A7K3KFI2      ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVKTLNR
A0A3E4JJC9      ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRTLNR
A0A3E4WDQ0      ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRTLNR
A0A414H9P2      ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRTLNR
A0A7K0JKU9      ------R-EEELY-TQA-PVKVS-------------FPE----EENHL-DFSLTVRTLNR
C3R5A8          ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRTLNR
A0A1C5XJA7      ------R-NVELY-TKS-PVAVS-------------FAD----MLPEQ-YVAFTVTLLNK
A0A285T4L1      ------R-MNELY-NQS-PINVS-------------FIN----VMPER-YISFTVTPKNA
A0A3E5BU42      ------R-MNELY-NQS-PINVS-------------FIN----VMPER-YISFTVTPKNA
R7CUW4          ------R-YNELY-TQS-PVRLS-------------FPD----AMPEQ-GLALTVQPKSE
A0A416GGJ1      ------R-HIELY-TKA-PVTVS-------------FPG----MSPNG-AVQFKLKMLNL
D1JY72          ------R-EEELY-TQA-PVKVS-------------FPE----EEDHL-DFSLTVRILNR
A0A7G5NJU1      ------R-MNELY-TLS-PVNVS-------------FIN----VLPER-HISFVVTPKDD
D7J4K6          ------R-MNELY-TLS-PVNVS-------------FIN----VLPER-HISFVVTPKDD
Q8ABP9          ------R-MNELY-TLS-PVNVS-------------FIN----VLPER-HISFVVTPKDD
D6D2Z5          ------R-MNELY-TLS-PVNVS-------------FIN----LLPER-HISFVVTPKDD
A0A1T3EDR4      ------R-DYELY-TDS-PVEVI-------------LLG----ETSLS-GYSLKVEPLDG
A0A6N8KXI9      ------R-QVELY-KDA-PVLIH-------------LIH----NNSYE-GFEFDLKGIDK
A0A174SDD8      ------R-PVELY-TES-PVRVA-------------FLE----AGTDE-AHSLSVTPKSN
A0A1H7RFH3      ------R-PVELY-TES-PVRVT-------------FLD----AGMDE-AHSLSVTPKSR
A0A139L1N2      ------R-PVELY-TES-PVRVT-------------FLD----AGMDE-AHSLSVTPKSR
A0A174TVL8      ------R-PVELY-TES-PVRVT-------------FLD----AGMDE-AHSLSVTPKSR
A0A1H8BJR6      ------R-PVELY-TES-PVRVT-------------FLD----AGMDE-AHSLSVTPKSR
R9H6G0          ------R-PVELY-TES-PVRVT-------------FLD----AGMDE-AHSLSVTPKSR
A0A412GR09      ------R-PVELY-TES-PVRVT-------------FLD----AGMDE-AHSLSVTPKSR
A0A7J5JXN6      ------R-PVELY-TES-PVRVT-------------FLD----AGMDE-AHSLSVTPKSR
A0A081PBV5      ------R-EYELY-KDA-PVKVQ-------------FID----AKPEV-GFSLQIEAVDQ
A0A1I2AN85      ------R-EYELY-KDA-PVKVQ-------------FID----AKPEV-GFSLQIEAVDQ
A0A4U0GMP3      ------R-NTELY-TDA-PIQIS-------------FED----VRTED-NFSFTVSRNDD
A0A1H6CKR6      ------R-TLELY-KTS-PFLVK-------------FVD----ANPNM-PQEFTLKSLGK
A0A235E1C0      ------R-TIELY-KTS-PFIVR-------------FVN----APANA-GFSFNLKYKGN
R6D982          ------R-QKELY-MAA-PVRVH-------------FLV----SEPEA-ELSLLVTPKNE
A0A1F0I8C4      ------R-PRELY-TEA-PIRVA-------------FMD----AIPGE-RCFLSVIPKNQ
A0A3A5RIJ2      ------R-PRELY-TEA-PIRVA-------------FMD----AIPGE-RCFLSVIPKNQ
A0A515IZJ5      ------R-PRELY-TEA-PIRVA-------------FMD----AIPGE-RCFLSVIPKNQ
A0A7J4Y2H6      ------R-PRELY-TEA-PIRVA-------------FMD----AIPGE-RCFLSVIPKNQ
A0A0D5BSQ0      ------R-DYELY-KKS-PVQVK-------------VEG----KSSED-NYAFTVIPVDM
A0A1T3F6P5      ------R-DYELY-KKS-PVQVQ-------------VEG----KSSED-SYNFTVVPLDA
A0A0W8EPA0      ------R-DYELY-KKS-PVQVK-------------VEG----KSSED-SYNFTVVPVDA
A0A365UKN1      ------R-DYELY-KKS-PVQVQ-------------VEG----KSSED-SYSFTVVPVDA
A0A4R6WE41      ------R-VYELY-DKS-PIKVK-------------ILK----GLPQD-TWSLLITPISK
A0A2T5RP38      ------R-DYELY-KKS-PVKVV-------------FSN----KSPES-RYGFTIIPIDA
A0A1A6CF06      ------R-DYELY-KKS-PVQVK-------------VEG----KTQAD-SYGFTVTPIDT
A0A1T3D6S8      ------R-DNELY-KKS-PVQVK-------------VEG----KTHAD-SYGFTVTPVDT
A0A1P8E011      ------R-RKELY-TAS-PIKVI-------------VPQ----TKPED-SFSFTVTPVGG
A0A1V3N3U3      ------R-DIELY-RTS-PVKVD-------------LAG----AGPTS-QYNLLIIPLDA
C2FUH6          ------R-DQELY-TQS-PVKVT-------------WMD----KKPDQ-SFSFTLTPLDG
A0A0B8T471      ------R-TVELY-RNS-PFEVK-------------FLN----IKPES-NFSFTLTAIDS
A0A4R7D2K0      ------R-KVELY-RKS-PFEVK-------------FLN----IKPES-NFSFTLTAIDS
A0A2X2J8S4      ------R-DYELY-NES-PVLVQ-------------FVN----YNPSG-SFSFTITPRDN
A0A3C0S618      ------R-DYELY-NES-PVLVQ-------------FVN----YNPSG-SFSFTITPRDN
A0A4P7DRF9      ------R-TLELY-RKS-PYLVE-------------FEG----INQNA-GFSFNLRRKDA
A0A239XXC4      ------R-SVELY-KTS-PFIVR-------------FRN----AAPQS-GFSFNLKYKGN
A0A4U9K473      ------R-SVELY-KTS-PFIVR-------------FIN----VPSSA-GFSFNLKYKGN
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          ----------MVV-----------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------SAAPALQ-----------------------------------------------
A0A519TAP8      -------MQLLVD-----------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A7C7CKY6      ------------------------------------------------------------
A0A1G1TG88      ---------------------------------------------------------G--
A0A661XXA6      ------------------------------------------VINEDFEFNMVLSPSW--
A0A519SD85      E-KFELYIND----------------------EKRIYKFDQ-VIIHENLQIKVQRPLV--
A0A3M1TXY5      T-EYEIEADEKS-AEIWNIAEDALVHELEPFVFNKRLRFGQ-PYTDQNLSFTLHRNPD--
A0A2E0VQ27      G-RFRFFDGSPKDSA-----------------HATIVDQGQ-LIEKNGLLLTIEPDSA--
R6U429          D-AFVIKDWHVAGEEMEY--------------AKIKGRLND-TLDTPVGKLVIAPTML--
A0A5C8AF42      SISVNYAHLGKN--------------------YALKGKLNE-RLSNTHFEISIDSPIP--
A0A353WYK7      K-KFILRLKKGDQV------------------IENTYSFGE-EIVCDGFVFML--ALS--
A0A355BP94      N-KYQLWV--GENG------------------TKQTGTLGE-PVVVSDANFVI--ELS--
A0A136LSC7      N-EVSLRL--KGAV------------------ST-RGSMGN-PVEFDGTVLTI--TKT--
A0A5C7N8Q5      N-QFTLRL--GDAG------------------PTVSGTMNK-PVELDKTILIV--NKT--
A0A239K409      K-SYNLEEGG----------------------KTFKFEFGE-VVRRPYGTFTILTSDA--
A0A1V5S1J9      N-NFEISAPGTKQLPE----------------LKISGKYGI-PIQNSSFFIQVDKSAI--
A0A0A2EYC8      N-EFTIKIFDNEDVEL----------------ETVKGRYNE-PVGCKYFLIKVTKNSN--
A0A2G6H6Y4      K-SFNISVLDEHDEVL----------------EVVDGEYGE-PIGCKYFLVKVLRDER--
A0A1M3DPL8      G-TFTVTEDEESMPKG----------------FNINGRIGY-PLQHHLMFITINDISG--
A0A1V5F519      G-TFTISPHNNNSMPS----------------SPINGHIGV-PLQHNLFFMTVNSVSD--
A0A2G6R1T9      G-SYVISDDKGVIDED----------------LEIRGKIGV-PVKSKLFVINVTKDIE--
A0A350V3E4      -------------------------------------------------------SAT--
A0A6J4K208      Q-LYRLKVHGEN-VPVFDLRTDRQVAVIPLIAVDKVLRVGR-PYRDPHLGFRIEFLKK--
A0A2W4RDE8      S-KYMVSVRGKE-VPTYDVITNTVKDRVPVVDIQEVVDINK-PFQSKNLSFSITFNDA--
A0A0L8VEV2      S-NFQIEVKGKK----------MVYGKEVEIEFSQKGKFGE-LFSNDYFNFTL--YPK--
A0A1I2A9Z9      T-NYRIIVDEKT----------MYYGREIEIKIDQRGVFGE-IFENDYFHFTL--YPK--
A0A212J9Z9      E-KCEISYKENPESETK---------------ISLIAPFDQ-EIDYKLFRIKLHKTPNFR
F5IV23          E-KCEISYKENPESETK---------------ISLIAPFEQ-EIDYKLFKIKLHKTPNFR
F8X2T0          S-QIRVSYKDGLDGEPE---------------EAFNVVFDS-PVENKFFKGTIRKTKN--
A0A1M3LAG1      S-QIRVSYKDGLDGEPE---------------EAFNVVFDS-PVENKFFKGTIRKTKN--
A0A212K6G4      S-QIRVSYKDGLDGEPE---------------EAFNVVFDS-PVENKFFKGTIRKTKN--
A0A4Y9IPG7      S-QIRVSYKDGLDGEPE---------------EAFNIVFDS-PVENKFFKGTIRKTKN--
A0A1M5DFS8      D-KCRIFY-PGSENTAP---------------FSMEVPYNQ-YVQESRFYIKINKTDR--
A0A4Y8KZS5      D-KCRIFY-PGSESTPP---------------FSMEVPYNQ-FVQESRFYIKINKTDR--
A0A2V3PNY7      E-KCRIFY-EGSETTQP---------------FSMEVPYDQ-FVQEPRFYIKITKSPR--
A0A6G7X5K8      E-KCRIFY-PGSETTAP---------------FSMEVPYGQ-FVQEQRFYIKINKSPR--
A0A2P8CDS1      N-RVEMTIQGKK-AVRYDYRNEKELQPEKEIEETRTFPIDS-FVASDDYAFRIIPAAD--
A0A660LQT8      G-HFELTNFVTNLDRKIEKT------------QVVKGHFGQ-IVNTPVGRVRV--TPT--
A0A389LWV6      T-AYEITFDGAKNIAP----------------FSIVGNYGT-SLQHNLFFVTVDKTDQ--
A0A1G9B1T9      N-RYEISVEADEASVYQMAEEKFAPTKARDVLIQNVQKVGQ-PVRTPYLNFTLIRNEQ--
A0A350PNH9      N-LFSIVHVSGTDKAGNQVESD----------EEVQGKLGQ-TVRTAMGHVCV--DQA--
A0A354LNT9      N-LFSIVHVSGTDKAGNQVESD----------EEVQGKLGQ-TVRTAMGHVCV--DQA--
A0A161LWY6      V-TYEIAHQKDKQLDE----------------LRYTGRYGS-LLNTPYFSVVV--NKT--
A0A6I3N9U6      V-TYEIAHQKDKQLGE----------------LRYTGRYGS-LLNTPYFSVVV--NKT--
A0A3D0FMX4      G-QLTVSIADEDTKNP----------------MTFNTIYGQ-TFDCGLFSGLFMPTEY--
A0A1M3MEI8      G-TFLITEEEENLRKG----------------FALRGRLGK-TFQHNLFFITVNMAEG--
A0A1J5HQM0      G-TFTITVDENKQYEN----------------FKLNGNIGE-PISNNLFFITINNTNS--
A0A653AC35      G-SYIITDENS---LN----------------IKIKGYLNQ-PIQHNLFFLTIAPTNQ--
E4T131          G-SYTISVDDKNLFSK----------------FQINGRYGR-PLQHNLFFLTVHNVNK--
A0A2W7RD29      L-SYSVRFVGDE-----PTTSMFNSNQDEGSGKSYVCKFNE-WCGLPFLTLRTRLLEA--
A0A3N2NDY8      G-NVVLSKFHLETPDGDEEIE-----------KEVKAKIGAGPIETPVGKVSIAANGN--
D7JEV9          D-YFTIKVFDNEDVEL----------------ETVEGRYNE-PVGCKYFLIKV--IEN--
A0A4R6H3B7      T-NYRIIVDEKT----------MYYGREIEVKIDQRGVFGE-IFENDYFHFTL--YPK--
A0A521H707      S-KFRLSYS------------TALSKQSGTFPVNTWI-----TIPGLKFKITIKDYGQ--
A0A1F3D6P8      T-TFRLVIDQNT-VSLYNYLDNQIVIENVPLKVDTICRFNE-TIRGKTFKFSVSFNRD--
A0A356Z058      T-TFRLVIDQNT-VSLYNYLDNQIVIENVPLKVDTICRFNE-TIRGKTFKFSVSFNRD--
A0A3D1BT36      T-TYRLTVSEDD-VSFYNYLDNKVISAGHMLNIDTVYKFNQ-TIASPYFRFSVSKNQD--
A0A5R9QZP0      S-RFRLSVYDDG-AKLYNYLDNKVTSRGNRIEFDSICTFNE-TITTPYFKFSVNLNKD--
A0A3D3HL11      Q-SYRLTASEDE-ASYYNYIDNAVVSTENRVRIDTICRFNE-TVTSYNYKFSIGFNKE--
A0A6L8U6G9      Q-TYRLTASEDE-VAYYNYIDNAVVSDKNIFHLDTICRFNE-TISSFNFKFSIALNKE--
A0A352ME00      S-SFRLTASQKK-VSYYNYVDNQIISEDNFFEIDTICKFNE-TISNKVVRFSVALNKD--
A0A6L8UH35      S-TFRITISDKN-VSLYNYVDNMILNDDYDLEVDTICKFGE-TIQNKAFKFSVTNNRN--
A0A3P1Z8V4      N-TVTLTDFEGIRGLSSEQEN-----------LKLKVPFGV-KTKTPIGTLTL--YKE--
A0A1M6MYT6      G-KLELKIEEEDEVMVFNYKDKTVLDELDSYSYSEEATPGT-RISTDEFAFKI--LLN--
A0A2W7QSQ0      T-KFLLILDED---------------------KQKEFEYGQ-KIKFSFGIISI--QKK--
A0A3D5KRY6      T-KYEISCDEKIRIGGWS--------------KHIQFHKEQ-TLGEAFKNEFFQFTIS--
R7F6L5          G-TVILKDFNKGGTELPD--------------KPLSCKLGA-TVKTPVGAIAI---DR--
A0A7C5MRV2      N-KFKLVYTKRQ-ES-----------------VEGQYYFGE-TINIDGFKFQVVKRET--
A0A229I3A5      G-SYVISKLKGVTRDNLPVDDS----------DEITGRIGQ-IIRTPLGKIKVDKAPA--
A0A3R6HJB3      G-SYVISKLKGVTRDNLPVDDS----------DEITGRIGQ-IIRTPLGKIKVDKAPA--
R6NN15          K-GI---KLTSFVHNGEKVD------------GEVVGTLND-SLVTPIGKIVIRPAAA--
A0A553GA49      D-LFTLKVEVDE-GELHNFLNASSEQLVEDWEFKHTYRFGE-SIENENFNFTV--LLK--
A0A497D6F6      G-KLLIKVEDEH-AAIFDFLNSEIVTYVTNLSFSKEAAYNE-VIKTDYFSFIIKPKRE--
A0A5M4AAB9      N-KVKIKTKSRK-AIRYDYLRKTELSEPHAVNNSRTFDIDE-QIKSADYSFRIIPISS--
F4KR18          S-TFKITPLNNY-SFRFSQGSKTE-TQRFGTLFSNQFGV-----------FRINRIGA--
A0A2M6GH67      N-TFKLVYLI-GEEE-----------------ITGEYKVGE-PINKKEIYLVLNRTPN--
A0A7K1TE30      T-HYQLNAVL-GEQK-----------------IEGTHALGQ-LVKLPGMQLRLLANEE--
A0A7D4BE70      K-HYHLQVSLKSNET-----------------LAGNYELGQ-YVQLPGMRLRLLPSGS--
A0A142HHS5      K-HYRLNVTV-GNAK-----------------LGGNYEFGQ-LVKLPGISLRLLSAS---
A0A7D4C435      D-SYHLEVVL-GEET-----------------LKGTYKIDQ-YVQLPGIKLRLLATSY--
C9LKL0          G-KVRLFDFKLN-GEEYS--------------DDIETAPEQ-AVKTPLGVLKI--SKN--
A0A3D0QPV7      E-RIDIFSNSNQITLNCRN-------------QTFTTESGG-LLQSPWFRARITVADP--
A0A496KT23      G-RVILDNFTKD-GASLS--------------GTVMGKVGE-RCVTPVGLVKF--VAN--
L1M9T3          G-RVLLENFVRD-GQNLG--------------GSVLSQVGK-RCATPIGLLKL--TPT--
A0A3C0I8F1      K-HFVLA-FEQGRGV-----------------IKQKYQFND-TIHLSGMSLVL--IPK--
R5JJI4          A-TVRLSDFSLSIAG-----------EEIRSAEVVDARLND-TISTPVGTMVV--TPT--
A0A0A2DQN2      N-QVSVS--YNE--------------------EEHIFLLGD-TISIGKNRLII--EPN--
A0A0A2F2N5      S-SI-VLSREGG--------------------ETKQVQLGE-EVTYEKSRLIV--VPS--
L1NGW4          G-HVSIQPQGSS--------------------KAQDVPLNV-PVQLGPDRFII--EPR--
Z4WRA0          G-HVSVLPQGSS--------------------KAQDVPLNV-PVQFGPDRFII--EPR--
U2K8K9          S-HVSIKLGKDG--------------------RTQVIPVGE-PIRIGETRFIV--EAR--
A0A069ZM60      G-HVRVTPVHTG--------------------KSQVVPLNV-PVQLGDERFII--EPH--
J6GV98          G-HVRVTPVHTG--------------------KSQVVPLNV-PVQLGDERFII--EPH--
A0A134B4F8      S-HVRVTPASTG--------------------KSQVIALNV-PVQLGEERFII--EPR--
A0A134B8C7      S-HVRVTPASTG--------------------KSQVIALNV-PVQLGEERFII--EPR--
A0A3D2HF71      K-KYKIEIDGER-----N--------------FSKEMNFGD-RFNEQGFDFIIELRDK--
A0A4Z0EKR0      D-TFELDDYSG---------------------HMYSYHFGE-QIQKPYGTFSIIAGGA--
B5CTK0          K-EVTITDIITSSGESVN--------------KSFYIPLND-TVSTPIGRILI--SPT--
A0A1M6B6D5      K-NINLQNYNSKEKK---------SLFVEAGDFSKDFKIGE-PVNTPFFNGIF--VPN--
A0A451FS66      K-NINLQNYTTKEKS---------SLFIDTDVFSKDYKLGE-SISTPFFSGTF--IPN--
A0A2E3GN39      K-DSVRLDYIYQGKS-----------------WGGFLKPGK-PYSDENIYLAISNLDQ--
A0A3D1MEL0      K-DSVRLDYIYQGKS-----------------WGGFLKPGK-PYVDENIYLDISNLDQ--
A0A519UDD1      R-PDNAFDLDDYTGHITT------------------HKFGQ-QIRKPYGTFTVIATGL--
A0A2A4N9A6      E-FKLLYSIDKKYDNIYN--------------------FGT-WIRTEFADFKVSLKES--
A0A6C0GGI1      N-KYQVQVVGGETAYIYNISTNKTIGETTTPEINKIVNLGD-PFKDEHLNFKI--FLN--
A0A368D1N7      Q-KDSVRL-----DYIYQ---GKSWGGFLKP--------GK-PYADENIYLAISNLDQ--
A0A3B8TU58      K-KDSIRL-----EYIYK---GSTWGGHLKP--------GK-PFIDENIFISISNFDE--
A0A1T5IIR6      G-HIRLQTSAGS-QL---------------------VALGD-TVALGRGKVVF--LPT--
A0A3E0QD27      E-KVKAFQTNVW-NKVPG--------------LKFRMTVQN-WAAIQKQEINL--QDE--
A0A6N8DCX3      G-KVELDDFKSSERDLES--------------GTVTGTLND-TLQTPLGKIIP--VPT--
F0R0C9          G-KLELSDFTRNGEKVE---------------GISEGKLND-TIASPVGKLLV--EPT--
A0A0M1W1I6      K-QVRLSDFSTD-AT--S--------------ITLTANLGD-TIQSPIGKIVV--SPT--
A0A4R4GHU2      K-QVRLSDFSTD-AT--S--------------ITLTANLGD-TIQSPIGKIVV--SPT--
I8WPR6          K-QVRLSDFSTD-AT--S--------------ITLTANLGD-TIQSPIGKIVV--SPT--
A0A0K2HKS3      K-QVRLSDFSTD-AT--S--------------ITLTANLGD-TIQSPIGKIVV--SPT--
B6W3W8          K-QVRLSDFSTD-AT--S--------------ITLTANLGD-TIQSPIGKIVV--SPT--
A0A7M3EEL4      K-QVRLSDFSTD-AT--S--------------ITLTANLGD-TIQSPIGKIVV--SPT--
A0A076IRY8      K-QVRLSDFSTD-AT--S--------------ITLTANLGD-TIQSPVGKIVV--SPT--
A0A3A6AD54      K-QVRLSDFSTD-AT--S--------------ITLTANLGD-TIQSPVGKIVV--SPT--
A0A3A6MIU7      K-QVRLSDFSTD-AT--S--------------ITLTANLGD-TIQSPVGKIVV--SPT--
I8WPP8          K-QVRLSDFSTD-AT--S--------------ITLTANLGD-TIQSPVGKIVV--SPT--
A0A372Y7D2      K-QVRLSDFSTD-AT--S--------------ITLTANLGD-TIQSPVGKIVV--SPT--
A0A7K3KFI2      K-QVRLSDFSTD-AT--G--------------ITLTANLGD-TIQSPVGKIVV--SPT--
A0A3E4JJC9      K-QVRLSDFSTD-AT--G--------------ITLTANLGD-TIQSPVGKIVV--SPT--
A0A3E4WDQ0      K-QVRLSDFSTD-AT--G--------------ITLTANLGD-TIQSPVGKIVV--SPT--
A0A414H9P2      K-QVRLSDFSTD-AT--G--------------ITLTANLGD-TIQSPVGKIVV--SPT--
A0A7K0JKU9      K-QVRLSDFSTD-AT--G--------------ITLTANLGD-TIQSPVGKIVV--SPT--
C3R5A8          E-QVRLSDFSTD-AT--G--------------ITLTANLGD-TIQSPVGKIVV--SPT--
A0A1C5XJA7      D-SVEITDFSMA-EN--G--------------ERQVVELND-TISLNEGKVVV--VPT--
A0A285T4L1      K-QVLLSDFTGI-PAAND--------------KTYTMRLND-TLTIGSERILI--TGT--
A0A3E5BU42      K-QVLLSDFTGI-PAAND--------------KTYTMRLND-TLTIGSERILI--TGT--
R7CUW4          R-SVTLSRFSWM-EA--D--------------STCTVAMGD-TVRVHGQRLVV--TPT--
A0A416GGJ1      K-EAQITTLGDA-GK------------------TYKVQLRD-TTAIGNFKIAV--TPT--
D1JY72          K-QVRLSDFSTD-AT--S--------------ITLTANLGD-TIQSPIGKIVV--SPT--
A0A7G5NJU1      A-TVTLSGFGGLPAA--K--------------DSYDVRLND-TLAVGGERILV--TGT--
D7J4K6          A-TVTLSGFGGLPAA--K--------------DSYDVRLND-TLAVGGERILV--TGT--
Q8ABP9          A-TVTLSGFGGLPAA--K--------------DSYDVRLND-TLAVGGERILV--TGT--
D6D2Z5          A-TVTLSGFGGLPAA--G--------------ESYEVRLND-TLAVGGERILV--TGT--
A0A1T3EDR4      G-SVLIREWQSK-KL--E--------------KPFKLSLNK-PTRLPFGELLV--KGS--
A0A6N8KXI9      E-TVELFGFSKG-DP--S--------------VRIKAKFNE-EIQTPVGKMTL--TAN--
A0A174SDD8      V-QVELSDFSRG-ME--Q--------------RKV-VKLND-TIQTALGKLVV--FAA--
A0A1H7RFH3      Q-QVELADFSRG-ME--Q--------------RKV-VNLND-TIHTALGRLIV--FAA--
A0A139L1N2      Q-QVELADFSRG-ME--Q--------------RKV-VNLND-TIHTALGRLIV--FAA--
A0A174TVL8      Q-QVELADFSRG-ME--Q--------------RKV-VNLND-TIHTALGRLIV--FAA--
A0A1H8BJR6      Q-QVELADFSRG-ME--Q--------------RKV-VNLND-TIHTALGRLIV--FAA--
R9H6G0          Q-QVELADFSRG-ME--Q--------------RKV-VNLND-TIHTALGRLIV--FAA--
A0A412GR09      Q-QVELADFSRG-ME--Q--------------RKV-VNLND-TIHTALGRLIV--FAA--
A0A7J5JXN6      Q-QVELADFSRG-ME--Q--------------RKV-VNLND-TIHTALGRLIV--FAA--
A0A081PBV5      D-HVALSSFSKG-NT--S--------------QVLKIKLNQ-TVRTPIGLLKV--TRS--
A0A1I2AN85      D-HVALSSFSKG-NT--S--------------QVLKIKLNQ-TVRTPIGLLKV--TRS--
A0A4U0GMP3      S-TVLMSGFSKG-DM--E--------------QRFIVKFNE-KVRTPVGVLAV--RPT--
A0A1H6CKR6      N-QLELSEFSNQEEA--G--------------KPLVVALNQ-TVNTPIGKVII--TPN--
A0A235E1C0      N-QVELSNFSNT-DP--E--------------KTVTVKLNA-ETKTPVGNLII--SAN--
R6D982          R-QVELSDFSRG-AE--S--------------RKT-VNIND-TVETALGRLVV--SAT--
A0A1F0I8C4      Q-QVELAEFSKG-TE--L--------------RRV-VNLND-TVHTALGKLVV--FAA--
A0A3A5RIJ2      Q-QVELAEFSKG-TE--L--------------RRV-VNLND-TVHTALGKLVV--FAA--
A0A515IZJ5      Q-QVELAEFSKG-TE--L--------------RRV-VNLND-TVHTALGKLVV--FAA--
A0A7J4Y2H6      Q-QVELAEFSKG-TE--L--------------RRV-VNLND-TVHTALGKLVV--FAA--
A0A0D5BSQ0      K-HVVIKNWSNT-NK--N--------------EEFKVVLNQ-SVVTPIGKVLI--KPS--
A0A1T3F6P5      N-NVIIKNWNPS-NK--D--------------KEIKIALGK-LTSTPIGKLLI--NPS--
A0A0W8EPA0      N-NVIIKNWNPA-SK--D--------------KEIKVALNS-LTSTPVGKVLI--TPS--
A0A365UKN1      N-NVIIKNWNPE-NK--D--------------KEIKVALNR-LTLTPVGKVLI--TPS--
A0A4R6WE41      D-SVEIGGWKDN-TD--R--------------APVRLAIGQ-AFRTPLGEIQL--DST--
A0A2T5RP38      K-NVIVKDWNKN-VD--G--------------QEVKVVLNQ-LTKTPFGEIII--VPS--
A0A1A6CF06      R-YVLLKKWNET-SE-----------------EELKIELNR-WVVTPAGKVFI--TPT--
A0A1T3D6S8      R-YVLLKKWNET-SD-----------------EELKIELNR-WVVTPVGKVFI--TPT--
A0A1P8E011      K-EVVLSNWSEG-DA--A--------------LEVDATLDK-PVNTPFGQVIV--QSA--
A0A1V3N3U3      Q-TVLLSGRIAG-KE--Q--------------QEIRVPLNK-TVNTTLGRLTV--RPT--
C2FUH6          K-YVLLKKWSNG-DR--A--------------KELKIELNK-ESNTPVGRIVV--TAE--
A0A0B8T471      T-KVRFAT-VDG-DV--E--------------NYTTIPIGK-EIKTPFGNMVV--DTT--
A0A4R7D2K0      T-TVRFAT-VDG-DV--E--------------SYTTIPIGK-EIKTPFGNMVV--DST--
A0A2X2J8S4      K-SVLVVENVGK-DK--E--------------KVYIAPLNK-AIKTSFGGIRI--LAT--
A0A3C0S618      K-SVLVVENLGK-DK--E--------------KVYIAPLNK-AIKTSFGGIRI--LAT--
A0A4P7DRF9      N-EVELSDFSTN-KE--A--------------KSIIVPLNQ-LVNTPVGKMII--QFN--
A0A239XXC4      N-QVELSSFSNS-DP--D--------------KTITVKLNS-EVKTPVGNLII--SAN--
A0A4U9K473      N-QVELSMFSND-EL--A--------------KPIIVKLNA-ETKTPVGNVII--SAN--
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A7C7CKY6      -------------NQFQENPYFFTFNNVHYVINHYQQ-SLDIRLLNQ-----A--AKTIE
A0A1G1TG88      -------------PASLAAKYHFTIQDQGTVNAYLEK-NLAVDISSA-----D--ANTIQ
A0A661XXA6      -------------NSSMGTEFYFIIRSHDALMDYIEA-NLSVEPVNV-----E--ANIFK
A0A519SD85      ------RVLN---------TIRFKYLSTPEFVNQIRK-SLKVDDSQA--------NNILS
A0A3M1TXY5      ------------FEVKKGQRFYFVIHGLKDLAERYQS-ALKVEAVSK-----E--ARLLN
A0A2E0VQ27      ------FLKLKPNSLKPGDLFALKVNSEDALIGQYKSDKLFVKPVDK-----E--VSIIK
R6U429          -------------YDQWKKPIVISWVNAKKLAKAYNK-SLSVSLSGK-----E--STVLV
A0A5C8AF42      ------SEFK---DESSDNELYFVFNSVESYAARLLP-SLQIVPVDP-----E--AKTIQ
A0A353WYK7      ------PHYR---KDNDNVHYFFKINSPQSNIRYLMD-NTEVKPLDF-----K--AKTIS
A0A355BP94      ------PNAT---PDFKN-HFFFVMNSRNRLLDFLSS-NLRIEPINF-----D--ANTIR
A0A136LSC7      ------NYFT---ENDGN-NYYFVLNSRKSLIEYLSK-NIQVDPLNF-----N--ANTIR
A0A5C7N8Q5      ------IFFT---ENDGN-NYFFVLNSRKTLIDYLSK-NIQVDPLNF-----N--ANTIR
A0A239K409      ----------FPQKSPKQKKIIVVFENINTLAKYYSD-WLKVEPINA-----K--ASVLN
A0A1V5S1J9      --------------YRRNFNICFKLLNPENLAITYSA-KLSFDFLMT-----G--ASVVQ
A0A0A2EYC8      --------------YHSANSVNFVFRNRDNLVMEFAS-KLQIN-LLP-----N--TSVLN
A0A2G6H6Y4      --------------YNEIPQFYFRFRTRMSLIQEFVG-RLEVA-PID-----K--TSVLN
A0A1M3DPL8      --------------NNSAKDLYFKFRTKESLIGEFSS-KLALNFVMD-----G--SSVLE
A0A1V5F519      --------------NVKEFEMYFRFRTRETLIEDFKS-RLSSRYVIE-----G--SSILE
A0A2G6R1T9      --------------FSNK-TMFFRFRTKTSLVNEFSG-LYPE--FIN-----K--SSVLS
A0A350V3E4      ------------------PENQVDPKSKNQIANVLSA-VTEISQKRG--------LDIVS
A0A6J4K208      ------------PGQFDAEGRFFVINSLADQAGQYQR-RLRVHPLGE-----G--SRTLR
A0A2W4RDE8      ------FKLE------PDSKMFFRINNQVSLAERYRN-QLNIEPISK-----E--SNIVQ
A0A0L8VEV2      -------------YAKRGNQYYFTFNNFENQVKKYMN-RLVIEEPED-----K--ADLIY
A0A1I2A9Z9      -------------NVKRGETYFFTFNNFEGLVRNYSG-RLMIEETEE-----Q--ADLIR
A0A212J9Z9      KDVKGAFKPD-------ISTFNFRFLSEAQLIGMYSG-RIGSALQ-N-----N--SSILS
F5IV23          NDVKGAFKPD-------ISTFNFRFLSEGQLIGMYSG-RIGSDLQ-N-----N--SSILS
F8X2T0          ------FKRD-------FLPFSFRFFTNSQLTGMFSG-RVSTALKTE-----N--STALT
A0A1M3LAG1      ------FKHD-------FLPFSFRFFTNSQLTGMYSG-RVSTALKTE-----N--STALT
A0A212K6G4      ------FKRD-------FLPFSFRFFTNSQLTGMYSG-RVSTALKTE-----N--STALT
A0A4Y9IPG7      ------FKRD-------FLPFSFRFFTNSQLTGMYSG-RVSTALKTE-----N--STALT
A0A1M5DFS8      ------FTPN-------FTPFSFRFISKEELIGRYTG-RTSSGYQRE-----G--SSALA
A0A4Y8KZS5      ------FTPN-------FTPFSFRFISKEELIGRYTG-RTSSGYQRE-----G--STALA
A0A2V3PNY7      ------FAPN-------FEPFSFRFVSKEELIGRYSG-RISSGLVRD-----G--STALG
A0A6G7X5K8      ------FAAN-------FEPFSFRFVSKEELIGRYSG-RISTGMIRE-----G--STALG
A0A2P8CDS1      ------SKLE--------GNYRVVFHSLDELTADYLN-RLTVAPISK-----E--GTIVK
A0A660LQT8      ------NHFD----VVEHQPIHVLRTTMRKAIEHY-N-NVEITLADK-----G--AEILN
A0A389LWV6      ------FPHT------VKYELNFNFLSRGQQIADYNN-RLNCSFLLD-----G--ASVME
A0A1G9B1T9      ------EPLD------TLSQYSFMIHPLERVTEQYQK-KLVVAPFEE-----G--SDILV
A0A350PNH9      ------PGYSAFINGHESRKLHVTRTNLYAMTNHIKA-SLSASISEE-----K--ATVID
A0A354LNT9      ------PGYSAFINGHESRKLHVTRTNLYAMTDHIKA-SLSASISEE-----K--ATVID
A0A161LWY6      ------DNFE------PRKKINFAFLSNAYLIDYFTP-RISLSFVTQ-----N--STVLA
A0A6I3N9U6      ------DNFE------PRKKINFAFLSNAYLIDYFTP-RISLSFVTQ-----N--STVLA
A0A3D0FMX4      -------MTE-------KTTIYFRFRSQESLVADFSS-RLTLNFVAE-----G--SSVLT
A0A1M3MEI8      ------VVHG-------KKEVYFRFRSRESLISDFSG-RLRLNFVME-----G--SSVLE
A0A1J5HQM0      -------YYA-------ERELYFQFRSRESLISDFAS-RLTFNFVQE-----G--SSVLE
A0A653AC35      -------NRQ-------EYDTYFIFRTRESLIGDFMS-RLNVNYVSD-----G--SSVLA
E4T131          -------YMG-------NTEMYFKFRTKESLVNDFIS-RFSTSYVTE-----G--SSVLR
A0A2W7RD29      ------KNDG---------NFLFKIRNEESLISEFSG-NLAIYPATT-----G--GSILD
A0A3N2NDY8      ------YTAPKGKKNKPVTEIIVERDGMQSTVETYGG-LVKADLADK-----D--ADVID
D7JEV9          ------KAFR------DVDKVHFRFRHRQELIAEFSS-KLAIQLIPN--------TSVLN
A0A4R6H3B7      ------NVKR-------GETYFFTFNNFEGSVRSYLE-RLMIEETEE-----K--ADLIR
A0A521H707      ------IKKQILATTNDEP-YYIIFYNPETVIDQYYA-DATVTVMNQ-----Y--AQTVR
A0A1F3D6P8      ------FYTR--ETNMEDF-YYFSFFHLDYLTKDYLK-KLEVEPISP-----K--TSLII
A0A356Z058      ------FYTR--ETNMEDF-YYFSFFHLDYLTKDYLK-KLEVEPISP-----K--TSLII
A0A3D1BT36      ------YLNQ--RPVDEER-SFFMMNHIDIITEQYLN-RLTVESVSL-----K--STLIN
A0A5R9QZP0      ------LYKG--TQASKTKAHFFEFNHLDVISRRYLR-KLAIAPVNI-----R--STLIN
A0A3D3HL11      ------YYNP--KLSGETD-YYFEFYHLDQLTRTYLR-RLKVEPVSI-----R--SSLIN
A0A6L8U6G9      ------IYNQ--QLAKETE-FSFVFYHLDQLTKSYLK-RLKVEPVSI-----R--SSLIN
A0A352ME00      ------FPLK--KTEDKSR-YYFKFNHLDYLAKGYLK-QLEIEKASP-----L--ASIIN
A0A6L8UH35      ------YVSN--PTQNKHK-YFIKFNHLDYLAKRYLK-SMDIHRISP-----L--ASIIN
A0A3P1Z8V4      ------TPFR---RFPKGTPIVVHHYSNEIAARIYKK-ALTAAEYSK-----E--SSLLL
A0A1M6MYT6      ------EHFN----PESDNEFKFRFHSPQELIRQYQN-QLEVALKSD-----E--TTILD
A0A2W7QSQ0      ------PASD--DFATEMGNVLVELVNPQVAAENYSR-VLEFQNPSV-----K--SSTLY
A0A3D5KRY6      ------AKTG--VAPQEDEEYVLIFNDLSRMALAYKE-KLVVKALSAIDPTIN--SNMIT
R7F6L5          ------PEWV---SDYVDKTIHYSHVPVRPVAESIVG-GLKATYEAK-----E--GTLIA
A0A7C5MRV2      ------ARYS----LVPGIEYRWQAIKWKSLVGRALG-GLKVEQSGY-----L--VPILK
A0A229I3A5      ------FTQF--VSGEDESVLYVSRSNVYAMTDRIKG-SLSASLSDV-----K--STVID
A0A3R6HJB3      ------FTQF--VSGEDEPVLYVSRSNVYAMTDRIKG-SLSASLSDV-----K--STVID
R6NN15          ------FVDW--QKSSEP--LTVSRSGLNSAVSRYSA-GLSVALQSE-----K--TTIVD
A0A553GA49      ------EGLN--IDKLVGKKLFFVIKSNRQVVDESKD-NLKIEATQL-----D--ATAIS
A0A497D6F6      ------R------NKIETATYKFRFNIRSDLLKQYKN-DLSVNMLSQ-----E--TSIIE
A0A5M4AAB9      ------L------PL--QGRYRINFNSLNELTNEYLE-KLTVYQVSL-----K--SSILK
F4KR18          ------L------PISSDSSMYVSFQDTKGLARNYQH-NLSVELSDE-----KNHSSVLI
A0A2M6GH67      ------F--N---PFVLEQNYHFVINSDGALNNYFRS-NLAVEIINP-----S--ANTIS
A0A7K1TE30      ------S--P---TNTPDAKFHFTIQDDNTIERYLNL-NLTVEVVNP-----N--ANTIQ
A0A7D4BE70      ------A--T---GTSTEANYHFTILDDNTINAYLDQ-NLTAEILNA-----N--ANTIQ
A0A142HHS5      ---------S---PAELDAIYHFVIVDDNTINSYLDH-NLKAEVLNP-----I--ANTIQ
A0A7D4C435      ------APLA---PAFSEANYHFTILDDNTINNYLDR-NLMADVLNV-----S--ANTIQ
C9LKL0          ------ATFE---EFSKGKVITVDYIPADLAARRYQG-EISATVQDQ-----E--SSLIV
A0A3D0QPV7      ------QTIQ---AIQSENKLYFVFNHPDQLLTQYFP-AINVQVLNA-----S--AKTLQ
A0A496KT23      ------TGY----RRGMTDEYKVTRSPISAVAAVVRG-SFNIALSNK-----A--STIID
L1M9T3          ------NAY----RKGMTDEYDIKRSSISTTAAIVRS-RFDVQLSDK-----A--STIID
A0A3C0I8F1      ------PAIN------ISKNYYFIINSRYALLSYLQS-KLKVDIINH-----N--AGIIR
R5JJI4          ------LYYT---DTYYGKPVYITKSNMEKVVEGYLR-RINISLASK-----T--ATIIN
A0A0A2DQN2      ------PNYT---SPWIARQIQVSRVPVPALAVAYQG-SLSIGQPEG-----R--ATILS
A0A0A2F2N5      ------KGYN---EPWPNKAIKITRLPVKDLAASYQG-RLFIGQPEN-----R--ATVLS
L1NGW4          ------SNFN---SPWEHKTINVIRHPLVGTARYYQN-AVAISQPQE-----K--SSTLM
Z4WRA0          ------SNFN---SPWEHKTINVIRHPLVGTARYYQN-AVAISQPQE-----K--SSTLM
U2K8K9          ------KTFN---APWAYSEIQVSRIPFVDAVRFYQH-SVAITQPEA-----Q--TSTLT
A0A069ZM60      ------QNFN---TPWEYKHIEVNRMPFTQTVRYYQH-AILVAEPEN-----R--ASTLT
J6GV98          ------QNFN---TPWEYKHIEVNRMPFTQMVRYYQH-AILVAEPEN-----R--ASTLT
A0A134B4F8      ------QNFN---APWEHKHIEVTRMPFTQTVRYYQH-AIMVAEPEN-----R--ASTLA
A0A134B8C7      ------QNFN---APWEHKHIEVTRMPFTQTVRYYQH-AIMVAEPEN-----R--ASTLA
A0A3D2HF71      ------NNFV--FDPNASNRYYFYFVSPQSLANIYRS-KLSVSPVEE-----E--ASLVT
A0A4Z0EKR0      -------------NKWLGTKIIVQFQDINQVANYYNS-AIGIAPVNT-----R--ASVLN
B5CTK0          ------LYYG--KGEF--SPLIVRKVNLKSIANSFAA-RLTIAQALA-----G--STMLN
A0A1M6B6D5      ------PDVI----SKMGTPYYLVFSEYDATVKRYL--DINIAPLSS-----G--SSVLQ
A0A451FS66      ------EEVI----SNPGTPYYFIFQDYDTTVKNYL--NTKVTPESK-----G--SSVLR
A0A2E3GN39      ------KLLE--GSAESQKSILFKVYTDEQLSNELMA-ITSIEP-NK-----E--TFAIL
A0A3D1MEL0      ------KLLD--ESAENQKSILFKVYTDEQLSNELMA-ITSIEP-NK-----E--TFAIQ
A0A519UDD1      ------QNMP--A-----TKIIVRFQDILKVADYYNK-AIGVQPINK-----N--ASILY
A0A2A4N9A6      ------DAII--TDSKSNIYYFLINNLDEQARFKFAP-AIQTLITNL-----S--ARTMI
A0A6C0GGI1      ------PYYE--TYLTKGKKFFFIINNIGNLTKGYQA-KISAKPISR-----D--SRILN
A0A368D1N7      ------KLLE--GNAENQKSILFKVYTDEQLSNELMA-ITSIEP-NK-----E--TFAIQ
A0A3B8TU58      ------SLLT--DEFEGEKNIFFNVYDNNRLADEMLS-NIKIEP-NK-----E--TFSVA
A0A1T5IIR6      ------ARYS---PDQYGQSIRIQKIPVNWAAQAYIS-RLSIAH--------D--KQILT
A0A3E0QD27      ------AYYF-------------IINNSTTLVERYFK-NLTVVLMNQ-----V--AQTIL
A0A6N8DCX3      ------PFYS---ATEKYPLIHLSRTNLYDCVDGCIE-NLEAELSSE-----D--ATVIE
F0R0C9          ------PYYN---IGFHEP-VYVSRSSLHGATGAYSS-RLSVVLSDE-----K--STVIN
A0A0M1W1I6      ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A4R4GHU2      ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
I8WPR6          ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A0K2HKS3      ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
B6W3W8          ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A7M3EEL4      ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A076IRY8      ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A3A6AD54      ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A3A6MIU7      ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
I8WPP8          ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A372Y7D2      ------LYYT---DKWFNTPITIRRQSTDIMASLFRS-NLNISQAEN-----D--ASILY
A0A7K3KFI2      ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A3E4JJC9      ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A3E4WDQ0      ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A414H9P2      ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A7K0JKU9      ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
C3R5A8          ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A1C5XJA7      ------NYMT---ESWIGVPVKVSKMPLDAVVSVYRN-SIAVKQEEE-----E--SSILT
A0A285T4L1      ------DRWG---QAWTERDIRVSKNPLNAVAGRFQG-SMGIRQEED-----E--SSILV
A0A3E5BU42      ------DRWG---QAWTERDIRVSKNPLNAVAGRFQG-SMGIRQEED-----E--SSILV
R7CUW4          ------NYYA---ASWTDVPIRVQKRPLESVVNRYKG-ALGIQQEEE-----E--SSILT
A0A416GGJ1      ------NFLN---KSWIGQEITVRKNPLESVVSYYSG-NFAIRQEED-----E--SSILT
D1JY72          ------LYYT---DKWFNTPITIRRQSTDTMASLFRS-NLNISQAEN-----D--ASILY
A0A7G5NJU1      ------DHWG---KSWTGREIHVVKNPLNAVAGRLQG-SMGIRQEED-----E--SSILV
D7J4K6          ------DHWG---KSWTGREIHVVKNPLNAVAGRLQG-SMGIRQEED-----E--SSILV
Q8ABP9          ------DHWG---KSWTGREIHVVKNPLNAVAGRLQG-SMGIRQEED-----E--SSILV
D6D2Z5          ------DHWG---KSWTGREIHVVKNPLNAVAGRLQG-SMGIRQEED-----E--SSILV
A0A1T3EDR4      ------PHYG---TPYYGKSIRVEKLPLERSVVYFLG-QLKIKHLGE-----D--TSVLE
A0A6N8KXI9      ------NNYD---EYFFGEEILIKKIPLEAMAAYFLS-NMTIQQLQD-----D--ANLLE
A0A174SDD8      ------ENYG---ESCFGKPIVVTCKPLEEMVSFWLN-NLSIRQMSG-----D--AALLR
A0A1H7RFH3      ------ENYG---ESSFGKPVLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AALLH
A0A139L1N2      ------ENYG---ESSFGKPVLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AALLH
A0A174TVL8      ------ENYG---ESSFGKPVLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AALLH
A0A1H8BJR6      ------ENYG---ESSFGKPVLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AALLH
R9H6G0          ------ENYG---ESSFGKPVLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AALLH
A0A412GR09      ------ENYG---ESSFGKPVLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AALLH
A0A7J5JXN6      ------ENYG---ESSFGKPVLVTCKPPEEMVSFWLY-NLAIKQMSG-----D--AALLH
A0A081PBV5      ------PGYK---VSDFDKPVIVRKYPREAMVGYYMA-NLKIQQMEE-----D--ASLLQ
A0A1I2AN85      ------PGYK---VSDFDKPVIVRKYPREAMVGYYMA-NLKIQQMEE-----D--ASLLQ
A0A4U0GMP3      ------DAYS---LAAFTNEIRVSKNPREAMVGYFMG-RMNIRQMED-----D--AALLQ
A0A1H6CKR6      ------PESK--YRVNVSEPIQVSKTPIDAMVGYFLS-NLEIVQM-E-----D--VAILQ
A0A235E1C0      ------SDKK--FRVNLSEDITITKSPIESMVGYFLG-NLDIVQM-E-----D--VEILK
R6D982          ------ENYD---SSCWGKPVKVSKQAREKMVYFFLS-NLSIKQVNG-----D--VALLN
A0A1F0I8C4      ------ENYG---GDWMERAVKVISHPQEDMVSFWLS-NLTIRQMSG-----D--AALLR
