BYKdb

Dataset for cluster orphancd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

195 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A519SD85      ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A3M1TXY5      ------------------------------------------------------------
A0A2E0VQ27      --------------------------------MTFNKEYKMIIRPLLKA------SPVLI
R6U429          ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A5C8AF42      ------------------------------VIQLDNQDNAKDIIELENI-----------
A0A642EJV3      ------------------------------------------------------------
A0A161LWY6      ---------------METNNNNQYQNYPLSNSDMEEDESGFDIIEWLFK------ILRHW
A0A212J9Z9      -------------MDNN--NKKVIESDPYFEEVKTKTNISFDFVLWFYR------ILKYW
F5IV23          -------------MDNN--NKKVIESDPYFEEVKTKTNISFDFVLWFYR------ILKYW
F8X2T0          -------------MDIN--NKPGADTDPYFEEIKSKTTLSFDFVLWFYR------ILKYW
A0A1M3LAG1      -------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVLWFYR------ILKYW
A0A212K6G4      -------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVLWFYR------ILKYW
A0A4Y9IPG7      -------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVLWFYR------ILKYW
A0A2V3PNY7      -----------MEQNIN--RPADFGTDPYFDEVQAKTKFTFDFVLWFYR------ILKYW
A0A1M5DFS8      -----------MEQNINTTRPNDYGADPYFDEVQAKSKFSFDFVLWFYR------ILKYW
A0A4Y8KZS5      -----------MEQSLN--KPNDFGTDPYFDEIQAKTKFSFDFVLWFYR------ILKYW
A0A239K409      ----------------------MVMIDKEAQKMGNRQNEQESFIDSFFK------YVRYW
A0A350V3E4      ------------------------------------------------------------
A0A1M6MYT6      -------------------MKKQQNDKDILNFYGQLEEESLISKKTLFK------CFRNW
A0A2P8CDS1      ----------------------MDTQNPLTPNQPTTFSRPRNYRKYFFL------LLSHW
A0A5M4A2I9      ------------------------------------------------------------
A0A353WYK7      ----------------------------------MEQNQQFDFDKLQMV------FKRSL
A0A355BP94      -------------------------MSKQLNSPTTDPIEGFDLDKLWVL------LKKNA
A0A136LSC7      -------------------------MLQPKEIGP--QVQSIDTEKLSAV------IRKNL
A0A5C7N8Q5      ------------------------MLKEPKDIGPLTEVQSIDTEKLAAV------FRKNL
A0A1V5S1J9      ------------MDNNQQYTQNQYTSQANAFSDDDGGGQKFDIMLWVLR------FLKSW
A0A0A2EYC8      -----------------MENTNN-IPNIQTFSEEE-ASS-FNLMEWVMR------FLKYW
A0A2G6H6Y4      -----------------METSNNQIQSMQQFSEEDNTSS-LSVMEWIMR------CVRYW
A0A1M3DPL8      -----------------MNMEEENKDIKTSDFTDEESS--FDIMEWVML------FVSHW
A0A1V5F519      --------------------MNPDTGSINQNFTEEESS--FDFQKWLHL------FIKNW
A0A2G6R1T9      --------------------MEENSLNQQQFDDSEESG--FDFMSWVIL------LVQYW
A0A2W4RDE8      -----------------------------------MEEEKINIKKIFHK------LISKW
A0A0L8VEV2      ------------------------MKTMEDFSKSLEREDMLAIKKFFHK------LKRNW
A0A1I2A9Z9      ------------------------MKTMEEYSNSLEREDMLSVKKFFHK------LVRNW
A0A142HHS5      MASTENAELEELIRRASTGGEAAPPTGASFAEEDTEDGDNFDLSTLVLV------ARRSL
A0A660LQT8      ------------------------MEDKDNITPSQETKNGVDIVDVLYL------CLDRW
A0A350PNH9      -----------------MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYL------CLVRW
A0A354LNT9      -----------------MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYL------CLVRW
A0A2M6GH67      ------------------------------------------FITLLVV------TRKSL
A0A389LWV6      --------------MESTNTKSTNFSIDDTNFQHPGNTSSFDLVLWIFR------ILKYW
A0A1G9B1T9      ------------------------METSRYSHTQALKSDPIDLSVITKK------IIRKW
A0A3D0FMX4      --------------------MATDTNVQNQDFTNQDDRIQFDVMEWVFK------FLSVW
A0A1M3MEI8      ---------------------MEQPVKPRERVIPEEEESGFDIMEWVAH------FIGHW
A0A1J5HQM0      ---------------------MEQNKPANP--FSEEEESSFDIMEWVNI------FLHFW
A0A653AC35      -------------------MEENPYNTQYPQQFTEEEESSFDIKEWAFL------FLHYW
E4T131          ---------------------MDKFNLEKP--FNSEEESGFDIMEWVSY------FLNNW
A0A521H707      ----------------------------MAKKKISNLNEEFDFKLFTII------ARKNA
A0A1F3D6P8      -------------------------------MTKETDSGIALIKHYLQD------IAYFK
A0A356Z058      -------------------------------MTKETDSGIALIKHYLQD------IAYFK
A0A3D1BT36      -----------------------------MSKNNETKSESLKIKEFIFK------VFSYK
A0A352ME00      -----------------------------MLKTIEPDSSIAPLKYFILK------VASLK
A0A3D3HL11      --------------------------MQLMTNNNDSQSEAFNIKEFLAE------ALSYK
A0A5R9QZP0      -----------------------------MSLNNNHPEEGFNIKEFILL------TFRYK
A0A2W7RD29      ------------------------MNNKSESDPLLLSSQKIDFSVFFKR------LGKKW
A0A3N2NDY8      ------------------------MSDNINVTQESEAAEEFSLKDFLAC------CLSKW
D7JEV9          ---------------------MEQNNNISNNTFNEEETSSFNFMEWAIR------FLKYW
A0A4R6H3B7      ------------------------MKTMEEYSNSLEREDMLSVKKFFHK------LVRNW
A0A2W7QSQ0      --------------------------MRKINKKVNSNEEPINIKLILRT------ILKSW
R7F6L5          ---------------MANQIKENEAANISPYYEQAAPASLVSVQGFLSF------VRHRW
A0A553GA49      --------------------------------MNLENDQSNDLKNVLHK------VGKHW
A0A497D6F6      ------------------------------------------------------------
A0A5M4AAB9      ------------------------------------------------------------
F4KR18          ----------------------MNEFEYPKAILLNSNLKDSSDSQVDYWGLLHKFILSKW
C9LKL0          -------------------------MEYSQKNEVQNSEFKIVPFLLLCY----HVFLAKW
A0A3D0QPV7      --------------------MIDEKIQRQSESFSQYKERITNFSNEFELGLFLYIARKSL
A0A496KT23      ----------------MQRSAENFSQNSSFISQTSSVSILELLRDAWLL------CLAHW
L1M9T3          -----------------------------------------MVRDGFYL------CLAHW
A0A3C0I8F1      ---------DYFVKKIIPPTTVFLERNHENINKILEESEGMDIVNDFDFEKFVEILRGSI
R5JJI4          ------------------------------------------------------------
A0A3D2HF71      ------------------MTSPSPLNNPSQPYYIPPEEEGLDFKRYLSL------FISNW
A0A0A2DQN2      ---------------------------------MIRQVSDVNLLDVLRY------LVSYW
A0A0A2F2N5      ---------------------MTPQSSSKQTKSAGTVVADINLIDLFFY------LLGYW
L1NGW4          ----------------------MANTQETTSTQPAEKGLEVNLVDIFFY------LLRFW
Z4WRA0          ----------------------MANTQETTSTQPAEKGLEVNLVDIFFY------LLRFW
U2K8K9          ------------------------MPEQQITNRPSDKGADLNLVDIFMY------LYRYK
A0A069ZM60      -----------------------MSTQTNRSNQAGEKAAEVNLLDIFFY------LLRFW
J6GV98          -----------------------MSTQTNRSNQAGEKAAEVNLLDIFFY------LLRFW
A0A134B4F8      -----------------------MSTQTNRSNQAGEKTAEVNLLDIFFY------LLRFW
A0A134B8C7      -----------------------MSTQTNRSNQAGEKTAEVNLLDIFFY------LLRFW
A0A4Z0EKR0      ------------------------MTNDELFPLKTEQPETADLKSVLLS------YARYW
A0A229I3A5      ------------------------------MARPNQEEDFIRIQDLLYL------CLTQW
A0A3R6HJB3      ------------------------------MARPNQEEDFIRIQDLLYL------CLTQW
B5CTK0          -----------------------MAEKKQATDLLKGEDSSFNIGEILHM------FLSNW
A0A1M6B6D5      ---------------------------MSEEFETNEAGTTFDFKGFLIR------LLRNW
A0A451FS66      ---------------------------MNQEFDIKQADGSFDFKGFFDR------LLRSG
A0A2E3GN39      ------------------------------------------------------------
A0A3D1MEL0      ------------------------------------------------------------
F0R0C9          ------------------------MAIPNNPTRPKQGDDFIRIQDLFYL------CLAKW
A0A2A4N9A6      ----------------------------MKENQIQNPLPDLDIGLLIGI------FRKSF
A0A368D1N7      -----------------------MSEPSKKKQQSSVLYDKFNVGLLLYV------LRKSF
A0A3B8TU58      ------------------------------------------------------------
A0A1T5IIR6      ---------------------------MKTAPRKVTRNEQVNLVDLFYY------LIGNW
A0A3E0QD27      --------------------------MGKKKITNLNEEFDFKLFSIIAK------KNAYW
A0A0M1W1I6      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A4R4GHU2      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
I8WPR6          ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A0K2HKS3      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
B6W3W8          ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A4R4GSI6      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A076IRY8      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A3A6AD54      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A3A6MIU7      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
I8WPP8          ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A372Y7D2      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMY------LLSKW
A0A3E4JJC9      ------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMY------LLSNW
A0A3E4WDQ0      ------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMY------LLSNW
A0A414H9P2      ------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMY------LLSNW
C3R5A8          ------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMY------LLSNW
A0A1C5XJA7      ---------------------------MQNNIQSNKNDQNINLLDLLMY------LASKW
A0A3E5BU42      ---------------------------MQNNTLSNKNEQSINLVDLFVY------LLSKW
R7CUW4          ---------------------------MQTTSNNNRNEQGINVVDLLVY------FASKW
A0A416GGJ1      ---------------------------MQTNKKVDSG---LNLIDVFSF------LASKW
D1JY72          ---------------------------MSGDKTLSGGGFNINPVDIIMY------LLSKW
D7J4K6          ---------------------------MQNNSLSNKNEQGVNLVDLSVY------LLSKW
Q8ABP9          ---------------------------MQNNSLSNKNEQGVNLVDLSVY------LLSKW
A0A5M6AHF7      ---------------------------MQNNSLSNKNEQGVNLVDLSVY------LLSKW
D6D2Z5          ---------------------------MQNNSLSNKNEQGVNLVDLSVY------LLSKW
A0A1T3EDR4      -----------------------MIRNSKYINIRGTWGENFHILDLFKY------ALGYW
A0A174SDD8      -------------------------MEKHKKLAVTEEEKSINIVDLFIY------LLVHW
A0A1H7RFH3      -------------------------MEKHKKLAVTEEEKSINIVDLFVY------LVVHW
A0A139L1N2      -------------------------MEKHKKLAVTEEEKSINIVDLFVY------LVVHW
A0A174TVL8      -------------------------MEKHKKLAVTEEEKSINIVDLFVY------LVVHW
A0A1H8BJR6      -------------------------MEKHKKLAVTEEEKSINIVDLFVY------LVVHW
R9H6G0          -------------------------MEKHKKLAVTEEEKSINIVDLFVY------LVVHW
A0A412GR09      -------------------------------MAVTEEEKSINIVDLFVY------LVVHW
A0A4Q5DX00      -------------------------------MAVTEEEKSINIVDLFVY------LVVHW
A0A081PBV5      ----------------------MDNLNNINLMPKAKEEKSINLLDILKY------LLFQW
A0A1I2AN85      ----------------------MDNLNNINLMPKAKEEKSINLLDILKY------LLFQW
A0A4U0GMP3      ----------------------MENSAATNYLVQEKEEKSINVIDILKY------LLFHW
A0A1H6CKR6      --------------------------MNKDFLIKDKQTQSINVLDVLKY------LLSNW
A0A235E1C0      ---------------------MVNHSTNKPFQGKGKQDQSLYVLDILRY------LLANW
R6D982          -------------------------MEKQVKKILAEEDKSINLVDILMY------LLSYW
A0A1F0I8C4      -------------------------MEKQRKLALTEEEKSVNIVDVFMY------LIAHW
A0A3A5RIJ2      -------------------------------MALTEEEKSVNIVDVFMY------LIAHW
A0A515IZJ5      -------------------------------MALTEEEKSVNIVDVFMY------LIAHW
A0A5M5NLR3      -------------------------------MALTEEEKSVNIVDVFMY------LIAHW
A0A0D5BSQ0      ------------------------MINQNKQNV--QKDGIINVLDILKY------FLFHW
A0A1T3F6P5      ----------------------MDTINQKNQVVGNKKEHSVNVLDILKY------LLHNW
A0A0W8EPA0      ----------------------MDTINQKNQVIGNKKEHSVNVLDILKY------LLHNW
A0A365UKN1      ----------------------MDTINQKNQVIGNKKEHSVNVLDILKY------LLHNW
A0A4R6WE41      ----------------------MVKNKDTEGVVQEQRDPSLNVLDVLKY------LLSYW
A0A2T5RP38      ----------------------MNTLNQKEYRIGERKEQTINVLDLLKY------LLHNW
A0A1A6CF06      ----------------------MNQYSKNSV----QKENTINVLDIFKY------LLFHW
A0A1T3D6S8      ----------------------MNQYNKHSV----QKENTINVLDIFKY------LLFHW
A0A1P8E011      --------------------------MKTTHYNQLQKDKSINVLDVLAH------LLYHW
A0A1V3N3U3      ----------------------MNNILERTGAGAERKNNSVNVLDIFKY------LLFHW
C2FUH6          ------------------------MVNNQITQNITKADKSVNIIDLFKY------LMIHW
A0A0B8T471      ---------------------MDNTNYNPYIESREKEGKSLNLIDLIKY------LLLHW
A0A4R7D2K0      ---------------------MDNTNYNPYIESREKEGKSLNLIDLIKY------LLLHW
A0A2X2J8S4      -------------------MENRPEVVNNQFFGA-KNNSTFNVLDIIKY------LLFHW
A0A3C0S618      -------------------MENRPEVVNNQFFGA-KNNSTFNVLDIIKY------LLFHW
A0A4P7DRF9      -----------------------MSKISNTYMQK-QQEKSINILDLFRY------LLANW
A0A239XXC4      --------------------------MNKSFQGKGKQDQSLYVLDILRY------LLGNW
A0A4U9K473      --------------------------MSKPFQGKGKQDQSLHVLDILRY------FLSNW
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A641LIG3      ------------------------------------------------------------
A0A641LPE6      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      --------------MKVTPTQYF-------------------------------------
A0A661XXA6      --------------ISLLDTSRFILSYNLG------------------------------
A0A2T2UAJ4      ------------G-----------------------------------------------
A0A519SD85      ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A3M1TXY5      --------L---------------------------------------------------
A0A2E0VQ27      GLITIAILVTRRA------VTYMTPEYRAG---------------GAIKI-------NNL
R6U429          ----------MRD-----------------------------------------------
R5DEG6          ---------------------------------------------MVVVP----------
A0A5C8AF42      ------------------------------------------------------------
A0A642EJV3      ------------------------------------------------------------
A0A161LWY6      YLFVIALAI-SLS-ISFIANRTWKPSYQVS---------------ARVIL-------GGG
A0A212J9Z9      YLFIISVAL-FLG-YAYIKNKSWVPVFYVQ---------------ALMIL-------EDR
F5IV23          YLFIISVAL-FLG-YAYIKNKSWVPVFYVQ---------------ALMIL-------EDR
F8X2T0          YLFVISVVL-FMA-YAFIKNKSWVPLYGIQ---------------AMIIL-------EDR
A0A1M3LAG1      YLFVISIAL-FMA-YAFIKNKSWVPFYGIQ---------------AMIIL-------EDR
A0A212K6G4      YLFVISIAL-FMA-YAFIKNKSWVPFYGIQ---------------AMIIL-------EDR
A0A4Y9IPG7      YLFVISIAL-FMA-YAFIKNKSWVPFYGIQ---------------AMIIL-------EDR
A0A2V3PNY7      YLFALSLAL-FLG-YAYIKNKSWTPLYQSG---------------AVLMM-------ESR
A0A1M5DFS8      YLFVLSLAL-FLG-YAYLKNKSWTPLYRSG---------------AVLMM-------ESR
A0A4Y8KZS5      YLFILSLAL-FLG-YAYLKNKSWTPLYRSS---------------ATLMM-------EPR
A0A239K409      YLFLLGLLI-TVG-TAYVYIQHATPLYLIS---------------GTLLI-------KTS
A0A350V3E4      MPILLSLAV-GLV-VSYFYAYSQVDIYASA---------------SSMRL-------SKP
A0A1M6MYT6      YWYVVAVIV-AGA-LAWLYVQYTTSVYEIK---------------SSMLVE------EGK
A0A2P8CDS1      YWFVIAFIL-TVT-GIWLYYRYSHPVYAVS---------------STMLIH------EQQ
A0A5M4A2I9      -----------------------------------------------MLIH------EQQ
A0A353WYK7      PVLIMLLIF-SVA-TAYLTIRYTKDLYQSE---------------SVLQL-------DIK
A0A355BP94      LIIILLFLS-TNL-IAYLKIRWTKDEFESY---------------SELKL-------EVK
A0A136LSC7      VWIVLIFIA-VNL-AAYLTIRYTKDLFESE---------------SEMKL-------DIK
A0A5C7N8Q5      IWIILIFIA-ANL-AAYLTIRYTKDLFESE---------------SEMKL-------DIK
A0A1V5S1J9      YLFVISLAI-FLS-IAYVKNRSWQPNYKSS---------------ALVII-------EEN
A0A0A2EYC8      YLFAIGVVI-ALT-IAYYQNRSFVPIYNSS---------------LRLLL-------K-Q
A0A2G6H6Y4      YLFVIGASI-GFG-LAFYKNQKVVPNYLSY---------------SQILL-------EDK
A0A1M3DPL8      YLILISVFV-FMF-LAYMQNRKWLPSFKSS---------------ATVII-------DES
A0A1V5F519      YLFLIFIPF-FLI-GGYLKNRSWMPLYQSV---------------GTIII-------NEN
A0A2G6R1T9      YLFVIFGVL-AFG-ASYLKNRSWVPVYFSS---------------GKLMI-------DPN
A0A2W4RDE8      YYFPLGLLI-TMP-LAYAYIQLTEPRYLVR---------------ASMLL-------KGE
A0A0L8VEV2      YWFMIAGII-GGA-GGYLLTQVTPPSYELN---------------SLFLI-------KKK
A0A1I2A9Z9      YWFMIVGII-GVG-LGYLKTQVTAPAYKLE---------------SLFLI-------KTD
A0A142HHS5      PWVIFLLTL-GIT-SSWLYMRYTKPIYEAT---------------SILKI-------DDH
A0A660LQT8      YWFVVSVLL-FLG-LGMYMILRTPPVYNRY---------------ASVLI-------KDN
A0A350PNH9      RWFVISLVV-TLG-IATYHLLSTPCVYQRT---------------ASILI-------KED
A0A354LNT9      RWFVISLVV-TLG-IATYNLLSTPCVYQRT---------------ASILI-------KED
A0A2M6GH67      IWIVFLIML-GLG-ASYLFLRYTKPVYRSS---------------STLKI-------DER
A0A389LWV6      YLFLVVILL-SLS-LALLKNKTWTPTYKTS---------------STILI-------NEN
A0A1G9B1T9      YLLLGSLLL-TLA-LAYVVILTTPEVYKVS---------------SSMLV-------RDE
A0A3D0FMX4      YLYVICLAI-AFG-ISIYSNRKWVPTYRTA---------------GTLII-------NEY
A0A1M3MEI8      YLFVIGLVI-AFG-LSYMQNRKWLPEYKST---------------GSVII-------DDS
A0A1J5HQM0      YLFVIFVII-SLG-MAYLKNRTWIPSYKSA---------------GTMLI-------EEY
A0A653AC35      YLFVIFIAL-ALG-AAYLKNRSWIPSYQST---------------GTLMI-------EES
E4T131          YLFVIGIIL-SLG-LAYIENRSWLPTFQTE---------------GRVLI-------DEN
A0A521H707      YWLFLLLTI-SST-FAFLYLRYTHPIYLSQ---------------ATL---------KIG
A0A1F3D6P8      YFYIICLVI-LLT-VAFLFNKYSSRLYEVK---------------ASI---------GPV
A0A356Z058      YFYIICLVI-LLT-VAFLFNKYSSRLYEVK---------------ASI---------GPV
A0A3D1BT36      YYFISSIIL-LGL-MAFLLNKFTPAVYEVN---------------SII---------GPV
A0A352ME00      YLYMALIVL-CLA-IAFFYNHFSKKVYEAS---------------ASL---------SPV
A0A3D3HL11      YFYIASFFI-CLL-IAFLVNRFSPTVYEVN---------------SVI---------GPV
A0A5R9QZP0      YLYLLSIVV-FLL-LGYTYNKFVPTVYQVN---------------SVI---------GPV
A0A2W7RD29      PLFLLTGII-CLF-IAHTSYKSTVTTYEIN---------------SKLFI-------YTE
A0A3N2NDY8      RWFTVSIVL-FCC-LGVLYVLRQQPVYSRS---------------MELLI-------KDQ
D7JEV9          YLFVLGVFI-SLA-IAYYQNRSFVPIYNSS---------------LRMLL-------KQE
A0A4R6H3B7      YWFMIVGII-GVG-LGYLKTQVTAPAYKLE---------------SLFLI-------KTD
A0A2W7QSQ0      YLFPIFILL-FCG-VAYYYIKTITPEYLIS---------------SVIII-------KEG
R7F6L5          YWYVISVAV-CVG-IAWLMLARSPRLYTKS---------------ETILI-------KDP
A0A553GA49      KLYVISITL-FLGIGVLFNKFSEPKVNIS----------------AKLVV-------HES
A0A497D6F6      -----------VS-IAYVYKRYATPIYEIT---------------SSLLLE------VGN
A0A5M4AAB9      -----------------MYYKYTHPIYEVS---------------ASILIE------EQQ
F4KR18          YLYLAFSII-CIG-LAYVYYKNQQPVYAIT---------------SKLLIR------ERE
C9LKL0          RWFAFSIIV-CVA-CGWYYQQIQPRVYTRQ---------------ATMLIEGGNGSGRGG
A0A3D0QPV7      RWVLLFLITSLLA--AWLYLRYTPPVYESL---------------SVIQI-------SEE
A0A496KT23      KWFLLSVIVCLGG--AYYHLLRTPKTYVAS---------------ASILI-------KPD
L1M9T3          KWFVLSLLVCLSS--ATYYLLRTPKTYVAS---------------ASILI-------KPD
A0A3C0I8F1      PFIILIVGLSLGGSYLFLRYTKALFQSSSD---------------LRLSI-------RDE
R5JJI4          ------------------------------------------------MI-------RDD
A0A3D2HF71      YWFAGALLI-ALS-IAYSINRWSEDVYSVS---------------STLLI-------KDE
A0A0A2DQN2      KWFVLSVLI-CAG-YMYYRSAQQPYTYMSE---------------VTVII-------QDP
A0A0A2F2N5      KWFLLSILL-CTG-YMYYKSAKQAYTYESV---------------VTVIV-------RDP
L1NGW4          YLYVICVGI-VVA-FALYRTAKQPYIYEAS---------------VKVFI-------KDA
Z4WRA0          YLYVICVGI-VVA-FALYRTAKQPYIYEAS---------------VKVFI-------KDA
U2K8K9          FLYILCVGI-VVA-LALYRNARQPFTYEGV---------------VKIFI-------RDA
A0A069ZM60      WLYLLSVGV-VLA-VALYRNAKQPYVYESS---------------VKIFI-------KDA
J6GV98          WLYLLSVGV-VLA-VALYRNAKQPYVYESS---------------VKIFI-------KDA
A0A134B4F8      WLYLLSIGV-VLA-VALYRNAKQPYVYESS---------------VKIFI-------KDA
A0A134B8C7      WLYLLSIGV-VLA-VALYRNAKQPYVYESS---------------VKIFI-------KDA
A0A4Z0EKR0      YLFLIAVALCLGA-AFIYLRYYTVSVYSVY---------------STLLI-------KDE
A0A229I3A5      RWFILSLVV-TCG-IAIYYNLTTPNVYQRT---------------ASLMI-------KDE
A0A3R6HJB3      RWFILSLVV-TCG-IAIYYNLTTPNVYQRT---------------ASLMI-------KDE
B5CTK0          YWFLVSVIL-CLF-FGWYTLQKAIPTYKRM---------------ATVLI-------KDN
A0A1M6B6D5      PLFLIFLAI-TFS-IAYYINVRKLPVYLIE---------------NLVSI-------RDD
A0A451FS66      PLFLISFLI-TFS-IAYYFNIRKLPIYQME---------------NLVAI-------KDD
A0A2E3GN39      ------MLL-SSG-VAHIFLHFSTRIYSSK---------------GVLIH-------IAG
A0A3D1MEL0      ------MLL-SSG-IAHIFLHFSTRIYSSK---------------GVLIH-------IAG
F0R0C9          RWFVVSLVL-TLG-IAVYYLLTTPPVYTRA---------------ASLLI-------KED
A0A2A4N9A6      LLFCLIFAM-AMF-GVWLFLRYTPPIYQAVTHIRAASNKAVELGTFVNFL-------EKD
A0A368D1N7      KWFFLFMLL-SSG-IAHIFLHFSTRIYSSK-------------GVLIHIA-------GED
A0A3B8TU58      ------MLL-SSG-VAHIFLHFATRVYDSK-------------GVIIHIG-------GEQ
A0A1T5IIR6      YWFLLCVLL-ALG-VAYYRYSRMPFVYSSG---------------VTAII-------KNP
A0A3E0QD27      LFVILTICF-TSA-FLYLRYTLPIYESRGI---------------LKIGT-------VNT
A0A0M1W1I6      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
A0A4R4GHU2      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
I8WPR6          YWFVLSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
A0A0K2HKS3      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
B6W3W8          YWFVLSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
A0A4R4GSI6      YWFVLSVSL-FGG-YTWYQYAKLPFIYSRS---------------ATVMI-------KDA
A0A076IRY8      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
A0A3A6AD54      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
A0A3A6MIU7      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
I8WPP8          YWFVLSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
A0A372Y7D2      YWFVLSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
A0A3E4JJC9      YWFILSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
A0A3E4WDQ0      YWFILSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
A0A414H9P2      YWFILSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
C3R5A8          YWFILSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
A0A1C5XJA7      KWFIMSVLI-FGG-IAWYKYATAPLVYFGS---------------ATVII-------KDP
A0A3E5BU42      KWFVLSVLL-FGG-LAWYHYATLPLVFFRN---------------VTVII-------KDP
R7CUW4          KWFLISVLV-CGG-LAWLSYARSPLVYFRS---------------ATVII-------KDP
A0A416GGJ1      KWFLLSVLV-FGS-AAWLYYARKPFVYFRS---------------ATVII-------KDP
D1JY72          YWFVLSVSL-FGG-YAWYQYAKLPFIYSRS---------------ATVMI-------KDA
D7J4K6          KWFVLSVLL-FGG-MAWYHYAKSPLVFFRS---------------VTVII-------KDP
Q8ABP9          KWFVLSVLL-FGG-MAWYHYAKSPLVFFRS---------------VTVII-------KDP
A0A5M6AHF7      KWFVLSVLL-FGG-MAWYHYAKSPLVFFRS---------------VTVII-------KDP
D6D2Z5          KWFVLSVLL-FGG-MAWYHYAKSPLVFFRS---------------VTVII-------KDP
A0A1T3EDR4      YWLVLSCIF-FGG-YYYYRYSKSLYVYRDK---------------EVVMI-------KKQ
A0A174SDD8      KWFVLSILL-FGG-CFWYIYCKTPFEYSRV---------------AIVMI-------KTP
A0A1H7RFH3      KWYLLSILL-FGG-CFWYIYCKTPFTYSRV---------------AIVMI-------KTP
A0A139L1N2      KWYLLSILL-FGG-CFWYIYCKTPFTYSRV---------------AIVMI-------KTP
A0A174TVL8      KWYLLSILL-FGG-CFWYIYCKTPFTYSRV---------------AIVMI-------KTP
A0A1H8BJR6      KWYLLSILL-FGG-CFWYIYCKTPFTYSRV---------------AIVMI-------KTP
R9H6G0          KWYLLSILL-FGG-CFWYIYCKTPFTYSRV---------------AIVMI-------KTP
A0A412GR09      KWYLLSILL-FGG-CFWYIYCKTPFTYSRV---------------AIVMI-------KTP
A0A4Q5DX00      KWYLLSILL-FGG-CFWYIYCKTPFTYSRV---------------AIVMI-------KTP
A0A081PBV5      KWFLLSIFI-FGG-YYLYQYSKTPFIYSRS---------------ETIMI-------KTP
A0A1I2AN85      KWFLLSIFI-FGG-YYLYQYSKTPFIYSRS---------------ETIMI-------KTP
A0A4U0GMP3      KWFVLSILI-FGG-YYLYQYNKTAFIYSRT---------------QTVMI-------KTP
A0A1H6CKR6      RWYLLSILI-FGG-YFYYQYNKTPFLYKSS---------------QTVMI-------KTA
A0A235E1C0      KWFLLSILV-FGG-FYYYQYSKTPFLYKKE---------------QTVMI-------KTA
R6D982          KWYVLSILI-CGG-YFWYDYSRTPFVYSRS---------------ATVMI-------KTP
A0A1F0I8C4      KWYFLSILL-FGG-CFWYFYCKTPFVYSRV---------------AIVMI-------KTP
A0A3A5RIJ2      KWYFLSILL-FGG-CFWYFYCKTPFVYSRV---------------AIVMI-------KTP
A0A515IZJ5      KWYFLSILL-FGG-CFWYFYCKTPFVYSRV---------------AIVMI-------KTP
A0A5M5NLR3      KWYFLSILL-FGG-CFWYFYCKTPFVYSRV---------------AIVMI-------KTP
A0A0D5BSQ0      KWFALSVLI-FGG-YYYYQYSKTPFVYNRS---------------EVVMI-------RTP
A0A1T3F6P5      KWFALSILV-FGG-YYYYQYSKTPFVYNSS---------------ETVIV-------KTP
A0A0W8EPA0      KWFALSILL-FGG-YYYYQYSKTPFVYNSS---------------EIVIV-------KTP
A0A365UKN1      KWFALSILV-FGG-YYYYQYSKTPFVYNSS---------------EIVIV-------KTP
A0A4R6WE41      PWFLASILL-FGG-YYLYDYSKTPFMYGQA---------------QTVLI-------KTP
A0A2T5RP38      KWFALSILV-FGG-YYYYQYCKTPFVYSRS---------------EVVMI-------KNS
A0A1A6CF06      KWFALSILI-FGG-YFYYQYSKSPFIYNRS---------------EVVMI-------KTP
A0A1T3D6S8      KWFALSILI-FGG-YFYYQYSKSPFIYNRS---------------EVVMI-------KTP
A0A1P8E011      KWFALSILL-FGS-YYYYQYAKSPFIYRSA---------------ETIII-------KTP
A0A1V3N3U3      KWFVLSVLC-FGL-YFYYGYSKSPFIYRST---------------EMVMI-------KTP
C2FUH6          KWFALSVLL-FGG-YYYYQYSRSTFMYRSS---------------EMVMI-------KTP
A0A0B8T471      YWFVLSVLL-FGG-YYYYQYSKTQFLYSRS---------------QTVMI-------KST
A0A4R7D2K0      YWFVLSVLL-FGG-YYYYEYSKTQFLYSRS---------------QTVMI-------KST
A0A2X2J8S4      PWFLLSVCI-FGG-YYYYQYSKTTFSYRQA---------------STVMI-------KTP
A0A3C0S618      PWFLLSVCI-FGG-YYYYQYSKTTFTYRQA---------------STVMI-------KTP
A0A4P7DRF9      KWFLLSVLI-FGG-YYYYQYSKTPYLYSQS---------------ETVMI-------KTA
A0A239XXC4      KWFLLSILI-FGG-YFYYQYSKTPFLYKKD---------------QTVMI-------KTA
A0A4U9K473      KWFLLSILL-FGG-YYYYQYSKTPFLYKKD---------------QTVMI-------KTA
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A641LIG3      ------------------------------------------------------------
A0A641LPE6      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ------------------------------------------------------------
A0A2T2UAJ4      ---------------------------------------------------GKGVGY---
A0A519SD85      ---------------------------------------VLLSAVNSL---KYKIVF---
A0A4Q3SEI4      ------------------------------------------------------------
A0A3M1TXY5      ---------------------------------------------------DFGISY---
A0A2E0VQ27      NYTQAAINLFGEENEK---NLPRQNENFLAEVEVFQTRDLIRKTLENL---HWELTT---
R6U429          ----------LASFTGGLSRMRSSGSNVYNEMEAFSSPDLMCSVVKRL---GLETSY---
R5DEG6          ------------------------------------------------------------
A0A5C8AF42      ---------------------NSKQDDISSEIELMRSQFMFERAIKRT---SYNVSL---
A0A642EJV3      ------------------------------------------------------------
A0A161LWY6      QASA------SQQMVMQGVNLNMAYKNNDNQMIMFTSNDLVERAINKI---NANVDY---
A0A212J9Z9      NTASVVAGSVPTGTLLR---------NTENQQIVLKSYGLTERTVKSLPA-KMRIEY---
F5IV23          NTASVVAGSVPTGTLLR---------NTENQQIVLKSYGLTERTVKSLPA-KMRIEY---
F8X2T0          GSSMIS-GAVPLGSILR---------NTENQQIVLESYGLTERTVKNLPK-KMHIDY---
A0A1M3LAG1      GSSMIS-GAVPLGSILR---------NTENQQIVLESYGLTERTVKNLSK-KMHIDY---
A0A212K6G4      GSSMIS-GAVPLGSILR---------NTENQQIVLESYGLTERTVKNLPK-KMHIDY---
A0A4Y9IPG7      GSSMIS-GAVPLGSILR---------NTENQQIVLESYGLTERTVKNLPK-KMHIDY---
A0A2V3PNY7      GNAGVAIGSVQLGTLVQ---------NSINQQMLLNSYDMVVRAVAKLP--QMRVDY---
A0A1M5DFS8      GNSGVAMGAVQLGSLVQ---------NSVNQQMILNSYDMVVRTVAKLP--QMRVDY---
A0A4Y8KZS5      GNNGVAMGSVQLGSLVQ---------SSVNQQMILNSYDMVVRTVGKLP--QMRVDY---
A0A239K409      GNEGQL----SESAAFSDLNTFKTSKNFDNEIEVLKSYRLMRRVLSKL---PVNISY---
A0A350V3E4      KENVLENKIFSDIEGEL------PERYINNEVEILKSFAIREKTAASL------------
A0A1M6MYT6      SGSPLGSGGANSENIFLGLGMMNSMRNIHNQIAVLSSTPIVSRTLDEL---DFSVNY---
A0A2P8CDS1      NQNPLTTQKDPESNVFQGFGLFQGKQNTENQIQILKSWTQVRTTLEHF---NFEATY---
A0A5M4A2I9      NQNPLTTQKDPESNVFQGFGLFQGKQNTENQIQILKSWTQVRTTLEHF---NFEATY---
A0A353WYK7      SE--------AQVLGFRSF--DEDINNLSKEIELLKSKLFFTRVAEVI---NNDVNV---
A0A355BP94      QD--------ATALGIKQFAEDQNRNLVAGEIEQMKSKLFFSRVLDSL---DLGISY---
A0A136LSC7      RD--------ATELGIKTYMEDQNVNQVSGEIEQIKSKIFFNQVLDSL---DFEVSY---
A0A5C7N8Q5      RD--------ATELGIKTYIEDQNMNVVSGEIEQIKSKLFFNKVLDSL---DLSVSY---
A0A1V5S1J9      KGLSGAQAALMQGFS-----VERGYRNVNNQVIMFGSYELISRVIAKQP--ELTIDY---
A0A0A2EYC8      E---SGSFLSMQNFNSG--FSRQDQTNIENQILLLQSQDLIGRTIDSLP--NFKIDF---
A0A2G6H6Y4      K---ADSFATLQNYS-----SRGSGKGVENQIVILKSWDMVTRTIDSLP--QFKIDF---
A0A1M3DPL8      RGSMNSAQVLMQGFG-----IQESYRNVNNQVIMISSYDLMSRVVDSLP--EFQIEY---
A0A1V5F519      KYR-SSSQGFMQGFG-----LEEAYQNVNNQVIILNSYDLIGKVVDSLP--FMKVDY---
A0A2G6R1T9      AGQ-NNPQ-FMQGFG-----VESGHKNMANQVILLTSRDLISQVVDNLP--EMRVEY---
A0A2W4RDE8      KDKGP-----SQFLKGM--ELFQSATDLEDEIGIIKSFSNVESAIKRL---NFGISY---
A0A0L8VEV2      DNA-------QVQLDLPFSNAMGGNINLLNHIGILTSHSINRQVLENL---DWTTSW---
A0A1I2A9Z9      NKG-------GLRMDFPLPSAFGGNINLQNNIGIITSYSINRQVMENL---DWSTSW---
A0A142HHS5      SDASALGLGMAMGGAEN-----NQASQLAGEVELIKSGLTYKRLKQTV---PLDINY---
A0A660LQT8      QSSKN-----TSIDQQLAQIGVGKASNVNNEMLAFQSPALTENVVRRL---KLDVNY---
A0A350PNH9      GKSQSINSDVASMFSDM--GISGGKSNVNNELIAIQSPAVLLEAGKQL---KLDVNY---
A0A354LNT9      GKSQSINSDVASMFSDM--GISGGKSNVNNELIAIQSPAVLLEAGKQL---KLDVNY---
A0A2M6GH67      SQAGALGL--GGPLGNA--AAEQNMVSLSGEVELINSDIIYRDLKENL---NLKVNY---
A0A389LWV6      KGQQV-----SDLTTGF--AVSQGLRNVNNQMIMYGSYDLISKSVDKL---DISTDI---
A0A1G9B1T9      SATGN-----QQFMEGI--GLFEPQTKISDQTAMLTSFDIIRRTLEKL---DFGVTY---
A0A3D0FMX4      ---GSQ----ASNALMQGFGVDVGYRNVNNQVIMMGSYDLMCRVVDSLP--FMRTDY---
A0A1M3MEI8      -RTMMN----SAQVMMQGFGIQDAYRNVNNQVIMLGSYDLLGRVVDSLP--ALSIDY---
A0A1J5HQM0      --KITN----NTQAMMQGFGVDAGYKNTRNQIIMLSSYDLIGRVVDSLP--QMRVDY---
A0A653AC35      -SRNNS----GSQVLMQGFGVQSGYRSLENQRYILTSYDFISRVVDSMP--SLNIDY---
E4T131          RSSNAN----SSQALMQGFGIQSGYKNAKNQIIMLGSNDLFSKVVDSLP--FLKVDY---
A0A521H707      TVNTASAVLNIQNSQAL--DILGSNQ-FAGDIELLRSRVMISRVLDRM---PLDVGY---
A0A1F3D6P8      QNDASSLLTSNDLFMGL--KALQSNRNLESGISNFISFPTVSSTISSM---NLEIGY---
A0A356Z058      QNDASSLLTSNDLFMGL--KALQSNRNLESGISNFISFPTVSSTISSM---NLEIGY---
A0A3D1BT36      ENKQSSLLESSDIFSGL--GSLSQSRNLENDINSLKSFSLISETIKNL---ALEIGY---
A0A352ME00      EDKTSSLLKSNELFSGI--QSLESLRNIENDIKNLSSFELVYSTVNSM---NLEVSY---
A0A3D3HL11      EDRRSSMLGSNDLFSGL--GALAESRNLENDINSLNSFSLVATTIRSM---NLEVGY---
A0A5R9QZP0      EDRRTTFLESSRQFSVL--GSQSQTSNLENDMNSLSSFSLVSKTIKDL---GLEISYYEQ
A0A2W7RD29      GQS-------INFFEKLQNVTNSQNVLLDNEVVIIKSNPVIKSTLEVL---DLKVGY---
A0A3N2NDY8      DGGGGVADI-SNAFSSL--GLVSSNTNVNNELISLSSPAVMYEVVKNL---GLDVNY---
D7JEV9          AGSLSYMQ--GQGFNSV--MNRLDQTNIENQILLLQSQDLIGRTIDSLP--KFRVDF---
A0A4R6H3B7      NKSS------NLRMDFPLSSAFGGNINLQNNIGVITSYSINRQVMENL---DWSTSW---
A0A2W7QSQ0      ERNNNV----TENSIVSDLENMKSTITVENELEKLKSKSLLMDAVIKN---KGFINY---
R7F6L5          TFGNS-----ASSVDLSEVGVMPKYANLENEIAIFTSPDLMENVVKAY---NLNNFY---
A0A553GA49      RRNMI-----DPSSFMPGSELFSGRNTFQNSLISLNARPLLEQVVNKL---NIDVFY---
A0A497D6F6      SNSPLTNKNANEDNVFQGFGITDSDRNIFNQLIVLTSTPILNRTLEEL---DFDINY---
A0A5M4AAB9      NQNPLITAADKQPNVFQGFSLFNGNQNIENQIQILKSWSLIYNTLEHF---NFEVTY---
F4KR18          RDY-----GPGADFVKQNINFAAAAEDASNEIEMLTSFALMKAVVEDL---GLETRY---
C9LKL0          FSSSRNRGSGLNTMMDF--NGVTIGDNLSNELFILTTRRLMRKVVDSL---GLDVDY---
A0A3D0QPV7      NN--------MKQVIPGINSFEDEQSGVDKALELMRSEFLFKKSIEKL---DFTVSF---
A0A496KT23      NNRGNSPDQLLARQRMI--VEGASDAQMTNEILALSSATITRTVAERL---NLDVEY---
L1M9T3          SNKGNTPDELLAR-RMN--VESGLDAQMTNEMLSLKSVTITRAVAERL---NLDVEY---
A0A3C0I8F1      AQPGGLPIQ-TAPINNN--------AHLLGEIEFIKSELLHEEVIKKM---NLGLTI---
R5JJI4          SKGGSISE--STAFADI--SFLGGKRNVDNEVLVFQSRHLMEKVARRL---HLDMSY---
A0A3D2HF71      QLMGGLSSGTTTLFPGM--EAFRSQQNLKNEMGILRSFTLNYRVMQEMPDFHVDYTA---
A0A0A2DQN2      SQRTSIDFD-FINPRQR------GRANIENERLILRSQRIIENALKKI---DAQVSY---
A0A0A2F2N5      AQRTSIDLD-LVG--RR------SRVNIENERLQLRSRVVIANAIKAI---NGHVHY---
L1NGW4          SQRSMMDAD-VLRYMRS------FRLNMDNEKMQMSSRRVLERAVKTV---NANVYY---
Z4WRA0          SQRSMMDAD-VLRYMRS------FRLNMDNEKMQMSSRRVLERAVKTV---NANVYY---
U2K8K9          SQRTMVDDN-MLRYMRN------TRLNVSNERIQLSSRRVMQRTVRLS---GANVFY---
A0A069ZM60      SQRAMMDTE-MLRYARA------ARLNMDNEHVQLVSRRVLERTVKMA---NANVFY---
J6GV98          SQRAMMDTE-MLRYARA------ARLNMDNEHVQLVSRRVLERTVKMA---NANVFY---
A0A134B4F8      SQRAMMDAD-VLRYTRS------TRLNMDNERMQLVSRRVMERTVKMA---NANVLY---
A0A134B8C7      SQRAMMDAD-VLRYTRS------TRLNMDNERMQLVSRRVMERTVKMA---NANVLY---
A0A4Z0EKR0      KTGQNLSN--ADVLNDL--STFKATRNIDNEIQVLRSKSLMTRVVTEL---GLFTKY---
A0A229I3A5      SKAQGIGGDVASMFSDM--GMGNMKSNVNNELIAIQSPAVLLETGKRL---KLDVDY---
A0A3R6HJB3      SKAQGIGSDVASMFSDM--GMGNMKSNVNNELIAIQSPAVLLETGKRL---KLDVDY---
B5CTK0          SSGSM-----SESAVFEDIATVRAERNVSNEMLVFKSNRLMQIVARRL---HLDVNY---
A0A1M6B6D5      QNPFF-----TSNTSLVF-NWGGTSDKVNTSVITLRSRSHNEKVVERT---QYYLTY---
A0A451FS66      QNPFF-----TTTTSLTF-NWGGTTDKVNTSVITLQSRSHNEKIVERL---QFYLTY---
A0A2E3GN39      EEKQS-----LLGLDKTLPNQDFTPTDFQQDVRVITSPIIVNKAFSQK---GLNYVF---
A0A3D1MEL0      EEKQS-----LLGLDKTLPSQNFTPTDFQQDVRVITSPIVVNTAFSQK---GLNYIF---
F0R0C9          SKGQSLSGDVGSTFADM--GLFQANTNVNNELLSLQSPAVMLDVVKRL---HLHTDY---
A0A2A4N9A6      KNKML-------------------LEELQEEIAILKSVFMIKKTLTTM---NYGVSY---
A0A368D1N7      KQNLL-----GLDKTLP--SQNFTPTDFQQDVRVITSPIVVNKAFRQK---GLNYIF---
A0A3B8TU58      KQNLL-----GFDRDFQ--KQ-FTNTDFQQDIRVLTSPLVINNAYSDK---GLNLLF---
A0A1T5IIR6      GDELR-----TARLETY--DQMINKVSVTNEQLQLRSLTIMTEVVKAL---DADVNY---
A0A3E0QD27      ANAVL-----NIGSNQA--LEVLGSNQLAGDVELIRSRVIVSRVVGAL---PLDVSY---
A0A0M1W1I6      YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
A0A4R4GHU2      YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
I8WPR6          YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
A0A0K2HKS3      YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
B6W3W8          YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
A0A4R4GSI6      YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
A0A076IRY8      YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
A0A3A6AD54      YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
A0A3A6MIU7      YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
I8WPP8          YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
A0A372Y7D2      YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
A0A3E4JJC9      YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
A0A3E4WDQ0      YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
A0A414H9P2      YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
C3R5A8          YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
A0A1C5XJA7      SSKTT-----TTGLDRF--DNFINKVNVANEMLQFNSKRLIREVVSRT---HADVSY---
A0A3E5BU42      SNKTS-----TAGLDRY--DNYINKVNVANEILQFRSKRLMREVVQRL---HADVDY---
R7CUW4          SNKTS-----TAGLDRY--DNFINKVNVANEILQFRSKKLMREVVQRV---HADVDY---
A0A416GGJ1      SNKTT-----TAGFDRY--DNYINKVNVANEILQFRSKRLMREVVQRM---HGDVDY---
D1JY72          YSNNI-----GRGLDRF--NTY-SYTNVSNEILQFQSHKLMRDVVNRL---HANVCY---
D7J4K6          SNKTS-----TAGLDRY--DNYINKVNVANEILQFRSKRLMREVVQRL---HADVDY---
Q8ABP9          SNKTS-----TAGLDRY--DNYINKVNVANEILQFRSKRLMREVVQRL---HADVDY---
A0A5M6AHF7      SNKTS-----TAGLDRY--DNYINKVNVANEILQFRSKRLMREVVQRL---HADVDY---
D6D2Z5          SNKTS-----TAGLDRY--DNYINKVNVANEILQFRSKRLMREVVQRL---HADVDY---
A0A1T3EDR4      SSAPI-----TSAFLQS--AE--SPVNIKDEMLQLQSKELLRQVIPYM---GGDKSY---
A0A174SDD8      ANSRS-----TMQLNNS--DFA-GQVNVASEILQFKSKELMRKVIDRL---QANICY---
A0A1H7RFH3      ANSRS-----TMQLNNS--DFT-GLVNVASEILQFKSKELMRKVIDRL---QANISY---
A0A139L1N2      ANSRS-----TMQLNNS--DFT-GLVNVASEILQFKSKELMRKVIDRL---QANISY---
A0A174TVL8      ANSRS-----TMQLNNS--DFT-GLVNVASEILQFKSKELMRKVIDRL---QANISY---
A0A1H8BJR6      ANSRS-----TMQLNNS--DFT-GLVNVASEILQFKSKELMRKVIDRL---QANISY---
R9H6G0          ANSRS-----TMQLNNS--DFT-GLVNVASEILQFKSKELMRKVIDRL---QANISY---
A0A412GR09      ANSRS-----TMQLNNS--DFT-GLVNVASEILQFKSKELMRKVIDRL---QANISY---
A0A4Q5DX00      ANSRS-----TMQLNNS--DFT-GLVNVASEILQFKSKELMRKVIDRL---QANISY---
A0A081PBV5      LNTMP-----GTRITRA--NYY-NTVNVASEILQLRSKELMRKTIDRI---EGDISY---
A0A1I2AN85      LNTMP-----GTRITRA--NYY-NTVNVASEILQLRSKELMRKTIDRI---EGDISY---
A0A4U0GMP3      ANTVS-----TARISRS--NSY-NVVNVAGEILQLRSKELMRRTISRL---NADVSY---
A0A1H6CKR6      SNTIS-----SSRITRP--NNIYNSVNVNSEILQLRSKELMRNTIGAL---DANISY---
A0A235E1C0      TNSMS-----ASRITRP--NNFYNIVNVNSEILQLRSQELMRNTISLL---NADVSY---
R6D982          ANTPS-----AIRLIRS--GDYMGQVNMATERLQFQSKALMRKVISRL---NADVSY---
A0A1F0I8C4      TNSRS-----AMQLYGS--NDFMGQINVASEILQFKSKELMRKVIDRL---QANVSY---
A0A3A5RIJ2      TNSRS-----AMQLYGS--NDFMGQINVASEILQFKSKELMRKVIDRL---QANVSY---
A0A515IZJ5      TNSRS-----AMQLYGS--NDFMGQINVASEILQFKSKELMRKVIDRL---QANVSY---
A0A5M5NLR3      TNSRS-----AMQLYGS--NDFMGQINVASEILQFKSKELMRKVIDRL---QANVSY---
A0A0D5BSQ0      SNTPT-----TARITRS--SSA-NVISVKDEILQLKSKELMRQTIDRI---GADISY---
A0A1T3F6P5      SNTPT-----TARITRS--FGA-NSISVKDELLQLKSKELMRLVVDRI---NADKSY---
A0A0W8EPA0      SNTPT-----TARITRS--FGA-NSISVKDELLQLKSKELMRLVVDKI---EADKSY---
A0A365UKN1      SNTPT-----TARITRS--FGA-NTISVKDELLQLKSKELMRLVVDRI---NADKSY---
A0A4R6WE41      ANTPA-----TARFTRA--SAGYNSVSVASETLQLRSKELMRQAVEHL---GADISY---
A0A2T5RP38      SNTPT-----TARITRT--NVS-SSVSVKDEILQLRSKELMRQTIDRL---GADISY---
A0A1A6CF06      SNTPT-----TARITRS--FSG-GGVSVKDEILQLKSKELMRQVVDKV---GADKSY---
A0A1T3D6S8      SNTPT-----TARITRS--FGG-GGVSVKDEILQLKSKELMRQVIDKV---GADKSY---
A0A1P8E011      MNTPR-----TARISRT--NEAYNSISVASEILQLKSKELMRQTVTRI---GAEMSY---
A0A1V3N3U3      LNTPA-----TARITNT--NNAVGSVSVTSEILQLKSKELMRETIGRI---GAETSY---
C2FUH6          MNTPS-----TARITRT--NSAFNSVSVAGEILQLNSKELMRRTIDRL---NADVSY---
A0A0B8T471      TNTLS-----VSRATRL--NSYYNTVNVAGEILQLRSKELMRNTISSL---RSDVSY---
A0A4R7D2K0      ANTLS-----VSRATRL--NSYYNTVNVAGEILQLRSKELMRNTISSL---RTDISY---
A0A2X2J8S4      ANTPS-----SATLTRS--GMSYNTVNLATEMLQLKSKELMRETVESI---KADVSY---
A0A3C0S618      ANTPS-----SATLTRS--GMSYNTVNLATEMLQLKSKELMRETVESI---KADVSY---
A0A4P7DRF9      SNTMV-----ATRIARP--NNFYNAVNVNSEILQLRSKELMRNTIDSL---NTDISY---
A0A239XXC4      TNSMS-----ASRITRP--NNFYNMVNVNSEILQLRSQELMRNTISLL---NADISY---
A0A4U9K473      NNSIS-----ASRITRP--NNFYNFVNVNSEILQLRSQELMRNTISLL---NADVSY---
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A641LIG3      ------------------------------------------------------------
A0A641LPE6      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A3M1Y2F5      ---------------NI-------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ---------------EK------------EFEQ-EYKFSSP-------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A519SD85      ---ESKKGLR-----WT------------NTYP-NEPLKVS-------------TVK---
A0A4Q3SEI4      ---------------SD-------------------------------------------
A0A3M1TXY5      ---YLKEGLK-----TR------------QTYH-YAPFEVQ-------------LDS---
A0A2E0VQ27      ---YRVGDVR-----LS------------EIYE-ERPFKID-------------YGV---
R6U429          ---VEKQFLR-----TR------------DLFT-NSPLAL--------------VRA---
R5DEG6          -----------------------------SLYYGDKYFNTT-------------------
A0A5C8AF42      ---FSKGQVL-----TE------------EKYL-SSSFYVT-------------PFE---
A0A642EJV3      ---------------SC-------------------------------------------
A0A161LWY6      ---YTTGHFK-----VS------------NLYG-YAPIEIK-------------GDN---
A0A212J9Z9      ---YIQTRFK-----YI------------SLYT-DTPIEIE-------------MID---
F5IV23          ---YIQTRFK-----YI------------SLYT-DTPIEIE-------------MID---
F8X2T0          ---FIQTRFK-----YI------------SLYT-DSPIEIA-------------IDSLET
A0A1M3LAG1      ---FIQTRFK-----YI------------SLYT-DSPIEIV-------------IDSLET
A0A212K6G4      ---FIQTRFK-----YI------------SLYT-DSPIEIA-------------IDSLET
A0A4Y9IPG7      ---FIQTRFK-----YI------------SLYT-DSPIEIA-------------IDSLET
A0A2V3PNY7      ---FKKSKFK-----VE------------NWYG-VTPVTIE-------------AKY---
A0A1M5DFS8      ---FLKTKFK-----TE------------NLYG-VTPITIE-------------AKY---
A0A4Y8KZS5      ---FLKTKFK-----TE------------NLYG-MTPISIE-------------AKY---
A0A239K409      ---YVEESLK-----ER------------ELYGSELPIKVV-------------AHS---
A0A350V3E4      --------LD-----SF------------QVLKGKIPFYLL-------------------
A0A1M6MYT6      ---YSIGRFA-----AT------------ERYQ-DVPFMVV-------------WEE---
A0A2P8CDS1      ---YKIGRFR-----TI------------ELYK-DVPFHIE-------------LDR---
A0A5M4A2I9      ---YKIGRFR-----TI------------ELYK-DVPFHIE-------------LDR---
A0A353WYK7      ---FAYGKVL-----FE------------ERYQ-NSPFFVE-------------Y-K---
A0A355BP94      ---YSLGNVL-----EH------------EMYR-RSPFKAR-------------CIG---
A0A136LSC7      ---YSLGKVL-----TD------------EMYK-RSPFRIK-------------ASH---
A0A5C7N8Q5      ---YSLGKVL-----TD------------EMYK-RSPFLVT-------------TTQ---
A0A1V5S1J9      ---YTQGRFK-----ST------------NLYK-AAPILIT-------------KTF---
A0A0A2EYC8      ---YRKLKFK-----NR------------PMYG-RSPIDIE-------------IIS---
A0A2G6H6Y4      ---FKILTFK-----QK------------ALYE-NLPINVE-------------ILS---
A0A1M3DPL8      ---ISKGRFK-----TR------------NLYE-WTPISID-------------ADF---
A0A1V5F519      ---LTIGRFK-----TR------------NLYT-TTPIIIE-------------ADY---
A0A2G6R1T9      ---ISKGKFK-----TR------------NLYK-MSPIQIE-------------TNY---
A0A2W4RDE8      ---YTEKNFK-----TA------------EHYG-NTPFTIH-------------LDS---
A0A0L8VEV2      ---YEELLLR-----DD------------EMYG-NEPFEIL-------------YDR---
A0A1I2A9Z9      ---YHELMFR-----NE------------ELYK-NEPYDVL-------------FDR---
A0A142HHS5      ---YTQGTVL-----ET------------ELFG-NCPYRVT-------------YVI---
A0A660LQT8      ---SVSGFFH-----DE------------TLYGKTLPIQVQ-------------FLS---
A0A350PNH9      ---SEDGTFH-----PV------------ALYGRTLPVTVH-------------FYS---
A0A354LNT9      ---SEDGTFH-----PV------------ALYGRTLPVTVH-------------FYS---
A0A2M6GH67      ---YAMGNVL-----NE------------ELYN-NAPFKID-------------YEI---
A0A389LWV6      ---YHKGLLK-----SV------------SYYK-ASPILIK-------------SNF---
A0A1G9B1T9      ---YKHDQFI-----QH------------EIYK-RRPFDVE-------------LDS---
A0A3D0FMX4      ---ISRGRFK-----DT------------YLYR-YTPVVFE-------------PSE---
A0A1M3MEI8      ---ISQGRFK-----VR------------NLYG-QSPVVIH-------------TDY---
A0A1J5HQM0      ---ISKGNFK-----TR------------NLYN-ASPIQIN-------------PDY---
A0A653AC35      ---ISKGRFK-----TR------------NKYN-ESPIAII-------------ADF---
E4T131          ---ISKGSFK-----TR------------NLYK-TTPIIIQ-------------TDY---
A0A521H707      ---FAHGKVI-----DH------------EMYT-KSPFSVE-------------YEL---
A0A1F3D6P8      ---FREKHHL--FRQVS------------ELYL-RSPYVVI-------------MDK---
A0A356Z058      ---FREKHHL--FRQVS------------ELYL-RSPYVVI-------------MDK---
A0A3D1BT36      ---FIESDDI--LGQVR------------QVYP-NSHYTVN-------------IDK---
A0A352ME00      ---FSESKKL--LKQTN------------ELFG-TTPFTVS-------------IDK---
A0A3D3HL11      ---FAGKNTI--FQKPT------------QVYL-GNPFSVI-------------IDK---
A0A5R9QZP0      PVRFANKKSLGFINKPL------------QTYG-NNKYIVN-------------IDK---
A0A2W7RD29      ---YVPPETT-----SKNFWSFNKSNLPIEIYE-DAPFEIE-------------LKE---
A0A3N2NDY8      ---STPGRFH-----EK------------TLYGSNLPVNVK-------------FHD---
D7JEV9          ---YKKLQFK-----NR------------PMYA-TSPIDID-------------IIS---
A0A4R6H3B7      ---YHELMFR-----NE------------ELYK-NEPYDVL-------------FDR---
A0A2W7QSQ0      ---YNAEDFF-----KT------------KIDPFQSSIDITVD-----------SIS---
R7F6L5          ---SYNDGFK-----DV------------DIYH-QEPGIIS-------------SPD---
A0A553GA49      ---YQPKVLY-----DK------------NLYT-SSPFQVVLDKNYLQLTGAEFYVE---
A0A497D6F6      ---YSVGRVK-----SR------------EIYK-ESPFEVI-------------WDY---
A0A5M4AAB9      ---SERGFFR-----TT------------ELYH-DLPFEIE-------------FDD---
F4KR18          ---YWKHKFS-----EY------------DAYG-NFPIVVD-------------------
C9LKL0          ---TTKNALH-----RI------------ALYD-NRPFDVS-------------FGT---
A0A3D0QPV7      ---FSEGQIL-----TE------------NKYP-AKYLRFS-------------------
A0A496KT23      ---THKGMFH-----DK------------VIYGSELPVKVE-------------FLN---
L1M9T3          ---THKGMFH-----PK------------VIYGSELPVKTE-------------FLN---
A0A3C0I8F1      ---YAQGNIL-----DN------------ELYG-NVPFEIK------------WWAT---
R5JJI4          ---KVKNGLR-----ED------------ELYT-HSPITVL-------------FPE---
A0A3D2HF71      ---VGRRGIV-----EK------------RIYN-KSPFIVI-------------YDS---
A0A0A2DQN2      ---KYKKEFR-----MI------------ELYK-ASPIRVS-------------FVD---
A0A0A2F2N5      ---GIIDGLR-----PI------------ELYK-SAPIQVT-------------FAD---
L1NGW4          ---QVQSGLR-----TL------------ELYT-AAPFSMR-------------FLD---
Z4WRA0          ---QVQSGLR-----TL------------ELYT-AAPFSMR-------------FLD---
U2K8K9          ---NVKSGLR-----TL------------ELYD-EAPFKVT-------------FLD---
A0A069ZM60      ---NVKSGLR-----TL------------ELYS-DAPFSMK-------------FLD---
J6GV98          ---NVKSGLR-----TL------------ELYS-DAPFSMK-------------FLD---
A0A134B4F8      ---NVKSGLR-----TI------------ELYT-DAPFSMK-------------FLD---
A0A134B8C7      ---NVKSGLR-----TI------------ELYT-DAPFSMK-------------FLD---
A0A4Z0EKR0      ---SIEGKVR-----DT------------EIYGNELPIKVI-------------LGK---
A0A229I3A5      ---AIDGRFH-----KE------------ALYGADLPVTVD-------------FVG---
A0A3R6HJB3      ---AIDGRFH-----KE------------ALYGADLPVTVD-------------FVG---
B5CTK0          ---LIEEGLH-----MK------------ELYT-QAPISVR-------------FFD---
A0A1M6B6D5      ---LRDGEYQ-----QE------------DAYK-QTPFFVEVDTAKSQMLNHQIKVV---
A0A451FS66      ---LRDGKFQ-----LI------------DAYK-QTPFLIRVDTTKAQVLNQQFKVV---
A0A2E3GN39      ---YEVGDFR-----SL------------EIYP-NPYFTID-------------SFY---
A0A3D1MEL0      ---YEVGDFR-----SL------------EIYP-NPYFTID-------------SFY---
F0R0C9          ---LTDGTFY-----KQ------------VLYGQTLPFSIS-------------FFG---
A0A2A4N9A6      ---FAEGDLL-----TQ------------ELYK-SSNYKVD-------------FMV---
A0A368D1N7      ---YEVGDFR-----SL------------EIYP-NPYFTID-------------SFY---
A0A3B8TU58      ---YDVGNFR-----SL------------EIYP-NPYFSVD-------------SFY---
A0A1T5IIR6      ---LDRIKFR-----DV------------ELYTSQSPVRMA-------------FNR---
A0A3E0QD27      ---YAHGKVI-----DH------------EMYL-SSPFRIEYEIEDSAIFSIPFYLD---
A0A0M1W1I6      ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
A0A4R4GHU2      ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
I8WPR6          ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
A0A0K2HKS3      ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
B6W3W8          ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
A0A4R4GSI6      ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
A0A076IRY8      ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
A0A3A6AD54      ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
A0A3A6MIU7      ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
I8WPP8          ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
A0A372Y7D2      ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
A0A3E4JJC9      ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
A0A3E4WDQ0      ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
A0A414H9P2      ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
C3R5A8          ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
A0A1C5XJA7      ---KMKDGLR-----NV------------ELYT-KSPVAVS-------------FAD---
A0A3E5BU42      ---RVEEGLR-----MN------------ELYN-QSPINVS-------------FIN---
R7CUW4          ---LIQDGLR-----YN------------ELYT-QSPVRLS-------------FPD---
A0A416GGJ1      ---LIEDGLR-----HI------------ELYT-KAPVTVS-------------FPG---
D1JY72          ---LIMDDLR-----EE------------ELYT-QAPVKVS-------------FPE---
D7J4K6          ---RVESGLR-----MN------------ELYT-LSPVNVS-------------FIN---
Q8ABP9          ---RVESGLR-----MN------------ELYT-LSPVNVS-------------FIN---
A0A5M6AHF7      ---RVESGLR-----MN------------ELYT-LSPVNVS-------------FIN---
D6D2Z5          ---RVESGLR-----MN------------ELYT-LSPVNVS-------------FIN---
A0A1T3EDR4      ---KISKGLR-----DY------------ELYT-DSPVEVI-------------LLG---
A0A174SDD8      ---TVHEGLR-----PV------------ELYT-ESPVRVA-------------FLE---
A0A1H7RFH3      ---TVYDGLR-----PV------------ELYT-ESPVRVT-------------FLD---
A0A139L1N2      ---TVYDGLR-----PV------------ELYT-ESPVRVT-------------FLD---
A0A174TVL8      ---TVYDGLR-----PV------------ELYT-ESPVRVT-------------FLD---
A0A1H8BJR6      ---TVYDGLR-----PV------------ELYT-ESPVRVT-------------FLD---
R9H6G0          ---TVYDGLR-----PV------------ELYT-ESPVRVT-------------FLD---
A0A412GR09      ---TVYDGLR-----PV------------ELYT-ESPVRVT-------------FLD---
A0A4Q5DX00      ---TVYDGLR-----PV------------ELYT-ESPVRVT-------------FLD---
A0A081PBV5      ---TVKKGLR-----EY------------ELYK-DAPVKVQ-------------FID---
A0A1I2AN85      ---TVKKGLR-----EY------------ELYK-DAPVKVQ-------------FID---
A0A4U0GMP3      ---SVRQGLR-----NT------------ELYT-DAPIQIS-------------FED---
A0A1H6CKR6      ---KRQNGLR-----TL------------ELYK-TSPFLVK-------------FVD---
A0A235E1C0      ---TKEEGLR-----TI------------ELYK-TSPFIVR-------------FVN---
R6D982          ---AVRDGLR-----QK------------ELYM-AAPVRVH-------------FLV---
A0A1F0I8C4      ---MVYDGLR-----PR------------ELYT-EAPIRVA-------------FMD---
A0A3A5RIJ2      ---MVYDGLR-----PR------------ELYT-EAPIRVA-------------FMD---
A0A515IZJ5      ---MVYDGLR-----PR------------ELYT-EAPIRVA-------------FMD---
A0A5M5NLR3      ---MVYDGLR-----PR------------ELYT-EAPIRVA-------------FMD---
A0A0D5BSQ0      ---KIRKGLR-----DY------------ELYK-KSPVQVK-------------VEG---
A0A1T3F6P5      ---KVHRGLR-----DY------------ELYK-KSPVQVQ-------------VEG---
A0A0W8EPA0      ---KVHKGLR-----DY------------ELYK-KSPVQVK-------------VEG---
A0A365UKN1      ---KVHRGLR-----DY------------ELYK-KSPVQVQ-------------VEG---
A0A4R6WE41      ---SHKVGLR-----VY------------ELYD-KSPIKVK-------------ILK---
A0A2T5RP38      ---KVHRGLR-----DY------------ELYK-KSPVKVV-------------FSN---
A0A1A6CF06      ---KIHSGLR-----DY------------ELYK-KSPVQVK-------------VEG---
A0A1T3D6S8      ---KIHSGLR-----DN------------ELYK-KSPVQVK-------------VEG---
A0A1P8E011      ---TVGDGLR-----RK------------ELYT-ASPIKVI-------------VPQ---
A0A1V3N3U3      ---SIRKGLR-----DI------------ELYR-TSPVKVD-------------LAG---
C2FUH6          ---VIRNGLR-----DQ------------ELYT-QSPVKVT-------------WMD---
A0A0B8T471      ---SVQHGLR-----TV------------ELYR-NSPFEVK-------------FLN---
A0A4R7D2K0      ---SVEQGLR-----KV------------ELYR-KSPFEVK-------------FLN---
A0A2X2J8S4      ---VVRRQLR-----DY------------ELYN-ESPVLVQ-------------FVN---
A0A3C0S618      ---VVRRQLR-----DY------------ELYN-ESPVLVQ-------------FVN---
A0A4P7DRF9      ---SVKSGLR-----TL------------ELYR-KSPYLVE-------------FEG---
A0A239XXC4      ---SRKEGLR-----SV------------ELYK-TSPFIVR-------------FRN---
A0A4U9K473      ---GRKDGLR-----SV------------ELYK-TSPFIVR-------------FIN---
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ---------------SA------------APALQPAPAAAS-------------------
A0A519TAP8      ----------------M------------QLLVDSVPGRAL-------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A641LIG3      ------------------------------------------------------------
A0A641LPE6      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      ----------------GPASLAAK------------------------------------
A0A661XXA6      -VINEDFEFNMVLSPSWNSSMGTE------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A519SD85      -TDKKSSSYYFQFSQLDNEKFELY--------------------I--NDEKRIYKFDQVI
A0A4Q3SEI4      ------------------------------------------------------------
A0A3M1TXY5      -SHVQIVGAKFFVRPISDTEYEIEADEKSAEIWNIAEDALVHELEPFVFNKRL-------
A0A2E0VQ27      -NDDKALDKTIYFDYLGEGRFRFF-----------------DGSP--KDSAHATIV----
R6U429          -GDNNASSFSFEIMKEGEDAFVIK--------------DWHVAGE--EMEYAKIKG----
R5DEG6          ------------------------------------------------------------
A0A5C8AF42      -LKDSSLINVPIFVAFDGKSISVN--------------------YAHLGKNYALKG----
A0A642EJV3      ------------------------------------------------------------
A0A161LWY6      -ISDAVSGLEFDFRDIDGVTYEIA-----------------------HQKDKQLDE--LR
A0A212J9Z9      -IKPEAYNYAYEVTYIDQEKCEIS---------------YKENPE--SETKISLIA----
F5IV23          -IKPEAYNYSYEIAYIDQEKCEIS---------------YKENPE--SETKISLIA----
F8X2T0          DITPEAYSKVFDVSYVSDSQIRVS---------------YKDGLD--GEPEEAFNV----
A0A1M3LAG1      DITPQAYSKVFDVAYVSDSQIRVS---------------YKDGLD--GEPEEAFNV----
A0A212K6G4      DITPGAYSKVFDVAYVSDSQIRVS---------------YKDGLD--GEPEEAFNV----
A0A4Y9IPG7      DITPQAYSKVFDVAYVSDSQIRVS---------------YKDGLD--GEPEEAFNI----
A0A2V3PNY7      -VAPSAYSIVFEIEPINSEKCRIF---------------Y-EGSE--TTQPFSMEV----
A0A1M5DFS8      -VAPSAYSIVFEVEPIDSDKCRIF---------------Y-PGSE--NTAPFSMEV----
A0A4Y8KZS5      -VAPSAYSIVFEIEPINADKCRIF---------------Y-PGSE--STPPFSMEV----
A0A239K409      -LDSTAYGREVTVSFNGGKSYNL------------------------EEGGKTFKF----
A0A350V3E4      --------------------------------------------S---------------
A0A1M6MYT6      -DHPQIINADFYLTIQPDGKLELKIEEEDEVMVFNYKDKTVLDEL--DSYSYSEEA----
A0A2P8CDS1      -SHPQLLDANFDLHFLPNNRVEMTIQGKKAVR-YDYRNEKELQPE--KEIEETRTF----
A0A5M4A2I9      -SHPQLLDANFDLHFLPNNRVEMTIQGKKAVR-YDYRNEKELQPE--KEIEETRTF----
A0A353WYK7      -IEPQYFDHPFDVDILNSKKFILR--------------------LKKGDQVIENTY----
A0A355BP94      -NVESFQDQPIFVDFVEGNKYQLW--------------------V--GENGTKQTG----
A0A136LSC7      -INPKHYDQPIYFDFLDNNEVSLR--------------------L--KGAVST-RG----
A0A5C7N8Q5      -INPKHYDQSIFLDFQDNNQFTLR--------------------L--GDAGPTVSG----
A0A1V5S1J9      -VSPQAYEREFTIQDLGNNNFEIS----------------APGTK--QLPELKISG----
A0A0A2EYC8      -TPDAGFWQYYLYQKQNDNEFTIK----------------IFDNE--DVELETVKG----
A0A2G6H6Y4      -TYDNSFDNYYRFEVTGEKSFNIS----------------VLDEH--DEVLEVVDG----
A0A1M3DPL8      -ISPQAYDILFKLNIKPDGTFTVT----------------EDEES--MPKGFNING----
A0A1V5F519      -VAPEAYELLFKISLHPNGTFTIS----------------PHNNN--SMPSSPING----
A0A2G6R1T9      -ISTEAYGVLFKIEINEDGSYVIS----------------DDKGV--IDEDLEIRG----
A0A2W4RDE8      -SVHQLINVPIYIERLSSSKYMVSVRGKEVPTYDVITNTVKDR-V--PVVDIQEVV----
A0A0L8VEV2      -QAMNLEGIPIHIQMLDTSNFQIEVKGKKMVYGKEVEIEFSQKG----------------
A0A1I2A9Z9      -NAMNLEGIPVYVQMLDSTNYRIIVDEKTMYYGREIEIKIDQRG----------------
A0A142HHS5      -SDPAYYNHKFDVEYIDAKHYRLN--------------------V--TVGNAKLGG----
A0A660LQT8      -LSDER-SAMLDITYERDGHFELT--------------NFVTNLD--RKIEKTQVV----
A0A350PNH9      -LNDMQ-SANLDVEVKHGNLFSIV----------HVSGTDKAGNQ--VESDEEVQG----
A0A354LNT9      -LNDMQ-SANLDVEVKHGNLFSIV----------HVSGTDKAGNQ--VESDEEVQG----
A0A2M6GH67      -RDGSFYDKEFKVNFIDNNTFKLV--------------------Y--LIGEEEITG----
A0A389LWV6      -ISEEAASLDFRIRGIDTTAYEIT---------------FDGA-K--NIAPFSIVG----
A0A1G9B1T9      -LSDQLIGVPIYVRFLSSNRYEISVEADEASVYQMAEEKFAPTKA--RDVLIQNVQ----
A0A3D0FMX4      -IRPEGYEHLYKLDIGTNGQLTVS--------------------I--ADEDTKNPM----
A0A1M3MEI8      -IAPEAYGILFKLSISEDGTFLIT--------------------E--EEENLRKGF----
A0A1J5HQM0      -IAPEAFNLTFKLDLNANGTFTIT--------------------V--DENKQYENF----
A0A653AC35      -VSPNAYGILFKVNVKTDGSYIIT--------------------D--ENS---LNI----
E4T131          -IAPEAYGVLFKIKLHSNGSYTIS--------------------V--DDKNLFSKF----
A0A521H707      -TDSSYFDRRFFIDFEGDSKFRLS-----------YSTALSKQ-S--GTFPVNTWI----
A0A1F3D6P8      -SHIQPIDVKLRVFILSDTTFRLVIDQNTVSLYNYLDNQIVIE-N--VPLKVDTIC----
A0A356Z058      -SHIQPIDVKLRVFILSDTTFRLVIDQNTVSLYNYLDNQIVIE-N--VPLKVDTIC----
A0A3D1BT36      -SHIQPINARFYINIVSDTTYRLTVSEDDVSFYNYLDNKVISA-G--HMLNIDTVY----
A0A352ME00      -SHIQPIGANIYVSILDESSFRLTASQKKVSYYNYVDNQIISE-D--NFFEIDTIC----
A0A3D3HL11      -SHIQPINTRFRVDILDDQSYRLTASEDEASYYNYIDNAVVST-E--NRVRIDTIC----
A0A5R9QZP0      -SHSQAINTRYYIEILDESRFRLSVYDDGAKLYNYLDNKVTSR-G--NRIEFDSIC----
A0A2W7RD29      -NDKSIEEKFFRISWVDSLSYSVR-----FVGDEPTTSMFNSNQD--EGSGKSYVC----
A0A3N2NDY8      -LEEQQ-CAGFRIELGKDGNVVLS--------------KFHLE-T--PDGDEEIEK----
D7JEV9          -ISDISYGKYYLYQRKDNDYFTIK--------------VFDNEDV--E--LETVEG----
A0A4R6H3B7      -NTMNLEGVPVYVQMLDSTNYRII----------------VDEKT--MYYGREIEV-KID
A0A2W7QSQ0      -KSFISPSESFEIQPISETKFLLI-----------------------LDEDKQKEF----
R7F6L5          -AANADASYSFKYIVKPDGTVILK--------------DFNKGGT--ELPDKPLSC----
A0A553GA49      -ILSKD-LFTLKVEVDEGELHNFL--------------------N--ASSEQLVEDWEFK
A0A497D6F6      -EHPQLIYADFLLEILPDGKLLIKVEDEHAAIFDFLNSEIVTY-V--TNLSFSKEA----
A0A5M4AAB9      -RHSQLIDTNFDLKFLSDNKVKIKTKSRKAIRYDYLRKTELSE-P--HAVNNSRTF----
F4KR18          ---------TFKLNPSAESTFKITPLNNYSFRFSQGSKTE-TQ-R--FGTLFSNQF----
C9LKL0          -KTSV--PANFQAEIMPGGKVRLF--------------DFKLN-G--EEYSDDIET----
A0A3D0QPV7      -------DLTIIDSTIFGERIDIF--------------------S--NSNQITLNCRNQT
A0A496KT23      -IGEEQ-RASFGLSLQADGRVILD--------------NFTKD-G--ASLSGTVMG----
L1M9T3          -ISEEQ-TASLSLTLMADGRVLLE--------------NFVRD-G--QNLGGSVLS----
A0A3C0I8F1      -ANNPWFDKRFDVQIVDPKHFVLA---------------FEQGRG--VIKQKY-------
R5JJI4          -SEERQ-VIEMTVTPVDSATVRLS--------------DFSLSIA--GEEIRSAEV----
A0A3D2HF71      -LNKQTIGEKVNVKILSAKKYKIE---------IDGERNFSKE------------M----
A0A0A2DQN2      -SLEL--YDSFFVSYKDENQVSVS------------------------YNEEEHIF----
A0A0A2F2N5      -SLDQ--YHQFEVTYKDASSI-VL--------------------S--REGGETKQV----
L1NGW4          -SLEK--VATYEVRFKDAGHVSIQ--------------------P--QGSSKAQDV----
Z4WRA0          -SLEK--VASYEVRFKDAGHVSVL--------------------P--QGSSKAQDV----
U2K8K9          -TLDV--ANTFRVSYQDASHVSIK--------------------L--GKDGRTQVI----
A0A069ZM60      -TTER--KSTYEVAFQDAGHVRVT--------------------P--VHTGKSQVV----
J6GV98          -TTER--KSVYEVAFQDAGHVRVT--------------------P--VHTGKSQVV----
A0A134B4F8      -TLER--GSSFDVAFQDASHVRVT--------------------P--ASTGKSQVI----
A0A134B8C7      -TLER--GSSFDVAFQDASHVRVT--------------------P--ASTGKSQVI----
A0A4Z0EKR0      -LEPTAGGVNFTVRPKSVDTFELD--------------DYSGH---------MYSY----
A0A229I3A5      -FTDEQ-SGSFKLQLKGDGSYVIS--------------KLKGV-T--R--DNLPVDDSDE
A0A3R6HJB3      -FTDEQ-SGSFKLQLKGDGSYVIS--------------KLKGV-T--R--DNLPVDDSDE
B5CTK0          -VDEAE-TLSLTVLPHSEKEVTIT--------------DIITSSG--ESVNKSFYI----
A0A1M6B6D5      -FKDSL-TFNLSVSFEEAKNINLQ--------------NYNSKEK--K--SLFVEAGDFS
A0A451FS66      -FKDSV-NFNLSVSFEEGKNINLQ--------------NYTTKEK--S--SLFIDTDVFS
A0A2E3GN39      -QDPKMRRVSIDYSVLINQQKDSV-----RLDYIYQGKSWGGF-L--KPGKPYSDE----
A0A3D1MEL0      -QDPKMRRVSIDYSILINQQKDSV-----RLDYIYQGKSWGGF-L--KPGKPYVDE----
F0R0C9          -LQDNE-TASLTLRQGASGKLELS--------------DFTRN-G--EKVEGISEG----
A0A2A4N9A6      -KDPIIYQVRFNIEILNTREFKLLYSIDKKYDNIYNFGTW--------IRTEFADF----
A0A368D1N7      -QDYKMRRVSIDYSILINQQKDSV-----RLDYIYQGKSWGGF-L--KPGKPYADE----
A0A3B8TU58      -QAPELTKINIDYHMFLSRKKDSI-----RLEYIYKGSTWGGH-L--KPGKPFIDE----
A0A1T5IIR6      -EKSDPGSVSVTVIPEDAGHIRLQ--------------TSAGS-Q--L-------V----
A0A3E0QD27      -FESEK-VFHLRYPTHEGEKVKAF--------------QTNVW-N--KVPGLKFRM----
A0A0M1W1I6      -EEDHL-DFSLTVRIQNRKQVRLS--------------DFSTD-A--T--SITLTA----
A0A4R4GHU2      -EEDHL-DFSLTVRIQNRKQVRLS--------------DFSTD-A--T--SITLTA----
I8WPR6          -EEDHL-DFSLTVRIQNRKQVRLS--------------DFSTD-A--T--SITLTA----
A0A0K2HKS3      -EEDHL-DFSLTVRILNRKQVRLS--------------DFSTD-A--T--SITLTA----
B6W3W8          -EEDHL-DFSLTVRILNRKQVRLS--------------DFSTD-A--T--SITLTA----
A0A4R4GSI6      -EEDHL-DFNLTVRILNRKQVRLS--------------DFSTD-A--T--SITLTA----
A0A076IRY8      -EEDHL-DFSLTVRILNRKQVRLS--------------DFSTD-A--T--SITLTA----
A0A3A6AD54      -EEDHL-DFSLTVRILNRKQVRLS--------------DFSTD-A--T--SITLTA----
A0A3A6MIU7      -EEDHL-DFSLTVRILNRKQVRLS--------------DFSTD-A--T--SITLTA----
I8WPP8          -EEDHL-DFSLTVRILNRKQVRLS--------------DFSTD-A--T--SITLTA----
A0A372Y7D2      -EEDHL-DFSLTVRILNRKQVRLS--------------DFSTD-A--T--SITLTA----
A0A3E4JJC9      -EEDHL-DFSLTVRTLNRKQVRLS--------------DFSTD-A--T--GITLTA----
A0A3E4WDQ0      -EEDHL-DFSLTVRTLNRKQVRLS--------------DFSTD-A--T--GITLTA----
A0A414H9P2      -EEDHL-DFSLTVRTLNRKQVRLS--------------DFSTD-A--T--GITLTA----
C3R5A8          -EEDHL-DFSLTVRTLNREQVRLS--------------DFSTD-A--T--GITLTA----
A0A1C5XJA7      -MLPEQ-YVAFTVTLLNKDSVEIT--------------DFSMA-E--N--GERQVV----
A0A3E5BU42      -VMPER-YISFTVTPKNAKQVLLS--------------DFTGI-P--AANDKTYTM----
R7CUW4          -AMPEQ-GLALTVQPKSERSVTLS--------------RFSWM-E--A--DSTCTV----
A0A416GGJ1      -MSPNG-AVQFKLKMLNLKEAQIT--------------TLGDA-G--K----TYKV----
D1JY72          -EEDHL-DFSLTVRILNRKQVRLS--------------DFSTD-A--T--SITLTA----
D7J4K6          -VLPER-HISFVVTPKDDATVTLS--------------GFGGLPA--A--KDSYDV----
Q8ABP9          -VLPER-HISFVVTPKDDATVTLS--------------GFGGLPA--A--KDSYDV----
A0A5M6AHF7      -LLPER-HISFVVTPKDDATVTLS--------------GFGGLPA--A--GESYEV----
D6D2Z5          -LLPER-HISFVVTPKDDATVTLS--------------GFGGLPA--A--GESYEV----
A0A1T3EDR4      -ETSLS-GYSLKVEPLDGGSVLIR--------------EWQSK-K--L--EKPFKL----
A0A174SDD8      -AGTDE-AHSLSVTPKSNVQVELS--------------DFSRG-M--E--QRKV-V----
A0A1H7RFH3      -AGMDE-AHSLSVTPKSRQQVELA--------------DFSRG-M--E--QRKV-V----
A0A139L1N2      -AGMDE-AHSLSVTPKSRQQVELA--------------DFSRG-M--E--QRKV-V----
A0A174TVL8      -AGMDE-AHSLSVTPKSRQQVELA--------------DFSRG-M--E--QRKV-V----
A0A1H8BJR6      -AGMDE-AHSLSVTPKSRQQVELA--------------DFSRG-M--E--QRKV-V----
R9H6G0          -AGMDE-AHSLSVTPKSRQQVELA--------------DFSRG-M--E--QRKV-V----
A0A412GR09      -AGMDE-AHSLSVTPKSRQQVELA--------------DFSRG-M--E--QRKV-V----
A0A4Q5DX00      -AGMDE-AHSLSVTPKSRQQVELA--------------DFSRG-M--E--QRKV-V----
A0A081PBV5      -AKPEV-GFSLQIEAVDQDHVALS--------------SFSKG-N--T--SQVLKI----
A0A1I2AN85      -AKPEV-GFSLQIEAVDQDHVALS--------------SFSKG-N--T--SQVLKI----
A0A4U0GMP3      -VRTED-NFSFTVSRNDDSTVLMS--------------GFSKG-D--M--EQRFIV----
A0A1H6CKR6      -ANPNM-PQEFTLKSLGKNQLELS--------------EFSNQEE--A--GKPLVV----
A0A235E1C0      -APANA-GFSFNLKYKGNNQVELS--------------NFSNT-D--P--EKTVTV----
R6D982          -SEPEA-ELSLLVTPKNERQVELS--------------DFSRG-A--E--SRKT-V----
A0A1F0I8C4      -AIPGE-RCFLSVIPKNQQQVELA--------------EFSKG-T--E--LRRV-V----
A0A3A5RIJ2      -AIPGE-RCFLSVIPKNQQQVELA--------------EFSKG-T--E--LRRV-V----
A0A515IZJ5      -AIPGE-RCFLSVIPKNQQQVELA--------------EFSKG-T--E--LRRV-V----
A0A5M5NLR3      -AIPGE-RCFLSVIPKNQQQVELA--------------EFSKG-T--E--LRRV-V----
A0A0D5BSQ0      -KSSED-NYAFTVIPVDMKHVVIK--------------NWSNT-N--K--NEEFKV----
A0A1T3F6P5      -KSSED-SYNFTVVPLDANNVIIK--------------NWNPS-N--K--DKEIKI----
A0A0W8EPA0      -KSSED-SYNFTVVPVDANNVIIK--------------NWNPA-S--K--DKEIKV----
A0A365UKN1      -KSSED-SYSFTVVPVDANNVIIK--------------NWNPE-N--K--DKEIKV----
A0A4R6WE41      -GLPQD-TWSLLITPISKDSVEIG--------------GWKDN-T--D--RAPVRL----
A0A2T5RP38      -KSPES-RYGFTIIPIDAKNVIVK--------------DWNKN-V--D--GQEVKV----
A0A1A6CF06      -KTQAD-SYGFTVTPIDTRYVLLK--------------KWNET-S--E---EELKI----
A0A1T3D6S8      -KTHAD-SYGFTVTPVDTRYVLLK--------------KWNET-S--D---EELKI----
A0A1P8E011      -TKPED-SFSFTVTPVGGKEVVLS--------------NWSEG-D--A--ALEVDA----
A0A1V3N3U3      -AGPTS-QYNLLIIPLDAQTVLLS--------------GRIAG-K--E--QQEIRV----
C2FUH6          -KKPDQ-SFSFTLTPLDGKYVLLK--------------KWSNG-D--R--AKELKI----
A0A0B8T471      -IKPES-NFSFTLTAIDSTKVRFA--------------T-VDG-D--V--ENYTTI----
A0A4R7D2K0      -IKPES-NFSFTLTAIDSTTVRFA--------------T-VDG-D--V--ESYTTI----
A0A2X2J8S4      -YNPSG-SFSFTITPRDNKSVLVV--------------ENVGK-D--K--EKVYIA----
A0A3C0S618      -YNPSG-SFSFTITPRDNKSVLVV--------------ENLGK-D--K--EKVYIA----
A0A4P7DRF9      -INQNA-GFSFNLRRKDANEVELS--------------DFSTN-K--E--AKSIIV----
A0A239XXC4      -AAPQS-GFSFNLKYKGNNQVELS--------------SFSNS-D--P--DKTITV----
A0A4U9K473      -VPSSA-GFSFNLKYKGNNQVELS--------------MFSND-E--L--AKPIIV----
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A641LIG3      ------------------------------------------------------------
A0A641LPE6      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      -------------------------------------------YHFTIQDQGTVNAYLEK
A0A661XXA6      -------------------------------------------FYFIIRSHDALMDYIEA
A0A2T2UAJ4      ------------------------------------------------------------
A0A519SD85      IHENLQI-----KVQRPLVRVLNT-------------------IRFKYLSTPEFVNQIRK
A0A4Q3SEI4      ------------------------------------------------------------
A0A3M1TXY5      ---RFGQ-----PYTDQNLSFTLHRNPDFE-------VKKGQRFYFVIHGLKDLAERYQS
A0A2E0VQ27      ---DQGQ-----LIEKNGLLLTIEPDSAFLKLKPN-SLKPGDLFALKVNSEDALIGQYKS
R6U429          ---RLND-----TLDTPVGKLVIAPTMLYDQWKKP--------IVISWVNAKKLAKAYNK
R5DEG6          -------------------------------------------VQVTKSPLQNVALRFQS
A0A5C8AF42      ---KLNE-----RLSNTHFEISIDSPIPSEFKDES-SDNE---LYFVFNSVESYAARLLP
A0A642EJV3      ----------------------------------------------------------SS
A0A161LWY6      YTGRYGS-----LLNTPYFSVVVNKTDNFE------PRKK---INFAFLSNAYLIDYFTP
A0A212J9Z9      ---PFDQ-----EIDYKLFRIKLHKTPNFRKDVKGAFKPDISTFNFRFLSEAQLIGMYSG
F5IV23          ---PFEQ-----EIDYKLFKIKLHKTPNFRNDVKGAFKPDISTFNFRFLSEGQLIGMYSG
F8X2T0          ---VFDS-----PVENKFFKGTIRKTKN--------FKRDFLPFSFRFFTNSQLTGMFSG
A0A1M3LAG1      ---VFDS-----PVENKFFKGTIRKTKN--------FKHDFLPFSFRFFTNSQLTGMYSG
A0A212K6G4      ---VFDS-----PVENKFFKGTIRKTKN--------FKRDFLPFSFRFFTNSQLTGMYSG
A0A4Y9IPG7      ---VFDS-----PVENKFFKGTIRKTKN--------FKRDFLPFSFRFFTNSQLTGMYSG
A0A2V3PNY7      ---PYDQ-----FVQEPRFYIKITKSPR--------FAPNFEPFSFRFVSKEELIGRYSG
A0A1M5DFS8      ---PYNQ-----YVQESRFYIKINKTDR--------FTPNFTPFSFRFISKEELIGRYTG
A0A4Y8KZS5      ---PYNQ-----FVQESRFYIKINKTDR--------FTPNFTPFSFRFISKEELIGRYTG
A0A239K409      ---EFGE-----VVRRPYGTFTILTSDAFPQKSPK-QKK----IIVVFENINTLAKYYSD
A0A350V3E4      ---ATPE------------------------------------NQVDPKSKNQIANVLSA
A0A1M6MYT6      ---TPGT-----RISTDEFAFKILLNEHFN-------PESDNEFKFRFHSPQELIRQYQN
A0A2P8CDS1      ---PIDS-----FVASDDYAFRIIPAA--D-------SKLEGNYRVVFHSLDELTADYLN
A0A5M4A2I9      ---PIDS-----FVASDDYAFRIIPAA--D-------SKLEGNYRVVFHSLDELTADYLN
A0A353WYK7      ---SFGE-----EIVCDGFVFMLALSPHYR--KDN-DNVH---YFFKINSPQSNIRYLMD
A0A355BP94      ---TLGE-----PVVVSDANFVIELSPNAT--PDF-KN-H---FFFVMNSRNRLLDFLSS
A0A136LSC7      ---SMGN-----PVEFDGTVLTITKTNYFT--END-GN-N---YYFVLNSRKSLIEYLSK
A0A5C7N8Q5      ---TMNK-----PVELDKTILIVNKTIFFT--END-GN-N---YFFVLNSRKTLIDYLSK
A0A1V5S1J9      ---KYGI-----PIQNSSFFIQVDKSAIYR---------RNFNICFKLLNPENLAITYSA
A0A0A2EYC8      ---RYNE-----PVGCKYFLIKVTKNSNYH---------SANSVNFVFRNRDNLVMEFAS
A0A2G6H6Y4      ---EYGE-----PIGCKYFLVKVLRDERYN---------EIPQFYFRFRTRMSLIQEFVG
A0A1M3DPL8      ---RIGY-----PLQHHLMFITINDISGNN---------SAKDLYFKFRTKESLIGEFSS
A0A1V5F519      ---HIGV-----PLQHNLFFMTVNSVSDNV---------KEFEMYFRFRTRETLIEDFKS
A0A2G6R1T9      ---KIGV-----PVKSKLFVINVTKDIEFS---------NK-TMFFRFRTKTSLVNEFSG
A0A2W4RDE8      ---DINK-----PFQSKNLSFSITFNDAFK-------LEPDSKMFFRINNQVSLAERYRN
A0A0L8VEV2      ---KFGE-----LFSNDYFNFTLYPKYAKR-------GNQ---YYFTFNNFENQVKKYMN
A0A1I2A9Z9      ---VFGE-----IFENDYFHFTLYPKNVKR-------GET---YFFTFNNFEGLVRNYSG
A0A142HHS5      -NYEFGQ-----LVKLPGISLRLLSASSPAELDAI--------YHFVIVDDNTINSYLDH
A0A660LQT8      -KGHFGQ-----IVNTPVGRVRVTPTNHFD---VV-EHQP---IHVLRTTMRKAIEHY-N
A0A350PNH9      ---KLGQ-----TVRTAMGHVCVDQAPGYS--AFI-NGHESRKLHVTRTNLYAMTNHIKA
A0A354LNT9      ---KLGQ-----TVRTAMGHVCVDQAPGYS--AFI-NGHESRKLHVTRTNLYAMTDHIKA
A0A2M6GH67      -EYKVGE-----PINKKEIYLVLNRTPNFN--PFV-LEQN---YHFVINSDGALNNYFRS
A0A389LWV6      ---NYGT-----SLQHNLFFVTVDKTDQFPHTVKY-E------LNFNFLSRGQQIADYNN
A0A1G9B1T9      ---KVGQ-----PVRTPYLNFTLIRNEQEP--LDT-LSQ----YSFMIHPLERVTEQYQK
A0A3D0FMX4      ---TFNT-----IYGQTFDCGLFSGLFMPTEY-MT-EKTT---IYFRFRSQESLVADFSS
A0A1M3MEI8      ---ALRG-----RLGKTFQHNLFFITVNMAEGVVH-GKKE---VYFRFRSRESLISDFSG
A0A1J5HQM0      ---KLNG-----NIGEPISNNLFFITINNTNS-YY-AERE---LYFQFRSRESLISDFAS
A0A653AC35      ---KIKG-----YLNQPIQHNLFFLTIAPTNQ-NR-QEYD---TYFIFRTRESLIGDFMS
E4T131          ---QING-----RYGRPLQHNLFFLTVHNVNK-YM-GNTE---MYFKFRTKESLVNDFIS
A0A521H707      ------------TIPGLKFKITIKDYGQIKKQILA-TTNDEP-YYIIFYNPETVIDQYYA
A0A1F3D6P8      ---RFNE-----TIRGKTFKFSVSFNRDFYTR--E-TNMEDF-YYFSFFHLDYLTKDYLK
A0A356Z058      ---RFNE-----TIRGKTFKFSVSFNRDFYTR--E-TNMEDF-YYFSFFHLDYLTKDYLK
A0A3D1BT36      ---KFNQ-----TIASPYFRFSVSKNQDYLNQ--R-PVDEER-SFFMMNHIDIITEQYLN
A0A352ME00      ---KFNE-----TISNKVVRFSVALNKDFPLK--K-TEDKSR-YYFKFNHLDYLAKGYLK
A0A3D3HL11      ---RFNE-----TVTSYNYKFSIGFNKEYYNP--K-LSGETD-YYFEFYHLDQLTRTYLR
A0A5R9QZP0      ---TFNE-----TITTPYFKFSVNLNKDLYKG--T-QASKTKAHFFEFNHLDVISRRYLR
A0A2W7RD29      ---KFNE-----WCGLPFLTLRTRLLEAKN-------DGN---FLFKIRNEESLISEFSG
A0A3N2NDY8      ---EVKAKIGAGPIETPVGKVSIAANGNYTAPKGK-KNKPVTEIIVERDGMQSTVETYGG
D7JEV9          ---RYNE-----PVGCKYFLIKVIENKAFR---------DVDKVHFRFRHRQELIAEFSS
A0A4R6H3B7      QRGVFGE-----IFENDYFHFTLYPKNVKR-------GET---YFFTFNNFEGSVRSYLE
A0A2W7QSQ0      ---EYGQ-----KIKFSFGIISIQKKPA----SDD-FATEMGNVLVELVNPQVAAENYSR
R7F6L5          ---KLGA-----TVKTPVGAIAIDRPEWVS---DY-VDKT---IHYSHVPVRPVAESIVG
A0A553GA49      HTYRFGE-----SIENENFNFTVLLKEGLNI-DKL-VGKK---LFFVIKSNRQVVDESKD
A0A497D6F6      ---AYNE-----VIKTDYFSFIIKPKRERN---KI-ETAT---YKFRFNIRSDLLKQYKN
A0A5M4AAB9      ---DIDE-----QIKSADYSFRIIPISSLP---L---QGR---YRINFNSLNELTNEYLE
F4KR18          ---GV---------------FRINRIGALP---IS-SDSS---MYVSFQDTKGLARNYQH