A0A3A5RIJ2      ------ENYG---GDWMERAVKVISHPQEDMVSFWLS-NLTIRQMSG-----D--AALLR
A0A515IZJ5      ------ENYG---GDWMERAVKVISHPQEDMVSFWLS-NLTIRQMSG-----D--AALLR
A0A7J4Y2H6      ------ENYG---GDWMERAVKVISHPQEDMVSFWLS-NLTIRQMSG-----D--AALLR
A0A0D5BSQ0      ------KFYK---KDYYGTEIQVTKSPRESMTGYFVG-NLVVKQMEE-----D--TSLLQ
A0A1T3F6P5      ------RYYK---KDYYGVEIQVVKSPRESVMGNFVG-NLSIKQMEE-----E--ASLLQ
A0A0W8EPA0      ------KYYK---KDYYGVEIQVTKFPREAVMGNFVG-NLSIKQMEE-----E--ASLLQ
A0A365UKN1      ------KYYT---KDYYEVEIQVAKLPREAVMGSFVG-NLTINQIEE-----E--ASLLQ
A0A4R6WE41      ------SHYL---PGSFGKSIRVEKFAREYMVNFFLS-NLKIKQMED-----D--AFLLQ
A0A2T5RP38      ------KYYH---KDNYGESILVTKYPREEMMLGLMG-NLKVKQMEE-----D--ASLLQ
A0A1A6CF06      ------KFYN---KDYYGKDIQVTKSPREAVMGYFIA-NLKIKQMDE-----D--TSLLQ
A0A1T3D6S8      ------KFYS---KDYYGKDIQVTKLPREAVMGYFIA-NLKIKQMDE-----D--TSLLQ
A0A1P8E011      ------LKPN---KALPQQEVKVEKFALEGMVNYFIS-TISITQMEE-----D--ASLLQ
A0A1V3N3U3      ------KFYK---AGVFGEEIQVRKYDREDIVGYFLG-NLKITQLEE-----D--ASLLQ
C2FUH6          ------KQFT---ASTVGEDIQVTKYAHEAMVGYIMG-NLKIQQMEE-----D--ASLLQ
A0A0B8T471      ------AKFT---SSYYGEQVTVSKNAMESMVGYFLS-RMRIEQMED-----D--ASLLQ
A0A4R7D2K0      ------KHFT---PSYYGEQVTVSKNAMESVVGYFLS-RMRIEQMED-----D--ASLLQ
A0A2X2J8S4      ------PYYT---KAAYDQEISVNKLSSIDMANALLG-RLSITQTTD-----D--ASLLQ
A0A3C0S618      ------PYYT---KAAYDQEISVNKLSSIDMANALLG-RLSITQTTD-----D--ASLLQ
A0A4P7DRF9      ------PNLN--YRKSSDEQITITKSPIDAMVGYFLG-KLQIRQ-LE-----D--VELLQ
A0A239XXC4      ------SDKS--YRVNLSEQITITKNPIESMVSYFLG-NLKILQ-ME-----D--VEILQ
A0A4U9K473      ------PDKK--YRVNLTEDITITKTPINAMVGYFLG-NLKITQ-ME-----D--VEVLQ
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
R5DEG6          ------VPSLYYGDKYFNTTVQVTKSPLQNVALRFQS-GLQATLASK-----T--ATIIN
A0A4Q3SEI4      -----------------------------------SD-NIRATPAGK-----L--STVIN
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------PAPAAASWPPNEPDTRGAALE-------LDL-DLSEAPHLT-----L--SDLPP
A0A519TAP8      ------SVPGRALPVGDDPQYHFVILNDGAVINYLDK-NLDVTVVNP-----S--ANTIQ
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A7C7CKY6      VTLRDKNSKKASDIVNAIAEEFINYDILKKAKSANKVLTFIDDQLGIVY-DKLRTSENKM
A0A1G1TG88      ISFTDFNPRKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNY-DNLERAENRY
A0A661XXA6      VSFKDYNVNKAHALISAIDTLYYKYSLNEKNRANKNKIEYLNTQLTETE-NKLDDFEKYF
A0A519SD85      LRYSNSNIYLSADILNAILASYLKFDKDQREISLTQTSKFITSLSDQLS-LKTIASSVAL
A0A3M1TXY5      ITSEGPVVSMQNQFINTLLNTYIQNDLEKQREIGRKMLMLIDEQLTGVT-DSLRKAEFSL
A0A2E0VQ27      VYFNHELPEKAQTFVNTLMKTYIEEGRKSREQQVAETLEYLEKQLEVVK-KRLGDAEAGL
R6U429          LTLTDRFPSRADNILSTLIDVYNEQWVEDKNRSARNTTAFINDRLVVIE-KELGGVEEHL
A0A5C8AF42      ITFQGNNPQLCHDISLAVAEAFIEYDEEVKRKGSENILQFIDQQLDSLA-GELKSSKDSL
A0A353WYK7      VTFKDFNKYKAQDILMAIDTLYIYYTQLEKNRVNDQKIKFLNEQLHQTE-STLSELENYF
A0A355BP94      VTFRDFNPLKVYTVVNKIDSVYLYYSNEQKNQANRQKIDWLNQELHQVE-NKMEGFENYF
A0A136LSC7      VSFRDHNAHKAYDVVNKIDSLYIVYSNQQKNLANKQKIEWLNNELVQVE-EKMEGYENYF
A0A5C7N8Q5      VSFRDHNALKAYDVVNKIDSLYIIYSNQQKNLANKQKIDWLNNELVQVE-RKMEGYEDYF
A0A239K409      ISITDPVPERGRDVINKLMQDYREEELEGKNLIAASTIKLIDDRLNGLS-AELIEIEKDV
A0A1V5S1J9      ASISGTVPERDCDFLNGLCEEFLADNLARKNDAAIKTIEFIDEQLSTIA-DSLRISEGRL
A0A0A2EYC8      ISVASDNPIRDVDFLSKHAKSFLDDNLDKKNYEADKTIQFINDQLSVIS-DSLSRSESNL
A0A2G6H6Y4      LSLASNNPARDIDFLNQHSKSFLSNNLDRKNSEAEKTIHFINDQLSNVS-DSLSRSEAKL
A0A1M3DPL8      ISMVSETPRRDVDFINKLCDIYLMSNLERKNDAATKTIQFIDEQLENVS-KSLATSEDNL
A0A1V5F519      ISLISETPDRDVDFINKLSEIYLEENLKKKNDVASKTIQFINEQLSEVS-KSLSVSEDEM
A0A2G6R1T9      ISLQSPTPQRDVDFINKLFEVYLANNLERKNEQARKTIKFIDEQLTGIK-QTLKGSENDI
A0A350V3E4      IKTESPSPQEAALISNCYAEAYADYSMKFNRGHLTLNREFLEKQVQEKY-NSLLQTEDKL
A0A6J4K208      LSIRGTLPDKEAAFLNGLLRVHLREGQERQHRQHRDVIAWIDRQLGLDG-GDAAEAPEPV
A0A2W4RDE8      LTIEQAVPQKGVDFINAVMRVYLDNELYKKNQLGLRTIAFIDEQLMGVS-DSLRRVEGTL
A0A0L8VEV2      LSLIDQVPQKGADYLNELSRVYLAYELREKNHTSATTIDFIDSQLKDVI-DTLQVAGNKF
A0A1I2A9Z9      LSMVDEVPQKAADYLNELSRVYLTYELREKNHASATTIDFIDSQLKDVI-DTLKVAGNNF
A0A212J9Z9      ISMSGTNPAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLIN-DSLDISRFKL
F5IV23          ISMSGTNPAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLIN-DSLDISRFKL
F8X2T0          VSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVIN-DSLNISRLKL
A0A1M3LAG1      VSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVIN-DSLNISRLKL
A0A212K6G4      VSMYGTDPAKDMDYLKALLDKFQDYNLALKNQQADLTIKFLDAQITVIN-DSLNISRLKL
A0A4Y9IPG7      VSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVIN-DSLNISRLKL
A0A1M5DFS8      ISIYGTSPAQDVDFLKALLKEFEEYNLTLKNEAADRTIAFIDRQMTLIS-DSLEQSEQTF
A0A4Y8KZS5      VSIFGTSPLQDVDFLRALLKEFEDYNLTLKNEAADRTIAFIDRQMALIS-DSLQQSETTF
A0A2V3PNY7      ISIFGSSPAQDVDFLRALLQEFEEYNLTLKNEAADRTIAFIDKQMGIIA-DSLQQSEIIF
A0A6G7X5K8      VSIYGSSPAQDVDFLRALLKEFEDYNLTLKNEAADRTIAFIDRQMGIIA-DSLQQSEASF
A0A2P8CDS1      LSTTCENPQKGIDFLNEMMQVYQTHNLDKKNIIATKTIFFITSQLANVS-DSLSASQKIR
A0A660LQT8      MSFNDVSQERAEDVLRMLIDAYNEAWLADKNQIAVNTSKFINERLQVIE-NELGNVDKNI
A0A389LWV6      ISLVGKVTQRDIDFLKILNQEFFDDNLKRKNATAERAIEFINEQLLILK-DSISSAESKL
A0A1G9B1T9      LTTTGEIVEKELMFLNSLMETYIEDEVKNKNLLGLRTINFIDKQIATVA-DSLSQVEQSL
A0A350PNH9      LTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIE-RELGDVDKDI
A0A354LNT9      LTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIE-RELGDVDKDI
A0A161LWY6      VSLVGTVYQRDIDFLNALCDEFLLDNLNRKNEEANRTISFIDKQLSDIS-DSLRTSESHL
A0A6I3N9U6      VSLVGTVYQRDIDFLNALCDEFLLDNLNRKNEEANRTISFIDKQLSDIS-DSLKTSESHL
A0A3D0FMX4      IQLVSETPERDKEFIDKLCDIYLLQSLERKNKVAESTIQFIDQQLDTIR-KSLASSESAM
A0A1M3MEI8      ISLASATPARDVDFINKLCEVYLISNLERKNDAASKTITFIDKQLESVA-EELSMSEDEF
A0A1J5HQM0      IAMNSETPERDIDYINKHVTMSLLQNLERKNDAANKTINFIDEQLQNVS-KSLTVSQGEM
A0A653AC35      VSLVSPTPQRDIDFLNKLSELFLAENLERKNDAANKTMRFIDEQLSDVK-KSLEASEGAM
E4T131          INFVSDTPDRDIDFINKLCETFLADNLSRKNDAANKTIQFIDEQLKGVS-KSLTTSESQM
A0A2W7RD29      IRLITNNPAKGEDFLNQLMNNYLFIELDDKNSIATNTINFISNQIQNVS-DTLGVIENEL
A0A3N2NDY8      LSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIE-RELGNVDNEI
D7JEV9          ISVLSDNPLRDVDFLTRHAQSFLDDNLDKKNYEADKTIQFINDQLGIIS-DSLSRSESNL
A0A4R6H3B7      LSMVDEVPQKAADYLNELSSVYLTYELREKNHASATTIDFIDSQLKDVI-DTLKVAGNNF
A0A521H707      ISFKDQNSQKASDFVNTMVDEFNRYDKERKSEGADKSLQFIDETVLGID-TQLRLSEYSV
A0A1F3D6P8      LKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEIS-DSLVISESKL
A0A356Z058      LKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEIS-DSLVISESKL
A0A3D1BT36      VFFQGENLDLTVDFLNTFLQTYLDNNLSKKNTIALNTVNFIDSQISEIS-ESLSSSQSEL
A0A5R9QZP0      INFKGENLDLTVDFLNNYLQTYLNDNLSKKNNVAFNTINFIDAQISDIS-DSLVKSESEL
A0A3D3HL11      VLFHGENRRLTIDFLNKFIQSYLDENLAKKNKIAINTIDFIDSQISEIS-DSLTQSESKL
A0A6L8U6G9      LLFTGENRRLTIDFLNNFIQAYLDDNLSKKNKIALNTIDFIDSQISEIS-DSLTISESKL
A0A352ME00      VRFSENNLDKTINFLNRYLSTFLEGNLAKKNNMASKTVNFIDSQVSDMA-DSLVRSESAL
A0A6L8UH35      IKFTDNNLEKTIKFLNQYLNSFLDDNLGKKNKIALSTVNFIDSQISEIS-DSLNISESQL
A0A3P1Z8V4      LTCTDINKHRAEDVLNEVCNIYKKDIVDNKNRVAQRTAEFIDERLTLIS-RELSDVEHRL
A0A1M6MYT6      LTLRDRNVRKGMAFLNKLTEVYQLDNLEKKNENANRTIQFINSQLASIS-DSLSVSESRM
A0A2W7QSQ0      IRLYDTSPEMGKQIMSSVIEGYNQRIINQKNETALKTINFINERLGIVK-NDLEEFEKSG
A0A3D5KRY6      LELKTNQLERDVDFLDQLSKMYIQYGLEKKNRKASNTITFIDNQIAGVN-YSLQSAGNMF
R7F6L5          LSYTSTSPYRCEDVLNGVVQAYNDQWINDKKAIADATSDFISERLSVIE-QELGNVDSDI
A0A7C5MRV2      VSQIDFVAKFASDFLNTLMKVYEKEDISRKQQAATQALDFIAEQLDTIK-SSVNSAEQIL
A0A229I3A5      LTYKDVLAKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIE-RELGDVDKNI
A0A3R6HJB3      LTYKDVLAKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIE-RVLGDVDKNI
R6NN15          LTFKDVCIQRAEDILNTVIAVYNENWIKDKNQIAVSTSMFINDRLGVIE-SELGHVDENI
A0A553GA49      INLVSTNFNMGKEFLDKYIETVIEYDLQRKNHIAFSTIDFIDDHLSDVF-DSLSIAEQSL
A0A497D6F6      LSLKTLNVAKGIDFLNTLVAVYQAYTLERKNENASRTINFISTQLQTVS-DSLGISENAM
A0A5M4AAB9      LKTTCENTEKGIAFLDMLMRVYQEHNLKKKNTIATKTIFFITSQLSEVR-DSLKASQKIR
F4KR18          LGLRDVVPQRGIDIVNRLVDKFNQLKSEVNTEITLKTLELIDGRLANIS-AELASAESTV
A0A2M6GH67      ISFTDFNPRKAQDIINRVDSAYLVQKLLVKNQATQQQLKFLDEQIQATK-DDVTRYEKAM
A0A7K1TE30      ISFTDNNRLKAKRIVDVLDSVYLDAKLARKQESTDKALAYLDEQLDENG-LRLEKAEDNL
A0A7D4BE70      ISFLDNNRVKAQRLVNALDTVYRDAKLARKQESTEKALAYLDQQLEENG-RNLAKAEDNL
A0A142HHS5      ISFLDNNRFKAQRIVNALDTVYRDVKLAYKQETTENSLAYLDKQLEENG-QNLAKAEDNL
A0A7D4C435      ISFQDYNRLKAQRIVNALDTVYRDAKVARKKESNEKALAYLDQQLSANG-NNLAKAEDNL
C9LKL0          LTCQDINIARATDIINTLFSCYKQDVVDNKNRVGQNTAHFIDERLSLIG-SELAGVEGRL
A0A3D0QPV7      ISMRDHNKAIAHDIVYAITHAFNEFALERKNESSKKILDFIDSQIDTVY-TKLKNSELEL
A0A496KT23      IQYSDVNTARAKDAIDMLISVYNENWVRDRNQISVSTNEFIKERLAVIQ-RELGSVDQNI
L1M9T3          IRYSDVNTARAKDAIDMLISVYNENWVKDRNQISVSTNEFIKERLSVIQ-RELGNVDQNI
A0A3C0I8F1      ISFKDHNAEKVRDIVNVIDTVYLEKTLAAKSQATLQQTNYLNEQLEKVD-EELTKYESLL
R5JJI4          LVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIE-RELGSVDANI
A0A0A2DQN2      LSITEASKQKATDLLGALVEAYNEEVNTLRTQISVNTTEFINNRLISLE-EELESMENNR
A0A0A2F2N5      LTLTDNSKQRATDLLEAIVDAYNTETSSVRNQIAVNTARFINERIANLS-EELDALASNI
L1NGW4          LSLQDRTKQRALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLS-KELGIVENEM
Z4WRA0          LSLQDRTKQRALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLS-KELGIVENEM
U2K8K9          LTLRDKTLKRALDILAAQVMAYNQEEVEMRNQVSKNTAEFVNERLEALS-RELGVVEQDM
A0A069ZM60      LRLQDRTKKRALDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALG-KELGLVEGDM
J6GV98          LRLQDRTKKRALDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALG-KELGLVEGDM
A0A134B4F8      IRLQDRTKKRALDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALG-KELGLVEGDM
A0A134B8C7      IRLQDRTKKRALDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALG-KELGLVEGDM
A0A3D2HF71      LTVTGTNPEQEADYLNKLMDVYIEFGLENKNRTADQTIDFIEKQLAIIS-DSLHLAENSL
A0A4Z0EKR0      LTLTDPIAGKAKDVLNKLMDVYNREAIEEKNLTTANTLKFLDDRLEKLA-YGLSGTEKVV
B5CTK0          LSIIDSSVARADDVLNTLIAVYNEDLINDKNQIAINTSNFISERLNIIE-KELGNVDSNI
A0A1M6B6D5      MRMTGHNKAKLVDYLNMSVQVLSEDMLERKNLFATKTIRFIDSSLAEKS-IELSLVEDEL
A0A451FS66      LTVIGSNKAKLVDYLNTSIQILSEDMLERKNLYATKTIQFIDSSLAKKS-AELNSVQDEL
A0A2E3GN39      VSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSISFLDKQIDSIK-PLYDDALIAV
A0A3D1MEL0      VSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLDQQIDSIK-PLYDDALIAV
A0A519UDD1      LSLTDPIPAKAKDILNKLMEVYNKEAIEDKNLLATNTLRFLDDRLAYLT-SDLSSVEKLV
A0A2A4N9A6      LNFRDPNPAKAADFLNNLVQSYMEYGLDKRKESIINSANFIEDQLQKIEIQLLNSTNKLM
A0A6C0GGI1      LYAEGTVAAKEAKFLDTLISVYLETDLIEKQEANIKAIAFINSQLSTVA-NQLENS----
A0A368D1N7      VSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLDQQIDSIK-PLYDGALIAV
A0A3B8TU58      ITGKHPSKAKALVMVDLLIESFLNFHLYQKTESIKQSISFLDEQIDSIK-PLYDEALVAV
A0A1T5IIR6      LVEQDYNAQRAADIINMLVVKYNEAAIREKNRVAVHTEDFINERLAIIE-EELGGVEGEL
A0A3E0QD27      IKFNDNNAVKASDFVNSIMDEFNEYDRERKSEGAIKSLDFINETVAGID-VELRASEGSL
A0A6N8DCX3      LSYKDISIPRAEDVLNTVITVYNEEWMKDKNQITVSTSRFISERLEALE-HELGKVDSDI
F0R0C9          LSFQDVCIQRAEDVLNTVIAVYNENWVKDKNQIAVSTSMFINERLGVIE-GELGNVDENI
A0A0M1W1I6      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENEL
A0A4R4GHU2      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENEL
I8WPR6          LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENEL
A0A0K2HKS3      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENEL
B6W3W8          LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENEL
A0A7M3EEL4      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENEL
A0A076IRY8      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENEL
A0A3A6AD54      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENEL
A0A3A6MIU7      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENEL
I8WPP8          LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENEL
A0A372Y7D2      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENEL
A0A7K3KFI2      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENEL
A0A3E4JJC9      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENEL
A0A3E4WDQ0      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENEL
A0A414H9P2      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENEL
A0A7K0JKU9      LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENEL
C3R5A8          LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENEL
A0A1C5XJA7      LALKDNSSERAEDILNMLVNVYNEETIRDKNQVAVNTANFINERLIIIG-QELGDVESDL
A0A285T4L1      LSLKDDSPLRAEDVLNTLVNVYNEEALNDKNQVAVNTSEFINERLLIIE-RELGGVETEL
A0A3E5BU42      LSLKDDSPLRAEDVLNTLVNVYNEEALNDKNQVAVNTSEFINERLLIIE-RELGGVETEL
R7CUW4          LALKDSSPVRAEDVLNMLITVYNEEAIKDKNQVAVNTANFINERLIIIE-RELGGVESDL
A0A416GGJ1      LALRDFSPERAEELLNTMINVYNEEAIEDKNQVAINTANFINERLIIIE-KDLGVVESDL
D1JY72          LSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENEL
A0A7G5NJU1      LSLKDGSPLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIE-RELGGVETEL
D7J4K6          LSLKDGSPLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIE-RELGGVETEL
Q8ABP9          LSLKDGSPLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIE-RELGGVETEL
D6D2Z5          LSLKDGSPLRAEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIE-RELGGVETEL
A0A1T3EDR4      LSIEDSSSKRGVSFLKSLVAVYNALYLDDKKRIAQSTGEFIADRLKIVE-GELSGVEQKI
A0A6N8KXI9      ISIQDGSPKRADDIITKMIEVYNELTVIDKNQIANNTSNFIKERLQIIE-SELGSVESDI
A0A174SDD8      IAMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDI
A0A1H7RFH3      LTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDI
A0A139L1N2      LTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDI
A0A174TVL8      LTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDI
A0A1H8BJR6      LTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDI
R9H6G0          LTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDI
A0A412GR09      LTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDI
A0A7J5JXN6      LTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDI
A0A081PBV5      VFVEDSSLQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQ-SELGSVESNL
A0A1I2AN85      VFVEDSSLQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQ-SELGSVESNL
A0A4U0GMP3      ISMEDNSPRRAEDVITMLITVYNEEAIDDKNRIAVNTADFIRERIDIIE-SELGLVESDL
A0A1H6CKR6      MTMEDTSPMRAAEMITNLITVYNNMTINDKKALGDTTANFIRDRIAIIE-TELSGVESQI
A0A235E1C0      MTLEDASPLRAEDMVTKLIEVYNQMTIEDKKTVANNTADFINDRIVIIE-KELSSVESSL
R6D982          IMMDDFSPLRAGDVLNMLITVYNEEAIEDKNRIAVNAAQFIRERIEIIE-DELGSVETDI
A0A1F0I8C4      ITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDI
A0A3A5RIJ2      ITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDI
A0A515IZJ5      ITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDI
A0A7J4Y2H6      ITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDI
A0A0D5BSQ0      ITLSDNSSERASDILTLLVQVYNEVYLQDKNKIAVNTAKFIKDRLVIIE-AELGAVESNI
A0A1T3F6P5      VTITDDSPERAADILTSLIIVYNEVYLQDKGKIAENTANFIKDRLAIIE-GELGAVESNV
A0A0W8EPA0      VTISDDSPDRAADILTSLITVYNDVYLQDKGKIAENTANFIKDRLAIIE-GELGAVESNV
A0A365UKN1      LTIKDDSPERAADILTSLITVYNDVFLQDKGKIAENTANFIKDRLAIIE-GELGAVESNV
A0A4R6WE41      MHLEDRSARRAGDILTELITVYNRTALEDLNQTAVNTADFIKNRLQIIE-EELYEVETDI
A0A2T5RP38      VSLDDLSSERADDILGTLIKMYNEIYLQDKNKIAVNTANFIKDRLAIIE-SELGAVEANI
A0A1A6CF06      VSIEDVSSDRADDMLTTLINVYNEVYLQDKNKIAVNTADFIKERLAIIE-GELGAVESNI
A0A1T3D6S8      VSMDDVSSDRADDMLTTLINVYNEVYLQDKNKIAINTADFIKERLAIIE-GELGAVESNI
A0A1P8E011      IVAEDTNPLRATALIAEMINVYNEVALQDKNQIGVNTANFIRERLAIIE-QELGSVESSI
A0A1V3N3U3      IVIEDQNPQRAAALIAEMITVYNEISLKDKNQIGVNTANFIKERLAIIQ-QELGSVESNI
C2FUH6          ITLEDQSIKRANDIITTLITVYNEFSLEDKNQIAINTAQFIRERLQIIE-SELGNVENNI
A0A0B8T471      MSLEDVSAERAADMLSTLVTVYNKETVEDKNRVAKNSAEFIKERIAIIE-TELGGVETDL
A0A4R7D2K0      MSLEDVSAERAADMLSTLVSVYNQETVEDKNRVAKNSAEFIKDRIAIIE-DELGGVETDL
A0A2X2J8S4      IAMEDSNPQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILS-EELGSVEGDL
A0A3C0S618      IAMEDSNPQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILS-EELGSVEGDL
A0A4P7DRF9      VTMEDSNPLRAADMITKLIKVYNVMTIKDKNMIAHNTADFIRDRIAIIE-EELSSVESDI
A0A239XXC4      MTLEDASPLRAEDMITKLIEVYNQMTIEDKKTVANNTADFINDRIVIIE-KELSSVESSL
A0A4U9K473      MTMEDSSPMRAEEMISKLIEVYNEMTVQDKKKIANNTANFINDRLVIIE-KELSSVESDL
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      --------------MKQLISRYQKASIGEKNKVADNTIAFINANLARIS-SELVQVETRI
A0A2P8G5K0      MSVQDVLPRKGEAILNQLIARYQKASIGEKNKVADNTIAFINNNLARIS-SELALVETNI
R5DEG6          LTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIE-KELGDVDSDI
A0A4Q3SEI4      LTMNDEVPERGENILDNLLTVYNKAAISDKNVMSSNTLDFVEERIRFVV-KELDSIETKL
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      IAFQSANARKAHDIVTALANEFTKYDIEERSKSSRNVLGFIDKQLDKYY-NKLKVSENKL
A0A7C7LI79      -----------------IAQEFIDYDIKKKAKSANKVLAFIDEQLTLVY-EKLRTSENKM
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      VPVTPPPPAGQA------------------------------------------------
A0A519TAP8      ISFTDNNPEKAAHIINNIDTVYLQEKLDRKKQSSALSLEFIDQVIADND-KRWRAAEEAH
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A7C7CKY6      QSFKKQNKLSKQDDLLTVY-----VERLD----HFESQLIDLELESDLLKDIT-----AT
A0A1G1TG88      QGFVEQTKTYDVRSEVAAL-----AAKGE----DLEEQRLKLNQNLVLLSDISRMVQQTH
A0A661XXA6      EDVTISNRTVSLDEDVKRT-----VTIMN----NLDSQQVRLQDRLADLNSIINEIKDGQ
A0A519SD85      QKFKEVDNDIISPLAISHN-----VKAYS----DLNEELKRISIAEQTLKFVYKDLTK--
A0A3M1TXY5      RGFRAGTNIVDIGVTSKDL-----TDQLT----ELERQRAALAVAGQYYEYVLEDIQADN
A0A2E0VQ27      AGYRSENQLINSTQETDAV-----LRELT----QLNLQKVDLDMKTSELKRLQEYLLS--
R6U429          KDYKAEHNITDIQSLSAAY-----LGEST----EYKSMSFEVNNQLAIAKFIKEYLEN--
A0A5C8AF42      MLYQRQSNLPDPEAVGTTI-----SENIS----KLQDQQFEIDEEIRSLNLVSSKLKS--
A0A353WYK7      ENFTIDNRTTDMNVSLSRT-----ITMLE----ELDSIKMKLNDQLDNFNEIYDKLLDTA
A0A355BP94      EDFTLKNKSSDLTTELRQT-----IYALN----QVDSQRFSLNKRILELNGYIEE-LSTG
A0A136LSC7      ESFTLQNKSSDLTLDLKKT-----IAAIN----VVDSQRYSLNKQLAELNTLIDQ-ITAS
A0A5C7N8Q5      ESFTLQNKSSDLTLDLKNT-----IATIN----RVDSQRFNLNKRLIELNALIEH-ITTE
A0A239K409      EQYKRQNKLADVASQSKVY-----VEESN----TYQKQLAEWSVQIDVLETIETYISNSK
A0A1V5S1J9      KDYKANNFVVA-SVGGSNL-----MGQYT----QLDAMQTDLRLKESYLNYLTNYLKSNV
A0A0A2EYC8      NSFKIANKMYG-QNNSILL-----TNKME----ALEEQGKIIKLRDEYFKYLRNYLKNNI
A0A2G6H6Y4      NSYKIEHKIYS-SDMTSVL-----VGQME----KLKNQGKQIKLRDEYFKYIKRYLNKNI
A0A1M3DPL8      SDFRKRNQLINVSSLTDEL-----LSKAA----SFDEELNQIRLKETYIAYVEKYIQTNL
A0A1V5F519      TRFRRDNQIIDISSHGSEL-----MSKAN----SLDEKKAELKLKETYLNYLTKYLTGNF
A0A2G6R1T9      TEFRRSNQIVDITTHTSEI-----VEKST----EYNERKSALRLKEKYLNYLADYIKTNL
A0A350V3E4      TNFLRTENVVELNAQANSI-----ISSLSGIEGDYNRSLIDVQSTTRALTDIKGELDKYD
A0A6J4K208      PAEALPQPRPGEGLRDALL-----------------AERERARNRVQLYEGLLQSLGR--
A0A2W4RDE8      ESFRARSNVIDIRTSAQTL-----TNNLD----KLETERANLEVKLKYYQYILQSLQS--
A0A0L8VEV2      TSFRSQNQIVDIGQEGGII-----VQRLV----DLDKERSLAQSHLDYYRNLQKYLSDTE
A0A1I2A9Z9      TSFRSRNQIVDMSQEGGII-----VQRLV----DLDTERSMIQSHLDYYKNLQQYLDDTE
A0A212J9Z9      ERFQKETGVYDVSSQSLRI-------ALD----SADREKDALALREKSVLLLTEKMKEKI
F5IV23          EKFQKETGVYDVSSQSLRI-------ALD----SADREKDALALREKSVLLLTEKMKEKI
F8X2T0          EQFQKETGVYEVSSATVRR-------ELD----VADVDRDQVAMREKTVLFTTQKIKEGI
A0A1M3LAG1      ERFQKETGVYEVSSATVRR-------ELD----VADVDRDQVAMREKTVLFTTQKIKEGI
A0A212K6G4      ERFQKETGVYEVSSATVRR-------ELD----VADVDRDQVAMREKTVLFTTQKIKEGI
A0A4Y9IPG7      ERFQKETGVYEVSSATVRR-------ELD----VADVDRDQVAMREKTVLFTTQKIKEGI
A0A1M5DFS8      KTFQDETGLYRIQGGDQRA-------DRD----AVLQGIAENKAQEELILRLTDEINNSI
A0A4Y8KZS5      KRFQDETGLYKIEGGDKRL-------ERN----DILTAMAENKAQEDIILRLTDEIKSSI
A0A2V3PNY7      KDFQDETGLYRITKSDGRV-------ELE----SVMKSIGEVKAQEDLILRLTDEISNSI
A0A6G7X5K8      KDFQDETGLYRLTKTDGRS-------ELE----SVMQSIGEVKAQEDMILRLTDEINSSI
A0A2P8CDS1      ERFQSRNNLLDVSYQSQQL-----LDQLV----KLEDQKSLLETQHQYYQYLETYLSRND
A0A660LQT8      SSYKSANLLSDTDEASKLY-----IKKTE----ENTDKMMDLNNQIYMTRYVSQLISN--
A0A389LWV6      NAYQSQAGIFSSDNSLRSS------TELV----DLDKKKAEIRLRKEYTKFLQDNLKK--
A0A1G9B1T9      RSFRDRTRTVDIGTTARDL-----NTKLD----ELQKTREDLLIDYRSYQNLFQYLEQ--
A0A350PNH9      SSFKSRNLLPDVETAAQQY-----MQKSG----DVDKQILELNSRLSMARYLRDFLTG--
A0A354LNT9      SSFKSRNLLPDVETAAQQY-----MQKSG----DVDKQILELNSRLSMARYLRDFLTG--
A0A161LWY6      QHFRKANQILDLNAYGSTI-----LGHLT----SYDEKRLQYNLKESYLNYLADYIKKNV
A0A6I3N9U6      QHFRKANQILDLNAYGSTI-----LGHLT----SYDEKRLQYNLKESYLNYLTDYIKKNV
A0A3D0FMX4      TDFRKRNEIVDIQSYSSEL-----LGKVN----AYDQERLAMRLKETYFEYLTNYLNTTM
A0A1M3MEI8      TSFRRRNQIIDVGSFSGDL-----LSKAA----AYDTEINQLKLKESYLDYLVKYVKTNL
A0A1J5HQM0      TDFRQRNQIINVDTHAGEL-----LGKSN----SYESQFSTLKLKETYLDYLTKYLRTNM
A0A653AC35      TQFRQSNQIVDMSSHSTEV-----LGKAT----AYDEKQNELQLRESYFNYLTDYLKTNL
E4T131          TNFRQSNKIVDVSSHTSDL-----LGKAT----KYDGQQAELKLREDYLTYLTKYLKTNL
A0A2W7RD29      QNFRAANQTTNISSEGEVI-----FGRLQ----SMGEELAKEKIKKEYLLSLDRYLRN--
A0A3N2NDY8      FDFKRDHRVPNLEEAAKTQ-----MKQSV----EMSNKMLEVTNQMSMSIYLRDYLNN--
D7JEV9          NSFKVANKMYGQNNTSIL------TERME----SLENQGKQIRLRDEYFKYLRNYLKNNI
A0A4R6H3B7      TSFRSRNQIVDMSQEGGII-----VQRLV----DLDTERSMIQSHLDYYKNLQQYLDDTE
A0A521H707      EAFKKEHLIIDPLQNAEDA-----LAHIN----LLIDQRIEVQLQLAVLQRIEKNINS--
A0A1F3D6P8      RNYRSANQVMDLSFQGKSL-----YEKLE----QIETERANLQIQERYYNYIINNFKS--
A0A356Z058      RNYRSANQVMDLSFQGKSL-----YEKLE----QIETERANLQIQERYYNYIINNFKS--
A0A3D1BT36      RDYRSTHQVTDLSYQGQQA-----LNQME----QIDNEKATLQAQQRYYNYIIDYFNN--
A0A5R9QZP0      RNFKASNQVTDLSYQGQQA-----LTQIT----AVDNEISSLNVQEKYYNYILDYFDQ--
A0A3D3HL11      RDYRSANQVTDLSYQGQQA-----LEQMR----QIENERSMLQVQERYYNYILDYFDK--
A0A6L8U6G9      RDYRSAHQVTDLSYQGQQA-----LEAMR----EIENERTTLQVQERYYNYVLDYMEK--
A0A352ME00      KNYRSANQVMDLSFQGQRV-----YEQMT----DIDNERANLKVQERYYNYVINYFKM--
A0A6L8UH35      RNYRAANQVMDLSFQGQQT-----FEQMT----LIQQERATLQLQQRYYNYVINYFKA--
A0A3P1Z8V4      ATFKQNNSIVDLTATATAM-----TQQSI----QARQKTIELETELSVASFLADHLRS--
A0A1M6MYT6      EDFQSEHQIVNISAQSEQL-----LERMR----ELDQERIAMETQNKYYHYLRDYINT--
A0A2W7QSQ0      ENFKTRNNITDISMNSKIY-----LENTA----ETRKQVAEVSGKIDILESIELTMNN--
A0A3D5KRY6      TNFRAENRTVDLGREASLV-----VENLK----KVEADRANLDLRLESFNNLKYYLEN--
R7F6L5          SSYKARTMSPDLEAQAQIN-----MARSS----ELQNQQYDLSNQIQILNYVRGELSR--
A0A7C5MRV2      QEFKQDKEFISVDLKVGFD-----MESMK----RNAELQSHHVLKLMEINRLSTDIAR--
A0A229I3A5      SAFKSSNLLPDVEAAAQQY-----MQKST----EVDKQIMDLNSRLAIAQYIRNYLTG--
A0A3R6HJB3      STFKSSNLLPDVEAAAQQY-----MQKST----EVDKQIMDLNSRLAIAQYIRNYLTG--
R6NN15          STFKSENLLPDVQAASQLY-----MTERS----QAQSQILTLNTQLSMARYIRNYLTA--
A0A553GA49      QDFKTDQQVVDVNLKAGQI-----YENLR----AIGIEKDQLEAHVNNLEFLNENFQK--
A0A497D6F6      QAFQSKHKLLNISIQSEQL-----LDQVN----ELEKEKVVLETKNKYYKYLREYIIN--
A0A5M4AAB9      ERFQSNNQLLDVGYQSQQL-----LDQLV----KLEDQKNLLETQHQYYKYLENYLLQ--
F4KR18          ESYKLNNDII-----AETT-----TDLSI----TLEDVNNLVKEQRKVELQQKMLQAM--
A0A2M6GH67      QDFAIQNKTYDVRGEIAKS-----MARLE----ELYKERSDLGLQINLLRDIHNLVAH--
A0A7K1TE30      KGFVLKNGTYDAKGELGNI-----TSKME----ELAADRLKLEQKGALLAEVGRLATQER
A0A7D4BE70      KNFVQRNGTYDAKSELGDI-----TSKLE----DIQTTRLKLQQKITVLTEVAQLATQER
A0A142HHS5      KIFVQQNGTYDAKGELGTI-----TNKLE----KIEEDRFKLEQKLTLLADVSQRAAAER
A0A7D4C435      KSFVQRNGTYDAKEQLSEI-----TTKLT----EIEKQRDELEQKLTLLNNVGRLAEQEQ
C9LKL0          ASLKESNRIVDFKTAADQY-----SSMSV----TARQSSVDLQSQVSVARYLKDFMQN--
A0A3D0QPV7      QAFRQLNKVQNFEGVSKNY-----LERLT----ELEGQLLKVDIDEELIIEVERALKE--
A0A496KT23      AGYKSANLLPDVEQSGNMA-----VNQAN----EAEAKARELSTQVYMTRHVKEYLTD--
L1M9T3          AGYKSANLLPDVEQSGSMA-----MAQAN----DAEIKARELSTQTYMTRHVREYLTD--
A0A3C0I8F1      EGSLIENKTTDLLSKFSTS-----VKESE----NFGEKKAEITNLLNLLDQLEVQAQN--
R5JJI4          ESFKRENQLTDITSETGMY-----LQNTS----RYKQEGLSLENQLSIVKYIKEYLVD--
A0A0A2DQN2      EELLIENQFINPASLAESY-----MNRTQ----TNQNGRIELEAQERLIAYMQSYLKD--
A0A0A2F2N5      DSFQRANNFIAPEVVAGAY-----TSRAQ----TGHEASFEIDAQKRLARYFLDFINN--
L1NGW4          ESFLVTNRTLDFDAKMGRY-----NTRSV----DYEVQAMEIETQLKLVSFMLSNLSS--
Z4WRA0          ESFLVTNRTLDFDAKMGRY-----NTRSV----DYEVQAMEIETQLKLVSFMLSNLSS--
U2K8K9          TRFSARNKTIDFTSKVESY-----NARSL----EEEDASIKIEKQLKLVSYMLSQLNS--
A0A069ZM60      ERFLMNNRTLDFEGKVGVY-----NSRSL----ESEAEALQIETQLKLISYMLSEFSN--
J6GV98          ERFLMNNRTLDFEGKVGVY-----NSRSL----ESEAEALQIETQLKLISYMLSEFSN--
A0A134B4F8      ERFLMNNRTLDFEGKVGVY-----NSRSL----ESEAEALQIETQLKLISYMLSEFSN--
A0A134B8C7      ERFLMNNRTLDFEGKVGVY-----NSRSL----ESEAEALQIETQLKLISYMLSEFSN--
A0A3D2HF71      ESFRLANRLIDLSREGVAI-----QNRLE----EIDKEKTSLMLQKNYYEYLKDYIDT--
A0A4Z0EKR0      EKFKSANQLTDITTQASNY-----TSQAN----SYDKQLSEWAIQIDVLESIEGYLEK--
B5CTK0          ETFKRQNRLTDVNSEASMY-----LASSS----SYQQEGVGIENQLTLAKYIKSYLTD--
A0A1M6B6D5      NDFRRNNVIFDLNIEGAEL-----NEKLN----ALDLRKEAAARELDYYNTLQEYLVT--
A0A451FS66      NKFRNKSAVYDLATEGSEL-----NSKLN----ALDLRKEAVNRELNYFITLQEYLTT--
A0A2E3GN39      RNAEAQKGYRNIEALGGGL-----YKDIK----DLQKKLVRIEYVTSVLEWFAVMIQQ--
A0A3D1MEL0      RNAEAQKGYRNIEALGGGL-----YQDVK----ELQKKLVRIEYVTSVLEWFAVMVQQ--
A0A519UDD1      EQYKSTKGLTDVSTQASVY-----TSQAS----TYNTQLSELAIQIDVLESLERYLVT--
A0A2A4N9A6      NINLDTKTIANISRVFQSEGKYIINDNPE----FLIAQKINDLKLEINIIDTVNYYL---
A0A6C0GGI1      --KQALEGYKRTYGTERGVAKLNAYERLE----ALQLQRSDYTTRLRSLNNTLDYMIT--
A0A368D1N7      RNAEAQKGYRNIEALGGGL-----YEDVK----ELQRK----LVRIEYVTSVLEWFAV--
A0A3B8TU58      RNAEAQKGYRNIEALGGGL-----YADVK----NLQQK----LVRLDYLISVLGWFAV--
A0A1T5IIR6      ARFKSSNKIMDVDYTANMY-----LGDSR----GYNAEIVAVETKLALSNYLKDHVVS--
A0A3E0QD27      EQFKKDNMIIDPRQNASEA-----LTHIN----KLIEQRVEMQLQLAVMNRLERDITS--
A0A6N8DCX3      STYKSENLLPDAEKASMLF-----MEQAQ----ENDNRLIAISTQAAIAKYIREHLTG--
F0R0C9          SSYKSEHLLPDVQAASNLY-----MAQSS----ETNAQILALNTQLSMARYIRNYLTA--
A0A0M1W1I6      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYLVD--
A0A4R4GHU2      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYLVD--
I8WPR6          QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYLVD--
A0A0K2HKS3      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYLVD--
B6W3W8          QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYLVD--
A0A7M3EEL4      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYLVD--
A0A076IRY8      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYLVD--
A0A3A6AD54      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYLVD--
A0A3A6MIU7      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYLVD--
I8WPP8          QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYLVD--
A0A372Y7D2      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYLVD--
A0A7K3KFI2      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYLVD--
A0A3E4JJC9      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYLVD--
A0A3E4WDQ0      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYLVD--
A0A414H9P2      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYLVD--
A0A7K0JKU9      QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYLVD--
C3R5A8          QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSYLVD--
A0A1C5XJA7      ESFKRENQTLDISSSASMY-----MGESQ----KYNSSALELETQLRLAQYIKEYLTD--
A0A285T4L1      EAFKQSNQLMDIGSLAGQY-----MGEAQ----TYSADALEQETQLKLAQFIKEYLTD--
A0A3E5BU42      EAFKQSNQLMDIGSLAGQY-----MGEAQ----TYSADALEQETQLKLAQFIKEYLTD--
R7CUW4          ESFKRSNQIVDISSAAGMY-----MTESQ----KYNADALELETQLRLANFIKDYLTD--
A0A416GGJ1      ETFKSSNQLMDVSSTAGMY-----MSESQ----KYGADGMELETQLRLAQYIKEYLID--
D1JY72          QSYKQNNDIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGYLVD--
A0A7G5NJU1      ESFKQHNQVMDIGSLAGRY-----MGEAQ----AYSADALEQETQLKLARFIKEYLTD--
D7J4K6          ESFKQHNQVMDIGSLAGRY-----MGEAQ----AYSADALEQETQLKLARFIKEYLTD--
Q8ABP9          ESFKQHNQVMDIGSLAGRY-----MGEAQ----AYSADALEQETQLKLARFIKEYLTD--
D6D2Z5          ESFKQHNQVMDIGSLAGRY-----MGEAQ----AYSADALEQETQLKLARFIKEYLTD--
A0A1T3EDR4      EDFKLSNQGMDAQSLKSLS-----LSEQG----ENKSQGMKIDMDISLLEMLSSYLKD--
A0A6N8KXI9      ENLKSRNQGIDVGTASEIY-----LTDSR----QYQADKNKIETDIKLANMMRDYLRS--
A0A174SDD8      EDLKKANNGVDINMAAGMY-----IQDSR----QYESSIKELDTQLQLVTFIKQYLQD--
A0A1H7RFH3      EDLKRANNGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYLQD--
A0A139L1N2      EDLKRANNGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYLQD--
A0A174TVL8      EDLKRANNGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYLQD--
A0A1H8BJR6      EDLKRANNGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYLQD--
R9H6G0          EDLKRANNGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYLQD--
A0A412GR09      EDLKRANNGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYLQD--
A0A7J5JXN6      EDLKRANNGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQYLQD--
A0A081PBV5      ENLKVSNQGIDVNAASQMY-----VSEGM----MHESAGNDVQTQLKLVEMMQNYMRD--
A0A1I2AN85      ENLKVSNQGIDVNAASQMY-----VSEGM----MHESAGNDVQTQLKLVEMMQNYMRD--
A0A4U0GMP3      ERLRIANQGLDLASSRQMY-----SSESQ----TYYAEGNAAETQMKLVELMKQYLED--
A0A1H6CKR6      EGMKTSNQGLDVKSAGEQY-----WSDSR----GYDASSKEIETQMKLVEIMRQRLDD--
A0A235E1C0      EGMKTQNQGLDVKSAGEQY-----WTESR----TYQSSSKELATQMKLVEIMRQRLSD--
R6D982          EVMRKESDWGDINTAASMY-----VSDGR----KYESSLKELDTQLQLVSFIKQYLQD--
A0A1F0I8C4      EDLKRANNGVDINTVAGIY-----IQDSR----QYELLIKELDTQLQLVTFIRQYLQD--
A0A3A5RIJ2      EDLKRANNGVDINTVAGIY-----IQDSR----QYELLIKELDTQLQLVTFIRQYLQD--
A0A515IZJ5      EDLKRANNGVDINTVAGIY-----IQDSR----QYELLIKELDTQLQLVTFIRQYLQD--
A0A7J4Y2H6      EDLKRANNGVDINTVAGIY-----IQDSR----QYELLIKELDTQLQLVTFIRQYLQD--
A0A0D5BSQ0      ENLKVANQGIDVETAGSMY-----LAEKN----QYKTDRTKVETDIRLAEMMRSYLGS--
A0A1T3F6P5      ENLKVANQGIDVATAGGLY-----LNEKN----QYKTEGAKIETDIRLAEMMRSYLTN--
A0A0W8EPA0      ENLKVANQGIDVATAGGLY-----LNEKS----QYKSEGAKIETDIRLAEMMRSYLTN--
A0A365UKN1      ENLKVANQGIDVATAGGLY-----LNEKN----QYKTEGAKIETDIRLAEMMRSYLNN--
A0A4R6WE41      EKLKVNNQGVDVGTAGQLY-----VAEGR----AFQTQRTQIETDKRLVEMMRDYLTA--
A0A2T5RP38      ENLKIDNQGLDIETAGGMY-----LSESN----QYKTEKTKTETDLRLAEMMRSYLNN--
A0A1A6CF06      ENLKIANQGIDIATAGGMY-----LSESS----QYKTEGTKIETDIRLAEMMHSYLNN--
A0A1T3D6S8      ENLKIANQGMDVATSGNMY-----LSESN----QYKTEGTKIETDIRLAEMMHSYLTN--
A0A1P8E011      EDLRTQNQGMDASTVGTAY-----FEDSR----LYQSERNKVETDINLAQMMRGYLSD--
A0A1V3N3U3      EQLRQSNQGVNIETAGEMY-----LNDSR----QFQSARTKIETERKLTQLMQRQLHD--
C2FUH6          EQLKTANQGVDVNVAGEMY-----LSESR----QHLEERNKLETDIRLVDMMRSHLDN--
A0A0B8T471      EQMKARNEGMDVNTATGVF-----WGESR----EYQSTTRGIETQLRLVELMRQRIDN--
A0A4R7D2K0      EQMKARNEGMDVNTATGVF-----WGESR----EYQSTTRGIETQLRLVELMRQRIEN--
A0A2X2J8S4      EKIKVNNNGMDVAEVGGMY-----IEDSR----SYRLEATKIDTDLKLAEMMSDYLSK--
A0A3C0S618      EKIKINNNGMDVAEVGGMY-----IEDSR----SYRLEATKIDTDLKLAEMMSDYLSK--
A0A4P7DRF9      EGMKIQNQGLDVKAAGEQY-----WSESR----GYQSTSKDIETQKKLVEIMRQRLND--
A0A239XXC4      EGMKTQNQGLDVKSAGEQY-----WTESR----TYQSSSKELETQMKLVEIMRQRLSD--
A0A4U9K473      EGMKTQNQGLDVKSAGEQY-----WTESR----GYQSSSKELGTQMKLVEIMRQRLSD--
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3M1Y2F5      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      EHFRKRHRVIDMAEDSRQA-----LQNLN----TNASEEKQLAVHLKIVKLLEGHLR---
A0A2P8G5K0      EHFRKRHRIIDMAEDGRQA-----LQKSA----TNALEEKELAIRLKIVRLLEAHLL---
R5DEG6          ESYKREHQLTDISSETGMY-----LQTSS----QYRQEGLSLENQLSLAKYIKNYLT---
A0A4Q3SEI4      QNYRTKTGVVDLSEQGKLY-----LQSVG----ENDRMMTDLHIQTAMLDEVEKYVL---
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ----------------------------------------MLQMEFNILTEIAKSLE---
A0A519SYE7      --------------DISGL-----KDRLE----QQQLTREKLIQNLRLLDDVQQMVARGQ
A0A7C7CFR2      --------------ELES----------------------------SMLDDIENMIA---
A0A3N2LCI3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A3D4CJE1      QKFQKENKISGSSEFSAMY-----MEKLN----RLENQLIDLDLQINVLKEIQNKAK---
A0A7C7LI79      QSFNKQNKMAGKGDFITIY-----VGKLD----NLESELLDLELEQNMLKEINTMIT---
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      -------VGFGMDNDLVEL-------------------RLELEQNLELLDEVGALAEQER
A0A519TAP8      TEFVRRNKTYDVKGDMATL-----KNGLE----QQQEARQKLQDKLRLLSDINGLMNRDQ
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A7C7CKY6      IAGEKELDAYN---------LLPVLT---------GTP--YKD-EIGDLISNLHNLLATK
A0A1G1TG88      ITRNEEETVEQ---------SIPGL----------GDI--NDP-VLSQLLGQLNGMQWDQ
A0A661XXA6      IV------------------IMPTL----------DDK--FPA-HIISLINELNLLINDR
A0A519SD85      --------------------GIPDRL-----SYDVQDI--PDV-QLQDMTSKYQDLVIKR
A0A3M1TXY5      SLAEV---------------VAPAST---------G-I--EDP-LLTSLLVDLARLKQER
A0A2E0VQ27      --GNS---LSD---------FSPNFE---------A-L--SDP-IFRGSYLKAQSYEEQR
R6U429          --PAH---DGA---------LIPANS---------G-L--TNS-TVESQIGEYNQLVLSR
A0A5C8AF42      --DPNRLEIYR---------LLPEML---------GKS--YEQ-SLTGQIASLYDLLEKK
A0A353WYK7      DLQLG---------------NSELRM--------------LSS-EVAQDINRLEELKKEM
A0A355BP94      KLVQV---------------A-PRNF--------------LPE-YLNTRIEEYLKLVRGK
A0A136LSC7      DFANA---------------IRPANS--------------FPE-SILQRIEELHKKTRER
A0A5C7N8Q5      DFSST---------------SRPTRS--------------LPE-SINQRMEELYKQARER
A0A239K409      ENSYR---------------LVPSTL---------S-I--EDP-TLQELISRFNELQLER
A0A1V5S1J9      EEGAI---------------IAPDNL---------G-V--SDA-NLSSLVSQFTEMQLKR
A0A0A2EYC8      DSESL---------------ASPTTI---------G-I--QEP-RLIALVDKYNELQIKL
A0A2G6H6Y4      QTESL---------------ASPTTI---------G-I--QEP-RLISLVDKYNELQLQL
A0A1M3DPL8      NEGAI---------------IAPSNI---------G-L--NEP-MLMTIVQQINDLLLKR
A0A1V5F519      EEGTV---------------VAPSNL---------G-L--NEP-LLMQLVQQINELYLQR
A0A2G6R1T9      SSGNI---------------IIPTNT---------G-L--NES-TLVVLAQQFNELLEER
A0A350V3E4      PKATD---------------YFESKI--------------TDP-YVAELQGEIARLEIQR
A0A6J4K208      --------ENEMI-------ALPVSP--------------PDT-ALQQRLGRYNDLLRER
A0A2W4RDE8      --GKN---TDI---------VAPSTF---------G-V--DDP-LLSNLLIELSKLNQER
A0A0L8VEV2      KMQEV---------------VAPSVV---------G-I--VDE-SLNNLVTQLSDLYRQR
A0A1I2A9Z9      KMKQV---------------VAPSVV---------G-I--VDD-ALNNLVVHLSDLYRQR
A0A212J9Z9      LGTDD---------------LMDPAS-----------MNIRNP-KLSEFVVTYNELLQKA
F5IV23          LGTDD---------------LMDPAS-----------MNIRNP-KLSEFVVKYNELLQKA
F8X2T0          MGSSE---------------LIDPVS-----------IGLTDEIKLSRYVEEYNQELRKS
A0A1M3LAG1      MGSAE---------------LIDPIS-----------IGLTDEIKLSRYVEEYNQELRKS
A0A212K6G4      MGSAE---------------LIDPIS-----------IGLTDEIKLSRYVEEYNQELRKS
A0A4Y9IPG7      MGSAE---------------LIDPIS-----------IGLTDEIKLSRYVEEYNQELRKS
A0A1M5DFS8      LSNTE---------------LIDPSA-----------FGISDT-KLSQSVGEYNKIVKKL
A0A4Y8KZS5      LNSTE---------------LVSPNA-----------FGINEP-KLSQSIADYNNIIKKL
A0A2V3PNY7      LNKTE---------------LIDPTA-----------LGLNEP-KLARSIGEYNNLVNKL
A0A6G7X5K8      LNRTE---------------LVEPSA-----------LGITEA-KLTQSIGEYNSLINKL
A0A2P8CDS1      NLQSL---------------VAPTTV---------G-I--DDP-LLVNLLQELSQLNIEK
A0A660LQT8      --DKK---KYD---------LLPVNS---------G-I--NST-AIESMIGDYNSNVLQR
A0A389LWV6      --------EDGN--------LVPPSS-----------MGIQDV-ELAVLVSKYNDIFFEI
A0A1G9B1T9      --NDY---TEV---------IAPSVR---------N-I--NDE-VMSGLLRNLIELNQQR
A0A350PNH9      --KVG---KNQ---------LLPANI---------G-I--DSP-GIEQQITEYNKQQLER
A0A354LNT9      --KVG---KNQ---------LLPANI---------G-I--DSP-GIEQQITEYNKQQLER
A0A161LWY6      NNQEL---------------LTPSSL---------G-I--VDP-VLTGLLTQYNETIRKL
A0A6I3N9U6      NNQEL---------------LTPSSL---------G-I--VDP-VLTGLLTQYNETIRKL
A0A3D0FMX4      EQGTV---------------IAPSTM---------G-L--DAQ-ALGTLVTQLNDLQIKR
A0A1M3MEI8      QDGSI---------------VAPTNL---------G-L--NEP-MLMALVQQINELIMKR
A0A1J5HQM0      EDGSI---------------IAPSSL---------G-L--NEP-MLMGLVSQINDLNLKR
A0A653AC35      EAGAI---------------VAPASL---------G-L--NEP-MLMTLVQQFNDAVTLR
E4T131          EDGAI---------------VAPSSL---------G-L--SEP-MLMKLVEQVNDLYNQR
A0A2W7RD29      --NDF---DNI---------VVPSLV---------G-I--TDP-TINSLIDELINLQNEK
A0A3N2NDY8      --PGN---AKS---------VIPVNT---------G-I--GSP-TLEAQISNYNNLLLTR
D7JEV9          DNESL---------------ASPTTI---------G-I--QEP-RLIALVDKYNELQIKL
A0A4R6H3B7      KMKQV---------------VAPSVV---------G-I--VDD-ALNNLVVHLSDLYRQR
A0A521H707      --DEN---TES---------LLPLLS---------GTY--IDG-VIQGLITKIQALEDQK
A0A1F3D6P8      --SND---MSG---------VVPPSA---------MNV--ADP-IMNQLITQLLLLYSQR
A0A356Z058      --SND---MSG---------VVPPSA---------MNV--ADP-IMNQLITQLLLLYSQR
A0A3D1BT36      --NQD---IAG---------LAPPSA---------ANV--SDP-IMNTLVLELLDLNSQR
A0A5R9QZP0      --NQD---ITG---------LSPPSS---------ANV--IDP-IMNSMILELLELNAER
A0A3D3HL11      --NQD---MTS---------LAPPSS---------SNV--VDP-ILSSMIMELQQSSAER
A0A6L8U6G9      --NQD---MSS---------LSPPSA---------ANV--VDP-IMNSLVLELFALNSER
A0A352ME00      --NAD---VSG---------LAPPSA---------MNV--SDP-IINQMITNLNDLNAQR
A0A6L8UH35      --NQD---MAG---------VVPPSA---------MNV--SDP-ITNQMISELLNLYNQR
A0A3P1Z8V4      --SGK---GKE---------VIPAVA---------G-F--TNA-ALAQQITEYNRLVLTR
A0A1M6MYT6      --TASRELETV---------IAPSAM---------G-I--EDP-LLNNLILQLNDLINER
A0A2W7QSQ0      --QSG---QFD---------LIP------------GGLADLDP-SLSGLLTQYNTLQRDK
A0A3D5KRY6      --RDQ---NKD---------LVFPSI---------EQL--TDP-ALIETVKKLNGLYSNR
R7F6L5          --EG----IDE---------TLPSNM---------G-I--ANT-GLESQIQVYNQQVIER
A0A7C5MRV2      --GNR---ELS----------LPYSI---------EGQ--TDP-ILTSLISSYNGLVQEK
A0A229I3A5      --KVG---KNQ---------LLPTNT---------G-I--ESP-GIEQQITEYNKSQLER
A0A3R6HJB3      --KVG---KNQ---------LLPSNT---------G-I--ESP-GIEQQITEYNKSQLER
R6NN15          --ASS---RNQ---------LLPANS---------G-L--ESA-NIENQISEYNNLQLQR
A0A553GA49      --DEDFSAHSV---------TLMSNL--------------NNE-VLNDLLNEYIGLVGRK
A0A497D6F6      --------NQELETI-----IAPSAM---------D-I--DDP-LLNALILELNNLSIEK
A0A5M4AAB9      --------NGDLESL-----VAPSTV---------G-I--DDP-LLVNLLQDLNQLNIEL
F4KR18          --------KSDLQDTSSKFKLIPINP---------A-L--YDG-KIRDLIQPYNDLVMER
A0A2M6GH67      -----DSDLEQ---------IIPSLK---------Q-I--EDA-ELSTKIAELSSLQRSY
A0A7K1TE30      ITASEDQTVEQ---------TLPGLG---------D-L--EDP-VLTELLNELNTTQQNL
A0A7D4BE70      LTPSDDIPVTQ---------SIPELE---------V-L--DNP-SLAQQLTELNSLQQNL
A0A142HHS5      LTPSDEVTVDQ---------TIPGLA---------L-L--EDP-ALSQQLNNLNALQQNL
A0A7D4C435      LTPNDDVSVEQ---------SIPGLV---------L-L--GDP-IISRQLDELNTLQQNL
C9LKL0          --NSN---KHQ---------LIPVLN-----------L--PDA-TFAGLVNEYNTMMIER
A0A3D0QPV7      --YHNESDIYN---------VLSILS---------GTR--FES-ELSGMVKELHVLILTK
A0A496KT23      --GRH---ENQ---------VLPSNS---------G-I--NNA-SIQSQINDYNTRLLER
L1M9T3          --GRH---ENQ---------VLPSNS---------G-I--NNP-SIQAQINDYNSKLLER
A0A3C0I8F1      --DSI---ITT---------LMPEVN-----------L--PGI-DFNSLILKINALFSEI
R5JJI4          --PQK---GSD---------LIPANT---------G-I--SDN-SVESQIKEYNDMLLKR
A0A0A2DQN2      --ASK---TNE---------FLPLNI---------G-I--MSP-ALDESIGQFNQIKQER
A0A0A2F2N5      --PSK---RSE---------YLPQNI---------G-L--NNA-ALETAITAYNQVKPEY
L1NGW4          --PQK---QTE---------YMPLNI---------G-V--SDP-NLDGYIAKYNQLKGDR
Z4WRA0          --PQK---QTE---------YMPLNI---------G-V--SDP-NLDGYIAKYNQLKGDR
U2K8K9          --PSK---RNE---------LMPLNI---------A-M--PDP-ELDGYITQYNQLKFQR
A0A069ZM60      --SHR---KNG---------YLPLNV---------G-V--PDQ-ALDGYIAQYNQLKSQR
J6GV98          --SHR---KNG---------YLPLNV---------G-V--PDQ-ALDGYIAQYNQLKSQR
A0A134B4F8      --SHR---KNG---------YLPLNV---------G-V--PDQ-ALDGYIAQYNQLKSQR
A0A134B8C7      --SHR---KNG---------YLPLNV---------G-V--PDQ-ALDGYIAQYNQLKSQR
A0A3D2HF71      --KKE---SGE---------IIAPSV-----------MGVTDQ-LLIRLVEELSQLQKQK
A0A4Z0EKR0      --NAG---NYS---------AVPSTL---------G-I--KDE-TLLALIGKFNELQQER
B5CTK0          --PSK---NFN---------LIPTNT---------G-ISGADV-NIESSIATYNAMLLKR
A0A1M6B6D5      --RSDY--RDV---------PAPSVA---------G-I--SES-SVVAGVGKIVSLAEQR
A0A451FS66      --RTDY--RDV---------PAPSVA---------G-I--SEG-SIIAGVGKIVALAQER
A0A2E3GN39      --EEDLSLAST---------QLSGEE-----------F--DGI-TRALSVDEILKLEYEK
A0A3D1MEL0      --EEDLSLVST---------QLSGEE-----------F--DGV-TRALSVDEILNLEYEK
A0A519UDD1      --TAG---RYT---------TVPSSL---------G-I--KDG-TLTSLIGKYNELQIER
A0A2A4N9A6      ---------NN---------NISLENIILLPKE-------AYV-TIIGQLRELEL---QK
A0A6C0GGI1      ---------GQ---------DLEMSQVPITA----G-I--NDQ-IIIDLVRQLDILYQER
A0A368D1N7      --MVQ---QEE---------DLNLASTQLSGEDFDG-V--TRA-LSVDEILKLEY---EK
A0A3B8TU58      --MVE---QEE---------DLSLASTQLSGADFEG-I--ING-LSVSEILNLEA---EK
A0A1T5IIR6      --GAE---SYR---------LIPGNM---------G-L--EDN-SMDEVIARYNDLVLQR
A0A3E0QD27      --DSE---VES---------LLPFLS---------GSY--SDG-VILSIVSKIHELEDKR
A0A6N8DCX3      --GKK---RNQ---------LIPVNL---------G-L--ENT-DIEGLITEYNTVQLKR
F0R0C9          --ASS---RNQ---------LLPANS---------G-I--ESA-NIEQQIGEYNTMQLQR
A0A0M1W1I6      --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKR
A0A4R4GHU2      --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKR
I8WPR6          --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKR
A0A0K2HKS3      --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKR
B6W3W8          --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKR
A0A7M3EEL4      --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKR
A0A076IRY8      --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQITAYNANKLKR
A0A3A6AD54      --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQITAYNANKLKR
A0A3A6MIU7      --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQITAYNANKLKR
I8WPP8          --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQITAYNANKLKR
A0A372Y7D2      --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQITAYNANKLKR
A0A7K3KFI2      --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQITAYNANKLKR
A0A3E4JJC9      --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQITAYNANKLKR
A0A3E4WDQ0      --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQITAYNANKLKR
A0A414H9P2      --PSK---ETE---------LISSNT---------G-I--ADI-NIETQITAYNANKLKR
A0A7K0JKU9      --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQITAYNANKLKR
C3R5A8          --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQITAYNANKLKR
A0A1C5XJA7      --PKK---EAD---------LIPSNT---------G-I--SDM-NIENQIGMYNAAKLKR
A0A285T4L1      --PTK---NRD---------LIPSGT---------G-I--SDA-SVEGQINQYNALKLKR
A0A3E5BU42      --PTK---NRD---------LIPSGT---------G-I--SDA-SVEGQINQYNALKLKR
R7CUW4          --PSK---ETD---------LIPSNT---------G-L--SDM-NIESQINLYNTAKLKR
A0A416GGJ1      --PAK---ETD---------LIPANT---------G-L--SDA-SVESQINTYNELKLRR
D1JY72          --PSK---ETE---------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKR
A0A7G5NJU1      --PTK---SRD---------LIPSGT---------G-I--SDA-AVEGQINQYNALKLKR
D7J4K6          --PTK---SRD---------LIPSGT---------G-I--SDA-AVEGQINQYNALKLKR
Q8ABP9          --PTK---SRD---------LIPSGT---------G-I--SDA-AVEGQINQYNALKLKR
D6D2Z5          --PTK---SRD---------LIPSGT---------G-I--SDA-AVEGQINQYNALKLKR
A0A1T3EDR4      --ADK---SKG---------LLPSNM---------G-L--SGG-NIEQQIQAYNSFFLKR
A0A6N8KXI9      --AER---TKD---------LIPNNT---------G-L--VDA-NVESQINEYNNILLKK
A0A174SDD8      --SSK---DDE---------LIPSNI---------G-L--EDL-NIESQIARYNETLLRR
A0A1H7RFH3      --SSK---EDE---------LIPSNI---------G-L--EDL-NIETQISRYNETLLRR
A0A139L1N2      --SSK---EDE---------LIPSNI---------G-L--EDL-NIETQISRYNETLLRR
A0A174TVL8      --SSK---EDE---------LIPSNI---------G-L--EDL-NIETQISRYNETLLRR
A0A1H8BJR6      --SSK---EDE---------LIPSNI---------G-L--EDL-NIETQISRYNETLLRR
R9H6G0          --SSK---EDE---------LIPSNI---------G-L--EDL-NIETQISRYNETLLRR
A0A412GR09      --SSK---EDE---------LIPSNI---------G-L--EDL-NIETQISRYNETLLRR
A0A7J5JXN6      --SSK---EDE---------LIPSNI---------G-L--EDL-NIETQISRYNETLLRR
A0A081PBV5      --ADK---KDD---------LIPNNT---------G-L--VDV-NIENRINEYNTASLRR
A0A1I2AN85      --ADK---KDD---------LIPNNT---------G-L--VDV-NIENRINEYNTASLRR
A0A4U0GMP3      --AER---RND---------LIPNNT---------G-L--VDM-NIESQINEYNVALLKR
A0A1H6CKR6      --PSK---RDE---------LIPSNT---------G-L--VDQ-SIESIITEYNTLLLRR
A0A235E1C0      --PSR---VDD---------LIPSNT---------G-L--VDN-NIEDIISEYNTLLLRR
R6D982          --AAK---EDE---------LIPGDI---------G-L--TDA-VIEGQIARYNEALLRR
A0A1F0I8C4      --SGK---EEE---------LIPGNI---------G-L--TDI-NIESQIARYNETLLRR
A0A3A5RIJ2      --SGK---EEE---------LIPGNI---------G-L--TDI-NIESQIARYNETLLRR
A0A515IZJ5      --SGK---EEE---------LIPGNI---------G-L--TDI-NIESQIARYNETLLRR
A0A7J4Y2H6      --SGK---EGE---------LIPGNI---------G-L--TDI-NIESQIARYNETLLRR
A0A0D5BSQ0      --RDQ---KNA---------LIPNST---------G-L--VDA-NVETQITEYNTALLKR
A0A1T3F6P5      --RGK---QNN---------LIPNNT---------G-L--VDS-GVEGQIAEYNKALLKR
A0A0W8EPA0      --KGK---QNN---------LIPNNT---------G-L--VDS-GVEGQIAEYNKALLKR
A0A365UKN1      --RGK---QNN---------LIPNNT---------G-L--VDS-GVEGQIAEYNKALLKR
A0A4R6WE41      --DGK---SKE---------LIPNNT---------G-L--VDA-NVEGQIVEYNKALLRR
A0A2T5RP38      --KN----RNE---------LIPNNT---------G-L--VDA-SVESQIAEYNMALLKR
A0A1A6CF06      --KNK---RNA---------LIPNNT---------G-L--VDT-GVESQIADYNTALLKR
A0A1T3D6S8      --KNK---RNA---------LIPNNT---------G-L--VDT-GVESQIAEYNTALLKR
A0A1P8E011      --GSK---KNE---------LIPNNT---------G-L--VDA-SVETQINDYNTTLLRR
A0A1V3N3U3      --ANK---RNE---------LIPNNT---------G-L--VDG-GVEAQITEYNRALLRK
C2FUH6          --KTK---RNE---------LIPSNT---------G-L--VEA-NIENQITDYNTTLLRR
A0A0B8T471      --TES---RND---------LIPSNT---------G-L--VED-NIEAQITEYNEVLLKR
A0A4R7D2K0      --DVD---RND---------LIPSNT---------G-L--VED-NIESQITEYNEVLLKR
A0A2X2J8S4      --SDK---QTA---------LIPNNT---------G-L--IDG-NIEGQIQAYNTLQIRK
A0A3C0S618      --SDK---QTA---------LIPNNT---------G-L--IDG-NIEGQIQAYNTLQIRK
A0A4P7DRF9      --PAR---ARD---------LIPSNT---------G-L--VDG-NIESIISEYNSVLLKR
A0A239XXC4      --PSR---VDD---------LIPSNT---------G-L--VDN-NIEGIISEYNTLLLRR
A0A4U9K473      --PSR---VDD---------LIPSNT---------G-L--VDG-SIEEIIAEYNTLLLRR
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A3M1Y2F5      ---------------------------------NINDP------FLQSLMGKLTELVSER
A0A3D4RLG4      -----------------------------MHKYKATSK------ICRKKNWRWSLSNAIT
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------AKPSA---------AIPSAL-------YPQEG------NFEALIGKYNEMELSR
A0A2P8G5K0      ------EKPAA---------AIPSAL-------YPQEG------TFEALAGKYNEMQMAR
R5DEG6          ----DPGKNSD---------LIPANTG------IS-DV------NIESQIGEFNEMLLKR
A0A4Q3SEI4      ----AKDRQIG---------VVPAITS------VK-DP------MLGQLLNSLFESEMQY
A0A348PT57      ---------------------------------SK-------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      --QDNEVDIYR---------LIAILAG------SEFSG------MVSRMLQNLQDLLIER
A0A519SYE7      LTRSENETVAN---------NLPGLTELNDPLLAGMLN------ELDEQQRSLRLTLLSQ
A0A7C7CFR2      --NKEDIDVYN---------LLPALTG------SSFQD------EISRLVNSLHELLAKK
A0A3N2LCI3      ----------K---------MLPMNSG------VA-NV------DIQSQITDYNNLVLQR
A0A6H9Q899      ---------------------LPANSG------IE-SV------NIESQIAEYNKQLLQR
A0A3D4CJE1      -NANDNMQVYD---------LLSILAG------TDYES------TINGLITNLQRLLDKK
A0A7C7LI79      -NTED-IDVYK---------LLPVLTG------ASFQE------EITDLLSKLNALLSSK
A0A4Q5ZQ60      --------VES---------FLPSLSL------VN-DQ------MLGEQMKALVELQKQH
A0A519Q885      LTVRENQTVTQ---------NIPGLVD------LS-DP------VLVQLLEQLNKEQINL
A0A519TAP8      LTRNEDETVAD---------NLPGLTE------LE-DP------VLVGLLDLLDSQQRSL
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
A0A7C7CKY6      EQALY--TITA---NSEEAKSLDYQIDVQKRLLVAMLEALSNKLV---------------
A0A1G1TG88      ERVRR--SYTG---ATEAVQQKNAQMDYTLSSILRQITQARKALA---------------
A0A661XXA6      EKLGL--SYRE---NTYTYKARQKEIDLLKSDLLGQIENAKENTI---------------
A0A519SD85      NHLLK--QYTI---SSKFVTDIDQEIEIFRNSITNNLLLQHKLLT---------------
A0A3M1TXY5      AAIRL--TAKE---RSPKVQNIDAKINNVRQAILKNVNTSIRANN---------------
A0A2E0VQ27      QDYLQ--KYTL---QHPLILNLDQKIKETRAFLNESVNSTLENLQ---------------
R6U429          DRLVS--GSSS---ENPLVLDYNNSIAALKIAINRSIENLISTLK---------------
A0A5C8AF42      EDLLY--RVTD---ENSEVKALNSKIQTKLNSIRKSVAAILERLY---------------
A0A353WYK7      NILKG--AYKT---NTFAYRKKKEEINFLRERIIGYVEESRKGIY---------------
A0A355BP94      ERLAL--SYKD---NTFAYQQKDQELNAARTALFTQLAEIKKQWL---------------
A0A136LSC7      DKLAL--AYNE---NTFAFRQKEREVSLVKDELFNQLSTLKKEWL---------------
A0A5C7N8Q5      DKLGL--AYNE---NTFAFRQKQKEVTLLKDELFSQLSTLKKDWL---------------
A0A239K409      ERLLR--TTEK---INPIILSIDQQLQSLRVNILENIHNIKGGLV---------------
A0A1V5S1J9      KEIGV---------KSPLYAKYTRDIDAVKAQMYEALKNIRVGLD---------------
A0A0A2EYC8      LDLGV---------KNPQYDIVFNQISQTKAQLNELISSVSDIYK---------------
A0A2G6H6Y4      IDLGV---------KNPQYEIVIAQIEQIKKQLKELIASVSDVYS---------------
A0A1M3DPL8      SELTE---------KNIFHSKYTREIDNLKTAINEVIKNTKASIN---------------
A0A1V5F519      SELTE---------KNLYYAKYTKAIENVKTSIFELIKNMRASLE---------------
A0A2G6R1T9      NSTSR---------KNPVYKKLTREINNIKASINEAIKSMRKSIQ---------------
A0A350V3E4      DLAKT--GNDELVKNSKSLKDINNKVAELKRSLDEKLNILKEGANSNSPEEMRSLTSKYF
A0A6J4K208      EQLQL---DNA---PAGRISKVNAQIQKTRVGLVEYAGSLANRAR---------------
A0A2W4RDE8      SGLNY--SARE---GNPLAQVIELKITNLKASITENVSNIIDATN---------------
A0A0L8VEV2      EVFSY--TVQE---KNPKLILVNNQIEMVKRNLQENLKNLINNAI---------------
A0A1I2A9Z9      EVISY--TAQE---KNPKLILIGNEIEMVKRNLRENLKNLINNAI---------------
A0A212J9Z9      RNLGA---------KNPLYNKTIDELNDLRVKILQEIQVSQINLQ---------------
F5IV23          RNLGA---------KNPLYNKTIDELNDLRVKILQEIQVSQINLQ---------------
F8X2T0          KNLGP---------KSPIYMTAINKLNESRVQILRELQLIQVKLQ---------------
A0A1M3LAG1      KNLGP---------KSPIYMTAINKLNESRVQILRELQLIQVKLQ---------------
A0A212K6G4      KNLGP---------KSPIYMTAINKLNESRVQILRELQLIQVKLQ---------------
A0A4Y9IPG7      KNLGP---------KSPIYMTAINKLNESRVQILRELQLIQVKLQ---------------
A0A1M5DFS8      ASMGE---------AHPLYAKSEQSMNNLRIKILEDLRNAQDKVQ---------------
A0A4Y8KZS5      ASMGE---------AHPLYSKSEQSMNSLRIKILEDLRTAQDKIQ---------------
A0A2V3PNY7      SSMGS---------AHPMYAKSEQSLTNLRINILEELRALQDRVQ---------------
A0A6G7X5K8      ASMGS---------AHPMYAKSEQSLTNLRIKILEELRGLQDRIQ---------------
A0A2P8CDS1      TTLSA-TVKDP---DHPRMRQLNIQMETTKRTLLENSRNIMHQSE---------------
A0A660LQT8      NRLVM--NSST---SSPLIADLEDRISKQRQVIGVSINNWLLTLQ---------------
A0A389LWV6      K------GLGS---ENPIYKRYKLQLTDIKSSINQSIVSMKNSIG---------------
A0A1G9B1T9      AQLKT--SVRQ---SLPAIEELDAKVKSIRAQLHENVNNLIATTK---------------
A0A350PNH9      NNLVA--NSSE---QNPLVADYDQSLASMRHSIVTSIDNFVVTLN---------------
A0A354LNT9      NNLVA--NSSE---QNPLVADYDQSLASMRHSIVTSIDNFVVTLN---------------
A0A161LWY6      L------QTTP---QNPFYAKYQEELNKLKGSLTDALRNVRAAFS---------------
A0A6I3N9U6      L------QTTP---QNPFYAKYQEELNKLKGSLTDALRNVRAAFS---------------
A0A3D0FMX4      AELSE---------KNIYYDKYTTDMQNIKVAILEVLSSMRASMD---------------
A0A1M3MEI8      AELPE---------KSMFHSKYTREIETVKNAINEMVRNMQVSMD---------------
A0A1J5HQM0      SELSE---------KNMYYAKYTRDIDHIKVAINEVTKNMRASLE---------------
A0A653AC35      NETTE---------KNPLYSKYNREVEALRTSINEVLKNMKTSLA---------------
E4T131          SDLTE---------ANPYYAKFTKQIETSKLTILEVIKSMRASLE---------------
A0A2W7RD29      SNQLV--TLTD---SSPIVIEQQKRIVISKKNTLELVKSAISNID---------------
A0A3N2NDY8      NTLAA--SSSD---TNPLVVDYDGQIKGLREAIVNAINGQIVALN---------------
D7JEV9          LDLGV---------KNPQYDVVISQIRQIKTQLNELINSVSDVYK---------------
A0A4R6H3B7      EVISY--TAQE---KNPKLILIGNEIEMVKRNLRENLKNLINNAI---------------
A0A521H707      TTLKF--LATE---HNAAVISLEKDIAFQRSNLILSLNNAREALI---------------
A0A1F3D6P8      SGIAS--NNAE---KNLFLGQIDNKIKVQKQAIIETVTNNLNTLN---------------
A0A356Z058      SGIAS--NNAE---KNLFLGQIDNKIKVQKQAIIETVTNNLNTLN---------------
A0A3D1BT36      SAILS--NNVQ---KSLFLEQIENKINLQKQTIIENVKNNLNTLS---------------
A0A5R9QZP0      SAILS--SKAE---KSLFLGQIENNIRLQKQSIVENVKNNLNALN---------------
A0A3D3HL11      ANILS--NNAE---KNLFLGQIENKIRLLKQAIIENVKNNLNTLN---------------
A0A6L8U6G9      ATILS--NNAE---KNLFLGQIENKIRLQKQAIIENVKNSLNTLN---------------
A0A352ME00      STIIA-GSNPQ---KNIFIGQIDSKIDFQKQIILENFTNNLNTLT---------------
A0A6L8UH35      STITA-GSSTD---KNIFLGQIDNRIRMQRQAIIENFTNNLNTLT---------------
A0A3P1Z8V4      NRYAV--NSND---DTPAVRDLDRQLEALRSAINTSLANHVKSIE---------------
A0A1M6MYT6      LSQTS-IRQNS---EHPTIVRLNAQIASVKNSLRENVDNIISQSD---------------
A0A2W7QSQ0      QRIIR--IVQP---NNPQLLSLNDQIVNVKSNILANISSIKSNLL---------------
A0A3D5KRY6      EVLSY--TVQE---KNPVLVSLNNEIRFTQKSLLENIESLISNAK---------------
R7F6L5          NRLLK--TTGA---NNPQVVEKDEALRTMKRNIQHTAATYATSLN---------------
A0A7C5MRV2      LAALQ--SYTA---SHPKVKEMDSKLEELRFSISENIASIKNNTE---------------
A0A229I3A5      NNIVA--NSSE---QNPLVADYDQSLTSMRKSISASLDNFVVTLK---------------
A0A3R6HJB3      NNIVA--NSSE---QNPLVADYDQSLTSMRKSISASLDNFVVTLK---------------
R6NN15          NNLVA--NSSE---QNPLVVDMDESLRSMRRSIVSSVDNLITTLN---------------
A0A553GA49      QHLLE--NKQA---KSPQLRELTFQISNLKNTILVNLQYELDASR---------------
A0A497D6F6      SSM-T-SVKNT---EHPKLKRLNAQIENAKSNLLENVNNIISQSE---------------
A0A5M4AAB9      STLAA-TVHDP---EYPRMRQLRIQMETTKRTLLENSRSIMHQSE---------------
F4KR18          ERFLT-KGQTS---N-PVVQSNNQKLKSLQSSINLAIDHMQDDLN---------------
A0A2M6GH67      KILLL--SYKK---TTQTVKIREEEMRLTKEAVTELLQQNIDLLQ---------------
A0A7K1TE30      RRLTR--SYNE---TTEAVKQQRSVLAYARIALQRQLRQDQKLLS---------------
A0A7D4BE70      RRVER--SYTD---KTEALAQIRAQVKFATNTLNRQLAQARKQLQ---------------
A0A142HHS5      RRIRR--SYQD---RLEAVQGPLAQLKFAQATLQHQLVQAQKQLR---------------
A0A7D4C435      RRIRR--SYQD---ATEAVKQPKAMVAFAQTTLKHQIKQAQIQLR---------------
C9LKL0          NSTEK--NSSP---NSPLVKDLDSKLTTMRNTILSSVRSYVKTLE---------------
A0A3D0QPV7      EKEKF--SSTS---KSTYMKSLDYQIDIQLKMINQAITSLKNQFS---------------
A0A496KT23      NRLLA--TSSA---QNPAVMDLETQLGSIRRGIIQSLDNELDMLK---------------
L1M9T3          NRLLA--TSSA---QNPAVMDLETQLGSIRRGIIQSLDNELDMLK---------------
A0A3C0I8F1      ASISY--YKTD---NNATLKVKRTQLIKYQKELRAQINEAQRMLN---------------
R5JJI4          DKLVA--GSSN---KNPIVIDLNNSLGAMKQTIIRSVDNLIVGLN---------------
A0A0A2DQN2      DLWMQATGASQ---DNPIVERYNQSMHVARAAVARALKDAAAAIS---------------
A0A0A2F2N5      DRWLATTGGME---DHPMVQKYAKAMEQTRMSISHTLEGYIKSLD---------------
L1NGW4          DRLVKASEGST---ENPVIAEYDRGLAQIRQNAISSLNQYANVLR---------------
Z4WRA0          DRLVKASEGST---ENPVIAEYDRGLAQIRQNAISSLNQYANVLR---------------
U2K8K9          DKLVESSGGST---QNPVIAEYDATLDQLRKSATEILNQQASALR---------------
A0A069ZM60      DKLVEGAGGST---ENPVITEYDNALSQLRKNAIESLNQQAAVLR---------------
J6GV98          DKLVEGAGGST---ENPVITEYDNALSQLRKNAIESLNQQAAVLR---------------
A0A134B4F8      DKLVEGAGGST---ENPVITEYDNALSQLRKNAIESLNQQAAVLR---------------
A0A134B8C7      DKLVEGAGGST---ENPVITEYDNALSQLRKNAIESLNQQAAVLR---------------
A0A3D2HF71      KQLSL--NLLE---STGPLRVLEGNIANTRIAISNNIADGLANIE---------------
A0A4Z0EKR0      KRMLR--TTEP---SNPIVQNINEQLASLRISILENLRNIKKGLQ---------------
B5CTK0          DKLID--SSSD---KNPVVVNLNNSLSALKQTIIRSIDNTIVALN---------------
A0A1M6B6D5      NKLQY--SFKE---DAPVFNDIDRQIDAVKIVLLENIRSSKSLMN---------------
A0A451FS66      NKLQY--SFKE---GAPVFNDIDRQINAVKSVLLENIRSSRSLKA---------------
A0A2E3GN39      ESALM--QVTP---EHPTVVLIERNLDKARATLIAQVEINIDKFQ---------------
A0A3D1MEL0      ESALM--QVTP---EHPTVVLIERNLDKARATLIAQVEINIDKNQ---------------
A0A519UDD1      QRLLP--NLEP---SSILIQNVNEQLANLRANTLENLRNIKKGLQ---------------
A0A2A4N9A6      KFLAQ--HETE---LGPNTKLINGQIKANKKILLYSIKAIRATLF---------------
A0A6C0GGI1      AKLAL--SIRS---DNPLYQQQQEKIVNTRNTIIENLRRLVSVVN---------------
A0A368D1N7      ESALM--QVTP---EHPTVVLIERNLDKARATLIAQVEINIDKNQ---------------
A0A3B8TU58      EKALM--QVTP---EHPAIVLIERNLDKARVTLVAQVRINIERYQ---------------
A0A1T5IIR6      DRLVA--ASST---TSPAVLKLENTLGSLRSNILGMISNLQTSLE---------------
A0A3E0QD27      SNLRF--IATD---KNAAVISLEQDIDFQKKNLVMSIQNARLSIR---------------
A0A6N8DCX3      NNLIT--NSSD---QNPLIADLDQSLASMRTSIVSSIDNLVMSLD---------------
F0R0C9          NNLVA--NSSE---QNPLVKDLDQSLASMRRAIITSVDNLMVTLD---------------
A0A0M1W1I6      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A4R4GHU2      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
I8WPR6          DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A0K2HKS3      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
B6W3W8          DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A7M3EEL4      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A076IRY8      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A3A6AD54      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A3A6MIU7      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
I8WPP8          DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A372Y7D2      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A7K3KFI2      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A3E4JJC9      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A3E4WDQ0      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A414H9P2      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A7K0JKU9      DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
C3R5A8          DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A1C5XJA7      DRLIS--DSSD---KNPVVEELNSSLRAMKQSIIRAVDNMIVSIN---------------
A0A285T4L1      DKLIA--DSSE---SNPVVEELNNAIHALRQSIIRAVDNMIVSIN---------------
A0A3E5BU42      DKLIA--DSSE---SNPVVEELNNAIHALRQSIIRAVDNMIVSIN---------------
R7CUW4          DRLIS--DSSE---KNPVVEELNNSLRAMKQTIIRAVDNMIVSLN---------------
A0A416GGJ1      DKLID--DSSD---KNPVVEEMNNSLRAMKQNIVRAVDNLIVSLN---------------
D1JY72          DKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNMIVSID---------------
A0A7G5NJU1      DKLIA--DSSE---SNPVVEELNNSIHALRQSIIRAVDNMIVGIN---------------
D7J4K6          DKLIA--DSSE---SNPVVEELNNSIHALRQSIIRAVDNMIVGIN---------------
Q8ABP9          DKLIA--DSSE---SNPVVEELNNSIHALRQSIIRAVDNMIVGIN---------------
D6D2Z5          DKLIA--DSSE---SNPVVEELNNSIHALRQSIIRAVDNMIVGIN---------------
A0A1T3EDR4      NRLME--GGNN---KNPVVRDLDASLVSLRQEIQRSLDHSIRGLV---------------
A0A6N8KXI9      NRLEE--GSSS---ENPIVKELNRDLSSMRGNINRAVDNAVEGLR---------------
A0A174SDD8      NRLMN--GSSS---NNPVVQELNRTMQTMKQNIYRALDNLSTTLR---------------
A0A1H7RFH3      NRLMN--GSSS---NNPVVQELNRTTQTMKLNIYRALDNLSASLR---------------
A0A139L1N2      NRLMN--GSSS---NNPVVQELNRTMQTMKLNIYRALDNLSASLR---------------
A0A174TVL8      NRLMN--GSSS---NNPVVQELNRTMQTMKLNIYRALDNLSASLR---------------
A0A1H8BJR6      NRLMN--GSSS---NNPVVQELNRTMQTMKLNIYRALDNLSASLR---------------
R9H6G0          NRLMN--GSSS---NNPVVQELNRTMQTMKLNIYRALDNLSASLR---------------
A0A412GR09      NRLMN--GSSS---NNPVVQELNRTMQTMKLNIYRALDNLSASLR---------------
A0A7J5JXN6      NRLMN--GSSS---NNPVVQELNRTMQTMKLNIYRALDNLSASLR---------------
A0A081PBV5      NRLLE--GSSS---ENPIVQDLNITLAAMRKNIYRAMENAVSGLQ---------------
A0A1I2AN85      NRLLE--GSSS---ENPIVQDLNITLAAMRKNIYRAMENAVSGLQ---------------
A0A4U0GMP3      NRLVE--GGSF---SNPIIQDLDNALQAMRKNIDRSIENTLAGLR---------------
A0A1H6CKR6      NRLTA--GNSS---ENPIVQDLNTALNALRDNISRAVDNVLTGYR---------------
A0A235E1C0      NRLMS--GNSS---ENPIVQDLNNALSQVRQNIARAIDNVISGFR---------------
R6D982          NRLRS--GSGG---NHPVVQELTRSVETMRQNINRSINNQVTSLK---------------
A0A1F0I8C4      NRLVS--GSSS---NNPVVQELDRSMQTMRQNIFRALDNLSASLK---------------
A0A3A5RIJ2      NRLVS--GSSS---NNPVVQELDRSMQTMRQNIFRALDNLSASLK---------------
A0A515IZJ5      NRLVS--GSSS---NNPVVQELDRSMQTMRQNIFRALDNLSASLK---------------
A0A7J4Y2H6      NRLVS--GSSS---NNPVVQELDRSMQTMKQNIFRALDNLSASLK---------------
A0A0D5BSQ0      NRLAE--GGNT---SNPVVLDLDEALKAMRNNIGRAVDNTLRGLN---------------
A0A1T3F6P5      NRLAE--GGNT---ANPVVLDLDDALAAMRTNIGRAVDNALRGLN---------------
A0A0W8EPA0      NRLAE--GGNS---SNPVVLDLDDALGAMRTNISRAVDNAVRGLN---------------
A0A365UKN1      NRLAE--GGNS---SNPVVLDLDDALAAMRTNISRAVDNALRGLN---------------
A0A4R6WE41      NRLEE--GSSM---ANPVVQELDQGLDAMHTNILRAINNTLSGLQ---------------
A0A2T5RP38      NRLAE--GGNT---LNPVVVDLDEALKSMRNNINRAVDNALRGLT---------------
A0A1A6CF06      NRLAE--GGNS---ANPVVLDMDEALNSMRNNISRAVDNALKGLN---------------
A0A1T3D6S8      NRLAE--GGNS---ANPVVLDMDESLNAMRNNISRAVDNALKGLN---------------
A0A1P8E011      NRLIE--GSSD---ANPVVQDLDRALQAMRGNIGRAVDNAIGGLK---------------
A0A1V3N3U3      NRLVE--GSST---ANPVVQDLDKALAAMHENISSAVDNAVAGLD---------------
C2FUH6          NRLVE--GSST---ENPIVQDLDKALGAMRGNIDRAVENATEGLR---------------
A0A0B8T471      NRLVG--GDNS---ANPIVKDMDAALRAIRDNISRSVDNAAMGLR---------------
A0A4R7D2K0      NRLVS--GDNS---ENPIVKDMDAALRAIRDNISRSVDNAAMGLR---------------
A0A2X2J8S4      NKLME--DGNS---ENPIVKEIDKSLNTMRSGIERTLGNTISGLQ---------------
A0A3C0S618      NKLME--DGNS---ENPIVKEIDKSLNTMRSGIERTLGNTISGLQ---------------
A0A4P7DRF9      NRLQA--GENS---NNPIVQDMDNALVAMRENIVRAVDNVITGFN---------------
A0A239XXC4      NRLMS--GNSS---ENPIVQDLNNALSQVRQNIARAIDNVISGFR---------------