C9LKL0          ---APEQ-----AVKTPLGVLKISKNATFE--EFS-KGKV---ITVDYIPADLAARRYQG
A0A3D0QPV7      FTTESGG-----LLQSPWFRARITVADPQTI-QAI-QSENK--LYFVFNHPDQLLTQYFP
A0A496KT23      ---KVGE-----RCVTPVGLVKFVANTGYR---RG-MTDE---YKVTRSPISAVAAVVRG
L1M9T3          ---QVGK-----RCATPIGLLKLTPTNAYR---KG-MTDE---YDIKRSSISTTAAIVRS
A0A3C0I8F1      ---QFND-----TIHLSGMSLVLIPKPAIN------ISKN---YYFIINSRYALLSYLQS
R5JJI4          VDARLND-----TISTPVGTMVVTPTLYYT--DTY-YGKP---VYITKSNMEKVVEGYLR
A0A3D2HF71      ---NFGD-----RFNEQGFDFIIELRDKNN--FVF-DPNASNRYYFYFVSPQSLANIYRS
A0A0A2DQN2      ---LLGD-----TISIGKNRLIIEPNPNYT--SPW-IARQ---IQVSRVPVPALAVAYQG
A0A0A2F2N5      ---QLGE-----EVTYEKSRLIVVPSKGYN--EPW-PNKA---IKITRLPVKDLAASYQG
L1NGW4          ---PLNV-----PVQLGPDRFIIEPRSNFN--SPW-EHKT---INVIRHPLVGTARYYQN
Z4WRA0          ---PLNV-----PVQFGPDRFIIEPRSNFN--SPW-EHKT---INVIRHPLVGTARYYQN
U2K8K9          ---PVGE-----PIRIGETRFIVEARKTFN--APW-AYSE---IQVSRIPFVDAVRFYQH
A0A069ZM60      ---PLNV-----PVQLGDERFIIEPHQNFN--TPW-EYKH---IEVNRMPFTQTVRYYQH
J6GV98          ---PLNV-----PVQLGDERFIIEPHQNFN--TPW-EYKH---IEVNRMPFTQMVRYYQH
A0A134B4F8      ---ALNV-----PVQLGEERFIIEPRQNFN--APW-EHKH---IEVTRMPFTQTVRYYQH
A0A134B8C7      ---ALNV-----PVQLGEERFIIEPRQNFN--APW-EHKH---IEVTRMPFTQTVRYYQH
A0A4Z0EKR0      ---HFGE-----QIQKPYGTFSIIAGGA----NKW-LGTK---IIVQFQDINQVANYYNS
A0A229I3A5      ITGRIGQ-----IIRTPLGKIKVDKAPAFT--QFV-SGEDESVLYVSRSNVYAMTDRIKG
A0A3R6HJB3      ITGRIGQ-----IIRTPLGKIKVDKAPAFT--QFV-SGEDEPVLYVSRSNVYAMTDRIKG
B5CTK0          ---PLND-----TVSTPIGRILISPTLYYG--KGE-FS-P---LIVRKVNLKSIANSFAA
A0A1M6B6D5      KDFKIGE-----PVNTPFFNGIFVPNPDVI---SK-MGTP---YYLVFSEYDATVKRYL-
A0A451FS66      KDYKLGE-----SISTPFFSGTFIPNEEVI---SN-PGTP---YYFIFQDYDTTVKNYL-
A0A2E3GN39      ---NIYL-----AISNLDQKLLEGSAESQK---------S---ILFKVYTDEQLSNELMA
A0A3D1MEL0      ---NIYL-----DISNLDQKLLDESAENQK---------S---ILFKVYTDEQLSNELMA
F0R0C9          ---KLND-----TIASPVGKLLVEPTPYYN---IG-FHEP---VYVSRSSLHGATGAYSS
A0A2A4N9A6      ---KVSL-----KESD---AIITDSKSNIY---------Y---FLINNLDEQARFKFAPA
A0A368D1N7      ---NIYL-----AISNLDQKLLEGNAENQK---------S---ILFKVYTDEQLSNELMA
A0A3B8TU58      ---NIFI-----SISNFDESLLTDEFEGEK---------N---IFFNVYDNNRLADEMLS
A0A1T5IIR6      ---ALGD-----TVALGRGKVVFLPTARYS--PDQ-YGQS---IRIQKIPVNWAAQAYIS
A0A3E0QD27      ---TVQN-----WAAIQKQEINLQDEAYYF----------------IINNSTTLVERYFK
A0A0M1W1I6      ---NLGD-----TIQSPIGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
A0A4R4GHU2      ---NLGD-----TIQSPIGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
I8WPR6          ---NLGD-----TIQSPIGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
A0A0K2HKS3      ---NLGD-----TIQSPIGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
B6W3W8          ---NLGD-----TIQSPIGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
A0A4R4GSI6      ---NLGD-----TIQSPIGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
A0A076IRY8      ---NLGD-----TIQSPVGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
A0A3A6AD54      ---NLGD-----TIQSPVGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
A0A3A6MIU7      ---NLGD-----TIQSPVGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
I8WPP8          ---NLGD-----TIQSPVGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
A0A372Y7D2      ---NLGD-----TIQSPVGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDIMASLFRS
A0A3E4JJC9      ---NLGD-----TIQSPVGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
A0A3E4WDQ0      ---NLGD-----TIQSPVGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
A0A414H9P2      ---NLGD-----TIQSPVGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
C3R5A8          ---NLGD-----TIQSPVGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
A0A1C5XJA7      ---ELND-----TISLNEGKVVVVPTNYMT--ESW-IGVP---VKVSKMPLDAVVSVYRN
A0A3E5BU42      ---RLND-----TLTIGSERILITGTDRWG--QAW-TERD---IRVSKNPLNAVAGRFQG
R7CUW4          ---AMGD-----TVRVHGQRLVVTPTNYYA--ASW-TDVP---IRVQKRPLESVVNRYKG
A0A416GGJ1      ---QLRD-----TTAIGNFKIAVTPTNFLN--KSW-IGQE---ITVRKNPLESVVSYYSG
D1JY72          ---NLGD-----TIQSPIGKIVVSPTLYYT--DKW-FNTP---ITIRRQSTDTMASLFRS
D7J4K6          ---RLND-----TLAVGGERILVTGTDHWG--KSW-TGRE---IHVVKNPLNAVAGRLQG
Q8ABP9          ---RLND-----TLAVGGERILVTGTDHWG--KSW-TGRE---IHVVKNPLNAVAGRLQG
A0A5M6AHF7      ---RLND-----TLAVGGERILVTGTDHWG--KSW-TGRE---IHVVKNPLNAVAGRLQG
D6D2Z5          ---RLND-----TLAVGGERILVTGTDHWG--KSW-TGRE---IHVVKNPLNAVAGRLQG
A0A1T3EDR4      ---SLNK-----PTRLPFGELLVKGSPHYG--TPY-YGKS---IRVEKLPLERSVVYFLG
A0A174SDD8      ---KLND-----TIQTALGKLVVFAAENYG--ESC-FGKP---IVVTCKPLEEMVSFWLN
A0A1H7RFH3      ---NLND-----TIHTALGRLIVFAAENYG--ESS-FGKP---VLVTCKPPEEMVSFWLY
A0A139L1N2      ---NLND-----TIHTALGRLIVFAAENYG--ESS-FGKP---VLVTCKPPEEMVSFWLY
A0A174TVL8      ---NLND-----TIHTALGRLIVFAAENYG--ESS-FGKP---VLVTCKPPEEMVSFWLY
A0A1H8BJR6      ---NLND-----TIHTALGRLIVFAAENYG--ESS-FGKP---VLVTCKPPEEMVSFWLY
R9H6G0          ---NLND-----TIHTALGRLIVFAAENYG--ESS-FGKP---VLVTCKPPEEMVSFWLY
A0A412GR09      ---NLND-----TIHTALGRLIVFAAENYG--ESS-FGKP---VLVTCKPPEEMVSFWLY
A0A4Q5DX00      ---NLND-----TIHTALGRLIVFAAENYG--ESS-FGKP---VLVTCKPPEEMVSFWLY
A0A081PBV5      ---KLNQ-----TVRTPIGLLKVTRSPGYK--VSD-FDKP---VIVRKYPREAMVGYYMA
A0A1I2AN85      ---KLNQ-----TVRTPIGLLKVTRSPGYK--VSD-FDKP---VIVRKYPREAMVGYYMA
A0A4U0GMP3      ---KFNE-----KVRTPVGVLAVRPTDAYS--LAA-FTNE---IRVSKNPREAMVGYFMG
A0A1H6CKR6      ---ALNQ-----TVNTPIGKVIITPNPESKY-RVN-VSEP---IQVSKTPIDAMVGYFLS
A0A235E1C0      ---KLNA-----ETKTPVGNLIISANSDKKF-RVN-LSED---ITITKSPIESMVGYFLG
R6D982          ---NIND-----TVETALGRLVVSATENYD--SSC-WGKP---VKVSKQAREKMVYFFLS
A0A1F0I8C4      ---NLND-----TVHTALGKLVVFAAENYG--GDW-MERA---VKVISHPQEDMVSFWLS
A0A3A5RIJ2      ---NLND-----TVHTALGKLVVFAAENYG--GDW-MERA---VKVISHPQEDMVSFWLS
A0A515IZJ5      ---NLND-----TVHTALGKLVVFAAENYG--GDW-MERA---VKVISHPQEDMVSFWLS
A0A5M5NLR3      ---NLND-----TVHTALGKLVVFAAENYG--GDW-MERA---VKVISHPQEDMVSFWLS
A0A0D5BSQ0      ---VLNQ-----SVVTPIGKVLIKPSKFYK--KDY-YGTE---IQVTKSPRESMTGYFVG
A0A1T3F6P5      ---ALGK-----LTSTPIGKLLINPSRYYK--KDY-YGVE---IQVVKSPRESVMGNFVG
A0A0W8EPA0      ---ALNS-----LTSTPVGKVLITPSKYYK--KDY-YGVE---IQVTKFPREAVMGNFVG
A0A365UKN1      ---ALNR-----LTLTPVGKVLITPSKYYT--KDY-YEVE---IQVAKLPREAVMGSFVG
A0A4R6WE41      ---AIGQ-----AFRTPLGEIQLDSTSHYL--PGS-FGKS---IRVEKFAREYMVNFFLS
A0A2T5RP38      ---VLNQ-----LTKTPFGEIIIVPSKYYH--KDN-YGES---ILVTKYPREEMMLGLMG
A0A1A6CF06      ---ELNR-----WVVTPAGKVFITPTKFYN--KDY-YGKD---IQVTKSPREAVMGYFIA
A0A1T3D6S8      ---ELNR-----WVVTPVGKVFITPTKFYS--KDY-YGKD---IQVTKLPREAVMGYFIA
A0A1P8E011      ---TLDK-----PVNTPFGQVIVQSALKPN--KAL-PQQE---VKVEKFALEGMVNYFIS
A0A1V3N3U3      ---PLNK-----TVNTTLGRLTVRPTKFYK--AGV-FGEE---IQVRKYDREDIVGYFLG
C2FUH6          ---ELNK-----ESNTPVGRIVVTAEKQFT--AST-VGED---IQVTKYAHEAMVGYIMG
A0A0B8T471      ---PIGK-----EIKTPFGNMVVDTTAKFT--SSY-YGEQ---VTVSKNAMESMVGYFLS
A0A4R7D2K0      ---PIGK-----EIKTPFGNMVVDSTKHFT--PSY-YGEQ---VTVSKNAMESVVGYFLS
A0A2X2J8S4      ---PLNK-----AIKTSFGGIRILATPYYT--KAA-YDQE---ISVNKLSSIDMANALLG
A0A3C0S618      ---PLNK-----AIKTSFGGIRILATPYYT--KAA-YDQE---ISVNKLSSIDMANALLG
A0A4P7DRF9      ---PLNQ-----LVNTPVGKMIIQFNPNLNY-RKS-SDEQ---ITITKSPIDAMVGYFLG
A0A239XXC4      ---KLNS-----EVKTPVGNLIISANSDKSY-RVN-LSEQ---ITITKNPIESMVSYFLG
A0A4U9K473      ---KLNA-----ETKTPVGNVIISANPDKKY-RVN-LTED---ITITKTPINAMVGYFLG
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------WPPNEPDTRGAALE-------LDL
A0A519TAP8      ------------------------------------PVGDDPQYHFVILNDGAVINYLDK
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A641LIG3      ------------------------------------------------------------
A0A641LPE6      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      -NLAVDISSAD--ANTIQISFTDFNPRKAQRIVNKVDTVYQRAKVLREQENTARTLRYLD
A0A661XXA6      -NLSVEPVNVE--ANIFKVSFKDYNVNKAHALISAIDTLYYKYSLNEKNRANKNKIEYLN
A0A2T2UAJ4      ------------------------------------------------------------
A0A519SD85      -SLKVDDSQAN---NILSLRYSNSNIYLSADILNAILASYLKFDKDQREISLTQTSKFIT
A0A4Q3SEI4      -NIRATPAGKL--STVINLTMNDEVPERGENILDNLLTVYNKAAISDKNVMSSNTLDFVE
A0A3M1TXY5      -ALKVEAVSKE--ARLLNITSEGPVVSMQNQFINTLLNTYIQNDLEKQREIGRKMLMLID
A0A2E0VQ27      DKLFVKPVDKE--VSIIKVYFNHELPEKAQTFVNTLMKTYIEEGRKSREQQVAETLEYLE
R6U429          -SLSVSLSGKE--STVLVLTLTDRFPSRADNILSTLIDVYNEQWVEDKNRSARNTTAFIN
R5DEG6          -GLQATLASKT--ATIINLTLQDVSIPRAEDVINTLISVYNTDAINDKNQIVMNTSNFIN
A0A5C8AF42      -SLQIVPVDPE--AKTIQITFQGNNPQLCHDISLAVAEAFIEYDEEVKRKGSENILQFID
A0A642EJV3      -NLSVSLNSEK--ASVIDLSFKDNSTQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFIN
A0A161LWY6      -RISLSFVTQN--STVLAVSLVGTVYQRDIDFLNALCDEFLLDNLNRKNEEANRTISFID
A0A212J9Z9      -RIGSALQ-NN--SSILSISMSGTNPAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLD
F5IV23          -RIGSDLQ-NN--SSILSISMSGTNPAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLD
F8X2T0          -RVSTALKTEN--STALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLD
A0A1M3LAG1      -RVSTALKTEN--STALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLD
A0A212K6G4      -RVSTALKTEN--STALTVSMYGTDPAKDMDYLKALLDKFQDYNLALKNQQADLTIKFLD
A0A4Y9IPG7      -RVSTALKTEN--STALTVSMYGTDPAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLD
A0A2V3PNY7      -RISSGLVRDG--STALGISIFGSSPAQDVDFLRALLQEFEEYNLTLKNEAADRTIAFID
A0A1M5DFS8      -RTSSGYQREG--SSALAISIYGTSPAQDVDFLKALLKEFEEYNLTLKNEAADRTIAFID
A0A4Y8KZS5      -RTSSGYQREG--STALAVSIFGTSPLQDVDFLRALLKEFEDYNLTLKNEAADRTIAFID
A0A239K409      -WLKVEPINAK--ASVLNISITDPVPERGRDVINKLMQDYREEELEGKNLIAASTIKLID
A0A350V3E4      -VTEISQKRG---LDIVSIKTESPSPQEAALISNCYAEAYADYSMKFNRGHLTLNREFLE
A0A1M6MYT6      -QLEVALKSDE--TTILDLTLRDRNVRKGMAFLNKLTEVYQLDNLEKKNENANRTIQFIN
A0A2P8CDS1      -RLTVAPISKE--GTIVKLSTTCENPQKGIDFLNEMMQVYQTHNLDKKNIIATKTIFFIT
A0A5M4A2I9      -RLTVAPISKE--GTIVKLSTTCENPQKGIDFLNEMMQVYQTHNLDKKNIIATKTIFFIT
A0A353WYK7      -NTEVKPLDFK--AKTISVTFKDFNKYKAQDILMAIDTLYIYYTQLEKNRVNDQKIKFLN
A0A355BP94      -NLRIEPINFD--ANTIRVTFRDFNPLKVYTVVNKIDSVYLYYSNEQKNQANRQKIDWLN
A0A136LSC7      -NIQVDPLNFN--ANTIRVSFRDHNAHKAYDVVNKIDSLYIVYSNQQKNLANKQKIEWLN
A0A5C7N8Q5      -NIQVDPLNFN--ANTIRVSFRDHNALKAYDVVNKIDSLYIIYSNQQKNLANKQKIDWLN
A0A1V5S1J9      -KLSFDFLMTG--ASVVQASISGTVPERDCDFLNGLCEEFLADNLARKNDAAIKTIEFID
A0A0A2EYC8      -KLQIN-LLPN--TSVLNISVASDNPIRDVDFLSKHAKSFLDDNLDKKNYEADKTIQFIN
A0A2G6H6Y4      -RLEVA-PIDK--TSVLNLSLASNNPARDIDFLNQHSKSFLSNNLDRKNSEAEKTIHFIN
A0A1M3DPL8      -KLALNFVMDG--SSVLEISMVSETPRRDVDFINKLCDIYLMSNLERKNDAATKTIQFID
A0A1V5F519      -RLSSRYVIEG--SSILEISLISETPDRDVDFINKLSEIYLEENLKKKNDVASKTIQFIN
A0A2G6R1T9      -LYPE--FINK--SSVLSISLQSPTPQRDVDFINKLFEVYLANNLERKNEQARKTIKFID
A0A2W4RDE8      -QLNIEPISKE--SNIVQLTIEQAVPQKGVDFINAVMRVYLDNELYKKNQLGLRTIAFID
A0A0L8VEV2      -RLVIEEPEDK--ADLIYLSLIDQVPQKGADYLNELSRVYLAYELREKNHTSATTIDFID
A0A1I2A9Z9      -RLMIEETEEQ--ADLIRLSMVDEVPQKAADYLNELSRVYLTYELREKNHASATTIDFID
A0A142HHS5      -NLKAEVLNPI--ANTIQISFLDNNRFKAQRIVNALDTVYRDVKLAYKQETTENSLAYLD
A0A660LQT8      -NVEITLADKG--AEILNMSFNDVSQERAEDVLRMLIDAYNEAWLADKNQIAVNTSKFIN
A0A350PNH9      -SLSASISEEK--ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFIT
A0A354LNT9      -SLSASISEEK--ATVIDLTYKDQLTQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFIT
A0A2M6GH67      -NLAVEIINPS--ANTISISFTDFNPRKAQDIINRVDSAYLVQKLLVKNQATQQQLKFLD
A0A389LWV6      -RLNCSFLLDG--ASVMEISLVGKVTQRDIDFLKILNQEFFDDNLKRKNATAERAIEFIN
A0A1G9B1T9      -KLVVAPFEEG--SDILVLTTTGEIVEKELMFLNSLMETYIEDEVKNKNLLGLRTINFID
A0A3D0FMX4      -RLTLNFVAEG--SSVLTIQLVSETPERDKEFIDKLCDIYLLQSLERKNKVAESTIQFID
A0A1M3MEI8      -RLRLNFVMEG--SSVLEISLASATPARDVDFINKLCEVYLISNLERKNDAASKTITFID
A0A1J5HQM0      -RLTFNFVQEG--SSVLEIAMNSETPERDIDYINKHVTMSLLQNLERKNDAANKTINFID
A0A653AC35      -RLNVNYVSDG--SSVLAVSLVSPTPQRDIDFLNKLSELFLAENLERKNDAANKTMRFID
E4T131          -RFSTSYVTEG--SSVLRINFVSDTPDRDIDFINKLCETFLADNLSRKNDAANKTIQFID
A0A521H707      -DATVTVMNQY--AQTVRISFKDQNSQKASDFVNTMVDEFNRYDKERKSEGADKSLQFID
A0A1F3D6P8      -KLEVEPISPK--TSLIILKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFID
A0A356Z058      -KLEVEPISPK--TSLIILKFRGRNIEKIVSFLNRYTDAILEENLAKKNKIALSTIKFID
A0A3D1BT36      -RLTVESVSLK--STLINVFFQGENLDLTVDFLNTFLQTYLDNNLSKKNTIALNTVNFID
A0A352ME00      -QLEIEKASPL--ASIINVRFSENNLDKTINFLNRYLSTFLEGNLAKKNNMASKTVNFID
A0A3D3HL11      -RLKVEPVSIR--SSLINVLFHGENRRLTIDFLNKFIQSYLDENLAKKNKIAINTIDFID
A0A5R9QZP0      -KLAIAPVNIR--STLININFKGENLDLTVDFLNNYLQTYLNDNLSKKNNVAFNTINFID
A0A2W7RD29      -NLAIYPATTG--GSILDIRLITNNPAKGEDFLNQLMNNYLFIELDDKNSIATNTINFIS
A0A3N2NDY8      -LVKADLADKD--ADVIDLSMKDVSTQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFID
D7JEV9          -KLAIQLIPN---TSVLNISVLSDNPLRDVDFLTRHAQSFLDDNLDKKNYEADKTIQFIN
A0A4R6H3B7      -RLMIEETEEK--ADLIRLSMVDEVPQKAADYLNELSSVYLTYELREKNHASATTIDFID
A0A2W7QSQ0      -VLEFQNPSVK--SSTLYIRLYDTSPEMGKQIMSSVIEGYNQRIINQKNETALKTINFIN
R7F6L5          -GLKATYEAKE--GTLIALSYTSTSPYRCEDVLNGVVQAYNDQWINDKKAIADATSDFIS
A0A553GA49      -NLKIEATQLD--ATAISINLVSTNFNMGKEFLDKYIETVIEYDLQRKNHIAFSTIDFID
A0A497D6F6      -DLSVNMLSQE--TSIIELSLKTLNVAKGIDFLNTLVAVYQAYTLERKNENASRTINFIS
A0A5M4AAB9      -KLTVYQVSLK--SSILKLKTTCENTEKGIAFLDMLMRVYQEHNLKKKNTIATKTIFFIT
F4KR18          -NLSVELSDEKNHSSVLILGLRDVVPQRGIDIVNRLVDKFNQLKSEVNTEITLKTLELID
C9LKL0          -EISATVQDQE--SSLIVLTCQDINIARATDIINTLFSCYKQDVVDNKNRVGQNTAHFID
A0A3D0QPV7      -AINVQVLNAS--AKTLQISMRDHNKAIAHDIVYAITHAFNEFALERKNESSKKILDFID
A0A496KT23      -SFNIALSNKA--STIIDIQYSDVNTARAKDAIDMLISVYNENWVRDRNQISVSTNEFIK
L1M9T3          -RFDVQLSDKA--STIIDIRYSDVNTARAKDAIDMLISVYNENWVKDRNQISVSTNEFIK
A0A3C0I8F1      -KLKVDIINHN--AGIIRISFKDHNAEKVRDIVNVIDTVYLEKTLAAKSQATLQQTNYLN
R5JJI4          -RINISLASKT--ATIINLVLDDVSTARAEDILNMLIAVYNEDVINDKNQIAVNTSKFIN
A0A3D2HF71      -KLSVSPVEEE--ASLVTLTVTGTNPEQEADYLNKLMDVYIEFGLENKNRTADQTIDFIE
A0A0A2DQN2      -SLSIGQPEGR--ATILSLSITEASKQKATDLLGALVEAYNEEVNTLRTQISVNTTEFIN
A0A0A2F2N5      -RLFIGQPENR--ATVLSLTLTDNSKQRATDLLEAIVDAYNTETSSVRNQIAVNTARFIN
L1NGW4          -AVAISQPQEK--SSTLMLSLQDRTKQRALDILTAQVAAYNQEEVEMRSQISVNTANFVN
Z4WRA0          -AVAISQPQEK--SSTLMLSLQDRTKQRALDILTAQVAAYNQEEVEMRSQISVNTANFVN
U2K8K9          -SVAITQPEAQ--TSTLTLTLRDKTLKRALDILAAQVMAYNQEEVEMRNQVSKNTAEFVN
A0A069ZM60      -AILVAEPENR--ASTLTLRLQDRTKKRALDILLAQVSAYNQEEMDMRNQVSKNTADFVN
J6GV98          -AILVAEPENR--ASTLTLRLQDRTKKRALDILLAQVSAYNQEEMDMRNQVSKNTADFVN
A0A134B4F8      -AIMVAEPENR--ASTLAIRLQDRTKKRALDILLAQVSAYNQEELDMRNQVSKNTADFVN
A0A134B8C7      -AIMVAEPENR--ASTLAIRLQDRTKKRALDILLAQVSAYNQEELDMRNQVSKNTADFVN
A0A4Z0EKR0      -AIGIAPVNTR--ASVLNLTLTDPIAGKAKDVLNKLMDVYNREAIEEKNLTTANTLKFLD
A0A229I3A5      -SLSASLSDVK--STVIDLTYKDVLAKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFIT
A0A3R6HJB3      -SLSASLSDVK--STVIDLTYKDVLAKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFIT
B5CTK0          -RLTIAQALAG--STMLNLSIIDSSVARADDVLNTLIAVYNEDLINDKNQIAINTSNFIS
A0A1M6B6D5      -DINIAPLSSG--SSVLQMRMTGHNKAKLVDYLNMSVQVLSEDMLERKNLFATKTIRFID
A0A451FS66      -NTKVTPESKG--SSVLRLTVIGSNKAKLVDYLNTSIQILSEDMLERKNLYATKTIQFID
A0A2E3GN39      -ITSIEP-NKE--TFAILVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSISFLD
A0A3D1MEL0      -ITSIEP-NKE--TFAIQVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLD
F0R0C9          -RLSVVLSDEK--STVINLSFQDVCIQRAEDVLNTVIAVYNENWVKDKNQIAVSTSMFIN
A0A2A4N9A6      -IQTLIT-NLS--ARTMILNFRDPNPAKAADFLNNLVQSYMEYGLDKRKESIINSANFIE
A0A368D1N7      -ITSIEP-NKE--TFAIQVSARHPSKSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLD
A0A3B8TU58      -NIKIEP-NKE--TFSVAITGKHPSKAKALVMVDLLIESFLNFHLYQKTESIKQSISFLD
A0A1T5IIR6      -RLSIAH---D--KQILTLVEQDYNAQRAADIINMLVVKYNEAAIREKNRVAVHTEDFIN
A0A3E0QD27      -NLTVVLMNQV--AQTILIKFNDNNAVKASDFVNSIMDEFNEYDRERKSEGAIKSLDFIN
A0A0M1W1I6      -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFIN
A0A4R4GHU2      -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFIN
I8WPR6          -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFIN
A0A0K2HKS3      -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFIN
B6W3W8          -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFIN
A0A4R4GSI6      -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFIN
A0A076IRY8      -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFIN
A0A3A6AD54      -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFIN
A0A3A6MIU7      -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFIN
I8WPP8          -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFIN
A0A372Y7D2      -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFIN
A0A3E4JJC9      -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFIN
A0A3E4WDQ0      -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFIN
A0A414H9P2      -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFIN
C3R5A8          -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSSFIN
A0A1C5XJA7      -SIAVKQEEEE--SSILTLALKDNSSERAEDILNMLVNVYNEETIRDKNQVAVNTANFIN
A0A3E5BU42      -SMGIRQEEDE--SSILVLSLKDDSPLRAEDVLNTLVNVYNEEALNDKNQVAVNTSEFIN
R7CUW4          -ALGIQQEEEE--SSILTLALKDSSPVRAEDVLNMLITVYNEEAIKDKNQVAVNTANFIN
A0A416GGJ1      -NFAIRQEEDE--SSILTLALRDFSPERAEELLNTMINVYNEEAIEDKNQVAINTANFIN
D1JY72          -NLNISQAEND--ASILYLSLRDYSTARAEDVLNMLITVYNEETIKDKNQIAINTSNFIN
D7J4K6          -SMGIRQEEDE--SSILVLSLKDGSPLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFIN
Q8ABP9          -SMGIRQEEDE--SSILVLSLKDGSPLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFIN
A0A5M6AHF7      -SMGIRQEEDE--SSILVLSLKDGSPLRAEDVLNTLVNVYNEEAVNDKNQVAVNTSEFIN
D6D2Z5          -SMGIRQEEDE--SSILVLSLKDGSPLRAEDVLNTLVNVYNEEAVNDKNQVAVNTSEFIN
A0A1T3EDR4      -QLKIKHLGED--TSVLELSIEDSSSKRGVSFLKSLVAVYNALYLDDKKRIAQSTGEFIA
A0A174SDD8      -NLSIRQMSGD--AALLRIAMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIK
A0A1H7RFH3      -NLAIKQMSGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIK
A0A139L1N2      -NLAIKQMSGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIK
A0A174TVL8      -NLAIKQMSGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIK
A0A1H8BJR6      -NLAIKQMSGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIK
R9H6G0          -NLAIKQMSGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIK
A0A412GR09      -NLAIKQMSGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIK
A0A4Q5DX00      -NLAIKQMSGD--AALLHLTMNDLSPTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIK
A0A081PBV5      -NLKIQQMEED--ASLLQVFVEDSSLQRADDLITTLITVYNEDAVEDKNKVAINTAQFIM
A0A1I2AN85      -NLKIQQMEED--ASLLQVFVEDSSLQRADDLITTLITVYNEDAVEDKNKVAINTAQFIM
A0A4U0GMP3      -RMNIRQMEDD--AALLQISMEDNSPRRAEDVITMLITVYNEEAIDDKNRIAVNTADFIR
A0A1H6CKR6      -NLEIVQM-ED--VAILQMTMEDTSPMRAAEMITNLITVYNNMTINDKKALGDTTANFIR
A0A235E1C0      -NLDIVQM-ED--VEILKMTLEDASPLRAEDMVTKLIEVYNQMTIEDKKTVANNTADFIN
R6D982          -NLSIKQVNGD--VALLNIMMDDFSPLRAGDVLNMLITVYNEEAIEDKNRIAVNAAQFIR
A0A1F0I8C4      -NLTIRQMSGD--AALLRITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIK
A0A3A5RIJ2      -NLTIRQMSGD--AALLRITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIK
A0A515IZJ5      -NLTIRQMSGD--AALLRITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIK
A0A5M5NLR3      -NLTIRQMSGD--AALLRITMDDWSPVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIK
A0A0D5BSQ0      -NLVVKQMEED--TSLLQITLSDNSSERASDILTLLVQVYNEVYLQDKNKIAVNTAKFIK
A0A1T3F6P5      -NLSIKQMEEE--ASLLQVTITDDSPERAADILTSLIIVYNEVYLQDKGKIAENTANFIK
A0A0W8EPA0      -NLSIKQMEEE--ASLLQVTISDDSPDRAADILTSLITVYNDVYLQDKGKIAENTANFIK
A0A365UKN1      -NLTINQIEEE--ASLLQLTIKDDSPERAADILTSLITVYNDVFLQDKGKIAENTANFIK
A0A4R6WE41      -NLKIKQMEDD--AFLLQMHLEDRSARRAGDILTELITVYNRTALEDLNQTAVNTADFIK
A0A2T5RP38      -NLKVKQMEED--ASLLQVSLDDLSSERADDILGTLIKMYNEIYLQDKNKIAVNTANFIK
A0A1A6CF06      -NLKIKQMDED--TSLLQVSIEDVSSDRADDMLTTLINVYNEVYLQDKNKIAVNTADFIK
A0A1T3D6S8      -NLKIKQMDED--TSLLQVSMDDVSSDRADDMLTTLINVYNEVYLQDKNKIAINTADFIK
A0A1P8E011      -TISITQMEED--ASLLQIVAEDTNPLRATALIAEMINVYNEVALQDKNQIGVNTANFIR
A0A1V3N3U3      -NLKITQLEED--ASLLQIVIEDQNPQRAAALIAEMITVYNEISLKDKNQIGVNTANFIK
C2FUH6          -NLKIQQMEED--ASLLQITLEDQSIKRANDIITTLITVYNEFSLEDKNQIAINTAQFIR
A0A0B8T471      -RMRIEQMEDD--ASLLQMSLEDVSAERAADMLSTLVTVYNKETVEDKNRVAKNSAEFIK
A0A4R7D2K0      -RMRIEQMEDD--ASLLQMSLEDVSAERAADMLSTLVSVYNQETVEDKNRVAKNSAEFIK
A0A2X2J8S4      -RLSITQTTDD--ASLLQIAMEDSNPQRAADIINNLIRIYNINSINDKNQIARNTADFIN
A0A3C0S618      -RLSITQTTDD--ASLLQIAMEDSNPQRAADIINNLIRIYNINSINDKNQIARNTADFIN
A0A4P7DRF9      -KLQIRQ-LED--VELLQVTMEDSNPLRAADMITKLIKVYNVMTIKDKNMIAHNTADFIR
A0A239XXC4      -NLKILQ-MED--VEILQMTLEDASPLRAEDMITKLIEVYNQMTIEDKKTVANNTADFIN
A0A4U9K473      -NLKITQ-MED--VEVLQMTMEDSSPMRAEEMISKLIEVYNEMTVQDKKKIANNTANFIN
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A1H6Z2F8      --------------------------------MKQLISRYQKASIGEKNKVADNTIAFIN
A0A2P8G5K0      ------------------MSVQDVLPRKGEAILNQLIARYQKASIGEKNKVADNTIAFIN
A0A519SYE7      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A3D4CJE1      ------------------IAFQSANARKAHDIVTALANEFTKYDIEERSKSSRNVLGFID
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      -DLSEAPHLTL--SDLPPVPVTPPPPAGQA------------------------------
A0A519TAP8      -NLDVTVVNPS--ANTIQISFTDNNPEKAAHIINNIDTVYLQEKLDRKKQSSALSLEFID
A0A2K8ZAP1      -MKNTNAAISE-------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A641LIG3      ------------------------------------------------------------
A0A641LPE6      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A3M1Y2F5      ------------------------------------------------------------
A0A1G1TG88      QQLEVNYDNLERAENRYQGFVEQTKTYDVRSEVAALAAKGE----DLEEQRLKLNQNLVL
A0A661XXA6      TQLTETENKLDDFEKYFEDVTISNRTVSLDEDVKRTVTIMN----NLDSQQVRLQDRLAD
A0A2T2UAJ4      ------------------------------------------------------------
A0A519SD85      SLSDQLSLKTIASSVALQKFKEVDNDIISPLAISHNVKAYS----DLNEELKRISIAEQT
A0A4Q3SEI4      ERIRFVVKELDSIETKLQNYRTKTGVVDLSEQGKLYLQSVG----ENDRMMTDLHIQTAM
A0A3M1TXY5      EQLTGVTDSLRKAEFSLRGFRAGTNIVDIGVTSKDLTDQLT----ELERQRAALAVAGQY
A0A2E0VQ27      KQLEVVKKRLGDAEAGLAGYRSENQLINSTQETDAVLRELT----QLNLQKVDLDMKTSE
R6U429          DRLVVIEKELGGVEEHLKDYKAEHNITDIQSLSAAYLGEST----EYKSMSFEVNNQLAI
R5DEG6          DRLIVIEKELGDVDSDIESYKREHQLTDISSETGMYLQTSS----QYRQEGLSLENQLSL
A0A5C8AF42      QQLDSLAGELKSSKDSLMLYQRQSNLPDPEAVGTTISENIS----KLQDQQFEIDEEIRS
A0A642EJV3      ERLGVIERELGNVDEDISSYKSEHLLPDVQAASSMYMAQSS----AANAQILSLNNQLYM
A0A161LWY6      KQLSDISDSLRTSESHLQHFRKANQILDLNAYGSTILGHLT----SYDEKRLQYNLKESY
A0A212J9Z9      NQLKLINDSLDISRFKLERFQKETGVYDVSSQSLRIALDSA------DREKDALALREKS
F5IV23          NQLKLINDSLDISRFKLEKFQKETGVYDVSSQSLRIALDSA------DREKDALALREKS
F8X2T0          AQITVINDSLNISRLKLEQFQKETGVYEVSSATVRRELDVA------DVDRDQVAMREKT
A0A1M3LAG1      AQITVINDSLNISRLKLERFQKETGVYEVSSATVRRELDVA------DVDRDQVAMREKT
A0A212K6G4      AQITVINDSLNISRLKLERFQKETGVYEVSSATVRRELDVA------DVDRDQVAMREKT
A0A4Y9IPG7      AQITVINDSLNISRLKLERFQKETGVYEVSSATVRRELDVA------DVDRDQVAMREKT
A0A2V3PNY7      KQMGIIADSLQQSEIIFKDFQDETGLYRITKSDGRVELESV------MKSIGEVKAQEDL
A0A1M5DFS8      RQMTLISDSLEQSEQTFKTFQDETGLYRIQGGDQRADRDAV------LQGIAENKAQEEL
A0A4Y8KZS5      RQMALISDSLQQSETTFKRFQDETGLYKIEGGDKRLERNDI------LTAMAENKAQEDI
A0A239K409      DRLNGLSAELIEIEKDVEQYKRQNKLADVASQSKVYVEESN----TYQKQLAEWSVQIDV
A0A350V3E4      KQVQEKYNSLLQTEDKLTNFLRTENVVELNAQANSIISSLSGIEGDYNRSLIDVQSTTRA
A0A1M6MYT6      SQLASISDSLSVSESRMEDFQSEHQIVNISAQSEQLLERMR----ELDQERIAMETQNKY
A0A2P8CDS1      SQLANVSDSLSASQKIRERFQSRNNLLDVSYQSQQLLDQLV----KLEDQKSLLETQHQY
A0A5M4A2I9      SQLANVSDSLSASQKIRERFQSRNNLLDVSYQSQQLLDQLV----KLEDQKSLLETQHQY
A0A353WYK7      EQLHQTESTLSELENYFENFTIDNRTTDMNVSLSRTITMLE----ELDSIKMKLNDQLDN
A0A355BP94      QELHQVENKMEGFENYFEDFTLKNKSSDLTTELRQTIYALN----QVDSQRFSLNKRILE
A0A136LSC7      NELVQVEEKMEGYENYFESFTLQNKSSDLTLDLKKTIAAIN----VVDSQRYSLNKQLAE
A0A5C7N8Q5      NELVQVERKMEGYEDYFESFTLQNKSSDLTLDLKNTIATIN----RVDSQRFNLNKRLIE
A0A1V5S1J9      EQLSTIADSLRISEGRLKDYKANNFVVA-SVGGSNLMGQYT----QLDAMQTDLRLKESY
A0A0A2EYC8      DQLSVISDSLSRSESNLNSFKIANKMYG-QNNSILLTNKME----ALEEQGKIIKLRDEY
A0A2G6H6Y4      DQLSNVSDSLSRSEAKLNSYKIEHKIYS-SDMTSVLVGQME----KLKNQGKQIKLRDEY
A0A1M3DPL8      EQLENVSKSLATSEDNLSDFRKRNQLINVSSLTDELLSKAA----SFDEELNQIRLKETY
A0A1V5F519      EQLSEVSKSLSVSEDEMTRFRRDNQIIDISSHGSELMSKAN----SLDEKKAELKLKETY
A0A2G6R1T9      EQLTGIKQTLKGSENDITEFRRSNQIVDITTHTSEIVEKST----EYNERKSALRLKEKY
A0A2W4RDE8      EQLMGVSDSLRRVEGTLESFRARSNVIDIRTSAQTLTNNLD----KLETERANLEVKLKY
A0A0L8VEV2      SQLKDVIDTLQVAGNKFTSFRSQNQIVDIGQEGGIIVQRLV----DLDKERSLAQSHLDY
A0A1I2A9Z9      SQLKDVIDTLKVAGNNFTSFRSRNQIVDMSQEGGIIVQRLV----DLDTERSMIQSHLDY
A0A142HHS5      KQLEENGQNLAKAEDNLKIFVQQNGTYDAKGELGTITNKLE----KIEEDRFKLEQKLTL
A0A660LQT8      ERLQVIENELGNVDKNISSYKSANLLSDTDEASKLYIKKTE----ENTDKMMDLNNQIYM
A0A350PNH9      ERLGVIERELGDVDKDISSFKSRNLLPDVETAAQQYMQKSG----DVDKQILELNSRLSM
A0A354LNT9      ERLGVIERELGDVDKDISSFKSRNLLPDVETAAQQYMQKSG----DVDKQILELNSRLSM
A0A2M6GH67      EQIQATKDDVTRYEKAMQDFAIQNKTYDVRGEIAKSMARLE----ELYKERSDLGLQINL
A0A389LWV6      EQLLILKDSISSAESKLNAYQSQAGIFSSDNSLRSS-TELV----DLDKKKAEIRLRKEY
A0A1G9B1T9      KQIATVADSLSQVEQSLRSFRDRTRTVDIGTTARDLNTKLD----ELQKTREDLLIDYRS
A0A3D0FMX4      QQLDTIRKSLASSESAMTDFRKRNEIVDIQSYSSELLGKVN----AYDQERLAMRLKETY
A0A1M3MEI8      KQLESVAEELSMSEDEFTSFRRRNQIIDVGSFSGDLLSKAA----AYDTEINQLKLKESY
A0A1J5HQM0      EQLQNVSKSLTVSQGEMTDFRQRNQIINVDTHAGELLGKSN----SYESQFSTLKLKETY
A0A653AC35      EQLSDVKKSLEASEGAMTQFRQSNQIVDMSSHSTEVLGKAT----AYDEKQNELQLRESY
E4T131          EQLKGVSKSLTTSESQMTNFRQSNKIVDVSSHTSDLLGKAT----KYDGQQAELKLREDY
A0A521H707      ETVLGIDTQLRLSEYSVEAFKKEHLIIDPLQNAEDALAHIN----LLIDQRIEVQLQLAV
A0A1F3D6P8      SQISEISDSLVISESKLRNYRSANQVMDLSFQGKSLYEKLE----QIETERANLQIQERY
A0A356Z058      SQISEISDSLVISESKLRNYRSANQVMDLSFQGKSLYEKLE----QIETERANLQIQERY
A0A3D1BT36      SQISEISESLSSSQSELRDYRSTHQVTDLSYQGQQALNQME----QIDNEKATLQAQQRY
A0A352ME00      SQVSDMADSLVRSESALKNYRSANQVMDLSFQGQRVYEQMT----DIDNERANLKVQERY
A0A3D3HL11      SQISEISDSLTQSESKLRDYRSANQVTDLSYQGQQALEQMR----QIENERSMLQVQERY
A0A5R9QZP0      AQISDISDSLVKSESELRNFKASNQVTDLSYQGQQALTQIT----AVDNEISSLNVQEKY
A0A2W7RD29      NQIQNVSDTLGVIENELQNFRAANQTTNISSEGEVIFGRLQ----SMGEELAKEKIKKEY
A0A3N2NDY8      DRLRLIERELGNVDNEIFDFKRDHRVPNLEEAAKTQMKQSV----EMSNKMLEVTNQMSM
D7JEV9          DQLGIISDSLSRSESNLNSFKVANKMYG-QNNTSILTERME----SLENQGKQIRLRDEY
A0A4R6H3B7      SQLKDVIDTLKVAGNNFTSFRSRNQIVDMSQEGGIIVQRLV----DLDTERSMIQSHLDY
A0A2W7QSQ0      ERLGIVKNDLEEFEKSGENFKTRNNITDISMNSKIYLENTA----ETRKQVAEVSGKIDI
R7F6L5          ERLSVIEQELGNVDSDISSYKARTMSPDLEAQAQINMARSS----ELQNQQYDLSNQIQI
A0A553GA49      DHLSDVFDSLSIAEQSLQDFKTDQQVVDVNLKAGQIYENLR----AIGIEKDQLEAHVNN
A0A497D6F6      TQLQTVSDSLGISENAMQAFQSKHKLLNISIQSEQLLDQVN----ELEKEKVVLETKNKY
A0A5M4AAB9      SQLSEVRDSLKASQKIRERFQSNNQLLDVGYQSQQLLDQLV----KLEDQKNLLETQHQY
F4KR18          GRLANISAELASAESTVESYKLNNDII-----AETTTDLSI----TLEDVNNLVKEQRKV
C9LKL0          ERLSLIGSELAGVEGRLASLKESNRIVDFKTAADQYSSMSV----TARQSSVDLQSQVSV
A0A3D0QPV7      SQIDTVYTKLKNSELELQAFRQLNKVQNFEGVSKNYLERLT----ELEGQLLKVDIDEEL
A0A496KT23      ERLAVIQRELGSVDQNIAGYKSANLLPDVEQSGNMAVNQAN----EAEAKARELSTQVYM
L1M9T3          ERLSVIQRELGNVDQNIAGYKSANLLPDVEQSGSMAMAQAN----DAEIKARELSTQTYM
A0A3C0I8F1      EQLEKVDEELTKYESLLEGSLIENKTTDLLSKFSTSVKESE----NFGEKKAEITNLLNL
R5JJI4          DRLIIIERELGSVDANIESFKRENQLTDITSETGMYLQNTS----RYKQEGLSLENQLSI
A0A3D2HF71      KQLAIISDSLHLAENSLESFRLANRLIDLSREGVAIQNRLE----EIDKEKTSLMLQKNY
A0A0A2DQN2      NRLISLEEELESMENNREELLIENQFINPASLAESYMNRTQ----TNQNGRIELEAQERL
A0A0A2F2N5      ERIANLSEELDALASNIDSFQRANNFIAPEVVAGAYTSRAQ----TGHEASFEIDAQKRL
L1NGW4          ERIAVLSKELGIVENEMESFLVTNRTLDFDAKMGRYNTRSV----DYEVQAMEIETQLKL
Z4WRA0          ERIAVLSKELGIVENEMESFLVTNRTLDFDAKMGRYNTRSV----DYEVQAMEIETQLKL
U2K8K9          ERLEALSRELGVVEQDMTRFSARNKTIDFTSKVESYNARSL----EEEDASIKIEKQLKL
A0A069ZM60      ERLAALGKELGLVEGDMERFLMNNRTLDFEGKVGVYNSRSL----ESEAEALQIETQLKL
J6GV98          ERLAALGKELGLVEGDMERFLMNNRTLDFEGKVGVYNSRSL----ESEAEALQIETQLKL
A0A134B4F8      ERLAALGKELGLVEGDMERFLMNNRTLDFEGKVGVYNSRSL----ESEAEALQIETQLKL
A0A134B8C7      ERLAALGKELGLVEGDMERFLMNNRTLDFEGKVGVYNSRSL----ESEAEALQIETQLKL
A0A4Z0EKR0      DRLEKLAYGLSGTEKVVEKFKSANQLTDITTQASNYTSQAN----SYDKQLSEWAIQIDV
A0A229I3A5      ERLGVIERELGDVDKNISAFKSSNLLPDVEAAAQQYMQKST----EVDKQIMDLNSRLAI
A0A3R6HJB3      ERLGVIERVLGDVDKNISTFKSSNLLPDVEAAAQQYMQKST----EVDKQIMDLNSRLAI
B5CTK0          ERLNIIEKELGNVDSNIETFKRQNRLTDVNSEASMYLASSS----SYQQEGVGIENQLTL
A0A1M6B6D5      SSLAEKSIELSLVEDELNDFRRNNVIFDLNIEGAELNEKLN----ALDLRKEAAARELDY
A0A451FS66      SSLAKKSAELNSVQDELNKFRNKSAVYDLATEGSELNSKLN----ALDLRKEAVNRELNY
A0A2E3GN39      KQIDSIKPLYDDALIAVRNAEAQKGYRNIEALGGGLYKDIK----DLQKKLVRIEYVTSV
A0A3D1MEL0      QQIDSIKPLYDDALIAVRNAEAQKGYRNIEALGGGLYQDVK----ELQKKLVRIEYVTSV
F0R0C9          ERLGVIEGELGNVDENISSYKSEHLLPDVQAASNLYMAQSS----ETNAQILALNTQLSM
A0A2A4N9A6      DQLQKIE-------IQLLNSTNKLMNINLDT-----------------KTIANIS---RV
A0A368D1N7      QQIDSIKPLYDGALIAVRNAEAQKGYRNIEALGGGLYEDVK----ELQRKLVRIE---YV
A0A3B8TU58      EQIDSIKPLYDEALVAVRNAEAQKGYRNIEALGGGLYADVK----NLQQKLVRLD---YL
A0A1T5IIR6      ERLAIIEEELGGVEGELARFKSSNKIMDVDYTANMYLGDSR----GYNAEIVAVETKLAL
A0A3E0QD27      ETVAGIDVELRASEGSLEQFKKDNMIIDPRQNASEALTHIN----KLIEQRVEMQLQLAV
A0A0M1W1I6      ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
A0A4R4GHU2      ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
I8WPR6          ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
A0A0K2HKS3      ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
B6W3W8          ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
A0A4R4GSI6      ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
A0A076IRY8      ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
A0A3A6AD54      ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
A0A3A6MIU7      ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
I8WPP8          ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
A0A372Y7D2      ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
A0A3E4JJC9      ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
A0A3E4WDQ0      ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
A0A414H9P2      ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
C3R5A8          ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
A0A1C5XJA7      ERLIIIGQELGDVESDLESFKRENQTLDISSSASMYMGESQ----KYNSSALELETQLRL
A0A3E5BU42      ERLLIIERELGGVETELEAFKQSNQLMDIGSLAGQYMGEAQ----TYSADALEQETQLKL
R7CUW4          ERLIIIERELGGVESDLESFKRSNQIVDISSAAGMYMTESQ----KYNADALELETQLRL
A0A416GGJ1      ERLIIIEKDLGVVESDLETFKSSNQLMDVSSTAGMYMSESQ----KYGADGMELETQLRL
D1JY72          ERLVIIEKELGGVENELQSYKQNNDIIDIGSAASMSMSDKR----QYSSTTQELELQARM
D7J4K6          ERLLIIERELGGVETELESFKQHNQVMDIGSLAGRYMGEAQ----AYSADALEQETQLKL
Q8ABP9          ERLLIIERELGGVETELESFKQHNQVMDIGSLAGRYMGEAQ----AYSADALEQETQLKL
A0A5M6AHF7      ERLLIIERELGGVETELESFKQHNQVMDIGSLAGRYMGEAQ----AYSADALEQETQLKL
D6D2Z5          ERLLIIERELGGVETELESFKQHNQVMDIGSLAGRYMGEAQ----AYSADALEQETQLKL
A0A1T3EDR4      DRLKIVEGELSGVEQKIEDFKLSNQGMDAQSLKSLSLSEQG----ENKSQGMKIDMDISL
A0A174SDD8      ERLQIIEHELGSVETDIEDLKKANNGVDINMAAGMYIQDSR----QYESSIKELDTQLQL
A0A1H7RFH3      ERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSR----EYESSIKELDTQLQL
A0A139L1N2      ERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSR----EYESSIKELDTQLQL
A0A174TVL8      ERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSR----EYESSIKELDTQLQL
A0A1H8BJR6      ERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSR----EYESSIKELDTQLQL
R9H6G0          ERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSR----EYESSIKELDTQLQL
A0A412GR09      ERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSR----EYESSIKELDTQLQL
A0A4Q5DX00      ERLQIIEHELGSVETDIEDLKRANNGVDIDMAAGMYIQDSR----EYESSIKELDTQLQL
A0A081PBV5      DRIQIIQSELGSVESNLENLKVSNQGIDVNAASQMYVSEGM----MHESAGNDVQTQLKL
A0A1I2AN85      DRIQIIQSELGSVESNLENLKVSNQGIDVNAASQMYVSEGM----MHESAGNDVQTQLKL
A0A4U0GMP3      ERIDIIESELGLVESDLERLRIANQGLDLASSRQMYSSESQ----TYYAEGNAAETQMKL
A0A1H6CKR6      DRIAIIETELSGVESQIEGMKTSNQGLDVKSAGEQYWSDSR----GYDASSKEIETQMKL
A0A235E1C0      DRIVIIEKELSSVESSLEGMKTQNQGLDVKSAGEQYWTESR----TYQSSSKELATQMKL
R6D982          ERIEIIEDELGSVETDIEVMRKESDWGDINTAASMYVSDGR----KYESSLKELDTQLQL
A0A1F0I8C4      ERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSR----QYELLIKELDTQLQL
A0A3A5RIJ2      ERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSR----QYELLIKELDTQLQL
A0A515IZJ5      ERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSR----QYELLIKELDTQLQL
A0A5M5NLR3      ERLQIIEHELGSVETDIEDLKRANNGVDINTVAGIYIQDSR----QYELLIKELDTQLQL
A0A0D5BSQ0      DRLVIIEAELGAVESNIENLKVANQGIDVETAGSMYLAEKN----QYKTDRTKVETDIRL
A0A1T3F6P5      DRLAIIEGELGAVESNVENLKVANQGIDVATAGGLYLNEKN----QYKTEGAKIETDIRL
A0A0W8EPA0      DRLAIIEGELGAVESNVENLKVANQGIDVATAGGLYLNEKS----QYKSEGAKIETDIRL
A0A365UKN1      DRLAIIEGELGAVESNVENLKVANQGIDVATAGGLYLNEKN----QYKTEGAKIETDIRL
A0A4R6WE41      NRLQIIEEELYEVETDIEKLKVNNQGVDVGTAGQLYVAEGR----AFQTQRTQIETDKRL
A0A2T5RP38      DRLAIIESELGAVEANIENLKIDNQGLDIETAGGMYLSESN----QYKTEKTKTETDLRL
A0A1A6CF06      ERLAIIEGELGAVESNIENLKIANQGIDIATAGGMYLSESS----QYKTEGTKIETDIRL
A0A1T3D6S8      ERLAIIEGELGAVESNIENLKIANQGMDVATSGNMYLSESN----QYKTEGTKIETDIRL
A0A1P8E011      ERLAIIEQELGSVESSIEDLRTQNQGMDASTVGTAYFEDSR----LYQSERNKVETDINL
A0A1V3N3U3      ERLAIIQQELGSVESNIEQLRQSNQGVNIETAGEMYLNDSR----QFQSARTKIETERKL
C2FUH6          ERLQIIESELGNVENNIEQLKTANQGVDVNVAGEMYLSESR----QHLEERNKLETDIRL
A0A0B8T471      ERIAIIETELGGVETDLEQMKARNEGMDVNTATGVFWGESR----EYQSTTRGIETQLRL
A0A4R7D2K0      DRIAIIEDELGGVETDLEQMKARNEGMDVNTATGVFWGESR----EYQSTTRGIETQLRL
A0A2X2J8S4      NRVAILSEELGSVEGDLEKIKVNNNGMDVAEVGGMYIEDSR----SYRLEATKIDTDLKL
A0A3C0S618      NRVAILSEELGSVEGDLEKIKINNNGMDVAEVGGMYIEDSR----SYRLEATKIDTDLKL
A0A4P7DRF9      DRIAIIEEELSSVESDIEGMKIQNQGLDVKAAGEQYWSESR----GYQSTSKDIETQKKL
A0A239XXC4      DRIVIIEKELSSVESSLEGMKTQNQGLDVKSAGEQYWTESR----TYQSSSKELETQMKL
A0A4U9K473      DRLVIIEKELSSVESDLEGMKTQNQGLDVKSAGEQYWTESR----GYQSSSKELGTQMKL
A0A3D4RLG4      ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A1H6Z2F8      ANLARISSELVQVETRIEHFRKRHRVIDMAEDSRQALQNLN----TNASEEKQLAVHLKI