A0A4U9K473      NRLMS--GNSS---ENPIVQDLNNALTQVRQNIARAIDNVISGLR---------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      -------------------------MKNTNAAISENIETIRQQLI---------------
A0A3M1Y2F5      AELDF--SVTA---DNPNIDRINLEISRVKSSLLENINNRVSSTE---------------
A0A3D4RLG4      ELMTT--TXTQ---KNVYYAKYTKDIENVKTAINEVVGSMRASLE---------------
A0A2T2UAJ4      --------GGK---GVGYVAEQRRGLAQSRIELNGLQARLDV------------------
A0A6I0DZQ5      --------------------KYTREIETVKNAINEMVRNMQVSMD---------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      TRALA--SLAP---GHPDIRSIEKQMEVLRTNLFDAIQNQKQELA---------------
A0A2P8G5K0      IMALA--TLAP---EHPQLRSLEKQIEVLRNNLLDAIGLQIQELT---------------
R5DEG6          DKLIS--NSSS---KNPVVQDLNNSLIAMKQTIIRSVDNLIVGLN---------------
A0A4Q3SEI4      EKLKK--TIPG---GNPTMYTLKTQIENLRPAILESIQNQRASLN---------------
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      EQLLY--QVTP---ESSQIQALNHQINIQRKLVVESITTLKNNLD---------------
A0A519SYE7      TNKTF--AVQR---DQADIQETRAALERQLSRDQALVRQQLARLD---------------
A0A7C7CFR2      EEILY--TATP---ESEAIKKVDYQINVQKKLLVATIRSLSKKLD---------------
A0A3N2LCI3      NSLLA--KSSD---KNPLVVQLNEQMDQMRHAILASVDNSINALN---------------
A0A6H9Q899      NSLVA--NSSA---ENPLVVDMDQALASMRGAIIRSIDNQIVTLN---------------
A0A3D4CJE1      QQLQN--EVTP---DSEILKTLNLQIEAQRDLIIESLRSLLDKLL---------------
A0A7C7LI79      EEVLY--TATT---QSEEIKAFNYRIEVQKKLLIASIKALVNKCE---------------
A0A4Q5ZQ60      ALLMG--SAKK---ATFAVKSKEEEITFVKNNIAESVKKNKKLAQ---------------
A0A519Q885      ARVKR--SYKE---STFAVEDQEANIIITRQAVRKQLIQARKLLQ---------------
A0A519TAP8      RLTLK--SQTD---KTFAVQRNQAVIRDTRELLQR-------------------------
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      -----------------------------------------------MLTAGTTA-----
A0A7C7CKY6      ----------NKQESLHQKVKEIESKFFNLP--TQELEYARILRLF-TINEKFYT----S
A0A1G1TG88      ----------NRIALLDRQQNKLDAKQQGLP--SRATEQARLQRPL-ALAEGTYT----M
A0A661XXA6      ----------EDESDLVNQKIQLNQQLKKLP--SKSTEYNKVKRFY-TLYEEIYL----S
A0A519SD85      ----------EKGNLIRKTSDSIQRKLSQLP--NKERLLGELQSRF-DVDRKVYN----Y
A0A3M1TXY5      ----------IAISNVNERIEALRTRLRRLP--ESERILTNIKRNF-DHSSEVHK----Y
A0A2E0VQ27      ----------QKTLELESQIAEVNQKVERFP--EKERQLVVLQRQV-ALNEALYN----Y
R6U429          ----------LQADKVAAEETNIMNKISNTS--GQELQLLSIERQQ-KIKEELYI----Y
A0A5C8AF42      ----------ANSRSVQGKIQGFESEFFELP--EKKMEFSRLKNIQ-DLNEKYFT----L
A0A353WYK7      ----------DKLDEINLKKNRLETDFSSLP--SKSTEYAKTERYY-DLYEEFYL----S
A0A355BP94      ----------GAMLELNQKKESLEKKFASMP--DKSTQYSKNQRFY-KLYEEFYL----S
A0A136LSC7      ----------ADMAELGKRKEKLERAFAEMP--DKNTQFSKNQRYY-KLYEEFYL----T
A0A5C7N8Q5      ----------ADMAELGRRKEKLEREFAEMP--DKNTQFSKNQRYY-KLYEEFYL----T
A0A239K409      ----------LTRRNLKDRTNLYDAKINSVP--LVERELQEIDRQR-GIKQQLYK----Y
A0A1V5S1J9      ----------IQKADMQNRLQKLSAGMQELP--YKEQQLLNIQRKF-KINDDYYT----F
A0A0A2EYC8      ----------IESDAYQKDLNELNNLLIAAP--NKELRMLDYERRY-KINDSYYT----F
A0A2G6H6Y4      ----------IETDLYKKDLNTLKSELVEAP--SKELRMLDYQRRF-RINDEYYT----Y
A0A1M3DPL8      ----------IQKDDLNTRLASVQKQIETLP--EQELEMVGIERNY-RMNDSYYT----M
A0A1V5F519      ----------IEKNEVNRLLADVNSQIAELP--KKELEIIGIERNY-KVNDNYYT----F
A0A2G6R1T9      ----------IEKQDIDSKIAAVRSKMNMLP--KKETQMTALTRQY-KIDDNYYN----F
A0A350V3E4      ETKVLNNQNKIKESLLRGYLNKYQEKFNKLP--AQSIEYANLERER-LANEKVYL----M
A0A6J4K208      ----------QRTLLLDRSIAKATPSPPATP-------LPEVRRQL-KLDDKMYRSIHDY
A0A2W4RDE8      ----------IALNDLNQRIARLNAQLERLP--RNERELVKIQRRY-DFSDNVYN----Y
A0A0L8VEV2      ----------VQIQGLDRRVDQVNRQLSAHP--KTEQQMMNMQRMY-DLNNELYT----F
A0A1I2A9Z9      ----------IQVQGLDRRIEKVNQQLTAYP--KTEQQLMNMKRMY-DLNNELYT----F
A0A212J9Z9      ----------NQKDALVRKYEVLQLKIDNLP--PQERDLIKFQREF-RVNEMYHQ----Y
F5IV23          ----------NQKDALVRKYEVLQLKIDNLP--PQERDLIKFQREF-RVNEMYHQ----Y
F8X2T0          ----------DQKDLLVKKYQNLDLKLDNLP--PQERDLIKYQREY-NVNEMYHQ----F
A0A1M3LAG1      ----------DQKDLLVKKYQNLDLKLDNLP--PQERDLIKYQREY-NVNEMYHQ----F
A0A212K6G4      ----------DQKDLLVKKYQNLDLKLDNLP--PQERDLIKYQREY-NVNEMYHQ----F
A0A4Y9IPG7      ----------DQKDLLVKKYQNLDLKLDNLP--PQERDLIKYQREY-NVNEMYHQ----F
A0A1M5DFS8      ----------EKKENLNSRLASVESEMSTLP--AQEREYARYEKRY-QVNDAYYT----Y
A0A4Y8KZS5      ----------EKKELLNASLSSVETEMTTLP--AQEREYARYEKVY-KVNDAYYT----Y
A0A2V3PNY7      ----------NKKESLDNNTKEIEDKMATLP--AQEREYIRYEKRY-QVNDAYYT----Y
A0A6G7X5K8      ----------NKKEDLNNSTREIESRMSTLP--AQEREYARYEKKY-QVNDAYYT----Y
A0A2P8CDS1      ----------ITLNDLTKRIDNLQQRTRNLP--SVERNYVNIERRY-QLNNDTYT----F
A0A660LQT8      ----------NQVKSLTSQEGTLTSKMAQAP--NQASYLQSISREQ-KVKESLYI----F
A0A389LWV6      ----------IEEADLNQRYSKLSAEVASLP--DKERKLLTHERDF-KINDSYNT----Y
A0A1G9B1T9      ----------YKIESVENQIEELDSQINLLP--KNEQELINIERKF-QFSDNQYN----Y
A0A350PNH9      ----------SQLGNLQANEAQTTSQIASNP--SQAKYLQTVGRQQ-KVKEALYL----F
A0A354LNT9      ----------SQLGNLQANEAQTTSQIASNP--SQAKYLQTVGRQQ-KVKEALYL----F
A0A161LWY6      ----------IEKKDIDTQSRKASGQLATLP--DIETQMNSFERQF-KMNDTYYT----Y
A0A6I3N9U6      ----------IEKKDIDTQSRKASGQLATLP--DIETQMNSFERQF-KMNDTYYT----Y
A0A3D0FMX4      ----------IEKKDLELRFSEVRAGINALP--EKELEMVALERNY-RIDDNYYT----F
A0A1M3MEI8      ----------IQKKDLNRRYAEVQQEINQLP--AKELEMIGIERRY-KMNDSYYT----L
A0A1J5HQM0      ----------IEKNDLKEKNDKVNKEIEQLP--SKEIEMTSIARKY-KMDDNYYT----F
A0A653AC35      ----------LDKEDLNKKLYAVKQQITALP--QKEMEMVTLERKY-RVDDNYYT----F
E4T131          ----------IEKSDFNKRLSVVNKQIEELP--EKELEQIAIQRKY-KMDDNYYT----F
A0A2W7RD29      ----------ISIDDLNYRISEISKDFRKLP--FTEQNLIKIEREF-TLNEGIYN----F
A0A3N2NDY8      ----------KSLRNMEGAKGAAESQLASGS--TQAKYLLSVERQQ-KVKESLYL----Y
D7JEV9          ----------IEKSSYQSDLSALNKLLVEAP--NKELRMLDYERRY-KINDSYYT----F
A0A4R6H3B7      ----------IQVQGLDRRIEKVNQQLTAYP--KTEQQLMNMKRMY-DLNNELYT----F
A0A521H707      ----------QKIKSLDERMNEFEQIFLTLP--AQEAELARLNRLY-LVNEKFYQ----L
A0A1F3D6P8      ----------LSLNELNYRADKLSREISQLP--RTELNMVGLQRKF-DLSDVIYT----Y
A0A356Z058      ----------LSLNELNYRADKLSREISQLP--RTELNMVGLQRKF-DLSDVIYT----Y
A0A3D1BT36      ----------LTLNELDYRAEKLSSQIARLP--RTELNMVSMQRQY-NITDAIYT----F
A0A5R9QZP0      ----------LKINELNYRRNKLSREISRLP--KTELNMVSMQRQF-NITDAMYT----F
A0A3D3HL11      ----------LTQNELDYRESKLSGEISRLP--RTELNMVSMQRQF-NLTDQIYT----F
A0A6L8U6G9      ----------LTQNELDYREGKLSGEISRLP--RTELNMVSMQRQF-NLTDQIYT----F
A0A352ME00      ----------LSLNELDYRQNKLSKEASSLP--RTEMNMVSMKRKF-DLNDEIYT----F
A0A6L8UH35      ----------LSLNELDYRENKLSREISQLP--RTEMNMVGMKRKF-DLNDAIYT----Y
A0A3P1Z8V4      ----------LELRAARSTQSRFDGQAGAIP--VKEREALDIVRQQ-NLKEALYT----F
A0A1M6MYT6      ----------MALENLNQRIRQFEAQVRRLP--ATERNYVNIERKY-KLNNETYI----F
A0A2W7QSQ0      ----------ISKRNFETTLNENSYKAQSIP--GIERELVEISRNT-DLKQEQYQ----Y
A0A3D5KRY6      ----------LEQKTLDDQQARINSELSKLP--KTEQNLIGIKRNF-DLNNELYT----F
R7F6L5          ----------TRLSGVRSQESVTNSRLATAP--RQANYLLSVERQQ-KVKESLYL----F
A0A7C5MRV2      ----------QKIGFYKAELSKSRNNLQSIP--QTQRIYQGLMREH-KVKESILS----T
A0A229I3A5      ----------TQLGTLQANEAATTSQIASNP--NQAKYLQTVGRQQ-KVKEALYL----F
A0A3R6HJB3      ----------TQLGTLQANEAATTSQIASNP--NQAKYLQTVGRQQ-KVKEALYL----F
R6NN15          ----------TQIHSLEKSDQRATERIAANP--SQAKYLLSVERQQ-KVKESLYL----F
A0A553GA49      ----------LALQQIRSKISTLNVELNRLP--ETQRNLTTYERNF-RLNDAIYT----F
A0A497D6F6      ----------LALTDVKNRLWRYERRIQTLP--ETERNYINIERKY-QLNNETYT----F
A0A5M4AAB9      ----------LTLQDISKRTDSLRKQTRSLP--AVERDYVNIERSY-QLNNNNYN----F
F4KR18          ----------MQQNKLKYHYDQSSNHLRSVP--SKERGLSDRVRIQ-SIKENLYV----Y
A0A2M6GH67      ----------NQTATLTRDINAIEAELKQMP--ARVTEWARLQRPF-ENVEGAYR----Q
A0A7K1TE30      ----------NELALLDQQRNLLSDNLRSLP--GKETELARLKRPL-ELYGGTQQ----M
A0A7D4BE70      ----------TEMALLDKQQSQLGGALQSLP--GKETELERLKRPL-ELYGNSYQ----M
A0A142HHS5      ----------GQIALLDTQQGKLSNELQLIP--GKETELERLKRPL-GLYGNSYQ----M
A0A7D4C435      ----------NQLNVLSSQQGLLSGELQSLP--GKETELERLRRPL-QLYGNTYQ----M
C9LKL0          ----------MRAKSARSNESVINGEVSRAP--GLERRALSIGRQQ-NLKEALYT----Y
A0A3D0QPV7      ----------KRKGSLKDKIRQYETIYYGLP--EKEIEHARMERMF-AINEKYHT----M
A0A496KT23      ----------TQQRVTESSHSEATSKISANP--RQASYLLSVERQQ-KVKESLYL----F
L1M9T3          ----------TQQRATEASHSEATSRISANP--RQASYLLSVERQQ-KVKESLYI----F
A0A3C0I8F1      ----------KEIGALQSKFSRAQGEFLKIP--SKETELKRIKRLH-TIYEAFYS----Q
R5JJI4          ----------IQLKNIREQEEQTTKRIEAVP--TQQKYVLTVERQQ-KIKEELYL----Y
A0A0A2DQN2      ----------IKLKEMRYQDNQAYAELVTLP--PKERQWLDAERQY-KMKEALYT----Q
A0A0A2F2N5      ----------LQLREIEIRNRQGLAEMMAVP--NKQRQWLDIERQQ-RMKEALYT----Q
L1NGW4          ----------VRLKDAQGTQSSLLSQLPDVS--NKGREKAEIDRKI-AIRERLYT----E
Z4WRA0          ----------VRLKDAQGTQSSLLSQLPDVS--NKGREKAEIDRKI-AIRERLYT----E
U2K8K9          ----------ARLKSVERDQSALFSKLPGVT--EEGRTKADIDRRL-AIQEGLYT----E
A0A069ZM60      ----------MRLKDIQGQQSSLLSKLPEVS--NQGREKADIDRRL-EIRQRLYT----E
J6GV98          ----------MRLKDTQGQQSSLLSKLPEVS--NQGREKADIDRRL-EIRQRLYT----E
A0A134B4F8      ----------MRLKDAQGQQSSLLSKLPEVS--NQGREKADIDRRL-EIRQRLYT----E
A0A134B8C7      ----------MRLKDAQGQQSSLLSKLPEVS--NQGREKADIDRRL-EIRQRLYT----E
A0A3D2HF71      ----------KSISEADKRLNEVEREIMKLP--STERQMINIQRKF-DINNTVYT----F
A0A4Z0EKR0      ----------ITSNSLKASSGQFQSKIKKVP--GMERELLEINRQK-SIKQNIYS----Y
B5CTK0          ----------VKLKNLQAQEARTASRIAAVP--THQKYILSVERQQ-KIKEELYL----Y
A0A1M6B6D5      ----------EEIRTINRDIGRYEAEIRKLP--KEQQELLKIERRY-NLSEGTYN----M
A0A451FS66      ----------DEINSINQDIGRYESEIRKLP--KEQQDLLNIERRY-NLSEGTYN----L
A0A2E3GN39      ----------QEKDAVVAEINKLLEELDLLP--LFEAEYLRLKRDY-EVKSSFYN----S
A0A3D1MEL0      ----------QERDAVVAEINKMLEELDLLP--LFEAEYLRLKRDY-EVKSSFYN----S
A0A519UDD1      ----------ITSANLKASSGQFQTKIKQVP--GIERELLEINRQQ-SIKQNIYS----Y
A0A2A4N9A6      ----------AQLALIDKAVRQ-KQKLDSEVNFDAAIEYLRVSTAY-KMEKKYYE----R
A0A6C0GGI1      ----------SSLAVTNQSISQLENNIFRLPQDQRQLEQLQSKKDYNEQTVAFYE----Q
A0A368D1N7      ----------QERDAVVAEINKLLEELDLLP--LFEAEYLRLKRDY-EVKSSFYN----S
A0A3B8TU58      ----------QERQLMIDEINKILEELDVLP--LFEAEYLRLKRDY-ETKAMFYN----N
A0A1T5IIR6      ----------IQRRDLSDRERNAVAKFSSMP--TKERQMLEIQRQQ-SIKQELYL----F
A0A3E0QD27      ----------EKINNIDERIREFEGNFLKLP--SQEAELSRLSRLF-EINQKFYQ----L
A0A6N8DCX3      ----------TQRNELLRNERRTTAKIAVNP--DQTKYLQTVGRQQ-KVKEALYL----F
F0R0C9          ----------TRIRSLQRSEQQTTERLAANP--SQAKYLLSVERQQ-KVKEALYL----F
A0A0M1W1I6      ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A4R4GHU2      ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
I8WPR6          ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A0K2HKS3      ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
B6W3W8          ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A7M3EEL4      ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A076IRY8      ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A3A6AD54      ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A3A6MIU7      ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
I8WPP8          ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A372Y7D2      ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A7K3KFI2      ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A3E4JJC9      ----------VKLNEARSRAGEAQWRGTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A3E4WDQ0      ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A414H9P2      ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A7K0JKU9      ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
C3R5A8          ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A1C5XJA7      ----------VKRNDAQNREMRVQERLSAMP--TKERQMLSIERQQ-KIKESLYL----F
A0A285T4L1      ----------MKRNDARSRQAQAQARFTTVP--TKERQMLSIERQQ-KIKESLYM----F
A0A3E5BU42      ----------MKRNDARSRQAQAQARFTTVP--TKERQMLSIERQQ-KIKESLYM----F
R7CUW4          ----------VKRNDAQNREMRAQSRVTSIP--TKERQMLSIERQQ-KIKESLYL----F
A0A416GGJ1      ----------VRRRDALSRETRAQVRFSSIP--KKERKMLSIERQQ-KIKESLYM----F
D1JY72          ----------VKLNEARSRAGEAQWRVTNIP--RQQQQMLSIERQQ-RIKEELYL----Y
A0A7G5NJU1      ----------MKRNDARSRQEQAQARFTTVP--TKERQMLSIERQQ-KIKEALYM----F
D7J4K6          ----------MKRNDARSRQEQAQARFTTVP--TKERQMLSIERQQ-KIKEALYM----F
Q8ABP9          ----------MKRNDARSRQEQAQARFTTVP--TKERQMLSIERQQ-KIKEALYM----F
D6D2Z5          ----------MKRNDARSRQEQAQARFTTVP--TKERQMLSIERQQ-KIKEALYM----F
A0A1T3EDR4      ----------QRRRQASALEQRALGQMLKVP--SKEREQYSIYRSH-AVKENLYL----Y
A0A6N8KXI9      ----------IKLTNVDREYRRLTGKVMEIP--KKERTMLSVERQQ-KVKEELYL----F
A0A174SDD8      ----------LKKQDYSLQENQVRQKVQAVP--RKQREMLSVERQQ-KVKESLYI----F
A0A1H7RFH3      ----------LKKQDYSLQENRVRQKVQAVP--RKQREMLSIERQQ-KVKESLYI----F
A0A139L1N2      ----------LKKQDYSLQENRVRQKVQAVP--RKQREMLSIERQQ-KVKESLYI----F
A0A174TVL8      ----------LKKQDYSLQENRVRQKVQAVP--RKQREMLSIERQQ-KVKESLYI----F
A0A1H8BJR6      ----------LKKQDYSLQENRVRQKVQAVP--RKQREMLSIERQQ-KVKESLYI----F
R9H6G0          ----------LKKQDYSLQENRVRQKVQAVP--RKQREMLSIERQQ-KVKESLYI----F
A0A412GR09      ----------LKKQDYSLQENRVRQKVQAVP--RKQREMLSIERQQ-KVKESLYI----F
A0A7J5JXN6      ----------LKKQDYSLQENRVRQKVQAVP--RKQREMLSIERQQ-KVKESLYI----F
A0A081PBV5      ----------IKINNLKKEQTQARNKAMAVP--AKQRMMLSVERQQ-KVKEELYL----L
A0A1I2AN85      ----------IKINNLKKEQTQARNKAMAVP--AKQRMMLSVERQQ-KVKEELYL----L
A0A4U0GMP3      ----------IKLRNAQREGGAARSKVQSIP--PKERVMLSVERQQ-KVKEELYI----F
A0A1H6CKR6      ----------IKVRNLRQEENAAIGRARSMP--AKQRMMLSVERQQ-KVKEELYI----F
A0A235E1C0      ----------IRMSNMKDEENAAIGKARSLP--SKQRIMLSAERQQ-KVIEELYI----F
R6D982          ----------LKRTEISGQERLARRKVRDVP--GKQREMLSVERQQ-KVKESLYL----F
A0A1F0I8C4      ----------QKKNDYTVQENRVRQKVQAVP--RKQREMLSVERQQ-KVKESLYV----F
A0A3A5RIJ2      ----------QKKNDYTVQENRVRQKVQAVP--RKQREMLSVERQQ-KVKESLYV----F
A0A515IZJ5      ----------QKKNDYTVQENRVRQKVQAVP--RKQREMLSVERQQ-KVKESLYV----F
A0A7J4Y2H6      ----------QKKNDYTVQENRVRQKVQAVP--RKQREMLSVERQQ-KVKESLYV----F
A0A0D5BSQ0      ----------VRLNNAKQEEATAQSKTLQIP--QQERAILSIERQR-KIKEELYL----F
A0A1T3F6P5      ----------IKLNNTRQEEGVAQSKMLQMP--QKERTMVSVERQR-RVKEDLYM----F
A0A0W8EPA0      ----------IKLNNTRQEESIAQGKMLQMP--QKERTMVSVERQR-RVKEDLYM----F
A0A365UKN1      ----------VKLNNTRQEEGIAQGKMLQMP--QKERTMVSVERQR-RVKEDLYM----F
A0A4R6WE41      ----------VKINNVQREENQVKGQVMQIP--GKQRMILEVERKQ-KVKEDLYL----F
A0A2T5RP38      ----------IKMRNAQREEEQAIGKTLQMP--KKQRAMLSVERQH-KVKEELYL----Y
A0A1A6CF06      ----------IKLNNARQEGRTAQAKVLQMP--QKERTMLSIERQH-KVKEELYL----F
A0A1T3D6S8      ----------IKLNNARQEGRTAQAKVLQMP--QKERTMLSIERQH-KVKEELYL----F
A0A1P8E011      ----------IKAGNMKKEENVARGKAMQVP--QKQRVMLSVERQQ-KVKEELYL----Y
A0A1V3N3U3      ----------LKIRNAQQEESMAKGKALQVP--KKQRIMLSVERQQ-KVKEELYL----Y
C2FUH6          ----------VKMQKARSEEQQARGKVIQMP--QKQRIMLSVERQQ-KVKEELYV----F
A0A0B8T471      ----------IRIRNLQQEEAASRAKAQSLP--AKQRMMLSIERQQ-KVKEELYI----L
A0A4R7D2K0      ----------IRIRNLQQEEAASRAKAQSLP--AKQRMMLSIERQQ-KVKEELYI----L
A0A2X2J8S4      ----------VKKNNAVKEENRASGKSRQMP--QKQRLVLSIERQQ-KVKESLYV----F
A0A3C0S618      ----------VKKNNAVKEENRASGKSRQMP--QKQRLVLSIERQQ-KVKESLYV----F
A0A4P7DRF9      ----------IKIRNLQQEENAAIRKAQSLP--TKQRMMLSVERQQ-KVKEELYI----F
A0A239XXC4      ----------IRMSNMKDEENAAIGKAKSLP--SKQRIMLSAERQQ-KVIEELYI----F
A0A4U9K473      ----------IRMSNLRDEENAAIGKARSLP--SKQRIMLSAERQQ-KVIEELYI----F
A0A2T4XEQ1      --------------------------------------------DV-NIAESIYL----T
A0A2K8ZAP1      ----------SNRNQLVANNQRMEGMIRTVPGK--ERALLNITRQQ-GIKNNLYT----Y
A0A3M1Y2F5      ----------FELESVEDQIRTANGRLSRLPRN--ERMLTQMGRTY-ESINELYS----Y
A0A3D4RLG4      ----------IEKKDLQNRYKEVEKEIPNLPTK--ELQMVAIERNY-RIDDNYYT----F
A0A2T2UAJ4      ---------------LNERLRENRQKLEQIPTQ--SIKLAQPQRER-RSTEQIYS----F
A0A6I0DZQ5      ----------IQKKDLNRRYAEVQQEINQLPAK--ELEMIGIERRY-KMNDSYYT----L
A0A3D3LSK1      ----------NKIGIVNSLSSQYNAQIKTLPSQ--VIEYAKLERDK-LAAEKLYA----A
A0A496L711      --------------------------------------MLDYERRY-KINDSYYT----F
A0A1H6Z2F8      ----------LSISAIHAYGKGFEAEISRLPGH--QRALLSQSREQ-GIQQELYL----F
A0A2P8G5K0      ----------VNAAAIRKYGKESEAEISKLPAH--QRAFLAQSREQ-GIQQELYL----F
R5DEG6          ----------IKIKNIRAQEEQTSRRISAVPTQ--QKEVLSVERRQ-KIKEELYL----Y
A0A4Q3SEI4      ----------ANRSKLGAGTGMYTSILKGIPKK--ERDLLDISRQQ-AIKNDAYS----F
A0A348PT57      -----------------------------------EIEYARIERVY-NSNEKYYT----L
A0A7C3PTI0      ----------------KKAKEFEFDKLSTLPED--EVEYARLQRLY-AINEKFYT----L
A0A5Q4EKA0      ----------ARIKEILSKIESYEGILLNHGGRYSLIEYSMLQRVH-TINERFYN----Q
A0A519SYE7      ----------KLDATLNTRL-------MAMPDL--ATQQDRLKRPL-DLYANTYS----Q
A0A7C7CFR2      ----------LKKQTLESKIKEVEDKFYNLPTQ--ELEYARLLRLF-TINEKFYT----N
A0A3N2LCI3      ----------MQISSLQGSQASTTSKIASNPSQ--AKYLLSVERQQ-KVKESLYL----F
A0A6H9Q899      ----------SQIKSLRQTEQQTTSRIAANPTQ--AKYLLSVERQQ-KVKEALYL----F
A0A3D4CJE1      ----------TQRNEVAQKIKEFEQKFYNIPAK--ELEYARLERMF-SIDEKFFT----L
A0A7C7LI79      ----------VRKETLKGKINEIEAKFINLPTK--ELEYARLLRLF-SINEKFYT----T
A0A4Q5ZQ60      ----------DKIASLSNTIMQAENELLKLPSK--ETDLTRLRRFY-NLYEQSYL----L
A0A519Q885      ----------KKLGLLGDQDSKLENKRRVLPLL--ATQEARLQRPL-ELYSGAVR----D
A0A519TAP8      -----------------------------------------------SLYASTYQ----R
                                                                            

A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      -------------------------------------MKIVGKVSKALNKVESVHKPDFT
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          --------------------------------------------------MAIPAGILWL
A0A1V5S5I3      -------------------------------MIPTAPVKKNIALVAIVLGLLIPVVIVFI
A0A2M7VVW6      ----------------------------------------MIMATGVLLGIVISLIILIL
A0A413V760      --------------------------------------------------LGIPMGVFWL
A0A656PYT8      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ---------------------------DFQILSAASAPDAPISPKKMLVYAIGLAGGLVL
A0A7C7CKY6      LLEKKAEYSISRAGFV-SKNEILERS-LPP-TIPVSPDRRMIYALSLIVGLILSVGLLLV
A0A1G1TG88      LMGKKVDYNIQKAGTT-ADFQILFPA-SEP-RVPISPVRLMVYAIGLAGGLFLGLGLIAV
A0A661XXA6      LMQSKNEFEIAIAGST-TKIKILSPA-TMP-DSPIKPNKTIIYMAGGVSFIVLSFIFIVI
A0A519SD85      LSEKKLEAEIARAAVI-PGAVIIDKA-DYP-EEPNLPLPVTLYTSSALFGLAGGITFIFL
A0A3M1TXY5      LLQKRAETAIALATDI-ANKFVVDEAKQVG-SGPVSPKVGLIYAVAFVLSLGLPLAIMLV
A0A2E0VQ27      LMRKYTELSIMQQSDL-FPHKIIEHA-VRP-KATVAPNKSLYYGMAFLLALLAGMFYAYL
R6U429          LLQKREENEIASLVNV-GNTRLVMEP-AGE-DMPQSPNKKMIMLIALILGAGIPFGIFFM
A0A5C8AF42      LTEKKVLYSISDAGYA-SNNRILSRP-AVN-NTPVSPNRKLIYVTFVFFGIVIGLGIMFF
A0A353WYK7      LMKNKAQFELAQAGTV-TDFKILSSA-SLP-SNPIAPNKILIWAGAIIASVILSFLFIII
A0A355BP94      MMQAKAEFEIAQAGST-PDLKILSSA-ILP-GRPVAPNRYLILGIGLVAGLVINFFFISI
A0A136LSC7      MMQSKAEFEIAQAGST-PDFKILSPA-TLP-IKPISPSKVMVLGIGFVAAIVLCLFFIGL
A0A5C7N8Q5      MMQSKAEFEIAQAGST-PDFKILSPA-TLP-TTPISPSKIMVLGIGFVAGIVLSIFFIGL
A0A239K409      LLEKREESSLALATSA-PNSLVLRPA-IIE-GVPVEPKKQTVFLLAFIAGLGVPLASIFI
A0A1V5S1J9      LVQKRADAQIQKASNS-PDNIILDKA-RLA-SMTNAGEKNKAYTMFLAIGLLVPVAIIVL
A0A0A2EYC8      LLQKRSEAQIRKASNS-PDNAVMQKA-RTM-SLINAKEKQNKYIVFLLIGLAVPAALIIL
A0A2G6H6Y4      LLQKRAAAEILKASNT-PDNTVLQTA-MIS-GQLNDKEKRTNYLIFIVLGLMIPVVLIVL
A0A1M3DPL8      FLQKRAEAQILKASNT-PDNNILDRA-RTT-SVTNQGTKSKTIMMYFLIGILLPSVFIIL
A0A1V5F519      FLQKRAEAEIQKASNT-PDNNILDQA-RTV-SLINADVKSNTMFMFILLGILIPSLIIVL
A0A2G6R1T9      FISKKAEAQIQKAANS-PDNEVVEQA-RVR-FVVNGGKKKETTMTYLLFGLMIPAIFLIA
A0A350V3E4      LLEKYQEALINEESQP-NNVKIIDYG-KVP-KAPSKPNRFLIITIGLLIGLGLGYGFALL
A0A6J4K208      LLTRRAEAGMALATGR-TGSMIVDEARPDG-QKPVYPDAPLVYTVAALLGLLLPLGLLTL
A0A2W4RDE8      LLEKRAEAGIAIASNV-VEKSVVDEAMMVG-SAPVSPNKRMIYAAAFILGFGGALGLLIL
A0A0L8VEV2      LLKKRAEAAITHASNV-SDTEVLDEARPEL-AELMGPYLTFNVAGGLLAGLFVPFMVIML
A0A1I2A9Z9      LLKKRAEAAITHASNV-SDTQVLDEARPEL-ASRLGPNLVINVAGGMLAGLFIPFVVIML
A0A212J9Z9      LTQRQYEAKIQKASNT-PDNFIWEAPRQMG-GAVNGGEIGKNYTYYFIIGLILPLCFVVL
F5IV23          LTQRQYEAKIQKASNT-PDNFIWEAPRQMG-GAVNGGEIGKNYTYYFIIGLILPLCFVVL
F8X2T0          LTQRQYEAKIQRASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIPLIFVVV
A0A1M3LAG1      LTQRQYEAKIQRASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIPLIFVVV
A0A212K6G4      LTQRQYEAKIQRASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIPLIFVVV
A0A4Y9IPG7      LTQRQYEAKIQRASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIPLIFVVV
A0A1M5DFS8      LRNKRYEATIQKASNI-PDNFVLEEPRQLG-GPVNGDEKKKTYTFYLAIGLAIPLIFVIC
A0A4Y8KZS5      LRNKRYEATIQKASNI-PDNFVLEEPRQMG-GPINGDEKNKTYTFYLAIGLAIPLIFVIC
A0A2V3PNY7      LRQRRYEATIQKASNI-PDNFIMEAPRQKG-GPVNGDEKRKNYTFYFFIGLGLPLLFVIA
A0A6G7X5K8      LRQRRYEATIQKASNI-PDNFIMEEPRQKG-GPVNGDEKSKNYTFFFLIGLALPLAFVVC
A0A2P8CDS1      LLQKLSEAQIAKASNM-PDNEIIDPARMEG-NTPISPNNMTIYLVALLFGIFLPAGGIIL
A0A660LQT8      LLQKREENELSIAFTA-YNTRIITPP-MGS-NKPISPVKRNILLIALGLALALPFGIFYL
A0A389LWV6      LLQRRIESQIQLASNM-PDNLVLDNA-RTT-GLVNAGDISNTYVYFVVTGLILTIIFIFL
A0A1G9B1T9      LLQKRTEVGIAVASNA-STKKVVEEARLDG-RTPVSPNKILILLTAIVLGLALPVGALIL
A0A350PNH9      LLQKREENELSKAFTA-YNTRIITPP-TGD-TKPVQPVRRNIILVAFVLGVLIPVVVIFI
A0A354LNT9      LLQKREENELSKAFTA-YNTRIITPP-TGD-TKPVQPVRRNIILVAFVLGVLIPVVVIFI
A0A161LWY6      LLQKRAEAQIQRASNV-PDNTILERA-RMI-SITNGGDKKKSMMMALALGLIIPLLIIIL
A0A6I3N9U6      LLQKRAEAQIQRASNV-PDNTILERA-RMI-SITNGGDKKKSMMMALALGLIIPLLIIIL
A0A3D0FMX4      FLQKRAESEIQKASNT-PDNDRLDKA-RIL-ECTNAGAKNANRTKYLLLGLIIPFLFVIL
A0A1M3MEI8      FLQKRAEAEILKASNT-PDNNILDRA-RVI-NVVNQGEKSKTTLLFLLLGLVVPAGFVVV
A0A1J5HQM0      FLQKRAESEILKSSNT-PDNNILDRA-RII-AVTNDGTQSKTTLTFLIIGLLIPAAFVAL
A0A653AC35      FLQKRAEAAIQKASNS-PDNNILDKA-RIM-GVTNGKVISKNYMTYGLIGFLIPFLIVLL
E4T131          FLQKRAESEILKASNT-PDNDILDKA-RIV-GVTNSDKRSKTTMVFLLFGLLIPTFIVIL
A0A2W7RD29      LLQKRAEAAISKASNI-NNNKIIEQA-KAN-ALPIGPRKLNFYGYAIIITFLLPVIITFL
A0A3N2NDY8      LLQKREENELTQKFTA-DNTRIITPP-TGS-LQPVAPKVKFILAICMFFGLCVPGVAIYI
D7JEV9          LLQKRSEAQIRKASNS-PDNAVMQKA-RTS-QLVNANQKQKKYMIFFFIGLAIPAVLIIL
A0A4R6H3B7      LLKKRAEAAITHASNV-SDTQVLDEARPEL-AFRLGPNLVINVAGGMLAGLFIPFVVIML
A0A521H707      LLEKKVEFAITKAGII-TNNIVLEQGKPAL-NPL-SPNRKLILAGSLLVGFILSFVIIFV
A0A1F3D6P8      LLQKRSEAAITMASNY-PDFEVIEPAREFT-KKIIVPRPKLSYLLAIFFGLAIPTTFIFI
A0A356Z058      LLQKRSEAAITMASNY-PDFEVIEPAREFT-KKIIVPRPKLSYLLAIFFGLAIPTTFIFI
A0A3D1BT36      MLQKRSEAGIAMASNH-PDYEVLESARSIT-SSIIKPKKMINYIASFFLGLLIPSLIIIL
A0A5R9QZP0      LLQKRSEAAISMASNY-PDYEILEPARLVT-SSVISPKTTINYLLSLFIGFIIPSIFTLL
A0A3D3HL11      LLEKKAEAAIAMASNY-PDYEILEPARDVT-ASIIAPRTNLNWLIALFMAFMVPTIYIIL
A0A6L8U6G9      LLEKKAEAAIAMASNY-PDYEILEPARDIT-ASIIAPRSSLNWIIALFMAFMIPTLYIIL
A0A352ME00      LLQKRSEAQISLASTR-PDYEIVEPARTIT-SRIVAPKSAINYMMALFFGLLLPTLYLMI
A0A6L8UH35      LLQKRSEAAIALASNY-PDYEILEPAREIT-SKIVSPKDFINYLIAVFMGLLIPTMYLVL
A0A3P1Z8V4      LLNKREEVALQLAIEE-ANVRVVEEP-LFA-SRPISPRKGIIMLIALLLGILIPSFAFWL
A0A1M6MYT6      LMQKLSEAQIAKASNI-PDSQMIEEAKMAG-TGPVEPQKRKIYALALLLALAFPTGIIIL
A0A2W7QSQ0      LLRKRDEAVLTLEVTGVSSAQMVDPP-IAS-LKPVKPNKLMIMAAALGLGLSLPLGLILV
A0A3D5KRY6      LLQRRAEAEITRASNT-PDATVLDPV-DQDIAIILGPILWLDLAVGFAVGLLGALGLIIL
R7F6L5          LLQKREENELAQAFKS-YNTQVVRQP-AGP-GAPISPVSTNTYLIAVLIGLIIPSGVYVV
A0A7C5MRV2      LLEKQAEAQIAKASIV-SSVYILDRA-LTP-RAPISPLAQKVYIIGCGLGVCLGLLLILL
A0A229I3A5      LLQKREENELSKAFTA-YNTRIITPP-TGD-NTPVEPVRRKILLIALVLGFLIPMVVIYI
A0A3R6HJB3      LLQKREENELSKAFTA-YNTRIITPP-TGD-NTPVEPVRRKILLIALVLGFLIPMVVIYI
R6NN15          LLQKREENELSQAFTA-YNTRVITPP-TGS-MAPTAPMKKNILLVALALGVLIPVVFVFL
A0A553GA49      LIQKRSEAQIAKASNL-PAFELIDYP---AFDGRAAPKKSRNLILMVFFGLLLPTIYVLL
A0A497D6F6      LLQKLTDAQIARASNV-SDSRVIEDA-HIKGIGPVEPKKSRIYLIALFLGLFVPALIILM
A0A5M4AAB9      LLQKLSEAQIAKASNT-PDNEVIDPA-RIIGDKPVKPNNIKTGIAALLLGIFFPSTLIII
F4KR18          LLQKREETALALVSNY-ANALLFDPPYSSIG--PVGPNKIKIFAAAGMGGLAIPFFLILV
A0A2M6GH67      LINRRLDFNIAKAGTT-ADFQILQPA-SLP-AAPIKPDKLMVYAIGLASGLFLGIGLIAA
A0A7K1TE30      LMEKKVEYNIKNAGTT-PDFQILSPA-SAP-DAPISPIKLLVYAIGLAGGLITGLGLIAT
A0A7D4BE70      LLEKKVEYNIKNAGTT-ADFQILSPA-SAP-DIPISPVRLLIYVIGLVGGLVLGLGLIAV
A0A142HHS5      LLEKKVEYNIKNAGTT-ADFQILSPA-FAP-EEPISPKKLLVYAIGLAGGLILGLGLIGT
A0A7D4C435      LLEKKVEYNIQNAGTT-ANFQILSPA-YAP-DTPISPVRLFVYAIGLAGGLVLSLGLIAT
C9LKL0          LMNKREEVALQLAVND-ANVRLVEDP-LGS-NTPISPSRSTIILISLLIGLLIPTLILTI
A0A3D0QPV7      LLEKKTEYEISLAGQT-TGNQILEQA-TIP-KLPVSPKKRMIVIAFFFIGILFSSVMIVI
A0A496KT23      LLQKREENELSQAFTA-YNTQIIETP-HIT-GIPPQPVSRNILLTAFLIGLAIPAAFVFG
L1M9T3          LLQKREENELSQAFTA-YNTQIIETP-HVT-GTPATPVSKKILGIALLLGLGIPAALIFA
A0A3C0I8F1      MLNKKAEIGISRSAIV-PEFVILAPA-SQP-TKPIYPVPTNIYSLGLAAGVVLSLLLVAI
R5JJI4          LLNKREENALTQAITE-SNARIIDPA-SGS-SVPVAPKSMMILLAAIVLGGTIPMIVLWL
A0A0A2DQN2      LLSKREENLFAQTITN-NNAYILDLG-VGT-SAPISPVPSRSILLGIVLGLFIPAAYAIL
A0A0A2F2N5      LLSKREENTLAQTAQS-NNAYVMDFD-TGS-NSPISPNTTRTLLISFAIGLFIPTAFFLL
L1NGW4          LLNKREEYALMQAMTQ-DSAYILDMN-DAP-APPVSPNKTRTVLLAILIGLALPTIGLII
Z4WRA0          LLNKREEYALMQAMTQ-DSAYILDMN-DAP-APPVSPNKTRTVLLAILIGLALPTIGLII
U2K8K9          LLSKREEYALRQSMTQ-DSAYILDMN-DAPNTPPVSPNTLRTIVLAFLLGLALPTIFLIV
A0A069ZM60      LLNKREEYALRQAMTQ-DSAYVLDMD-DAP-SKPISPNTLRVVLIAILIGLVLPSVYLII
J6GV98          LLNKREEYALRQAMTQ-DSAYVLDMD-DAP-SKPVSPNALRVALIAILIGLVLPSVYLII
A0A134B4F8      LLNKREEYALRQAMTQ-DSAYVLDMD-DAP-SKPVSPNTLRVVLIAILIGLVLPSVYLII
A0A134B8C7      LLNKREEYALRQAMTQ-DSAYVLDMD-DAP-SKPVSPNTLRVVLIAILIGLVLPSVYLII
A0A3D2HF71      LLEKRAEAGIARASTV-SDNRIIDYAGVYS-STMIKPKERQNFMLAIILGLFFPGIGILL
A0A4Z0EKR0      LLQKREEAALSLAATT-AIARVIDPA-TGG-DYPISANSRTIYLMALLLGLAIPFGGIYT
B5CTK0          LLNKREENALAQSITE-SNVRTIDPA-SGS-NTPIAPDRMRIWMISFLIGIGIPAVFLML
A0A1M6B6D5      FLAKRSEAGLVKAANV-SDVLVIDPAKDTG-GGQIGPNTQLNYMMAGLIGFFVPILLIFV
A0A451FS66      FLAKRSEAGLVKAANV-SDVVIIDTAKDTG-GGKIGPNTQLNYVMAGLLGLFIPLFIIFG
A0A2E3GN39      LLDRKASFTLSRAGIV-SDYIILEMP-KIA-EKHVAPDDSFIRFVGLAIGAILSLILVVF
A0A3D1MEL0      LLDRKASFTLSRAGIV-SDYIVLEVP-KIA-EEHVAPDDSFIRFVGLAIGAILSLILVVF
A0A519UDD1      LLQKREETALSLAATA-SVARVLDPA-MGG-NFPVSPNGRTIYLMSLLLGLGLPLAGIYA
A0A2A4N9A6      LLEKHANLQIHAAGII-NDVVILAEA-SVP-KIQEYPSPVYAMLTGIISFLMLSLITVIF
A0A6C0GGI1      --KRAAAEILLATNAP-SKKRVDYAK-MVG-NGPMSPKTNAIYLIAFLVGLFIPAGGILA
A0A368D1N7      LLDRKASFTLSRAGIV-SDYIILEMP-KIA-EQHVAPDDSFIRFVGLAIGAILSLILVVI
A0A3B8TU58      LIERKSSFSLSKAGIV-SDYTILENP-KIA-KNHISPNDSFIRFVGLAIGAILSLILVVF
A0A1T5IIR6      LLNKREENALSQAMAD-DNIRVVDPA-VAN-LTPTSPQRMKIVMLAILIGLLIPGVILIA
A0A3E0QD27      LLEKKVEFSITKAGII-SNNIVLERG-KPA-VNPLSPNRRLVIAGSLLLGFIISFLIIFV
A0A6N8DCX3      LLQKREENELSQAFTP-YNMRILTPP-SGN-LEPVAPQKKKILAVAFLLGLMFPAGCILL
F0R0C9          LLQKREENELSQAFTA-YNTRVITPP-TGS-MLPTAPVRRNILLVAFALGLLIPVVIVFV
A0A0M1W1I6      LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
A0A4R4GHU2      LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
I8WPR6          LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
A0A0K2HKS3      LLNKREENALGQATTE-TDARVLDPA-GGG-DTPISPNGRSMIMAGIMKGIALPAIVLLL
B6W3W8          LLNKREENALGQATTE-TDARVLDPA-GGG-DTPISPNGRSMIMAGIMKGIALPAIVLLL
A0A7M3EEL4      LLNKREENALGQATTE-TDARVLDPA-GGG-DTPISPNGRSMIMAGIMKGIALPAIVLLL
A0A076IRY8      LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
A0A3A6AD54      LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
A0A3A6MIU7      LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
I8WPP8          LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
A0A372Y7D2      LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
A0A7K3KFI2      LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
A0A3E4JJC9      LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
A0A3E4WDQ0      LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
A0A414H9P2      LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
A0A7K0JKU9      LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
C3R5A8          LLNKREENALSQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLL
A0A1C5XJA7      LLNKREENALSQAMAD-NNARVIDSA-EAT-KYPISPNRNKILALGILLGLALPTVSFLV
A0A285T4L1      LLNRREENALSQAMAD-NNARTIDSV-DGP-VGPIAPVRNRILLLGVLVGLAVPGVVFLM
A0A3E5BU42      LLNRREENALSQAMAD-NNARTIDSV-DGP-VGPIAPVRNRILLLGVLVGLAVPGVVFLM
R7CUW4          LLNRREENALSQAMAD-NNARIIDSA-EGG-DSPISPRRNRILLLGLLVGIALPGVGCLL
A0A416GGJ1      LLNRREENALTQAMAD-NNARLIDEA-DKG-SGPIAPVRNRILILGLLAGIALPGVACLL
D1JY72          LLNKREENALGQATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGIMKGIALPAIVLLL
A0A7G5NJU1      LLNRREENALSQAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLM
D7J4K6          LLNRREENALSQAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLM
Q8ABP9          LLNRREENALSQAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLM
D6D2Z5          LLNRREENALSQAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLM
A0A1T3EDR4      LLNKREENALNAAIGE-AKLHVVDHA-VIS-HVPISPNILISVFTGLGIGFLVWVALLLL
A0A6N8KXI9      LLNKREENALNQAMTE-DNMRIIDPA-TGS-GAPISPSKFRKVGLGVGLGFLIPTIILLA
A0A174SDD8      LLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLMLGVGCGVIVPSVILLL
A0A1H7RFH3      LLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLL
A0A139L1N2      LLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLL
A0A174TVL8      LLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLL
A0A1H8BJR6      LLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLL
R9H6G0          LLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLL
A0A412GR09      LLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLL
A0A7J5JXN6      LLNKREENALSQAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLL
A0A081PBV5      LLNKREENAINQAMTE-DNVRIIDPA-SGS-DAPIYPSRIKKLALGVGIGIALPAIVFLL
A0A1I2AN85      LLNKREENAINQAMTE-DNVRIIDPA-SGS-DAPIYPSRIKKLALGVGIGIALPAIVFLL
A0A4U0GMP3      LLNRREENSLNQAMTD-DNVRIIDPA-SGS-SAPIYPSRFSKVALGVGIGAAIPAVVLLL
A0A1H6CKR6      LLNKREENAINQAMTD-DNIKVIDSA-NTS-NYPFYPSLLKKLALGIGIGLAIPTAILLL
A0A235E1C0      LLNKREENAINRAMTD-DNIRVIDSA-SGS-DAPFYPSKFKKVAIGVAIGIAVPAAILLL
R6D982          LLNKREENALNQSMVD-NNARIIDSA-SGS-NAPFYPNKYKKLLLGGGMGILIPTVILLL
A0A1F0I8C4      LLNKREENALNQAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVPTVVLLL
A0A3A5RIJ2      LLNKREENALNQAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVPTVVLLL
A0A515IZJ5      LLNKREENALNQAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVPTVVLLL
A0A7J4Y2H6      LLNKREENALNQAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVPTVALLL
A0A0D5BSQ0      LLNKREENALNEAIAE-SNLRIVDPP-TGL-DFPVSPNKLKKLSIGVAIGAVLPAVVLLS
A0A1T3F6P5      LLNKREENALNEAVTE-ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAIGTVLPAVVLLS
A0A0W8EPA0      LLNKREENALNEAVTE-ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAIGAVLPAVVLLS
A0A365UKN1      LLNKREENALNEAVTE-ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAMGAVLPAVVLLS
A0A4R6WE41      LLNKREENALNQAMTE-DNIRIVDPA-YGS-EAPMYPSRLRKVGMGLAVGTVLPAVVLLL
A0A2T5RP38      LLNKREENALNEAMTD-ENIRVVDPA-SGP-DVAVYPNRLKKIFTGVALGTAVPAVILLS
A0A1A6CF06      LLNKREENALNEAITE-ANLRIVDPP-VGD-AYPIYPNRLKKVFTGVAIGTVLPMIVLLS
A0A1T3D6S8      LLNKREENALNEAITE-ANLRIVDPP-VGD-AYPIYPNRLKKLFTGVAIGTVLPMIVLLS
A0A1P8E011      LLNKREENAINQAMTE-DNIRVIDPA-IVS-FDPVAPSRMRKLGLGMAIGFILPAIVIMT
A0A1V3N3U3      LLNKREENALNLAMTE-DNIRIIDRA-SVA-TSPIFPSKFRKVATGIGIGLILPTVILLF
C2FUH6          LLNKREENALNKAMTD-DNIRIIDPA-SGS-DAPVYPVRFKKVMTGVGIGIVLPAAVLLC
A0A0B8T471      LLNRREENALNQAMTD-DNLRVVDPP-SGS-EAPIYPSKARKVMTGVGFGVVLPTVVLLL
A0A4R7D2K0      LLNRREENALNQAMTD-DNLRVVDPP-SGS-EGPIYPSKARKVMTGVGFGVVLPAVVLLL
A0A2X2J8S4      LLNKREENAINQAMTD-DNIKVIDPA-SGS-FAPVYPNKFKKVGLGVAIGLVIPSLLLIL
A0A3C0S618      LLNKREENAINQAMTD-DNIKVIDPA-SGS-FAPVYPDKFKKVGLGVAIGLVVPSVILIL
A0A4P7DRF9      LLNKREENAINQAMTD-DNIRIIDSA-SGS-DWPIYPNKLKKLAIGIGIGLAIPAIVLLL
A0A239XXC4      LLNKREENAINRAMTD-DNIRVIDSA-SGS-NLPFYPSKLKKVAIGVAIGIAVPAAILLL
A0A4U9K473      LLNKREENAINREMTD-DNIRVIDSA-SGS-DLPFYPSKFKKIALGVAIGIAVPAAILLL
A0A2T4XEQ1      ISRQYAETALWEQTQF-GLGRPLDYA-VAP-LSPFKPNKRLFILIGIFLGGAVGVGLAFG
A0A2K8ZAP1      LLQKREETALSAASRV-SDSRIVDPA-HTT-SQPVKPVKLMIFALFAVVGLVIPIGVITA
A0A3M1Y2F5      LQKKKTEAEIALANLT-VDLMIIDPA-RYT-GKESRNSRMLIMALALILAIGLPAGFLVV
A0A3D4RLG4      FLQKRAETEIQKASNT-PDNAVLDKA-RTT-YITNAKQQRKTMISYLALGFLLPLVLSVL
A0A2T2UAJ4      VQEKLQEARLAEQSEI-GYAEIIRSA-APG-RPVGPDTR-RNLLLGLMLGLVAGGGLVVL
A0A6I0DZQ5      FLQKRAEAEILKASNT-PDNNILDRA-RVI-NVVNQGEKSKTTLLFLLLGLVVPAGFVVV
A0A3D3LSK1      LESNYQESLINERTQT-IKSYVIDPG-YDD-NSPIGPDRRNMNIFGIIAGLIIGLAFALM
A0A496L711      LLQKRSEAQIRKASNS-PDNAVMQKA-RTS-QLVNANQKQKKYMIFFFIGLAIPAVLIIL
A0A1H6Z2F8      LLKKRMETAISRSANI-ANARVIDPP-KAS-PLPVSPNRQLTILVAFLAGLLAPACVIYV
A0A2P8G5K0      LLKKRVETAISRSANI-ANARVIDPP-KAS-RLPVYPNRELTILIAVFTGILTPLGVLYT
R5DEG6          LLNKREENELTQRMTE-SNARIIDPA-AGS-NAPVAPKAMMILLASVVLGCAIPAGILWL
A0A4Q3SEI4      LLQKREEAAISYAAVV-ADSRTINHA-TAS-FLPISPEKTFVYLVSIVIGLLIGFSFVII
A0A348PT57      LLEKKTEYAISEAGFI-SENRVLRRA-STS-RIPISPVKPIIYASFLALGLILSFLLIGI
A0A7C3PTI0      LLEKKTEYSISEAGNV-SLHEILEKS-LPP-TSPVSPSKKLVVISAFMVALFVSFGLVLV
A0A5Q4EKA0      LVEKKAEYSISKAGYV-SQSVILERS-RVP-GQPISPKPRGVYASSLLAALFLGIGVFLL
A0A519SYE7      LLNQKLNFGIQQAGTT-ANFQILSPA-YPP-GEPISPVRALVYAIGLASGLALGLGLIAT
A0A7C7CFR2      LLEKKAEYSISKAGFV-SKNMILESA-TVP-TSPISPDSSKVIALVLIIASFLSAAMLVI
A0A3N2LCI3      LLQKREENELSQAFTA-YNTRVVNKP--AS-FGPTAPNTRNILMMSFLLGLAIPFGVVYL
A0A6H9Q899      LLQKREENELSQAFTA-YNTRIVTPP-HGS-MLPTSPVRKNIFMVAFALGLLIPVVIIFM
A0A3D4CJE1      LLEKRTEYSISEAGFV-PQHTILEQA-EIP-NVPIKPNKKLIFVVFVFGSLVLGIGFVVI
A0A7C7LI79      LLEKKAEFSISKAGFV-SKNAILEVG-VPP-IIPVSPDKQKVFTLGTLVALFLSGLLLII
A0A4Q5ZQ60      LMEKKIQFGIAKAGTT-DNSQILSPA-SLP-TLPIYPNKMLVYAIGIAASFFLSIVLVTA
A0A519Q885      LMQKQLEYEIQNAGTI-PDFQILSAA-ATP-DEPISPKKILVYAIGLAGGLILGLGLIGV
A0A519TAP8      LVDRKMDFNIQQAGTT-PEFQILSPA-SPP-SEPITPVRLLVYAIGLAGGLILGLGLIAT
                                                                            

A0A1T4NDR5      --------------------------------------MTNV------------------
A0A3D5KRM7      ---------------M-VENSESDSL--DNIRYSKTRIMPLD------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      S-PAPPDEPQVISSST-VAEERKRKV--AAKAPSLPPDLGAS------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
R7JFY1          R-WANDTRIRSMKDVQ-DRT--ALPL--LGEIP--------A------------------
A0A1V5S5I3      R-ENMNTKVRGRKDLE-SL---SLPF--AGEIPLAVSGKGKK------------------
A0A2M7VVW6      K-YVLKNTISTMDEIT-KFSNGAVGI--LGTVP----TYNRE------------------
A0A413V760      L-NVTDTKVRTRKELD-GVL--TIPF--LGNIP----RHGNN------------------
A0A656PYT8      M-EILDTTIRGRKDIE-DKL--SIPF--LGDIP----EYHGS------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ---------------------------------------MLK------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A7K3KYQ2      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      -------------------------------------MSVIY------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      G-LGLIGVRYLMHNTV-TSIGELERN--TKASVLGVIPTYSK------------------
A0A7C7CKY6      T-YLLHDVVTSVQEIK-IHTSA--RI--LGIVPSYKN-----------------------
A0A1G1TG88      R-YLLHNTITNTRELE-RSTQA--AV--LGVIPTYDK-----------------------
A0A661XXA6      S-YLAHDKIDGIADVE-RNTAA--TL--LGSVPKYKS-----------------------
A0A519SD85      K-RKINPFVNIAEDIL-QHTIT--PV--LATLRRSTD-------SNDLLSKN--------
A0A3M1TXY5      Y-DFFNEKISGDQDIE-ACTNI--PI--LGYIA---------------------------
A0A2E0VQ27      R-SYVKETVSSKDELEEKLPQY--PI--IGEVY---------------------------
R6U429          I-NQLDTRVKTRNDLT--NMQV--PF--LAEIPQL--------------GQGAGILNKMR
A0A5C8AF42      K-YLTFNEINMLDDLK-KLLPS--RASILGGVPLFK------------------------
A0A353WYK7      R-YLLHNSVSSEKDIE-HITPT--SI--LGSIPFVEK-------L---------------
A0A355BP94      V-YLLSNKITSLQEIE-RTIHV--PV--LGVIP---E-------M---------------
A0A136LSC7      V-YLLNNKITSVKEVE-RGINL--PM--LGAIP---A-------S---------------
A0A5C7N8Q5      V-YVLNNKITSVKEVE-RGINL--PM--LGAIP---A-------S---------------
A0A239K409      K-NAFNRKVQQRADVE-RATTA--PV--LGEVSYNDT-------KDV-------------
A0A1V5S1J9      L-ELMVPYIRTESEVI-SMAPK--QYQLLGVIMHT-------------------------
A0A0A2EYC8      K-ELLNNAIRTEKDIE-KAIKN--KFQIIGTVRHT-------------------------
A0A2G6H6Y4      K-EFMNSAVRTEKDVD-IATKN--RFDIIGSVLHT-------------------------
A0A1M3DPL8      K-ELLNNTIRTSRDVE-K--MS--AFPLIGLVRHT-------------------------
A0A1V5F519      K-EVLNNTIRSIKDIE-K--RS--VFPVIGMIRHA-------------------------
A0A2G6R1T9      R-ELLNNTIRGQKDVE-K--NS--KFPIIGNIRHT-------------------------
A0A350V3E4      R-NILDVSVKSPEDLE--NIGI--SL--IGWVPTFMR--------------------EPK
A0A6J4K208      R-HFMRNRIINQTDIQ-LNTAI--PT--LGVVGYN-------------------------
A0A2W4RDE8      K-DFLNDNIVTHEDLE-QYTRI--PF--LGVVSHG-------------------------
A0A0L8VEV2      A-TYFYDRIKSAEDIE-EYTDI--PV--IGNIVN--------------------------
A0A1I2A9Z9      A-TYFYDRIKSAEDIE-EYSDI--PV--IGNIVN--------------------------
A0A212J9Z9      KEEILNFSITTKEECE-KISGF--PV--IGTIENVSK-------KLN--NGV--------
F5IV23          KEEILNFSITTKEECE-KISGF--PV--IGTIENVSK-------KLN--NGV--------
F8X2T0          KEEVLNFAITSKEECE-KISGL--PV--IGTIENISK-------KLA--GGV--------
A0A1M3LAG1      KEEVLNFAITSKEECE-KISGL--PV--IGTIENISK-------KLA--GGV--------
A0A212K6G4      KEEVLNFAITSKEECE-KISGL--PV--IGTIENISK-------KLA--GGV--------
A0A4Y9IPG7      KEEVLNFAITSKEECE-KISGL--PV--IGTIENISK-------KLA--GGV--------
A0A1M5DFS8      KEELFNYAISTKEDCE-RLSGL--PV--IGTIENISK-------KMSS-NST--------
A0A4Y8KZS5      KEELFNYAISTKEDCE-RLSSL--PV--IGTIENISK-------KMPS-GNT--------
A0A2V3PNY7      KEEIFNLVISTKEDCE-RLSGL--PV--IGTIENISK-------KLSSSGST--------
A0A6G7X5K8      KEEIFNHAISTKEDCE-RLSGL--PV--IGTIENISK-------KISSAGST--------
A0A2P8CDS1      K-NEFDNKVRTPEDLE-NLTKY--PI--LGHIIHD-------------------------
A0A660LQT8      R-EMLDTRVRGRRDME--NLDI--PH--IGEIPHMDA-------SVESWTSKLLVKLGLK
A0A389LWV6      KEVLLKTSIQSRSEVE-KISEL--PI--LGTIE---------------------------
A0A1G9B1T9      A-DMFQDKISSREEVA-NIISM--PL--VGEVP---------------------------
A0A350PNH9      R-ENMNTTVRGRNDLK--NITI--PF--LGEIPYCIS-------R----KNRPTLLQRIQ
A0A354LNT9      R-ENMNTTVRGRNDLK--NITI--PF--LGEIPYSIS-------R----KNRPTLLQRIQ
A0A161LWY6      K-EYLKTKVMDKRDIE-KLSPF--PY--IGSLPH--------------------------
A0A6I3N9U6      K-EYLKTKVMDKRDIE-KLSPF--PY--IGSLPH--------------------------
A0A3D0FMX4      R-ELLNNKVRTTREAE-ALSHY--KL--LAQVR---------------------------
A0A1M3MEI8      K-ELLNVRIMTNRDVE-KYSSF--PL--IGMIR---------------------------
A0A1J5HQM0      R-EFSNGTIRSNKDIE-KNSKF--TM--IGSVR---------------------------
A0A653AC35      T-ELLNNTIRNAKDVE-KNSPF--SL--IGAVR---------------------------
E4T131          I-ELLNNTVHSTKDVE-KNSVF--PL--IGAVR---------------------------
A0A2W7RD29      Q-ETVFKKLVDPSEIE-KLLNI--PV--IGSIPVA-------------------------
A0A3N2NDY8      I-SATDTKVRSRKDLD--RMSA--PF--AGEIPFVGK-------K----SIKDRMARLLP
D7JEV9          K-ELLNNAIRTEKDIE-RATRN--RFPTIGSVRHT-------------------------
A0A4R6H3B7      A-TYFYDRIKSAEDIE-EYSDI--PV--IGNIVNTGI-------G----AEF--------
A0A521H707      K-YLFYNEITSLDEIN-LYTNA--AL--LGIIPKY----------------------KSE
A0A1F3D6P8      R-NFFNNKISSIYDLE-SLINQ--SG--MGVIFNN----------------------NYK
A0A356Z058      R-NFFNNKISSIYDLE-SLINQ--SG--MGVIFNN----------------------NYK
A0A3D1BT36      K-DFFNEKITRAYEIE-DVLGK--PV--LSTIYNN----------------------SFK
A0A5R9QZP0      K-VFFSQKVSSVRDIE-RVIHQ--PI--LNLIYTN----------------------YHN
A0A3D3HL11      K-NFFNEKISSVRDVE-HMIGQ--PV--MNLIYTN----------------------FYK
A0A6L8U6G9      R-NFFNEKITSVRDVE-RIIGQ--PV--MNLIYKN----------------------YYK
A0A352ME00      R-DFFDDKIRSINDAE-YMLHR--SV--MSVIYSN----------------------NLK
A0A6L8UH35      R-DFFDDKIRSLNDAE-YLLHK--PI--LSVIYSN----------------------NHK
A0A3P1Z8V4      L-DLFDHTVSGRQDVE-NALDI--PI--VGELPHV-------------------------
A0A1M6MYT6      L-DLLNTKILSKDDVE-ALTDY--PI--IGHVFNN-------------------------
A0A2W7QSQ0      N-YLVTSKVTSKRVIE-KILNA--QI--LGEIAKND---------------------QNG
A0A3D5KRY6      K-EAATNTVSDADEVA-RLLDV--AT--IGSISHNRY-------K----TERPTIDFPRS
R7F6L5          K-ANLDNKVRSREDVE--NIGI--PF--IGEIPQKG---------------------RKK
A0A7C5MRV2      S-GMLKNTVSYREEVE-NMSVT--PI--IGVVRRSNE-------S----LKQ-----KYP
A0A229I3A5      R-EKANTTVRGRKDLK--KVNV--PF--LGEIPFSIS-------R----KNRPTLEQRIK
A0A3R6HJB3      R-EKANTTVRGRKDLK--KVNV--PF--LGEIPFSIS-------R----KNRPTLEQRIK
R6NN15          Q-ETLNTRVRGKKDLE--NLSI--PF--VGEIPLYGK-------V----RRSGLFHKKV-
A0A553GA49      N-ESYFEKISDIEDYR-FSFKA--PV--LGQITLCSN-------G----SKK--------
A0A497D6F6      K-YFSTNKITTVDDIK-EITNA--PV--VGLVFN-----------------------TRK
A0A5M4AAB9      R-NALDNKVRTLDDLK-LLTDS--PV--LGQIPH-----------------------DEQ
F4KR18          L-ELLKNSVQTEEDLKSMLPEK--TI--MGVINH-----------------------QKG
A0A2M6GH67      R-YFMHNTITNLGEVE-RNTKA--PV--LGVVPRYT---------------------KEK
A0A7K1TE30      R-YFMHNTITGVQELE-RNTKA--SV--LGVIPTYE---------------------KEK
A0A7D4BE70      R-YLMHNTVTSVSELE-HSTKA--SV--LGVIPTYE---------------------KER
A0A142HHS5      R-YLMHNTITSVNELE-RNTKA--SV--LGVIPTYD---------------------KEQ
A0A7D4C435      R-YLMHNTITSVNELE-RNTNA--SV--LGVIPTYE---------------------KEK
C9LKL0          R-RLMDITVSGRHDVE-EATTI--PL--VGELPTWEE-------G----GDD--------
A0A3D0QPV7      R-YLMHNEITTLHEIT-RISNA--SLGILGIIPKY----------------------KED
A0A496KT23      R-EALNSTVRGRKDLE-D-YSM--PL--VGELPLKGK-------K----RPVWKRWRKEK
L1M9T3          R-EGFNTTVRGRKDLE-D-MSV--PL--VGELPFKGK-------K----RPVWQRWRKQT
A0A3C0I8F1      R-YLLNNTVANQKELE-KIIIA--PV--LGVIPF-----------------------HNK
R5JJI4          L-NVTDTKVRTRKELD-NILTI--PF--LGDIPR-----------------------HGT
A0A0A2DQN2      K-LLTDTKIHSRRDVV-DQVSL--PF--LGEIPL-----------------------NTT
A0A0A2F2N5      K-LLADTKVRTRKDVL-ERVSI--PY--LGDIPQ-----------------------SDT
L1NGW4          R-LLADNKVRTRKDIL-DRLTI--PF--LGDIPK-----------------------EDA
Z4WRA0          R-LLADNKVRTRKDIL-DRLTI--PF--LGDIPK-----------------------EDA
U2K8K9          R-LLTDNKVRTRKDIL-DRLTI--PF--LGDIPK-----------------------EER
A0A069ZM60      R-LLADNKVRSRKDVM-DRVSI--PF--LGDIPR-----------------------EEK
J6GV98          R-LLADNKVRSRKDVM-DRVSI--PF--LGDIPK-----------------------EEK
A0A134B4F8      R-LLADNKVRSRKDVM-DRVSI--PF--LGDIPR-----------------------EEK
A0A134B8C7      R-LLADNKVRSRKDVM-DRVSI--PF--LGDIPR-----------------------EEK
A0A3D2HF71      L-DYFNNKIIDKKDIE-KRTSA--PI--IGFIGHNTF-------K----TDL--------
A0A4Z0EKR0      N-NLLDNKVQSQQDVS-AMTPT--PI--LGEISHN----------------------NSN
B5CTK0          L-KMTDTKVRTKKDIE-NKLSI--PF--LGEIPKY----------------------QGK
A0A1M6B6D5      R-AFFDTKVESVKDLE-AITPI--PM--IGVI-------------------------GKN
A0A451FS66      M-AFFDTKVEYVKDLA-KITPI--PL--FGVI-------------------------GKN
A0A2E3GN39      R-YVTHKEIINIEDIT-SQTET--SL--LGVIQRY----------------------SEK
A0A3D1MEL0      R-YITHKEIINIEDIT-SQTET--SL--LGVIQRY----------------------SEK
A0A519UDD1      A-NLLNNKVQTQQDVA-SVTEA--PI--LGDIAHN----------------D-----TGD
A0A2A4N9A6      R-YMLHNKISHLSDID-RSTNA--TV--LGIIPQF----------------K-----REE
A0A6C0GGI1      Y-DLVNNTIKSKDDVR-GVTNI--PV--LGLIGHS----------------D------GK
A0A368D1N7      R-YITHKEIINIEDIT-SQTET--SL--LGIIQRY----------------S------EK
A0A3B8TU58      R-YITHKEIINIEDVT-SQTET--AL--LGVIQRY----------------S------EK
A0A1T5IIR6      R-LFLDTKIRTRKEIE-ENIDV--PF--LAEIPLNGT-------L----RGIVFKQGKHK
A0A3E0QD27      K-YLFYNEITTLDEIN-LYTDA--AL--LGIIPKY----------------------KNE
A0A6N8DCX3      R-ENMNTTVRRRKDIA--RLAV--PF--IGEIPLDTS-------G----KKKRLLRKQVE
F0R0C9          R-ENMNTKVRGKKDLE--CLSM--PF--AGEIPLAGE-------S----RRKHLFASKTY
A0A0M1W1I6      F-LFFDTRIRNRKDIE-DVVTV--PF--LGEIPKDSS-------K----RKI-----ENK
A0A4R4GHU2      F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----RKI-----ENK
I8WPR6          F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----RKI-----ENK
A0A0K2HKS3      F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----RKI-----ENK
B6W3W8          F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----RKI-----ENK
A0A7M3EEL4      F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----RKI-----ENK
A0A076IRY8      F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----GKT-----ENK
A0A3A6AD54      F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----GKT-----ENK
A0A3A6MIU7      F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----GKT-----ENK
I8WPP8          F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----GKT-----ENK
A0A372Y7D2      F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----GKT-----ENK
A0A7K3KFI2      F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----GKT-----ENK
A0A3E4JJC9      F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----GKT-----ENK
A0A3E4WDQ0      F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----GKT-----ENK
A0A414H9P2      F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----GKT-----ENK
A0A7K0JKU9      F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----GKT-----ENK
C3R5A8          F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----GKT-----ENK
A0A1C5XJA7      I-MFMDTRIHSRKDIL-GAVSV--PF--LGEIPLD----------------K-----NYK
A0A285T4L1      I-LFMDTRVRSRKDLK-GAVSI--PF--LGEIPQD----------------K-----EAA
A0A3E5BU42      I-LFMDTRVRSRKDLK-GAVSI--PF--LGEIPQD----------------K-----EAA
R7CUW4          V-LFLDTRVHGRKDIE-KAVSV--PF--LGEIPLD----------------K-----EAA
A0A416GGJ1      I-LFLDTRVHGRKDLE-GVVTA--PL--LGEIPLD---------K----KLA-----KKK
D1JY72          F-LFFDTRIRNRKDIE-DAVTV--PF--LGEIPKDSS-------K----RKI-----ENK
A0A7G5NJU1      I-LFMDTRVHSRKDLK-GAVSI--PF--LGEVP------------------Q-----DKE
D7J4K6          I-LFMDTRVHSRKDLK-GAVSI--PF--LGEVP------------------Q-----DKE
Q8ABP9          I-LFMDTRVHSRKDLK-GAVSI--PF--LGEVP------------------Q-----DKE
D6D2Z5          I-LFMDTRVHSRKDLK-GAVSI--PF--LGEVP------------------Q-----DKE
A0A1T3EDR4      R-LFLNTTVKSREEIE-SALNI--PF--LGEIPYS----------------R-----SKS
A0A6N8KXI9      M-LMLDTKVRGKGDLE-NGLSI--PV--MGEIPLA----------------------DNK
A0A174SDD8      M-LILDTGVHNRKEVE-SIVSA--PF--LADIPQT----------------P-----KAM
A0A1H7RFH3      M-LMLDTGVHNRKEIE-SIVSA--PF--LADIPQT----------------P-----KAM
A0A139L1N2      M-LMLDTGVHNRKEIE-SIVNA--PF--LADIPQT----------------P-----KAM
A0A174TVL8      M-LMLDTGVHNRKEIE-SIVSA--PF--LADIPQT----------------P-----KAM
A0A1H8BJR6      M-LMLDTGVHNRKEIE-SIVSA--PF--LADIPQT----------------P-----KAM
R9H6G0          M-LMLDTGVHNRKEIE-SIVSA--PF--LADIPQT----------------P-----KAM
A0A412GR09      M-LMLDTGVHNRKEIE-SIVSA--PF--LADIPQT----------------P-----KAM
A0A7J5JXN6      M-LMLDTGVHNRKEIE-SIVNA--PF--LADIPQT----------------P-----KAM
A0A081PBV5      M-LMLDTGVRSRKDIE-EVLSV--PF--LGEIPFT-----------------------LK
A0A1I2AN85      M-LMLDTGVRSRKDIE-EVLSV--PF--LGEIPFT-----------------------LK
A0A4U0GMP3      M-LLLDTGVRNRKDIE-GAVTT--PF--LGEIPFS---------------DK-----RRR
A0A1H6CKR6      I-LMLNTKIRYRKDIE-DNISV--PL--VGEIPFS----------------T-----DLK
A0A235E1C0      M-LLLNTKIRNRKDIE-DAVSV--PF--LAEIPFS----------------T-----EMK
R6D982          I-LIVDTRVRNRKDME-AVVSA--PF--LAEIPKS----------------A-----EKV
A0A1F0I8C4      I-LVLDTRVHSRKEIE-ASVSA--PF--LADIPQV----------------S-----KTE
A0A3A5RIJ2      I-LVLDTRVHSRKEIE-ASVSA--PF--LADIPQV----------------S-----KTE
A0A515IZJ5      I-LVLDTRVHSRKEIE-ASVSA--PF--LADIPQV----------------S-----KTE
A0A7J4Y2H6      I-LVLDTRVHSRKEIE-ASVSA--PF--LADIPQV----------------S-----KTE
A0A0D5BSQ0      M-LMLNTGVRGRQDLE-DVLSV--PF--LGEIPLM----------------R-----SRK
A0A1T3F6P5      M-LMLNTGVRGRQDLE-NVLTV--PF--LGEIPLA----------------K-----GRR
A0A0W8EPA0      M-LMLNTGVRGRQDLE-NVLTV--PF--LGEIPLA----------------R-----GRR
A0A365UKN1      M-LMLNTGVRGRQDLE-NVLTV--PF--LGEIPLA----------------R-----GRK
A0A4R6WE41      M-LMLDTGVRSRQDIQ-KVVTA--PF--LGELPM-----------------------EKK
A0A2T5RP38      M-LVLNTGVRGRQDLE-NVLSV--PF--LGEIPLA----------------R-----GRR
A0A1A6CF06      L-LLLNTAVRGRQDLE-NVLSV--PF--LGEIPLA----------------R-----SRR
A0A1T3D6S8      L-LLLNTAVRGRQDLE-NVLSV--PF--LGEIPLA----------------R-----NRR
A0A1P8E011      L-SILDTGVRRRQDIE-EAIDV--PL--LGEIPLA----------------T-----NKR
A0A1V3N3U3      L-LVFNTGVRSRQDVE-TVLSV--PF--LGEIPLS----------------K-----RKS
C2FUH6          L-LIFNTGVRGRQDIE-SVLDI--PF--LGEIPQA----------------G-----KRK
A0A0B8T471      L-LLLDTKVNGRKDIE-EAVSV--PF--LGEIPFS----------------K-----QTI
A0A4R7D2K0      L-LLLDTKVNGRKDIE-EAVTV--PF--LGEIPFS----------------R-----QTM
A0A2X2J8S4      M-LVVDSGVRNRKDLE-EGLSV--PF--LGEIPLA----------------K-----KNK
A0A3C0S618      L-LIVDSGVRNRKDLE-DGLSV--PF--LGEIPLA----------------K-----KNK
A0A4P7DRF9      M-LLFNTKIRNKRDIE-SEVSI--PF--AGEIPFS----------------T-----DMQ
A0A239XXC4      M-LLLNTKVRNRKDIE-DAVSV--PF--LAEIPFS----------------T-----EMK
A0A4U9K473      M-LLLNTKVRNRKDVE-DAISV--PF--VGEIPFS----------------T-----EMK
A0A2T4XEQ1      R-EFLNRTIDGLDKLK-GSGY---PI--LAVIPDFTEYVKKKYEEKSKVAVK--------
A0A2K8ZAP1      K-DTVNNHVLRRSDVE-EVTQI--PI--IGEVIKERQ-----------------------
A0A3M1Y2F5      L-SYFSDKVSTYQELK-KATPI--PV--LGTVIKNDD-----------------------
A0A3D4RLG4      I-ELIYNKLRIPKEVE-RLSSF--PL--IGSLRHVRS-----------------------
A0A2T2UAJ4      R-EQLDTRIYQPDDLR-EHGHH---V--LGVVPSMTPLIDDEFGGQETIEID--------
A0A6I0DZQ5      K-ELLNVRIMTNRDVE-KYSSF--PL--IGMIRHTNS-----------------------
A0A3D3LSK1      R-IYFNKNLSTPEELE-SKGVSLLSW--IPNIEQITD-------KSD-------------
A0A496L711      K-ELLNNAIRTEKDIE-RATKNRFQI--IGSVRHTKH-------K---------------
A0A1H6Z2F8      G-QIFNNKITSKDDIS-RQCDV--TI--IGEISQQSR-------ADR-------------
A0A2P8G5K0      S-QIFNNKITSKEDIQ-RQCDV--MI--LGEISQQSR-------TGL-------------
R5DEG6          L-MVSDTKVRSRKDVE-GVLSV--PF--LGEIPMRDK-------K---------------
A0A4Q3SEI4      K-ELLTHKVQFRHDIE-RLTTI--PV--VAEVIKVKA-----------------------
A0A348PT57      R-YILNNDISGVHDLS-RLMNPRISL--LGVVPKYSK-------N-I-------------
A0A7C3PTI0      R-YILHNDINSLNEIT-KMTNASISV--LGIVPRYKK-------E-I-------------
A0A5Q4EKA0      K-YLFYNEIPSLHDIL-KYTQA--PV--IGVIPKYKS-------E-I-------------
A0A519SYE7      R-YLMHNTITSVQELE-RGTRA--AV--LGVIPTYDK-------EKL-------------
A0A7C7CFR2      S-YLLHNEITSVNELT-SGGRK--SL--LGIIPSYTK-------D-I-------------
A0A3N2LCI3      M-ESNNTKVRGRKDVE-HLAV---PF--LGELPQDGH-------EKK----K--------
A0A6H9Q899      R-ENMNTRVRGRKDLE-NVTV---PF--IGEIPLFTR-------KKKGIFGK--------
A0A3D4CJE1      K-YLFHNEITSVADIT-QEGKAKLGV--LGVIPKYKK-------E-I-------------
A0A7C7LI79      S-YLLHNNIISITDIS-KQTSA--AI--LGVIPTYKK-------D-I-------------
A0A4Q5ZQ60      R-YFLHNTITNLKELE-RNTMA--PL--LGIVPSYTK-------EKL-------------
A0A519Q885      R-YLMHNTVTSVAELE-RNTKA--TV--LGVIPSYTK-------EQM-------------
A0A519TAP8      R-YLMHNTVTGVAELE-RGARA--AV--LGVIPTYDK-------EKL-------------
                                                                            

A0A1T4NDR5      ---ENKMLKDLISIYDSS-NP-ATEAYRALRTNI--------MYK---NFD----APIKV
A0A3D5KRM7      ---AEVLQDNRIIMGLYN-DQ-RADLFRVLRTNI--------LKQ---LRE----NNWNS
A0A3M1NUH2      -----------------M-SP-VVESYRHLRTNI--------QFS---RPD----TVVET
A0A7C1IBE4      ---TENWDERLVHAIETF-SG-VAESFRKLRTMI--------LHP---ESG----EPPRS
A0A2T2TDL4      --------------------------------------------LQLGRPD----ETNTT
A0A359ATS6      -----------------R-DV-INEAFRVVRTNL--------EFM-DGSGE----PDSNV
A0A2E0MDX6      ---------------------------------M--------QFI---ANN----EGSKI
A0A2M7KCE1      -----------------------SEAFRSVRSSL--------EFI---KNI----KESKT
R7JFY1          ---LEKNQEKLVVKEGSR-DA-VSEAFRILRANM--------DFM--RGGD----EHMQV
A0A1V5S5I3      ---KVHNAKKIVIRQGNR-DI-VNEAFRVLRTNL--------EFMLDAKTG----GKAGV
A0A2M7VVW6      ---IPISQ--LVINRDPK-SV-ISEAFRTIRTNL--------QFI--S-KS----EESKL
A0A413V760      ---KGEDSDGIVVRENSR-DS-VSEAFRIIRTNM--------DFM--RVKA----ANLQV
A0A656PYT8      ---TRQGS--VVVRDNGR-DS-VSEAFRLIRSNL--------GFM--SVKS----GKLQI
A0A1V6HYH8      ------------------------------------------------------------
A0A523GUD4      ---SPITDIEHLKEARND-TP-GNAEIMRLLSKL--------DTF---RNG----THKQT
A0A3D1AEJ6      ---------------------------------M--------DFM--RVKQ----DNIKV
A0A7K3KYQ2      -----------------------------LRTNV--------EFM--CNSS----EGNKV
A0A641X2Z6      -----METITLIADRDAK-SP-VAEAYRTIRTNI--------QFS---NVG----QELKT
A0A6L8U2P8      ---SNNLKSEAVVAEYPK-SA-IAESFRNLRSTL--------FLK---SDH----EKSKV
A0A7C6G639      -------------------------MFRVIRTRI--------EFI---VQR----KSKIM
A0A519PJW5      ------------------------EAIRSIRTNL--------DFI---SPS----NKKRL
A0A519T3R9      ---EQMSVSRLVVDKNPK-SS-VSEAIRSIRTNL--------DFI---SPA----SKKRL
A0A7C7CKY6      ---DI-PVSQLLVNQNSK-SL-IAESFRAIRTNL--------QFISNE-------PGSKI
A0A1G1TG88      ---EKMEVSRLVVNDNPK-SA-ISEAIRSIRTNL--------DFISSA-------KKKRL
A0A661XXA6      ---AK-EHAKIIVNEHPK-SA-LSESMRSIRTNM--------QFMLPE-------TKSKV
A0A519SD85      ----------LILQEAPR-SL-FSESLRSLRSNL--------FSLIN--------KDCNM
A0A3M1TXY5      ---RYEKSNNYIIEKDSR-TS-FAESFRSLRVKM--------LFVVEG-------DKKKV
A0A2E0VQ27      ----------RLTRKTPP-GFSLVSGLTANLRDL--------PKPETK-------GQAQL
R6U429          KKMCDDANTKIVVAPSNR-NS-INEAFRVLRTNL--------DFMTGGQ------EGCHK
A0A5C8AF42      ---SEMEFSQLVVHESPK-SM-LAESMRKIRTNL--------SYIK---------PDYKT
A0A353WYK7      ---KGRDSDRLVIDKVPK-SE-ISEAFRSIRTNL--------EFIKRT-------DKNTV
A0A355BP94      ---RRNTTSPFYIVENPR-SI-VSEAIRTLRTNL--------DFFTSS-------ETNKI
A0A136LSC7      ---HHTVQSLFHVIDNPK-SI-VSEAIRTLRTNL--------EFFNTG-------EKCKV
A0A5C7N8Q5      ---NHTVQSLFHVIDNPK-SI-VSEAIRTLRTNL--------EFFNTG-------EKSKV
A0A239K409      ----------IVVSESSK-TA-IAELFRLIRTNL--------QFVVQG-------GERKV
A0A1V5S1J9      ---DRKT--PVIVDKYPK-SA-ITEAFRVIRTRI--------EFLSGK-------SKGIS
A0A0A2EYC8      ---KHKADEKVIAAKYPN-SY-FVEQLRVIRTKI--------ELILKR-------KERIT
A0A2G6H6Y4      ---KHKTEDKVIAPKYPN-SY-FVEQLRVIRTKV--------EIILGR-------KEAIT
A0A1M3DPL8      ---NSTD--PYLIVNNPR-SS-FTEMFRIIRTRI--------EFIAKR-------KTDIT
A0A1V5F519      ---KNDL--PDLTLKNPK-SS-FTEMFRVIRTRV--------EFVVRR-------KTDIV
A0A2G6R1T9      ---KKAN--PLLTLKHPR-SS-FTEMFRVIRTRI--------EFIVQR-------KTGIM
A0A350V3E4      AGRHTHTEQELVLAYNSD-SV-PAEAFRTLRTRL--------QFSKLEP------EPIKT
A0A6J4K208      ---EKAGNYLVAYSSKSA----LAESFRSLRVNL--------QYLFLD-------TGKKV
A0A2W4RDE8      ---SRREQSNVVANALSP----VGESFRSLRVNL--------QYLTLG-------KEVNV
A0A0L8VEV2      ---SGIGSEYLAAIDNPR-SA-IAESFRELRTNL--------QFIVPGLK-----NKSLV
A0A1I2A9Z9      ---TGIGAEFLAAIDNPR-SA-IAESFRELRTNL--------QFVAPKKN-----NECTI
A0A212J9Z9      ----------VLVKNYPK-SS-FAESFRNMRVRI--------EYMAQR-------ENKIT
F5IV23          ----------VLVKNYPK-SS-FAESFRNMRVRI--------EYMAQR-------ENKIT
F8X2T0          ----------VLVKNFPK-SS-FAESFRNMRVRI--------EYMAQR-------ENKIT
A0A1M3LAG1      ----------VLVKNFPK-SS-FAESFRNMRVRI--------EYMAQR-------ENKIT
A0A212K6G4      ----------VLVKNFPK-SS-FAESFRNMRVRI--------EYMAQR-------ENKIT
A0A4Y9IPG7      ----------VLVKNFPK-SS-FAESFRNMRVRI--------EYMAQR-------ENKIT
A0A1M5DFS8      ----------TLVKNFPK-SS-FAESFRNMRIRL--------EYMAQK-------ETGIS
A0A4Y8KZS5      ----------TLVKNFPK-SS-FAESFRNMRIRL--------EYMAQK-------ETGIS
A0A2V3PNY7      ----------TLVKNFPK-SS-FAESFRNMRIRI--------EYIAQK-------ETGIS
A0A6G7X5K8      ----------TLVKNFPK-SS-FAESFRNMRIRI--------EYMAQK-------ESGIS
A0A2P8CDS1      ---DQAAISHTALLDHPN-SP-VGETYRALRMKL--------KFMLNG-------TEQPV
A0A660LQT8      KLPQRLDKNEVVVKPQNA-NI-INEAFRVLRSNF--------EFCTNKF------GKGAV
A0A389LWV6      ---HTERKEMMVLYKYPK-SS-FAENFRHLRSRM--------IYLTKR-------DSPIV
A0A1G9B1T9      ---RLRRKENALVYSRPR-SA-AAESFRTIRSNL--------LLQNHVN------GASKT
A0A350PNH9      FWKKPKETLQIVVKAGKR-DI-VNEAFRVLRTNL--------EFMIGTH------PEQNV
A0A354LNT9      FWKKPKETRQIVVKAGKR-DI-VNEAFRVLRTNL--------EFMIGTH------PEQNV
A0A161LWY6      ---ATHDDATITVLKRPK-SA-IAEAYRMVRTRI--------KFVSRQ-------MDASC
A0A6I3N9U6      ---ATHDDATITVLKRPK-SA-IAEAYRMVRTRI--------KFVSRQ-------MDASC
A0A3D0FMX4      ---HTRGSNPTEVVDHPR-SS-YAEQLRALRTRI--------EFVVRR-------KTGIM
A0A1M3MEI8      ---HTNSDNPFIVAANPR-SS-FTEMFRIIRTRI--------EFITQR-------KDKIT
A0A1J5HQM0      ---HTNSNDPLITINNPR-SA-FTEMFRVIRTRI--------EFIVQR-------KKNIM
A0A653AC35      ---HTQNKDPMLAAHRPR-SS-FTEMFRVIRTRI--------EFIVQR-------KTNIS
E4T131          ---HTKSTDPLVVSKNPR-SA-YTEMFRIIRTRI--------EFIVQR-------KTNII
A0A2W7RD29      ---EGKTNVQLVDYPNSK----VAESFRLLRTNL--------NFILPN-------SESTV
A0A3N2NDY8      AKKNSKELERVVVAVKEGSRDAVSESFRIVRGNI--------DFMIRGK------EGGNV
D7JEV9          ---KHKADERVIASKYPN-SY-FVEQLRVIRTKI--------EFILKR-------KEKIT
A0A4R6H3B7      ----------LAAIDNPR-SA-IAESFRELRTNL--------QFVAPKKN-----NECTI
A0A521H707      I--PVSQ---LLVDKNPK-SA-ISESFRSVRTNL--------QFISNE-------SGPKV
A0A1F3D6P8      -----SE---AVVLEAPK-SA-IAESFRNLRSSL--------FLKLKS-------EKSKV
A0A356Z058      -----SE---AVVLEAPK-SA-IAESFRNLRSSL--------FLKLKS-------EKSKV
A0A3D1BT36      -----YE---DVVHKAVG-SP-IAESFRNLRSNL--------FFRSKT-------NPLKV
A0A5R9QZP0      -----TE---NVNTEFPN-SS-LAESFRNLRTNI--------FLKFKS-------KPLKV
A0A3D3HL11      -----TE---SVVKDYPG-SS-IAESFRNLRSSL--------FLKFRS-------EPQKV
A0A6L8U6G9      -----SE---SVVKDYPG-SS-IAESFRNLRSSL--------FLKFRS-------EPHKV
A0A352ME00      -----SE---AVVAEFPK-SA-ISESFRNLRSSL--------FLKSDH-------EKSKV
A0A6L8UH35      -----SE---SVVAEFPK-SA-VSESFRNLRSSL--------FLKAGH-------EQSKV
A0A3P1Z8V4      ---KKTTDQTLVYDVDTDQNSPSAEAFRLLRYGL--------HFMN---------RTAKV
A0A1M6MYT6      ---RKESESHTLVLDKPN-SP-ASEPYSAIRTKL--------ELITKG-------KEHAV
A0A2W7QSQ0      V---------IAISPKSI-SP-AAEQLRMIRSNL--------KFQSG--------DNNKV
A0A3D5KRY6      S---------------------IAESFRGIRGNL--------EFLFND-------SPRKV
R7F6L5          LGKDSSSERQVVVRADST-NV-INEAFRVVRTNL--------DFFLTSDK-----KGAQV
A0A7C5MRV2      L---------LKSVEHPK-SS-LSESIRAIRTNM--------QFINSEKE-----EGSKI
A0A229I3A5      FWKKPKEVRMIVVKAGKR-DI-VNEAFRVLRTNF--------EFTIGTH------PEQNV
A0A3R6HJB3      FWKKPKEVRMIVVKAGKR-DI-VNEAFRVLRTNF--------EFTIGTH------PEQNV
R6NN15          ---TPLTETKVVVKEGSR-DV-VNEAFRVLRTNL--------EFVSGEN------GKGQV
A0A553GA49      ------------IFEPSNEDAVVAESFRKLRTNL--------GFWPWKDT-----LEGRV
A0A497D6F6      D--YKGN---TLILDKPG-SP-ASEQYRSVKNKI--------NFISGK-------KSNPV
A0A5M4AAB9      V--LPSQ---IPLLEHPN-SP-LGESYRALRTKL--------KFIQNG-------NEHNV
F4KR18          ----KKQ---HSLLSKSQ-NT-LTERFRTLRTNL--------QFHQRE-------KTKSI
A0A2M6GH67      L--LVSK---LIVHKNPK-SA-ISESIRSIRTNL--------DFISSA-------KKKRL
A0A7K1TE30      L--EVSR---LVVDKNPK-SS-VSEAIRSIRTNL--------DFISPS-------TKRRL
A0A7D4BE70      L--DVSR---LVVDKNPK-SS-VSEAIRSIRTNL--------DFISPS-------TKKRL
A0A142HHS5      L--NISR---LIVDKNPK-SS-VSEAIRSIRTNL--------DFISPS-------NKKRL
A0A7D4C435      L--HISR---MVVDKNPK-SS-VSEAIRSIRTNL--------DFISPS-------SKKRL
C9LKL0          ----------GLITTCSS-DAPIVEAFRMLRYGL--------NFMR---------HSAKV
A0A3D0QPV7      I--PVSQ---LIVDKNPK-SL-ISEAFRTIRTNM--------QFLTAD-------KDAKL
A0A496KT23      I--VAAPN--MVVADQKR-DI-LNEAFRTVRTKL--------EFTLGFD------GRNKV
L1M9T3          I--VAQPN--MVVADQQR-DI-INEAFRTVRTKL--------EFSMGFD------NGCKV
A0A3C0I8F1      Q--KNAKYSKLVILDNPK-ST-INEALRSVRTNL--------DFVLNKSGGLNDTSTSKV
R5JJI4          R--KGEDTDAIVVHESGR-DS-VSEAFRIIRTNM--------EFMRVKS------DNLQV
A0A0A2DQN2      K--KGG--EGIGVSEQGT-DL-TSEAFRILRSNM--------DFM-GQNG-----VMPKR
A0A0A2F2N5      N-------LFVAVEPQGS-DA-ITEAFRVLRTNM--------GFMKKYGR-----TSGQR
L1NGW4          P--GRK--QPRGAREQGS-DE-TSESFRVLRENL--------RFMIGSGD-----TPSKK
Z4WRA0          P--GRK--QPRGAREQGS-DE-TSESFRVLRENL--------RFMIGSGD-----TPSKK
U2K8K9          ----AKSGHTRGVREQGG-DE-TSEAFRVLRENM--------RFMIGSAA-----GKTKK
A0A069ZM60      R--GGKKSQPRGVREQGG-DE-TSEAFRVLRENM--------RFMIGTGG-----KKAKK
J6GV98          R--GGKKAQPRGVREQGS-DE-TSEAFRVLRENM--------RFMIGTGG-----KKAKK
A0A134B4F8      R--GGKKSQPRGVREQGS-DE-TSEAFRVLRENM--------RFMIGTGG-----KVAKK
A0A134B8C7      R--GGKKSQPRGVREQGS-DE-TSEAFRVLRENM--------RFMIGTGG-----KVAKK
A0A3D2HF71      ----------PAVEHTG--SS-LAESLRSVRTNL--------KYFMKD-------ISNPV
A0A4Z0EKR0      E--S------VVVTNGNR-SP-IAEMFRLIRTNL--------HFAAVG-------RKKTV
B5CTK0          D--D------IIIHENGR-DS-ISEAFRIIRTNM--------DFMRMKK------DNMKV
A0A1M6B6D5      H--SETV---LAVLSKPK-SA-IAEAFRSLRSSL--------QFLYKQQG----ITGAKT
A0A451FS66      H--SGNI---LAVLSHPK-SA-IAEAFRSLRSSL--------QFLYKQHG----VTGAKT
A0A2E3GN39      L--PMSS---IVVTNRPK-SG-ISESFRGVRSNL--------EFLD-AD------KGFRS
A0A3D1MEL0      L--PMSS---IVVTNRPK-SG-ISESFRGVRSNL--------EFLE-AE------KGFRS
A0A519UDD1      T---------VVVARESR-TP-IAEMFRLVRTNL--------NFVA-IG------REKTV
A0A2A4N9A6      M--PISQ---LVVEKNPK-AG-ITEALRSLRANL--------QFIS-TN------PGPKI
A0A6C0GGI1      N--GI-----LAKTDNHK-SA-LSEAFRSLRVNL--------QYLA-AG------MDQKA
A0A368D1N7      L--PVSS---IVVTNRPK-SG-ISESFRGVRSNL--------EFLE-EE------KGFRS
A0A3B8TU58      L--PMSS---IVVTNRPK-SG-ISESFRGVRSNL--------EFLA-AE------KNFRS