A0A2P8G5K0      NNLARISSELALVETNIEHFRKRHRIIDMAEDGRQALQKSA----TNALEEKELAIRLKI
A0A519SYE7      -------------------------------DISGLKDRLE----QQQLTREKLIQNLRL
A0A5Q4EKA0      ----------------------------------------------------MLQMEFNI
A0A3D4CJE1      KQLDKYYNKLKVSENKLQKFQKENKISGSSEFSAMYMEKLN----RLENQLIDLDLQINV
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------VGFGMDNDLVEL--------------RLELEQNLEL
A0A519TAP8      QVIADNDKRWRAAEEAHTEFVRRNKTYDVKGDMATLKNGLE----QQQEARQKLQDKLRL
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A641LIG3      ------------------------------------------------------------
A0A641LPE6      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A3M1Y2F5      ----------------------------------------NDP-FLQSLMGKLT------
A0A1G1TG88      LSDISRMVQQTHITRNEEETVEQ------SIPGLGD-I--NDP-VLSQLLGQLN------
A0A661XXA6      LNSIINEIKDGQIV---------------IMPTLDD-K--FPA-HIISLINELN------
A0A2T2UAJ4      -------------------------------------V--AEQ-----------------
A0A519SD85      LKFVYKDLT-------KGIPD--------RLSYDVQDI--PDV-QLQDMTSKYQ------
A0A4Q3SEI4      LDEVEKYVL-------AKDRQIG------VVPAITS-V--KDP-MLGQLLNSLF------
A0A3M1TXY5      YEYVLEDIQ-------ADNSLAEV-----VAPASTG-I--EDP-LLTSLLVDLA------
A0A2E0VQ27      LKRLQEYLL-------SGNSLSD------FSPNFEA-L--SDP-IFRGSYLKAQ------
R6U429          AKFIKEYLE-------NPAHDGA------LIPANSG-L--TNS-TVESQIGEYN------
R5DEG6          AKYIKNYLT-------DPGKNSD------LIPANTG-I--SDV-NIESQIGEFN------
A0A5C8AF42      LNLVSSKLK-------SDPNRLEIYR---LLPEMLGKS--YEQ-SLTGQIASLY------
A0A642EJV3      TRYIRNYLA-------NDANRTQ------LLPANSG-I--ESA-NIESQIAEYN------
A0A161LWY6      LNYLADYIK-------KNVNNQEL-----LTPSSLG-I--VDP-VLTGLLTQYN------
A0A212J9Z9      VLLLTEKMK-------EKILGTDDL----MDPASMN-I--RNP-KLSEFVVTYN------
F5IV23          VLLLTEKMK-------EKILGTDDL----MDPASMN-I--RNP-KLSEFVVKYN------
F8X2T0          VLFTTQKIK-------EGIMGSSEL----IDPVSIG-L--TDEIKLSRYVEEYN------
A0A1M3LAG1      VLFTTQKIK-------EGIMGSAEL----IDPISIG-L--TDEIKLSRYVEEYN------
A0A212K6G4      VLFTTQKIK-------EGIMGSAEL----IDPISIG-L--TDEIKLSRYVEEYN------
A0A4Y9IPG7      VLFTTQKIK-------EGIMGSAEL----IDPISIG-L--TDEIKLSRYVEEYN------
A0A2V3PNY7      ILRLTDEIS-------NSILNKTEL----IDPTALG-L--NEP-KLARSIGEYN------
A0A1M5DFS8      ILRLTDEIN-------NSILSNTEL----IDPSAFG-I--SDT-KLSQSVGEYN------
A0A4Y8KZS5      ILRLTDEIK-------SSILNSTEL----VSPNAFG-I--NEP-KLSQSIADYN------
A0A239K409      LETIETYIS-------NSKENSYR-----LVPSTLS-I--EDP-TLQELISRFN------
A0A350V3E4      LTDIKGELDKYDPKATDYFESKI-----------------TDP-YVAELQGEIA------
A0A1M6MYT6      YHYLRDYIN----------TTASRELETVIAPSAMG-I--EDP-LLNNLILQLN------
A0A2P8CDS1      YQYLETYLS----------RNDN--LQSLVAPTTVG-I--DDP-LLVNLLQELS------
A0A5M4A2I9      YQYLETYLS----------RNDN--LQSLVAPTTVG-I--DDP-LLVNLLQELS------
A0A353WYK7      FNEIYDKLL-------DTADLQL------GNSELRM----LSS-EVAQDINRLE------
A0A355BP94      LNGYIEE-L-------STGKLVQ------VA-PRNF----LPE-YLNTRIEEYL------
A0A136LSC7      LNTLIDQ-I-------TASDFAN------AIRPANS----FPE-SILQRIEELH------
A0A5C7N8Q5      LNALIEH-I-------TTEDFSS------TSRPTRS----LPE-SINQRMEELY------
A0A1V5S1J9      LNYLTNYLK-------SNVEEGAI-----IAPDNLG-V--SDA-NLSSLVSQFT------
A0A0A2EYC8      FKYLRNYLK-------NNIDSESL-----ASPTTIG-I--QEP-RLIALVDKYN------
A0A2G6H6Y4      FKYIKRYLN-------KNIQTESL-----ASPTTIG-I--QEP-RLISLVDKYN------
A0A1M3DPL8      IAYVEKYIQ-------TNLNEGAI-----IAPSNIG-L--NEP-MLMTIVQQIN------
A0A1V5F519      LNYLTKYLT-------GNFEEGTV-----VAPSNLG-L--NEP-LLMQLVQQIN------
A0A2G6R1T9      LNYLADYIK-------TNLSSGNI-----IIPTNTG-L--NES-TLVVLAQQFN------
A0A2W4RDE8      YQYILQSLQ-------SGKNTDI------VAPSTFG-V--DDP-LLSNLLIELS------
A0A0L8VEV2      YRNLQKYLS-------DTEKMQEV-----VAPSVVG-I--VDE-SLNNLVTQLS------
A0A1I2A9Z9      YKNLQQYLD-------DTEKMKQV-----VAPSVVG-I--VDD-ALNNLVVHLS------
A0A142HHS5      LADVSQRAAAERLTPSDEVTVDQ------TIPGLAL-L--EDP-ALSQQLNNLN------
A0A660LQT8      TRYVSQLIS-------NDKKKYD------LLPVNSG-I--NST-AIESMIGDYN------
A0A350PNH9      ARYLRDFLT-------GKVGKNQ------LLPANIG-I--DSP-GIEQQITEYN------
A0A354LNT9      ARYLRDFLT-------GKVGKNQ------LLPANIG-I--DSP-GIEQQITEYN------
A0A2M6GH67      LRDIHNLVA-------HDSDLEQ------IIPSLKQ-I--EDA-ELSTKIAELS------
A0A389LWV6      TKFLQDNLK---------KEDGN------LVPPSSMGI--QDV-ELAVLVSKYN------
A0A1G9B1T9      YQNLFQYLE-------QNDYTEV------IAPSVRN-I--NDE-VMSGLLRNLI------
A0A3D0FMX4      FEYLTNYLN-------TTMEQGTV-----IAPSTMG-L--DAQ-ALGTLVTQLN------
A0A1M3MEI8      LDYLVKYVK-------TNLQDGSI-----VAPTNLG-L--NEP-MLMALVQQIN------
A0A1J5HQM0      LDYLTKYLR-------TNMEDGSI-----IAPSSLG-L--NEP-MLMGLVSQIN------
A0A653AC35      FNYLTDYLK-------TNLEAGAI-----VAPASLG-L--NEP-MLMTLVQQFN------
E4T131          LTYLTKYLK-------TNLEDGAI-----VAPSSLG-L--SEP-MLMKLVEQVN------
A0A521H707      LQRIEKNIN-------SDENTES------LLPLLSGTY--IDG-VIQGLITKIQ------
A0A1F3D6P8      YNYIINNFK-------SSNDMSG------VVPPSAMNV--ADP-IMNQLITQLL------
A0A356Z058      YNYIINNFK-------SSNDMSG------VVPPSAMNV--ADP-IMNQLITQLL------
A0A3D1BT36      YNYIIDYFN-------NNQDIAG------LAPPSAANV--SDP-IMNTLVLELL------
A0A352ME00      YNYVINYFK-------MNADVSG------LAPPSAMNV--SDP-IINQMITNLN------
A0A3D3HL11      YNYILDYFD-------KNQDMTS------LAPPSSSNV--VDP-ILSSMIMELQ------
A0A5R9QZP0      YNYILDYFD-------QNQDITG------LSPPSSANV--IDP-IMNSMILELL------
A0A2W7RD29      LLSLDRYLR-------NNDFDNI------VVPSLVG-I--TDP-TINSLIDELI------
A0A3N2NDY8      SIYLRDYLN-------NPGNAKS------VIPVNTG-I--GSP-TLEAQISNYN------
D7JEV9          FKYLRNYLK-------NNIDNESL-----ASPTTIG-I--QEP-RLIALVDKYN------
A0A4R6H3B7      YKNLQQYLD-------DTEKMKQV-----VAPSVVG-I--VDD-ALNNLVVHLS------
A0A2W7QSQ0      LESIELTMN-------NQSGQFD------LIPGGLADL---DP-SLSGLLTQYN------
R7F6L5          LNYVRGELS--------REGIDE------TLPSNMG-I--ANT-GLESQIQVYN------
A0A553GA49      LEFLNENFQ-------KDEDFSA------HSVTLMSNL--NNE-VLNDLLNEYI------
A0A497D6F6      YKYLREYII-------NNQELETI-----IAPSAMD-I--DDP-LLNALILELN------
A0A5M4AAB9      YKYLENYLL-------QNGDLESL-----VAPSTVG-I--DDP-LLVNLLQDLN------
F4KR18          ELQQKMLQA-------MKSDLQDTSSKFKLIPINPA-L--YDG-KIRDLIQPYN------
C9LKL0          ARYLKDFMQ-------NNSNKHQ------LIPV----LNLPDA-TFAGLVNEYN------
A0A3D0QPV7      IIEVERALK----EYHNESDIYN------VLSILSGTR--FES-ELSGMVKELH------
A0A496KT23      TRHVKEYLT-------DGRHENQ------VLPSNSG-I--NNA-SIQSQINDYN------
L1M9T3          TRHVREYLT-------DGRHENQ------VLPSNSG-I--NNP-SIQAQINDYN------
A0A3C0I8F1      LDQLEVQAQ-------NDSIITT------LMPEVNL----PGI-DFNSLILKIN------
R5JJI4          VKYIKEYLV-------DPQKGSD------LIPANTG-I--SDN-SVESQIKEYN------
A0A3D2HF71      YEYLKDYID-------TKKESGE------IIAPSVMGV--TDQ-LLIRLVEELS------
A0A0A2DQN2      IAYMQSYLK-------DASKTNE------FLPLNIG-I--MSP-ALDESIGQFN------
A0A0A2F2N5      ARYFLDFIN-------NPSKRSE------YLPQNIG-L--NNA-ALETAITAYN------
L1NGW4          VSFMLSNLS-------SPQKQTE------YMPLNIG-V--SDP-NLDGYIAKYN------
Z4WRA0          VSFMLSNLS-------SPQKQTE------YMPLNIG-V--SDP-NLDGYIAKYN------
U2K8K9          VSYMLSQLN-------SPSKRNE------LMPLNIA-M--PDP-ELDGYITQYN------
A0A069ZM60      ISYMLSEFS-------NSHRKNG------YLPLNVG-V--PDQ-ALDGYIAQYN------
J6GV98          ISYMLSEFS-------NSHRKNG------YLPLNVG-V--PDQ-ALDGYIAQYN------
A0A134B4F8      ISYMLSEFS-------NSHRKNG------YLPLNVG-V--PDQ-ALDGYIAQYN------
A0A134B8C7      ISYMLSEFS-------NSHRKNG------YLPLNVG-V--PDQ-ALDGYIAQYN------
A0A4Z0EKR0      LESIEGYLE-------KNAGNYS------AVPSTLG-I--KDE-TLLALIGKFN------
A0A229I3A5      AQYIRNYLT-------GKVGKNQ------LLPTNTG-I--ESP-GIEQQITEYN------
A0A3R6HJB3      AQYIRNYLT-------GKVGKNQ------LLPSNTG-I--ESP-GIEQQITEYN------
B5CTK0          AKYIKSYLT-------DPSKNFN------LIPTNTG-ISGADV-NIESSIATYN------
A0A1M6B6D5      YNTLQEYLV-------TRSDYRD------VPAPSVAGI--SES-SVVAGVGKIV------
A0A451FS66      FITLQEYLT-------TRTDYRD------VPAPSVAGI--SEG-SIIAGVGKIV------
A0A2E3GN39      LEWFAVMIQ----------QEED------LSLASTQ-L--SGE-EFDGITRALSVDEIL-
A0A3D1MEL0      LEWFAVMVQ----------QEED------LSLVSTQ-L--SGE-EFDGVTRALSVDEIL-
F0R0C9          ARYIRNYLT-------AASSRNQ------LLPANSG-I--ESA-NIEQQIGEYN------
A0A2A4N9A6      FQSEGKYIINDNPEFLIAQKIND------LKLEINI-I--DTV-NYY-LNNNISLENIIL
A0A368D1N7      TSVLEWFAV-------MVQQEED------LNLASTQ-L--SGE-DFDGVTRALSVDEIL-
A0A3B8TU58      ISVLGWFAV-------MVEQEED------LSLASTQ-L--SGA-DFEGIINGLSVSEIL-
A0A1T5IIR6      SNYLKDHVV-------SGAESYR------LIPGNMG-L--EDN-SMDEVIARYN------
A0A3E0QD27      MNRLERDIT-------SDSEVES------LLPFLSGSY--SDG-VILSIVSKIH------
A0A0M1W1I6      ARYIKGYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQIAAYN------
A0A4R4GHU2      ARYIKGYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQIAAYN------
I8WPR6          ARYIKGYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQIAAYN------
A0A0K2HKS3      ARYIKGYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQIAAYN------
B6W3W8          ARYIKGYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQIAAYN------
A0A4R4GSI6      ARYIKGYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQIAAYN------
A0A076IRY8      ARYIKSYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQITAYN------
A0A3A6AD54      ARYIKSYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQITAYN------
A0A3A6MIU7      ARYIKSYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQITAYN------
I8WPP8          ARYIKSYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQITAYN------
A0A372Y7D2      ARYIKSYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQITAYN------
A0A3E4JJC9      ARYIKSYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQITAYN------
A0A3E4WDQ0      ARYIKSYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQITAYN------
A0A414H9P2      ARYIKSYLV-------DPSKETE------LISSNTG-I--ADI-NIETQITAYN------
C3R5A8          ARYIKSYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQITAYN------
A0A1C5XJA7      AQYIKEYLT-------DPKKEAD------LIPSNTG-I--SDM-NIENQIGMYN------
A0A3E5BU42      AQFIKEYLT-------DPTKNRD------LIPSGTG-I--SDA-SVEGQINQYN------
R7CUW4          ANFIKDYLT-------DPSKETD------LIPSNTG-L--SDM-NIESQINLYN------
A0A416GGJ1      AQYIKEYLI-------DPAKETD------LIPANTG-L--SDA-SVESQINTYN------
D1JY72          ARYIKGYLV-------DPSKETE------LIPSNTG-I--ADI-NIETQIAAYN------
D7J4K6          ARFIKEYLT-------DPTKSRD------LIPSGTG-I--SDA-AVEGQINQYN------
Q8ABP9          ARFIKEYLT-------DPTKSRD------LIPSGTG-I--SDA-AVEGQINQYN------
A0A5M6AHF7      ARFIKEYLT-------DPTKSRD------LIPSGTG-I--SDA-AVEGQINQYN------
D6D2Z5          ARFIKEYLT-------DPTKSRD------LIPSGTG-I--SDA-AVEGQINQYN------
A0A1T3EDR4      LEMLSSYLK-------DADKSKG------LLPSNMG-L--SGG-NIEQQIQAYN------
A0A174SDD8      VTFIKQYLQ-------DSSKDDE------LIPSNIG-L--EDL-NIESQIARYN------
A0A1H7RFH3      VTFIKQYLQ-------DSSKEDE------LIPSNIG-L--EDL-NIETQISRYN------
A0A139L1N2      VTFIKQYLQ-------DSSKEDE------LIPSNIG-L--EDL-NIETQISRYN------
A0A174TVL8      VTFIKQYLQ-------DSSKEDE------LIPSNIG-L--EDL-NIETQISRYN------
A0A1H8BJR6      VTFIKQYLQ-------DSSKEDE------LIPSNIG-L--EDL-NIETQISRYN------
R9H6G0          VTFIKQYLQ-------DSSKEDE------LIPSNIG-L--EDL-NIETQISRYN------
A0A412GR09      VTFIKQYLQ-------DSSKEDE------LIPSNIG-L--EDL-NIETQISRYN------
A0A4Q5DX00      VTFIKQYLQ-------DSSKEDE------LIPSNIG-L--EDL-NIETQISRYN------
A0A081PBV5      VEMMQNYMR-------DADKKDD------LIPNNTG-L--VDV-NIENRINEYN------
A0A1I2AN85      VEMMQNYMR-------DADKKDD------LIPNNTG-L--VDV-NIENRINEYN------
A0A4U0GMP3      VELMKQYLE-------DAERRND------LIPNNTG-L--VDM-NIESQINEYN------
A0A1H6CKR6      VEIMRQRLD-------DPSKRDE------LIPSNTG-L--VDQ-SIESIITEYN------
A0A235E1C0      VEIMRQRLS-------DPSRVDD------LIPSNTG-L--VDN-NIEDIISEYN------
R6D982          VSFIKQYLQ-------DAAKEDE------LIPGDIG-L--TDA-VIEGQIARYN------
A0A1F0I8C4      VTFIRQYLQ-------DSGKEEE------LIPGNIG-L--TDI-NIESQIARYN------
A0A3A5RIJ2      VTFIRQYLQ-------DSGKEEE------LIPGNIG-L--TDI-NIESQIARYN------
A0A515IZJ5      VTFIRQYLQ-------DSGKEEE------LIPGNIG-L--TDI-NIESQIARYN------
A0A5M5NLR3      VTFIRQYLQ-------DSGKEGE------LIPGNIG-L--TDI-NIESQIARYN------
A0A0D5BSQ0      AEMMRSYLG-------SRDQKNA------LIPNSTG-L--VDA-NVETQITEYN------
A0A1T3F6P5      AEMMRSYLT-------NRGKQNN------LIPNNTG-L--VDS-GVEGQIAEYN------
A0A0W8EPA0      AEMMRSYLT-------NKGKQNN------LIPNNTG-L--VDS-GVEGQIAEYN------
A0A365UKN1      AEMMRSYLN-------NRGKQNN------LIPNNTG-L--VDS-GVEGQIAEYN------
A0A4R6WE41      VEMMRDYLT-------ADGKSKE------LIPNNTG-L--VDA-NVEGQIVEYN------
A0A2T5RP38      AEMMRSYLN-------NKN-RNE------LIPNNTG-L--VDA-SVESQIAEYN------
A0A1A6CF06      AEMMHSYLN-------NKNKRNA------LIPNNTG-L--VDT-GVESQIADYN------
A0A1T3D6S8      AEMMHSYLT-------NKNKRNA------LIPNNTG-L--VDT-GVESQIAEYN------
A0A1P8E011      AQMMRGYLS-------DGSKKNE------LIPNNTG-L--VDA-SVETQINDYN------
A0A1V3N3U3      TQLMQRQLH-------DANKRNE------LIPNNTG-L--VDG-GVEAQITEYN------
C2FUH6          VDMMRSHLD-------NKTKRNE------LIPSNTG-L--VEA-NIENQITDYN------
A0A0B8T471      VELMRQRID-------NTESRND------LIPSNTG-L--VED-NIEAQITEYN------
A0A4R7D2K0      VELMRQRIE-------NDVDRND------LIPSNTG-L--VED-NIESQITEYN------
A0A2X2J8S4      AEMMSDYLS-------KSDKQTA------LIPNNTG-L--IDG-NIEGQIQAYN------
A0A3C0S618      AEMMSDYLS-------KSDKQTA------LIPNNTG-L--IDG-NIEGQIQAYN------
A0A4P7DRF9      VEIMRQRLN-------DPARARD------LIPSNTG-L--VDG-NIESIISEYN------
A0A239XXC4      VEIMRQRLS-------DPSRVDD------LIPSNTG-L--VDN-NIEGIISEYN------
A0A4U9K473      VEIMRQRLS-------DPSRVDD------LIPSNTG-L--VDG-SIEEIIAEYN------
A0A3D4RLG4      -----------------MHKYKA------TSKICRKKN--WRW-SLSNAITEL-------
A0A3N2LCI3      ----------------------K------MLPMNSGVA---NV-DIQSQITDYN------
A0A1H6Z2F8      VKLLEGHL---------RAKPSA------AIPSALYPQ---EG-NFEALIGKYN------
A0A2P8G5K0      VRLLEAHL---------LEKPAA------AIPSALYPQ---EG-TFEALAGKYN------
A0A519SYE7      LDDVQQMVARGQLTRSENETVAN------NLPGLTELN---DP-LLAGMLNELD------
A0A5Q4EKA0      LTEIAKSL--------EQDNEVD------IYRLIAILA---GS-EFSGMVSRML------
A0A3D4CJE1      LKEI----QNKAKNANDNMQVYD------LLSILAGTD--YES-TINGLITNLQ------
A0A4Q5ZQ60      --------------------VES------FLPSLSLVN---DQ-MLGEQMKALV------
A0A519Q885      LDEVGALAEQERLTVRENQTVTQ------NIPGLVDLS---DP-VLVQLLEQLN------
A0A519TAP8      LSDINGLMNRDQLTRNEDETVAD------NLPGLTELE---DP-VLVGLLDLLD------
A0A2K8ZAP1      --------------------------------------------NIETIRQQLI------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A641LIG3      ------------------------------------------------------------
A0A641LPE6      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A3M1Y2F5      --------------ELVSERAELDF--SVTA---DNPNIDRINLEISRVKSSLLENINNR
A0A1G1TG88      --------------GMQWDQERVRR--SYTG---ATEAVQQKNAQMDYTLSSILRQITQA
A0A661XXA6      --------------LLINDREKLGL--SYRE---NTYTYKARQKEIDLLKSDLLGQIENA
A0A2T2UAJ4      --------------RRGLAQSRIEL-----------------------------------
A0A519SD85      --------------DLVIKRNHLLK--QYTI---SSKFVTDIDQEIEIFRNSITNNLLLQ
A0A4Q3SEI4      --------------ESEMQYEKLKK--TIPG---GNPTMYTLKTQIENLRPAILESIQNQ
A0A3M1TXY5      --------------RLKQERAAIRL--TAKE---RSPKVQNIDAKINNVRQAILKNVNTS
A0A2E0VQ27      --------------SYEEQRQDYLQ--KYTL---QHPLILNLDQKIKETRAFLNESVNST
R6U429          --------------QLVLSRDRLVS--GSSS---ENPLVLDYNNSIAALKIAINRSIENL
R5DEG6          --------------EMLLKRDKLIS--NSSS---KNPVVQDLNNSLIAMKQTIIRSVDNL
A0A5C8AF42      --------------DLLEKKEDLLY--RVTD---ENSEVKALNSKIQTKLNSIRKSVAAI
A0A642EJV3      --------------KQLLQRNSLVA--NSST---ENPLVVDMDQALASMRGAIIRSIDNQ
A0A161LWY6      --------------ETIRKLLQTTP---------QNPFYAKYQEELNKLKGSLTDALRNV
A0A212J9Z9      --------------ELLQKARNLGA---------KNPLYNKTIDELNDLRVKILQEIQVS
F5IV23          --------------ELLQKARNLGA---------KNPLYNKTIDELNDLRVKILQEIQVS
F8X2T0          --------------QELRKSKNLGP---------KSPIYMTAINKLNESRVQILRELQLI
A0A1M3LAG1      --------------QELRKSKNLGP---------KSPIYMTAINKLNESRVQILRELQLI
A0A212K6G4      --------------QELRKSKNLGP---------KSPIYMTAINKLNESRVQILRELQLI
A0A4Y9IPG7      --------------QELRKSKNLGP---------KSPIYMTAINKLNESRVQILRELQLI
A0A2V3PNY7      --------------NLVNKLSSMGS---------AHPMYAKSEQSLTNLRINILEELRAL
A0A1M5DFS8      --------------KIVKKLASMGE---------AHPLYAKSEQSMNNLRIKILEDLRNA
A0A4Y8KZS5      --------------NIIKKLASMGE---------AHPLYSKSEQSMNSLRIKILEDLRTA
A0A239K409      --------------ELQLERERLLR--TTEK---INPIILSIDQQLQSLRVNILENIHNI
A0A350V3E4      --------------RLEIQRDLAKT--GNDELVKNSKSLKDINNKVAELKRSLDEKLNIL
A0A1M6MYT6      --------------DLINERLSQTS-IRQNS---EHPTIVRLNAQIASVKNSLRENVDNI
A0A2P8CDS1      --------------QLNIEKTTLSA-TVKDP---DHPRMRQLNIQMETTKRTLLENSRNI
A0A5M4A2I9      --------------QLNIEKTTLSA-TVKDP---DHPRMRQLNIQMETTKRTLLENSRNI
A0A353WYK7      --------------ELKKEMNILKG--AYKT---NTFAYRKKKEEINFLRERIIGYVEES
A0A355BP94      --------------KLVRGKERLAL--SYKD---NTFAYQQKDQELNAARTALFTQLAEI
A0A136LSC7      --------------KKTRERDKLAL--AYNE---NTFAFRQKEREVSLVKDELFNQLSTL
A0A5C7N8Q5      --------------KQARERDKLGL--AYNE---NTFAFRQKQKEVTLLKDELFSQLSTL
A0A1V5S1J9      --------------EMQLKRKEIGV---------KSPLYAKYTRDIDAVKAQMYEALKNI
A0A0A2EYC8      --------------ELQIKLLDLGV---------KNPQYDIVFNQISQTKAQLNELISSV
A0A2G6H6Y4      --------------ELQLQLIDLGV---------KNPQYEIVIAQIEQIKKQLKELIASV
A0A1M3DPL8      --------------DLLLKRSELTE---------KNIFHSKYTREIDNLKTAINEVIKNT
A0A1V5F519      --------------ELYLQRSELTE---------KNLYYAKYTKAIENVKTSIFELIKNM
A0A2G6R1T9      --------------ELLEERNSTSR---------KNPVYKKLTREINNIKASINEAIKSM
A0A2W4RDE8      --------------KLNQERSGLNY--SARE---GNPLAQVIELKITNLKASITENVSNI
A0A0L8VEV2      --------------DLYRQREVFSY--TVQE---KNPKLILVNNQIEMVKRNLQENLKNL
A0A1I2A9Z9      --------------DLYRQREVISY--TAQE---KNPKLILIGNEIEMVKRNLRENLKNL
A0A142HHS5      --------------ALQQNLRRIRR--SYQD---RLEAVQGPLAQLKFAQATLQHQLVQA
A0A660LQT8      --------------SNVLQRNRLVM--NSST---SSPLIADLEDRISKQRQVIGVSINNW
A0A350PNH9      --------------KQQLERNNLVA--NSSE---QNPLVADYDQSLASMRHSIVTSIDNF
A0A354LNT9      --------------KQQLERNNLVA--NSSE---QNPLVADYDQSLASMRHSIVTSIDNF
A0A2M6GH67      --------------SLQRSYKILLL--SYKK---TTQTVKIREEEMRLTKEAVTELLQQN
A0A389LWV6      --------------------DIFFEIKGLGS---ENPIYKRYKLQLTDIKSSINQSIVSM
A0A1G9B1T9      --------------ELNQQRAQLKT--SVRQ---SLPAIEELDAKVKSIRAQLHENVNNL
A0A3D0FMX4      --------------DLQIKRAELSE---------KNIYYDKYTTDMQNIKVAILEVLSSM
A0A1M3MEI8      --------------ELIMKRAELPE---------KSMFHSKYTREIETVKNAINEMVRNM
A0A1J5HQM0      --------------DLNLKRSELSE---------KNMYYAKYTRDIDHIKVAINEVTKNM
A0A653AC35      --------------DAVTLRNETTE---------KNPLYSKYNREVEALRTSINEVLKNM
E4T131          --------------DLYNQRSDLTE---------ANPYYAKFTKQIETSKLTILEVIKSM
A0A521H707      --------------ALEDQKTTLKF--LATE---HNAAVISLEKDIAFQRSNLILSLNNA
A0A1F3D6P8      --------------LLYSQRSGIAS--NNAE---KNLFLGQIDNKIKVQKQAIIETVTNN
A0A356Z058      --------------LLYSQRSGIAS--NNAE---KNLFLGQIDNKIKVQKQAIIETVTNN
A0A3D1BT36      --------------DLNSQRSAILS--NNVQ---KSLFLEQIENKINLQKQTIIENVKNN
A0A352ME00      --------------DLNAQRSTIIA-GSNPQ---KNIFIGQIDSKIDFQKQIILENFTNN
A0A3D3HL11      --------------QSSAERANILS--NNAE---KNLFLGQIENKIRLLKQAIIENVKNN
A0A5R9QZP0      --------------ELNAERSAILS--SKAE---KSLFLGQIENNIRLQKQSIVENVKNN
A0A2W7RD29      --------------NLQNEKSNQLV--TLTD---SSPIVIEQQKRIVISKKNTLELVKSA
A0A3N2NDY8      --------------NLLLTRNTLAA--SSSD---TNPLVVDYDGQIKGLREAIVNAINGQ
D7JEV9          --------------ELQIKLLDLGV---------KNPQYDVVISQIRQIKTQLNELINSV
A0A4R6H3B7      --------------DLYRQREVISY--TAQE---KNPKLILIGNEIEMVKRNLRENLKNL
A0A2W7QSQ0      --------------TLQRDKQRIIR--IVQP---NNPQLLSLNDQIVNVKSNILANISSI
R7F6L5          --------------QQVIERNRLLK--TTGA---NNPQVVEKDEALRTMKRNIQHTAATY
A0A553GA49      --------------GLVGRKQHLLE--NKQA---KSPQLRELTFQISNLKNTILVNLQYE
A0A497D6F6      --------------NLSIEKSSM-T-SVKNT---EHPKLKRLNAQIENAKSNLLENVNNI
A0A5M4AAB9      --------------QLNIELSTLAA-TVHDP---EYPRMRQLRIQMETTKRTLLENSRSI
F4KR18          --------------DLVMERERFLT-KGQTS---N-PVVQSNNQKLKSLQSSINLAIDHM
C9LKL0          --------------TMMIERNSTEK--NSSP---NSPLVKDLDSKLTTMRNTILSSVRSY
A0A3D0QPV7      --------------VLILTKEKEKF--SSTS---KSTYMKSLDYQIDIQLKMINQAITSL
A0A496KT23      --------------TRLLERNRLLA--TSSA---QNPAVMDLETQLGSIRRGIIQSLDNE
L1M9T3          --------------SKLLERNRLLA--TSSA---QNPAVMDLETQLGSIRRGIIQSLDNE
A0A3C0I8F1      --------------ALFSEIASISY--YKTD---NNATLKVKRTQLIKYQKELRAQINEA
R5JJI4          --------------DMLLKRDKLVA--GSSN---KNPIVIDLNNSLGAMKQTIIRSVDNL
A0A3D2HF71      --------------QLQKQKKQLSL--NLLE---STGPLRVLEGNIANTRIAISNNIADG
A0A0A2DQN2      --------------QIKQERDLWMQATGASQ---DNPIVERYNQSMHVARAAVARALKDA
A0A0A2F2N5      --------------QVKPEYDRWLATTGGME---DHPMVQKYAKAMEQTRMSISHTLEGY
L1NGW4          --------------QLKGDRDRLVKASEGST---ENPVIAEYDRGLAQIRQNAISSLNQY
Z4WRA0          --------------QLKGDRDRLVKASEGST---ENPVIAEYDRGLAQIRQNAISSLNQY
U2K8K9          --------------QLKFQRDKLVESSGGST---QNPVIAEYDATLDQLRKSATEILNQQ
A0A069ZM60      --------------QLKSQRDKLVEGAGGST---ENPVITEYDNALSQLRKNAIESLNQQ
J6GV98          --------------QLKSQRDKLVEGAGGST---ENPVITEYDNALSQLRKNAIESLNQQ
A0A134B4F8      --------------QLKSQRDKLVEGAGGST---ENPVITEYDNALSQLRKNAIESLNQQ
A0A134B8C7      --------------QLKSQRDKLVEGAGGST---ENPVITEYDNALSQLRKNAIESLNQQ
A0A4Z0EKR0      --------------ELQQERKRMLR--TTEP---SNPIVQNINEQLASLRISILENLRNI
A0A229I3A5      --------------KSQLERNNIVA--NSSE---QNPLVADYDQSLTSMRKSISASLDNF
A0A3R6HJB3      --------------KSQLERNNIVA--NSSE---QNPLVADYDQSLTSMRKSISASLDNF
B5CTK0          --------------AMLLKRDKLID--SSSD---KNPVVVNLNNSLSALKQTIIRSIDNT
A0A1M6B6D5      --------------SLAEQRNKLQY--SFKE---DAPVFNDIDRQIDAVKIVLLENIRSS
A0A451FS66      --------------ALAQERNKLQY--SFKE---GAPVFNDIDRQINAVKSVLLENIRSS
A0A2E3GN39      --------------KLEYEKESALM--QVTP---EHPTVVLIERNLDKARATLIAQVEIN
A0A3D1MEL0      --------------NLEYEKESALM--QVTP---EHPTVVLIERNLDKARATLIAQVEIN
F0R0C9          --------------TMQLQRNNLVA--NSSE---QNPLVKDLDQSLASMRRAIITSVDNL
A0A2A4N9A6      LPKEAYVTIIGQLRELELQKKFLAQ--HETE---LGPNTKLINGQIKANKKILLYSIK-A
A0A368D1N7      --------------KLEYEKESALM--QVTP---EHPTVVLIERNLDKARATLIAQVEIN
A0A3B8TU58      --------------NLEAEKEKALM--QVTP---EHPAIVLIERNLDKARVTLVAQVRIN
A0A1T5IIR6      --------------DLVLQRDRLVA--ASST---TSPAVLKLENTLGSLRSNILGMISNL
A0A3E0QD27      --------------ELEDKRSNLRF--IATD---KNAAVISLEQDIDFQKKNLVMSIQNA
A0A0M1W1I6      --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
A0A4R4GHU2      --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
I8WPR6          --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
A0A0K2HKS3      --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
B6W3W8          --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
A0A4R4GSI6      --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
A0A076IRY8      --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
A0A3A6AD54      --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
A0A3A6MIU7      --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
I8WPP8          --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
A0A372Y7D2      --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
A0A3E4JJC9      --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
A0A3E4WDQ0      --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
A0A414H9P2      --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
C3R5A8          --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
A0A1C5XJA7      --------------AAKLKRDRLIS--DSSD---KNPVVEELNSSLRAMKQSIIRAVDNM
A0A3E5BU42      --------------ALKLKRDKLIA--DSSE---SNPVVEELNNAIHALRQSIIRAVDNM
R7CUW4          --------------TAKLKRDRLIS--DSSE---KNPVVEELNNSLRAMKQTIIRAVDNM
A0A416GGJ1      --------------ELKLRRDKLID--DSSD---KNPVVEEMNNSLRAMKQNIVRAVDNL
D1JY72          --------------ANKLKRDKLIE--GSSD---KNPIVQELNKNLIAMRQNIIRAIDNM
D7J4K6          --------------ALKLKRDKLIA--DSSE---SNPVVEELNNSIHALRQSIIRAVDNM
Q8ABP9          --------------ALKLKRDKLIA--DSSE---SNPVVEELNNSIHALRQSIIRAVDNM
A0A5M6AHF7      --------------ALKLKRDKLIA--DSSE---SNPVVEELNNSIHALRQSIIRAVDNM
D6D2Z5          --------------ALKLKRDKLIA--DSSE---SNPVVEELNNSIHALRQSIIRAVDNM
A0A1T3EDR4      --------------SFFLKRNRLME--GGNN---KNPVVRDLDASLVSLRQEIQRSLDHS
A0A174SDD8      --------------ETLLRRNRLMN--GSSS---NNPVVQELNRTMQTMKQNIYRALDNL
A0A1H7RFH3      --------------ETLLRRNRLMN--GSSS---NNPVVQELNRTTQTMKLNIYRALDNL
A0A139L1N2      --------------ETLLRRNRLMN--GSSS---NNPVVQELNRTMQTMKLNIYRALDNL
A0A174TVL8      --------------ETLLRRNRLMN--GSSS---NNPVVQELNRTMQTMKLNIYRALDNL
A0A1H8BJR6      --------------ETLLRRNRLMN--GSSS---NNPVVQELNRTMQTMKLNIYRALDNL
R9H6G0          --------------ETLLRRNRLMN--GSSS---NNPVVQELNRTMQTMKLNIYRALDNL
A0A412GR09      --------------ETLLRRNRLMN--GSSS---NNPVVQELNRTMQTMKLNIYRALDNL
A0A4Q5DX00      --------------ETLLRRNRLMN--GSSS---NNPVVQELNRTMQTMKLNIYRALDNL
A0A081PBV5      --------------TASLRRNRLLE--GSSS---ENPIVQDLNITLAAMRKNIYRAMENA
A0A1I2AN85      --------------TASLRRNRLLE--GSSS---ENPIVQDLNITLAAMRKNIYRAMENA
A0A4U0GMP3      --------------VALLKRNRLVE--GGSF---SNPIIQDLDNALQAMRKNIDRSIENT
A0A1H6CKR6      --------------TLLLRRNRLTA--GNSS---ENPIVQDLNTALNALRDNISRAVDNV
A0A235E1C0      --------------TLLLRRNRLMS--GNSS---ENPIVQDLNNALSQVRQNIARAIDNV
R6D982          --------------EALLRRNRLRS--GSGG---NHPVVQELTRSVETMRQNINRSINNQ
A0A1F0I8C4      --------------ETLLRRNRLVS--GSSS---NNPVVQELDRSMQTMRQNIFRALDNL
A0A3A5RIJ2      --------------ETLLRRNRLVS--GSSS---NNPVVQELDRSMQTMRQNIFRALDNL
A0A515IZJ5      --------------ETLLRRNRLVS--GSSS---NNPVVQELDRSMQTMRQNIFRALDNL
A0A5M5NLR3      --------------ETLLRRNRLVS--GSSS---NNPVVQELDRSMQTMKQNIFRALDNL
A0A0D5BSQ0      --------------TALLKRNRLAE--GGNT---SNPVVLDLDEALKAMRNNIGRAVDNT
A0A1T3F6P5      --------------KALLKRNRLAE--GGNT---ANPVVLDLDDALAAMRTNIGRAVDNA
A0A0W8EPA0      --------------KALLKRNRLAE--GGNS---SNPVVLDLDDALGAMRTNISRAVDNA
A0A365UKN1      --------------KALLKRNRLAE--GGNS---SNPVVLDLDDALAAMRTNISRAVDNA
A0A4R6WE41      --------------KALLRRNRLEE--GSSM---ANPVVQELDQGLDAMHTNILRAINNT
A0A2T5RP38      --------------MALLKRNRLAE--GGNT---LNPVVVDLDEALKSMRNNINRAVDNA
A0A1A6CF06      --------------TALLKRNRLAE--GGNS---ANPVVLDMDEALNSMRNNISRAVDNA
A0A1T3D6S8      --------------TALLKRNRLAE--GGNS---ANPVVLDMDESLNAMRNNISRAVDNA
A0A1P8E011      --------------TTLLRRNRLIE--GSSD---ANPVVQDLDRALQAMRGNIGRAVDNA
A0A1V3N3U3      --------------RALLRKNRLVE--GSST---ANPVVQDLDKALAAMHENISSAVDNA
C2FUH6          --------------TTLLRRNRLVE--GSST---ENPIVQDLDKALGAMRGNIDRAVENA
A0A0B8T471      --------------EVLLKRNRLVG--GDNS---ANPIVKDMDAALRAIRDNISRSVDNA
A0A4R7D2K0      --------------EVLLKRNRLVS--GDNS---ENPIVKDMDAALRAIRDNISRSVDNA
A0A2X2J8S4      --------------TLQIRKNKLME--DGNS---ENPIVKEIDKSLNTMRSGIERTLGNT
A0A3C0S618      --------------TLQIRKNKLME--DGNS---ENPIVKEIDKSLNTMRSGIERTLGNT
A0A4P7DRF9      --------------SVLLKRNRLQA--GENS---NNPIVQDMDNALVAMRENIVRAVDNV
A0A239XXC4      --------------TLLLRRNRLMS--GNSS---ENPIVQDLNNALSQVRQNIARAIDNV
A0A4U9K473      --------------TLLLRRNRLMS--GNSS---ENPIVQDLNNALTQVRQNIARAIDNV
A0A3D4RLG4      ----------------------MTT--TXTQ---KNVYYAKYTKDIENVKTAINEVVGSM
A0A3N2LCI3      --------------NLVLQRNSLLA--KSSD---KNPLVVQLNEQMDQMRHAILASVDNS
A0A1H6Z2F8      --------------EMELSRTRALA--SLAP---GHPDIRSIEKQMEVLRTNLFDAIQNQ
A0A2P8G5K0      --------------EMQMARIMALA--TLAP---EHPQLRSLEKQIEVLRNNLLDAIGLQ
A0A519SYE7      --------------EQQRSLRLTLL--SQTN---KTFAVQRDQADIQETRAALERQLSRD
A0A5Q4EKA0      --------------QNLQDL---LI--EREQ---LLYQVTPESSQIQ----ALNHQINIQ
A0A3D4CJE1      --------------RLLDKKQQLQN--EVTP---DSEILKTLNLQIEAQRDLIIESLRSL
A0A4Q5ZQ60      --------------ELQKQHALLMG--SAKK---ATFAVKSKEEEITFVKNNIAESVKKN
A0A519Q885      --------------KEQINLARVKR--SYKE---STFAVEDQEANIIITRQAVRKQLIQA
A0A519TAP8      --------------SQQRSLRLTLK--SQTD---KTFAVQRNQAVIRDTRELLQR-----
A0A2K8ZAP1      ------------------------------------------------------------
A0A2T4XEQ1      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A641LIG3      ------------------------------------------------------------
A0A641LPE6      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A3M1Y2F5      VSSTE-------------------------FELESV-EDQIRTANGRLSRLPRNE-----
A0A1G1TG88      RKALA-------------------------NRIALL-DRQQNKLDAKQQGLPSRA-----
A0A661XXA6      KENTI-------------------------EDESDL-VNQKIQLNQQLKKLPSKS-----
A0A2T2UAJ4      -NGLQ-------------------------ARLDVL-NERLRENRQKLEQIPTQS-----
A0A519SD85      HKLLT-------------------------EKGNLI-RKTSDSIQRKLSQLPNKE-----
A0A4Q3SEI4      RASLN-------------------------ANRSKL-GAGTGMYTSILKGIPKKE-----
A0A3M1TXY5      IRANN-------------------------IAISNV-NERIEALRTRLRRLPESE-----
A0A2E0VQ27      LENLQ-------------------------QKTLEL-ESQIAEVNQKVERFPEKE-----
R6U429          ISTLK-------------------------LQADKV-AAEETNIMNKISNTSGQE-----
R5DEG6          IVGLN-------------------------IKIKNI-RAQEEQTSRRISAVPTQQ-----
A0A5C8AF42      LERLY-------------------------ANSRSV-QGKIQGFESEFFELPEKK-----
A0A642EJV3      IVTLN-------------------------SQIKSL-RQTEQQTTSRIAANPTQA-----
A0A161LWY6      RAAFS-------------------------IEKKDI-DTQSRKASGQLATLPDIE-----
A0A212J9Z9      QINLQ-------------------------NQKDAL-VRKYEVLQLKIDNLPPQE-----
F5IV23          QINLQ-------------------------NQKDAL-VRKYEVLQLKIDNLPPQE-----
F8X2T0          QVKLQ-------------------------DQKDLL-VKKYQNLDLKLDNLPPQE-----
A0A1M3LAG1      QVKLQ-------------------------DQKDLL-VKKYQNLDLKLDNLPPQE-----
A0A212K6G4      QVKLQ-------------------------DQKDLL-VKKYQNLDLKLDNLPPQE-----
A0A4Y9IPG7      QVKLQ-------------------------DQKDLL-VKKYQNLDLKLDNLPPQE-----
A0A2V3PNY7      QDRVQ-------------------------NKKESL-DNNTKEIEDKMATLPAQE-----
A0A1M5DFS8      QDKVQ-------------------------EKKENL-NSRLASVESEMSTLPAQE-----
A0A4Y8KZS5      QDKIQ-------------------------EKKELL-NASLSSVETEMTTLPAQE-----
A0A239K409      KGGLV-------------------------LTRRNL-KDRTNLYDAKINSVPLVE-----
A0A350V3E4      KEGANSNSPEEMRSLTSKYFETKVLNNQNKIKESLL-RGYLNKYQEKFNKLPAQS-----
A0A1M6MYT6      ISQSD-------------------------MALENL-NQRIRQFEAQVRRLPATE-----
A0A2P8CDS1      MHQSE-------------------------ITLNDL-TKRIDNLQQRTRNLPSVE-----
A0A5M4A2I9      MHQSE-------------------------ITLNDL-TKRIDNLQQRTRNLPSVE-----
A0A353WYK7      RKGIY-------------------------DKLDEI-NLKKNRLETDFSSLPSKS-----
A0A355BP94      KKQWL-------------------------GAMLEL-NQKKESLEKKFASMPDKS-----
A0A136LSC7      KKEWL-------------------------ADMAEL-GKRKEKLERAFAEMPDKN-----
A0A5C7N8Q5      KKDWL-------------------------ADMAEL-GRRKEKLEREFAEMPDKN-----
A0A1V5S1J9      RVGLD-------------------------IQKADM-QNRLQKLSAGMQELPYKE-----
A0A0A2EYC8      SDIYK-------------------------IESDAY-QKDLNELNNLLIAAPNKE-----
A0A2G6H6Y4      SDVYS-------------------------IETDLY-KKDLNTLKSELVEAPSKE-----
A0A1M3DPL8      KASIN-------------------------IQKDDL-NTRLASVQKQIETLPEQE-----
A0A1V5F519      RASLE-------------------------IEKNEV-NRLLADVNSQIAELPKKE-----
A0A2G6R1T9      RKSIQ-------------------------IEKQDI-DSKIAAVRSKMNMLPKKE-----
A0A2W4RDE8      IDATN-------------------------IALNDL-NQRIARLNAQLERLPRNE-----
A0A0L8VEV2      INNAI-------------------------VQIQGL-DRRVDQVNRQLSAHPKTE-----
A0A1I2A9Z9      INNAI-------------------------IQVQGL-DRRIEKVNQQLTAYPKTE-----
A0A142HHS5      QKQLR-------------------------GQIALL-DTQQGKLSNELQLIPGKE-----
A0A660LQT8      LLTLQ-------------------------NQVKSL-TSQEGTLTSKMAQAPNQA-----
A0A350PNH9      VVTLN-------------------------SQLGNL-QANEAQTTSQIASNPSQA-----
A0A354LNT9      VVTLN-------------------------SQLGNL-QANEAQTTSQIASNPSQA-----
A0A2M6GH67      IDLLQ-------------------------NQTATL-TRDINAIEAELKQMPARV-----
A0A389LWV6      KNSIG-------------------------IEEADL-NQRYSKLSAEVASLPDKE-----
A0A1G9B1T9      IATTK-------------------------YKIESV-ENQIEELDSQINLLPKNE-----
A0A3D0FMX4      RASMD-------------------------IEKKDL-ELRFSEVRAGINALPEKE-----
A0A1M3MEI8      QVSMD-------------------------IQKKDL-NRRYAEVQQEINQLPAKE-----
A0A1J5HQM0      RASLE-------------------------IEKNDL-KEKNDKVNKEIEQLPSKE-----
A0A653AC35      KTSLA-------------------------LDKEDL-NKKLYAVKQQITALPQKE-----
E4T131          RASLE-------------------------IEKSDF-NKRLSVVNKQIEELPEKE-----
A0A521H707      REALI-------------------------QKIKSL-DERMNEFEQIFLTLPAQE-----
A0A1F3D6P8      LNTLN-------------------------LSLNEL-NYRADKLSREISQLPRTE-----
A0A356Z058      LNTLN-------------------------LSLNEL-NYRADKLSREISQLPRTE-----
A0A3D1BT36      LNTLS-------------------------LTLNEL-DYRAEKLSSQIARLPRTE-----
A0A352ME00      LNTLT-------------------------LSLNEL-DYRQNKLSKEASSLPRTE-----
A0A3D3HL11      LNTLN-------------------------LTQNEL-DYRESKLSGEISRLPRTE-----
A0A5R9QZP0      LNALN-------------------------LKINEL-NYRRNKLSREISRLPKTE-----
A0A2W7RD29      ISNID-------------------------ISIDDL-NYRISEISKDFRKLPFTE-----
A0A3N2NDY8      IVALN-------------------------KSLRNM-EGAKGAAESQLASGSTQA-----
D7JEV9          SDVYK-------------------------IEKSSY-QSDLSALNKLLVEAPNKE-----
A0A4R6H3B7      INNAI-------------------------IQVQGL-DRRIEKVNQQLTAYPKTE-----
A0A2W7QSQ0      KSNLL-------------------------ISKRNF-ETTLNENSYKAQSIPGIE-----
R7F6L5          ATSLN-------------------------TRLSGV-RSQESVTNSRLATAPRQA-----
A0A553GA49      LDASR-------------------------LALQQI-RSKISTLNVELNRLPETQ-----
A0A497D6F6      ISQSE-------------------------LALTDV-KNRLWRYERRIQTLPETE-----
A0A5M4AAB9      MHQSE-------------------------LTLQDI-SKRTDSLRKQTRSLPAVE-----
F4KR18          QDDLN-------------------------MQQNKL-KYHYDQSSNHLRSVPSKE-----
C9LKL0          VKTLE-------------------------MRAKSA-RSNESVINGEVSRAPGLE-----
A0A3D0QPV7      KNQFS-------------------------KRKGSL-KDKIRQYETIYYGLPEKE-----
A0A496KT23      LDMLK-------------------------TQQRVT-ESSHSEATSKISANPRQA-----
L1M9T3          LDMLK-------------------------TQQRAT-EASHSEATSRISANPRQA-----
A0A3C0I8F1      QRMLN-------------------------KEIGAL-QSKFSRAQGEFLKIPSKE-----
R5JJI4          IVGLN-------------------------IQLKNI-REQEEQTTKRIEAVPTQQ-----
A0A3D2HF71      LANIE-------------------------KSISEA-DKRLNEVEREIMKLPSTE-----