A0A1T5IIR6      Q--GHDDPSPFVYDPTSH-TV-FTEAMRMLCTNL--------SFLDSGK------KAPFV
A0A3E0QD27      I--PVSQ---LLVDKNPK-SA-ISESFRSVRTNL--------QFIS-NE------PGPKV
A0A6N8DCX3      D--EKR----IVVKEGSR-NA-MNEAFRVLRTNM--------EFMSGNG--------TEV
F0R0C9          D--APRG---IVVKQGKR-NI-INEAFRVLRTNL--------EFMTSEN------EKANV
A0A0M1W1I6      K--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A4R4GHU2      K--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
I8WPR6          K--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A0K2HKS3      K--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
B6W3W8          K--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A7M3EEL4      K--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A076IRY8      E--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A3A6AD54      E--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A3A6MIU7      E--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
I8WPP8          E--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A372Y7D2      E--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A7K3KFI2      E--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A3E4JJC9      E--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A3E4WDQ0      E--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A414H9P2      E--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A7K0JKU9      E--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
C3R5A8          E--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A1C5XJA7      S---SRK---GAANAYGYGDNVVTEAFRILRTNM--------SFMAKKD------RPLQV
A0A285T4L1      K----------TGVAVGRDDGMLSESFRILRTNM--------AFMAKKD------KPMQV
A0A3E5BU42      K----------TGVAVGRDDGMLSESFRILRTNM--------AFMAKKD------KPMQV
R7CUW4          R--QHGR---TAKASVGQDDSIVSEAFRILRTNM--------AFMSRKD------RPTQV
A0A416GGJ1      K--TVHG---PRLFLDKQDDI-IAEAFRILRTNM--------AFMAKKG------VPVKV
D1JY72          K--TAHG---IAVRAQGR-DI-VSEAFRIIRTNM--------DFMRVKS------KNMQV
A0A7G5NJU1      A--AKAG---VAVGEED--GM-LAESFRILRTNM--------TFMVKKD------KPMQV
D7J4K6          A--AKAG---VAVGEED--GM-LAESFRILRTNM--------TFMVKKD------KPMQV
Q8ABP9          A--AKAG---VAVGEED--GM-LAESFRILRTNM--------TFMVKKD------KPMQV
D6D2Z5          A--AKAG---VAVGEED--GM-LAESFRILRTNM--------TFMVKKD------KPMQV
A0A1T3EDR4      E--SGMG---VFVYHTGK-DA-LSEAFRILRTNI--------TFMVNSG------ISPQV
A0A6N8KXI9      K--STSD---VKVFENGR-DP-LTESFRILRTNL--------SFMSPES------QGAKV
A0A174SDD8      A--NVHE---VVGRARGL-DA-LSESFRILRTNL--------GFMLSQT------QERKV
A0A1H7RFH3      A--NVHE---VVVRARGL-DA-LSESFRILRTNL--------GFMLSQT------QERKV
A0A139L1N2      A--NVHE---VVVRARGL-DA-LSESFRILRTNL--------GFMLSQT------QERKV
A0A174TVL8      A--NVHE---VVVRARGL-DA-LSESFRILRTNL--------GFMLSQT------QERKV
A0A1H8BJR6      A--NVHE---VVVRARGL-DA-LSESFRILRTNL--------GFMLSQT------QERKV
R9H6G0          A--NVHE---VVVRARGL-DA-LSESFRILRTNL--------GFMLSQT------QERKV
A0A412GR09      A--NVHE---VVVRARGL-DA-LSESFRILRTNL--------GFMLSQT------QERKV
A0A7J5JXN6      A--NVHE---VVVRARGL-DA-LSESFRILRTNL--------GFMLSQT------QERKV
A0A081PBV5      D--KGGE---AVVEEKGR-DY-TSEAFRILRTNI--------GFMA-AG------KEQRV
A0A1I2AN85      D--KGGE---AVVEEKGR-DY-TSEAFRILRTNI--------GFMA-AG------KEQRV
A0A4U0GMP3      S--KEGN---LVIEAQGG-DP-VTEAFRILRTNI--------GFMASAD------KTLQV
A0A1H6CKR6      T--AKSD---IVIKEQGT-DE-VTEAFRIFRTNL--------GFMSAGD------KSQKV
A0A235E1C0      S--AKSE---IVIKEQGV-DE-VTEAFRIFRTNL--------SFMSSGD------KKQKV
R6D982          T--EIND---IMVRARGQ-DA-LSESFRILRTNL--------GFVASQS------PGQKV
A0A1F0I8C4      A--DAQE---VMVRARGL-DP-LSEAFRILRTNL--------GFMISQP------QEQKV
A0A3A5RIJ2      A--DAQE---VMVRARGL-DP-LSEAFRILRTNL--------GFMISQP------QEQKV
A0A515IZJ5      A--DAQE---VMVRARGL-DP-LSEAFRILRTNL--------GFMISQP------QEQKV
A0A7J4Y2H6      A--DAQE---VMVRARGL-DP-LSEAFRILRTNL--------GFMISQP------QEQKV
A0A0D5BSQ0      Q--GKSD---VLVSKSGR-DP-LTEAFRILRTNI--------NFMAKNG------EPPRV
A0A1T3F6P5      Q--GNGD---ILVSQSGR-DP-LTEAFRILRTNI--------NFMTKDE------HPPKV
A0A0W8EPA0      Q--GNGD---VLVSQSGR-DP-LTEAFRILRTNI--------NFMTKDE------HPPQV
A0A365UKN1      Q--GNGD---VLVSQSGR-DP-LTEAFRILRTNI--------NFMTKNE------HPPKV
A0A4R6WE41      Y--DDKG---IAVSKTGR-DP-LTEAFRILRTNI--------NFMAING------APPQV
A0A2T5RP38      Q--GKGD---ILVSGSGR-DP-LTEAFRILRTNI--------NFMTKDD------APPKV
A0A1A6CF06      Q--GKGD---ILVSKTGR-DP-LTEAFRILRTNI--------NFMTKDE------HPPKV
A0A1T3D6S8      Q--GNGD---VLVSQSGR-DP-LTEAFRILRTNI--------NFMTKDE------HPPKV
A0A1P8E011      T--SQNN---ILVSAMGR-DP-LTEAFRILRTNM--------SFMAREG------KHPQT
A0A1V3N3U3      E--QHAV---FRVEKTGR-DP-LTEAFRILRTNI--------NFMSREG------RAPQV
C2FUH6          T--DSNK---VLVSKTGR-DV-LTEAFRIIRTNI--------GFMSRNG------NSPQV
A0A0B8T471      R--ANDD---VVVNEQGR-DP-ATEAFRILRTNI--------GFMSSAE------REIRV
A0A4R7D2K0      R--ANDD---VVVNEQGR-DP-ATEAFRILRTNI--------GFMSSAE------REIRV
A0A2X2J8S4      H--TVGN---VSVSQTGR-DA-LTEAFRILRTNI--------NFMSRGG------VPPKV
A0A3C0S618      H--TVGN---VSVSQTGR-DA-LTEAFRILRTNI--------NFMSRGG------VPPKV
A0A4P7DRF9      S--AKQE---VVVKEQGT-DE-VTEAFRIFRTNL--------GFMSSGD------KEQKV
A0A239XXC4      T--AKSD---IVIKEQGV-DE-VTEAFRIFRTNL--------SFMSSGD------KKQKV
A0A4U9K473      S--AKSE---IVIKEQGV-DE-VTEAFRIFRTNL--------SFMSSGD------KSQKV
A0A2T4XEQ1      ---GRLVSTNWFSLLDNI-SP-VTESYRRLHNNI--------IYSQPDL------E-VKT
A0A2K8ZAP1      -----LGTESFVFKSRMH-SV-IGEQIRALRTNL--------LFLNGDA------QKNQV
A0A3M1Y2F5      -------GLEVIKQSTSY-SP-LAECFRAVRVHIYNKLTNKREKIDVSE------R-GIL
A0A3D4RLG4      -------QNPTLVQKNPR-SS-YTEMLRTIRTKI--------EFIVGRK------Q-NIV
A0A2T2UAJ4      ---GRSVNTLLAMLVSPM-SA-AAEAYRRIRTNL--------RFAKPDD------D-LQT
A0A6I0DZQ5      -------DNPFIVAANPR-SS-FTEMFRIIRTRI--------EFITQRK------D-KIT
A0A3D3LSK1      ------PTNDFIVAKKPS-SQ-ISEAFKALRTRI--------TFSKLED------KPLKT
A0A496L711      ------ADERVIASKYPN-SY-FVEQLRVIRTKI--------EFILKRK------E-KIT
A0A1H6Z2F8      -----------LSRNNVR-SL-LREQFRSLRTNI--------QFVVGER------Q-NTV
A0A2P8G5K0      -----------LKVADNR-SL-IKEQFRSLRTNI--------QFTTGER------P-HMV
R5DEG6          ------DKNEVVVHENGR-DS-VSEAFRIVRTNM--------DFMRVKE------KNMQV
A0A4Q3SEI4      ------KTADVYNNTKRQ-LS-FIEQFRQLRASV--------ALNGRKL------K-YRR
A0A348PT57      ------PLSQLIIDKNPK-SV-MAEAFRTLRTNL--------DFFQTDN------E-KKI
A0A7C3PTI0      ------PVSQLLVDKNPK-SL-IAEAFRSIRTNL--------QFISNEP------G-SKL
A0A5Q4EKA0      ------PPNQLLVLKKPK-SL-ISESLRAIRTNL--------QFINNDP------G-PKL
A0A519SYE7      ------EVSRLIVDKNPK-SS-VSEAIRSIRTNL--------DFISPAG------K-KRI
A0A7C7CFR2      ------PVSQLLVDKHPK-SL-IAEAFRSIRTNL--------HTSNSDP------G-PKV
A0A3N2LCI3      ---EAGEANTIVVKGGKL-DI-INEAFRVLRTNV--------EFMCNSS------EGNKV
A0A6H9Q899      ---KPQEVKAVVVKEGSR-DI-INEAFRVLRTNL--------EFMTGKD------KTSNV
A0A3D4CJE1      ------PVSQLIIDKNPK-SV-ISESFRTIRANL--------QFISNKP------G-SKV
A0A7C7LI79      ------PITLLLVDKNPK-SL-IAEAFRSIRTNL--------QFIDGSE------G-PKI
A0A4Q5ZQ60      ------PVSRLIVDLSPK-SA-ISESIRSIRTNL--------EFISSSA------K-KRI
A0A519Q885      ------SISRLVVDKNPK-AS-VSEAIRSIRTNM--------EFINAAN------K-KRL
A0A519TAP8      ------EVSRLVVDKNPK-AS-VSEAIRSIRTNL--------DFISPSN------K-KRI
                                                                            

A0A1T4NDR5      INITSATQGEGKSTTCLNLAVVFSQLNKK-VLVMDLDLRIPTIHKKLRIRNT-----MGI
A0A3D5KRM7      FFITSATPGAGKSWVATNLAIAIALEGNQTVLLVDADLRHPSICNHLGLNCK-----FGL
A0A3M1NUH2      IVVTSPSVEEGKSTTAANLAVVMAEAGRR-TVLIDADLRRPRVHQLFGRELG-----PGL
A0A7C1IBE4      VMVVSCDPQEGKSFVCANLGVSFAHSVKEQALVIDCDLRRPSLQSLFGLKHA-----RGL
A0A2T2TDL4      VLVTSPGSGDGKSLTAANLATVTAQAGHS-TLLIDGDLRRPRLHEVFDVSRT-----PGI
A0A359ATS6      LMLTSFNPGSGKTFLTMNMAISLAIKGKS-VLVIDGDLRRGSISDYVDTPKI------GL
A0A2E0MDX6      ITVTSTISGEGKTFVAINLGGIIAFSEKK-VIILDLDMRKPKTHIGFNVQNT-----IGM
A0A2M7KCE1      IAISSTISGEGKTFIALNLGGIYSFQGKK-TILIDLDLRKPRFHLCFNTDNS-----KGL
R7JFY1          LLFTSMNAGAGKTFISSNLAASLVLTHQK-VVLLDLDIRKGTLGKQAGYRGE------GI
A0A1V5S5I3      TLFTSFNPGSGKTFLAMNTAAVFALKGKR-ILVIDGDLRHGSASAYLGSRHK------GL
A0A2M7VVW6      MAITSTISGEGKTFCAINLSGIIAMSGKK-VIILDLDMRKPKIHLGFGVKND----K-GM
A0A413V760      VMFTSANPGAGKTFVSSNLAMSIAQTNKK-VVLVDVDIRKGTLSGIFSNSSN----RMGL
A0A656PYT8      IMVTSSNPHAGKTFVTTNLAMTLALADKK-VVIVDLDLRRRTLSKQMGQRDN----RNGV
A0A1V6HYH8      --MTSTISGEGKTFVAINLGGILALSNKK-VLIIDTDLRRPKMSITFNNLND-----FGL
A0A523GUD4      VMITSALSGEGKSTISTNIAIASSRNRQRPSLIIDFDLRRPRLHHIFKVDKE-----PGV
A0A3D1AEJ6      ITTTSTSVGSGKTFVSSNLAASLAMTGKK-VLLMDMDIRKGTLGKGVDTHKNIEGYDIGL
A0A7K3KYQ2      IAMTSFNPGSGKSFVSMNLGMAIALKGKK-VLIVDGDMRHGSTSAYMGSPAR------GL
A0A641X2Z6      IIVTSATPNEGKSTTISNLAVVMAQAGHK-VLLMDCDMRNPTQHKLFKLTN------KGL
A0A6L8U2P8      ILITSSQPQDGKSFVSLNLASSIASVGYK-TILVDCDLRRPTLHIKLKEDNS-----RGL
A0A7C6G639      LLITSAEFSDGKTYFCTNLASTYGMTGLK-TLLIDMDIRKPSINERLELSEN-----DGV
A0A519PJW5      ISVTSTISGEGKTFVTVNLGGIIALSGQR-VIILDLDMRKPKVNLAFDAENV-----RGI
A0A519T3R9      ISITSTISGEGKTFVTVNLAGIIALSGQR-VVVLDLDMRKPKVNLAFGAENI-----KGV
A0A7C7CKY6      IAITSTISGEGKTFVSMNLAGIIALANKK-VIIIDLDLRKPKIHLGFNSD----NKN-GI
A0A1G1TG88      ISVTSTISGEGKTFVTVNLAGIIAMSGQR-VIVLDLDMRKPKVNLAFGAE----NVK-GV
A0A661XXA6      YSITSTIGSEGKTFISTNMGALLAMAGKK-VIILDMDLRRPKVHKAFDKE----SSDCGM
A0A519SD85      ICITSEISGEGKSLISKNLAYAFAITGKK-VILVDADLRKPKLHESFNTG----NQ-MGL
A0A3M1TXY5      IGVTSSSSGEGKTFCATNLAATLAHAGKQ-TLLIDTDLRRPKVQTYFRTE----HH-AGL
A0A2E0VQ27      FVLSSNMPNEGKTFVSARIAKAMAAYGYK-VLLLDLDVRKPELHEELGMD----NS-DGF
R6U429          VMITSFNPTAGKTFVLMNMAATMALKGAK-VLLLDLDLRKGTLGKALEHNK------SGI
A0A5C8AF42      IAISSSISGEGKTFVALNLAGIIAMSGKK-TILLDLDLRKPKVHLGLNTN----NN-YGM
A0A353WYK7      IAITSTVSGEGKTFVTVNLGGVISLLKSK-VVLVDLDMRKPRLQKVFYHN----IQAKGV
A0A355BP94      IVISSTVSGEGKSFLAMNLGGILAMSNKK-VILLDLDMRKAKEILHARVT----DPSKGI
A0A136LSC7      ITITSTVSGEGKSFLAMNLGGVLALSRKR-VILVDLDMRKPKSEKYPTGN----DSSMGM
A0A5C7N8Q5      ITITSTISGEGKSFLAMNLGGVLALSRKR-VVLVDLDMRKPKSEKYPTGN----DSPLGM
A0A239K409      ILVTSSVSGEGKTFFSLNLGASLALTGKN-VVVLDFDLRKQSILADLGLA----CE-FGI
A0A1V5S1J9      VMVTSSQSGDGKSYISANIAGVFAMTGRK-TILVDLDMRKPSINTGL---YL--SVNKGI
A0A0A2EYC8      MLVSSTESGDGKTYISLNLAGVFALQKKK-VLLIDFDIRKPNLTRNLGD-II--KTKSGF
A0A2G6H6Y4      MLISSTESGDGKTYMSLNLAGVFGLQNKK-VLLIDFDIRKPNLTENLQESLS--KHKVGF
A0A1M3DPL8      IMVTSSESGDGKTYFCINLACIYAMASPK-TLLVDMDIRKPSVYQTI---GC--DNNMGV
A0A1V5F519      MMVTSVDAGDGKTFFSTNMAGVYGMTGHK-TLLIDMDIRKPAINRRF---NV--NHPKGV
A0A2G6R1T9      MLGTSTESGDGKTYVNINLASVYGMTGKK-TLLIDMDIRKPSVGDRL---GI--SEKAGV
A0A350V3E4      ILITSSIPREGKTIISSNLAASFALSS-R-VLLLDCDFRKPRMHNIFNMK----RY-PGL
A0A6J4K208      IGITSSGQGEGKTFCASNLSVVMAQSGKK-TLLIDADLRKPRIAARFDID----NA-AGL
A0A2W4RDE8      IGITSSRESEGKTYCSVNLAAAMANSRRR-TILIDADMRRPKVASYFQLE----ND-KGL
A0A0L8VEV2      IGVNSVIPGEGKSFTAANLASMIALNNKR-VLLIDCDLRKPSLHNRLKYK----NK-EGL
A0A1I2A9Z9      IGVNSVISGEGKSFTSANLASMIALNNKK-VLLVDCDLRKPSLHNRLKYK----NK-EGL
A0A212J9Z9      VLVTSTEPADGKTFIATNIASVYQLMGKK-VIIVDLDLRRPSVAKTLQID----SQ-KGI
F5IV23          VLVTSTEPADGKTFIATNIASVYQLMGKK-VIIVDLDLRRPSVAKTLQID----SQ-KGI
F8X2T0          ILVTSTEPADGKTFIATNVASVYQLMGKK-VIIVDLDLRRPSVGKTLQVD----AQ-KGI
A0A1M3LAG1      ILVTSTEPADGKTFIATNVASVYQLMGKK-VIIVDLDLRRPSVGKTLQID----AQ-KGI
A0A212K6G4      ILVTSTEPADGKTFIATNVASVYQLMGKK-VIIVDLDLRRPSVGKTLQID----AQ-KGI
A0A4Y9IPG7      ILVTSTEPADGKTFIATNVASVYQLMGKK-VIIVDLDLRRPSVGKTLQID----AQ-KGI
A0A1M5DFS8      VLVTSAEPGDGKTFIAGNIASVYQLTGRR-VVLIDFDLRRPSVAKLLNLQ----SK-KGV
A0A4Y8KZS5      LLVTSAEPGDGKTFIAGNIASVYQLTGRR-VVLIDFDLRRPSVAKLLNTQ----TK-KGV
A0A2V3PNY7      TLITSAEPGDGKTFIAGNIASVYQLTGKK-VVLIDFDLRRPSVGKLLSIE----SK-KGV
A0A6G7X5K8      ILITSAEPGDGKTFIAGNVASVYQLTGKK-VVLIDFDLRRPSVAKLLNIE----SK-KGV
A0A2P8CDS1      IAVTSTGSDEGKTFTAMNLAASFALLGQK-AVLLDLDLRNSKMAEMHNYD----KN-RGV
A0A660LQT8      TMVVSANPNSGKTFVTMNLAMSMVIKNKK-AVVVDLDLRKAATSLFVGRPK------YGI
A0A389LWV6      MLITSTEPRDGKTFVACNLASAYQMTGKK-TLMIDFDLRRPALSKALDLD----TQ-KGL
A0A1G9B1T9      LLVTSSVSNEGKTLCSVNLASSFAVANNR-TIIIDADLRRPRVHNILEKT----NG-VGL
A0A350PNH9      IILTSFNPGSGKSHLAGNIAMSLAIKKKK-VLVIDGDLRRGATSMLVGSPG------EGL
A0A354LNT9      IILTSFNPGSGKSHLAGNIAMSLAIKKKK-VLVIDGDLRLGSTSMLVGSPG------EGL
A0A161LWY6      VIVTSTESGDGKTHFCLNYASMCAMTGEP-TILVDMDLRKPSVSKRLSLE----NE-TGI
A0A6I3N9U6      VIVTSTESGDGKTHFCLNYASMCAMTGEP-TILVDMDLRKPSVSKRLSLE----NE-TGI
A0A3D0FMX4      VLTTSAQSGDGKTYLSTNLAALYAMSGKK-TLLMDMDIRKPNIHEKLGTS----IE-KGL
A0A1M3MEI8      IMVTSSESGDGKTYFSLNLASVYGLASPR-TLLVDLDIRKPSIHKRLGVE----NS-LGL
A0A1J5HQM0      VAVTSSESGDGKTYFSINMAGVYSMASKK-VLLVDLDIRKPSIHERFNIN----PS-QGI
A0A653AC35      ILTTSAESGDGKTYFCTNLASVYAMSGLK-TILVDMDIRKPSINERLSIS----EK-DGV
E4T131          VMTTSTESGDGKTYFSINLASVYAMASKK-TILVDMDIRKPSVNQRFNIV----HP-LGV
A0A2W7RD29      LLVSSVLPAEGKSFTSVNLATAFALTELK-VLIIDCDLRKPKVSDYLGVD----NT-AGL
A0A3N2NDY8      IMITSFNPGSGKSFISFNLSASFALKGKK-VLVVDGDLRHGSASQFVDMPS------KGL
D7JEV9          VLISSTESGDGKTYISLNLAGVFALQNKK-ILLIDFDIRKPNLTKNLGGMVK--NK-LGF
A0A4R6H3B7      IGVNSVISGEGKSFTSANLASMIALNNKK-VLLVDCDLRKPSLHNRLKYK----NK-EGL
A0A521H707      IAITSTISGEGKTFIAINLAGVIAFSEKK-VVIIDLDMRKPKIHLGFNVE----NI-RGM
A0A1F3D6P8      IVITSSQPKDGKSFISFNLAASIAIVGYK-TIIIDCDLRKPTLHEKFKED----NS-SGI
A0A356Z058      IVITSSQPKDGKSFISFNLAASIAIVGYK-TIIIDCDLRKPTLHEKFKED----NS-SGI
A0A3D1BT36      ILVTSCQPQDGKSFVAMNLASSIASVGHK-TIILDCDLRRPTLHDKFKID----NE-GGI
A0A5R9QZP0      ILVTSALPQDGKSFIAFNLATAIAAVGHK-TIIIDCDLRKPTLHMKLKKD----NP-FGI
A0A3D3HL11      IMITSAQPQDGKSFVSSNLAASIASVGHK-TVLLDCDLRRPTLHEKLKIV----NS-VGL
A0A6L8U6G9      LMVTSSQPQDGKSFVSSNLAASIASVGHK-TVLIDADLRRPTLHEKLKIV----NS-VGL
A0A352ME00      ILITSSQPQDGKSFVSLNLSSSIASVGYK-TVLIDCDLRRPTLHIKLKED----NA-KGI
A0A6L8UH35      ILITSSQPQDGKSFISFNLASSIASVGYK-TILIDCDLRRPTLHSKLKVE----NR-MGL
A0A3P1Z8V4      FLITSASPGQGKSFVSRNLAVALSMTGKK-VLLVDTDVRKQNLTAGFTNG----RK-KGL
A0A1M6MYT6      IAVTSSFPSEGKTYNAINIASSVALSNKT-AVILDLDLRKSRINEDIGLK----IE-KNV
A0A2W7QSQ0      ILVSSSMSGEGKTFFCLNLAATLSIVDKK-VVVVDLDLRRPSIFKSLNIK----SK-HSL
A0A3D5KRY6      LAIHSYMPGEGKSFVAFNIAVIFAMNNKK-VLLVDGDLRKPRLHLMLKQE----NT-TGL
R7F6L5          IMVTSANPGSGKTFITMNLAVALALKHKR-VLMIDFDLRRAALSNAFGSPR------EGI
A0A7C5MRV2      VSITSTVSGEGKSFITINLGGIISLLNVK-VVILDMDLRKPKLHFSFGHD----NS-AGV
A0A229I3A5      IVFTSFNPGSGKSHIAANMAMSLAIKKKK-VLLIDGDLRHGSTSMLIHSPG------EGL
A0A3R6HJB3      IVFTSFNPGSGKSHIAANMAMSLAIKKKK-VLLIDGDLRHGSTSMLIHSPG------EGL
R6NN15          ILMTSFNPGSGKTFLTVNIAATLAIKGKR-VLVIDGDLRRGSTSVYVGSPH------HGL
A0A553GA49      VLFTSTMPGEGKTFCSYNLAQSLASLGKK-TVILDFDLRKGDLSENYFKS----EN-KGI
A0A497D6F6      IAFTSSIANEGKSFSALNIASLYALSKKK-TVLLDLDLRMSSMAKNLELD----TD-KGV
A0A5M4AAB9      IAVTSTAAGEGKTFTALNLAASFALLGKK-TVFLDLDLRNSRIGKKMGYE----SN-RGA
F4KR18          L-VTSSTSDEGKTFVATNLAMSFALAKKK-TIVVDFDLRKPSISKYFEGN----AE-IGL
A0A2M6GH67      ISITSTVSGEGKTFVAVNLGGIIALSDQK-VVILDLDLRRPKVNLAFDAE----NN-IGI
A0A7K1TE30      ISVTSTISGEGKTFVTVNLGGIIALSGQR-VIILDLDMRKPKVNLAFGAE----NV-RGI
A0A7D4BE70      ISVTSTISGEGKTFVTVNLAGIIAQSGQR-VIVLDLDMRKPKVNLAFGAE----NV-RGI
A0A142HHS5      ISVTSTISGEGKTFVTVNLGGIIALSGQR-VVILDLDMRKPKVNLAFDAE----NV-RGI
A0A7D4C435      ISVTSTISGEGKTFVTVNLGGIIALSGQR-VIILDLDMRKPKVNLAFDAE----NV-RGI
C9LKL0          CVVTSSTPGQGKSFISRNLAAIMGMANKR-VLLVDADIRKRTLSSKFGRS-------NGL
A0A3D0QPV7      VSVTSTISGEGKTFVAINLAGMIAFSGKK-VVILDLDMRKPKIHIGFGTD----NE-VGM
A0A496KT23      VMLSSLNPGSGKTFITANLSAAFSLKGKR-VLVMDLDLRKASLSDYVGQPK------VGI
L1M9T3          IMVTSMNPGSGKTFITANLSTAYALKGKR-VLVMDLDLRKASLSQYVGNPQ------IGL
A0A3C0I8F1      ISITSTISGEGKTFVAANLAGIIAMLNLK-VLIIDFDMRRPKVHIAFDREEE--DNLKGT
R5JJI4          VMFTSANPGAGKTFVSSNLAMSIAQTNKK-VVLVDVDIRKGTLSGIFSNPS---GR-MGL
A0A0A2DQN2      IVLTSFGAEAGKSYISYNLAKSLVFAGKS-VVLIDIDIRKRTLTRKLNFE----HN-MGL
A0A0A2F2N5      IMCVSFGANAGKTFTTYNLARSLIFADKK-VVIVDLDLRKGMMSKRLEMS-----G-RGM
L1NGW4          IIFTSFGESAGKSYVSYNLAKTLTFSGST-VVIVDLDLRKGTLSRRAHVA-----G-QGV
Z4WRA0          IIFTSFGESAGKSYVSYNLAKTLTFSGST-VVVVDLDLRKGTLSRRAHVA-----G-QGV
U2K8K9          IIFTSFGESAGKSYVSYNLAKTLTFSGHR-VVLVDLDLRKGTLSHRAGII-----G-KGV
A0A069ZM60      VIFTSFGESAGKSYVSYNLAQTLTFAGHS-VVLVDLDLRKGTLSRRIGLA-----G-MGA
J6GV98          VIFTSFGESAGKSYVSYNLAQTLTFAGHS-VVLVDLDLRKGTLSRRIGLA-----G-MGA
A0A134B4F8      VIFTSFGESAGKSYVSYNLAQTLTFAGHS-VVLVDLDLRKGTLSRRIGLA-----G-MGA
A0A134B8C7      VIFTSFGESAGKSYVSYNLAQTLTFAGHS-VVLVDLDLRKGTLSRRIGLA-----G-MGA
A0A3D2HF71      IAVSSTITGEGKTFVAVNLAAIIALPGKK-VLLIDLDLRKPKAHKILGNND---NT-EGI
A0A4Z0EKR0      FLITSSMSGEGKTFFSINLGASLAITDKR-TLLLDLDLRNPKVAQRLALP----AG-PGI
B5CTK0          VTFTSMMPGAGKTFVSMNLALSFALTDKK-IILMDLDIRKGTLSAHSKR-----KE-LGV
A0A1M6B6D5      VLLTSSVSGEGKTFCSINLASIFALSDKK-TIIIDLDLRKPKVGAAFNIQ----NS-MGV
A0A451FS66      VLFTSSVSGEGKTFCSINIASIFALSEKR-TVIVDLDLRKPKVSGAFNMD----NS-IGV
A0A2E3GN39      IAVTSTIPGEGKTFVAINLAAIIAMQGKR-VLLVDVDLRKPRIHKIFDLP----NS-AGM
A0A3D1MEL0      IAVTSTIPGEGKTFVAINLAAIIAMQGKR-VLLVDVDLRKPRIHKIFDLP----NS-AGM
A0A519UDD1      LLITSSMSGEGKTFFSINLGASIALTGKR-VVLLDLDLRNPRVASELNML----KS-IGL
A0A2A4N9A6      MAITSTISTEGKTFVAINMAGIIALSGKK-VIILDLDLRKPRIHKAFEID----NA-KGM
A0A6C0GGI1      IGITSSVSGEGKTFCAINLSTVLALSGKR-TVLIDVDLRKPKVAAYLGLK----NT-TGL
A0A368D1N7      IAVTSTIPGEGKTFVAINLAAIIAMQGKR-VLLVDVDLRKPRIHKIFDLP----NS-SGM
A0A3B8TU58      IAVTSTIPGEGKTFVAINLAAIIAMQGKR-VLLVDVDLRKPRVHKIFNLP----NS-AGM
A0A1T5IIR6      IATTSYSSSSGKTFITANMASCLADAQKR-VILVDTDMRKRSLSGVFALKH---KT-KGL
A0A3E0QD27      VAITSTISGEGKTFVAINLAGVIAFSEKR-VVIIDLDMRKPKIHLGFNVE----NT-KGM
A0A6N8DCX3      ILLTSFNPGSGKTFLTVNIAASLAIKGKR-VLVIDGDLRHGSLSSYIGS-----PG-IGL
F0R0C9          ILLTSFNPGSGKTFLSLNIAGSLALKGKK-VLIIDGDLRKASVSAFIDS-----PK-TGL
A0A0M1W1I6      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---EE-KGM
A0A4R4GHU2      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---EE-KGM
I8WPR6          VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---EE-KGM
A0A0K2HKS3      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---EE-KGM
B6W3W8          VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---EE-KGM
A0A7M3EEL4      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---EE-KGM
A0A076IRY8      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---KE-KGM
A0A3A6AD54      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---KE-KGM
A0A3A6MIU7      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---KE-KGM
I8WPP8          VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---KE-KGM
A0A372Y7D2      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---KE-KGM
A0A7K3KFI2      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---KE-KGM
A0A3E4JJC9      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---KE-KGM
A0A3E4WDQ0      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---KE-KGM
A0A414H9P2      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---KE-KGM
A0A7K0JKU9      VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---KE-KGM
C3R5A8          VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---KE-KGM
A0A1C5XJA7      ITFTSFNSGAGKSFVAFNLADSLAYTKKK-VILIDLDIRKGSLSHRMHK-----HG-VGM
A0A285T4L1      ITFTSFNEGAGKTFVSRNLAMSLVLTKKR-VVLVDLDIRKGTLSRHFSK-----HP-VGV
A0A3E5BU42      ITFTSFNEGAGKTFVSRNLAMSLVLTKKR-VVLVDLDIRKGTLSRHFSK-----HP-VGV
R7CUW4          ITFTSFNEGAGKTFISCNLAMSFVYARKR-VVVIDLDIRKGTLSRHLGE-----HR-TGV
A0A416GGJ1      ITFTSFREGAGKTFILRNLAVSLMAAKKK-VVVLDLDIRKRTLSRHFAKH-----P-YGM
D1JY72          VTFSSFGPGAGKTYVSSNLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT---EE-KGM
A0A7G5NJU1      VTFTSFNEGAGKTFISRNLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK-----HP-VGV
D7J4K6          VTFTSFNEGAGKTFISRNLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK-----HP-VGV
Q8ABP9          VTFTSFNEGAGKTFISRNLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK-----HP-VGV
D6D2Z5          VTFTSFNEGAGKTFISRNLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK-----HP-VGV
A0A1T3EDR4      ITYTSFSAGVGKTFNTLNLAASFSYMKKR-VVLVDLDLRKGTLSTRVGLE----GK-AGV
A0A6N8KXI9      IMLSSSRIGAGKTFSALNLSATLAFLNKK-VVLVDLDIRKGTLSSKFNLE----VD-KGV
A0A174SDD8      ITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMSHCT----QV-KGV
A0A1H7RFH3      ITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR----QV-KGV
A0A139L1N2      ITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR----QV-KGV
A0A174TVL8      ITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR----QV-KGV
A0A1H8BJR6      ITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR----QV-KGV
R9H6G0          ITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR----QV-KGV
A0A412GR09      ITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR----QV-KGV
A0A7J5JXN6      ITLTSFNIGAGKTFISINLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR----QV-KGV
A0A081PBV5      ITFTSFNIGAGKTFTAINLAASFRYLNKK-VLLLDLDLRKGTLSNRVNAQKE--KG-LGV
A0A1I2AN85      ITFTSFNIGAGKTFTAINLAASFRYLNKK-VLLLDLDLRKGTLSNRVNAQKE--KG-LGV
A0A4U0GMP3      ITFTSFNIGAGKTFTAMNLAASFSFLQKR-VVLLDLDLRKGTLSKSLKGRRK------GV
A0A1H6CKR6      ITFTSFNVGAGKTFSVINLGVSLTYLKKR-VVLVDLDLRKGTLSNITKFP----MP-IGA
A0A235E1C0      ITFTSFNVGAGKTFSVINLGVSMTFLKKK-VVLVDLDLRKGTLSNITKFP----MP-IGV
R6D982          VTLTSFNVSAGKTFVSVNLSASLVQADKK-VILIDLDLRKATLSLIAKARGN--GI-KGM
A0A1F0I8C4      ITLASFNMGAGKTFVSVNLAASLVQAEKK-IIMIDLDLRKGRLSHFAHAK----RV-KGV
A0A3A5RIJ2      ITLASFNMGAGKTFVSVNLAASLVQAEKK-IIMIDLDLRKGRLSHFAHAK----RV-KGV
A0A515IZJ5      ITLASFNMGAGKTFVSVNLAASLVQAEKK-IIMIDLDLRKGRLSHFAHAK----RV-KGV
A0A7J4Y2H6      ITLASFNMGAGKTFVSVNLAASLVQAEKK-IIMIDLDLRKGRLSHFAHAK----RV-KGV
A0A0D5BSQ0      ITFTSFSAGVGKTFSALNLATTLSYLEKK-VVVIDLDLRKGTLSSRIDLL----HG-KGV
A0A1T3F6P5      ITFTSFSAGVGKTFSVLNLAATLSYLDKK-VVVLDLDLRKGTLSSRTGLL----HG-KGT
A0A0W8EPA0      ITFTSFSAGVGKTFSVLNLAATLSYLDKK-VVVLDLDLRKGTLSSRTGLL----HG-KGT
A0A365UKN1      ITFTSFSAGVGKTFSVLNLAATLSYLDKK-VVVLDLDLRKGTLSSRTGLL----HG-KGT
A0A4R6WE41      ITFSSFTIGAGKTFNVMNLSATVSYLKKR-VVMVDLDLRKGTLTRRMGIK----FR-KGV
A0A2T5RP38      LTFTSFSAGVGKTFSVLNLATTLSFLEKK-VVVIDLDLRKGTLSSRVDLL----HG-KGS
A0A1A6CF06      ITFTSFSAGVGKTFSVLNLAATLSYLDKK-VVVIDLDLRKGTLSSRVDLL----HE-KGT
A0A1T3D6S8      ITFTSFSAGVGKTFSVLNLAATLSYLDKK-VVVLDLDLRKGTLSSRTGLL----HG-KGT
A0A1P8E011      ITLTSFIPGVGKTFTSLNLSSTLSFLNKK-VIVVDMDLRKGTLSERMGII----HG-KGL
A0A1V3N3U3      ITFTSFGVEVGKTFSSINLSATLSFMEKR-TVVVDLDLRKGTLSSRLGLL----DK-IGC
C2FUH6          ITFTSFSIGAGKTFTALNLAATLSFLDKK-ILILDLDLRKGTISSRVNVK----SA-LGV
A0A0B8T471      ITFTSFNVGAGKTFTAVNLAASLTFLLQN-VVLLDLDLRKGTLSDHLKLG----SV-KGV
A0A4R7D2K0      ITFTSFNVGAGKTFTAINLAASLTFLLQN-VVLLDLDLRKGTLSDHLKLG----SV-KGV
A0A2X2J8S4      ITFSSARVGAGKTFSVINLATTLSFLNKR-VIMVDLDLRKGTLSSRIPVP----VR-KGI
A0A3C0S618      ITFSSARVGAGKTFSVINLATTLSFLNKR-VIMVDLDLRKGTLSSRIPVP----VR-KGI
A0A4P7DRF9      LTFTSFNVGAGKTFSVINLGVSFTFLKKR-VVLVDLDLRKGTLSHKTKVP----MP-VGI
A0A239XXC4      VTFTSFNVGAGKTFSVINLGVSMTFLKKK-VVLVDLDLRKGTLSNITKFP----MP-IGV
A0A4U9K473      ITFTSFNVGAGKTFSVINLGVSMTFLKKK-VVLVDLDLRKGTLSNITKFP----MP-IGV
A0A2T4XEQ1      ILVTSPGKGEGKTTTAVNLAGILAESGKR-VLIIDFDFRRPNLHKTLG--ES--QT-PGI
A0A2K8ZAP1      ILFTSSISGDGKSFMSLNLGASLALVNRK-TVIVDMDMRKPKLHKSLH--IE--NK-LGL
A0A3M1Y2F5      LGVCSTWSDEGKSFCAANLAASFGIGGYN-TLLVDLDLRNPSQPEYFR--YP--RQ-MGI
A0A3D4RLG4      LSITSTQSGDGKTFLATNLAALYGMTGKK-TLLIDLDIRKPNIHEKLG--VD--AG-LGV
A0A2T2UAJ4      MAVSSADKGDGKTTTCANLALALASAGKR-TIVVDADLRRPWMHEMLN--VD--RD-LGL
A0A6I0DZQ5      IMVTSSESGDGKTYFSLNLASVYGLASPR-TLLVDLDIRKPSIHKRLG--VE--NS-LGL
A0A3D3LSK1      ILVTSSLPSDGKTIVSVNLAGSFALDNKK-VILIDCDLRKPRVHTVFE--FD--RF-PGL
A0A496L711      VLISSTESGDGKTYISLNLAGVFALQNKK-ILLIDFDIRKPNLTKNLSGMVK--NK-LGF
A0A1H6Z2F8      VLLTSSMADEGKSFVAMHLAHSLALASRK-VLLVDFDLRKPTLASLLN--LR--PE-GVT
A0A2P8G5K0      ILLTSAMANEGKSFVAMHLAHSLALAGKK-VLLVDFDLRKPSLATLLN--LR--PN-GVT
R5DEG6          VMFTSFNPGAGKTFVSINLAMSFALTHKK-VVLVDLDIRKGTLSSHVQ--VS--DM--GV
A0A4Q3SEI4      ILVTSSIAGEGKSFIANNLALSLAISGKK-VVLVDLDLRHPKTTTMHD--LN--GQ-RGV
A0A348PT57      IAVTSTISGEGKTFVAINLGGILAFSDKK-VIILDLDMRKPRIHKGFN--ST--NE-YGM
A0A7C3PTI0      MAVTSTISGEGKTFVAINLAGIIAYSDKK-VIILDLDMRKPKIHLGFN--VP--NL-KGM
A0A5Q4EKA0      VAVTSTISGEGKTFFAMNLAGILAFSNKK-VIVIDFDMRKPKIHLGFN--VE--NI-NGV
A0A519SYE7      ISITSTISGEGKTFVAVNLSGIIALSGQR-VVILDLDMRKPKVNLAFG--AE--NV-RGI
A0A7C7CFR2      IAITSTVSGEGKTFVAINLSGIIAFSDKK-VVILDLDLRKPKIHLGFN--YD--NE-HGI
A0A3N2LCI3      IAMTSFNPGSGKSFVSMNLGMAIALKGKK-VLIVDGDMRHGSTS-AYM--GS--PA-KGL
A0A6H9Q899      IIVTSFNPGSGKSFLTMNIAMSFAIKGKK-VLVIDGDLRHGSAS-SYI--DS--PD-KGL
A0A3D4CJE1      MAITSTVSGEGKTFVAINIAGIIAYSGKK-VIILDLDMRKPKIHLGFN--VE--ND-RGM
A0A7C7LI79      IAVTSTVASEGKTFVTINLAGIIAFSEKK-VIVLDLDLRKPKIHLGFN--FE--NK-KGI
A0A4Q5ZQ60      ISVTSTIGGEGKTFVAVNLAGIIAQSGQR-VVILDLDMRKPKVNLAFE--AE--NI-RGM
A0A519Q885      ISITSTISGEGKTFVAVNLAGIIALSGQR-VVILDLDMRKPKVNLAFG--AE--NI-QGV
A0A519TAP8      ISVTSTISGEGKTFVAVNLGGIIALSGQR-VIILDLDMRKPKVNLAFD--AD--NV-RGI
                    *     **:    . .           :.:* *.*                     

A0A1T4NDR5      TDLLNGRA---TVDN---VVKPVFK----NIDVITTGTKIIYHSEFIQSTALMNFIERMK
A0A3D5KRM7      IDYLSGVT---SLEQ--ILIHPKIE----NLVLLPGKESKVNYSELISSPKMIEFIKETK
A0A3M1NUH2      AHFLVQEP---RFDE--ELVATPID----NLWIIPAGKVVPRSSELFATRVMRDFIESLR
A0A7C1IBE4      TEYLRDGD---NISD--MIYATGLP----KLSIIPSGSPPDNPSELLSSDRMSAMLDELA
A0A2T2TDL4      TEALQNDL---DEH---AMKRPLID----NLCVLPAGTEVENPAKVLGSSRFRDFLQRAE
A0A359ATS6      SDYLGKRI---DTPEEIIVVDKKHP----TLHILPVGTIPPNPTELLVEERLKELINRMR
A0A2E0MDX6      STLLIGQS---SLED--CIQKSHLE----NLHFITAGPIPPNPAELIISNKMTDVINELK
A0A2M7KCE1      STILIGKN---KVHD--CIKKSKIA----NLDYITAGPIPPNPSELTAGNEILNVINELK
R7JFY1          TNYLSGKV---TDVTSLICQDELVP----GLDVIHAGPVPPNPAELLQNKRLDAMIAELR
A0A1V5S5I3      SDYLGKRE---NNLDGLIQENPDIP----GFFLLPAGTIPPNPTELLAEPMFKEAIERLR
A0A2M7VVW6      STILIDK----DQIKECIHHSEL-T----NLDFITSGPIPPNPSELIISGKLDEVIAELK
A0A413V760      THYLSGST---DKLDDIIGRSEEYD----KLDVIFSGPVPPNPAELLLSERFDRLITELR
A0A656PYT8      SGYISGTI---ANLNDIVFQSGLHE----NLDIIFAGLQPPNPAEMLLSEKFDEFMADLR
A0A1V6HYH8      SNYLLGEC---NIEQ--CIKGTEIN----NLFYFPAGSLPEYPNELLTSSKMDELLENLK
A0A523GUD4      VDAVTNQI---SFQE--LIKDSGFP----NLKIITSGNLNDSPIKIFNAQNIKAFLETAS
A0A3D1AEJ6      TSYLSKIV---TKVESLIIQDQDYP----NIDIIRSGPEPPNPAELLLSPRLDELIRELR
A0A7K3KYQ2      ADYLGGAV---SEVDTLIVKTPECQ----NMQVLPIGSIPPNPTELLESPRFGELIGELK
A0A641X2Z6      SNCISASE---EVRE--VIQKTGIE----NLELLASGPVAPNPSELLGSKRMEQLLEQLK
A0A6L8U2P8      SNYMIKKA---SIED--IIRNTAIP----NLDFISAGPVIPNPSELMESGVLDHLINQLK
A0A7C6G639      TNYLIGEK---SLDE--LILKKEKY----NFDILLGGTVPPNPGELIRSEQLKQMFLALR
A0A519PJW5      STILIDRH---SVAE--CVQHTSIE----SLDFISAGPTPPNPSELILHPRFDLMLQELY
A0A519T3R9      STILIDRH---SVAE--CVQHTSIE----ALDFISAGPTPPNPSELILSPRFDQMLQELY
A0A7C7CKY6      STILSGVD---KVED--TISKSNVD----NLDYITAGPIPINPSELIISEKMDELLVYLK
A0A1G1TG88      STILIDRH---SVAE--CIQHTSID----ALQFISAGPTPPNPSELILSPRFDQMLNELY
A0A661XXA6      STLLIKKH---NLSE--CITKSHIE----DLDFIGAGPVPPNPSELILREAFDEILEKLR
A0A519SD85      TNYIHSDL---ALEQ--IIRKTSIE----NLEFIPSGPLPINPSELLENEKIDVLINSLK
A0A3M1TXY5      SDFLCGEV--DYVNE--IIHSTHIE----NLHIIPAGNPSNNPTDLISNSRMKELVEACM
A0A2E0VQ27      CEAIKSDR---HALD--LVQNTSDE----NLYFIPAGQYDDSLEGKVFSAKALDIIHDLR
R6U429          SAFLNGKL-----ES--IVPEIQNIKE--NLDLISVGSLPPNPAELLVSEKFDKMMDELS
A0A5C8AF42      SGLIINKF---TLEQ--CIQHSTIE----DLDFITAGPIPPNPSELLLSDRFKEIVEELK
A0A353WYK7      STILIEKH---SVEE--CILKTNLE----NLDYISSGPIPPNPSELIHTGSFDKMIGDLK
A0A355BP94      STLLIHKT---TLEE--SITKTDMA----GFDYIPSGPHPPNPSELLLSKAFEDLLAELR
A0A136LSC7      STILIKKN---NWQE--CVLKTSLE----NFDFIPSGPHPPNPSELLLNGEFSDFLEELR
A0A5C7N8Q5      STILIKKN---KWQE--CVVKTSLE----NFDFIPSGPHPPNPSELLLNGEFSDFLEELR
A0A239K409      TDYLSFNT--VTVEE--MLNQSD-QVP--NLFIVGSGAIPVNPAELMMSNRVEQLFEELQ
A0A1V5S1J9      SNYLANQI---SLDE--AIVKHPDY----KFDILPVGVVPPNPGELIKSDNMNNLISILK
A0A0A2EYC8      VNYMIGDC---TIEE--AIESTP-Y----GFDFLKAGVIPPNPGEFVRRPQLLEMINLLK
A0A2G6H6Y4      VNYMIGEC---SLEE--AIDTTG-Y----GFDFLKAGVMPPNPGEFVRSPKLEQMITELK
A0A1M3DPL8      SNFLANQC---SLDE--IIVRPDGA----EFDFITAGTVPPNAGELIRSDNLKDMFDELR
A0A1V5F519      TNYLINEC---TLDE--IINVVPEV----NYDVIFAGTVPPNPAELIRSEKIIEMMGELR
A0A2G6R1T9      TNYLIGEN---ELDD--LIIKNDDF----SFDVLLGGTVPPNPGELIRSEKLKGMLKELR
A0A350V3E4      CDYLFGTV---TIEE--AVRETSFP----NLHIMTCGTIPTNPAELIASKHMQTFLNMMK
A0A6J4K208      ASYLTGAH---KADD--IIQATATE----NLYIIPSGPLPASPLNLLGTPRMEALLEKVR
A0A2W4RDE8      SNYLIGEA---SLKE--IINETGIK----GYDVITSGPIPPNPLDLIGTPRMAELLNELK
A0A0L8VEV2      STYLTDFS---SFDD--IFRQTR--VE--NLQFVSAGPIPPNPSELLENGKFEELIERCR
A0A1I2A9Z9      STYLTDFS---TFED--IFRQTR--VD--NLQFVSAGPIPPNPSELLENGKFEELIDRCR
A0A212J9Z9      SNYLIGQV---TLDE--IIYSHPDY----GFDIIPAGTLPPNPSELIKTAKTKQVLEHLK
F5IV23          SNYLIGQV---TLDE--ITYSHPDY----GFDIIPAGTLPPNPSELIKTAKTKQVLEHLK
F8X2T0          SNYLIGQV---TLEE--IIISHPDY----GFDIIPAGTLPPNPSELIKTAKTKQLLEHLK
A0A1M3LAG1      SNYLIGQV---TLDE--IIISHPDY----GFDIIPAGTLPPNPSELIKTAKTKQLLEHLK
A0A212K6G4      SNYLIGQV---TLDE--IIISHPDY----GFDIIPAGTLPPNPSELIKTAKTKQLLEHLK
A0A4Y9IPG7      SNYLIGQV---TLDE--IIISHPDY----GFDIIPAGTLPPNPSELIKTAKTKQLLEHLK
A0A1M5DFS8      SNFLIGQV---SLDE--ITVTHPEY----EFDVITAGTLPPNPSELIKTKKTKDLIEYLK
A0A4Y8KZS5      SNFLIGQV---SLDE--ITITHPEY----EFDVITAGTLPPNPSELIKTKKTRDLIEYLK
A0A2V3PNY7      SNYLIGQV---TLDE--ITITHPEY----EFDVITAGTLPPNPSELIKTKKTKDLLDHLK
A0A6G7X5K8      SNFLIGQV---TLDE--ITLTHPEY----EFDIITAGTLPPNPSELIKTKKTKDLIDYLK
A0A2P8CDS1      SNYLLGEM---RLED--ITFRSTHP----YMWLIPSGSFPPNPGELLADKKLKELIELLK
A0A660LQT8      ANYLNGQG---TLDE--IVCKYRDT----DLDVIPVGIMPPNPTELLYAERMDQLFTELK
A0A389LWV6      SNFLIGKA---SLAD--VVISHPDF----GFDILPAGTIPPNPSELINSEMTKKLLSFLS
A0A1G9B1T9      SNYLQGTA---DMSE--IIQPTD--QE--NLYVITAGKSDGHPGEILLSERLPQLINKLK
A0A350PNH9      SDYLNGRT--DDLEG--IICHGEEYGLVKDFDVLPIGTMPPNPTELLFTDRLEKMIRQMR
A0A354LNT9      SDYLNGRT--DDLEG--IICHGEEYGLVKDFDVLPIGTMPPNPTELLFTDRLEKMIRQMR
A0A161LWY6      TNCMLGQV--SLDDA--IIKKSPEI----NFDLLLAGTIPPNPGEMIRSPKLLELINELK
A0A6I3N9U6      TNCMLGQV--TLDEA--IIKKSPEI----NFDLLLAGTIPPNPGEMIRSPKMLELIKELK
A0A3D0FMX4      TNYLIGEI---SKQE--MIQHDPSY----EFDIIYAGSIPPNPGELIRSDQVVELLEELR
A0A1M3MEI8      TNFLVGQC---KAQD--IIMRPDGA----GFDFIPAGTIPPNAGELIRSEKLRTLFAKLK
A0A1J5HQM0      TNFLVGQA---TLDE--VIIHIPEL----EYDFLPGGTVPPNAGELIRSEKLVEMFQELR
A0A653AC35      TNYLIGEK---PLDK--LILKKDGI----NFDILLAGTVPPNPGELIRSDKLREMFKELE
E4T131          TNYLVGQC---ALDE--IILKLPKV----DFDILPAGSIPPNPGELIRSEKLGKMFEELR
A0A2W7RD29      SNYLSRRV--DDEST--IVKATS--IP--GLSCITSGPYPPNPSELIANKEIIKLLIKMK
A0A3N2NDY8      SNYLTGNT--DNWQS--LVVPVA-GQN--GMSVMPIGHRPPNPSELLDNGRIGQFLDEAR
D7JEV9          VNYMIGDC---SLNE--AIESTP-----YGFDFLKAGVIPPNPGEFVRSHKLLEMLAELQ
A0A4R6H3B7      STYLTDFS---TFED--IFRQTR--VD--NLQFVSAGPIPPNPSELLENGKFEELIDRCR
A0A521H707      STILIGKD---TTDF--CINKSS--LA--NLDFITAGPIPPNPSELILSQRMNELLDYLK
A0A1F3D6P8      SNFMVKNA---TVTE--IIRNTS--VE--NLSFIPAGPLLPNPSELIESGVLDELMNFLK
A0A356Z058      SNFMVKNA---TVTE--IIRNTS--VE--NLSFIPAGPLLPNPSELIESGVLDELMNFLK
A0A3D1BT36      TKYLTDKN---VDND--IILKTF--VD--NLDFIPAGPVLPNSSELIEAGALDKLIQYLE
A0A5R9QZP0      SNFMNKEV---TAQE--IIFDSG--IK--NLSYIPAGPTLPNAAELIEAGKLDSLITHVQ
A0A3D3HL11      SNYMVNNA---STKE--IIKKTD--VD--NLWFIPAGPILPNSSELIEAGVLDSLIEELK
A0A6L8U6G9      SNYMVRNV---SSKE--ILRKTD--ID--NLWFIPAGPILPNSSELIESGVLDELIEELK
A0A352ME00      SNFMIKKA---TADE--IIRNTA--IT--NLDFISAGPVIPNPSELMESGILDNLINYLK
A0A6L8UH35      TNYMTKNA---SLNE--IIRHTN--IE--NLSFIPAGPVIPNPSEMMELGVLDGLIGELK
A0A3P1Z8V4      TEYLIGDS--EAPHD--IIHTDG-VCK--GVDFLPAGTIPPNVSELLMSERFEQMIATLR
A0A1M6MYT6      VDYILGKA---TLEE--ITHKTK--HP--RLKVIPAGPHPPNPLQMLTDKNLSGLIDQLK
A0A2W7QSQ0      FDYLNHDI--KDLKE--IITPSG-INS--NMDIIGLNKSIENASEIITSQKIIKLINSLK
A0A3D5KRY6      SLLLEKKT---KAEE--IIRKTD--IP--NLSFVPSGPVLPNSSELLSTNLIKDFIQAAK
R7F6L5          ANYLCGAD---QMSD--IVQHNVNDVE--GLDLIGVGNLPPNPSELLYSERLKTLLSTME
A0A7C5MRV2      STYLVNQN---TLPE--ILTKTQYK----NLDIITSGPIPPNPAELIQSNRMTELLDELR
A0A229I3A5      SDYLNGRI--ADIHD--ILYKGEENGLVKNFDVIPIGTIPPNPTELLFTPLLEQMIKTMR
A0A3R6HJB3      SDYLNGRI--TDIHD--ILYKGEENGLVKGFDVIPIGTIPPNPTELLFTPLLEQMIKTMR
R6NN15          SNYLAGKV--QRIED--VIVPASET---VRFDVLPIGTIPPNPTELLAGERLQTLLADFR
A0A553GA49      SMFLSNQ---VELDD--IIEKQE--GK--NISYIAAGHLPPNPSELVESDKTLEMLAELK
A0A497D6F6      VSYLTGEA---GIDD--ITFSSK-H-P--DLDIIPAGPIPSNPAELLIDERLEKLMDKLK
A0A5M4AAB9      SNYILNEM---SIND--ITFNTP-H-P--YLHIIPAGSIPPNPGEMLADIQLMELTALLK
F4KR18          SSFLINQL---EVEE--VIQTSG-DLP--NLDYISGGPFIPNVSEQLTEQQLSVLFAYLK
A0A2M6GH67      STILIERH---SVPE--CIQKTA--IP--NLDFIPAGPTPPNPSELILNPKFDEMLEELR
A0A7K1TE30      STILIDRH---SVAE--CVQHST--IE--SLDFISAGPTPPNPSELILSPRFDQMLEELY
A0A7D4BE70      STILIDRH---TVAE--CIQHTD--IS--ALDFISAGPTPPNPSELILNPRFDQMLEELY
A0A142HHS5      STILIDRH---TVAE--CIQHTS--IE--SLDFISAGPTPPNPSELILNPRFDLMIQELY
A0A7D4C435      STILIDRH---SVAE--CIQHTG--IE--SLDFISAGPTPPNPSELILHPRFDQMLEELR
C9LKL0          TGWLVDEEEKLSLDE--IIIKDG-VAK--QVDFLPAGMLPPNPSELLMSSRLEALVEEAR
A0A3D0QPV7      SSLLIGRD---QLEQ--CIRKSE--ME--NLHFITAGPIPPNPAELIINGKLDSILEELK
A0A496KT23      SNYLSGQI--EDWHE--IITPLD------RVDVLPCGVIPPNPAELLSTERFAEMIKAAR
L1M9T3          SNYLSGQI--NDWHK--IIIPLG------QVDCLPSGVIPPNPAELLSTSRFRDLIETVR
A0A3C0I8F1      STILIGRH--TPQEC--IQHTPI---E--NLDFIPSGPIPPNPSELILRPICDEFIKQLT
R5JJI4          THYLSGRT--DGLDD--IIGASE-EYG--KLDIIFSGPVPPNPAELLLSERFDRLITELR
A0A0A2DQN2      TSYLSGMD--VSIDE--LIQQDP-NCE--MLSIIPAGTIAPNPTELLLSKRLDSLIDELG
A0A0A2F2N5      TNYLSDDS--IKIED--VLRQDK-NCP--SLHVIPIGSSAPNPAELLMSERLDALMDELS
L1NGW4          TEYLVDKA--MPVEK--IIHKDP-NFS--KLAIIPAGAIPPNPAELLLGHRLDDLAQELS
Z4WRA0          TEYLIDKA--MPVEK--IIHKDP-NFS--KLAIVPAGAIPPNPAELLLGHRLDDLAQELS
U2K8K9          TEYLSDPT--VQVDQ--IIRKDP-NAP--KLSVIASGAVPPNPAELLLGERLDELADKLS
A0A069ZM60      TEYLSNPD--VRLDQ--ILRKDP-NAP--KLQVITSGAVPPNPAELLLGERLDELAAKLA
J6GV98          TEYLSNPD--VRLDQ--ILRKDP-NAP--KLQVITSGAVPPNPAELLLGERLDELAAKLA
A0A134B4F8      TEYLSNPD--VRLDQ--ILRKDP-NAP--KLQVITSGAVPPNPAELLLGERLDELAAKLA
A0A134B8C7      TEYLSNPD--VRLDQ--ILRKDP-NAP--KLQVITSGAVPPNPAELLLGERLDELAAKLA
A0A3D2HF71      SKYLIGES--KIEDI--IIKTEV---E--NLWYAPAGPIPPNPAELIESESMKEFIDKAK
A0A4Z0EKR0      TDYLVSSD--ILISD--IIRESE-QVP--NLFIISSGPIPPNPAELLLSSKFAQLIEELK
B5CTK0          TDYLSGKI--ADLNQ--IIVKGK-LHA--NLDMIYAGAVPPNPAELLLSERLDQMIEELR
A0A1M6B6D5      VNYLINEA---DLDG--IIQKTE--ID--TLDVITSGPIPPNPSELLLGERLDQLLGLLK
A0A451FS66      VNYLINEA---DLDT--ITQKTE--VD--YLDVIPSGPTPPNPSELLIGERMDEFMERLK
A0A2E3GN39      STLLNKRS--TKEDI--TFSTSE---E--NLWAVPAGPIPPNPSELIGGEPFINFIDEVK
A0A3D1MEL0      STLLNKRS--TKEDI--TFSTPE---E--NLWAIPAGPIPPNPSELIGGDSFVNFLDEVK
A0A519UDD1      SNYLVNDD--ISIKN--ILRLSE-KVP--DLFIIGSGPIPPNPAELIMSPKLAYLIEELK
A0A2A4N9A6      STILIGKD--KVEDC--IFKSNI-D----TLHFIPSGPIPPNPAELIINQRTEELLAVLR
A0A6C0GGI1      SSYLIKSS--TLEEI--IQPTKV-K----NFDVISSGPIPPNPVEMIELKEMRDLIAKLK
A0A368D1N7      STLLNKRS--IKEDI--IFSTPE-E----NLWAIPAGPIPPNPSELIGGDSFVNFLDEVK
A0A3B8TU58      STLLNKRS--IKEDV--TFSTSE-E----NLWAIPAGPIPPNPSELIGGDSFVNFIEEIK
A0A1T5IIR6      SNYLYDLD--LTLDD--ILFKD--VKS--GIDFIPAGAVPPNPTELLGRPRLEELIEALR
A0A3E0QD27      STILIGKD--EA-DN--CIRKSN-LT---NLDFITAGPIPPNPSELILSRKMVELVEYLK
A0A6N8DCX3      SDYLAKRT--DDLKG--VIHKVDVRYA--GLDMIPVGTMPPNPTELLSGEYMRELVTEMR
F0R0C9          SDYLGRKT--DAIDT--AVVEAP-QCP--GLYILPVGTLPPNPTELLAEDRFGKLVAGLR
A0A0M1W1I6      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVMIAELR
A0A4R4GHU2      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVMIAELR
I8WPR6          TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVMIAELR
A0A0K2HKS3      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVMIAELR
B6W3W8          TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVMIAELR
A0A7M3EEL4      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVMIAELR
A0A076IRY8      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVLITELR
A0A3A6AD54      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVLITELR
A0A3A6MIU7      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVLITELR
I8WPP8          TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVLITELR
A0A372Y7D2      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVLITELR
A0A7K3KFI2      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVLITELR
A0A3E4JJC9      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVLITELR
A0A3E4WDQ0      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVLITELR
A0A414H9P2      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVLITELR
A0A7K0JKU9      TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVLITELR
C3R5A8          TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVLITELR
A0A1C5XJA7      TNYLADET--IALDD--IIHDCG-KD----YDFINAGTSAPNPAELLMDSRLDSMMEELR
A0A285T4L1      TNYLADES--IALDD--IIHTDE-KSG--GLDIISSGTVAPNPAELLMDSRLDTMMAELR
A0A3E5BU42      TNYLADES--IALDD--IIHTDE-KSG--GLDIISSGTVAPNPAELLMDSRLDTMMAELR
R7CUW4          TNYLADTT--VTVDD--IIRKGE-H-----FDIIASGPVAPNPAELLLDSRLDTLIAELR
A0A416GGJ1      TNYLSDAS--IRLED--ILVKGN-GVD--IPDAILAGPVAPNPAELLLENRLDELIEELK
D1JY72          TSFLAGKA--TT-DE--IIKHNE-ICE--NLDFIPAGPIAPNPSELLLSEQLEVMIAELR
A0A7G5NJU1      TNYLADDS--IRLDD--IIHTDG-KFD--NLDIISSGTVAPNPAELLMDERLDAMVEELR
D7J4K6          TNYLADDS--IRLDD--IIHTDG-KFD--NLDIISSGTVAPNPAELLMDERLDAMVEELR
Q8ABP9          TNYLADDS--IRLDD--IIHTDG-KFD--NLDIISSGTVAPNPAELLMDERLDAMVEELR
D6D2Z5          TNYLADDS--IRLDD--IIHTDG-KFD--NLDIISSGTVAPNPAELLMDERLDTMVEELR
A0A1T3EDR4      SHYLSGLL--RDINT--VIYHRE-IGL--GVDVIPLGAIAPNPVELLLSKHLDELIEALK
A0A6N8KXI9      THYLANHS--VDLSE--IIYPTN-LLNDYNVDLIPIGVPAPNPVELLLSKRLDDLFGQLR
A0A174SDD8      AHYLSNPS--IEVND--IILRDA-FGE--GLDLVPIGVIAPNPTELLLSKRLDELVDKLR
A0A1H7RFH3      AHYLSDSS--VEVTD--IIVQDT-FGE--GLDLVPIGVIAPNPTELLLSKRLDKLVAELK
A0A139L1N2      AHYLSDSS--VEVTD--IIVQDA-FGE--GLDLVPIGVIAPNPTELLLSKRLDKLVVELK
A0A174TVL8      AHYLSDSS--VEVTD--IIVQDA-FGE--GLDLVPIGVIAPNPTELLLSKRLDKLVVELK
A0A1H8BJR6      AHYLSDSS--VEVTD--IIVQDA-FGE--GLDLVPIGVIAPNPTELLLSKRLDKLVVELK
R9H6G0          AHYLSDSS--VEVTD--IIVQDA-FGE--GLDLVPIGVIAPNPTELLLSKRLDKLVVELK
A0A412GR09      AHYLSDSS--VEVTD--IIVQDA-FGE--GLDLVPIGVIAPNPTELLLSKRLDKLVVELK
A0A7J5JXN6      AHYLSDSS--VEVTD--IIVQDA-FGE--GLDLVPIGVIAPNPTELLLSKRLDKLVVELK
A0A081PBV5      TNFLANPK--VTVDD--IIYQGL-VGG--IIDVIPIGVIAPNPVELLLSTRLDELIIELK
A0A1I2AN85      TNFLANPK--VTVDD--IIYQGL-VGG--IIDVIPIGVIAPNPVELLLSTRLDELIIELK
A0A4U0GMP3      THYLSDAN--VAWSD--IVYKNE-FAN--SVDIVPIGTIAPNPVELLLGGRLDELIAALK
A0A1H6CKR6      THYLSDSA--ITVDE--IIYKDR-VDA--NIDIVPIGVIAPNPVELLLSERLDRLFVELK
A0A235E1C0      THYLSDSA--ITVDE--IIYKDR-TDA--EIDIVPIGVIAPNPVELLLSDRLDTLINELK
R6D982          AHYLSNKS--ISMDD--IIMKDG-FGE--RIDLIPVGVIAPNPAELLLSGRLDELIGHLR
A0A1F0I8C4      AHYLSNPL--VSADD--IILHDA-FGE--GLDLIPIGVIAPNPTELLLNRRLDELIVKLR
A0A3A5RIJ2      AHYLSNPL--VSADD--IILHDA-FGE--GLDLIPIGVIAPNPTELLLNRRLDELIVKLR
A0A515IZJ5      AHYLSNPL--VSADD--IILHDA-FGE--GLDLIPIGVIAPNPTELLLNRRLDELIVKLR
A0A7J4Y2H6      AHYLSNPL--VSADD--IILHDA-FGE--GLDLIPIGVIAPNPTELLLNRRLDELIVKLR
A0A0D5BSQ0      SHYLSSPS--VSVDE--VLHKSE-VAN--GVDFVPIGAIAPNPVELLLSKRLDELINELK
A0A1T3F6P5      SHYLSNSS--IQISD--ILHKSE-VAE--GVDFIPIGAIAPNPVELLLGKRLDELITELK
A0A0W8EPA0      SHYLSNSS--IKISD--ILHKSE-VAE--GVDFIPIGAIAPNPVELLLGKRLDELITELK
A0A365UKN1      SHYLSNSS--IKISD--ILHKSE-VAE--GVDFIPIGAIAPNPVELLLGKRLDELITELK
A0A4R6WE41      THYLSDSS--VKIDD--VLYKSD-LSE--GVDCVPIGVLAPNPVELLLSQRLDELIGELK
A0A2T5RP38      SHYLSSPS--ISIDE--IIHKSD-VAE--GVDFIPIGAIAPNPVELLLGKRLDELITKLK
A0A1A6CF06      SHYLSNSS--ISVDE--ILQKSE-LLE--NVDVIPIGAIAPNPVELLLSKRLDELINELK
A0A1T3D6S8      SHYLSNPS--IKISE--ILHKSE-VAE--GVDFIPIGAIAPNPVELLLGKRLDELITELK
A0A1P8E011      SHYLSDVN--LELEE--IIHYNL-HGK--NVDYISIGMEAPNPVELLLSKRLDQLISDLR
A0A1V3N3U3      SHFLADAT--VTLDT--VIYPVK-GLE--FLDCVPIGLIAPNPVELLLSARLDELIAELR
C2FUH6          SHYLSNSQ--VAIDD--IICKSG-IAD--NVDIISIGMVAPNPVELLLGKRLDELIADLR
A0A0B8T471      THFLADPA--VSLDH--ITYKAN-VGN--GVDVIPIGVIAPNPVELLLSKRLDVLIAQLK
A0A4R7D2K0      THFLADPA--VSLDH--ITYKAN-VGN--GVDVIPIGVIAPNPVELLLSKRLDVLITKLK
A0A2X2J8S4      THYLSDKE--LNLSE--VIYKTE-VSD--NIDIIPIGVIAPNPVELLHSDRLDNLIAELK
A0A3C0S618      THYLSDKE--LNPSE--VIYKTE-ISD--NIDIIPIGVIAPNPVELLHSDRLDNLIAELK
A0A4P7DRF9      THYLADSN--TQIDD--IIYKDR-IAD--GLDIIPIGVIAPNPVELLLSERLDNLFAELK
A0A239XXC4      THYLSDSS--VTVDE--IIYKDR-TDS--EIDIVPIGVIAPNPVELLLSERLDQLIAELK
A0A4U9K473      THYLSDSA--VTIDE--IIYKDR-VDA--DIDIIPIGVIAPNPVELLLSERLDNLIAELK
A0A2T4XEQ1      LELLFDGV---HFDD--VIRETAYP----GIHCLTTGRRSPNPASVAQSDKLKSIVEGVK
A0A2K8ZAP1      SNYLTGEA---DLDNL-LHPIIGHE----NYYIITAGSLPLNPSELLSSPRLANLLQELK
A0A3M1Y2F5      SNGLLGPE---RSHWKKWIIKDVES----QIDILPAGPHLPNSIDLLDTGAFEELIEELP
A0A3D4RLG4      TNYLIGEC---EIED--ILHKDTSY----NFDFLLAGTIPPNPGELIRTDKLVSLLQELR
A0A2T2UAJ4      SQVLY-EG---ELDP--EAYATEVE----NLFVIPAGDTVPNPAELLGSNRMKEFVEALE
A0A6I0DZQ5      TNFLVGQC---KAQD--IIMRPDGA----GFDFIPAGTIPPNAGELIRSEKLRTLFAKLK
A0A3D3LSK1      SDFLFHHV---NFED--IVRDSGFD----NLSVITAGTIPPNPSEMLGSLQMKKFLELVE
A0A496L711      VNYMIGDC---SLNE--AIESTPY-----GFDFLKAGVIPPNPGEFVRSHKLLEMLAELQ
A0A1H6Z2F8      EHIALEKD---LL----IQQCANGP----PFDFIAAGMQS--MDDTMLSPKIAGLIPALK
A0A2P8G5K0      ECIASGHE---PL----IQQNSSET----SFDFLAAGQQSPGTGEIILSPKVADLISTLK
R5DEG6          TNYLSGRI---DNVDEIIQKGELYD----KLDIIHAGPVPPNPAELLLSDRLEALIAELR
A0A4Q3SEI4      AEFLENNE---VPVST-IMYPTSNE----KIFVVPAGYSDVNPTELLLNGDINGLLTKLE
A0A348PT57      STYLSNRD---NLKD--IIRKSELD----GLHFITAGPIPPNPSELIISGNLTKGLDELK
A0A7C3PTI0      STLLIGKD---QVED--CIQHSSLE----NLHFITAGPIPPNPSELIISKKMDEILAHLK
A0A5Q4EKA0      STILSNID---TIDD--CIQPSRVK----NLDFITAGPVPPNPSELILTPRMDEMINYLK
A0A519SYE7      STILIERH---TVAE--CIQHTNIE----SLDFISAGPTPPNPSELILSPHFDQMLAELH
A0A7C7CFR2      STILSGKD---KLED--CINTSTIP----NMDVITAGPIPPNPSEMILSQQMQDLIEKLK
A0A3N2LCI3      ADYLGGAV---SEVDTLIVKTPECQ----NMQVLPIGSIPPNPTELLESPRFGELIGELK
A0A6H9Q899      SDYLGGRI---DKLDEIIVPDPRHK----SMDILPVGTIPPNPTELLFDERLKQAIDAVR
A0A3D4CJE1      STLLIGND---SLNN--CIKHSALK----GLDFITAGPIPPNPSELIINGNLTEIIEELK
A0A7C7LI79      STILSNKD---RIED--CIQSSTLK----NLDVITAGPIPPNPSELIISKKMDELIEFLK
A0A4Q5ZQ60      STILIEKH---SVQE--CIQHSRLS----NLDFISAGPTPPNPSELILNDKFDLVLQELK
A0A519Q885      STILINRH---TVAE--CIQHTSIE----SLDFISAGPTPPNPSELILSPRFDQMLQELH
A0A519TAP8      STILIERH---TLEE--CIQHTSIE----SLDFISAGPTPPNPSELILNPRFDQMLAELH
                                                                            

A0A1T4NDR5      DEYD--IILLDCPPVGIVTDALIVSKYSDGTILVCESDKN-DKKTLIRVKYQFDEVESK-
A0A3D5KRM7      SRYESRIIIFDVPPLFVADDALLYMSYCDAALFVVEDEKN-TVDEIKHSMKILEETNL--
A0A3M1NUH2      ARFD--VIILDTPPVRVATDAALLATQCDLTLVVVRAGQT-REGELEFAMESLAAVGAP-
A0A7C1IBE4      DMADNRLLVLDSPPFHVAAETLVLSQLVDKVVLVVRWGKS-GRENIKKMVDRIGREKI--
A0A2T2TDL4      QYFD--HVIVDSSPVLATADGPLLSDLCETTLCVARAGTT-TEAELDHAMEVLSGIGAN-
A0A359ATS6      SRYD--YILIDCPPIDVVADTAIIEKLADRTIFVVRAGLL-ERSMLVELEKIYNEQKYK-
A0A2E0MDX6      NLYD--VIVIDTPPVGIVTDAFPIISKVDYPVYIVRAHFS-KKVFLKNIQMLRDKKKIK-
A0A2M7KCE1      QIYD--VIIIDTPPLGLVTDALNIFKSCDYPIYVVKAHYS-KRSFLYNLNHLLLEKHIE-
R7JFY1          TRYD--YILLDNVPAGLVADAQIVARLADLTICVIRAGVL-DRRQIPALEML--SRRFP-
A0A1V5S5I3      GNYD--YIFIDCPPIDIVADTQIIEKLADRTVFVVRAGLL-ERDMLPELQRMYDEHRFK-
A0A2M7VVW6      KEYD--LVVLDNPPIGLVSDAMEMLKKADYPIYVFKSEYS-RKNFINNLNKLIVENGIK-
A0A413V760      KRYD--YIIVDNVPAGMVADASIVNRVADLTIFVVRSGVM-DRRQLPELENMYRQEQLR-
A0A656PYT8      KRYD--YVVIDSVPAMAVADALITDRLADLTIYVIREGLL-DRRQLPDIEKLYREKKFH-
A0A1V6HYH8      KYYD--IIILDTPPIGLISDTTKFVLLADTTVYVFRSEYS-KKEFIVNLEKLKQELNPK-
A0A523GUD4      SFYD--YIVVDAPPVIPVSDPLIIGKFVDNVILVAKAGET-PKRVIKRAVDMIHNVEIE-
A0A3D1AEJ6      EMYD--FIVIDNVPAGMVADAMISNRVTDLTLYIIRAGKM-DRRMLPEIEQLYREERLK-
A0A7K3KYQ2      SRFD--YVIIDCPPIEVVADAQIIDKFADRTFFVIRAGLF-DRSMLPELDRLYEEKKYR-
A0A641X2Z6      PDYD--YILIDTPPIMPVTDAAVLSGKVDGLVMLVSSGEV-TPAAAKEAKQRLLQAGAH-
A0A6L8U2P8      TQYD--YIVIDTTPVGIVADAILMMKYASKVLMVIRNNYT-RKDVFANVLSNLKANKMT-
A0A7C6G639      ERYD--YIIVDTSPIGLVADAYSLAPMMDANLFVARSGKT-NKSFFKRLNDQLKDDKLK-
A0A519PJW5      RTYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRANYS-RKAFLKNMNRLMQNNQFS-
A0A519T3R9      RSYD--VIMIDTPPVGLVTDGILIMRKADVPIYIVRANYS-RKTFLKNLNRLLHNNQLS-
A0A7C7CKY6      SSYD--MIVIDNPPVGIVTDGISSIQKADYPIYVVKANYS-KKHYLNSIDRLREESKIQ-
A0A1G1TG88      ESYD--VVMIDTPPVGLVTDGILIMRRADIPIYIVRADYS-RKAFIKNMNRLMRTNNLT-
A0A661XXA6      GLYD--VILLDTPPIGIVTDGLLAMQKADLPIYILRAGYS-KLSFIGNINRLMATGRYP-
A0A519SD85      RMYD--IIIFDSAPVGIVTDSTPILKKADINLFILRCGVS-RQEYINTPEAIKQKLMLD-
A0A3M1TXY5      DEYD--HIIFDTPPIGLVSDYLILMHLTDYNIYVVRHNVT-EVADLKLINELFETGKIQ-
A0A2E0VQ27      WHFD--MVIVDVAPIGLFDDSIVLMRKSTANLFLIRKGTT-RLRQLKPINELLDSFQIP-
R6U429          ARYD--YIFMDCPPVDIVADTSIIAKHADYTVFVIRAGLF-DKRALPAVEDAYERGVYN-
A0A5C8AF42      QTYD--VIIIDNPPIGLVSDGIKNLTEADIPIYVFKSHYS-KRNFAFRVKELFEMQQLN-
A0A353WYK7      SKYD--VVIIDTPPVGLVTDGILALKKSDIALFVVRSGFS-KKSFIQNIDRLVKAHHLD-
A0A355BP94      TRYD--YIVIDTPPVGLVTDGIMAMKRADLSIYVVRANYS-RKEFLSNLERIVSINKLS-
A0A136LSC7      ATYD--YVVIDTPPVGLVTDGVMAMKRSDLSIYVFRANYS-HKDFLQNLARVVTLNKLT-
A0A5C7N8Q5      ANYD--YIVIDTPPVGLVTDGVMAMKRSDLSIYVFRANYS-RKDFLQNLARVVTLNKLV-
A0A239K409      KKFD--YILIDTAPVGQVSDAFSLSKYVDLTVCLVRYNYT-PKHEIENINDILYNNKFK-
A0A1V5S1J9      ETYD--YIVFDTSPIGLVTDAYGIIESVDIILYAVRAEQT-NKSFYKKAMSQLEANNVK-
A0A0A2EYC8      EMYD--YVVIDSSPLGLVADAYALFSTVDIKLLIVRSLKT-NKVEFTDLAKRLYADNVE-
A0A2G6H6Y4      SMYD--YIIIDTSPLGLVTDSYALFPMVDVKLLVVRSFKT-SKREFSELTRRLYMDKVK-
A0A1M3DPL8      KRYE--YIIVDTSPIGVVADAYSFAALSDINLFVIRSNKT-NKQFVKTLSNQLKEDTKS-
A0A1V5F519      KRYD--YIILDSSPIGLVTDSFSLASLADVNLLVVRNNKT-HKDFFKNVVNQIVTDKLS-
A0A2G6R1T9      TRYE--YIIIDTSPI-------------------VRNEKT-NKAFFKRINEQIVSDKFN-
A0A350V3E4      PKYD--YILIDSPPLATVTDAELLSSYVDGTVVVSLASKT-RLDLLVNTIDTLNKINDT-
A0A6J4K208      QEYD--YVILDTPPLGLVSDFLVLLKYTDFNMYIVRHRLT-ERAGLNKINELYNSNRLR-
A0A2W4RDE8      QSYH--TIIIDSPPIGFVSEYIILMKYTDANIYVVRSDYT-TKYNLDRINKLYDERKVT-
A0A0L8VEV2      DMFD--YIVFDNPPLSLVSDGIVIGQKVDINLFVTRQDYS-KKNEVRFIDHVNKKKAMK-
A0A1I2A9Z9      NIFD--YIVFDNPPLSIVSDGIIIGQKVDINLFVTRQDYS-KKNEVKFIDHVHRKKSMK-
A0A212J9Z9      EMYD--YVIIDCSPVGLVSDAYILSEIADTTLFVVRRAKT-NKSFFKSVITQLKYDGVE-
F5IV23          EMYD--YVIIDCSPVGLVSDAYILSEIADTTLFVVRRAKT-NKSFFKSVITQLRYDGVE-
F8X2T0          EEYD--YVIVDCSPVGLVSDAYILSSMADTTLFVVRRAKT-NKAFFKSVITQLGFDGVE-
A0A1M3LAG1      EEYD--YVIVDCSPVGLVSDAYILSSMADTTLFVVRRAKT-NKAFFKSVITQLGFDGVE-
A0A212K6G4      EEYD--YVIVDCSPVGLVSDAYILSSMADTTLFVVRRAKT-NKAFFKSVITQLGFDGVE-
A0A4Y9IPG7      EEYD--YVIVDCSPVGLVSDAYILSSMADTTLFVVRRAKT-NKAFFKSVITQLGFDGVE-
A0A1M5DFS8      TKYD--YVVVDCSPIGLVSDAYILSKYVDTSLFVVRRAKT-NKAFFKSVVNQMRNDGLD-
A0A4Y8KZS5      TRYD--YVIVDCSPIGLVSDAYILSKYVDTTLFVVRRAKT-NKAFFKSVVNQMRNDGLE-
A0A2V3PNY7      SKYD--YVIVDCSPIGLVSDAYILSKYVDTTLFVVRRGKT-NKAFFKSVVSQMRNDGLE-
A0A6G7X5K8      TKYD--YVIVDCSPIGLVSDAYILSKYVDTTLFVVRRAKT-NKAFFKSVVNQMRNDGLE-
A0A2P8CDS1      EEYD--VIVIDSSPL-LVADLFQYSHLCNAYLYVSRQGVT-PQPAIKSALQEISNQHIR-
A0A660LQT8      ERYD--YIFLDCPPVEIVADAAIISRHADLTLFVVRAHLL-ERSMLPEINDFYRSNRYP-
A0A389LWV6      KEYE--YIILDCSPVGLVSDAHFLAKLADVVLYVVRNEKT-NRNFFKHTISEFKGDVTSG
A0A1G9B1T9      MEFK--FVVLDTPPVKIVTDALVLSAYSDINILVARRGVT-SKSQLMDVEELHQNNTLH-
A0A350PNH9      GEYD--YVFIDCPPVEIVADTQIIEKLADRTIFVVRSGLM-QRSMLGDIEQFYKDKKFK-
A0A354LNT9      GEYD--YVFIDCPPVEIVADTQIIEKLADRTIFVVRSGLM-QRSMLGDIEQFYKDKKFK-
A0A161LWY6      MRYH--YVIIDTSPVGIVSDAYPLAPISDCVIYITRSRKT-NKKFFKSVINQLKTDRMQ-
A0A6I3N9U6      SRYH--YVIIDTSPVGIVSDAYPLAPISDCVIYITRSRKT-NKKFFKSVINQLKTDRMQ-
A0A3D0FMX4      SEYD--YIVIDSSPIGLVTDAYALIERSDITLFVVRYNKT-QRNFCREVLAQMEEDGKQ-
A0A1M3MEI8      EYYD--YIIVDTSPIGVVADAYSFADLSDINLFIVRSDKT-HKLFLRTLTAQLKSDNVH-
A0A1J5HQM0      NRYE--FIVVDTSPIGIVADAYAIAHLSDINIFVARSGKT-SKSHFAKISKQLKSDNV--
A0A653AC35      SRYD--YVIVDTSPIGLVADAYSLAPLMDANIFVVRSEKT-NKSFFKKLNAQLKADNIK-
E4T131          TRYD--FIIVDSSPIGMVTDAYSLAQHSDVNLFVVRNGKT-NKTFFKKLCAQLKLDNIP-
A0A2W7RD29      DQFD--IIILDTPPLGIVSDSMSLFPLVDVSLLAFKCGYN-NHKGIVELNKLKSNDFIK-
A0A3N2NDY8      KEYD--YIFVDCPPTDVVVDTQIVEKYVDRTIFVVRAGLL-DRKALEEIDAIYRNKRFK-
D7JEV9          SMYD--YIIIDSSPLGLVADAYALFSVVDIKLLVVRSFKT-NKMEFTDLSKRLYSDNIE-
A0A4R6H3B7      NIFD--YIVFDNPPLSIVSDGIIIGQKVDINLFVTRQDYS-KKNEVKFIDHVHRKKSMK-
A0A521H707      SKYD--IIIIDTPPVGIVTDGVEIIQNADYPIYIIRAHYS-KRMFMQNLNKLIEEYKIR-
A0A1F3D6P8      KEYD--YIIVDTSPVGLVADATQLIRYATHILLVTRINYT-RKDILEHVLKNFSSNRIT-
A0A356Z058      KEYD--YIIVDTSPVGLVADATQLIRYATHILLVTRINYT-RKDILEHVLKNFSSNRIT-
A0A3D1BT36      DNYE--YIIIDTTPSGMVADAAQLIKYSSINLLVCRNNHT-RKDVFNSVLNFYKTHNIE-
A0A5R9QZP0      NDFN--YVIIDSTPTGLVSDAVALMNYASHILMVCRNNHT-IKNVFFDVLNFFKANRID-
A0A3D3HL11      QQFD--YVIIDSTPAGLVADATLMIKYASYILLVCRNDYT-RKDVFTDVLNLFRTNNIT-
A0A6L8U6G9      GNFD--YVIIDSTPAGLVADASLMVKYASFILLVCRNEYT-RKDVFTDVLNLFQTNNIN-
A0A352ME00      TKYD--YIIIDTTPVGIVADAILMMKYASKVLMVIRNNYT-RKDIFANVINNLKSNKLT-
A0A6L8UH35      SRFD--YIIIDTTPVGIVADAILMMKYASKVLMVMRNNYT-RKDILVNVINNLRINKLN-
A0A3P1Z8V4      QHYD--FILLDTTPCFAVADAGIVSRVAEVTLFVMRVGVQ-SKHGLPAVAELYRSRKIG-
A0A1M6MYT6      KQYD--VVIVDTPPVGMVADFFLLRDMFDAAVFIVRHKST-PKKPLKDILEELESHQIE-
A0A2W7QSQ0      SSYD--HIIIDTSPIGLVADAYSLSEIVDLVVYVVRMNYT-RVDNLHALAEIIDENIFK-
A0A3D5KRY6      EQFD--YIIFDNAPIGVVFDGSLIGRHADINLILLRLNFS-QKSEISAINKIGHEGILK-
R7F6L5          QEYD--FIFFDCPPIEVVADSRILNEYVDTTIFVIRAGLF-DRRMLKSIRNLYAERRYN-
A0A7C5MRV2      KQYD--YILIDTPPIGLVTDGTTILKLSDIALYVIRADYS-KKSFASNPDQLVEDHDIK-
A0A229I3A5      EEYD--YVFIDCPPIEVVADTPIYEQFADRTIFVVRAGLM-ERSMLPEVNALYKEKKFK-
A0A3R6HJB3      EEYD--YVFIDCPPIEVVADTPIYEQFADRTIFVVRAGLM-ERSMLPEVNALYKEKKFK-
R6NN15          TRYD--YILIDCPPIELVADTHIIGKYADRTIFVVRAGLL-ERSMLPELEALYIEHKFK-
A0A553GA49      TRYD--FIILDAGPTSVTAESLVLGKMADLILVVMRVNYT-LKKEFKEIIEELDGSFGK-
A0A497D6F6      STYD--MIIVDTSPVGVVADTLQITSQFDIIIFVVRQRMT-KKQVFKSAIEELQNFNVD-
A0A5M4AAB9      QEYE--TIIIDSSPL-LVADVFQFSNLWDTLLFVTRQGIT-LKPAAKSALQEISSQNTN-
F4KR18          SKYD--VIIIDSSPIGVVSDGMLLNNYVDNTLFVVRSNFT-KKATIAKAREIFEQNKLV-
A0A2M6GH67      QLYD--VIIVDTPPIGIVTDGTLVMRKADIPIYIVRADYS-KKEFLKNINKVIKTNKFN-
A0A7K1TE30      RNYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRANYS-RKAFLKNLNRLMRNNQFN-
A0A7D4BE70      LTYD--VIMIDTPPVGLVTDGILIMRKADVPIYIVRANYS-RKSFLKNLNRLMRNNQFT-
A0A142HHS5      RTYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRANYS-RKTFLKNMNRLMRNNQFT-
A0A7D4C435      KIYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRANYS-RKTFLKNMNRLLRNNQFT-
C9LKL0          ELYD--FIIIDTTPILAVSDASIVDRVADVTLFVIRVGVQ-VRAFLPELEKMNKDKKYR-
A0A3D0QPV7      RIYD--IVIVDLPPVGLVTDGIPIVQMADYPIYVFRANYS-KKNFVQNADRLVNENNIQ-
A0A496KT23      EEYD--IIFLDCPPVEIVADAEIINPHADLTLFIVRASLM-ERSYLKDIERWYAEKKYN-
L1M9T3          QEYD--LIFIDCPPVEIVADAEIINPVADLTLFVVRAGLM-ERSFLNDIERWYLDKKFH-
A0A3C0I8F1      LSYD--VIILDTPPIGLVTDGVLLMQKAEVPIYIFKANYS-KKAFSKSINKLILKNNFT-
R5JJI4          KRYD--YIIVDNVPAGMVADASIVNRVADLTIFVVRSGVM-DRRQLPELEKMYREEQLC-
A0A0A2DQN2      RRYD--YVIMDNVPFGVVADASIVNRAADLTLFIIRAERM-DRRMLPELERLYQEQVLT-
A0A0A2F2N5      ARYD--YVLIDGVPFGIVADATIVNRVVDLTLFILRSGTV-DRRVLPDLQLLYDEKILN-
L1NGW4          DRFD--FVIFDNVPFGSVADAAIANRIADLTIFVLRAARL-DKRALPELQRLYDNEILR-
Z4WRA0          DRFD--FVIFDNVPFGSVADAAIANRIADLTIFVLRAARL-DKRALPELQRLYDNEILR-
U2K8K9          EQFD--FVVFDNVPFGSVADAAIANRVADLTIFILRAAKL-DRRALPELQRLYDDHILT-
A0A069ZM60      EQFD--FVLFDNVPFGSVADAAIANRIADLTIFVLRAGRL-DRRALPELQHLYDENILT-
J6GV98          EQFD--FVLFDNVPFGSVADAAIANRIADLTIFVLRAGRL-DRRALPELQHLYDENILT-
A0A134B4F8      EQFD--FVLFDNVPFGSVADAAIANRIADLTIFVLRAGRL-DRRALPELQHLYDENILT-
A0A134B8C7      EQFD--FVLFDNVPFGSVADAAIANRIADLTIFVLRAGRL-DRRALPELQHLYDENILT-
A0A3D2HF71      KDFE--FIIIDTPPAAVVTDALLLADLADFYIFVVRQRFS-SKNTVELIEELYRNETIG-
A0A4Z0EKR0      ENFD--YIIMDTPPVGQVADAFTFSAFADISIYLVRYNMT-IKSQLKIIRNIYKSKSLI-
B5CTK0          TRYD--YIIVDNVPAGMIADAAIVNRIADWTLYIVRAGVL-DRKQLPDVDALYKSGQFT-
A0A1M6B6D5      DQYD--YIILDSPPMGLVSDALVLTKHVDATLYMVRQNYT-HKNMLTFVNEKFRRGEVK-
A0A451FS66      ERYD--YIILDSPPIGLVSDAMEIIKYADATLYMVRHNRT-RKNMLTFVNEKYKRGEIK-
A0A2E3GN39      TSFD--VVIFDTPPIGLVTDSIPVISTVNNPIYVLRADYS-HRSFVGHIESTKENLQVP-
A0A3D1MEL0      TSFE--VVIFDTPPIGLVTDAIPVISGTNNPIYVLRADYS-HRSFVGHIESTKDNLKVT-
A0A519UDD1      KSFD--YILIDTPPVGQVSDAFALKPLIDLTIYVVRYNYT-KKAQLTIPRNIYNSKTLS-
A0A2A4N9A6      KQYD--LIVIDTPPIGIVSDGIDIIRKADYPLYIFRADYS-KKDFVKIMNKLMNDHKIS-
A0A6C0GGI1      AEYD--YVIVDTPPLSFVAEYMILKEYLDANIFVVRANYT-KREVLDTINELYESKAIN-
A0A368D1N7      TLFE--VVIFDTPPIGLVTDAIPVISRANNPIYVLRADYS-HREFVGHIESIKDNLKVP-
A0A3B8TU58      TSFD--VLVFDTPPIGLVTDSIPVISKVNNPIYVMRADYS-HRSFVGHIESTKENLQIP-
A0A1T5IIR6      QKYD--YILLDGVPIQMLADPIVLNRVVDINLFILRSGQL-DRRILPQLDELNDKHHLH-
A0A3E0QD27      SKYD--VVIIDTPPVGIVTDGVDVIQNADYPIYIIRAQYS-KRMFINNLNRLIEESKVR-
A0A6N8DCX3      ARYD--YIFIDCPPVDIVADTQILEKVTDRTFFVVRAGLM-ERNMLPEVENLYKQKKLK-
F0R0C9          DRYD--YIFIDCPPIEIVADTQIIEKVADRTLFIVRAGLL-ERSMLAELETIYQEKRFK-
A0A0M1W1I6      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPELEKIYRSGQLN-
A0A4R4GHU2      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPELEKIYRSGQLN-
I8WPR6          NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPELEKIYRSGQLN-
A0A0K2HKS3      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPELEKIYRSGQLN-
B6W3W8          NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPELEKIYRSGQLN-
A0A7M3EEL4      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVIRVGKL-DRRMLPELEKIYRSGQLN-
A0A076IRY8      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-
A0A3A6AD54      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-
A0A3A6MIU7      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-
I8WPP8          NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-
A0A372Y7D2      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-
A0A7K3KFI2      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-
A0A3E4JJC9      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-
A0A3E4WDQ0      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-
A0A414H9P2      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-
A0A7K0JKU9      NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-
C3R5A8          NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-
A0A1C5XJA7      KRYD--YIVVDNVPVGLVADATIANRIADITIFVVRAGRL-DKRQLPDIEKLYQEKVLN-
A0A285T4L1      KRYD--YVIVDNVPVGIVADATISNRISDLTIFVVRAGKL-DRRQLPDLEELYRDNKLC-
A0A3E5BU42      KRYD--YVIVDNVPVGIVADATISNRISDLTIFVVRAGKL-DRRQLPDLEELYRDNKLC-
R7CUW4          TRYD--YIIVDNVPVGIVADATIANRIADLTVFVVRSGRL-DRRQLPDIESLYEDKKLH-
A0A416GGJ1      TMYD--YVIVDNVPIGIIADASIANRVADLTLFVVRAGSV-DRRLLPEIEDLYENKKLN-
D1JY72          NRYD--YIFVDNVPVGVVADAAITNRIADLTIFVVRVGKL-DRRMLPELEKIYRSGQLN-
A0A7G5NJU1      QRYD--YIIVDNVPVGIVADATITNRISDLTIFVVRAGRL-DRRLLPDMEELYRDNKLR-
D7J4K6          QRYD--YIIVDNVPVGIVADATITNRISDLTIFVVRAGRL-DRRLLPDMEELYRDNKLR-
Q8ABP9          QRYD--YIIVDNVPVGIVADATITNRISDLTIFVVRAGRL-DRRLLPDMEELYRDNKLR-
D6D2Z5          QRYD--YIIVDNVPVGIVADATITNRISDLTIFVVRAGRL-DRRLLPDMEELYRDNKLR-
A0A1T3EDR4      LKYD--YVIVDGVPMGIVADANIIDRISELTLFIIREGKL-DRRMLAELENIYQERKLS-
A0A6N8KXI9      EVYD--YIVVDSVPIEIVADGYISNRVTDLTLFVIRSGKM-DKRQLPEIEKVYQNHKLK-
A0A174SDD8      ERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-
A0A1H7RFH3      ERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-
A0A139L1N2      ERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-
A0A174TVL8      ERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-
A0A1H8BJR6      ERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-
R9H6G0          ERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-
A0A412GR09      ERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-
A0A7J5JXN6      ERYD--YIIVDNVPIGLVADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-
A0A081PBV5      KRYD--YIIVDNVPVNLVADASIVDRISELTIFVVRSGKM-DRRQLPEIQSLYDQRKIS-
A0A1I2AN85      KRYD--YIIVDNVPVNLVADASIVDRISELTIFVVRSGKM-DRRQLPEIQSLYDQRKIS-
A0A4U0GMP3      SNYD--YVIVDNVPVALVADAAIVDRISELTLFVVRAGKM-DRRQLPELDKLHRQGKLT-
A0A1H6CKR6      ERYD--YIIVDNVPLGIVADADIVNRITDVTIFVVRAGKM-DRRQLPDIQKLYSSGSLT-
A0A235E1C0      ERYD--YIIVDNVPLGIVADADIVNRITDVTIFVVRAGKM-DRRQLPDIQKIYDSSALT-
R6D982          ERYD--YIIVDGVPVGMVADVSISNRISDVTLFIVRAGKL-DKRQLPELERLYQEHKLN-
A0A1F0I8C4      RRYD--YIIVDNVPIGVVADASVVNRISDLTLFIVRVGKL-DRRQLPELERLYQEHRLN-
A0A3A5RIJ2      RRYD--YIIVDNVPIGVVADASVVNRISDLTLFIVRVGKL-DRRQLPELERLYQEHRLN-
A0A515IZJ5      RRYD--YIIVDNVPIGVVADASVVNRISDLTLFIVRVGKL-DRRQLPELERLYQEHRLN-
A0A7J4Y2H6      RRYD--YIIVDNVPIGVVADASVVNRISDLTLFIVRVGKL-DRRQLPELERLYQEHRLN-
A0A0D5BSQ0      ERYD--YVIIDGVPVGIVADASIIDRVADLTLFIIRVGKM-DRRQLPEIEKIYQEKKLS-
A0A1T3F6P5      GMYD--YVIIDGVPTGVVADASIIDRVADLTLFIIRIGKM-DRRQLPEIEKLYQEKKLS-
A0A0W8EPA0      GMYD--YVIIDGVPTGVVADASIIDRVADLTLFIIRIGKM-DRRQLPEIEKIYQEKKLS-
A0A365UKN1      GMYD--YVIIDGVPTGVVADASIIDRVADLTLFIIRIGKM-DRRQLPEIEKLYQEKKLS-
A0A4R6WE41      LRYD--YIIVDGVPVAIVADGSIISRISDLTLFVIRAGKM-DRRQLPELEKLYQSNKLA-
A0A2T5RP38      ERYD--YVIIDGVPVGIVADASIIDRVADLTLFIIRIGKM-DRRQLPEIEKIYQEKKLS-
A0A1A6CF06      NRYD--YIIIDGVPTGVVADASIIDRVADLTLFIIRIGKM-DRRQLPEIEKIYQEKKLS-
A0A1T3D6S8      GMYD--YVIIDGVPTGVVADASIIDRVADLTLFIIRIGKM-DRRQLPEIEKLYQEKKLS-
A0A1P8E011      NRYD--YIIIDGVPTGIVADATVVDRVSDLTLFVIRAGKM-DKRQLPEIQKIYAEKRLS-
A0A1V3N3U3      KRYD--YIVVDGVPLGIVADASIVDRISDLTLFMIRAGKM-DRRQLPEIEKIYRDRKLS-
C2FUH6          NRYD--YIIVDGVPVGLVADASIVNRISDLTIFMVRVGKM-DRRQLPEIEKIRQEGKLS-
A0A0B8T471      ERYR--YIVVDNVPIDLVADAAVVNRISELTVFVVRAGAM-DRRLLPEIEKIYRKGKLN-
A0A4R7D2K0      ERYR--YIVVDNVPIDLVADAAVVNRISELTVFVVRAGAM-DRRLLPEIEKIYRKGKLN-
A0A2X2J8S4      KQYD--YIIIDSVPVEIIADAYITDRVSELTIFVIRSGKM-DKRELPDIEKIYQSKKLS-
A0A3C0S618      KQYD--YIIIDSVPVEIIADAYITDRVSELTIFVIRSGKM-DKRELPDIEKIYQSKKLS-
A0A4P7DRF9      NRYD--YIIVDNVPLGIVADAKIVNRITDVTLFVVRAGKM-DKRQLPEVQKIYESGDLT-
A0A239XXC4      ERYD--YIIVDNVPLGIVADADIVNRITDVTIFVVRAGKM-DRRQLPDVQKIYDSSALT-
A0A4U9K473      ERYD--YIIVDNVPLGIVADADIVNRITDVTIFVVRAGKM-DRRQLPEIQKIYDSGSLT-
A0A2T4XEQ1      DQYD--YVVIDSAPYGIITDAAPMMKMADGIVVSVRFNKT-QTNELAQTLENLENIHVS-
A0A2K8ZAP1      ERFE--YILVDSPPIGLVTDSQVIAPYADATIFVVRHDHT-PKNYIKMVDALYKEQRFQ-
A0A3M1Y2F5      LHYQ--YVIVDLPPIMQASDYMLVEKWLDFTAFVVRHQQT-RLQDLERINELFEQERIG-
A0A3D4RLG4      KQYD--FIIIDTSPIGQVPDAFALIEQTDLTLYVIRCMQT-NKYFCKNTLQQMEADYKD-
A0A2T2UAJ4      AKFD--YVLIDTPPALLFSDVLGLAPRCDGTLLVVAAGET-DGRAFDHAAEMLADGEAD-
A0A6I0DZQ5      EYYD--YIIVDTSPIGVVADAYSFADLSDINLFIVRSDKT-HKLFLRTLTAQLKSDNVH-
A0A3D3LSK1      SKYD--IVILDSPPLISVTDSEILYNLTDGTVLVAQAEKTDKKAFFKTYNQLKRINPHN-
A0A496L711      SMYD--YIIIDSSPLGLVADAYALFSVVDIKLLVVRSFKT-NKMEFTDLSKRLYSDNIE-
A0A1H6Z2F8      AGYD--YVLLDSPPVGLVADARLLGPYADMTLYIVRQHFT-FIHQLAELQKASEQ--LP-
A0A2P8G5K0      IRYD--YVLLDSPPVGLVADARLLGAHADMTLYIVRQHFT-FIHQLAEIQNARNQSLLP-
R5DEG6          ERYD--YIILDNVPAGVVADAVIVNRVADLTIYVVRAGRM-DRRALPEVEKLYREGKLR-
A0A4Q3SEI4      ATFD--FVLIDTCPVDPVTDAYILSESCDLTVFVVRHNFT-PKSMIEMLEESHKVGALK-
A0A348PT57      KIYD--IIIIDNPPVGLVTDGIASLKLADYPIYIFRNEYS-KKSFIDNINRIFIENKIT-
A0A7C3PTI0      TQYD--VIVIDNPPVGLVTDGINIIQKADYPIYIFRAEYS-KRNFIQNVDRLFNENGIK-
A0A5Q4EKA0      SKYD--YVIVDNPPVGIVTDGMKSILMADYPIYIFKANYS-KRMFIQNVNRLIGESHIS-
A0A519SYE7      RTYD--VILIDTPPVGLVTDGILIMRKADVPIYIARANYS-RKVFLKNLNRLMSNNQFT-
A0A7C7CFR2      LKYD--MIVIDNPPVGIVTDGISIIQQADYPIYVFRANSS-KKNYISNVDRLITESKVK-
A0A3N2LCI3      SRFD--YVIIDCPPIEVVADAQIIDKFADRTFFVIRAGLF-DRSMLPELDRLYEEKKYR-
A0A6H9Q899      ERYD--YVLIDCPPIELVADTQIIEKLGDRTIFVVRAGLL-ERSMLAELEKIYGEKKYK-
A0A3D4CJE1      QTYD--LVIIDNPPIGLVTDALYTISMADYPIYVLRANYS-KKEYLKNAYRIYEENNIH-
A0A7C7LI79      TKYD--ILVIDNPPVGIVTDGISIIQNADYPIYVFRADFS-KKNYVKNVDRLINESNIG-
A0A4Q5ZQ60      EIYD--VILIDSPPVGLVTDGILIMRKADVPLYIVRANYS-KKVFLKNVNKLIKGHGFS-
A0A519Q885      RHYD--VIMIDTPPVGLVTDGILIMRKADIPIYIVRANYS-RKTFLKNLNRLMRNNQFG-
A0A519TAP8      RSYD--VILIDTPPVGLVTDGILIMRKADVPIYIVRANYS-RKAFLKNLNRLMSNNQFS-
                       :..*  *                                              

A0A1T4NDR5      VLGVVITKAD---------------------------FGKKYY-----S-HYN-------
A0A3D5KRM7      -LGIVLNKSRQPI-------------P-----------SYKYG-----Y-GYG-------
A0A3M1NUH2      AIGTVFNGFDVSM-------------A----------YGYKYR-----Y-RHY-------
A0A7C1IBE4      -IGVVFNAFEFNI-------------LDKKIQGVGYHNYYAEE-----Y-Y---------
A0A2T2TDL4      VAGVVFNGFDISM-------------A----------YGYKYR-----Y-RHY-------
A0A359ATS6      NMCVILNGTTGNG-------------G-------RYGYGYRYG-----Y-KYG-------
A0A2E0MDX6      NLSVILNGAGGDK-------------KYGGFRKYGYGYGYGYG-----Y-GYG-------
A0A2M7KCE1      NLSVVVNGIDIEK-------------S-----RYG---GYNYG-----Y-GYG-------
R7JFY1          KFSLVLNYVKGHH-------------G-------GYGYGYGYG-----Y-GYG-------
A0A1V5S5I3      NMALVLNGTDGGN-------------S-----RYGYRYGYHYD-----Y-GSK-------
A0A2M7VVW6      KLSIVLNGVDYSN-------------K--YY-SYGYNYNYSYG-----N-KDG-------