A0A0A2DQN2      AAAIS-------------------------IKLKEM-RYQDNQAYAELVTLPPKE-----
A0A0A2F2N5      IKSLD-------------------------LQLREI-EIRNRQGLAEMMAVPNKQ-----
L1NGW4          ANVLR-------------------------VRLKDA-QGTQSSLLSQLPDVSNKG-----
Z4WRA0          ANVLR-------------------------VRLKDA-QGTQSSLLSQLPDVSNKG-----
U2K8K9          ASALR-------------------------ARLKSV-ERDQSALFSKLPGVTEEG-----
A0A069ZM60      AAVLR-------------------------MRLKDI-QGQQSSLLSKLPEVSNQG-----
J6GV98          AAVLR-------------------------MRLKDT-QGQQSSLLSKLPEVSNQG-----
A0A134B4F8      AAVLR-------------------------MRLKDA-QGQQSSLLSKLPEVSNQG-----
A0A134B8C7      AAVLR-------------------------MRLKDA-QGQQSSLLSKLPEVSNQG-----
A0A4Z0EKR0      KKGLQ-------------------------ITSNSL-KASSGQFQSKIKKVPGME-----
A0A229I3A5      VVTLK-------------------------TQLGTL-QANEAATTSQIASNPNQA-----
A0A3R6HJB3      VVTLK-------------------------TQLGTL-QANEAATTSQIASNPNQA-----
B5CTK0          IVALN-------------------------VKLKNL-QAQEARTASRIAAVPTHQ-----
A0A1M6B6D5      KSLMN-------------------------EEIRTI-NRDIGRYEAEIRKLPKEQ-----
A0A451FS66      RSLKA-------------------------DEINSI-NQDIGRYESEIRKLPKEQ-----
A0A2E3GN39      IDKFQ-------------------------QEKDAV-VAEINKLLEELDLLPLFE-----
A0A3D1MEL0      IDKNQ-------------------------QERDAV-VAEINKMLEELDLLPLFE-----
F0R0C9          MVTLD-------------------------TRIRSL-QRSEQQTTERLAANPSQA-----
A0A2A4N9A6      IRATL-------------------------FAQLAL-IDKAVRQKQKLDSEVNFD-----
A0A368D1N7      IDKNQ-------------------------QERDAV-VAEINKLLEELDLLPLFE-----
A0A3B8TU58      IERYQ-------------------------QERQLM-IDEINKILEELDVLPLFE-----
A0A1T5IIR6      QTSLE-------------------------IQRRDL-SDRERNAVAKFSSMPTKE-----
A0A3E0QD27      RLSIR-------------------------EKINNI-DERIREFEGNFLKLPSQE-----
A0A0M1W1I6      IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
A0A4R4GHU2      IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
I8WPR6          IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
A0A0K2HKS3      IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
B6W3W8          IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
A0A4R4GSI6      IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
A0A076IRY8      IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
A0A3A6AD54      IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
A0A3A6MIU7      IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
I8WPP8          IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
A0A372Y7D2      IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
A0A3E4JJC9      IVSID-------------------------VKLNEA-RSRAGEAQWRGTNIPRQQ-----
A0A3E4WDQ0      IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
A0A414H9P2      IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
C3R5A8          IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
A0A1C5XJA7      IVSIN-------------------------VKRNDA-QNREMRVQERLSAMPTKE-----
A0A3E5BU42      IVSIN-------------------------MKRNDA-RSRQAQAQARFTTVPTKE-----
R7CUW4          IVSLN-------------------------VKRNDA-QNREMRAQSRVTSIPTKE-----
A0A416GGJ1      IVSLN-------------------------VRRRDA-LSRETRAQVRFSSIPKKE-----
D1JY72          IVSID-------------------------VKLNEA-RSRAGEAQWRVTNIPRQQ-----
D7J4K6          IVGIN-------------------------MKRNDA-RSRQEQAQARFTTVPTKE-----
Q8ABP9          IVGIN-------------------------MKRNDA-RSRQEQAQARFTTVPTKE-----
A0A5M6AHF7      IVGIN-------------------------MKRNDA-RSRQEQAQARFTTVPTKE-----
D6D2Z5          IVGIN-------------------------MKRNDA-RSRQEQAQARFTTVPTKE-----
A0A1T3EDR4      IRGLV-------------------------QRRRQA-SALEQRALGQMLKVPSKE-----
A0A174SDD8      STTLR-------------------------LKKQDY-SLQENQVRQKVQAVPRKQ-----
A0A1H7RFH3      SASLR-------------------------LKKQDY-SLQENRVRQKVQAVPRKQ-----
A0A139L1N2      SASLR-------------------------LKKQDY-SLQENRVRQKVQAVPRKQ-----
A0A174TVL8      SASLR-------------------------LKKQDY-SLQENRVRQKVQAVPRKQ-----
A0A1H8BJR6      SASLR-------------------------LKKQDY-SLQENRVRQKVQAVPRKQ-----
R9H6G0          SASLR-------------------------LKKQDY-SLQENRVRQKVQAVPRKQ-----
A0A412GR09      SASLR-------------------------LKKQDY-SLQENRVRQKVQAVPRKQ-----
A0A4Q5DX00      SASLR-------------------------LKKQDY-SLQENRVRQKVQAVPRKQ-----
A0A081PBV5      VSGLQ-------------------------IKINNL-KKEQTQARNKAMAVPAKQ-----
A0A1I2AN85      VSGLQ-------------------------IKINNL-KKEQTQARNKAMAVPAKQ-----
A0A4U0GMP3      LAGLR-------------------------IKLRNA-QREGGAARSKVQSIPPKE-----
A0A1H6CKR6      LTGYR-------------------------IKVRNL-RQEENAAIGRARSMPAKQ-----
A0A235E1C0      ISGFR-------------------------IRMSNM-KDEENAAIGKARSLPSKQ-----
R6D982          VTSLK-------------------------LKRTEI-SGQERLARRKVRDVPGKQ-----
A0A1F0I8C4      SASLK-------------------------QKKNDY-TVQENRVRQKVQAVPRKQ-----
A0A3A5RIJ2      SASLK-------------------------QKKNDY-TVQENRVRQKVQAVPRKQ-----
A0A515IZJ5      SASLK-------------------------QKKNDY-TVQENRVRQKVQAVPRKQ-----
A0A5M5NLR3      SASLK-------------------------QKKNDY-TVQENRVRQKVQAVPRKQ-----
A0A0D5BSQ0      LRGLN-------------------------VRLNNA-KQEEATAQSKTLQIPQQE-----
A0A1T3F6P5      LRGLN-------------------------IKLNNT-RQEEGVAQSKMLQMPQKE-----
A0A0W8EPA0      VRGLN-------------------------IKLNNT-RQEESIAQGKMLQMPQKE-----
A0A365UKN1      LRGLN-------------------------VKLNNT-RQEEGIAQGKMLQMPQKE-----
A0A4R6WE41      LSGLQ-------------------------VKINNV-QREENQVKGQVMQIPGKQ-----
A0A2T5RP38      LRGLT-------------------------IKMRNA-QREEEQAIGKTLQMPKKQ-----
A0A1A6CF06      LKGLN-------------------------IKLNNA-RQEGRTAQAKVLQMPQKE-----
A0A1T3D6S8      LKGLN-------------------------IKLNNA-RQEGRTAQAKVLQMPQKE-----
A0A1P8E011      IGGLK-------------------------IKAGNM-KKEENVARGKAMQVPQKQ-----
A0A1V3N3U3      VAGLD-------------------------LKIRNA-QQEESMAKGKALQVPKKQ-----
C2FUH6          TEGLR-------------------------VKMQKA-RSEEQQARGKVIQMPQKQ-----
A0A0B8T471      AMGLR-------------------------IRIRNL-QQEEAASRAKAQSLPAKQ-----
A0A4R7D2K0      AMGLR-------------------------IRIRNL-QQEEAASRAKAQSLPAKQ-----
A0A2X2J8S4      ISGLQ-------------------------VKKNNA-VKEENRASGKSRQMPQKQ-----
A0A3C0S618      ISGLQ-------------------------VKKNNA-VKEENRASGKSRQMPQKQ-----
A0A4P7DRF9      ITGFN-------------------------IKIRNL-QQEENAAIRKAQSLPTKQ-----
A0A239XXC4      ISGFR-------------------------IRMSNM-KDEENAAIGKAKSLPSKQ-----
A0A4U9K473      ISGLR-------------------------IRMSNL-RDEENAAIGKARSLPSKQ-----
A0A3D4RLG4      RASLE-------------------------IEKKDL-QNRYKEVEKEIPNLPTKE-----
A0A3N2LCI3      INALN-------------------------MQISSL-QGSQASTTSKIASNPSQA-----
A0A1H6Z2F8      KQELA-------------------------LSISAI-HAYGKGFEAEISRLPGHQ-----
A0A2P8G5K0      IQELT-------------------------VNAAAI-RKYGKESEAEISKLPAHQ-----
A0A519SYE7      QALVR-------------------------QQLARL-DKLDATLNTRLMAMPDLA-----
A0A5Q4EKA0      RKLVV-------------------------ESITTLKNNLDARIKEILSKIESYEGILLN
A0A3D4CJE1      LDKLL-------------------------TQRNEV-AQKIKEFEQKFYNIPAKE-----
A0A4Q5ZQ60      KKLAQ-------------------------DKIASL-SNTIMQAENELLKLPSKE-----
A0A519Q885      RKLLQ-------------------------KKLGLL-GDQDSKLENKRRVLPLLA-----
A0A519TAP8      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------SNRNQL-VANNQRMEGMIRTVPGKE-----
A0A2T4XEQ1      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      ----------------------------------------------------SKE-----
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------NKIGIV-NSLSSQYNAQIKTLPSQV-----
A0A496L711      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A641LIG3      -------------------------------------------------AVPAQQ-----
A0A641LPE6      -------------------------------------------------AVPAQQ-----
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A3M1Y2F5      -------R--MLTQMGRTYESINELYSYLQKKKTEAEIALANLT-VDLMIIDPA-RYT-G
A0A1G1TG88      -------T--EQARLQRPLALAEGTYTMLMGKKVDYNIQKAGTT-ADFQILFPA-SEP-R
A0A661XXA6      -------T--EYNKVKRFYTLYEEIYLSLMQSKNEFEIAIAGST-TKIKILSPA-TMP-D
A0A2T2UAJ4      -------I--KLAQPQRERRSTEQIYSFVQEKLQEARLAEQSEI-GYAEIIRSA--AP-G
A0A519SD85      -------R--LLGELQSRFDVDRKVYNYLSEKKLEAEIARAAVI-PGAVIIDKA-DYP-E
A0A4Q3SEI4      -------R--DLLDISRQQAIKNDAYSFLLQKREEAAISYAAVV-ADSRTINHA-TAS-F
A0A3M1TXY5      -------R--ILTNIKRNFDHSSEVHKYLLQKRAETAIALATDI-ANKFVVDEAKQVG-S
A0A2E0VQ27      -------R--QLVVLQRQVALNEALYNYLMRKYTELSIMQQSDL-FPHKIIEHA-VRP-K
R6U429          -------L--QLLSIERQQKIKEELYIYLLQKREENEIASLVNV-GNTRLVMEP-AGE-D
R5DEG6          -------K--EVLSVERRQKIKEELYLYLLNKREENELTQRMTE-SNARIIDPA-AGS-N
A0A5C8AF42      -------M--EFSRLKNIQDLNEKYFTLLTEKKVLYSISDAGYA-SNNRILSRP-AVN-N
A0A642EJV3      -------K--YLLSVERQQKVKEALYLFLLQKREENELSQAFTA-YNTRIVTPP-HGS-M
A0A161LWY6      -------T--QMNSFERQFKMNDTYYTYLLQKRAEAQIQRASNV-PDNTILERA-RMI-S
A0A212J9Z9      -------R--DLIKFQREFRVNEMYHQYLTQRQYEAKIQKASNT-PDNFIWEAPRQMG-G
F5IV23          -------R--DLIKFQREFRVNEMYHQYLTQRQYEAKIQKASNT-PDNFIWEAPRQMG-G
F8X2T0          -------R--DLIKYQREYNVNEMYHQFLTQRQYEAKIQRASNT-PDNFIWEYPRMVG-G
A0A1M3LAG1      -------R--DLIKYQREYNVNEMYHQFLTQRQYEAKIQRASNT-PDNFIWEYPRMVG-G
A0A212K6G4      -------R--DLIKYQREYNVNEMYHQFLTQRQYEAKIQRASNT-PDNFIWEYPRMVG-G
A0A4Y9IPG7      -------R--DLIKYQREYNVNEMYHQFLTQRQYEAKIQRASNT-PDNFIWEYPRMVG-G
A0A2V3PNY7      -------R--EYIRYEKRYQVNDAYYTYLRQRRYEATIQKASNI-PDNFIMEAPRQKG-G
A0A1M5DFS8      -------R--EYARYEKRYQVNDAYYTYLRNKRYEATIQKASNI-PDNFVLEEPRQLG-G
A0A4Y8KZS5      -------R--EYARYEKVYKVNDAYYTYLRNKRYEATIQKASNI-PDNFVLEEPRQMG-G
A0A239K409      -------R--ELQEIDRQRGIKQQLYKYLLEKREESSLALATSA-PNSLVLRPA-IIE-G
A0A350V3E4      -------I--EYANLERERLANEKVYLMLLEKYQEALINEESQP-NNVKIIDYG-KVP-K
A0A1M6MYT6      -------R--NYVNIERKYKLNNETYIFLMQKLSEAQIAKASNI-PDSQMIEEAKMAG-T
A0A2P8CDS1      -------R--NYVNIERRYQLNNDTYTFLLQKLSEAQIAKASNM-PDNEIIDPARMEG-N
A0A5M4A2I9      -------R--NYVNIERRYQLNNDTYTFLLQKLSEAQIAKASNM-PDNEIIDPARMEG-N
A0A353WYK7      -------T--EYAKTERYYDLYEEFYLSLMKNKAQFELAQAGTV-TDFKILSSA-SLP-S
A0A355BP94      -------T--QYSKNQRFYKLYEEFYLSMMQAKAEFEIAQAGST-PDLKILSSA-ILP-G
A0A136LSC7      -------T--QFSKNQRYYKLYEEFYLTMMQSKAEFEIAQAGST-PDFKILSPA-TLP-I
A0A5C7N8Q5      -------T--QFSKNQRYYKLYEEFYLTMMQSKAEFEIAQAGST-PDFKILSPA-TLP-T
A0A1V5S1J9      -------Q--QLLNIQRKFKINDDYYTFLVQKRADAQIQKASNS-PDNIILDKA-RLA-S
A0A0A2EYC8      -------L--RMLDYERRYKINDSYYTFLLQKRSEAQIRKASNS-PDNAVMQKA-RTM-S
A0A2G6H6Y4      -------L--RMLDYQRRFRINDEYYTYLLQKRAAAEILKASNT-PDNTVLQTA-MIS-G
A0A1M3DPL8      -------L--EMVGIERNYRMNDSYYTMFLQKRAEAQILKASNT-PDNNILDRA-RTT-S
A0A1V5F519      -------L--EIIGIERNYKVNDNYYTFFLQKRAEAEIQKASNT-PDNNILDQA-RTV-S
A0A2G6R1T9      -------T--QMTALTRQYKIDDNYYNFFISKKAEAQIQKAANS-PDNEVVEQA-RVR-F
A0A2W4RDE8      -------R--ELVKIQRRYDFSDNVYNYLLEKRAEAGIAIASNV-VEKSVVDEAMMVG-S
A0A0L8VEV2      -------Q--QMMNMQRMYDLNNELYTFLLKKRAEAAITHASNV-SDTEVLDEA-RPELA
A0A1I2A9Z9      -------Q--QLMNMKRMYDLNNELYTFLLKKRAEAAITHASNV-SDTQVLDEA-RPELA
A0A142HHS5      -------T--ELERLKRPLGLYGNSYQMLLEKKVEYNIKNAGTT-ADFQILSPA-FAP-E
A0A660LQT8      -------S--YLQSISREQKVKESLYIFLLQKREENELSIAFTA-YNTRIITPP-MGS-N
A0A350PNH9      -------K--YLQTVGRQQKVKEALYLFLLQKREENELSKAFTA-YNTRIITPP-TGD-T
A0A354LNT9      -------K--YLQTVGRQQKVKEALYLFLLQKREENELSKAFTA-YNTRIITPP-TGD-T
A0A2M6GH67      -------T--EWARLQRPFENVEGAYRQLINRRLDFNIAKAGTT-ADFQILQPA-SLP-A
A0A389LWV6      -------R--KLLTHERDFKINDSYNTYLLQRRIESQIQLASNM-PDNLVLDNA-RTT-G
A0A1G9B1T9      -------Q--ELINIERKFQFSDNQYNYLLQKRTEVGIAVASNA-STKKVVEEARLDG-R
A0A3D0FMX4      -------L--EMVALERNYRIDDNYYTFFLQKRAESEIQKASNT-PDNDRLDKA-RIL-E
A0A1M3MEI8      -------L--EMIGIERRYKMNDSYYTLFLQKRAEAEILKASNT-PDNNILDRA-RVI-N
A0A1J5HQM0      -------I--EMTSIARKYKMDDNYYTFFLQKRAESEILKSSNT-PDNNILDRA-RII-A
A0A653AC35      -------M--EMVTLERKYRVDDNYYTFFLQKRAEAAIQKASNS-PDNNILDKA-RIM-G
E4T131          -------L--EQIAIQRKYKMDDNYYTFFLQKRAESEILKASNT-PDNDILDKA-RIV-G
A0A521H707      -------A--ELARLNRLYLVNEKFYQLLLEKKVEFAITKAGII-TNNIVLEQGKPAL-N
A0A1F3D6P8      -------L--NMVGLQRKFDLSDVIYTYLLQKRSEAAITMASNY-PDFEVIEPAREFT-K
A0A356Z058      -------L--NMVGLQRKFDLSDVIYTYLLQKRSEAAITMASNY-PDFEVIEPAREFT-K
A0A3D1BT36      -------L--NMVSMQRQYNITDAIYTFMLQKRSEAGIAMASNH-PDYEVLESARSIT-S
A0A352ME00      -------M--NMVSMKRKFDLNDEIYTFLLQKRSEAQISLASTR-PDYEIVEPARTIT-S
A0A3D3HL11      -------L--NMVSMQRQFNLTDQIYTFLLEKKAEAAIAMASNY-PDYEILEPARDVT-A
A0A5R9QZP0      -------L--NMVSMQRQFNITDAMYTFLLQKRSEAAISMASNY-PDYEILEPARLVT-S
A0A2W7RD29      -------Q--NLIKIEREFTLNEGIYNFLLQKRAEAAISKASNI-NNNKIIEQA-KAN-A
A0A3N2NDY8      -------K--YLLSVERQQKVKESLYLYLLQKREENELTQKFTA-DNTRIITPP-TGS-L
D7JEV9          -------L--RMLDYERRYKINDSYYTFLLQKRSEAQIRKASNS-PDNAVMQKA-RTS-Q
A0A4R6H3B7      -------Q--QLMNMKRMYDLNNELYTFLLKKRAEAAITHASNV-SDTQVLDEA-RPELA
A0A2W7QSQ0      -------R--ELVEISRNTDLKQEQYQYLLRKRDEAVLTLEVTGVSSAQMVDPP-IAS-L
R7F6L5          -------N--YLLSVERQQKVKESLYLFLLQKREENELAQAFKS-YNTQVVRQP-AGP-G
A0A553GA49      -------R--NLTTYERNFRLNDAIYTFLIQKRSEAQIAKASNL-PAFELIDYP---AFD
A0A497D6F6      -------R--NYINIERKYQLNNETYTFLLQKLTDAQIARASNV-SDSRVIEDA-HIKGI
A0A5M4AAB9      -------R--DYVNIERSYQLNNNNYNFLLQKLSEAQIAKASNT-PDNEVIDPA-RIIGD
F4KR18          -------R--GLSDRVRIQSIKENLYVYLLQKREETALALVSNY-ANALLFDPPYSSIG-
C9LKL0          -------R--RALSIGRQQNLKEALYTYLMNKREEVALQLAVND-ANVRLVEDP-LGS-N
A0A3D0QPV7      -------I--EHARMERMFAINEKYHTMLLEKKTEYEISLAGQT-TGNQILEQA-TIP-K
A0A496KT23      -------S--YLLSVERQQKVKESLYLFLLQKREENELSQAFTA-YNTQIIETP-HIT-G
L1M9T3          -------S--YLLSVERQQKVKESLYIFLLQKREENELSQAFTA-YNTQIIETP-HVT-G
A0A3C0I8F1      -------T--ELKRIKRLHTIYEAFYSQMLNKKAEIGISRSAIV-PEFVILAPA-SQP-T
R5JJI4          -------K--YVLTVERQQKIKEELYLYLLNKREENALTQAITE-SNARIIDPA-SGS-S
A0A3D2HF71      -------R--QMINIQRKFDINNTVYTFLLEKRAEAGIARASTV-SDNRIIDYAGVYS-S
A0A0A2DQN2      -------R--QWLDAERQYKMKEALYTQLLSKREENLFAQTITN-NNAYILDLG-VGT-S
A0A0A2F2N5      -------R--QWLDIERQQRMKEALYTQLLSKREENTLAQTAQS-NNAYVMDFD-TGS-N
L1NGW4          -------R--EKAEIDRKIAIRERLYTELLNKREEYALMQAMTQ-DSAYILDMN-DAP-A
Z4WRA0          -------R--EKAEIDRKIAIRERLYTELLNKREEYALMQAMTQ-DSAYILDMN-DAP-A
U2K8K9          -------R--TKADIDRRLAIQEGLYTELLSKREEYALRQSMTQ-DSAYILDMN-DAPNT
A0A069ZM60      -------R--EKADIDRRLEIRQRLYTELLNKREEYALRQAMTQ-DSAYVLDMD-DAP-S
J6GV98          -------R--EKADIDRRLEIRQRLYTELLNKREEYALRQAMTQ-DSAYVLDMD-DAP-S
A0A134B4F8      -------R--EKADIDRRLEIRQRLYTELLNKREEYALRQAMTQ-DSAYVLDMD-DAP-S
A0A134B8C7      -------R--EKADIDRRLEIRQRLYTELLNKREEYALRQAMTQ-DSAYVLDMD-DAP-S
A0A4Z0EKR0      -------R--ELLEINRQKSIKQNIYSYLLQKREEAALSLAATT-AIARVIDPA-TGG-D
A0A229I3A5      -------K--YLQTVGRQQKVKEALYLFLLQKREENELSKAFTA-YNTRIITPP-TGD-N
A0A3R6HJB3      -------K--YLQTVGRQQKVKEALYLFLLQKREENELSKAFTA-YNTRIITPP-TGD-N
B5CTK0          -------K--YILSVERQQKIKEELYLYLLNKREENALAQSITE-SNVRTIDPA-SGS-N
A0A1M6B6D5      -------Q--ELLKIERRYNLSEGTYNMFLAKRSEAGLVKAANV-SDVLVIDPAKDTG-G
A0A451FS66      -------Q--DLLNIERRYNLSEGTYNLFLAKRSEAGLVKAANV-SDVVIIDTAKDTG-G
A0A2E3GN39      -------A--EYLRLKRDYEVKSSFYNSLLDRKASFTLSRAGIV-SDYIILEMP-KIA-E
A0A3D1MEL0      -------A--EYLRLKRDYEVKSSFYNSLLDRKASFTLSRAGIV-SDYIVLEVP-KIA-E
F0R0C9          -------K--YLLSVERQQKVKEALYLFLLQKREENELSQAFTA-YNTRVITPP-TGS-M
A0A2A4N9A6      -------AAIEYLRVSTAYKMEKKYYERLLEKHANLQIHAAGII-NDVVILAEA-SVP-K
A0A368D1N7      -------A--EYLRLKRDYEVKSSFYNSLLDRKASFTLSRAGIV-SDYIILEMP-KIA-E
A0A3B8TU58      -------A--EYLRLKRDYETKAMFYNNLIERKSSFSLSKAGIV-SDYTILENP-KIA-K
A0A1T5IIR6      -------R--QMLEIQRQQSIKQELYLFLLNKREENALSQAMAD-DNIRVVDPA-VAN-L
A0A3E0QD27      -------A--ELSRLSRLFEINQKFYQLLLEKKVEFSITKAGII-SNNIVLERG-KPA-V
A0A0M1W1I6      -------Q--QMLSIERQQRIKEELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-D
A0A4R4GHU2      -------Q--QMLSIERQQRIKEELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-D
I8WPR6          -------Q--QMLSIERQQRIKEELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-D
A0A0K2HKS3      -------Q--QMLSIERQQRIKEELYLYLLNKREENALGQATTE-TDARVLDPA-GGG-D
B6W3W8          -------Q--QMLSIERQQRIKEELYLYLLNKREENALGQATTE-TDARVLDPA-GGG-D
A0A4R4GSI6      -------Q--QMLSIERQQRIKEELYLYLLNKREENALGQATTE-TDARVLDPA-GGG-D
A0A076IRY8      -------Q--QMLSIERQQRIKEELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-D
A0A3A6AD54      -------Q--QMLSIERQQRIKEELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-D
A0A3A6MIU7      -------Q--QMLSIERQQRIKEELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-D
I8WPP8          -------Q--QMLSIERQQRIKEELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-D
A0A372Y7D2      -------Q--QMLSIERQQRIKEELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-D
A0A3E4JJC9      -------Q--QMLSIERQQRIKEELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-D
A0A3E4WDQ0      -------Q--QMLSIERQQRIKEELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-D
A0A414H9P2      -------Q--QMLSIERQQRIKEELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-D
C3R5A8          -------Q--QMLSIERQQRIKEELYLYLLNKREENALSQATTE-TDARVLDPA-GGG-D
A0A1C5XJA7      -------R--QMLSIERQQKIKESLYLFLLNKREENALSQAMAD-NNARVIDSA-EAT-K
A0A3E5BU42      -------R--QMLSIERQQKIKESLYMFLLNRREENALSQAMAD-NNARTIDSV-DGP-V
R7CUW4          -------R--QMLSIERQQKIKESLYLFLLNRREENALSQAMAD-NNARIIDSA-EGG-D
A0A416GGJ1      -------R--KMLSIERQQKIKESLYMFLLNRREENALTQAMAD-NNARLIDEA-DKG-S
D1JY72          -------Q--QMLSIERQQRIKEELYLYLLNKREENALGQATTE-TDARVLDPA-GGG-D
D7J4K6          -------R--QMLSIERQQKIKEALYMFLLNRREENALSQAMAD-NNARTIDSV-DGP-A
Q8ABP9          -------R--QMLSIERQQKIKEALYMFLLNRREENALSQAMAD-NNARTIDSV-DGP-A
A0A5M6AHF7      -------R--QMLSIERQQKIKEALYMFLLNRREENALSQAMAD-NNARTIDSV-DGP-A
D6D2Z5          -------R--QMLSIERQQKIKEALYMFLLNRREENALSQAMAD-NNARTIDSV-DGP-A
A0A1T3EDR4      -------R--EQYSIYRSHAVKENLYLYLLNKREENALNAAIGE-AKLHVVDHA-VIS-H
A0A174SDD8      -------R--EMLSVERQQKVKESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-N
A0A1H7RFH3      -------R--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-N
A0A139L1N2      -------R--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-N
A0A174TVL8      -------R--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-N
A0A1H8BJR6      -------R--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-N
R9H6G0          -------R--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-N
A0A412GR09      -------R--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-N
A0A4Q5DX00      -------R--EMLSIERQQKVKESLYIFLLNKREENALSQAMVD-NNARVLDPV-SGS-N
A0A081PBV5      -------R--MMLSVERQQKVKEELYLLLLNKREENAINQAMTE-DNVRIIDPA-SGS-D
A0A1I2AN85      -------R--MMLSVERQQKVKEELYLLLLNKREENAINQAMTE-DNVRIIDPA-SGS-D
A0A4U0GMP3      -------R--VMLSVERQQKVKEELYIFLLNRREENSLNQAMTD-DNVRIIDPA-SGS-S
A0A1H6CKR6      -------R--MMLSVERQQKVKEELYIFLLNKREENAINQAMTD-DNIKVIDSA-NTS-N
A0A235E1C0      -------R--IMLSAERQQKVIEELYIFLLNKREENAINRAMTD-DNIRVIDSA-SGS-D
R6D982          -------R--EMLSVERQQKVKESLYLFLLNKREENALNQSMVD-NNARIIDSA-SGS-N
A0A1F0I8C4      -------R--EMLSVERQQKVKESLYVFLLNKREENALNQAMVD-NNARILDPV-SGS-N
A0A3A5RIJ2      -------R--EMLSVERQQKVKESLYVFLLNKREENALNQAMVD-NNARILDPV-SGS-N
A0A515IZJ5      -------R--EMLSVERQQKVKESLYVFLLNKREENALNQAMVD-NNARILDPV-SGS-N
A0A5M5NLR3      -------R--EMLSVERQQKVKESLYVFLLNKREENALNQAMVD-NNARILDPV-SGS-N
A0A0D5BSQ0      -------R--AILSIERQRKIKEELYLFLLNKREENALNEAIAE-SNLRIVDPP-TGL-D
A0A1T3F6P5      -------R--TMVSVERQRRVKEDLYMFLLNKREENALNEAVTE-ANLRIVDPP-VAT-D
A0A0W8EPA0      -------R--TMVSVERQRRVKEDLYMFLLNKREENALNEAVTE-ANLRIVDPP-VAT-D
A0A365UKN1      -------R--TMVSVERQRRVKEDLYMFLLNKREENALNEAVTE-ANLRIVDPP-VAT-D
A0A4R6WE41      -------R--MILEVERKQKVKEDLYLFLLNKREENALNQAMTE-DNIRIVDPA-YGS-E
A0A2T5RP38      -------R--AMLSVERQHKVKEELYLYLLNKREENALNEAMTD-ENIRVVDPA-SGP-D
A0A1A6CF06      -------R--TMLSIERQHKVKEELYLFLLNKREENALNEAITE-ANLRIVDPP-VGD-A
A0A1T3D6S8      -------R--TMLSIERQHKVKEELYLFLLNKREENALNEAITE-ANLRIVDPP-VGD-A
A0A1P8E011      -------R--VMLSVERQQKVKEELYLYLLNKREENAINQAMTE-DNIRVIDPA-IVS-F
A0A1V3N3U3      -------R--IMLSVERQQKVKEELYLYLLNKREENALNLAMTE-DNIRIIDRA-SVA-T
C2FUH6          -------R--IMLSVERQQKVKEELYVFLLNKREENALNKAMTD-DNIRIIDPA-SGS-D
A0A0B8T471      -------R--MMLSIERQQKVKEELYILLLNRREENALNQAMTD-DNLRVVDPP-SGS-E
A0A4R7D2K0      -------R--MMLSIERQQKVKEELYILLLNRREENALNQAMTD-DNLRVVDPP-SGS-E
A0A2X2J8S4      -------R--LVLSIERQQKVKESLYVFLLNKREENAINQAMTD-DNIKVIDPA-SGS-F
A0A3C0S618      -------R--LVLSIERQQKVKESLYVFLLNKREENAINQAMTD-DNIKVIDPA-SGS-F
A0A4P7DRF9      -------R--MMLSVERQQKVKEELYIFLLNKREENAINQAMTD-DNIRIIDSA-SGS-D
A0A239XXC4      -------R--IMLSAERQQKVIEELYIFLLNKREENAINRAMTD-DNIRVIDSA-SGS-N
A0A4U9K473      -------R--IMLSAERQQKVIEELYIFLLNKREENAINREMTD-DNIRVIDSA-SGS-D
A0A3D4RLG4      -------L--QMVAIERNYRIDDNYYTFFLQKRAETEIQKASNT-PDNAVLDKA-RTT-Y
A0A3N2LCI3      -------K--YLLSVERQQKVKESLYLFLLQKREENELSQAFTA-YNTRVVNKP-ASF-G
A0A1H6Z2F8      -------R--ALLSQSREQGIQQELYLFLLKKRMETAISRSANI-ANARVIDPP-KAS-P
A0A2P8G5K0      -------R--AFLAQSREQGIQQELYLFLLKKRVETAISRSANI-ANARVIDPP-KAS-R
A0A519SYE7      -------T--QQDRLKRPLDLYANTYSQLLNQKLNFGIQQAGTT-ANFQILSPA-YPP-G
A0A5Q4EKA0      HGGRYSLI--EYSMLQRVHTINERFYNQLVEKKAEYSISKAGYV-SQSVILERS-RVP-G
A0A3D4CJE1      -------L--EYARLERMFSIDEKFFTLLLEKRTEYSISEAGFV-PQHTILEQA-EIP-N
A0A4Q5ZQ60      -------T--DLTRLRRFYNLYEQSYLLLMEKKIQFGIAKAGTT-DNSQILSPA-SLP-T
A0A519Q885      -------T--QEARLQRPLELYSGAVRDLMQKQLEYEIQNAGTI-PDFQILSAA-ATP-D
A0A519TAP8      -------------------SLYASTYQRLVDRKMDFNIQQAGTT-PEFQILSPA-SPP-S
A0A2K8ZAP1      -------R--ALLNITRQQGIKNNLYTYLLQKREETALSAASRV-SDSRIVDPA-HTT-S
A0A2T4XEQ1      -----------------DVNIAESIYLTISRQYAETALWEQTQF-GLGRPLDYA-VAP-L
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      -------I--EYARIERVYNSNEKYYTLLLEKKTEYAISEAGFI-SENRVLRRA-STS-R
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      -------I--EYAKLERDKLAAEKLYAALESNYQESLINERTQT-IKSYVIDPG-YDD-N
A0A496L711      -----------MLDYERRYKINDSYYTFLLQKRSEAQIRKASNS-PDNAVMQKA-RTS-Q
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      -----------------------------------------------------------M
A0A2M7VVW6      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A641LIG3      -------K--YVLTVERQQKIKEELYLYLLNKREENALTQAITE-SNARIIDSA-SGS-S
A0A641LPE6      -------K--YVLTVERQQKIKEELYLYLLNKREENALTQAITE-SNARIIDAA-SGS-S
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      -------------------------------------MLTAGTT-ADFQILSAA-SAP-D
                                                                            

A0A3M1Y2F5      KESRNSRMLIMALALILAIGLPAGFLVVL-SYFSDKVSTYQELK-KATPIPV--LGTVI-
A0A1G1TG88      VPISPVRLMVYAIGLAGGLFLGLGLIAVR-YLLHNTITNTRELE-RSTQAAV--LGVIP-
A0A661XXA6      SPIKPNKTIIYMAGGVSFIVLSFIFIVIS-YLAHDKIDGIADVE-RNTAATL--LGSVP-
A0A2T2UAJ4      RPVGPDTRRNLLLGLMLGLVAGGGLVVLR-EQLDTRIYQPDDLREHGHHV----LGVVP-
A0A519SD85      EPNLPLPVTLYTSSALFGLAGGITFIFLK-RKINPFVNIAEDIL-QHTITPV--LATLRR
A0A4Q3SEI4      LPISPEKTFVYLVSIVIGLLIGFSFVIIK-ELLTHKVQFRHDIE-RLTTIPV--VAEVI-
A0A3M1TXY5      GPVSPKVGLIYAVAFVLSLGLPLAIMLVY-DFFNEKISGDQDIE-ACTNIPI--LGYI--
A0A2E0VQ27      ATVAPNKSLYYGMAFLLALLAGMFYAYLR-SYVKETVSSKDELEEKLPQYPI--IGEVYR
R6U429          MPQSPNKKMIMLIALILGAGIPFGIFFMI-NQLDTRVKTRNDLT--NMQVPF--LAEIPQ
R5DEG6          APVAPKAMMILLASVVLGCAIPAGILWLL-MVSDTKVRSRKDVE-GVLSVPF--LGEIP-
A0A5C8AF42      TPVSPNRKLIYVTFVFFGIVIGLGIMFFK-YLTFNEINMLDDLK-KLLPSRASILGGVPL
A0A642EJV3      LPTSPVHKNIFMVAFALGLLIPIVIIFMR-ENMNTRVRGRKDLE--NLTIPF--IGEIPL
A0A161LWY6      ITNGGDKKKSMMMALALGLIIPLLIIILK-EYLKTKVMDKRDIE-KLSPFPY--IGSLP-
A0A212J9Z9      AVNGGEIGKNYTYYFIIGLILPLCFVVLKEEILNFSITTKEECE-KISGFPV--IGTIEN
F5IV23          AVNGGEIGKNYTYYFIIGLILPLCFVVLKEEILNFSITTKEECE-KISGFPV--IGTIEN
F8X2T0          AMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEECE-KISGLPV--IGTIEN
A0A1M3LAG1      AMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEECE-KISGLPV--IGTIEN
A0A212K6G4      AMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEECE-KISGLPV--IGTIEN
A0A4Y9IPG7      AMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITSKEECE-KISGLPV--IGTIEN
A0A2V3PNY7      PVNGDEKRKNYTFYFFIGLGLPLLFVIAKEEIFNLVISTKEDCE-RLSGLPV--IGTIEN
A0A1M5DFS8      PVNGDEKKKTYTFYLAIGLAIPLIFVICKEELFNYAISTKEDCE-RLSGLPV--IGTIEN
A0A4Y8KZS5      PINGDEKNKTYTFYLAIGLAIPLIFVICKEELFNYAISTKEDCE-RLSSLPV--IGTIEN
A0A239K409      VPVEPKKQTVFLLAFIAGLGVPLASIFIK-NAFNRKVQQRADVE-RATTAPV--LGEV--
A0A350V3E4      APSKPNRFLIITIGLLIGLGLGYGFALLR-NILDVSVKSPEDLE--NIGISL--IGWVPT
A0A1M6MYT6      GPVEPQKRKIYALALLLALAFPTGIIILL-DLLNTKILSKDDVE-ALTDYPI--IGHVF-
A0A2P8CDS1      TPISPNNMTIYLVALLFGIFLPAGGIILK-NEFDNKVRTPEDLE-NLTKYPI--LGHII-
A0A5M4A2I9      TPISPNNMTIYLVALLFGIFLPAGGIILK-NEFDNKVRTPEDLE-NLTKYPI--LGHII-
A0A353WYK7      NPIAPNKILIWAGAIIASVILSFLFIIIR-YLLHNSVSSEKDIE-HITPTSI--LGSIPF
A0A355BP94      RPVAPNRYLILGIGLVAGLVINFFFISIV-YLLSNKITSLQEIE-RTIHVPV--LGVIP-
A0A136LSC7      KPISPSKVMVLGIGFVAAIVLCLFFIGLV-YLLNNKITSVKEVE-RGINLPM--LGAIP-
A0A5C7N8Q5      TPISPSKIMVLGIGFVAGIVLSIFFIGLV-YVLNNKITSVKEVE-RGINLPM--LGAIP-
A0A1V5S1J9      MTNAGEKNKAYTMFLAIGLLVPVAIIVLL-ELMVPYIRTESEVI-SMAPKQYQLLGVIM-
A0A0A2EYC8      LINAKEKQNKYIVFLLIGLAVPAALIILK-ELLNNAIRTEKDIE-KAIKNKFQIIGTVR-
A0A2G6H6Y4      QLNDKEKRTNYLIFIVLGLMIPVVLIVLK-EFMNSAVRTEKDVD-IATKNRFDIIGSVL-
A0A1M3DPL8      VTNQGTKSKTIMMYFLIGILLPSVFIILK-ELLNNTIRTSRDVE-K--MSAFPLIGLVR-
A0A1V5F519      LINADVKSNTMFMFILLGILIPSLIIVLK-EVLNNTIRSIKDIE-K--RSVFPVIGMIR-
A0A2G6R1T9      VVNGGKKKETTMTYLLFGLMIPAIFLIAR-ELLNNTIRGQKDVE-K--NSKFPIIGNIR-
A0A2W4RDE8      APVSPNKRMIYAAAFILGFGGALGLLILK-DFLNDNIVTHEDLE-QYTRIPF--LGVVS-
A0A0L8VEV2      ELMGPYLTFNVAGGLLAGLFVPFMVIMLA-TYFYDRIKSAEDIE-EYTDIPV--IGNIV-
A0A1I2A9Z9      SRLGPNLVINVAGGMLAGLFIPFVVIMLA-TYFYDRIKSAEDIE-EYSDIPV--IGNIV-
A0A142HHS5      EPISPKKLLVYAIGLAGGLILGLGLIGTR-YLMHNTITSVNELE-RNTKASV--LGVIP-
A0A660LQT8      KPISPVKRNILLIALGLALALPFGIFYLR-EMLDTRVRGRRDME--NLDIPH--IGEIP-
A0A350PNH9      KPVQPVRRNIILVAFVLGVLIPVVVIFIR-ENMNTTVRGRNDLK--NITIPF--LGEIP-
A0A354LNT9      KPVQPVRRNIILVAFVLGVLIPVVVIFIR-ENMNTTVRGRNDLK--NITIPF--LGEIP-
A0A2M6GH67      APIKPDKLMVYAIGLASGLFLGIGLIAAR-YFMHNTITNLGEVE-RNTKAPV--LGVVP-
A0A389LWV6      LVNAGDISNTYVYFVVTGLILTIIFIFLKEVLLKTSIQSRSEVE-KISELPI--LGTI--
A0A1G9B1T9      TPVSPNKILILLTAIVLGLALPVGALILA-DMFQDKISSREEVA-NIISMPL--VGEVP-
A0A3D0FMX4      CTNAGAKNANRTKYLLLGLIIPFLFVILR-ELLNNKVRTTREAE-ALSHYKL--LAQV--
A0A1M3MEI8      VVNQGEKSKTTLLFLLLGLVVPAGFVVVK-ELLNVRIMTNRDVE-KYSSFPL--IGMI--
A0A1J5HQM0      VTNDGTQSKTTLTFLIIGLLIPAAFVALR-EFSNGTIRSNKDIE-KNSKFTM--IGSV--
A0A653AC35      VTNGKVISKNYMTYGLIGFLIPFLIVLLT-ELLNNTIRNAKDVE-KNSPFSL--IGAV--
E4T131          VTNSDKRSKTTMVFLLFGLLIPTFIVILI-ELLNNTVHSTKDVE-KNSVFPL--IGAV--
A0A521H707      PL-SPNRKLILAGSLLVGFILSFVIIFVK-YLFYNEITSLDEIN-LYTNAAL--LGIIP-
A0A1F3D6P8      KIIVPRPKLSYLLAIFFGLAIPTTFIFIR-NFFNNKISSIYDLE-SLINQSG--MGVIF-
A0A356Z058      KIIVPRPKLSYLLAIFFGLAIPTTFIFIR-NFFNNKISSIYDLE-SLINQSG--MGVIF-
A0A3D1BT36      SIIKPKKMINYIASFFLGLLIPSLIIILK-DFFNEKITRAYEIE-DVLGKPV--LSTIY-
A0A352ME00      RIVAPKSAINYMMALFFGLLLPTLYLMIR-DFFDDKIRSINDAE-YMLHRSV--MSVIY-
A0A3D3HL11      SIIAPRTNLNWLIALFMAFMVPTIYIILK-NFFNEKISSVRDVE-HMIGQPV--MNLIY-
A0A5R9QZP0      SVISPKTTINYLLSLFIGFIIPSIFTLLK-VFFSQKVSSVRDIE-RVIHQPI--LNLIY-
A0A2W7RD29      LPIGPRKLNFYGYAIIITFLLPVIITFLQ-ETVFKKLVDPSEIE-KLLNIPV--IGSIP-
A0A3N2NDY8      QPVAPKVKFILAICMFFGLCVPGVAIYII-SATDTKVRSRKDLD--RMSAPF--AGEIP-
D7JEV9          LVNANQKQKKYMIFFFIGLAIPAVLIILK-ELLNNAIRTEKDIE-RATRNRFPTIGSVR-
A0A4R6H3B7      FRLGPNLVINVAGGMLAGLFIPFVVIMLA-TYFYDRIKSAEDIE-EYSDIPV--IGNIV-
A0A2W7QSQ0      KPVKPNKLMIMAAALGLGLSLPLGLILVN-YLVTSKVTSKRVIE-KILNAQI--LGEI--
R7F6L5          APISPVSTNTYLIAVLIGLIIPSGVYVVK-ANLDNKVRSREDVE--NIGIPF--IGEIP-
A0A553GA49      GRAAPKKSRNLILMVFFGLLLPTIYVLLN-ESYFEKISDIEDYR-FSFKAPV--LGQI--
A0A497D6F6      GPVEPKKSRIYLIALFLGLFVPALIILMK-YFSTNKITTVDDIK-EITNAPV--VGLVF-
A0A5M4AAB9      KPVKPNNIKTGIAALLLGIFFPSTLIIIR-NALDNKVRTLDDLK-LLTDSPV--LGQIP-
F4KR18          -PVGPNKIKIFAAAGMGGLAIPFFLILVL-ELLKNSVQTEEDLKSMLPEKTI--MGVIN-
C9LKL0          TPISPSRSTIILISLLIGLLIPTLILTIR-RLMDITVSGRHDVE-EATTIPL--VGELP-
A0A3D0QPV7      LPVSPKKRMIVIAFFFIGILFSSVMIVIR-YLMHNEITTLHEIT-RISNASLGILGIIP-
A0A496KT23      IPPQPVSRNILLTAFLIGLAIPAAFVFGR-EALNSTVRGRKDLE-D-YSMPL--VGELP-
L1M9T3          TPATPVSKKILGIALLLGLGIPAALIFAR-EGFNTTVRGRKDLE-D-MSVPL--VGELP-
A0A3C0I8F1      KPIYPVPTNIYSLGLAAGVVLSLLLVAIR-YLLNNTVANQKELE-KIIIAPV--LGVIP-
R5JJI4          VPVAPKSMMILLAAIVLGGTIPMIVLWLL-NVTDTKVRTRKELD-NILTIPF--LGDIP-
A0A3D2HF71      TMIKPKERQNFMLAIILGLFFPGIGILLL-DYFNNKIIDKKDIE-KRTSAPI--IGFI--
A0A0A2DQN2      APISPVPSRSILLGIVLGLFIPAAYAILK-LLTDTKIHSRRDVV-DQVSLPF--LGEIP-
A0A0A2F2N5      SPISPNTTRTLLISFAIGLFIPTAFFLLK-LLADTKVRTRKDVL-ERVSIPY--LGDIP-
L1NGW4          PPVSPNKTRTVLLAILIGLALPTIGLIIR-LLADNKVRTRKDIL-DRLTIPF--LGDIP-
Z4WRA0          PPVSPNKTRTVLLAILIGLALPTIGLIIR-LLADNKVRTRKDIL-DRLTIPF--LGDIP-
U2K8K9          PPVSPNTLRTIVLAFLLGLALPTIFLIVR-LLTDNKVRTRKDIL-DRLTIPF--LGDIP-
A0A069ZM60      KPISPNTLRVVLIAILIGLVLPSVYLIIR-LLADNKVRSRKDVM-DRVSIPF--LGDIP-
J6GV98          KPVSPNALRVALIAILIGLVLPSVYLIIR-LLADNKVRSRKDVM-DRVSIPF--LGDIP-
A0A134B4F8      KPVSPNTLRVVLIAILIGLVLPSVYLIIR-LLADNKVRSRKDVM-DRVSIPF--LGDIP-
A0A134B8C7      KPVSPNTLRVVLIAILIGLVLPSVYLIIR-LLADNKVRSRKDVM-DRVSIPF--LGDIP-
A0A4Z0EKR0      YPISANSRTIYLMALLLGLAIPFGGIYTN-NLLDNKVQSQQDVS-AMTPTPI--LGEI--
A0A229I3A5      TPVEPVRRKILLIALVLGFLIPMVVIYIR-EKANTTVRGRKDLK-K-VNVPF--LGEIP-
A0A3R6HJB3      TPVEPVRRKILLIALVLGFLIPMVVIYIR-EKANTTVRGRKDLK-K-VNVPF--LGEIP-
B5CTK0          TPIAPDRMRIWMISFLIGIGIPAVFLMLL-KMTDTKVRTKKDIE-NKLSIPF--LGEIP-
A0A1M6B6D5      GQIGPNTQLNYMMAGLIGFFVPILLIFVR-AFFDTKVESVKDLE-AITPIPM--IGVIG-
A0A451FS66      GKIGPNTQLNYVMAGLLGLFIPLFIIFGM-AFFDTKVEYVKDLA-KITPIPL--FGVIG-
A0A2E3GN39      KHVAPDDSFIRFVGLAIGAILSLILVVFR-YVTHKEIINIEDIT-SQTETSL--LGVIQ-
A0A3D1MEL0      EHVAPDDSFIRFVGLAIGAILSLILVVFR-YITHKEIINIEDIT-SQTETSL--LGVIQ-
F0R0C9          LPTAPVRRNILLVAFALGLLIPVVIVFVR-ENMNTKVRGKKDLE--CLSMPF--AGEIP-
A0A2A4N9A6      IQEYPSPVYAMLTGIISFLMLSLITVIFR-YMLHNKISHLSDID-RSTNATV--LGIIP-
A0A368D1N7      QHVAPDDSFIRFVGLAIGAILSLILVVIR-YITHKEIINIEDIT-SQTETSL--LGIIQ-
A0A3B8TU58      NHISPNDSFIRFVGLAIGAILSLILVVFR-YITHKEIINIEDVT-SQTETAL--LGVIQ-
A0A1T5IIR6      TPTSPQRMKIVMLAILIGLLIPGVILIAR-LFLDTKIRTRKEIE-ENIDVPF--LAEIP-
A0A3E0QD27      NPLSPNRRLVIAGSLLLGFIISFLIIFVK-YLFYNEITTLDEIN-LYTDAAL--LGIIP-
A0A0M1W1I6      APISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DVVTVPF--LGEIP-
A0A4R4GHU2      APISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
I8WPR6          APISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
A0A0K2HKS3      TPISPNGRSMIMAGIMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
B6W3W8          TPISPNGRSMIMAGIMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
A0A4R4GSI6      TPISPNGRSMIMAGIMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
A0A076IRY8      APISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
A0A3A6AD54      APISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
A0A3A6MIU7      APISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
I8WPP8          APISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
A0A372Y7D2      APISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
A0A3E4JJC9      APISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
A0A3E4WDQ0      APISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
A0A414H9P2      APISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
C3R5A8          APISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
A0A1C5XJA7      YPISPNRNKILALGILLGLALPTVSFLVI-MFMDTRIHSRKDIL-GAVSVPF--LGEIP-
A0A3E5BU42      GPIAPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVRSRKDLK-GAVSIPF--LGEIP-
R7CUW4          SPISPRRNRILLLGLLVGIALPGVGCLLV-LFLDTRVHGRKDIE-KAVSVPF--LGEIP-
A0A416GGJ1      GPIAPVRNRILILGLLAGIALPGVACLLI-LFLDTRVHGRKDLE-GVVTAPL--LGEIP-
D1JY72          APISPNGRSMIMAGIMKGIALPAIVLLLF-LFFDTRIRNRKDIE-DAVTVPF--LGEIP-
D7J4K6          GPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHSRKDLK-GAVSIPF--LGEVP-
Q8ABP9          GPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHSRKDLK-GAVSIPF--LGEVP-
A0A5M6AHF7      GPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHSRKDLK-GAVSIPF--LGEVP-
D6D2Z5          GPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHSRKDLK-GAVSIPF--LGEVP-
A0A1T3EDR4      VPISPNILISVFTGLGIGFLVWVALLLLR-LFLNTTVKSREEIE-SALNIPF--LGEIP-
A0A174SDD8      IPISPNKYKKLMLGVGCGVIVPSVILLLM-LILDTGVHNRKEVE-SIVSAPF--LADIP-
A0A1H7RFH3      IPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEIE-SIVSAPF--LADIP-
A0A139L1N2      IPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEIE-SIVNAPF--LADIP-
A0A174TVL8      IPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEIE-SIVSAPF--LADIP-
A0A1H8BJR6      IPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEIE-SIVSAPF--LADIP-
R9H6G0          IPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEIE-SIVSAPF--LADIP-
A0A412GR09      IPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEIE-SIVSAPF--LADIP-
A0A4Q5DX00      IPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHNRKEIE-SIVNAPF--LADIP-
A0A081PBV5      APIYPSRIKKLALGVGIGIALPAIVFLLM-LMLDTGVRSRKDIE-EVLSVPF--LGEIP-
A0A1I2AN85      APIYPSRIKKLALGVGIGIALPAIVFLLM-LMLDTGVRSRKDIE-EVLSVPF--LGEIP-
A0A4U0GMP3      APIYPSRFSKVALGVGIGAAIPAVVLLLM-LLLDTGVRNRKDIE-GAVTTPF--LGEIP-
A0A1H6CKR6      YPFYPSLLKKLALGIGIGLAIPTAILLLI-LMLNTKIRYRKDIE-DNISVPL--VGEIP-
A0A235E1C0      APFYPSKFKKVAIGVAIGIAVPAAILLLM-LLLNTKIRNRKDIE-DAVSVPF--LAEIP-
R6D982          APFYPNKYKKLLLGGGMGILIPTVILLLI-LIVDTRVRNRKDME-AVVSAPF--LAEIP-
A0A1F0I8C4      IPISPNKYNKVLLGAGCGVIVPTVVLLLI-LVLDTRVHSRKEIE-ASVSAPF--LADIP-
A0A3A5RIJ2      IPISPNKYNKVLLGAGCGVIVPTVVLLLI-LVLDTRVHSRKEIE-ASVSAPF--LADIP-
A0A515IZJ5      IPISPNKYNKVLLGAGCGVIVPTVVLLLI-LVLDTRVHSRKEIE-ASVSAPF--LADIP-
A0A5M5NLR3      IPISPNKYNKVLLGAGCGVIVPTVALLLI-LVLDTRVHSRKEIE-ASVSAPF--LADIP-
A0A0D5BSQ0      FPVSPNKLKKLSIGVAIGAVLPAVVLLSM-LMLNTGVRGRQDLE-DVLSVPF--LGEIP-
A0A1T3F6P5      SPIYPSRTKKVMTGVAIGTVLPAVVLLSM-LMLNTGVRGRQDLE-NVLTVPF--LGEIP-
A0A0W8EPA0      SPIYPSRTKKVMTGVAIGAVLPAVVLLSM-LMLNTGVRGRQDLE-NVLTVPF--LGEIP-