A0A413V760      NMSVILNGVPSDH-------------K-----GYGYGYGYGYG-----Y-GYG-------
A0A656PYT8      NMSIVLNGSTGGA-------------R-RGY-GYGYGYGYGYG-----Y-GYG-------
A0A1V6HYH8      EIIIVLNGFNDKF-------------IKQSK-YGKYGYEYKYD-----I--YG-------
A0A523GUD4      ISGIILNNMRNVL-------------P----------YYYDHK-----Y--YG-------
A0A3D1AEJ6      NMAVILNGTGSGI-------------G----------YGYGYG-----Y-GYG-------
A0A7K3KYQ2      NMSFILNGSRNDQ-------------GRYGY-SHTYRYGYGYG-----Y-GYG-------
A0A641X2Z6      ILGVILNKVELAH-------------T---H-GYGYYYYYGSD-----S-TSG-------
A0A6L8U2P8      NFDIIYNDLSLHK-------------S-----------SYRH------------------
A0A7C6G639      HFYVILNDINMDA-------------S---R-YGGYTKNYGYG-----Y-GYS-------
A0A519PJW5      RMCTILNDAKAAG-------------S---Y-GYGY--GYGYG-----Y-GYG-------
A0A519T3R9      RLCTILNDAQAQG-------------S------YGY--GYGYG-----Y-GYG-------
A0A7C7CKY6      NMAVILNGVEFGK-------------GLGQ--------NQNLG-----Y-GYS---YG--
A0A1G1TG88      RMCTILNDAQSKG-------------AYGY--------GYGYG-----Y-GYGSGTYG--
A0A661XXA6      NLSVILNNVSNKK-------------T-------------GFG-----Y-SYGDVYTS--
A0A519SD85      NIYIVFNDFLPDN-------------FFSHYNKSKQILPYPNGYYSSYYQSI--------
A0A3M1TXY5      NIGLLLNGVASLS-------------DYGYL-------DTDYGING--YVKKGKKRKR--
A0A2E0VQ27      NLYLVLNGVRQKA----------KKGAYAR------------------YLKKRKPAPA--
R6U429          HMAVILNGVDTTS----------KSYGYGHY-------GYGYG-YG--Y-GYG-------
A0A5C8AF42      QLNVILNGVQTSK----------RSSAYGY--------GYGYN-YG--YGYYE-------
A0A353WYK7      QSSIIFNANRSSK-------------------------NYGYGSYGKSY-GY--------
A0A355BP94      HVAVVLNALPTSG-------------------------KT----YG--Y-GY--------
A0A136LSC7      HVSSVLNAIPLSG-------------------------NY----YG--Y-GY--------
A0A5C7N8Q5      HVSTVLNAIPLNG-------------------------KY----YG--Y-GY--------
A0A239K409      QPMIVLNGAKKFN-------------SNKY--------GYGYGYVK--K-----------
A0A1V5S1J9      KVGLIFNDVNLKKLEYS---------RYYD--------SYG----S--Y-GKKSGYYY--
A0A0A2EYC8      DIYVILNDVDKSKV------------GYGY--------GYS----K--Y-KKMGNYYV--
A0A2G6H6Y4      NVYIILNDVDRSKTGYGYGYG----YGYGY--------GYG----G--S-KKNNAYYV--
A0A1M3DPL8      RFYSILNDVEIESASYSQYYSRKYVYGRSK--------SYGLGTYG--Y-GYGYGYTS--
A0A1V5F519      NFYVVFTDVETD--------------GNYY--------SYK---YG--Y-SSKYGYYT--
A0A2G6R1T9      NFYIVLNDINITSKAYGR-------YGYGY--------GYG---YG--Y-GYGYGYGY--
A0A350V3E4      FIGVILNNFDYQA-------------TYGS--------YYKYY-YY--Y-----------
A0A6J4K208      NVGILINGARALS-------------------------AYGYSDKT--Y-KYG-------
A0A2W4RDE8      NISILLNDVKYSR-----------------------VNGYSYS-YK--Y-----------
A0A0L8VEV2      NAGIILNDIHLSK-------------------------HAHVGAYG--A-DYSHRKNS--
A0A1I2A9Z9      NPGIVLNDIHVSK-------------------------HAHVGSYG--A-DYSYKKKS--
A0A212J9Z9      DIALVFNDVKGRE-------------------------GY-YGTSR--Y-----------
F5IV23          DIALVFNDVKGRE-------------------------GY-YGTSR--Y-----------
F8X2T0          NIALVFNDVKGRE-------------------------GY-YGTSR--Y-----------
A0A1M3LAG1      NIALVFNDVKGRE-------------------------GY-YGTSR--Y-----------
A0A212K6G4      NIALVFNDVKGRE-------------------------GY-YGTSR--Y-----------
A0A4Y9IPG7      NIALVFNDVKGRE-------------------------GY-YGTSR--Y-----------
A0A1M5DFS8      HVAIVFNDVKGRE-------------------------GY-YGTSR--Y-----------
A0A4Y8KZS5      HVALVFNDVKGRE-------------------------GY-YGTSR--Y-----------
A0A2V3PNY7      HAALVFNDVKGRE-------------------------GY-YGTSR--Y-----------
A0A6G7X5K8      HAALVFNDVKGRE-------------------------GY-YGTSR--Y-----------
A0A2P8CDS1      NVGILLNDIRINN----------QPLGDRY--------NYSYM-YG--Y-GYK-------
A0A660LQT8      NMVTVLNGTLDTY-------KSYGHHRYGY--------RYGYR-YG--Y-GID-------
A0A389LWV6      KMAIIYNDVDLDG-------------NYYASRNYYGKSSYYHKHNS--Y-----------
A0A1G9B1T9      NLYVVLNDVQATK-------------------------GHGY--YE--------------
A0A350PNH9      NMSLILNGTKAQG----------GRYGHYY--------RYGYH-YG--Y-GYG-------
A0A354LNT9      NMSLILNGTKAQG----------GRYGHYY--------RYGYH-YG--Y-GYG-------
A0A161LWY6      HVGVVLNDIDANT----------G--GYGY--------NYSYQRYG--YGTYGNNPVT--
A0A6I3N9U6      HVGVVLNDIDAKT----------G--GYGY--------NYSYQRYG--YGTYGNNPVT--
A0A3D0FMX4      NIYIVFSDLPHER-SGRYN-YNSKSYHYGYG------YGYGYGGYG--Y-GYG-------
A0A1M3MEI8      DFYSILNDVELKS-NS-YSRYYSRKYAYGNSRRYGTKSGYGY-GYG--Y-GYG-------
A0A1J5HQM0      EAYCILNDVMSEE-SR-YSRYYSRRYGYGYG------YGYGS-GYG--Y-GYG-------
A0A653AC35      NLYLVINDVDSQK-SSYYGRYSN--------------YGYGY-GYG--Y-GYG-------
E4T131          QLYTVLNDVLDDE-SK-YTKYKL--------------YKYAY-LFG--F-SYG-------
A0A2W7RD29      KVYCILNGVDSHY-------------HIGS--------NKNYGYYE--V-----------
A0A3N2NDY8      QMSIVLNGTEAAS-------------------------RKSYGAYG--Y--YG-------
D7JEV9          DIYIILNDVDKSK----------I--------------GYVYG-YG--Y-GMHKKMGN--
A0A4R6H3B7      NPGIVLNDIHVSK-------------------------HAHVGSYG--A-DYSYKKKS--
A0A521H707      NLAVVLNGVETSK----------F--------------KYGYG-YG--YGYGYGYGYG--
A0A1F3D6P8      NYDAVLNSLPLDT----------S--------------PYR-------------------
A0A356Z058      NYDAVLNSLPLDT----------S--------------PYR-------------------
A0A3D1BT36      NFDIIYNDVEIKE----------S--------------RYG-------------------
A0A5R9QZP0      NFDIVYNDLDKKK----------S--------------TYG-------------------
A0A3D3HL11      DYDIVFNDLNLKK----------S--------------RYG-------------------
A0A6L8U6G9      NFDIVFNDLNLKK----------S--------------RYG-------------------
A0A352ME00      NYDIVYNDLNLHK----------S--------------SYR-------------------
A0A6L8UH35      NYDIVYNDLNLHK----------S--------------SYR-------------------
A0A3P1Z8V4      NICLVINDCDIKA----------R--TYGY--------GYGYG-YG--Y-GYG-------
A0A1M6MYT6      ELGIIVNNVYRTK----------SNRGYGY--------GYGYG-YG--Y-GYG-------
A0A2W7QSQ0      QNFVVLNDSNEYS-------------------------GSKFG-YG--Y-----------
A0A3D5KRY6      HVAIILNEIPQVE-------------------------GYGY--YS--EDGKS-------
R7F6L5          NMCLLLNGTSVGH---------NYGYGYGY--------GYGYG-YG--Y-GYG-------
A0A7C5MRV2      NLYIVLNSVSAAN----------R--RYG---------GYGYKVYG--S-GYY-------
A0A229I3A5      NMTLILNGTKAHG-----------G-RYGS--------HYGYG-YG--Y-GYG-------
A0A3R6HJB3      NMTLILNGTKAQG-----------G-RYGS--------HYGYG-YG--Y-GYG-------
R6NN15          NMTVLLNGTEGNG-----------SYRYGY--------RYGYH-YG--Y-GSS-------
A0A553GA49      KVTVVLNGVKVSR-------------QRYY--------NYSAY-YA--KPNLN-------
A0A497D6F6      KLGVLFNDVSSRD----------MKHGYGY--------TLGYG-YG--L-GYG-------
A0A5M4AAB9      RLGLLLNDISINN----------QFDRYNNH-------SYGYG-YE--N-NYK-------
F4KR18          NPAIIFNGVKKQN----------DAYGYSYK-------DYGYA-----------------
A0A2M6GH67      KLTVILNDAKAQG-------------GYGY--------GYAYG-YG--Y-SNSYYDLE--
A0A7K1TE30      RMCTILNDAQAQG-------------AHGY--------GYGYG-YG--Y-GYGYGSYG--
A0A7D4BE70      RMCTILNDAKAQG-------------SYGY--------GYGYG-YG--Y-GYGYGTYG--
A0A142HHS5      RMTTILNDAKAQG-------------SYGY--------GYGYG-YG--Y-GYGYGTKG--
A0A7D4C435      RMCTILNDAKAEG-------------SYGY--------GYGYG-YG--Y-GYGYG-HG--
C9LKL0          HLCIALNDVDVKA-----------KYGYGY--------GYGYG-YG--Y-GYGNYSYG--
A0A3D0QPV7      RLSVVLNSVDTDR--------GSSGYNYGY--------GYGYG-YG--Y-GYTYGGNY--
A0A496KT23      NLTLLLNGTTDAL----------G--RYGYHKY-----GYGYGGYG--Y-GYG-------
L1M9T3          NLTLLLNGTTDAL----------G--RYGYHKY-----GYGYGGYG--YGGYG-------
A0A3C0I8F1      NLSVVLNAVNKRF-------------SYGY--------GYGYG-YG--A-YYGKRSVA--
R5JJI4          NMCVVLNGVSYER----------RSYGYGY--------GYGYG-YG--Y-GYG-------
A0A0A2DQN2      NMAIILNGVNHNS----------SSYGYGY--------SYGYGYYG--Y-GYG-------
A0A0A2F2N5      NMAIVLNGISSQN----------KGYGYGY--------GYGYG-YG--Y-GYG-------
L1NGW4          NMSIVLNGASDGG----------HGYGYGY--------GYGYG-YG--Y-GYG-------
Z4WRA0          NMSIVLNGASDGG----------H--GYGY--------GYGYG-YG--Y-GYG-------
U2K8K9          NMAIVLNGATESG----------H--GYGY--------GYGYG-YG--Y-GYG-------
A0A069ZM60      NMSIVLNGATESG----------H--GYGY--------GYGYG-YG--Y-GYG-------
J6GV98          NMSIVLNGATESG----------H--GYGY--------GYGYG-YG--Y-GYG-------
A0A134B4F8      NMSIVLNGATESG----------H--GYGY--------GYGYG-YG--Y-GYG-------
A0A134B8C7      NMSIVLNGATESG----------H--GYGY--------GYGYG-YG--Y-GYG-------
A0A3D2HF71      RIGIVMNDISLTG-------------YYGYGLRYGYAGGYGYS-YG--Y-NYY-------
A0A4Z0EKR0      APMIVLNDAKQSN-------------GNNY--------GFGYG-YG--Y-PVK-------
B5CTK0          NMALILNGVDFKH-------------AHKY--------GYGYG-YG--Y-GYG-------
A0A1M6B6D5      HISIVINEYVEKS-------------GK----------GYGYG-YG--Y-GYG-------
A0A451FS66      HISIVLNEYVEKS-------------GRGF--------GYGYG-YG--Y-GYG-------
A0A2E3GN39      SLSIIMNDYGRGVSGSYYNYGYGYGYGYGY--------GYGYG-YG--Y-GYG-------
A0A3D1MEL0      NLSIVLNDYGRGVSGSYYN--YGYGYGYGY--------GYGYG-YG--Y-GYG-------
A0A519UDD1      HTMIVLNDAKEIN-------------GNNY--------GYGYG-YG--Y-EQD-------
A0A2A4N9A6      KLALILNESGGGS-----QYGYGYGYGYGY--------GYGYG-YG--Y-GYG-------
A0A6C0GGI1      NLSIVIND---------------INFSTVY--------GLSYN-------GKA-------
A0A368D1N7      NLSIVLNDYGRGVSGSYYNYGYGYGYGYGY--------GYGYG-YG--Y-GYG-------
A0A3B8TU58      NLSIIVNDYGRGVSGSYYN----YGYGYGY--------GYGYG-YG--Y-GYG-------
A0A1T5IIR6      NMAIVFNGPQIKK----------R-RGYGFGSYGYGY-GYGYG-YG--Y-GYG-------
A0A3E0QD27      NLAVVLNGVETSR----------FRYGYGY--------GYGYG-YG--Y-GYG-------
A0A6N8DCX3      NMAVILNGTENES----------G--RYGY--------RYGYK-YG--Y-RYG-------
F0R0C9          NMAVILNGTLDGN----------N--RYGY--------KYGYK-YG--Y-HYG-------
A0A0M1W1I6      NMSLVLNGAIVKT----------S--GYG---------GYGYG-YG--Y-GYG-------
A0A4R4GHU2      NMSLVLNGAIVKT----------S--GYG---------GYGYG-YG--Y-GYG-------
I8WPR6          NMSLVLNGAIVKT----------S--GYG---------GYGYG-YG--Y-GYG-------
A0A0K2HKS3      NMSLVLNGAIVKT----------S--GYG---------GYGYG-YG--Y-GYG-------
B6W3W8          NMSLVLNGAIVKT----------S--GYG---------GYGYG-YG--Y-GYG-------
A0A7M3EEL4      NMSLVLNGAIVKT----------S--GYG---------GYGYG-YG--Y-GYG-------
A0A076IRY8      NMSLVLNGAIVKT----------G--GYG---------GYGYG-YG--Y-GYG-------
A0A3A6AD54      NMSLVLNGAIVKT----------G--GYG---------GYGYG-YG--Y-GYG-------
A0A3A6MIU7      NMSLVLNGAIVKT----------G--GYG---------GYGYG-YG--Y-GYG-------
I8WPP8          NMSLVLNGAIVKT----------G--GYG---------GYGYG-YG--Y-GYG-------
A0A372Y7D2      NMSLVLNGAIVKT----------G--GYG---------GYGYG-YG--Y-GYG-------
A0A7K3KFI2      NMSLVLNGAIVKT----------G--GYG---------GYGYG-YG--Y-GYG-------
A0A3E4JJC9      NMSLVLNGAIVKT----------G--GYG---------GYGYG-YG--Y-GYG-------
A0A3E4WDQ0      NMSLVLNGAIVKT----------G--GYG---------GYGYG-YG--Y-GYG-------
A0A414H9P2      NMSLVLNGAIVKT----------G--GYG---------GYGYG-YG--Y-GYG-------
A0A7K0JKU9      NMSLVLNGAIVKT----------G--GYG---------GYGYG-YG--Y-GYG-------
C3R5A8          NMSLVLNGAIVKT----------G--GYG---------GYGYG-YG--Y-GYG-------
A0A1C5XJA7      NMALILNGADLER----------H--GYGY-------GSYGYG-YG--Y-GYG-------
A0A285T4L1      NMSLILNGVDPSR----------R--GYG----------YGYG-YG--Y-GYG-------
A0A3E5BU42      NMSLILNGVDPSR----------R--GYG----------YGYG-YG--Y-GYG-------
R7CUW4          NMALVLNGVDPHR----------H--GYG----------YGYG-YG--Y-GYG-------
A0A416GGJ1      NMAVVLNAVEHRT----------V---------------YGYG-YG--Y-SYQ-------
D1JY72          NMSLVLNGAIVKT----------S--GYG---------GYGYG-YG--Y-GYG-------
A0A7G5NJU1      NMAIILNGVGPHR----------R--GYGY--------GYGYG-YG--Y-GYG-------
D7J4K6          NMAIILNGVGPHR----------R--GYGY--------GYGYG-YG--Y-GYG-------
Q8ABP9          NMAIILNGVGPHR----------R--GYGY--------GYGYG-YG--Y-GYG-------
D6D2Z5          NMAIILNGVGPHR----------RGYGYGY--------GYGYG-YG--Y-GYG-------
A0A1T3EDR4      NLGIVFNGVRIG--------------AFGY--------GYGYG-----------------
A0A6N8KXI9      NMAVVLNGVKEDP----------R--SYGY--------GYGYG-YG--Y-GYG-------
A0A174SDD8      NMAVVLNGTEKGS----------S--GYGY--------GYGYN-YG--Y-GYA-------
A0A1H7RFH3      NMAVVLNGTEKGS----------S--GYGY--------GYGYN-YG--Y-GYA-------
A0A139L1N2      NMAVVLNGTEKGS----------S--GYGY--------GYGYN-YG--Y-GYA-------
A0A174TVL8      NMAVVLNGTEKGS----------S--GYGY--------GYGYN-YG--Y-GYA-------
A0A1H8BJR6      NMAVVLNGTEKGS----------S--GYGY--------GYGYN-YG--Y-GYA-------
R9H6G0          NMAVVLNGTEKGS----------S--GYGY--------GYGYN-YG--Y-GYA-------
A0A412GR09      NMAVVLNGTEKGS----------S--GYGY--------GYGYN-YG--Y-GYA-------
A0A7J5JXN6      NMAVVLNGTEKGS----------S--GYGY--------GYGYN-YG--Y-GYA-------
A0A081PBV5      HMAVLLNGVRLNK----------G--GYGY--------GYGYG-YG--Y-GYG-------
A0A1I2AN85      HMAVLLNGVRLNK----------G--GYGY--------GYGYG-YG--Y-GYG-------
A0A4U0GMP3      NMAILLNGIRKGK----------M--GYGY--------GYGYG-YG--Y-GYG-------
A0A1H6CKR6      NLAILLNGVKFTN----------T--GYGG--YGYGYGGYGYG-YG--Y-GYG-------
A0A235E1C0      NMAILLNGVKFGS----------S-YGYGY--GGYGYGGYGYG-YG--Y-GYG-------
R6D982          NMAVVLNGTKQGR----------R--GYGY--------GYGYG-YG--Y-GYS-------
A0A1F0I8C4      NLAVVLNGAKKGS----------R--GYGY--------GYGYG-YG--I-----------
A0A3A5RIJ2      NLAVVLNGAKKGS----------R--GYGY--------GYGYG-YG--I-----------
A0A515IZJ5      NLAVVLNGAKKGS----------R--GYGY--------GYGYG-YG--I-----------
A0A7J4Y2H6      NLAVVLNGAKKGS----------R--GYGY--------GYGYG-YG--I-----------
A0A0D5BSQ0      NLAIVLNGMKLNG----------Y--GY----------GYGYG--S--Y-GYG-------
A0A1T3F6P5      NLAIVLNGMKLNG----------Y--GYGY-------GGYGYG--S--Y-GYG-------
A0A0W8EPA0      NLAIVLNGMKLNG----------Y--GYGY-------GGYGYG--S--Y-GYG-------
A0A365UKN1      NLAIVLNGMKLNG----------Y--GYGY-------GGYGYG--S--Y-GYG-------
A0A4R6WE41      RLGVVLNGVKLGS----------G--AYGY-------GRYGYG--N--Y-GYS-------
A0A2T5RP38      NLAIVLNGLKLNG----------Y--GYGY-------GGYGYG--S--Y-GYG-------
A0A1A6CF06      NLAIVLNGLKLNG----------Y--GYGY-------GGYGYG--S--Y-GYG-------
A0A1T3D6S8      NLAIVLNGLKLNG----------Y--GYGY-------GGYGYG--S-----YG-------
A0A1P8E011      NLAIILNGLKLGQ----------S--------------GYGYG-YG--Y-GYG-------
A0A1V3N3U3      NLAVALNGIKL------------H--GPGY--------GYGYG-YG--Y-GYG-------
C2FUH6          NMSVILNGLKQGR----------R--GYGY--------GYGYG-YG--Y-GYG-------
A0A0B8T471      NMAILLNGIRKLK----------S--SYGY--------GYGYG-YG--Y-GYQ-------
A0A4R7D2K0      NMAILLNGIRKLK----------S--SYGY--------GYGYG-YG--Y-GYQ-------
A0A2X2J8S4      NMAILFNGVNSGK----------R--GYGY--------GYGYG-YG--Y-GYR-------
A0A3C0S618      NMAILFNGVNSGK----------R--GYGY--------GYGYG-YG--Y-SYR-------
A0A4P7DRF9      NMAILLNGVKFND----------T--RYGYGSYGYGYGGYGYG-YG--Y-GYG-------
A0A239XXC4      NMAILLNGVKFGN----------N--PYGY--GGYGYGGYGYG-YG--Y-GYS-------
A0A4U9K473      NMAIVLNGVKFGN----------S--AYGS--YGYGYGGYGYG-YG--Y-GYG-------
A0A2T4XEQ1      ILGLSLVGYDHKISSD---------------------YYYQNK-YK--Y-------YS--
A0A2K8ZAP1      KLSIVLNGVGKGESLS---------------------YSYNYG-------DYMDLTKK--
A0A3M1Y2F5      KIGLLINHVANPAQFR-------------HGDASYYTYGKKYA-KV--Y-GAM---HT--
A0A3D4RLG4      KVQLVFSDMPVEKKRK-RLGRKSYGYAY-------NSYGYGYG-YG--Y-GGK---ND--
A0A2T2UAJ4      VAGAVLNQFDASSSVL-------------------QSYGYNYG-YA--Y-SYR---RL--
A0A6I0DZQ5      DFYSILNDVELKSNSYSRYYSRKYAYGNSRRYGTKSGYGYGYG-YG--Y-GYT---KVSD
A0A3D3LSK1      LLGAVLNNFK---------------------------FNTSYG-YY--Y-------NY--
A0A496L711      DIYIILNDVDKSKIGY--------V------------YGYGYG-MP--K-KMG-------
A0A1H6Z2F8      DLQIVINGTR---------------------------DLHRYQ-YN--Y-------Y---
A0A2P8G5K0      DLHVVLNGTR---------------------------SLHRYQ-YN--Y-------Y---
R5DEG6          NMSLILNGTVYKHGTY--------G------------YHYGYG-YG--Y-GYG---YG--
A0A4Q3SEI4      NISIVFNGIR-SRGFF--------K----------GKYGYGYG-YG--R-KKV---YG--
A0A348PT57      NLSAVLNSVDLSRARY--------GSYGRGYGAKYG-YGYGYG-YG--Y-GYT---SG--
A0A7C3PTI0      RLSIVLNGVDVQRKAY--------G---------YN-YGYGYG-YG--Y-GYG---YG--
A0A5Q4EKA0      KLSVVLNAVDKEYSSY--------G---------YD-KGYSYG-YY--YGGYG---SG--
A0A519SYE7      KMCTVLNDAKAQ-GSY--------G------------YGYGYG-Y-----GYG---YG--
A0A7C7CFR2      NLAVVFNGVDTD-SVF--------G---------ND-YNYGYG-Y-----AYN---YG--
A0A3N2LCI3      NMSFILNGSRNDQGRY--------G---------YS-HTYRYG-YG--Y-GYG---YG--
A0A6H9Q899      NMSLILNGTEGSGGRY--------G---------YR-YGYRYG-YH--Y-GYG---SG--
A0A3D4CJE1      KLSLVLNSVD-FEQ---------------------GQYGYGYG-YG--Y-GYG---YG--
A0A7C7LI79      KLSVVLNGMD-TESKY--------G---------YGSYEHGYG-YG--Y-GYA---YG--
A0A4Q5ZQ60      KLALILNDAQ-TSGIY--------G---------YG-YGYGYG-YG--Y-GYG-YGYG--
A0A519Q885      RMCTILNDAQ-AQGSY--------G---------YG-YGYGYG-YG--Y-GYG--TYG--
A0A519TAP8      KMCTILNDAK-AQGAY--------G---------YG-YGYGYG-YG--Y-GSSGTGYG--
                                                                            

A0A1T4NDR5      --------YQYQPKARKRKKK-----------------------
A0A3D5KRM7      --------YG----------------------------------
A0A3M1NUH2      --------DRYTQYTSEYGTYGYRDVKELLKDKES---------
A0A7C1IBE4      --------------------------------------------
A0A2T2TDL4      --------DQYGPYDQYRSLPEEASA------------------
A0A359ATS6      --------YHYGSEKKKTWWGNKG--------------------
A0A2E0MDX6      --------YGYGGNH-GYYEEK-PQKEKTTFNKIFSKK------
A0A2M7KCE1      --------YGNSEYHTDYYDESITKKKKNIFTKIISHL------
R7JFY1          --------YGYGNEKKRK--------------------------
A0A1V5S5I3      --------SYYGK-------------------------------
A0A2M7VVW6      --------YYYDDTQKEK-LTKRI---------------FKKKK
A0A413V760      --------YGYGNESHGH-KHGRYESLKNLFSR------FFKRS
A0A656PYT8      --------YGYGEDESQK-SSAVIDSRYNLTQRLKDFLGLNDKK
A0A1V6HYH8      --------YYTDNEEKQSNTKKSMKKYFNYFYKKNK--------
A0A523GUD4      --------YDYYNYNTNDK-------------------------
A0A3D1AEJ6      --------Y---GNDKDK--------------------------
A0A7K3KYQ2      --------YNYGGGEKKK--------------------------
A0A641X2Z6      --------GGHSSLKVRW--------------KLRRY-------
A0A6L8U2P8      ----------YSNYYIRN--------------------------
A0A7C6G639      --------YGYGGYGYGYGYGYGRKKRLKEANKYAQYYDDDSEV
A0A519PJW5      --------YGYGSYGMGY-YEE-PVQKPTLSQRIKGLFS-----
A0A519T3R9      --------YGYGTYGMGY-YEEMDNRKLTVGQRLKRLFS-----
A0A7C7CKY6      --------YGYYQEESEFVKKTLLQRLLNS--------------
A0A1G1TG88      --------QGYYEDHGSAPPPTLAQKLGRLFK------------
A0A661XXA6      --------SPYYQE------------------------------
A0A519SD85      --------------------------------------------
A0A3M1TXY5      --------YEAIN-------------------------------
A0A2E0VQ27      --------LS----------------------------------
R6U429          --------YGYGNNVQD---------------------------
A0A5C8AF42      --------GDSEIEKGNLLNRLWSFISSKFRR------------
A0A353WYK7      --------YEEPEYLESNLFATFKSLFSK---------------
A0A355BP94      --------YHEDQKKRSLIRKIFRS-------------------
A0A136LSC7      --------YEDKTPRRKRWIKIFGLK------------------
A0A5C7N8Q5      --------YEDRTPRMRRWTKIFGLK------------------
A0A239K409      --------------------------------------------
A0A1V5S1J9      -----------YDKKFKSPRSQYLNYFDNTEEEL----------
A0A0A2EYC8      --------TEEFEQDDISMLEKIIDKIGEKTKRIRNIHSSRLFK
A0A2G6H6Y4      --------TAEFEKENTTAFQRVIEFVGDITKKIRNIKK-----
A0A1M3DPL8      --------SGRSKHKGN---NTYFQYYQDDEKDI----------
A0A1V5F519      --------S--KGQKNI---DEYRKYYDDNN-EI----------
A0A2G6R1T9      --------G--VKNKKD---NQYTHYYNDDDIDI----------
A0A350V3E4      --------YGSEKGKESAGTNGKSTNGVNTNGSQKEKIIKPN--
A0A6J4K208      --------YGD---------------------------------
A0A2W4RDE8      -------------KQKKYKQRSYKAV------------------
A0A0L8VEV2      --------SYYYFDSSPSYTG-----------------------
A0A1I2A9Z9      --------SYYYFESSPSYTG-----------------------
A0A212J9Z9      --------YGDRTYYLKKNSYYHDDYFEN---------------
F5IV23          --------YGDRTYYLKKNSYYHDDYFEN---------------
F8X2T0          --------YGDKTYYLKKNSYYHDDYFES---------------
A0A1M3LAG1      --------YGDKTYYLKKNSYYHDDYFES---------------
A0A212K6G4      --------YGDKTYYLKKNSYYHDDYFES---------------
A0A4Y9IPG7      --------YGDKTYYLKKNSYYHDDYFES---------------
A0A1M5DFS8      --------YGDKSYYLKRNSYYHDDYFEK---------------
A0A4Y8KZS5      --------YGDKSYYLKRNSYYHDDYFEK---------------
A0A2V3PNY7      --------YGDKSYYLKRNSYYHDDYFEK---------------
A0A6G7X5K8      --------YGDKSYYLKRNSYYHDDYFEK---------------
A0A2P8CDS1      -----------TQKPKNRPAAYWRKVNSKKQAQTT---------
A0A660LQT8      --------YGKS--------------------------------
A0A389LWV6      --------YNNDEFVDEQNQN-----------------------
A0A1G9B1T9      --------------------------------------------
A0A350PNH9      --------YHYGSDKNGGAKIGK---------------------
A0A354LNT9      --------YHYGSDKNGDAKIGK---------------------
A0A161LWY6      --------KDYIKDYYEEE-------------------------
A0A6I3N9U6      --------KDYIKDYYEEE-------------------------
A0A3D0FMX4      --------YGYGSRKKGT----NHYYTDE-DE------------
A0A1M3MEI8      --------YTKVSDKKNSDGTYYQYYQDDAHDI-----------
A0A1J5HQM0      --------YGNTRKKKEASEKYFQYYQDD-REI-----------
A0A653AC35      --------YAQLKKKKEY-DKNTHYYEDD-DDI-----------
E4T131          --------YTSKKKKGDA-EKYFHYYQDD-TEI-----------
A0A2W7RD29      --------YKDNKGLVNRVKNYLRSSK-----------------
A0A3N2NDY8      --------------------------------------------
D7JEV9          --------YYVTEEFEQDDVSILEKLIYKISDMTKKIRNIKK--
A0A4R6H3B7      --------SYYYFESSPSYTG-----------------------
A0A521H707      --------YGYYDDEARKNLSFFEKFKNRFSRK-----------
A0A1F3D6P8      -----------------HYTSYYLKK------------------
A0A356Z058      -----------------HYTSYYLKK------------------
A0A3D1BT36      -----------------RYHGYYKKPKAFTARK-----------
A0A5R9QZP0      -----------------GYDTYYHNNPKRKK-------------
A0A3D3HL11      -----------------RYDNYYKQ-------------------
A0A6L8U6G9      -----------------RYDNYYKQ-------------------
A0A352ME00      -----------------HYSNYYIKN------------------
A0A6L8UH35      -----------------HYSNYYIKN------------------
A0A3P1Z8V4      --------NNLDETASRKWWQLW---------------------
A0A1M6MYT6      --------YGHDTDSNQKKGKTKTKGRSIFKPS-----------
A0A2W7QSQ0      --------YSGKDTDVVSTRA-----------------------
A0A3D5KRY6      -----------KKSKKK---------------------------
R7F6L5          --------YAYGDDNDKKKKKRKKS-------------------
A0A7C5MRV2      -------------SDDKPQEPWWKFWKKLRS-------------
A0A229I3A5      --------YNYNKEKNGGGKILNNWIIE----------------
A0A3R6HJB3      --------YNYNKEKNGGAKS-----------------------
R6NN15          --------YYYGNEKQK---------------------------
A0A553GA49      --------------------------------------------
A0A497D6F6      ------------------------RTAKK---------------
A0A5M4AAB9      ------------------------KKISKELKPQRRSQKTEV--
F4KR18          --------------------------------------------
A0A2M6GH67      -----------------EKEGVLTRLKRNFT-------------
A0A7K1TE30      --------MGYYEEPTAPKKTFTERLKGLFS-------------
A0A7D4BE70      --------MGYYEEPT-QRKTWRQRLKGLFS-------------
A0A142HHS5      --------MGYYDETE-QKPTLGKRIKSLFS-------------
A0A7D4C435      --------MGYYEDPV-QKPSLGQRLKGLFS-------------
C9LKL0          --------YGEQYNNRKSKKKLSGRLLSKLRK------------
A0A3D0QPV7      --------YTERTNATEKKIRFFRRKNKK---------------
A0A496KT23      --------YGS---------------------------------
L1M9T3          --------YGK---------------------------------
A0A3C0I8F1      --------YYNDSESNYKPIRWINRIYKRAMSFRK---------
R5JJI4          --------YGNE-HHGNNKQGVAKRIINKLIAFFK---------
A0A0A2DQN2      --------YGHL-GKKSLRKRFVERMKMFFVS------------
A0A0A2F2N5      --------YGY--GNKKERSGIFSRFRKS---------------
L1NGW4          --------YGY--GN-KKKKGILYRLGLKK--------------
Z4WRA0          --------YGY--GN-KKKKGILYRLGLKK--------------
U2K8K9          --------YGY--GNKKKKKTLLQRLGIRR--------------
A0A069ZM60      --------YGY--GNKKKKKGLLRRLGLR---------------
J6GV98          --------YGY--GNKKKKKGLLRRLGLR---------------
A0A134B4F8      --------YGY--GNKKKKKGLLRRLGLR---------------
A0A134B8C7      --------YGY--GNKKKKKGLLRRLGLR---------------
A0A3D2HF71      --------GD----------YVYSRYGHSGEGKYYIEE------
A0A4Z0EKR0      --------EKMKKKATG---------------------------
B5CTK0          --------DTKTKHKKKS--------------------------
A0A1M6B6D5      --------GSSYKSYGN---GYHEAIKKPSLWKRMKKSITKK--
A0A451FS66      --------DGSYKSYGD---GYHGPLGKKSLADRIKNIFKQT--
A0A2E3GN39      --------YGYYSDSDN------TRKKERSSLFSIFRKKS----
A0A3D1MEL0      --------YGYYSDPDN------TRKKERSILFSRFRKKT----
A0A519UDD1      --------KSHHKQKAAL--------------------------
A0A2A4N9A6      --------YGYYAEDASRNKSLWERITNSKFISLLKN-------
A0A6C0GGI1      --------NGYYKN------------------------------
A0A368D1N7      --------YGYYSDPDNTRKK-----KRSSLISRFRKKS-----
A0A3B8TU58      --------YGYYSDPDETREN-----ERTGFFSRFRKNS-----
A0A1T5IIR6      --------YGYGDEPKK---KRFLGIFKRK--------------
A0A3E0QD27      --------YGYYDDEAKKPLTTWQAFKARLGKK-----------
A0A6N8DCX3      --------YGNDK--NT---D-----------------------
F0R0C9          --------YGSKDYYNN---E-----------------------
A0A0M1W1I6      --------YV---DGSE---SSWKRLFKKKS-------------
A0A4R4GHU2      --------YV---DGSE---SSWKRLFKKKS-------------
I8WPR6          --------YV---DGSE---SSWKRLFKKKS-------------
A0A0K2HKS3      --------YV---DGSE---SSWKRLFKKKS-------------
B6W3W8          --------YV---DGSE---SSWKRLFKKKS-------------
A0A7M3EEL4      --------YV---DGSE---SSWKRLFKKKS-------------
A0A076IRY8      --------YV---DGSE---SCWKRLFRKKS-------------
A0A3A6AD54      --------YV---DGSE---SCWKRLFRKKS-------------
A0A3A6MIU7      --------YV---DGSE---SCWKRLFRKKS-------------
I8WPP8          --------YV---DGSE---SCWKRLFRKKS-------------
A0A372Y7D2      --------YV---DGSE---SCWKRLFRKKS-------------
A0A7K3KFI2      --------YV---DGSE---SCWKRLFRKKS-------------
A0A3E4JJC9      --------YV---DGSE---SCWKRLFRKKS-------------
A0A3E4WDQ0      --------YV---DGSE---SCWKRLFRKKS-------------
A0A414H9P2      --------YV---DGSE---SCWKRLFRKKS-------------
A0A7K0JKU9      --------YV---DGSE---SCWKRLFRKKS-------------
C3R5A8          --------YV---DGSE---SCWKRLFRKKS-------------
A0A1C5XJA7      --------NNKNK-------------------------------
A0A285T4L1      --------KRKNK-------------------------------
A0A3E5BU42      --------KRKNK-------------------------------
R7CUW4          --------RYGYGNKKH---GRN---------------------
A0A416GGJ1      --------YK---GGE----------------------------
D1JY72          --------YV---DGSE---SSWKRLFKKKS-------------
A0A7G5NJU1      --------YGKH-GRRK---------------------------
D7J4K6          --------YGKH-GRRK---------------------------
Q8ABP9          --------YGKH-GRRK---------------------------
D6D2Z5          --------YGKH-GRRK---------------------------
A0A1T3EDR4      -----------Q-ELKG---GLWSRFLRMFRRV-----------
A0A6N8KXI9      --------YGYEVQKKK---GFFSNLFRRS--------------
A0A174SDD8      --------AT-Q-KKKG---GWWRRKGKK---------------
A0A1H7RFH3      --------AT-Q-KKKG---GWWRRKGKK---------------
A0A139L1N2      --------AT-Q-KKKG---GWWRRKGKK---------------
A0A174TVL8      --------AT-Q-KKKG---GWWRRKGKK---------------
A0A1H8BJR6      --------AT-Q-KKKG---GWWRRKGKK---------------
R9H6G0          --------AT-Q-KKKG---GWWRRKGKK---------------
A0A412GR09      --------AT-Q-KKKG---GWWRRKGKK---------------
A0A7J5JXN6      --------AT-Q-KKKG---RWWRRKGKK---------------
A0A081PBV5      --------YG-N-ETKK---TIWDKLFGKR--------------
A0A1I2AN85      --------YG-N-ETKK---TIWDKLFGKR--------------
A0A4U0GMP3      --------YG-N-TKT----------------------------
A0A1H6CKR6      -----------N-RKKK---SFFQKLLGR---------------
A0A235E1C0      -----------Q-PKKK---GFFSRLFGKN--------------
R6D982          --------YGND-EKKK---NWFFGKRKKESV------------
A0A1F0I8C4      -----------D-VEKS---GWWSRMKKRMKR------------
A0A3A5RIJ2      -----------D-VEKS---GWWSRMKKRMKR------------
A0A515IZJ5      -----------D-VEKS---GWWSRMKKRMKR------------
A0A7J4Y2H6      -----------D-VEKS---GWWSRMKKRMKR------------
A0A0D5BSQ0      --------YG-E-EKKK---SVFDWFKRS---------------
A0A1T3F6P5      --------YG-E-EKKK---SVFDWFKRS---------------
A0A0W8EPA0      --------YG-E-EKKK---TIFNWFKRS---------------
A0A365UKN1      --------YG-E-EKKK---SIFDWFKRS---------------
A0A4R6WE41      --------YG-N-EK-K---SIWKKIFG----------------
A0A2T5RP38      --------YG-E-EKKK---SVFDWFKRS---------------
A0A1A6CF06      --------YG-E-EKRK---SIFSWFKRS---------------
A0A1T3D6S8      --------YG-E-EKKK---SVFDWFKR----------------
A0A1P8E011      --------YG-R-EEGQ---NSWRKIARSIRTIFTRKIKH----
A0A1V3N3U3      --------YG-N-TEQQ---VWYKRWWRKIKS------------
C2FUH6          --------YS-N-EKRH---NLFSSLLEKIKGL-----------
A0A0B8T471      --------KE-K-AGLR---GFFNRLFRR---------------
A0A4R7D2K0      --------KE-K-AGLT---GFFRRLFQR---------------
A0A2X2J8S4      --------YG-D-DK-K---SFWKKVFNK---------------
A0A3C0S618      --------YG-D-DK-K---SFWKKVFNK---------------
A0A4P7DRF9      --------NH-K-KK-K---SIFNIFKKR---------------
A0A239XXC4      --------AQ-Q-KR-G---FFSRLFGKK---------------
A0A4U9K473      --------AQ-K-KK-R---FLL---------------------
A0A2T4XEQ1      --------YNDYLEYTEEKEEVA---------------------
A0A2K8ZAP1      --------FD----------------------------------
A0A3M1Y2F5      --------------------------------------------
A0A3D4RLG4      --------YNYYSDDE----------------------------
A0A2T2UAJ4      --------YEYYRDEDKGAPEPSGIRAWWGG-------------
A0A6I0DZQ5      KKNSDGTYYQYYQDDAHDI-------------------------
A0A3D3LSK1      --------YYYYSGDSKKKNN-----------------------
A0A496L711      ---------NYYVTEEFEQDDVSILEKLIYKISDMTKKIRNIKK
A0A1H6Z2F8      --------------------------------------------
A0A2P8G5K0      --------------------------------------------
R5DEG6          --------YGQRKKK-----------------------------
A0A4Q3SEI4      --------DHVYKSEAVQRKA-----------------------
A0A348PT57      --------NGYYSEDNEEEEPKLNFLRNLRSKLKNDDN------
A0A7C3PTI0      --------YGYYDD--LKKDDDRSVVKKIFTN------------
A0A5Q4EKA0      --------YGYYDD--QINIVKRSFWKRIL-------GLGSKKL
A0A519SYE7      --------YGSY-------------------------GMGY---
A0A7C7CFR2      --------YGYYDE--ESDSKKRSFWQRLFGRTLIQRGFWH---
A0A3N2LCI3      --------YNYGSGEKKEE-------------------------
A0A6H9Q899      --------YHYSSDEKRVGGG-----------------------
A0A3D4CJE1      --------YGYYED--VPEKQ--VWWKAIFNKK-----------
A0A7C7LI79      --------YGYYDE--ESEKHKSPWYRKIFRS------------
A0A4Q5ZQ60      --------YGYYDE--QEKKGLLGRIKDKFKKA-----------
A0A519Q885      --------MGYYEEPSQGKPSISQRFKRLFS-------------
A0A519TAP8      --------MGYYDEAVQ-PPTLGQKIKSFFS-------------
                                                            

© 1998-2021Legal notice