A0A365UKN1      SPIYPSRTKKVMTGVAMGAVLPAVVLLSM-LMLNTGVRGRQDLE-NVLTVPF--LGEIP-
A0A4R6WE41      APMYPSRLRKVGMGLAVGTVLPAVVLLLM-LMLDTGVRSRQDIQ-KVVTAPF--LGELP-
A0A2T5RP38      VAVYPNRLKKIFTGVALGTAVPAVILLSM-LVLNTGVRGRQDLE-NVLSVPF--LGEIP-
A0A1A6CF06      YPIYPNRLKKVFTGVAIGTVLPMIVLLSL-LLLNTAVRGRQDLE-NVLSVPF--LGEIP-
A0A1T3D6S8      YPIYPNRLKKLFTGVAIGTVLPMIVLLSL-LLLNTAVRGRQDLE-NVLSVPF--LGEIP-
A0A1P8E011      DPVAPSRMRKLGLGMAIGFILPAIVIMTL-SILDTGVRRRQDIE-EAIDVPL--LGEIP-
A0A1V3N3U3      SPIFPSKFRKVATGIGIGLILPTVILLFL-LVFNTGVRSRQDVE-TVLSVPF--LGEIP-
C2FUH6          APVYPVRFKKVMTGVGIGIVLPAAVLLCL-LIFNTGVRGRQDIE-SVLDIPF--LGEIP-
A0A0B8T471      APIYPSKARKVMTGVGFGVVLPTVVLLLL-LLLDTKVNGRKDIE-EAVSVPF--LGEIP-
A0A4R7D2K0      GPIYPSKARKVMTGVGFGVVLPAVVLLLL-LLLDTKVNGRKDIE-EAVTVPF--LGEIP-
A0A2X2J8S4      APVYPNKFKKVGLGVAIGLVIPSLLLILM-LVVDSGVRNRKDLE-EGLSVPF--LGEIP-
A0A3C0S618      APVYPDKFKKVGLGVAIGLVVPSVILILL-LIVDSGVRNRKDLE-DGLSVPF--LGEIP-
A0A4P7DRF9      WPIYPNKLKKLAIGIGIGLAIPAIVLLLM-LLFNTKIRNKRDIE-SEVSIPF--AGEIP-
A0A239XXC4      LPFYPSKLKKVAIGVAIGIAVPAAILLLM-LLLNTKVRNRKDIE-DAVSVPF--LAEIP-
A0A4U9K473      LPFYPSKFKKIALGVAIGIAVPAAILLLM-LLLNTKVRNRKDVE-DAISVPF--VGEIP-
A0A3D4RLG4      ITNAKQQRKTMISYLALGFLLPLVLSVLI-ELIYNKLRIPKEVE-RLSSFP--LIGSLRH
A0A3N2LCI3      -PTAPNTRNILMMSFLLGLAIPFGVVYLM-ESNNTKVRGRKDVE-HLAVP---FLGELPQ
A0A1H6Z2F8      LPVSPNRQLTILVAFLAGLLAPACVIYVG-QIFNNKITSKDDIS-RQCDVT--IIGEISQ
A0A2P8G5K0      LPVYPNRELTILIAVFTGILTPLGVLYTS-QIFNNKITSKEDIQ-RQCDVM--ILGEISQ
A0A519SYE7      EPISPVRALVYAIGLASGLALGLGLIATR-YLMHNTITSVQELE-RGTRAA--VLGVIPT
A0A5Q4EKA0      QPISPKPRGVYASSLLAALFLGIGVFLLK-YLFYNEIPSLHDIL-KYTQAP--VIGVIPK
A0A3D4CJE1      VPIKPNKKLIFVVFVFGSLVLGIGFVVIK-YLFHNEITSVADIT-QEGKAKLGVLGVIPK
A0A4Q5ZQ60      LPIYPNKMLVYAIGIAASFFLSIVLVTAR-YFLHNTITNLKELE-RNTMAP--LLGIVPS
A0A519Q885      EPISPKKILVYAIGLAGGLILGLGLIGVR-YLMHNTVTSVAELE-RNTKAT--VLGVIPS
A0A519TAP8      EPITPVRLLVYAIGLAGGLILGLGLIATR-YLMHNTVTGVAELE-RGARAA--VLGVIPT
A0A2K8ZAP1      QPVKPVKLMIFALFAVVGLVIPIGVITAK-DTVNNHVLRRSDVE-EVT--QIPIIGEVI-
A0A2T4XEQ1      SPFKPNKRLFILIGIFLGGAVGVGLAFGR-EFLNRTIDGLDKLK-GSGYPILAVIPDFT-
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      IPISPVKPIIYASFLALGLILSFLLIGIR-YILNNDISGVHDLS-RLMNPRISLLGVVP-
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      SPIGPDRRNMNIFGIIAGLIIGLAFALMR-IYFNKNLSTPEELE-SKGVSLLSWIPNIE-
A0A496L711      LVNANQKQKKYMIFFFIGLAIPAVLIILK-ELLNNAIRTEKDIE-RATKNRFQIIGSVR-
R7JFY1          ------------------MAIPAGILWLR-WANDTRIRSMKDVQ-DRT--ALPLLGEIP-
A0A1V5S5I3      IPTAPVKKNIALVAIVLGLLIPVVIVFIR-ENMNTKVRGRKDLE-SL---SLPFAGEIPL
A0A2M7VVW6      --------MIMATGVLLGIVISLIILILK-YVLKNTISTMDEIT-KFSNGAVGILGTVP-
A0A656PYT8      ----------------------------M-EILDTTIRGRKDIE-DKL--SIPFLGDIP-
A0A413V760      ------------------LGIPMGVFWLL-NVTDTKVRTRKELD-GVL--TIPFLGNIP-
A0A641LIG3      TPVAPKTMMILMVSVALGLGIPMGVFWLL-NVTDTKVRTRKELD-EVL--TIPFLGNIP-
A0A641LPE6      APVAPKTMTIFLASIVLGLAIPVGVFWLL-NVTDTKVRTRKELD-EVL--TIPFLGNIP-
A0A1T4NDR5      ---------------------------------------------------------MT-
A0A3D5KRM7      ------------------------------------MVENSESD-SLDNIRYSKTRIMP-
A0A3M1NUH2      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ----------------------------------------------------------M-
A0A641X2Z6      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      APISPKKMLVYAIGLAGGLVLGLGLIGVR-YLMHNTVTSIGELE-RNTKASVLGVIPTY-
                                                                            

A0A3M1Y2F5      --------------------------KNDDGLEVIKQ-----------STSYSP-LAECF
A0A1G1TG88      ---------------------TYDKEKMEVSRLVVND-----------NPK-SA-ISEAI
A0A661XXA6      ---------------------KYKSAK-EHAKIIVNE-----------HPK-SA-LSESM
A0A2T2UAJ4      -------SMTPLIDDEFGGQETIEIDGRSVNTLLAML-----------VSPMSA-AAEAY
A0A519SD85      STD---------------------SNDLLSKNLILQE-----------APR-SL-FSESL
A0A4Q3SEI4      ------------------------KVKAKTADVYNNT-----------KRQ-LS-FIEQF
A0A3M1TXY5      ------------------------ARYEKSNNYIIEK-----------DSR-TS-FAESF
A0A2E0VQ27      LTR---------------------KTPPGFSLV-------------------SG-LTANL
R6U429          LGQ----------GAGILNKMRKKMCDDANTKIVVAP-----------SNR-NS-INEAF
R5DEG6          --M---------------------RDKKDKNEVVVHE-----------NGR-DS-VSEAF
A0A5C8AF42      F-----------------------KSEMEFSQLVVHE-----------SPK-SM-LAESM
A0A642EJV3      FTRKKKGILG--------------KKPQEVKAVIVKE-----------GNR-DI-INEAF
A0A161LWY6      ------------------------HATHDDATITVLK-----------RPK-SA-IAEAY
A0A212J9Z9      VSK---------------------KL--NNGVVLVKN-----------YPK-SS-FAESF
F5IV23          VSK---------------------KL--NNGVVLVKN-----------YPK-SS-FAESF
F8X2T0          ISK---------------------KL--AGGVVLVKN-----------FPK-SS-FAESF
A0A1M3LAG1      ISK---------------------KL--AGGVVLVKN-----------FPK-SS-FAESF
A0A212K6G4      ISK---------------------KL--AGGVVLVKN-----------FPK-SS-FAESF
A0A4Y9IPG7      ISK---------------------KL--AGGVVLVKN-----------FPK-SS-FAESF
A0A2V3PNY7      ISK---------------------KLSSSGSTTLVKN-----------FPK-SS-FAESF
A0A1M5DFS8      ISK---------------------KM-SSNSTTLVKN-----------FPK-SS-FAESF
A0A4Y8KZS5      ISK---------------------KM-PSGNTTLVKN-----------FPK-SS-FAESF
A0A239K409      ------------------------SYNDTKDVIVVSE-----------SSK-TA-IAELF
A0A350V3E4      FMREPKAG----------------RHTHTEQELVLAY-----------NSD-SV-PAEAF
A0A1M6MYT6      --N---------------------NRKESESHTLVLD-----------KPN-SP-ASEPY
A0A2P8CDS1      --H---------------------DDQAAISHTALLD-----------HPN-SP-VGETY
A0A5M4A2I9      --H---------------------DDQAAISHTALLD-----------HPN-SP-VGETY
A0A353WYK7      VEK---------------------LKGRDSDRLVIDK-----------VPK-SE-ISEAF
A0A355BP94      --E---------------------MRRNTTSPFYIVE-----------NPR-SI-VSEAI
A0A136LSC7      --A---------------------SHHTVQSLFHVID-----------NPK-SI-VSEAI
A0A5C7N8Q5      --A---------------------SNHTVQSLFHVID-----------NPK-SI-VSEAI
A0A1V5S1J9      --H---------------------TDRKT--PVIVDK-----------YPK-SA-ITEAF
A0A0A2EYC8      --H---------------------TKHKADEKVIAAK-----------YPN-SY-FVEQL
A0A2G6H6Y4      --H---------------------TKHKTEDKVIAPK-----------YPN-SY-FVEQL
A0A1M3DPL8      --H---------------------TNSTD--PYLIVN-----------NPR-SS-FTEMF
A0A1V5F519      --H---------------------AKNDL--PDLTLK-----------NPK-SS-FTEMF
A0A2G6R1T9      --H---------------------TKKAN--PLLTLK-----------HPR-SS-FTEMF
A0A2W4RDE8      --H---------------------GSRREQSNVVANA-----------LSP----VGESF
A0A0L8VEV2      ------------------------NSGIGSEYLAAID-----------NPR-SA-IAESF
A0A1I2A9Z9      ------------------------NTGIGAEFLAAID-----------NPR-SA-IAESF
A0A142HHS5      --TYD-------------------KEQLNISRLIVDK-----------NPK-SS-VSEAI
A0A660LQT8      --HMDASVESWTSKLLVKLGLKKLPQRLDKNEVVVKP-----------QNA-NI-INEAF
A0A350PNH9      --Y----CISRKNRPTLLQRIQFWKKPKETLQIVVKA-----------GKR-DI-VNEAF
A0A354LNT9      --Y----SISRKNRPTLLQRIQFWKKPKETRQIVVKA-----------GKR-DI-VNEAF
A0A2M6GH67      --R----YT---------------KEKLLVSKLIVHK-----------NPK-SA-ISESI
A0A389LWV6      ------------------------EHTERKEMMVLYK-----------YPK-SS-FAENF
A0A1G9B1T9      --R----L-------------------RRKENALVYS-----------RPR-SA-AAESF
A0A3D0FMX4      ------------------------RHTRGSNPTEVVD-----------HPR-SS-YAEQL
A0A1M3MEI8      ------------------------RHTNSDNPFIVAA-----------NPR-SS-FTEMF
A0A1J5HQM0      ------------------------RHTNSNDPLITIN-----------NPR-SA-FTEMF
A0A653AC35      ------------------------RHTQNKDPMLAAH-----------RPR-SS-FTEMF
E4T131          ------------------------RHTKSTDPLVVSK-----------NPR-SA-YTEMF
A0A521H707      --K----Y----------------KSEIPVSQLLVDK-----------NPK-SA-ISESF
A0A1F3D6P8      --N----N----------------NYK---SEAVVLE-----------APK-SA-IAESF
A0A356Z058      --N----N----------------NYK---SEAVVLE-----------APK-SA-IAESF
A0A3D1BT36      --N----N----------------SFK---YEDVVHK-----------AVG-SP-IAESF
A0A352ME00      --S----N----------------NLK---SEAVVAE-----------FPK-SA-ISESF
A0A3D3HL11      --T----N----------------FYK---TESVVKD-----------YPG-SS-IAESF
A0A5R9QZP0      --T----N----------------YHN---TENVNTE-----------FPN-SS-LAESF
A0A2W7RD29      --V---------------------AEGKTNVQLVDYP-----------NSK----VAESF
A0A3N2NDY8      --F----VGKKSIKDRMARLLPAKKNSKELERVVVAV-----------KEGSRDAVSESF
D7JEV9          ------------------------HTKHKADERVIAS-----------KYP-NSYFVEQL
A0A4R6H3B7      ------------------------NTGIGAEFLAAID-----------NPR-SA-IAESF
A0A2W7QSQ0      ------------------------AKNDQNGVIAISP-----------KSI-SP-AAEQL
R7F6L5          --Q----KGRKKLG----------KDSSSERQVVVRA-----------DST-NV-INEAF
A0A553GA49      ------------------------TLCSNGSKKIFEP-----------SNE-DAVVAESF
A0A497D6F6      --N---------------------TRKDYKGNTLILD-----------KPG-SP-ASEQY
A0A5M4AAB9      --H---------------------DEQVLPSQIPLLE-----------HPN-SP-LGESY
F4KR18          --H---------------------QKG--KKQHSLLS-----------KSQ-NT-LTERF
C9LKL0          ------------------------TWEEGGDDGLITT-----------CSS-DAPIVEAF
A0A3D0QPV7      --K----Y----------------KEDIPVSQLIVDK-----------NPK-SL-ISEAF
A0A496KT23      --L----KGKKRPVWKRWRK----EKIVAAPNMVVAD-----------QKR-DI-LNEAF
L1M9T3          --F----KGKKRPVWQRWRK----QTIVAQPNMVVAD-----------QQR-DI-INEAF
A0A3C0I8F1      --F----HNK--------------QKNAKYSKLVILD-----------NPK-ST-INEAL
R5JJI4          --R----HGT--------------RKGEDTDAIVVHE-----------SGR-DS-VSEAF
A0A3D2HF71      ------------------------GHNTFKTDLPAVE-----------HTG-SS-LAESL
A0A0A2DQN2      --L----NTT--------------KKGG--EGIGVSE-----------QGT-DL-TSEAF
A0A0A2F2N5      --Q----SDT--------------N-----LFVAVEP-----------QGS-DA-ITEAF
L1NGW4          --K----EDA--------------PGRK--QPRGARE-----------QGS-DE-TSESF
Z4WRA0          --K----EDA--------------PGRK--QPRGARE-----------QGS-DE-TSESF
U2K8K9          --K----EER----------------AKSGHTRGVRE-----------QGG-DE-TSEAF
A0A069ZM60      --R----EEK--------------RGGKKSQPRGVRE-----------QGG-DE-TSEAF
J6GV98          --K----EEK--------------RGGKKAQPRGVRE-----------QGS-DE-TSEAF
A0A134B4F8      --R----EEK--------------RGGKKSQPRGVRE-----------QGS-DE-TSEAF
A0A134B8C7      --R----EEK--------------RGGKKSQPRGVRE-----------QGS-DE-TSEAF
A0A4Z0EKR0      ------------------------SHNNSNESVVVTN-----------GNR-SP-IAEMF
A0A229I3A5      --F----SISRKNRPTLEQRIKFWKKPKEVRMIVVKA-----------GKR-DI-VNEAF
A0A3R6HJB3      --F----SISRKNRPTLEQRIKFWKKPKEVRMIVVKA-----------GKR-DI-VNEAF
B5CTK0          --K----Y-------------------QGKDDIIIHE-----------NGR-DS-ISEAF
A0A1M6B6D5      --K----N-------------------HSETVLAVLS-----------KPK-SA-IAEAF
A0A451FS66      --K----N-------------------HSGNILAVLS-----------HPK-SA-IAEAF
A0A2E3GN39      --R------------------Y--SEKLPMSSIVVTN-----------RPK-SG-ISESF
A0A3D1MEL0      --R------------------Y--SEKLPMSSIVVTN-----------RPK-SG-ISESF
F0R0C9          --L----AGESRRKHLFA---S--KTYDAPRGIVVKQ-----------GKR-NI-INEAF
A0A2A4N9A6      --Q----F-------------K--REEMPISQLVVEK-----------NPK-AG-ITEAL
A0A368D1N7      --R----Y-------------S---EKLPVSSIVVTN-----------RPK-SG-ISESF
A0A3B8TU58      --R----Y-------------S---EKLPMSSIVVTN-----------RPK-SG-ISESF
A0A1T5IIR6      --L----NGTLRGIVFKQGKHK--QGHDDPSPFVYDP-----------TSH-TV-FTEAM
A0A3E0QD27      --K------------------Y--KNEIPVSQLLVDK-----------NPK-SA-ISESF
A0A0M1W1I6      --K----DSS--------KRKI--ENKKTAHGIAVRA-----------QGR-DI-VSEAF
A0A4R4GHU2      --K----DSS--------KRKI--ENKKTAHGIAVRA-----------QGR-DI-VSEAF
I8WPR6          --K----DSS--------KRKI--ENKKTAHGIAVRA-----------QGR-DI-VSEAF
A0A0K2HKS3      --K----DSS--------KRKI--ENKKTAHGIAVRA-----------QGR-DI-VSEAF
B6W3W8          --K----DSS--------KRKI--ENKKTAHGIAVRA-----------QGR-DI-VSEAF
A0A4R4GSI6      --K----DSS--------KRKI--ENKKTAHGIAVRA-----------QGR-DI-VSEAF
A0A076IRY8      --K----DSS--------KGKT--ENKETAHGIAVRA-----------QGR-DI-VSEAF
A0A3A6AD54      --K----DSS--------KGKT--ENKETAHGIAVRA-----------QGR-DI-VSEAF
A0A3A6MIU7      --K----DSS--------KGKT--ENKETAHGIAVRA-----------QGR-DI-VSEAF
I8WPP8          --K----DSS--------KGKT--ENKETAHGIAVRA-----------QGR-DI-VSEAF
A0A372Y7D2      --K----DSS--------KGKT--ENKETAHGIAVRA-----------QGR-DI-VSEAF
A0A3E4JJC9      --K----DSS--------KGKT--ENKETAHGIAVRA-----------QGR-DI-VSEAF
A0A3E4WDQ0      --K----DSS--------KGKT--ENKETAHGIAVRA-----------QGR-DI-VSEAF
A0A414H9P2      --K----DSS--------KGKT--ENKETAHGIAVRA-----------QGR-DI-VSEAF
C3R5A8          --K----DSS--------KGKT--ENKETAHGIAVRA-----------QGR-DI-VSEAF
A0A1C5XJA7      --L----D-------------K--N-YKSSRKGAANA-----------YGYGDNVVTEAF
A0A3E5BU42      --Q----D-------------K--EAAK-----TGVA-----------VGRDDGMLSESF
R7CUW4          --L----D-------------K--EAARQHGRTAKAS-----------VGQDDSIVSEAF
A0A416GGJ1      --L----D----------KKLA--KKKKTVHGPRLFL-----------DKQDDI-IAEAF
D1JY72          --K----DSS--------KRKI--ENKKTAHGIAVRA-----------QGR-DI-VSEAF
D7J4K6          ---------------------Q--DKEAAKAGVAVGE-----------ED--GM-LAESF
Q8ABP9          ---------------------Q--DKEAAKAGVAVGE-----------ED--GM-LAESF
A0A5M6AHF7      ---------------------Q--DKEAAKAGVAVGE-----------ED--GM-LAESF
D6D2Z5          ---------------------Q--DKEAAKAGVAVGE-----------ED--GM-LAESF
A0A1T3EDR4      --Y----S-------------R--SKSESGMGVFVYH-----------TGK-DA-LSEAF
A0A174SDD8      --Q----T-------------P--KAMANVHEVVGRA-----------RGL-DA-LSESF
A0A1H7RFH3      --Q----T-------------P--KAMANVHEVVVRA-----------RGL-DA-LSESF
A0A139L1N2      --Q----T-------------P--KAMANVHEVVVRA-----------RGL-DA-LSESF
A0A174TVL8      --Q----T-------------P--KAMANVHEVVVRA-----------RGL-DA-LSESF
A0A1H8BJR6      --Q----T-------------P--KAMANVHEVVVRA-----------RGL-DA-LSESF
R9H6G0          --Q----T-------------P--KAMANVHEVVVRA-----------RGL-DA-LSESF
A0A412GR09      --Q----T-------------P--KAMANVHEVVVRA-----------RGL-DA-LSESF
A0A4Q5DX00      --Q----T-------------P--KAMANVHEVVVRA-----------RGL-DA-LSESF
A0A081PBV5      --F----T-----------------LKDKGGEAVVEE-----------KGR-DY-TSEAF
A0A1I2AN85      --F----T-----------------LKDKGGEAVVEE-----------KGR-DY-TSEAF
A0A4U0GMP3      --F----S------------DK--RRRSKEGNLVIEA-----------QGG-DP-VTEAF
A0A1H6CKR6      --F----S-------------T--DLKTAKSDIVIKE-----------QGT-DE-VTEAF
A0A235E1C0      --F----S-------------T--EMKSAKSEIVIKE-----------QGV-DE-VTEAF
R6D982          --K----S-------------A--EKVTEINDIMVRA-----------RGQ-DA-LSESF
A0A1F0I8C4      --Q----V-------------S--KTEADAQEVMVRA-----------RGL-DP-LSEAF
A0A3A5RIJ2      --Q----V-------------S--KTEADAQEVMVRA-----------RGL-DP-LSEAF
A0A515IZJ5      --Q----V-------------S--KTEADAQEVMVRA-----------RGL-DP-LSEAF
A0A5M5NLR3      --Q----V-------------S--KTEADAQEVMVRA-----------RGL-DP-LSEAF
A0A0D5BSQ0      --L----M-------------R--SRKQGKSDVLVSK-----------SGR-DP-LTEAF
A0A1T3F6P5      --L----A-------------K--GRRQGNGDILVSQ-----------SGR-DP-LTEAF
A0A0W8EPA0      --L----A-------------R--GRRQGNGDVLVSQ-----------SGR-DP-LTEAF
A0A365UKN1      --L----A-------------R--GRKQGNGDVLVSQ-----------SGR-DP-LTEAF
A0A4R6WE41      --M---------------------EKKYDDKGIAVSK-----------TGR-DP-LTEAF
A0A2T5RP38      --L----A-------------R--GRRQGKGDILVSG-----------SGR-DP-LTEAF
A0A1A6CF06      --L----A-------------R--SRRQGKGDILVSK-----------TGR-DP-LTEAF
A0A1T3D6S8      --L----A-------------R--NRRQGNGDVLVSQ-----------SGR-DP-LTEAF
A0A1P8E011      --L----A-------------T--NKRTSQNNILVSA-----------MGR-DP-LTEAF
A0A1V3N3U3      --L----S-------------K--RKSEQHAVFRVEK-----------TGR-DP-LTEAF
C2FUH6          --Q----A-------------G--KRKTDSNKVLVSK-----------TGR-DV-LTEAF
A0A0B8T471      --F----S-------------K--QTIRANDDVVVNE-----------QGR-DP-ATEAF
A0A4R7D2K0      --F----S-------------R--QTMRANDDVVVNE-----------QGR-DP-ATEAF
A0A2X2J8S4      --L----A-------------K--KNKHTVGNVSVSQ-----------TGR-DA-LTEAF
A0A3C0S618      --L----A-------------K--KNKHTVGNVSVSQ-----------TGR-DA-LTEAF
A0A4P7DRF9      --F----S-------------T--DMQSAKQEVVVKE-----------QGT-DE-VTEAF
A0A239XXC4      --F----S-------------T--EMKTAKSDIVIKE-----------QGV-DE-VTEAF
A0A4U9K473      --F----S-------------T--EMKSAKSEIVIKE-----------QGV-DE-VTEAF
A0A3D4RLG4      --------------------------VRSQNPTLVQK-----------NPR-SS-YTEML
A0A3N2LCI3      DGH------------------EKKKEAGEANTIVVKG-----------GKL-DI-INEAF
A0A1H6Z2F8      ----------------------QSRA-----DRLSRN-----------NVR-SL-LREQF
A0A2P8G5K0      ----------------------QSRT-----GLLKVA-----------DNR-SL-IKEQF
A0A519SYE7      ----------------------YDKEKLEVSRLIVDK-----------NPK-SS-VSEAI
A0A5Q4EKA0      ----------------------Y-KSEIPPNQLLVLK-----------KPK-SL-ISESL
A0A3D4CJE1      ----------------------YKKE-IPVSQLIIDK-----------NPK-SV-ISESF
A0A4Q5ZQ60      ----------------------YTKEKLPVSRLIVDL-----------SPK-SA-ISESI
A0A519Q885      ----------------------YTKEQMSISRLVVDK-----------NPK-AS-VSEAI
A0A519TAP8      ----------------------YDKEKLEVSRLVVDK-----------NPK-AS-VSEAI
A0A2K8ZAP1      ------K-----------------ERQLGTESFVFKS-----------RMH-SV-IGEQI
A0A2T4XEQ1      ---EYVK-----------------KKYEEKSKVAVKGRLVSTNWFSLLDNI-SP-VTESY
A0A2T2TDL4      ------------------------------------------------------------
A0A348PT57      -----KY-----------------SKNIPLSQLIIDK-----------NPK-SV-MAEAF
A0A3D1AEJ6      ------------------------------------------------------------
A0A3D3LSK1      ----QIT-----------------DKSDPTNDFIVAK-----------KPS-SQ-ISEAF
A0A496L711      ------H-----------------TKHKADERVIASK-----------YPN-SY-FVEQL
R7JFY1          ------------------------ALEKNQEKLVVKE-----------GSR-DA-VSEAF
A0A1V5S5I3      AVSGKGK-----------------KKVHNAKKIVIRQ-----------GNR-DI-VNEAF
A0A2M7VVW6      ---TYNR-----------------EIPISQ--LVINR-----------DPK-SV-ISEAF
A0A656PYT8      ---EYHG-----------------STRQGS--VVVRD-----------NGR-DS-VSEAF
A0A413V760      ---RHGN-----------------NKGEDSDGIVVRE-----------NSR-DS-VSEAF
A0A641LIG3      ---RHGN-----------------NKGEDSDGIVVRE-----------NSR-DS-VSEAF
A0A641LPE6      ---RHSN-----------------NKGEDSDGIVVRE-----------NSR-DS-VSEAF
A0A1T4NDR5      ------N-----------------VENKMLKDLISIY-----------DSS-NP-ATEAY
A0A3D5KRM7      ------L-----------------DAEVLQDNRIIMG-----------LYN-DQ-RADLF
A0A3M1NUH2      --------------------------------------------------M-SP-VVESY
A0A359ATS6      --------------------------------------------------R-DV-INEAF
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      --------------------------------------------------------SEAF
A0A523GUD4      ------L-----------------KSPITDIEHLKEA-----------RND-TP-GNAEI
A0A641X2Z6      ---------------------------METITLIADR-----------DAK-SP-VAEAY
A0A519PJW5      ---------------------------------------------------------EAI
A0A519T3R9      ------S-----------------KEQMSVSRLVVDK-----------NPK-SS-VSEAI
                                                                            

A0A3M1Y2F5      RAVRVHIYNKL--TNKREKIDVSER--GILLGVCSTWSDEGKSFCAANLAASFGIGGYN-
A0A1G1TG88      RSIRTNL-DFI--SSA-------KK--KRLISVTSTISGEGKTFVTVNLAGIIAMSGQR-
A0A661XXA6      RSIRTNM-QFM--LPE-------TK--SKVYSITSTIGSEGKTFISTNMGALLAMAGKK-
A0A2T2UAJ4      RRIRTNL-RFA--KPD-------DD--LQTMAVSSADKGDGKTTTCANLALALASAGKR-
A0A519SD85      RSLRSNL-FSL--IN--------KD--CNMICITSEISGEGKSLISKNLAYAFAITGKK-
A0A4Q3SEI4      RQLRASV-ALN--GRK-------LK--YRRILVTSSIAGEGKSFIANNLALSLAISGKK-
A0A3M1TXY5      RSLRVKM-LFV--VEG-------DK--KKVIGVTSSSSGEGKTFCATNLAATLAHAGKQ-
A0A2E0VQ27      RDLPKPE-TK-------------GQ--AQLFVLSSNMPNEGKTFVSARIAKAMAAYGYK-
R6U429          RVLRTNL-DFM--TGGQ------EG--CHKVMITSFNPTAGKTFVLMNMAATMALKGAK-
R5DEG6          RIVRTNM-DFM--RVKE------KN--MQVVMFTSFNPGAGKTFVSINLAMSFALTHKK-
A0A5C8AF42      RKIRTNL-SYI--K---------PD--YKTIAISSSISGEGKTFVALNLAGIIAMSGKK-
A0A642EJV3      RVLRTNL-EFM--TGKD------KT--SNVIIMTSFNPGSGKSFLTMNIAVSLAIKGKK-
A0A161LWY6      RMVRTRI-KFV--SRQ-------MD--ASCVIVTSTESGDGKTHFCLNYASMCAMTGEP-
A0A212J9Z9      RNMRVRI-EYM--AQR-------EN--KITVLVTSTEPADGKTFIATNIASVYQLMGKK-
F5IV23          RNMRVRI-EYM--AQR-------EN--KITVLVTSTEPADGKTFIATNIASVYQLMGKK-
F8X2T0          RNMRVRI-EYM--AQR-------EN--KITILVTSTEPADGKTFIATNVASVYQLMGKK-
A0A1M3LAG1      RNMRVRI-EYM--AQR-------EN--KITILVTSTEPADGKTFIATNVASVYQLMGKK-
A0A212K6G4      RNMRVRI-EYM--AQR-------EN--KITILVTSTEPADGKTFIATNVASVYQLMGKK-
A0A4Y9IPG7      RNMRVRI-EYM--AQR-------EN--KITILVTSTEPADGKTFIATNVASVYQLMGKK-
A0A2V3PNY7      RNMRIRI-EYI--AQK-------ET--GISTLITSAEPGDGKTFIAGNIASVYQLTGKK-
A0A1M5DFS8      RNMRIRL-EYM--AQK-------ET--GISVLVTSAEPGDGKTFIAGNIASVYQLTGRR-
A0A4Y8KZS5      RNMRIRL-EYM--AQK-------ET--GISLLVTSAEPGDGKTFIAGNIASVYQLTGRR-
A0A239K409      RLIRTNL-QFV--VQG-------GE--RKVILVTSSVSGEGKTFFSLNLGASLALTGKN-
A0A350V3E4      RTLRTRL-QFS--KLEP------EP--IKTILITSSIPREGKTIISSNLAASFALSS-R-
A0A1M6MYT6      SAIRTKL-ELI--TKG-------KE--HAVIAVTSSFPSEGKTYNAINIASSVALSNKT-
A0A2P8CDS1      RALRMKL-KFM--LNG-------TE--QPVIAVTSTGSDEGKTFTAMNLAASFALLGQK-
A0A5M4A2I9      RALRMKL-KFM--LNG-------TE--QPVIAVTSTGSDEGKTFTAMNLAASFALLGQK-
A0A353WYK7      RSIRTNL-EFI--KRT-------DK--NTVIAITSTVSGEGKTFVTVNLGGVISLLKSK-
A0A355BP94      RTLRTNL-DFF--TSS-------ET--NKIIVISSTVSGEGKSFLAMNLGGILAMSNKK-
A0A136LSC7      RTLRTNL-EFF--NTG-------EK--CKVITITSTVSGEGKSFLAMNLGGVLALSRKR-
A0A5C7N8Q5      RTLRTNL-EFF--NTG-------EK--SKVITITSTISGEGKSFLAMNLGGVLALSRKR-
A0A1V5S1J9      RVIRTRI-EFL--SGK-------SK--GISVMVTSSQSGDGKSYISANIAGVFAMTGRK-
A0A0A2EYC8      RVIRTKI-ELI--LKR-------KE--RITMLVSSTESGDGKTYISLNLAGVFALQKKK-
A0A2G6H6Y4      RVIRTKV-EII--LGR-------KE--AITMLISSTESGDGKTYMSLNLAGVFGLQNKK-
A0A1M3DPL8      RIIRTRI-EFI--AKR-------KT--DITIMVTSSESGDGKTYFCINLACIYAMASPK-
A0A1V5F519      RVIRTRV-EFV--VRR-------KT--DIVMMVTSVDAGDGKTFFSTNMAGVYGMTGHK-
A0A2G6R1T9      RVIRTRI-EFI--VQR-------KT--GIMMLGTSTESGDGKTYVNINLASVYGMTGKK-
A0A2W4RDE8      RSLRVNL-QYL--TLG-------KE--VNVIGITSSRESEGKTYCSVNLAAAMANSRRR-
A0A0L8VEV2      RELRTNL-QFI--VPGLK-----NK--SLVIGVNSVIPGEGKSFTAANLASMIALNNKR-
A0A1I2A9Z9      RELRTNL-QFV--APKKN-----NE--CTIIGVNSVISGEGKSFTSANLASMIALNNKK-
A0A142HHS5      RSIRTNL-DFI--SPS-------NK--KRLISVTSTISGEGKTFVTVNLGGIIALSGQR-
A0A660LQT8      RVLRSNF-EFC--TNKF------GK--GAVTMVVSANPNSGKTFVTMNLAMSMVIKNKK-
A0A350PNH9      RVLRTNL-EFM--IGTH------PE--QNVIILTSFNPGSGKSHLAGNIAMSLAIKKKK-
A0A354LNT9      RVLRTNL-EFM--IGTH------PE--QNVIILTSFNPGSGKSHLAGNIAMSLAIKKKK-
A0A2M6GH67      RSIRTNL-DFI--SSA-------KK--KRLISITSTVSGEGKTFVAVNLGGIIALSDQK-
A0A389LWV6      RHLRSRM-IYL--TKR-------DS--PIVMLITSTEPRDGKTFVACNLASAYQMTGKK-
A0A1G9B1T9      RTIRSNL-LLQ--NHVN------GA--SKTLLVTSSVSNEGKTLCSVNLASSFAVANNR-
A0A3D0FMX4      RALRTRI-EFV--VRR-------KT--GIMVLTTSAQSGDGKTYLSTNLAALYAMSGKK-
A0A1M3MEI8      RIIRTRI-EFI--TQR-------KD--KITIMVTSSESGDGKTYFSLNLASVYGLASPR-
A0A1J5HQM0      RVIRTRI-EFI--VQR-------KK--NIMVAVTSSESGDGKTYFSINMAGVYSMASKK-
A0A653AC35      RVIRTRI-EFI--VQR-------KT--NISILTTSAESGDGKTYFCTNLASVYAMSGLK-
E4T131          RIIRTRI-EFI--VQR-------KT--NIIVMTTSTESGDGKTYFSINLASVYAMASKK-
A0A521H707      RSVRTNL-QFI--SNE-------SG--PKVIAITSTISGEGKTFIAINLAGVIAFSEKK-
A0A1F3D6P8      RNLRSSL-FLK--LKS-------EK--SKVIVITSSQPKDGKSFISFNLAASIAIVGYK-
A0A356Z058      RNLRSSL-FLK--LKS-------EK--SKVIVITSSQPKDGKSFISFNLAASIAIVGYK-
A0A3D1BT36      RNLRSNL-FFR--SKT-------NP--LKVILVTSCQPQDGKSFVAMNLASSIASVGHK-
A0A352ME00      RNLRSSL-FLK--SDH-------EK--SKVILITSSQPQDGKSFVSLNLSSSIASVGYK-
A0A3D3HL11      RNLRSSL-FLK--FRS-------EP--QKVIMITSAQPQDGKSFVSSNLAASIASVGHK-
A0A5R9QZP0      RNLRTNI-FLK--FKS-------KP--LKVILVTSALPQDGKSFIAFNLATAIAAVGHK-
A0A2W7RD29      RLLRTNL-NFI--LPN-------SE--STVLLVSSVLPAEGKSFTSVNLATAFALTELK-
A0A3N2NDY8      RIVRGNI-DFM--IRGK------EG--GNVIMITSFNPGSGKSFISFNLSASFALKGKK-
D7JEV9          RVIRTKI-EFI--LKR-------KE--KITVLISSTESGDGKTYISLNLAGVFALQNKK-
A0A4R6H3B7      RELRTNL-QFV--APKKN-----NE--CTIIGVNSVISGEGKSFTSANLASMIALNNKK-
A0A2W7QSQ0      RMIRSNL-KFQ--SG--------DN--NKVILVSSSMSGEGKTFFCLNLAATLSIVDKK-
R7F6L5          RVVRTNL-DFF--LTSDK-----KG--AQVIMVTSANPGSGKTFITMNLAVALALKHKR-
A0A553GA49      RKLRTNL-GFW--PWKDT-----LE--GRVVLFTSTMPGEGKTFCSYNLAQSLASLGKK-
A0A497D6F6      RSVKNKI-NFI--SGK-------KS--NPVIAFTSSIANEGKSFSALNIASLYALSKKK-
A0A5M4AAB9      RALRTKL-KFI--QNG-------NE--HNVIAVTSTAAGEGKTFTALNLAASFALLGKK-
F4KR18          RTLRTNL-QFH--QRE-------KT--KSIL-VTSSTSDEGKTFVATNLAMSFALAKKK-
C9LKL0          RMLRYGL-NFM--R---------HS--AKVCVVTSSTPGQGKSFISRNLAAIMGMANKR-
A0A3D0QPV7      RTIRTNM-QFL--TAD-------KD--AKLVSVTSTISGEGKTFVAINLAGMIAFSGKK-
A0A496KT23      RTVRTKL-EFT--LGFD------GR--NKVVMLSSLNPGSGKTFITANLSAAFSLKGKR-
L1M9T3          RTVRTKL-EFS--MGFD------NG--CKVIMVTSMNPGSGKTFITANLSTAYALKGKR-
A0A3C0I8F1      RSVRTNL-DFV--LNKSGGLNDTST--SKVISITSTISGEGKTFVAANLAGIIAMLNLK-
R5JJI4          RIIRTNM-EFM--RVKS------DN--LQVVMFTSANPGAGKTFVSSNLAMSIAQTNKK-
A0A3D2HF71      RSVRTNL-KYF--MKD-------IS--NPVIAVSSTITGEGKTFVAVNLAAIIALPGKK-
A0A0A2DQN2      RILRSNM-DFM---GQNG-----VM--PKRIVLTSFGAEAGKSYISYNLAKSLVFAGKS-
A0A0A2F2N5      RVLRTNM-GFM--KKYGR-----TS--GQRIMCVSFGANAGKTFTTYNLARSLIFADKK-
L1NGW4          RVLRENL-RFM--IGSGD-----TP--SKKIIFTSFGESAGKSYVSYNLAKTLTFSGST-
Z4WRA0          RVLRENL-RFM--IGSGD-----TP--SKKIIFTSFGESAGKSYVSYNLAKTLTFSGST-
U2K8K9          RVLRENM-RFM--IGSAA-----GK--TKKIIFTSFGESAGKSYVSYNLAKTLTFSGHR-
A0A069ZM60      RVLRENM-RFM--IGTGG-----KK--AKKVIFTSFGESAGKSYVSYNLAQTLTFAGHS-
J6GV98          RVLRENM-RFM--IGTGG-----KK--AKKVIFTSFGESAGKSYVSYNLAQTLTFAGHS-
A0A134B4F8      RVLRENM-RFM--IGTGG-----KV--AKKVIFTSFGESAGKSYVSYNLAQTLTFAGHS-
A0A134B8C7      RVLRENM-RFM--IGTGG-----KV--AKKVIFTSFGESAGKSYVSYNLAQTLTFAGHS-
A0A4Z0EKR0      RLIRTNL-HFA--AVG-------RK--KTVFLITSSMSGEGKTFFSINLGASLAITDKR-
A0A229I3A5      RVLRTNF-EFT--IGTH------PE--QNVIVFTSFNPGSGKSHIAANMAMSLAIKKKK-
A0A3R6HJB3      RVLRTNF-EFT--IGTH------PE--QNVIVFTSFNPGSGKSHIAANMAMSLAIKKKK-
B5CTK0          RIIRTNM-DFM--RMKK------DN--MKVVTFTSMMPGAGKTFVSMNLALSFALTDKK-
A0A1M6B6D5      RSLRSSL-QFL--YKQQG----ITG--AKTVLLTSSVSGEGKTFCSINLASIFALSDKK-
A0A451FS66      RSLRSSL-QFL--YKQHG----VTG--AKTVLFTSSVSGEGKTFCSINIASIFALSEKR-
A0A2E3GN39      RGVRSNL-EFL--D-AD------KG--FRSIAVTSTIPGEGKTFVAINLAAIIAMQGKR-
A0A3D1MEL0      RGVRSNL-EFL--E-AE------KG--FRSIAVTSTIPGEGKTFVAINLAAIIAMQGKR-
F0R0C9          RVLRTNL-EFM--TSEN------EK--ANVILLTSFNPGSGKTFLSLNIAGSLALKGKK-
A0A2A4N9A6      RSLRANL-QFI--S-TN------PG--PKIMAITSTISTEGKTFVAINMAGIIALSGKK-
A0A368D1N7      RGVRSNL-EFL--E-EE------KG--FRSIAVTSTIPGEGKTFVAINLAAIIAMQGKR-
A0A3B8TU58      RGVRSNL-EFL--A-AE------KN--FRSIAVTSTIPGEGKTFVAINLAAIIAMQGKR-
A0A1T5IIR6      RMLCTNL-SFL--DSGK------KA--PFVIATTSYSSSSGKTFITANMASCLADAQKR-
A0A3E0QD27      RSVRTNL-QFI--S-NE------PG--PKVVAITSTISGEGKTFVAINLAGVIAFSEKR-
A0A0M1W1I6      RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
A0A4R4GHU2      RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
I8WPR6          RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
A0A0K2HKS3      RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
B6W3W8          RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
A0A4R4GSI6      RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
A0A076IRY8      RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
A0A3A6AD54      RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
A0A3A6MIU7      RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
I8WPP8          RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
A0A372Y7D2      RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
A0A3E4JJC9      RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
A0A3E4WDQ0      RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
A0A414H9P2      RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
C3R5A8          RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
A0A1C5XJA7      RILRTNM-SFM--AKKD------RP--LQVITFTSFNSGAGKSFVAFNLADSLAYTKKK-
A0A3E5BU42      RILRTNM-AFM--AKKD------KP--MQVITFTSFNEGAGKTFVSRNLAMSLVLTKKR-
R7CUW4          RILRTNM-AFM--SRKD------RP--TQVITFTSFNEGAGKTFISCNLAMSFVYARKR-
A0A416GGJ1      RILRTNM-AFM--AKKG------VP--VKVITFTSFREGAGKTFILRNLAVSLMAAKKK-
D1JY72          RIIRTNM-DFM--RVKS------KN--MQVVTFSSFGPGAGKTYVSSNLAASFAQTDKK-
D7J4K6          RILRTNM-TFM--VKKD------KP--MQVVTFTSFNEGAGKTFISRNLAMSLVLTRKR-
Q8ABP9          RILRTNM-TFM--VKKD------KP--MQVVTFTSFNEGAGKTFISRNLAMSLVLTRKR-
A0A5M6AHF7      RILRTNM-TFM--VKKD------KP--MQVVTFTSFNEGAGKTFISRNLAMSLVLTRKR-
D6D2Z5          RILRTNM-TFM--VKKD------KP--MQVVTFTSFNEGAGKTFISRNLAMSLVLTRKR-
A0A1T3EDR4      RILRTNI-TFM--VNSG------IS--PQVITYTSFSAGVGKTFNTLNLAASFSYMKKR-
A0A174SDD8      RILRTNL-GFM--LSQT------QE--RKVITLTSFNIGAGKTFISINLAASLVQTEKK-
A0A1H7RFH3      RILRTNL-GFM--LSQT------QE--RKVITLTSFNIGAGKTFISINLAASLVQTEKK-
A0A139L1N2      RILRTNL-GFM--LSQT------QE--RKVITLTSFNIGAGKTFISINLAASLVQTEKK-
A0A174TVL8      RILRTNL-GFM--LSQT------QE--RKVITLTSFNIGAGKTFISINLAASLVQTEKK-
A0A1H8BJR6      RILRTNL-GFM--LSQT------QE--RKVITLTSFNIGAGKTFISINLAASLVQTEKK-
R9H6G0          RILRTNL-GFM--LSQT------QE--RKVITLTSFNIGAGKTFISINLAASLVQTEKK-
A0A412GR09      RILRTNL-GFM--LSQT------QE--RKVITLTSFNIGAGKTFISINLAASLVQTEKK-
A0A4Q5DX00      RILRTNL-GFM--LSQT------QE--RKVITLTSFNIGAGKTFISINLAASLVQTEKK-
A0A081PBV5      RILRTNI-GFM--A-AG------KE--QRVITFTSFNIGAGKTFTAINLAASFRYLNKK-
A0A1I2AN85      RILRTNI-GFM--A-AG------KE--QRVITFTSFNIGAGKTFTAINLAASFRYLNKK-
A0A4U0GMP3      RILRTNI-GFM--ASAD------KT--LQVITFTSFNIGAGKTFTAMNLAASFSFLQKR-
A0A1H6CKR6      RIFRTNL-GFM--SAGD------KS--QKVITFTSFNVGAGKTFSVINLGVSLTYLKKR-
A0A235E1C0      RIFRTNL-SFM--SSGD------KK--QKVITFTSFNVGAGKTFSVINLGVSMTFLKKK-
R6D982          RILRTNL-GFV--ASQS------PG--QKVVTLTSFNVSAGKTFVSVNLSASLVQADKK-
A0A1F0I8C4      RILRTNL-GFM--ISQP------QE--QKVITLASFNMGAGKTFVSVNLAASLVQAEKK-
A0A3A5RIJ2      RILRTNL-GFM--ISQP------QE--QKVITLASFNMGAGKTFVSVNLAASLVQAEKK-
A0A515IZJ5      RILRTNL-GFM--ISQP------QE--QKVITLASFNMGAGKTFVSVNLAASLVQAEKK-
A0A5M5NLR3      RILRTNL-GFM--ISQP------QE--QKVITLASFNMGAGKTFVSVNLAASLVQAEKK-
A0A0D5BSQ0      RILRTNI-NFM--AKNG------EP--PRVITFTSFSAGVGKTFSALNLATTLSYLEKK-
A0A1T3F6P5      RILRTNI-NFM--TKDE------HP--PKVITFTSFSAGVGKTFSVLNLAATLSYLDKK-
A0A0W8EPA0      RILRTNI-NFM--TKDE------HP--PQVITFTSFSAGVGKTFSVLNLAATLSYLDKK-
A0A365UKN1      RILRTNI-NFM--TKNE------HP--PKVITFTSFSAGVGKTFSVLNLAATLSYLDKK-
A0A4R6WE41      RILRTNI-NFM--AING------AP--PQVITFSSFTIGAGKTFNVMNLSATVSYLKKR-
A0A2T5RP38      RILRTNI-NFM--TKDD------AP--PKVLTFTSFSAGVGKTFSVLNLATTLSFLEKK-
A0A1A6CF06      RILRTNI-NFM--TKDE------HP--PKVITFTSFSAGVGKTFSVLNLAATLSYLDKK-
A0A1T3D6S8      RILRTNI-NFM--TKDE------HP--PKVITFTSFSAGVGKTFSVLNLAATLSYLDKK-
A0A1P8E011      RILRTNM-SFM--AREG------KH--PQTITLTSFIPGVGKTFTSLNLSSTLSFLNKK-
A0A1V3N3U3      RILRTNI-NFM--SREG------RA--PQVITFTSFGVEVGKTFSSINLSATLSFMEKR-
C2FUH6          RIIRTNI-GFM--SRNG------NS--PQVITFTSFSIGAGKTFTALNLAATLSFLDKK-
A0A0B8T471      RILRTNI-GFM--SSAE------RE--IRVITFTSFNVGAGKTFTAVNLAASLTFLLQN-
A0A4R7D2K0      RILRTNI-GFM--SSAE------RE--IRVITFTSFNVGAGKTFTAINLAASLTFLLQN-
A0A2X2J8S4      RILRTNI-NFM--SRGG------VP--PKVITFSSARVGAGKTFSVINLATTLSFLNKR-
A0A3C0S618      RILRTNI-NFM--SRGG------VP--PKVITFSSARVGAGKTFSVINLATTLSFLNKR-
A0A4P7DRF9      RIFRTNL-GFM--SSGD------KE--QKVLTFTSFNVGAGKTFSVINLGVSFTFLKKR-
A0A239XXC4      RIFRTNL-SFM--SSGD------KK--QKVVTFTSFNVGAGKTFSVINLGVSMTFLKKK-
A0A4U9K473      RIFRTNL-SFM--SSGD------KS--QKVITFTSFNVGAGKTFSVINLGVSMTFLKKK-
A0A3D4RLG4      RTIRTKI-EFI---VGR------KQ--NIVLSITSTQSGDGKTFLATNLAALYGMTGKK-
A0A3N2LCI3      RVLRTNV-EFM--CNSS------EG--NKVIAMTSFNPGSGKSFVSMNLGMAIALKGKK-
A0A1H6Z2F8      RSLRTNI-QFV---VGE------RQ--NTVVLLTSSMADEGKSFVAMHLAHSLALASRK-
A0A2P8G5K0      RSLRTNI-QFT---TGE------RP--HMVILLTSAMANEGKSFVAMHLAHSLALAGKK-
A0A519SYE7      RSIRTNL-DFI---SPA------GK--KRIISITSTISGEGKTFVAVNLSGIIALSGQR-
A0A5Q4EKA0      RAIRTNL-QFI---NND------PG--PKLVAVTSTISGEGKTFFAMNLAGILAFSNKK-
A0A3D4CJE1      RTIRANL-QFI---SNK------PG--SKVMAITSTVSGEGKTFVAINIAGIIAYSGKK-
A0A4Q5ZQ60      RSIRTNL-EFI---SSS------AK--KRIISVTSTIGGEGKTFVAVNLAGIIAQSGQR-
A0A519Q885      RSIRTNM-EFI---NAA------NK--KRLISITSTISGEGKTFVAVNLAGIIALSGQR-
A0A519TAP8      RSIRTNL-DFI---SPS------NK--KRIISVTSTISGEGKTFVAVNLGGIIALSGQR-
A0A2K8ZAP1      RALRTNL-LFL--NGDA------QK--NQVILFTSSISGDGKSFMSLNLGASLALVNRK-
A0A2T4XEQ1      RRLHNNI-IYS---QPD------LE--VKTILVTSPGKGEGKTTTAVNLAGILAESGKR-
A0A2T2TDL4      ----------LQLGRPD------ET--NTTVLVTSPGSGDGKSLTAANLATVTAQAGHS-
A0A348PT57      RTLRTNL-DFF---QTD------NE--KKIIAVTSTISGEGKTFVAINLGGILAFSDKK-
A0A3D1AEJ6      ------M-DFM--RVKQ------DN--IKVITTTSTSVGSGKTFVSSNLAASLAMTGKK-
A0A3D3LSK1      KALRTRI-TFS--KLED------KP--LKTILVTSSLPSDGKTIVSVNLAGSFALDNKK-
A0A496L711      RVIRTKI-EFI---LKR------KE--KITVLISSTESGDGKTYISLNLAGVFALQNKK-
R7JFY1          RILRANM-DFM--RGGD------EH--MQVLLFTSMNAGAGKTFISSNLAASLVLTHQK-
A0A1V5S5I3      RVLRTNL-EFMLDAKTG------GK--AGVTLFTSFNPGSGKTFLAMNTAAVFALKGKR-
A0A2M7VVW6      RTIRTNL-QFI--S-KS------EE--SKLMAITSTISGEGKTFCAINLSGIIAMSGKK-
A0A656PYT8      RLIRSNL-GFM--SVKS------GK--LQIIMVTSSNPHAGKTFVTTNLAMTLALADKK-
A0A413V760      RIIRTNM-DFM--RVKA------AN--LQVVMFTSANPGAGKTFVSSNLAMSIAQTNKK-
A0A641LIG3      RIIRTNM-DFM--HVKS------EK--LQVVMFTSANPGAGKTFVSSNLAMSIAQTNKK-
A0A641LPE6      RIIRTNM-DFM--RVKS------EK--LQVVMFTSANPGAGKTFVSSNLAMSIAQTNKK-
A0A1T4NDR5      RALRTNI-MYK---NFD------AP--IKVINITSATQGEGKSTTCLNLAVVFSQLNKK-
A0A3D5KRM7      RVLRTNI-LKQ---LRE------NN--WNSFFITSATPGAGKSWVATNLAIAIALEGNQT
A0A3M1NUH2      RHLRTNI-QFS---RPD------TV--VETIVVTSPSVEEGKSTTAANLAVVMAEAGRR-
A0A359ATS6      RVVRTNL-EFM---DGS------GEPDSNVLMLTSFNPGSGKTFLTMNMAISLAIKGKS-
A0A1V6HYH8      --------------------------------MTSTISGEGKTFVAINLGGILALSNKK-
A0A2E0MDX6      ------M-QFI---ANN------EG--SKIITVTSTISGEGKTFVAINLGGIIAFSEKK-
A0A2M7KCE1      RSVRSSL-EFI---KNI------KE--SKTIAISSTISGEGKTFIALNLGGIYSFQGKK-
A0A523GUD4      MRLLSKL-DTF---RNG------TH--KQTVMITSALSGEGKSTISTNIAIASSRNRQRP
A0A641X2Z6      RTIRTNI-QFS---NVG------QE--LKTIIVTSATPNEGKSTTISNLAVVMAQAGHK-
A0A519PJW5      RSIRTNL-DFI---SPS------NK--KRLISVTSTISGEGKTFVTVNLGGIIALSGQR-
A0A519T3R9      RSIRTNL-DFI---SPA------SK--KRLISITSTISGEGKTFVTVNLAGIIALSGQR-
                                                  *     **:    . .          

A0A3M1Y2F5      TLLVDLDLRNPSQPEYFRYP-----RQ-MGISNGLLGPE-RSHWKKWIIKDV----ESQI
A0A1G1TG88      VIVLDLDMRKPKVNLAFGAE-----NVK-GVSTILIDRH---SVAECIQHTS----IDAL
A0A661XXA6      VIILDMDLRRPKVHKAFDKE-----SSDCGMSTLLIKKH---NLSECITKSH----IEDL
A0A2T2UAJ4      TIVVDADLRRPWMHEMLNVD-----RD-LGLSQVLYEGE----LDPEAYATE----VENL
A0A519SD85      VILVDADLRKPKLHESFNTG-----NQ-MGLTNYIHSDL---ALEQIIRKTS----IENL
A0A4Q3SEI4      VVLVDLDLRHPKTTTMHDLN-----GQ-RGVAEFLENNE--VPVSTIMYPTS----NEKI
A0A3M1TXY5      TLLIDTDLRRPKVQTYFRTE-----HH-AGLSDFLCGEV--DYVNEIIHSTH----IENL
A0A2E0VQ27      VLLLDLDVRKPELHEELGMD-----NS-DGFCEAIKSDR--HALDLVQNTSD-----ENL
R6U429          VLLLDLDLRKGTLGKALEHNK-------SGISAFLNGKL-----ESIVPEIQ--NIKENL
R5DEG6          VVLVDLDIRKGTLSSHVQVSD-------MGVTNYLSGRI--DNVDEIIQKGE---LYDKL
A0A5C8AF42      TILLDLDLRKPKVHLGLNTN-----NN-YGMSGLIINKF---TLEQCIQHST----IEDL
A0A642EJV3      VLVIDGDLRHASASSYIDSPD-------KGLSDYLGGRI--DNLDEIIVPDP---KHKSM
A0A161LWY6      TILVDMDLRKPSVSKRLSLE-----NE-TGITNCMLGQV---SLDDAIIKKS---PEINF
A0A212J9Z9      VIIVDLDLRRPSVAKTLQID-----SQ-KGISNYLIGQV---TLDEIIYSHP----DYGF
F5IV23          VIIVDLDLRRPSVAKTLQID-----SQ-KGISNYLIGQV---TLDEITYSHP----DYGF
F8X2T0          VIIVDLDLRRPSVGKTLQVD-----AQ-KGISNYLIGQV---TLEEIIISHP----DYGF
A0A1M3LAG1      VIIVDLDLRRPSVGKTLQID-----AQ-KGISNYLIGQV---TLDEIIISHP----DYGF
A0A212K6G4      VIIVDLDLRRPSVGKTLQID-----AQ-KGISNYLIGQV---TLDEIIISHP----DYGF
A0A4Y9IPG7      VIIVDLDLRRPSVGKTLQID-----AQ-KGISNYLIGQV---TLDEIIISHP----DYGF
A0A2V3PNY7      VVLIDFDLRRPSVGKLLSIE-----SK-KGVSNYLIGQV---TLDEITITHP----EYEF
A0A1M5DFS8      VVLIDFDLRRPSVAKLLNLQ-----SK-KGVSNFLIGQV---SLDEITVTHP----EYEF
A0A4Y8KZS5      VVLIDFDLRRPSVAKLLNTQ-----TK-KGVSNFLIGQV---SLDEITITHP----EYEF
A0A239K409      VVVLDFDLRKQSILADLGLA-----CE-FGITDYLSFNT--VTVEEMLNQSD---QVPNL
A0A350V3E4      VLLLDCDFRKPRMHNIFNMK-----RY-PGLCDYLFGTV---TIEEAVRETS----FPNL
A0A1M6MYT6      AVILDLDLRKSRINEDIGLK-----IE-KNVVDYILGKA---TLEEITHKTK----HPRL
A0A2P8CDS1      AVLLDLDLRNSKMAEMHNYD-----KN-RGVSNYLLGEM---RLEDITFRST----HPYM
A0A5M4A2I9      AVLLDLDLRNSKMAEMHNYD-----KN-RGVSNYLLGEM---RLEDITFRST----HPYM
A0A353WYK7      VVLVDLDMRKPRLQKVFYHN-----IQAKGVSTILIEKH---SVEECILKTN----LENL
A0A355BP94      VILLDLDMRKAKEILHARVT-----DPSKGISTLLIHKT---TLEESITKTD----MAGF
A0A136LSC7      VILVDLDMRKPKSEKYPTGN-----DSSMGMSTILIKKN---NWQECVLKTS----LENF
A0A5C7N8Q5      VVLVDLDMRKPKSEKYPTGN-----DSPLGMSTILIKKN---KWQECVVKTS----LENF
A0A1V5S1J9      TILVDLDMRKPSINTGL---YL---SVNKGISNYLANQI---SLDEAIVKHP----DYKF
A0A0A2EYC8      VLLIDFDIRKPNLTRNLGD-II---KTKSGFVNYMIGDC---TIEEAIESTP-----YGF
A0A2G6H6Y4      VLLIDFDIRKPNLTENLQESLS---KHKVGFVNYMIGEC---SLEEAIDTTG-----YGF
A0A1M3DPL8      TLLVDMDIRKPSVYQTI---GC---DNNMGVSNFLANQC---SLDEIIVRPD----GAEF
A0A1V5F519      TLLIDMDIRKPAINRRF---NV---NHPKGVTNYLINEC---TLDEIINVVP----EVNY
A0A2G6R1T9      TLLIDMDIRKPSVGDRL---GI---SEKAGVTNYLIGEN---ELDDLIIKND----DFSF
A0A2W4RDE8      TILIDADMRRPKVASYFQLE-----ND-KGLSNYLIGEA---SLKEIINETG----IKGY
A0A0L8VEV2      VLLIDCDLRKPSLHNRLKYK-----NK-EGLSTYLTDFS---SFDDIFRQTR----VENL
A0A1I2A9Z9      VLLVDCDLRKPSLHNRLKYK-----NK-EGLSTYLTDFS---TFEDIFRQTR----VDNL
A0A142HHS5      VVILDLDMRKPKVNLAFDAE-----NV-RGISTILIDRH---TVAECIQHTS----IESL
A0A660LQT8      AVVVDLDLRKAATSLFVGRPK-------YGIANYLNGQG---TLDEIVCKYR----DTDL
A0A350PNH9      VLVIDGDLRRGATSMLVGSPG-------EGLSDYLNGRT--DDLEGIICHGEEYGLVKDF
A0A354LNT9      VLVIDGDLRLGSTSMLVGSPG-------EGLSDYLNGRT--DDLEGIICHGEEYGLVKDF
A0A2M6GH67      VVILDLDLRRPKVNLAFDAE-----NN-IGISTILIERH---SVPECIQKTA----IPNL
A0A389LWV6      TLMIDFDLRRPALSKALDLD-----TQ-KGLSNFLIGKA--SLADVVISHPD-----FGF
A0A1G9B1T9      TIIIDADLRRPRVHNILEKT-----NG-VGLSNYLQGTA---DMSEIIQPTD----QENL
A0A3D0FMX4      TLLMDMDIRKPNIHEKLGTS-----IE-KGLTNYLIGEI---SKQEMIQHDP----SYEF
A0A1M3MEI8      TLLVDLDIRKPSIHKRLGVE-----NS-LGLTNFLVGQC---KAQDIIMRPD----GAGF
A0A1J5HQM0      VLLVDLDIRKPSIHERFNIN-----PS-QGITNFLVGQA---TLDEVIIHIP----ELEY
A0A653AC35      TILVDMDIRKPSINERLSIS-----EK-DGVTNYLIGEK---PLDKLILKKD----GINF
E4T131          TILVDMDIRKPSVNQRFNIV-----HP-LGVTNYLVGQC---ALDEIILKLP----KVDF
A0A521H707      VVIIDLDMRKPKIHLGFNVE-----NI-RGMSTILIGKD---TTDFCINKSS----LANL
A0A1F3D6P8      TIIIDCDLRKPTLHEKFKED-----NS-SGISNFMVKNA---TVTEIIRNTS----VENL
A0A356Z058      TIIIDCDLRKPTLHEKFKED-----NS-SGISNFMVKNA---TVTEIIRNTS----VENL
A0A3D1BT36      TIILDCDLRRPTLHDKFKID-----NE-GGITKYLTDKN---VDNDIILKTF----VDNL
A0A352ME00      TVLIDCDLRRPTLHIKLKED-----NA-KGISNFMIKKA---TADEIIRNTA----ITNL
A0A3D3HL11      TVLLDCDLRRPTLHEKLKIV-----NS-VGLSNYMVNNA---STKEIIKKTD----VDNL
A0A5R9QZP0      TIIIDCDLRKPTLHMKLKKD-----NP-FGISNFMNKEV---TAQEIIFDSG----IKNL
A0A2W7RD29      VLIIDCDLRKPKVSDYLGVD-----NT-AGLSNYLSRR---VDDESTIVKAT---SIPGL
A0A3N2NDY8      VLVVDGDLRHGSASQFVDMPS-------KGLSNYLTGNT--DNWQSLVVPVA---GQNGM
D7JEV9          ILLIDFDIRKPNLTKNLGGMVK---NK-LGFVNYMIGDC---SLNEAIESTP-----YGF
A0A4R6H3B7      VLLVDCDLRKPSLHNRLKYK-----NK-EGLSTYLTDFS---TFEDIFRQTR----VDNL
A0A2W7QSQ0      VVVVDLDLRRPSIFKSLNIK-----SK-HSLFDYLNHDI--KDLKEIITPSG---INSNM
R7F6L5          VLMIDFDLRRAALSNAFGSPR-------EGIANYLCGAD---QMSDIVQHNV--NDVEGL
A0A553GA49      TVILDFDLRKGDLSENYFKS-----EN-KGISMFLSNQ---VELDDIIEKQE----GKNI
A0A497D6F6      TVLLDLDLRMSSMAKNLELD-----TD-KGVVSYLTGE---AGIDDITFSSK---H-PDL
A0A5M4AAB9      TVFLDLDLRNSRIGKKMGYE-----SN-RGASNYILNE---MSINDITFNTP---H-PYL
F4KR18          TIVVDFDLRKPSISKYFEGN-----AE-IGLSSFLINQ---LEVEEVIQTSG---DLPNL
C9LKL0          VLLVDADIRKRTLSSKFGRS--------NGLTGWLVDEEEKLSLDEIIIKDG---VAKQV
A0A3D0QPV7      VVILDLDMRKPKIHIGFGTD-----NE-VGMSSLLIGRD---QLEQCIRKSE----MENL
A0A496KT23      VLVMDLDLRKASLSDYVGQPK-------VGISNYLSGQI--EDWHEIIT------PLDRV
L1M9T3          VLVMDLDLRKASLSQYVGNPQ-------IGLSNYLSGQI--NDWHKIII------PLGQV
A0A3C0I8F1      VLIIDFDMRRPKVHIAFDREEE---DNLKGTSTILIGRH--TPQECIQHTPI-----ENL
R5JJI4          VVLVDVDIRKGTLSGIFSNPS----GR-MGLTHYLSGRT--DGLDDIIGASE---EYGKL
A0A3D2HF71      VLLIDLDLRKPKAHKILGNND----NT-EGISKYLIGES--KIEDIIIKTEV-----ENL
A0A0A2DQN2      VVLIDIDIRKRTLTRKLNFE-----HN-MGLTSYLSGMD--VSIDELIQQDP---NCEML
A0A0A2F2N5      VVIVDLDLRKGMMSKRLEMS------G-RGMTNYLSDDS--IKIEDVLRQDK---NCPSL
L1NGW4          VVIVDLDLRKGTLSRRAHVA------G-QGVTEYLVDKA--MPVEKIIHKDP---NFSKL
Z4WRA0          VVVVDLDLRKGTLSRRAHVA------G-QGVTEYLIDKA--MPVEKIIHKDP---NFSKL
U2K8K9          VVLVDLDLRKGTLSHRAGII------G-KGVTEYLSDPT--VQVDQIIRKDP---NAPKL
A0A069ZM60      VVLVDLDLRKGTLSRRIGLA------G-MGATEYLSNPD--VRLDQILRKDP---NAPKL
J6GV98          VVLVDLDLRKGTLSRRIGLA------G-MGATEYLSNPD--VRLDQILRKDP---NAPKL
A0A134B4F8      VVLVDLDLRKGTLSRRIGLA------G-MGATEYLSNPD--VRLDQILRKDP---NAPKL
A0A134B8C7      VVLVDLDLRKGTLSRRIGLA------G-MGATEYLSNPD--VRLDQILRKDP---NAPKL
A0A4Z0EKR0      TLLLDLDLRNPKVAQRLALP-----AG-PGITDYLVSSD--ILISDIIRESE---QVPNL
A0A229I3A5      VLLIDGDLRHGSTSMLIHS------PG-EGLSDYLNGRI--ADIHDILYKGEENGLVKNF
A0A3R6HJB3      VLLIDGDLRHGSTSMLIHS------PG-EGLSDYLNGRI--TDIHDILYKGEENGLVKGF
B5CTK0          IILMDLDIRKGTLSAHSKR------KE-LGVTDYLSGKI--ADLNQIIVKGK---LHANL
A0A1M6B6D5      TIIIDLDLRKPKVGAAFNIQ-----NS-MGVVNYLINEA---DLDGIIQKTE---I-DTL
A0A451FS66      TVIVDLDLRKPKVSGAFNMD-----NS-IGVVNYLINEA---DLDTITQKTE---V-DYL
A0A2E3GN39      VLLVDVDLRKPRIHKIFDLP-----NS-AGMSTLLNKRS--TKEDITFSTSE-----ENL
A0A3D1MEL0      VLLVDVDLRKPRIHKIFDLP-----NS-AGMSTLLNKRS--TKEDITFSTPE-----ENL
F0R0C9          VLIIDGDLRKASVSAFIDS------PK-TGLSDYLGRKT--DAIDTAVVEAP---QCPGL
A0A2A4N9A6      VIILDLDLRKPRIHKAFEID-----NA-KGMSTILIGKD--KVEDCIFKSNI-----DTL
A0A368D1N7      VLLVDVDLRKPRIHKIFDLP-----NS-SGMSTLLNKRS--IKEDIIFSTPE-----ENL
A0A3B8TU58      VLLVDVDLRKPRVHKIFNLP-----NS-AGMSTLLNKRS--IKEDVTFSTSE-----ENL
A0A1T5IIR6      VILVDTDMRKRSLSGVFALKH----KT-KGLSNYLYDLD--LTLDDILFKD----VKSGI
A0A3E0QD27      VVIIDLDMRKPKIHLGFNVE-----NT-KGMSTILIGKD--EA-DNCIRKSN---L-TNL
A0A0M1W1I6      VILIDMDIRKGTLTSHTRLHT----EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
A0A4R4GHU2      VILIDMDIRKGTLTSHTRLHT----EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
I8WPR6          VILIDMDIRKGTLTSHTRLHT----EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
A0A0K2HKS3      VILIDMDIRKGTLTSHTRLHT----EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
B6W3W8          VILIDMDIRKGTLTSHTRLHT----EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
A0A4R4GSI6      VILIDMDIRKGTLTSHTRLHT----EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
A0A076IRY8      VILIDMDIRKGTLTSHTRLHT----KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
A0A3A6AD54      VILIDMDIRKGTLTSHTRLHT----KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
A0A3A6MIU7      VILIDMDIRKGTLTSHTRLHT----KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
I8WPP8          VILIDMDIRKGTLTSHTRLHT----KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
A0A372Y7D2      VILIDMDIRKGTLTSHTRLHT----KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
A0A3E4JJC9      VILIDMDIRKGTLTSHTRLHT----KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
A0A3E4WDQ0      VILIDMDIRKGTLTSHTRLHT----KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
A0A414H9P2      VILIDMDIRKGTLTSHTRLHT----KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
C3R5A8          VILIDMDIRKGTLTSHTRLHT----KE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
A0A1C5XJA7      VILIDLDIRKGSLSHRMHK------HG-VGMTNYLADET--IALDDIIHDCG---KD--Y
A0A3E5BU42      VVLVDLDIRKGTLSRHFSK------HP-VGVTNYLADES--IALDDIIHTDE---KSGGL
R7CUW4          VVVIDLDIRKGTLSRHLGE------HR-TGVTNYLADTT--VTVDDIIRKGE---H---F
A0A416GGJ1      VVVLDLDIRKRTLSRHFAKH------P-YGMTNYLSDAS--IRLEDILVKGN---GVDIP
D1JY72          VILIDMDIRKGTLTSHTRLHT----EE-KGMTSFLAGKA--TT-DEIIKHNE---ICENL
D7J4K6          VVLVDLDIRKGTLSRHFHK------HP-VGVTNYLADDS--IRLDDIIHTDG---KFDNL
Q8ABP9          VVLVDLDIRKGTLSRHFHK------HP-VGVTNYLADDS--IRLDDIIHTDG---KFDNL
A0A5M6AHF7      VVLVDLDIRKGTLSRHFHK------HP-VGVTNYLADDS--IRLDDIIHTDG---KFDNL
D6D2Z5          VVLVDLDIRKGTLSRHFHK------HP-VGVTNYLADDS--IRLDDIIHTDG---KFDNL
A0A1T3EDR4      VVLVDLDLRKGTLSTRVGLE-----GK-AGVSHYLSGLL--RDINTVIYHRE---IGLGV
A0A174SDD8      IVLLDLDLRKGKLSEMSHCT-----QV-KGVAHYLSNPS--IEVNDIILRDA---FGEGL
A0A1H7RFH3      IVLLDLDLRKGKLSEMAHCR-----QV-KGVAHYLSDSS--VEVTDIIVQDT---FGEGL
A0A139L1N2      IVLLDLDLRKGKLSEMAHCR-----QV-KGVAHYLSDSS--VEVTDIIVQDA---FGEGL
A0A174TVL8      IVLLDLDLRKGKLSEMAHCR-----QV-KGVAHYLSDSS--VEVTDIIVQDA---FGEGL
A0A1H8BJR6      IVLLDLDLRKGKLSEMAHCR-----QV-KGVAHYLSDSS--VEVTDIIVQDA---FGEGL
R9H6G0          IVLLDLDLRKGKLSEMAHCR-----QV-KGVAHYLSDSS--VEVTDIIVQDA---FGEGL
A0A412GR09      IVLLDLDLRKGKLSEMAHCR-----QV-KGVAHYLSDSS--VEVTDIIVQDA---FGEGL
A0A4Q5DX00      IVLLDLDLRKGKLSEMAHCR-----QV-KGVAHYLSDSS--VEVTDIIVQDA---FGEGL
A0A081PBV5      VLLLDLDLRKGTLSNRVNAQKE---KG-LGVTNFLANPK--VTVDDIIYQGL---VGGII
A0A1I2AN85      VLLLDLDLRKGTLSNRVNAQKE---KG-LGVTNFLANPK--VTVDDIIYQGL---VGGII
A0A4U0GMP3      VVLLDLDLRKGTLSKSLKGRRK-------GVTHYLSDAN--VAWSDIVYKNE---FANSV
A0A1H6CKR6      VVLVDLDLRKGTLSNITKFP-----MP-IGATHYLSDSA--ITVDEIIYKDR---VDANI
A0A235E1C0      VVLVDLDLRKGTLSNITKFP-----MP-IGVTHYLSDSA--ITVDEIIYKDR---TDAEI
R6D982          VILIDLDLRKATLSLIAKARGN---GI-KGMAHYLSNKS--ISMDDIIMKDG---FGERI
A0A1F0I8C4      IIMIDLDLRKGRLSHFAHAK-----RV-KGVAHYLSNPL--VSADDIILHDA---FGEGL
A0A3A5RIJ2      IIMIDLDLRKGRLSHFAHAK-----RV-KGVAHYLSNPL--VSADDIILHDA---FGEGL
A0A515IZJ5      IIMIDLDLRKGRLSHFAHAK-----RV-KGVAHYLSNPL--VSADDIILHDA---FGEGL
A0A5M5NLR3      IIMIDLDLRKGRLSHFAHAK-----RV-KGVAHYLSNPL--VSADDIILHDA---FGEGL
A0A0D5BSQ0      VVVIDLDLRKGTLSSRIDLL-----HG-KGVSHYLSSPS--VSVDEVLHKSE---VANGV
A0A1T3F6P5      VVVLDLDLRKGTLSSRTGLL-----HG-KGTSHYLSNSS--IQISDILHKSE---VAEGV
A0A0W8EPA0      VVVLDLDLRKGTLSSRTGLL-----HG-KGTSHYLSNSS--IKISDILHKSE---VAEGV
A0A365UKN1      VVVLDLDLRKGTLSSRTGLL-----HG-KGTSHYLSNSS--IKISDILHKSE---VAEGV
A0A4R6WE41      VVMVDLDLRKGTLTRRMGIK-----FR-KGVTHYLSDSS--VKIDDVLYKSD---LSEGV
A0A2T5RP38      VVVIDLDLRKGTLSSRVDLL-----HG-KGSSHYLSSPS--ISIDEIIHKSD---VAEGV
A0A1A6CF06      VVVIDLDLRKGTLSSRVDLL-----HE-KGTSHYLSNSS--ISVDEILQKSE---LLENV
A0A1T3D6S8      VVVLDLDLRKGTLSSRTGLL-----HG-KGTSHYLSNPS--IKISEILHKSE---VAEGV
A0A1P8E011      VIVVDMDLRKGTLSERMGII-----HG-KGLSHYLSDVN--LELEEIIHYNL---HGKNV
A0A1V3N3U3      TVVVDLDLRKGTLSSRLGLL-----DK-IGCSHFLADAT--VTLDTVIYPVK---GLEFL
C2FUH6          ILILDLDLRKGTISSRVNVK-----SA-LGVSHYLSNSQ--VAIDDIICKSG---IADNV
A0A0B8T471      VVLLDLDLRKGTLSDHLKLG-----SV-KGVTHFLADPA--VSLDHITYKAN---VGNGV
A0A4R7D2K0      VVLLDLDLRKGTLSDHLKLG-----SV-KGVTHFLADPA--VSLDHITYKAN---VGNGV
A0A2X2J8S4      VIMVDLDLRKGTLSSRIPVP-----VR-KGITHYLSDKE--LNLSEVIYKTE---VSDNI
A0A3C0S618      VIMVDLDLRKGTLSSRIPVP-----VR-KGITHYLSDKE--LNPSEVIYKTE---ISDNI
A0A4P7DRF9      VVLVDLDLRKGTLSHKTKVP-----MP-VGITHYLADSN--TQIDDIIYKDR---IADGL
A0A239XXC4      VVLVDLDLRKGTLSNITKFP-----MP-IGVTHYLSDSS--VTVDEIIYKDR---TDSEI
A0A4U9K473      VVLVDLDLRKGTLSNITKFP-----MP-IGVTHYLSDSA--VTIDEIIYKDR---VDADI
A0A3D4RLG4      TLLIDLDIRKPNIHEKLGVD-----AG-LGVTNYLIGEC---EIED-ILHKD---TSYNF
A0A3N2LCI3      VLIVDGDMRHGSTSAYMGSP-----AK-GLADYLGGAVS---EVDTLIVKTP---ECQNM
A0A1H6Z2F8      VLLVDFDLRKPTLASLLNLR-----PE-GVTEHIALEKD---LLIQ---QCA---NGPPF
A0A2P8G5K0      VLLVDFDLRKPSLATLLNLR-----PN-GVTECIASGHE---PLIQ---QNS---SETSF
A0A519SYE7      VVILDLDMRKPKVNLAFGAE-----NV-RGISTILIERH---TVAE-CIQHT---NIESL
A0A5Q4EKA0      VIVIDFDMRKPKIHLGFNVE-----NI-NGVSTILSNID---TIDD-CIQPS---RVKNL
A0A3D4CJE1      VIILDLDMRKPKIHLGFNVE-----ND-RGMSTLLIGND---SLNN-CIKHS---ALKGL
A0A4Q5ZQ60      VVILDLDMRKPKVNLAFEAE-----NI-RGMSTILIEKH---SVQE-CIQHS---RLSNL
A0A519Q885      VVILDLDMRKPKVNLAFGAE-----NI-QGVSTILINRH---TVAE-CIQHT---SIESL
A0A519TAP8      VIILDLDMRKPKVNLAFDAD-----NV-RGISTILIERH---TLEE-CIQHT---SIESL
A0A2K8ZAP1      TVIVDMDMRKPKLHKSLHIE-----NK-LGLSNYLTGE---ADLDNLLHPII---GHENY
A0A2T4XEQ1      VLIIDFDFRRPNLHKTLGESQT------PGILELLFDG---VHFDDVIRETA----YPGI
A0A2T2TDL4      TLLIDGDLRRPRLHEVFDVSRT------PGITEALQ-----NDLDEHAMKRP---LIDNL
A0A348PT57      VIILDLDMRKPRIHKGFNST-----NE-YGMSTYLSNR---DNLKDIIRKSE----LDGL
A0A3D1AEJ6      VLLMDMDIRKGTLGKGVDTHKNIEGYD-IGLTSYLSKIV--TKVESLIIQDQ---DYPNI
A0A3D3LSK1      VILIDCDLRKPRVHTVF--EFD---RF-PGLSDFLFHH---VNFEDIVRDSG----FDNL
A0A496L711      ILLIDFDIRKPNLTKNLSGMVK---NK-LGFVNYMIGD---CSLNEAIESTP---Y--GF
R7JFY1          VVLLDLDIRKGTLGKQA-GYRG---E---GITNYLSGKV--TDVTSLICQDE---LVPGL
A0A1V5S5I3      ILVIDGDLRHGSASAYL-GSRH---K---GLSDYLGKRE--NNLDGLIQENP---DIPGF
A0A2M7VVW6      VIILDLDMRKPKIHLGF-GVKN---DK--GMSTILIDK---DQIKECIHHSE----LTNL
A0A656PYT8      VVIVDLDLRRRTLSKQM-GQRD---NR-NGVSGYISGTI--ANLNDIVFQSG---LHENL
A0A413V760      VVLVDVDIRKGTLSGIF-SNSS---NR-MGLTHYLSGST--DKLDDIIGRSE---EYDKL
A0A641LIG3      VVLVDVDIRKGTLSGIF-SNSS---NR-MGLTHYLSGST--DKVDDIVGRSE---EYDKL
A0A641LPE6      VVLLDVDIRKGTLSGIF-SNSS---NR-MGLTHYLSGST--DKLDDIVGRSE---EYDKL
A0A1T4NDR5      VLVMDLDLRIPTIHKKLRIR-----NT-MGITDLLNGRA--TVDN---VVKP---VFKNI
A0A3D5KRM7      VLLVDADLRHPSICNHLGLN-----CK-FGLIDYLSGVT--SLEQ--ILIHP---KIENL
A0A3M1NUH2      TVLIDADLRRPRVHQLFGRE-----LG-PGLAHFLVQEP--RFDE--ELVAT---PIDNL
A0A359ATS6      VLVIDGDLRRGSISDYVDTP-----K--IGLSDYLGKRI--DTPEEIIVVDK---KHPTL
A0A1V6HYH8      VLIIDTDLRRPKMSITFNNL-----ND-FGLSNYLLGEC--NIEQ--CIKGT---EINNL
A0A2E0MDX6      VIILDLDMRKPKTHIGFNVQ-----NT-IGMSTLLIGQS--SLED--CIQKS---HLENL
A0A2M7KCE1      TILIDLDLRKPRFHLCFNTD-----NS-KGLSTILIGKN--KVHD--CIKKS---KIANL
A0A523GUD4      SLIIDFDLRRPRLHHIFKVD-----KE-PGVVDAVTNQI--SFQE--LIKDS---GFPNL
A0A641X2Z6      VLLMDCDMRNPTQHKLFKLT-----N--KGLSNCISASE--EVRE--VIQKT---GIENL
A0A519PJW5      VIILDLDMRKPKVNLAFDAE-----NV-RGISTILIDRH--SVAE--CVQHT---SIESL
A0A519T3R9      VVVLDLDMRKPKVNLAFGAE-----NI-KGVSTILIDRH--SVAE--CVQHT---SIEAL
                 :.:* *.*                                                   

A0A3M1Y2F5      DILPAGPHLPNSIDLLDTGAFEELIEELPLHYQ--YVIVDLPPIMQASDYMLVEKWLDFT
A0A1G1TG88      QFISAGPTPPNPSELILSPRFDQMLNELYESYD--VVMIDTPPVGLVTDGILIMRRADIP
A0A661XXA6      DFIGAGPVPPNPSELILREAFDEILEKLRGLYD--VILLDTPPIGIVTDGLLAMQKADLP
A0A2T2UAJ4      FVIPAGDTVPNPAELLGSNRMKEFVEALEAKFD--YVLIDTPPALLFSDVLGLAPRCDGT
A0A519SD85      EFIPSGPLPINPSELLENEKIDVLINSLKRMYD--IIIFDSAPVGIVTDSTPILKKADIN
A0A4Q3SEI4      FVVPAGYSDVNPTELLLNGDINGLLTKLEATFD--FVLIDTCPVDPVTDAYILSESCDLT
A0A3M1TXY5      HIIPAGNPSNNPTDLISNSRMKELVEACMDEYD--HIIFDTPPIGLVSDYLILMHLTDYN
A0A2E0VQ27      YFIPAGQYDDSLEGKVFSAKALDIIHDLRWHFD--MVIVDVAPIGLFDDSIVLMRKSTAN
R6U429          DLISVGSLPPNPAELLVSEKFDKMMDELSARYD--YIFMDCPPVDIVADTSIIAKHADYT
R5DEG6          DIIHAGPVPPNPAELLLSDRLEALIAELRERYD--YIILDNVPAGVVADAVIVNRVADLT
A0A5C8AF42      DFITAGPIPPNPSELLLSDRFKEIVEELKQTYD--VIIIDNPPIGLVSDGIKNLTEADIP
A0A642EJV3      DILPVGTIPPNPTELLFDERLKQTIDTVREQYD--YVLIDCPPVELVADTQIIEKLADRT
A0A161LWY6      DLLLAGTIPPNPGEMIRSPKLLELINELKMRYH--YVIIDTSPVGIVSDAYPLAPISDCV
A0A212J9Z9      DIIPAGTLPPNPSELIKTAKTKQVLEHLKEMYD--YVIIDCSPVGLVSDAYILSEIADTT
F5IV23          DIIPAGTLPPNPSELIKTAKTKQVLEHLKEMYD--YVIIDCSPVGLVSDAYILSEIADTT
F8X2T0          DIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLVSDAYILSSMADTT
A0A1M3LAG1      DIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLVSDAYILSSMADTT
A0A212K6G4      DIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLVSDAYILSSMADTT
A0A4Y9IPG7      DIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLVSDAYILSSMADTT
A0A2V3PNY7      DVITAGTLPPNPSELIKTKKTKDLLDHLKSKYD--YVIVDCSPIGLVSDAYILSKYVDTT
A0A1M5DFS8      DVITAGTLPPNPSELIKTKKTKDLIEYLKTKYD--YVVVDCSPIGLVSDAYILSKYVDTS
A0A4Y8KZS5      DVITAGTLPPNPSELIKTKKTRDLIEYLKTRYD--YVIVDCSPIGLVSDAYILSKYVDTT
A0A239K409      FIVGSGAIPVNPAELMMSNRVEQLFEELQKKFD--YILIDTAPVGQVSDAFSLSKYVDLT
A0A350V3E4      HIMTCGTIPTNPAELIASKHMQTFLNMMKPKYD--YILIDSPPLATVTDAELLSSYVDGT
A0A1M6MYT6      KVIPAGPHPPNPLQMLTDKNLSGLIDQLKKQYD--VVIVDTPPVGMVADFFLLRDMFDAA
A0A2P8CDS1      WLIPSGSFPPNPGELLADKKLKELIELLKEEYD--VIVIDSSPL-LVADLFQYSHLCNAY
A0A5M4A2I9      WLIPSGSFPPNPGELLADKKLKELIELLKEEYD--VIVIDSSPL-LVADLFQYSHLCNAY
A0A353WYK7      DYISSGPIPPNPSELIHTGSFDKMIGDLKSKYD--VVIIDTPPVGLVTDGILALKKSDIA
A0A355BP94      DYIPSGPHPPNPSELLLSKAFEDLLAELRTRYD--YIVIDTPPVGLVTDGIMAMKRADLS
A0A136LSC7      DFIPSGPHPPNPSELLLNGEFSDFLEELRATYD--YVVIDTPPVGLVTDGVMAMKRSDLS
A0A5C7N8Q5      DFIPSGPHPPNPSELLLNGEFSDFLEELRANYD--YIVIDTPPVGLVTDGVMAMKRSDLS
A0A1V5S1J9      DILPVGVVPPNPGELIKSDNMNNLISILKETYD--YIVFDTSPIGLVTDAYGIIESVDII
A0A0A2EYC8      DFLKAGVIPPNPGEFVRRPQLLEMINLLKEMYD--YVVIDSSPLGLVADAYALFSTVDIK
A0A2G6H6Y4      DFLKAGVMPPNPGEFVRSPKLEQMITELKSMYD--YIIIDTSPLGLVTDSYALFPMVDVK
A0A1M3DPL8      DFITAGTVPPNAGELIRSDNLKDMFDELRKRYE--YIIVDTSPIGVVADAYSFAALSDIN
A0A1V5F519      DVIFAGTVPPNPAELIRSEKIIEMMGELRKRYD--YIILDSSPIGLVTDSFSLASLADVN
A0A2G6R1T9      DVLLGGTVPPNPGELIRSEKLKGMLKELRTRYE--YIIIDTSPI----------------
A0A2W4RDE8      DVITSGPIPPNPLDLIGTPRMAELLNELKQSYH--TIIIDSPPIGFVSEYIILMKYTDAN
A0A0L8VEV2      QFVSAGPIPPNPSELLENGKFEELIERCRDMFD--YIVFDNPPLSLVSDGIVIGQKVDIN
A0A1I2A9Z9      QFVSAGPIPPNPSELLENGKFEELIDRCRNIFD--YIVFDNPPLSIVSDGIIIGQKVDIN
A0A142HHS5      DFISAGPTPPNPSELILNPRFDLMIQELYRTYD--VILIDTPPVGLVTDGILIMRKADVP
A0A660LQT8      DVIPVGIMPPNPTELLYAERMDQLFTELKERYD--YIFLDCPPVEIVADAAIISRHADLT
A0A350PNH9      DVLPIGTMPPNPTELLFTDRLEKMIRQMRGEYD--YVFIDCPPVEIVADTQIIEKLADRT
A0A354LNT9      DVLPIGTMPPNPTELLFTDRLEKMIRQMRGEYD--YVFIDCPPVEIVADTQIIEKLADRT
A0A2M6GH67      DFIPAGPTPPNPSELILNPKFDEMLEELRQLYD--VIIVDTPPIGIVTDGTLVMRKADIP
A0A389LWV6      DILPAGTIPPNPSELINSEMTKKLLSFLSKEYE--YIILDCSPVGLVSDAHFLAKLADVV
A0A1G9B1T9      YVITAGKSDGHPGEILLSERLPQLINKLKMEFK--FVVLDTPPVKIVTDALVLSAYSDIN
A0A3D0FMX4      DIIYAGSIPPNPGELIRSDQVVELLEELRSEYD--YIVIDSSPIGLVTDAYALIERSDIT
A0A1M3MEI8      DFIPAGTIPPNAGELIRSEKLRTLFAKLKEYYD--YIIVDTSPIGVVADAYSFADLSDIN
A0A1J5HQM0      DFLPGGTVPPNAGELIRSEKLVEMFQELRNRYE--FIVVDTSPIGIVADAYAIAHLSDIN
A0A653AC35      DILLAGTVPPNPGELIRSDKLREMFKELESRYD--YVIVDTSPIGLVADAYSLAPLMDAN
E4T131          DILPAGSIPPNPGELIRSEKLGKMFEELRTRYD--FIIVDSSPIGMVTDAYSLAQHSDVN
A0A521H707      DFITAGPIPPNPSELILSQRMNELLDYLKSKYD--IIIIDTPPVGIVTDGVEIIQNADYP
A0A1F3D6P8      SFIPAGPLLPNPSELIESGVLDELMNFLKKEYD--YIIVDTSPVGLVADATQLIRYATHI
A0A356Z058      SFIPAGPLLPNPSELIESGVLDELMNFLKKEYD--YIIVDTSPVGLVADATQLIRYATHI
A0A3D1BT36      DFIPAGPVLPNSSELIEAGALDKLIQYLEDNYE--YIIIDTTPSGMVADAAQLIKYSSIN
A0A352ME00      DFISAGPVIPNPSELMESGILDNLINYLKTKYD--YIIIDTTPVGIVADAILMMKYASKV
A0A3D3HL11      WFIPAGPILPNSSELIEAGVLDSLIEELKQQFD--YVIIDSTPAGLVADATLMIKYASYI
A0A5R9QZP0      SYIPAGPTLPNAAELIEAGKLDSLITHVQNDFN--YVIIDSTPTGLVSDAVALMNYASHI
A0A2W7RD29      SCITSGPYPPNPSELIANKEIIKLLIKMKDQFD--IIILDTPPLGIVSDSMSLFPLVDVS
A0A3N2NDY8      SVMPIGHRPPNPSELLDNGRIGQFLDEARKEYD--YIFVDCPPTDVVVDTQIVEKYVDRT
D7JEV9          DFLKAGVIPPNPGEFVRSHKLLEMLAELQSMYD--YIIIDSSPLGLVADAYALFSVVDIK
A0A4R6H3B7      QFVSAGPIPPNPSELLENGKFEELIDRCRNIFD--YIVFDNPPLSIVSDGIIIGQKVDIN
A0A2W7QSQ0      DIIGLNKSIENASEIITSQKIIKLINSLKSSYD--HIIIDTSPIGLVADAYSLSEIVDLV
R7F6L5          DLIGVGNLPPNPSELLYSERLKTLLSTMEQEYD--FIFFDCPPIEVVADSRILNEYVDTT
A0A553GA49      SYIAAGHLPPNPSELVESDKTLEMLAELKTRYD--FIILDAGPTSVTAESLVLGKMADLI
A0A497D6F6      DIIPAGPIPSNPAELLIDERLEKLMDKLKSTYD--MIIVDTSPVGVVADTLQITSQFDII
A0A5M4AAB9      HIIPAGSIPPNPGEMLADIQLMELTALLKQEYE--TIIIDSSPL-LVADVFQFSNLWDTL
F4KR18          DYISGGPFIPNVSEQLTEQQLSVLFAYLKSKYD--VIIIDSSPIGVVSDGMLLNNYVDNT
C9LKL0          DFLPAGMLPPNPSELLMSSRLEALVEEARELYD--FIIIDTTPILAVSDASIVDRVADVT
A0A3D0QPV7      HFITAGPIPPNPAELIINGKLDSILEELKRIYD--IVIVDLPPVGLVTDGIPIVQMADYP
A0A496KT23      DVLPCGVIPPNPAELLSTERFAEMIKAAREEYD--IIFLDCPPVEIVADAEIINPHADLT
L1M9T3          DCLPSGVIPPNPAELLSTSRFRDLIETVRQEYD--LIFIDCPPVEIVADAEIINPVADLT
A0A3C0I8F1      DFIPSGPIPPNPSELILRPICDEFIKQLTLSYD--VIILDTPPIGLVTDGVLLMQKAEVP
R5JJI4          DIIFSGPVPPNPAELLLSERFDRLITELRKRYD--YIIVDNVPAGMVADASIVNRVADLT
A0A3D2HF71      WYAPAGPIPPNPAELIESESMKEFIDKAKKDFE--FIIIDTPPAAVVTDALLLADLADFY
A0A0A2DQN2      SIIPAGTIAPNPTELLLSKRLDSLIDELGRRYD--YVIMDNVPFGVVADASIVNRAADLT
A0A0A2F2N5      HVIPIGSSAPNPAELLMSERLDALMDELSARYD--YVLIDGVPFGIVADATIVNRVVDLT
L1NGW4          AIIPAGAIPPNPAELLLGHRLDDLAQELSDRFD--FVIFDNVPFGSVADAAIANRIADLT
Z4WRA0          AIVPAGAIPPNPAELLLGHRLDDLAQELSDRFD--FVIFDNVPFGSVADAAIANRIADLT
U2K8K9          SVIASGAVPPNPAELLLGERLDELADKLSEQFD--FVVFDNVPFGSVADAAIANRVADLT
A0A069ZM60      QVITSGAVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSVADAAIANRIADLT
J6GV98          QVITSGAVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSVADAAIANRIADLT
A0A134B4F8      QVITSGAVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSVADAAIANRIADLT
A0A134B8C7      QVITSGAVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSVADAAIANRIADLT
A0A4Z0EKR0      FIISSGPIPPNPAELLLSSKFAQLIEELKENFD--YIIMDTPPVGQVADAFTFSAFADIS
A0A229I3A5      DVIPIGTIPPNPTELLFTPLLEQMIKTMREEYD--YVFIDCPPIEVVADTPIYEQFADRT
A0A3R6HJB3      DVIPIGTIPPNPTELLFTPLLEQMIKTMREEYD--YVFIDCPPIEVVADTPIYEQFADRT
B5CTK0          DMIYAGAVPPNPAELLLSERLDQMIEELRTRYD--YIIVDNVPAGMIADAAIVNRIADWT
A0A1M6B6D5      DVITSGPIPPNPSELLLGERLDQLLGLLKDQYD--YIILDSPPMGLVSDALVLTKHVDAT
A0A451FS66      DVIPSGPTPPNPSELLIGERMDEFMERLKERYD--YIILDSPPIGLVSDAMEIIKYADAT
A0A2E3GN39      WAVPAGPIPPNPSELIGGEPFINFIDEVKTSFD--VVIFDTPPIGLVTDSIPVISTVNNP
A0A3D1MEL0      WAIPAGPIPPNPSELIGGDSFVNFLDEVKTSFE--VVIFDTPPIGLVTDAIPVISGTNNP
F0R0C9          YILPVGTLPPNPTELLAEDRFGKLVAGLRDRYD--YIFIDCPPIEIVADTQIIEKVADRT
A0A2A4N9A6      HFIPSGPIPPNPAELIINQRTEELLAVLRKQYD--LIVIDTPPIGIVSDGIDIIRKADYP
A0A368D1N7      WAIPAGPIPPNPSELIGGDSFVNFLDEVKTLFE--VVIFDTPPIGLVTDAIPVISRANNP
A0A3B8TU58      WAIPAGPIPPNPSELIGGDSFVNFIEEIKTSFD--VLVFDTPPIGLVTDSIPVISKVNNP
A0A1T5IIR6      DFIPAGAVPPNPTELLGRPRLEELIEALRQKYD--YILLDGVPIQMLADPIVLNRVVDIN
A0A3E0QD27      DFITAGPIPPNPSELILSRKMVELVEYLKSKYD--VVIIDTPPVGIVTDGVDVIQNADYP
A0A0M1W1I6      DFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
A0A4R4GHU2      DFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
I8WPR6          DFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
A0A0K2HKS3      DFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
B6W3W8          DFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
A0A4R4GSI6      DFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
A0A076IRY8      DFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
A0A3A6AD54      DFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
A0A3A6MIU7      DFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
I8WPP8          DFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
A0A372Y7D2      DFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
A0A3E4JJC9      DFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
A0A3E4WDQ0      DFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
A0A414H9P2      DFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
C3R5A8          DFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
A0A1C5XJA7      DFINAGTSAPNPAELLMDSRLDSMMEELRKRYD--YIVVDNVPVGLVADATIANRIADIT
A0A3E5BU42      DIISSGTVAPNPAELLMDSRLDTMMAELRKRYD--YVIVDNVPVGIVADATISNRISDLT
R7CUW4          DIIASGPVAPNPAELLLDSRLDTLIAELRTRYD--YIIVDNVPVGIVADATIANRIADLT
A0A416GGJ1      DAILAGPVAPNPAELLLENRLDELIEELKTMYD--YVIVDNVPIGIIADASIANRVADLT
D1JY72          DFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVVADAAITNRIADLT
D7J4K6          DIISSGTVAPNPAELLMDERLDAMVEELRQRYD--YIIVDNVPVGIVADATITNRISDLT
Q8ABP9          DIISSGTVAPNPAELLMDERLDAMVEELRQRYD--YIIVDNVPVGIVADATITNRISDLT
A0A5M6AHF7      DIISSGTVAPNPAELLMDERLDTMVEELRQRYD--YIIVDNVPVGIVADATITNRISDLT
D6D2Z5          DIISSGTVAPNPAELLMDERLDTMVEELRQRYD--YIIVDNVPVGIVADATITNRISDLT
A0A1T3EDR4      DVIPLGAIAPNPVELLLSKHLDELIEALKLKYD--YVIVDGVPMGIVADANIIDRISELT
A0A174SDD8      DLVPIGVIAPNPTELLLSKRLDELVDKLRERYD--YIIVDNVPIGLVADATVVNRITDLT
A0A1H7RFH3      DLVPIGVIAPNPTELLLSKRLDKLVAELKERYD--YIIVDNVPIGLVADATVVNRITDLT
A0A139L1N2      DLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLT
A0A174TVL8      DLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLT
A0A1H8BJR6      DLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLT
R9H6G0          DLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLT
A0A412GR09      DLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLT
A0A4Q5DX00      DLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLVADATVVNRITDLT
A0A081PBV5      DVIPIGVIAPNPVELLLSTRLDELIIELKKRYD--YIIVDNVPVNLVADASIVDRISELT
A0A1I2AN85      DVIPIGVIAPNPVELLLSTRLDELIIELKKRYD--YIIVDNVPVNLVADASIVDRISELT
A0A4U0GMP3      DIVPIGTIAPNPVELLLGGRLDELIAALKSNYD--YVIVDNVPVALVADAAIVDRISELT
A0A1H6CKR6      DIVPIGVIAPNPVELLLSERLDRLFVELKERYD--YIIVDNVPLGIVADADIVNRITDVT
A0A235E1C0      DIVPIGVIAPNPVELLLSDRLDTLINELKERYD--YIIVDNVPLGIVADADIVNRITDVT
R6D982          DLIPVGVIAPNPAELLLSGRLDELIGHLRERYD--YIIVDGVPVGMVADVSISNRISDVT
A0A1F0I8C4      DLIPIGVIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVVADASVVNRISDLT
A0A3A5RIJ2      DLIPIGVIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVVADASVVNRISDLT
A0A515IZJ5      DLIPIGVIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVVADASVVNRISDLT
A0A5M5NLR3      DLIPIGVIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVVADASVVNRISDLT
A0A0D5BSQ0      DFVPIGAIAPNPVELLLSKRLDELINELKERYD--YVIIDGVPVGIVADASIIDRVADLT
A0A1T3F6P5      DFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADASIIDRVADLT
A0A0W8EPA0      DFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADASIIDRVADLT
A0A365UKN1      DFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADASIIDRVADLT
A0A4R6WE41      DCVPIGVLAPNPVELLLSQRLDELIGELKLRYD--YIIVDGVPVAIVADGSIISRISDLT
A0A2T5RP38      DFIPIGAIAPNPVELLLGKRLDELITKLKERYD--YVIIDGVPVGIVADASIIDRVADLT
A0A1A6CF06      DVIPIGAIAPNPVELLLSKRLDELINELKNRYD--YIIIDGVPTGVVADASIIDRVADLT
A0A1T3D6S8      DFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVVADASIIDRVADLT
A0A1P8E011      DYISIGMEAPNPVELLLSKRLDQLISDLRNRYD--YIIIDGVPTGIVADATVVDRVSDLT
A0A1V3N3U3      DCVPIGLIAPNPVELLLSARLDELIAELRKRYD--YIVVDGVPLGIVADASIVDRISDLT
C2FUH6          DIISIGMVAPNPVELLLGKRLDELIADLRNRYD--YIIVDGVPVGLVADASIVNRISDLT
A0A0B8T471      DVIPIGVIAPNPVELLLSKRLDVLIAQLKERYR--YIVVDNVPIDLVADAAVVNRISELT
A0A4R7D2K0      DVIPIGVIAPNPVELLLSKRLDVLITKLKERYR--YIVVDNVPIDLVADAAVVNRISELT
A0A2X2J8S4      DIIPIGVIAPNPVELLHSDRLDNLIAELKKQYD--YIIIDSVPVEIIADAYITDRVSELT
A0A3C0S618      DIIPIGVIAPNPVELLHSDRLDNLIAELKKQYD--YIIIDSVPVEIIADAYITDRVSELT
A0A4P7DRF9      DIIPIGVIAPNPVELLLSERLDNLFAELKNRYD--YIIVDNVPLGIVADAKIVNRITDVT
A0A239XXC4      DIVPIGVIAPNPVELLLSERLDQLIAELKERYD--YIIVDNVPLGIVADADIVNRITDVT
A0A4U9K473      DIIPIGVIAPNPVELLLSERLDNLIAELKERYD--YIIVDNVPLGIVADADIVNRITDVT
A0A3D4RLG4      DFLLAGTIPPNPGELIRTDKLVSLLQELRKQYD--FIIIDTSPIGQVPDAFALIEQTDLT
A0A3N2LCI3      QVLPIGSIPPNPTELLESPRFGELIGELKSRFD--YVIIDCPPIEVVADAQIIDKFADRT
A0A1H6Z2F8      DFIAAGMQS--MDDTMLSPKIAGLIPALKAGYD--YVLLDSPPVGLVADARLLGPYADMT
A0A2P8G5K0      DFLAAGQQSPGTGEIILSPKVADLISTLKIRYD--YVLLDSPPVGLVADARLLGAHADMT
A0A519SYE7      DFISAGPTPPNPSELILSPHFDQMLAELHRTYD--VILIDTPPVGLVTDGILIMRKADVP
A0A5Q4EKA0      DFITAGPVPPNPSELILTPRMDEMINYLKSKYD--YVIVDNPPVGIVTDGMKSILMADYP
A0A3D4CJE1      DFITAGPIPPNPSELIINGNLTEIIEELKQTYD--LVIIDNPPIGLVTDALYTISMADYP
A0A4Q5ZQ60      DFISAGPTPPNPSELILNDKFDLVLQELKEIYD--VILIDSPPVGLVTDGILIMRKADVP
A0A519Q885      DFISAGPTPPNPSELILSPRFDQMLQELHRHYD--VIMIDTPPVGLVTDGILIMRKADIP
A0A519TAP8      DFISAGPTPPNPSELILNPRFDQMLAELHRSYD--VILIDTPPVGLVTDGILIMRKADVP
A0A2K8ZAP1      YIITAGSLPLNPSELLSSPRLANLLQELKERFE--YILVDSPPIGLVTDSQVIAPYADAT
A0A2T4XEQ1      HCLTTGRRSPNPASVAQSDKLKSIVEGVKDQYD--YVVIDSAPYGIITDAAPMMKMADGI
A0A2T2TDL4      CVLPAGTEVENPAKVLGSSRFRDFLQRAEQYFD--HVIVDSSPVLATADGPLLSDLCETT
A0A348PT57      HFITAGPIPPNPSELIISGNLTKGLDELKKIYD--IIIIDNPPVGLVTDGIASLKLADYP
A0A3D1AEJ6      DIIRSGPEPPNPAELLLSPRLDELIRELREMYD--FIVIDNVPAGMVADAMISNRVTDLT
A0A3D3LSK1      SVITAGTIPPNPSEMLGSLQMKKFLELVESKYD--IVILDSPPLISVTDSEILYNLTDGT
A0A496L711      DFLKAGVIPPNPGEFVRSHKLLEMLAELQSMYD--YIIIDSSPLGLVADAYALFSVVDIK
R7JFY1          DVIHAGPVPPNPAELLQNKRLDAMIAELRTRYD--YILLDNVPAGLVADAQIVARLADLT
A0A1V5S5I3      FLLPAGTIPPNPTELLAEPMFKEAIERLRGNYD--YIFIDCPPIDIVADTQIIEKLADRT
A0A2M7VVW6      DFITSGPIPPNPSELIISGKLDEVIAELKKEYD--LVVLDNPPIGLVSDAMEMLKKADYP
A0A656PYT8      DIIFAGLQPPNPAEMLLSEKFDEFMADLRKRYD--YVVIDSVPAMAVADALITDRLADLT
A0A413V760      DVIFSGPVPPNPAELLLSERFDRLITELRKRYD--YIIVDNVPAGMVADASIVNRVADLT
A0A641LIG3      DVIFSGPVPPNPAELLLSERFDRLITELRKRYD--YIIVDNVPAGMVADASIVNRVADLT
A0A641LPE6      DVIFSGPVPPNPAELLLSERFDRLITELRQRYD--YIIVDNVPAGMVADASIVNRVADLT
A0A1T4NDR5      DVITTGTKIIYHSEFIQSTALMNFIERMKDEYD--IILLDCPPVGIVTDALIVSKYSDGT
A0A3D5KRM7      VLLPGKESKVNYSELISSPKMIEFIKETKSRYESRIIIFDVPPLFVADDALLYMSYCDAA
A0A3M1NUH2      WIIPAGKVVPRSSELFATRVMRDFIESLRARFD--VIILDTPPVRVATDAALLATQCDLT
A0A359ATS6      HILPVGTIPPNPTELLVEERLKELINRMRSRYD--YILIDCPPIDVVADTAIIEKLADRT
A0A1V6HYH8      FYFPAGSLPEYPNELLTSSKMDELLENLKKYYD--IIILDTPPIGLISDTTKFVLLADTT
A0A2E0MDX6      HFITAGPIPPNPAELIISNKMTDVINELKNLYD--VIVIDTPPVGIVTDAFPIISKVDYP
A0A2M7KCE1      DYITAGPIPPNPSELTAGNEILNVINELKQIYD--VIIIDTPPLGLVTDALNIFKSCDYP
A0A523GUD4      KIITSGNLNDSPIKIFNAQNIKAFLETASSFYD--YIVVDAPPVIPVSDPLIIGKFVDNV
A0A641X2Z6      ELLASGPVAPNPSELLGSKRMEQLLEQLKPDYD--YILIDTPPIMPVTDAAVLSGKVDGL
A0A519PJW5      DFISAGPTPPNPSELILHPRFDLMLQELYRTYD--VILIDTPPVGLVTDGILIMRKADVP
A0A519T3R9      DFISAGPTPPNPSELILSPRFDQMLQELYRSYD--VIMIDTPPVGLVTDGILIMRKADVP
                                               :    :..*  *                 

A0A3M1Y2F5      AFVVRHQQTRLQD-LERINELFEQERIG-KIGLLINHVAN--------------------
A0A1G1TG88      IYIVRADYSRKAF-IKNMNRLMRTNNLT-RMCTILNDAQS--------------------
A0A661XXA6      IYILRAGYSKLSF-IGNINRLMATGRYP-NLSVILNNVSN--------------------
A0A2T2UAJ4      LLVVAAGETDGRA-FDHAAEMLADGEAD-VAGAVLNQFDA--------------------
A0A519SD85      LFILRCGVSRQEY-INTPEAIKQKLMLD-NIYIVFNDFLPDNFFSHYNKSKQILPYP-N-
A0A4Q3SEI4      VFVVRHNFTPKSM-IEMLEESHKVGALK-NISIVFNGIRS--------------------
A0A3M1TXY5      IYVVRHNVTEVAD-LKLINELFETGKIQ-NIGLLLNGVAS--------------------
A0A2E0VQ27      LFLIRKGTTRLRQ-LKPINELLDSFQIP-NLYLVLNGVRQ--------------------
R6U429          VFVIRAGLFDKRA-LPAVEDAYERGVYN-HMAVILNGVDT---------TSKSYGYG-H-
R5DEG6          IYVVRAGRMDRRA-LPEVEKLYREGKLR-NMSLILNGTVY---------KHGTYGYH-Y-
A0A5C8AF42      IYVFKSHYSKRNF-AFRVKELFEMQQLN-QLNVILNGVQT---------SKRSSAY----
A0A642EJV3      VFVVRAGLLERSM-LAELEKIYEEKKYK-NMSLILNGTEG---------SGGRYGYR-Y-
A0A161LWY6      IYITRSRKTNKKF-FKSVINQLKTDRMQ-HVGVVLNDIDA---------NTG--GYG-Y-
A0A212J9Z9      LFVVRRAKTNKSF-FKSVITQLKYDGVE-DIALVFNDVKG---------REGYYGTS-R-
F5IV23          LFVVRRAKTNKSF-FKSVITQLRYDGVE-DIALVFNDVKG---------REGYYGTS-R-
F8X2T0          LFVVRRAKTNKAF-FKSVITQLGFDGVE-NIALVFNDVKG---------REGYYGTS-R-
A0A1M3LAG1      LFVVRRAKTNKAF-FKSVITQLGFDGVE-NIALVFNDVKG---------REGYYGTS-R-
A0A212K6G4      LFVVRRAKTNKAF-FKSVITQLGFDGVE-NIALVFNDVKG---------REGYYGTS-R-
A0A4Y9IPG7      LFVVRRAKTNKAF-FKSVITQLGFDGVE-NIALVFNDVKG---------REGYYGTS-R-
A0A2V3PNY7      LFVVRRGKTNKAF-FKSVVSQMRNDGLE-HAALVFNDVKG---------REGYYGTS-R-
A0A1M5DFS8      LFVVRRAKTNKAF-FKSVVNQMRNDGLD-HVAIVFNDVKG---------REGYYGTS-R-
A0A4Y8KZS5      LFVVRRAKTNKAF-FKSVVNQMRNDGLE-HVALVFNDVKG---------REGYYGTS-R-
A0A239K409      VCLVRYNYTPKHE-IENINDILYNNKFK-QPMIVLNGAKK--------------------
A0A350V3E4      VVVSLASKTRLDL-LVNTIDTLNKINDT-FIGVILNNFDY--------------QAT-Y-
A0A1M6MYT6      VFIVRHKSTPKKP-LKDILEELESHQIE-ELGIIVNNVYR---------TKSNRGYG-Y-
A0A2P8CDS1      LYVSRQGVTPQPA-IKSALQEISNQHIR-NVGILLNDI-----------RINNQPLG-D-
A0A5M4A2I9      LYVSRQGVTPQPA-IKSALQEISNQHIR-NVGILLNDI-----------RINNQPLG-D-
A0A353WYK7      LFVVRSGFSKKSF-IQNIDRLVKAHHLD-QSSIIFNANRS--------------------
A0A355BP94      IYVVRANYSRKEF-LSNLERIVSINKLS-HVAVVLNALPT--------------------
A0A136LSC7      IYVFRANYSHKDF-LQNLARVVTLNKLT-HVSSVLNAIPL--------------------
A0A5C7N8Q5      IYVFRANYSRKDF-LQNLARVVTLNKLV-HVSTVLNAIPL--------------------
A0A1V5S1J9      LYAVRAEQTNKSF-YKKAMSQLEANNVK-KVGLIFNDVNL---------KKLEYS-----
A0A0A2EYC8      LLIVRSLKTNKVE-FTDLAKRLYADNVE-DIYVILNDVDK---------SKV--------
A0A2G6H6Y4      LLVVRSFKTSKRE-FSELTRRLYMDKVK-NVYIILNDVDR---------SKTGYGYG-YG
A0A1M3DPL8      LFVIRSNKTNKQF-VKTLSNQLKEDTKS-RFYSILNDVEI---------ESASYSQY-YS
A0A1V5F519      LLVVRNNKTHKDF-FKNVVNQIVTDKLS-NFYVVFTDVET---------D----------
A0A2G6R1T9      ---VRNEKTNKAF-FKRINEQIVSDKFN-NFYIVLNDINI---------TSKAYGR----
A0A2W4RDE8      IYVVRSDYTTKYN-LDRINKLYDERKVT-NISILLNDVKY----------SRVNGYS-Y-
A0A0L8VEV2      LFVTRQDYSKKNE-VRFIDHVNKKKAMK-NAGIILNDIHL---------SKHAHVGA-Y-
A0A1I2A9Z9      LFVTRQDYSKKNE-VKFIDHVHRKKSMK-NPGIVLNDIHV---------SKHAHVGS-Y-
A0A142HHS5      IYIVRANYSRKTF-LKNMNRLMRNNQFT-RMTTILNDAKA------------QGSYG-Y-
A0A660LQT8      LFVVRAHLLERSM-LPEINDFYRSNRYP-NMVTVLNGTLD----TYKSYGHHRYGYR-Y-
A0A350PNH9      IFVVRSGLMQRSM-LGDIEQFYKDKKFK-NMSLILNGTKA---------QGGRYGHY-Y-
A0A354LNT9      IFVVRSGLMQRSM-LGDIEQFYKDKKFK-NMSLILNGTKA---------QGGRYGHY-Y-
A0A2M6GH67      IYIVRADYSKKEF-LKNINKVIKTNKFN-KLTVILNDAKA--------------------
A0A389LWV6      LYVVRNEKTNRNF-FKHTISEFKGDVTSGKMAIIYNDVDL---------DGNYYASR-N-
A0A1G9B1T9      ILVARRGVTSKSQ-LMDVEELHQNNTLH-NLYVVLNDVQA--------------------
A0A3D0FMX4      LFVVRYNKTQRNF-CREVLAQMEEDGKQ-NIYIVFSDLPHERSGRYN-YNSKSYHYG-YG
A0A1M3MEI8      LFIVRSDKTHKLF-LRTLTAQLKSDNVH-DFYSILNDVELKSNS-YSRYYSRKYAYG-NS
A0A1J5HQM0      IFVARSGKTSKSH-FAKISKQLKSDNV--EAYCILNDVMSEESR-YSRYYSRRYGYG-YG
A0A653AC35      IFVVRSEKTNKSF-FKKLNAQLKADNIK-NLYLVINDVDSQKSSYYGRYSN---------
E4T131          LFVVRNGKTNKTF-FKKLCAQLKLDNIP-QLYTVLNDVLDDESK-YTKYKL---------
A0A521H707      IYIIRAHYSKRMF-MQNLNKLIEEYKIR-NLAVVLNGVET---------SKFKYGYG-YG
A0A1F3D6P8      LLVTRINYTRKDI-LEHVLKNFSSNRIT-NYDAVLNSLPL---------DTSPYR-----
A0A356Z058      LLVTRINYTRKDI-LEHVLKNFSSNRIT-NYDAVLNSLPL---------DTSPYR-----
A0A3D1BT36      LLVCRNNHTRKDV-FNSVLNFYKTHNIE-NFDIIYNDVEI---------KESRYG-----
A0A352ME00      LMVIRNNYTRKDI-FANVINNLKSNKLT-NYDIVYNDLNL---------HKSSYR-----
A0A3D3HL11      LLVCRNDYTRKDV-FTDVLNLFRTNNIT-DYDIVFNDLNL---------KKSRYG-----
A0A5R9QZP0      LMVCRNNHTIKNV-FFDVLNFFKANRID-NFDIVYNDLDK---------KKSTYG-----
A0A2W7RD29      LLAFKCGYNNHKG-IVELNKLKSNDFIK-KVYCILNGVDS--------------------
A0A3N2NDY8      IFVVRAGLLDRKA-LEEIDAIYRNKRFK-QMSIVLNGTEA---------ASR--------
D7JEV9          LLVVRSFKTNKME-FTDLSKRLYSDNIE-DIYIILNDVDK---------SKI--GYV-Y-
A0A4R6H3B7      LFVTRQDYSKKNE-VKFIDHVHRKKSMK-NPGIVLNDIHV---------SKH--AHV-G-
A0A2W7QSQ0      VYVVRMNYTRVDN-LHALAEIIDENIFK-QNFVVLNDSNE--------------------
R7F6L5          IFVIRAGLFDRRM-LKSIRNLYAERRYN-NMCLLLNGTSV----------GHNYGYG-Y-
A0A553GA49      LVVMRVNYTLKKE-FKEIIEELDGSFGK-KVTVVLNGVKV---------SRQ--------
A0A497D6F6      IFVVRQRMTKKQV-FKSAIEELQNFNVD-KLGVLFNDVSS---------RDMKHGYG-Y-
A0A5M4AAB9      LFVTRQGITLKPA-AKSALQEISSQNTN-RLGLLLNDISI---------NNQFDRYN-N-
F4KR18          LFVVRSNFTKKAT-IAKAREIFEQNKLV-NPAIIFNGVKK---------QNDAYGYS-Y-
C9LKL0          LFVIRVGVQVRAF-LPELEKMNKDKKYR-HLCIALNDVDV------------KAKYG-Y-
A0A3D0QPV7      IYVFRANYSKKNF-VQNADRLVNENNIQ-RLSVVLNSVDT---------DRGSSGYN-Y-
A0A496KT23      LFIVRASLMERSY-LKDIERWYAEKKYN-NLTLLLNGTTD---------ALG--RYG-YH
L1M9T3          LFVVRAGLMERSF-LNDIERWYLDKKFH-NLTLLLNGTTD---------ALG--RYG-YH
A0A3C0I8F1      IYIFKANYSKKAF-SKSINKLILKNNFT-NLSVVLNAVNK--------------RFS-Y-
R5JJI4          IFVVRSGVMDRRQ-LPELEKMYREEQLC-NMCVVLNGVSY---------ERRSYGYG-Y-
A0A3D2HF71      IFVVRQRFSSKNT-VELIEELYRNETIG-RIGIVMNDISL---------TGY---YG-YG
A0A0A2DQN2      LFIIRAERMDRRM-LPELERLYQEQVLT-NMAIILNGVNH---------NSSSYGYG-Y-
A0A0A2F2N5      LFILRSGTVDRRV-LPDLQLLYDEKILN-NMAIVLNGISS---------QNKGYGYG-Y-
L1NGW4          IFVLRAARLDKRA-LPELQRLYDNEILR-NMSIVLNGASD---------GGHGYGYG-Y-
Z4WRA0          IFVLRAARLDKRA-LPELQRLYDNEILR-NMSIVLNGASD---------GGH--GYG-Y-
U2K8K9          IFILRAAKLDRRA-LPELQRLYDDHILT-NMAIVLNGATE---------SGH--GYG-Y-
A0A069ZM60      IFVLRAGRLDRRA-LPELQHLYDENILT-NMSIVLNGATE---------SGH--GYG-Y-
J6GV98          IFVLRAGRLDRRA-LPELQHLYDENILT-NMSIVLNGATE---------SGH--GYG-Y-
A0A134B4F8      IFVLRAGRLDRRA-LPELQHLYDENILT-NMSIVLNGATE---------SGH--GYG-Y-
A0A134B8C7      IFVLRAGRLDRRA-LPELQHLYDENILT-NMSIVLNGATE---------SGH--GYG-Y-
A0A4Z0EKR0      IYLVRYNMTIKSQ-LKIIRNIYKSKSLI-APMIVLNDAKQ--------------SNG-N-
A0A229I3A5      IFVVRAGLMERSM-LPEVNALYKEKKFK-NMTLILNGTKA---------HGGRYGSH-Y-
A0A3R6HJB3      IFVVRAGLMERSM-LPEVNALYKEKKFK-NMTLILNGTKA---------QGGRYGSH-Y-
B5CTK0          LYIVRAGVLDRKQ-LPDVDALYKSGQFT-NMALILNGVDF--------------KHA-H-
A0A1M6B6D5      LYMVRQNYTHKNM-LTFVNEKFRRGEVK-HISIVINEYVE--------------KSG-K-
A0A451FS66      LYMVRHNRTRKNM-LTFVNEKYKRGEIK-HISIVLNEYVE--------------KSG-R-
A0A2E3GN39      IYVLRADYSHRSF-VGHIESTKENLQVP-SLSIIMNDYGRGVSG-SYYNYGYGYGYG-Y-
A0A3D1MEL0      IYVLRADYSHRSF-VGHIESTKDNLKVT-NLSIVLNDYGRGVSG-SYYN--YGYGYG-Y-
F0R0C9          LFIVRAGLLERSM-LAELETIYQEKRFK-NMAVILNGTLD---------GNNRYGYK-Y-
A0A2A4N9A6      LYIFRADYSKKDF-VKIMNKLMNDHKIS-KLALILNESGGGS------QYGYGYGYG-Y-
A0A368D1N7      IYVLRADYSHREF-VGHIESIKDNLKVP-NLSIVLNDYGRGVSG-SYYNYGYGYGYG-Y-
A0A3B8TU58      IYVMRADYSHRSF-VGHIESTKENLQIP-NLSIIVNDYGRGVSG-SYYN----YGYG-Y-
A0A1T5IIR6      LFILRSGQLDRRI-LPQLDELNDKHHLH-NMAIVFNGPQIKKRR-GYGFGSYGYGYG-Y-
A0A3E0QD27      IYIIRAQYSKRMF-INNLNRLIEESKVR-NLAVVLNGVET---------SRFRYGYG-Y-
A0A0M1W1I6      IFVVRVGKLDRRM-LPELEKIYRSGQLN-NMSLVLNGAIV---------KTS--GYG---
A0A4R4GHU2      IFVVRVGKLDRRM-LPELEKIYRSGQLN-NMSLVLNGAIV---------KTS--GYG---
I8WPR6          IFVVRVGKLDRRM-LPELEKIYRSGQLN-NMSLVLNGAIV---------KTS--GYG---
A0A0K2HKS3      IFVVRVGKLDRRM-LPELEKIYRSGQLN-NMSLVLNGAIV---------KTS--GYG---
B6W3W8          IFVVRVGKLDRRM-LPELEKIYRSGQLN-NMSLVLNGAIV---------KTS--GYG---
A0A4R4GSI6      IFVIRVGKLDRRM-LPELEKIYRSGQLN-NMSLVLNGAIV---------KTS--GYG---
A0A076IRY8      IFVVRVGKLDRRM-LPEVEKIYRSGQLN-NMSLVLNGAIV---------KTG--GYG---
A0A3A6AD54      IFVVRVGKLDRRM-LPEVEKIYRSGQLN-NMSLVLNGAIV---------KTG--GYG---
A0A3A6MIU7      IFVVRVGKLDRRM-LPEVEKIYRSGQLN-NMSLVLNGAIV---------KTG--GYG---
I8WPP8          IFVVRVGKLDRRM-LPEVEKIYRSGQLN-NMSLVLNGAIV---------KTG--GYG---
A0A372Y7D2      IFVVRVGKLDRRM-LPEVEKIYRSGQLN-NMSLVLNGAIV---------KTG--GYG---
A0A3E4JJC9      IFVVRVGKLDRRM-LPEVEKIYRSGQLN-NMSLVLNGAIV---------KTG--GYG---
A0A3E4WDQ0      IFVVRVGKLDRRM-LPEVEKIYRSGQLN-NMSLVLNGAIV---------KTG--GYG---
A0A414H9P2      IFVVRVGKLDRRM-LPEVEKIYRSGQLN-NMSLVLNGAIV---------KTG--GYG---
C3R5A8          IFVVRVGKLDRRM-LPEVEKIYRSGQLN-NMSLVLNGAIV---------KTG--GYG---
A0A1C5XJA7      IFVVRAGRLDKRQ-LPDIEKLYQEKVLN-NMALILNGADL---------ERH--GYG-Y-
A0A3E5BU42      IFVVRAGKLDRRQ-LPDLEELYRDNKLC-NMSLILNGVDP---------SRR--GYG---
R7CUW4          VFVVRSGRLDRRQ-LPDIESLYEDKKLH-NMALVLNGVDP---------HRH--GYG---
A0A416GGJ1      LFVVRAGSVDRRL-LPEIEDLYENKKLN-NMAVVLNAVEH---------RTV--------
D1JY72          IFVVRVGKLDRRM-LPELEKIYRSGQLN-NMSLVLNGAIV---------KTS--GYG---
D7J4K6          IFVVRAGRLDRRL-LPDMEELYRDNKLR-NMAIILNGVGP---------HRR--GYG-Y-
Q8ABP9          IFVVRAGRLDRRL-LPDMEELYRDNKLR-NMAIILNGVGP---------HRR--GYG-Y-
A0A5M6AHF7      IFVVRAGRLDRRL-LPDMEELYRDNKLR-NMAIILNGVGP---------HRRGYGYG-Y-
D6D2Z5          IFVVRAGRLDRRL-LPDMEELYRDNKLR-NMAIILNGVGP---------HRRGYGYG-Y-
A0A1T3EDR4      LFIIREGKLDRRM-LAELENIYQERKLS-NLGIVFNGVRI---------G----AFG-Y-
A0A174SDD8      LFIVRVGKIDRRQ-LPELERLYQEHKLN-NMAVVLNGTEK---------GSS--GYG-Y-
A0A1H7RFH3      LFIVRVGKIDRRQ-LPELERLYQEHKLN-NMAVVLNGTEK---------GSS--GYG-Y-
A0A139L1N2      LFIVRVGKIDRRQ-LPELERLYQEHKLN-NMAVVLNGTEK---------GSS--GYG-Y-
A0A174TVL8      LFIVRVGKIDRRQ-LPELERLYQEHKLN-NMAVVLNGTEK---------GSS--GYG-Y-
A0A1H8BJR6      LFIVRVGKIDRRQ-LPELERLYQEHKLN-NMAVVLNGTEK---------GSS--GYG-Y-
R9H6G0          LFIVRVGKIDRRQ-LPELERLYQEHKLN-NMAVVLNGTEK---------GSS--GYG-Y-
A0A412GR09      LFIVRVGKIDRRQ-LPELERLYQEHKLN-NMAVVLNGTEK---------GSS--GYG-Y-
A0A4Q5DX00      LFIVRVGKIDRRQ-LPELERLYQEHKLN-NMAVVLNGTEK---------GSS--GYG-Y-
A0A081PBV5      IFVVRSGKMDRRQ-LPEIQSLYDQRKIS-HMAVLLNGVRL---------NKG--GYG-Y-
A0A1I2AN85      IFVVRSGKMDRRQ-LPEIQSLYDQRKIS-HMAVLLNGVRL---------NKG--GYG-Y-
A0A4U0GMP3      LFVVRAGKMDRRQ-LPELDKLHRQGKLT-NMAILLNGIRK---------GKM--GYG-Y-
A0A1H6CKR6      IFVVRAGKMDRRQ-LPDIQKLYSSGSLT-NLAILLNGVKF---------TNT--GYG-G-
A0A235E1C0      IFVVRAGKMDRRQ-LPDIQKIYDSSALT-NMAILLNGVKF---------GSS-YGYG-Y-
R6D982          LFIVRAGKLDKRQ-LPELERLYQEHKLN-NMAVVLNGTKQ---------GRR--GYG-Y-
A0A1F0I8C4      LFIVRVGKLDRRQ-LPELERLYQEHRLN-NLAVVLNGAKK---------GSR--GYG-Y-
A0A3A5RIJ2      LFIVRVGKLDRRQ-LPELERLYQEHRLN-NLAVVLNGAKK---------GSR--GYG-Y-
A0A515IZJ5      LFIVRVGKLDRRQ-LPELERLYQEHRLN-NLAVVLNGAKK---------GSR--GYG-Y-
A0A5M5NLR3      LFIVRVGKLDRRQ-LPELERLYQEHRLN-NLAVVLNGAKK---------GSR--GYG-Y-
A0A0D5BSQ0      LFIIRVGKMDRRQ-LPEIEKIYQEKKLS-NLAIVLNGMKL---------NGY--GY----
A0A1T3F6P5      LFIIRIGKMDRRQ-LPEIEKLYQEKKLS-NLAIVLNGMKL---------NGY--GYG-Y-
A0A0W8EPA0      LFIIRIGKMDRRQ-LPEIEKIYQEKKLS-NLAIVLNGMKL---------NGY--GYG-Y-
A0A365UKN1      LFIIRIGKMDRRQ-LPEIEKLYQEKKLS-NLAIVLNGMKL---------NGY--GYG-Y-
A0A4R6WE41      LFVIRAGKMDRRQ-LPELEKLYQSNKLA-RLGVVLNGVKL---------GSG--AYG-Y-
A0A2T5RP38      LFIIRIGKMDRRQ-LPEIEKIYQEKKLS-NLAIVLNGLKL---------NGY--GYG-Y-
A0A1A6CF06      LFIIRIGKMDRRQ-LPEIEKIYQEKKLS-NLAIVLNGLKL---------NGY--GYG-Y-
A0A1T3D6S8      LFIIRIGKMDRRQ-LPEIEKLYQEKKLS-NLAIVLNGLKL---------NGY--GYG-Y-
A0A1P8E011      LFVIRAGKMDKRQ-LPEIQKIYAEKRLS-NLAIILNGLKL---------GQS--------
A0A1V3N3U3      LFMIRAGKMDRRQ-LPEIEKIYRDRKLS-NLAVALNGIKL-----------H--GPG-Y-
C2FUH6          IFMVRVGKMDRRQ-LPEIEKIRQEGKLS-NMSVILNGLKQ---------GRR--GYG-Y-
A0A0B8T471      VFVVRAGAMDRRL-LPEIEKIYRKGKLN-NMAILLNGIRK---------LKS--SYG-Y-
A0A4R7D2K0      VFVVRAGAMDRRL-LPEIEKIYRKGKLN-NMAILLNGIRK---------LKS--SYG-Y-
A0A2X2J8S4      IFVIRSGKMDKRE-LPDIEKIYQSKKLS-NMAILFNGVNS---------GKR--GYG-Y-
A0A3C0S618      IFVIRSGKMDKRE-LPDIEKIYQSKKLS-NMAILFNGVNS---------GKR--GYG-Y-
A0A4P7DRF9      LFVVRAGKMDKRQ-LPEVQKIYESGDLT-NMAILLNGVKF---------NDT--RYG-YG
A0A239XXC4      IFVVRAGKMDRRQ-LPDVQKIYDSSALT-NMAILLNGVKF---------GNN--PYG-Y-
A0A4U9K473      IFVVRAGKMDRRQ-LPEIQKIYDSGSLT-NMAIVLNGVKF---------GNS--AYG-S-
A0A3D4RLG4      LYVIRCMQTNKYF-CKNTLQQMEADYKD-KVQLVFSDMPVEKKRKRLGRKSYGYAYNSY-
A0A3N2LCI3      FFVIRAGLFDRSM-LPELDRLYEEKKYR-NMSFILNGS-------RNDQGRYGYSHT-Y-
A0A1H6Z2F8      LYIVRQHFTFIHQ-LAELQKASEQ--LP-DLQIVINGT-------R-DLHRYQYNYY---
A0A2P8G5K0      LYIVRQHFTFIHQ-LAEIQNARNQSLLP-DLHVVLNGT-------R-SLHRYQYNYY---
A0A519SYE7      IYIARANYSRKVF-LKNLNRLMSNNQFT-KMCTVLNDA-------K-AQGSYGYGYG-Y-
A0A5Q4EKA0      IYIFKANYSKRMF-IQNVNRLIGESHIS-KLSVVLNAV-------D-KEYS-SYGYD-K-
A0A3D4CJE1      IYVLRANYSKKEY-LKNAYRIYEENNIH-KLSLVLNSV-------DFEQGQYGYGYG-Y-
A0A4Q5ZQ60      LYIVRANYSKKVF-LKNVNKLIKGHGFS-KLALILNDA-------Q-TSGIYGYGYG-Y-
A0A519Q885      IYIVRANYSRKTF-LKNLNRLMRNNQFG-RMCTILNDA-------Q-AQGSYGYGYG-Y-
A0A519TAP8      IYIVRANYSRKAF-LKNLNRLMSNNQFS-KMCTILNDA-------K-AQGAYGYGYG-Y-
A0A2K8ZAP1      IFVVRHDHTPKNY-IKMVDALYKEQRFQ-KLSIVLNGVGKGES------------LS-Y-
A0A2T4XEQ1      VVSVRFNKTQTNE-LAQTLENLENIHVS-ILGLSLVGYDHKISSDYYYQ------NK-Y-
A0A2T2TDL4      LCVARAGTTTEAE-LDHAMEVLSGIGAN-VAGVVFNGFDISMA------------YG-Y-
A0A348PT57      IYIFRNEYSKKSF-IDNINRIFIENKIT-NLSAVLNSVDLSRARYGSYGRGYGAKYG-Y-
A0A3D1AEJ6      LYIIRAGKMDRRM-LPEIEQLYREERLK-NMAVILNGT----------G------SG-I-
A0A3D3LSK1      VLVAQAEKTDKKAFFKTYNQLKRINPHN-LLGAVLN----------NFK------FN-T-
A0A496L711      LLVVRSFKTNKME-FTDLSKRLYSDNIE-DIYIILNDVDKSKI---GYV------YG-Y-
R7JFY1          ICVIRAGVLDRRQ-IPALEMLSR--RFP-KFSLVLNYVKGHHG-----G------YG-Y-
A0A1V5S5I3      VFVVRAGLLERDM-LPELQRMYDEHRFK-NMALVLNGTDGGNS---RYG------YR-Y-
A0A2M7VVW6      IYVFKSEYSRKNF-INNLNKLIVENGIK-KLSIVLNGVDYSNK-YYSYG------YN-Y-
A0A656PYT8      IYVIREGLLDRRQ-LPDIEKLYREKKFH-NMSIVLNGSTGGARRGYGYG------YG-Y-
A0A413V760      IFVVRSGVMDRRQ-LPELENMYRQEQLR-NMSVILNGVPSDHK---GYG------YG-Y-
A0A641LIG3      IFVVRSGVMDRRQ-LPELENMYRQEQLR-NMSVILNGVPSEHR-----G------YG-Y-
A0A641LPE6      IFVVRSGVMDRRQ-LPELENMYRQEQLR-NMSVILNGVPSDHK-----G------YG-Y-
A0A1T4NDR5      ILVCESDKNDKKT-LIRVKYQFDEVESK-VLGVVITKAD----------------FG-K-
A0A3D5KRM7      LFVVEDEKNTVDE-IKHSMKILEETNL---LGIVLNKSRQPIP-----------------
A0A3M1NUH2      LVVVRAGQTREGE-LEFAMESLAAVGAP-AIGTVFNGFDVSMA-----------------
A0A359ATS6      IFVVRAGLLERSM-LVELEKIYNEQKYK-NMCVILNGTTGNGG-----R------YG-Y-
A0A1V6HYH8      VYVFRSEYSKKEF-IVNLEKLKQELNPK-EIIIVLNGFNDKFI------------KQ-S-
A0A2E0MDX6      VYIVRAHFSKKVF-LKNIQMLRDKKKIK-NLSVILNGAGGDKKYGGFRK------YG-Y-
A0A2M7KCE1      IYVVKAHYSKRSF-LYNLNHLLLEKHIE-NLSVVVNGIDIEKS-----R------YG---
A0A523GUD4      ILVAKAGETPKRV-IKRAVDMIHNVEIE-ISGIILNNMRNVLP------------YY-Y-
A0A641X2Z6      VMLVSSGEVTPAA-AKEAKQRLLQAGAH-ILGVILNKVELAHT------------HG-Y-
A0A519PJW5      IYIVRANYSRKAF-LKNMNRLMQNNQFS-RMCTILNDAKAAGS------------YG-Y-
A0A519T3R9      IYIVRANYSRKTF-LKNLNRLLHNNQLS-RLCTILNDAQAQGS---------------Y-
                                                                            

A0A3M1Y2F5      -----PAQFRHGDASYYTYGKKYAKVYGAMHT----------------------------
A0A1G1TG88      -----KGAYGYG-YGY-GYGYGSGTYGQGYYEDHGSAPPPTLAQKLGRLFK---------
A0A661XXA6      -----KKT------GF-GYSYGDVYTSSPYYQE---------------------------
A0A2T2UAJ4      -SSSVLQSYGYN-YGY-AYSYRRLYEYYRDEDKGAPEPSGIRAWWGG-------------
A0A519SD85      -------GYYSSYYQSI-------------------------------------------
A0A4Q3SEI4      ------RGFFKGKYGY-GYGYGRKKVYGDHVYKSEAVQRKA-------------------
A0A3M1TXY5      ----------LSDYGYLDTDYGINGYVKKGKKRKRYEAIN--------------------
A0A2E0VQ27      ------------------------------------------KAKKGAYARYLKKRKPAP
R6U429          ------YGYGYG-YGY-GYGYGYGNNVQD-------------------------------
R5DEG6          -------GYGYG-YGY-GYGYG--------QRKKK-------------------------
A0A5C8AF42      -------GYGYG-YNY-GYGYY--------EGDSEIEKGNLLNRLWSFISSKFRR-----
A0A642EJV3      -------GYRYG-YHY-GYGSGYHYGSD--------------------------------
A0A161LWY6      -------NYSYQRYGYGTYGNNPVTKDYIKDYYEEE------------------------
A0A212J9Z9      -------YYGDRTYYLKKNSYYHDDYFEN-------------------------------
F5IV23          -------YYGDRTYYLKKNSYYHDDYFEN-------------------------------
F8X2T0          -------YYGDKTYYLKKNSYYHDDYFES-------------------------------
A0A1M3LAG1      -------YYGDKTYYLKKNSYYHDDYFES-------------------------------
A0A212K6G4      -------YYGDKTYYLKKNSYYHDDYFES-------------------------------
A0A4Y9IPG7      -------YYGDKTYYLKKNSYYHDDYFES-------------------------------
A0A2V3PNY7      -------YYGDKSYYLKRNSYYHDDYFEK-------------------------------
A0A1M5DFS8      -------YYGDKSYYLKRNSYYHDDYFEK-------------------------------
A0A4Y8KZS5      -------YYGDKSYYLKRNSYYHDDYFEK-------------------------------
A0A239K409      --------FNSNKYGY-GYGYVKK------------------------------------
A0A350V3E4      -------GSYYKYYYY-YYGSEKGKESAGTNGKSTNGVNTNGSQKEKIIKPN--------
A0A1M6MYT6      -------GYGYG-YGY-GYGYG--------HDTDSNQ-----KKGKTKTKGRSIFKPS--
A0A2P8CDS1      -------RYNYS-YMY-GYGYK--------TQKPKNRPAAYWRKVNSKKQAQTT------
A0A5M4A2I9      -------RYNYS-YMY-GYGYK--------TQKPKNRPAAYWRKVNSKKQAQTT------
A0A353WYK7      -----SKNYGYGSYGK-SYGYY----------EEPEYLESNLFATFKSLFSK--------
A0A355BP94      -----SGKT----YG---YGYY----------HEDQKKRSLIRKIFRS------------
A0A136LSC7      -----SGNY----YG---YGYY----------EDKTPRRKRWIKIFGLK-----------
A0A5C7N8Q5      -----NGKY----YG---YGYY----------EDRTPRMRRWTKIFGLK-----------
A0A1V5S1J9      -----RYYDSYG-----SYGKKSGYYY---YDKKFKSPRSQYLNYFDNTEEEL-------
A0A0A2EYC8      -----GYGYGYS-----KYKKMGNYYVTEEFEQDDISMLEKIIDKIGEKTKRIRNIHSSR
A0A2G6H6Y4      ----YGYGYGYG-----GSKKNNAYYVTAEFEKENTTAFQRVIEFVGDITKKIRNIKK--
A0A1M3DPL8      RKYVYGRSKSYGLGTY-GYGYGYGYTSSGRSKHKGN---NTYFQYYQDDEKDI-------
A0A1V5F519      -----GNYYSYK---Y-GYSSKYGYYTS--KGQKNI---DEYRKYYDDNN-EI-------
A0A2G6R1T9      ----YGYGYGYG---Y-GYGYGYGYGYG--VKNKKD---NQYTHYYNDDDIDI-------
A0A2W4RDE8      -------SYKYKQKKYKQRSYKAV------------------------------------
A0A0L8VEV2      -------GADYSHRKNSSYYYFDSSPSYTG------------------------------
A0A1I2A9Z9      -------GADYSYKKKSSYYYFESSPSYTG------------------------------
A0A142HHS5      -------GYGYG-YGY-GYGYGTKGMGYYDETEQKPTLGKRIKSLFS-------------
A0A660LQT8      -------GYRYG-YGI-DYGKS--------------------------------------
A0A350PNH9      -------RYGYH-YGY-GYGYHYGSDKNGGAKIGK-------------------------
A0A354LNT9      -------RYGYH-YGY-GYGYHYGSDKNGDAKIGK-------------------------
A0A2M6GH67      -----QGGYGYG-YAY-GYGYS--------------------NSYYDLEEKEGVLTRLKR
A0A389LWV6      -------YYGKSSYYHKHNSYYNNDEFVDEQNQN--------------------------
A0A1G9B1T9      -------TKGHGYYE---------------------------------------------
A0A3D0FMX4      ------YGYGYGGYGY-GYGYG--------YGSRKKGT----NHYYTDE-DE--------
A0A1M3MEI8      RRYGTKSGYGY-GYGY-GYGYT--------KVSDKKNSDGTYYQYYQDDAHDI-------
A0A1J5HQM0      ------YGYGS-GYGY-GYGYG--------NTRKKKEASEKYFQYYQDD-REI-------
A0A653AC35      ------YGYGY-GYGY-GYGYA--------QLKKKKEY-DKNTHYYEDD-DDI-------
E4T131          ------YKYAY-LFGF-SYGYT--------SKKKKGDA-EKYFHYYQDD-TEI-------
A0A521H707      YGYGYGYGYGYGYYDDEARKNL--------------------SFFEKFKNRFSRK-----
A0A1F3D6P8      -------------------HYT--------------------SYYLKK------------
A0A356Z058      -------------------HYT--------------------SYYLKK------------
A0A3D1BT36      -------------------RYH--------------------GYYKKPKAFTARK-----
A0A352ME00      -------------------HYS--------------------NYYIKN------------
A0A3D3HL11      -------------------RYD--------------------NYYKQ-------------
A0A5R9QZP0      -------------------GYD--------------------TYYHNNPKRKK-------
A0A2W7RD29      -------HYHIG-SNK-NYGYY--------------------EVYKDNKGLVNRVKNYLR
A0A3N2NDY8      --------KSYGAYGYYG------------------------------------------
D7JEV9          -------GYGYGMHKKMGNYYV--------TEEFEQDDVSILEKLIYKISDMTKKIRNIK
A0A4R6H3B7      -------SYGAD-YSY--------------KKKSSYYYFESSPSYTG-------------
A0A2W7QSQ0      ----------YSGSKF-GYGYYSGKDTDVVSTRA--------------------------
R7F6L5          -------GYGYG-YGY-GYGYGYAYGDDNDKKKKKRKKS---------------------
A0A553GA49      -------RY----YNYSAYYAK--------PNLN--------------------------
A0A497D6F6      -------TLGYG-YGL-GYGRTAKK-----------------------------------
A0A5M4AAB9      ------HSYGYG-YEN-NYKKKISKELKPQRRSQKTEV----------------------
F4KR18          ------KDYGYA------------------------------------------------
C9LKL0          -------GYGYG-YGY-GYGYGNYSYGYGEQYNNRKSKKKLSGRLLSKLRK---------
A0A3D0QPV7      -------GYGYG-YGY-GYGYTYGGNYYTERTNATEKK----IRFFRRKNKK--------
A0A496KT23      KY-----GYGYGGYGY-GYGYGS-------------------------------------
L1M9T3          KY-----GYGYGGYGYGGYGYGK-------------------------------------
A0A3C0I8F1      -------GYGYG-YGY-GAYYGKRSVAYYNDSESNYKPIRWINRIYKRAMSFRK------
R5JJI4          -------GYGYG-YGY-GYGYG--------NEHHGNNKQGVAKRIINKLIAFFK------
A0A3D2HF71      LRYGYAGGYGYS-YGY-NYYGDYVYSRYGHSGEG--------KYYIEE------------
A0A0A2DQN2      -------SYGYGYYGY-GYGYG----HLGKKSLR--------KRFVERMKMFFVS-----
A0A0A2F2N5      -------GYGYG-YGY-GYGYG----Y-GNKKER--------SGIFSRFRKS--------
L1NGW4          -------GYGYG-YGY-GYGYG----Y-GN-KKK--------KGILYRLGLKK-------
Z4WRA0          -------GYGYG-YGY-GYGYG----Y-GN-KKK--------KGILYRLGLKK-------
U2K8K9          -------GYGYG-YGY-GYGYG----Y-GNKKKK--------KTLLQRLGIRR-------
A0A069ZM60      -------GYGYG-YGY-GYGYG----Y-GNKKKK--------KGLLRRLGLR--------
J6GV98          -------GYGYG-YGY-GYGYG----Y-GNKKKK--------KGLLRRLGLR--------
A0A134B4F8      -------GYGYG-YGY-GYGYG----Y-GNKKKK--------KGLLRRLGLR--------
A0A134B8C7      -------GYGYG-YGY-GYGYG----Y-GNKKKK--------KGLLRRLGLR--------
A0A4Z0EKR0      -------NYGFG-YGY-GYPVK------------------------EKMKKKATG-----
A0A229I3A5      -------GYGYG-YGY-GYNYN--------KEKNGGGKILNNWIIE--------------
A0A3R6HJB3      -------GYGYG-YGY-GYNYN--------KEKNGGAKS---------------------
B5CTK0          -------KYGYG-YGY-GYGYG--------DTKT-------------KHKKKS-------
A0A1M6B6D5      ---------GYG-YGY-GYGYGGSSYKSYGNGYHEAIKKPSLWKRMKKSITKK-------
A0A451FS66      -------GFGYG-YGY-GYGYGDGSYKSYGDGYHGPLGKKSLADRIKNIFKQT-------
A0A2E3GN39      -------GYGYG-YGY-GYGYGYGYYSDSDNTRKKER-----SSLFSIFRKKS-------
A0A3D1MEL0      -------GYGYG-YGY-GYGYGYGYYSDPDNTRKKER-----SILFSRFRKKT-------
F0R0C9          -------GYKYG-YHY-GYGSK------DYYNNE--------------------------
A0A2A4N9A6      -------GYGYG-YGY-GYGYGYGYYAEDASRNKSLWERITNSKFISLLKN---------
A0A368D1N7      -------GYGYG-YGY-GYGYGYGYYSDPDNTRKK-----KRSSLISRFRKKS-------
A0A3B8TU58      -------GYGYG-YGY-GYGYGYGYYSDPDETREN-----ERTGFFSRFRKNS-------
A0A1T5IIR6      -------GYGYG-YGY-GYGYG-------DEPKK--------KRFLGIFKRK--------
A0A3E0QD27      -------GYGYG-YGY-GYGYG-------YYDDEAKKPLTTWQAFKARLGKK--------
A0A0M1W1I6      -------GYGYG-YGY-GYGYV--------DGSE--------SSWKRLFKKKS-------
A0A4R4GHU2      -------GYGYG-YGY-GYGYV--------DGSE--------SSWKRLFKKKS-------
I8WPR6          -------GYGYG-YGY-GYGYV--------DGSE--------SSWKRLFKKKS-------
A0A0K2HKS3      -------GYGYG-YGY-GYGYV--------DGSE--------SSWKRLFKKKS-------
B6W3W8          -------GYGYG-YGY-GYGYV--------DGSE--------SSWKRLFKKKS-------
A0A4R4GSI6      -------GYGYG-YGY-GYGYV--------DGSE--------SSWKRLFKKKS-------
A0A076IRY8      -------GYGYG-YGY-GYGYV--------DGSE--------SCWKRLFRKKS-------
A0A3A6AD54      -------GYGYG-YGY-GYGYV--------DGSE--------SCWKRLFRKKS-------
A0A3A6MIU7      -------GYGYG-YGY-GYGYV--------DGSE--------SCWKRLFRKKS-------
I8WPP8          -------GYGYG-YGY-GYGYV--------DGSE--------SCWKRLFRKKS-------
A0A372Y7D2      -------GYGYG-YGY-GYGYV--------DGSE--------SCWKRLFRKKS-------
A0A3E4JJC9      -------GYGYG-YGY-GYGYV--------DGSE--------SCWKRLFRKKS-------
A0A3E4WDQ0      -------GYGYG-YGY-GYGYV--------DGSE--------SCWKRLFRKKS-------
A0A414H9P2      -------GYGYG-YGY-GYGYV--------DGSE--------SCWKRLFRKKS-------
C3R5A8          -------GYGYG-YGY-GYGYV--------DGSE--------SCWKRLFRKKS-------
A0A1C5XJA7      ------GSYGYG-YGY-GYGNN-------KNK----------------------------
A0A3E5BU42      --------YGYG-YGY-GYGKR-------KNK----------------------------
R7CUW4          --------YGYG-YGY-GYGRY-------GYGNK--------KHGRN-------------
A0A416GGJ1      --------YGYG-YGY-SYQYK--------GGE---------------------------
D1JY72          -------GYGYG-YGY-GYGYV--------DGSE--------SSWKRLFKKKS-------
D7J4K6          -------GYGYG-YGY-GYGYG-------KHGRR--------K-----------------
Q8ABP9          -------GYGYG-YGY-GYGYG-------KHGRR--------K-----------------
A0A5M6AHF7      -------GYGYG-YGY-GYGYG-------KHGRR--------K-----------------
D6D2Z5          -------GYGYG-YGY-GYGYG-------KHGRR--------K-----------------
A0A1T3EDR4      -------GYGYG------------------QELK--------GGLWSRFLRMFRRV----
A0A174SDD8      -------GYGYN-YGY-GYAAT--------QKKK--------GGWWRRKGKK--------
A0A1H7RFH3      -------GYGYN-YGY-GYAAT--------QKKK--------GGWWRRKGKK--------
A0A139L1N2      -------GYGYN-YGY-GYAAT--------QKKK--------GGWWRRKGKK--------
A0A174TVL8      -------GYGYN-YGY-GYAAT--------QKKK--------GGWWRRKGKK--------
A0A1H8BJR6      -------GYGYN-YGY-GYAAT--------QKKK--------GGWWRRKGKK--------
R9H6G0          -------GYGYN-YGY-GYAAT--------QKKK--------GGWWRRKGKK--------
A0A412GR09      -------GYGYN-YGY-GYAAT--------QKKK--------GGWWRRKGKK--------
A0A4Q5DX00      -------GYGYN-YGY-GYAAT--------QKKK--------GRWWRRKGKK--------
A0A081PBV5      -------GYGYG-YGY-GYGYG--------NETK--------KTIWDKLFGKR-------
A0A1I2AN85      -------GYGYG-YGY-GYGYG--------NETK--------KTIWDKLFGKR-------
A0A4U0GMP3      -------GYGYG-YGY-GYGYG--------NTKT--------------------------
A0A1H6CKR6      -YGYGYGGYGYG-YGY-GYG----------NRKK--------KSFFQKLLGR--------
A0A235E1C0      -GGYGYGGYGYG-YGY-GYG----------QPKK--------KGFFSRLFGKN-------
R6D982          -------GYGYG-YGY-GYSYG-------NDEKK--------KNWFFGKRKKESV-----
A0A1F0I8C4      -------GYGYG-YGI--------------DVEK--------SGWWSRMKKRMKR-----
A0A3A5RIJ2      -------GYGYG-YGI--------------DVEK--------SGWWSRMKKRMKR-----
A0A515IZJ5      -------GYGYG-YGI--------------DVEK--------SGWWSRMKKRMKR-----
A0A5M5NLR3      -------GYGYG-YGI--------------DVEK--------SGWWSRMKKRMKR-----
A0A0D5BSQ0      -------GYGYG--SY-GYGYG--------EEKK--------KSVFDWFKRS--------
A0A1T3F6P5      ------GGYGYG--SY-GYGYG--------EEKK--------KSVFDWFKRS--------
A0A0W8EPA0      ------GGYGYG--SY-GYGYG--------EEKK--------KTIFNWFKRS--------
A0A365UKN1      ------GGYGYG--SY-GYGYG--------EEKK--------KSIFDWFKRS--------
A0A4R6WE41      ------GRYGYG--NY-GYSYG--------NEK---------KSIWKKIFG---------
A0A2T5RP38      ------GGYGYG--SY-GYGYG--------EEKK--------KSVFDWFKRS--------
A0A1A6CF06      ------GGYGYG--SY-GYGYG--------EEKR--------KSIFSWFKRS--------
A0A1T3D6S8      ------GGYGYG--S---YGYG--------EEKK--------KSVFDWFKR---------
A0A1P8E011      -------GYGYG-YGY-GYGYG--------REEG--------QNSWRKIARSIRTIFTRK
A0A1V3N3U3      -------GYGYG-YGY-GYGYG--------NTEQ--------QVWYKRWWRKIKS-----
C2FUH6          -------GYGYG-YGY-GYGYS--------NEKR--------HNLFSSLLEKIKGL----
A0A0B8T471      -------GYGYG-YGY-GYQKE--------KAGL--------RGFFNRLFRR--------
A0A4R7D2K0      -------GYGYG-YGY-GYQKE--------KAGL--------TGFFRRLFQR--------
A0A2X2J8S4      -------GYGYG-YGY-GYRYG--------DDK---------KSFWKKVFNK--------
A0A3C0S618      -------GYGYG-YGY-SYRYG--------DDK---------KSFWKKVFNK--------
A0A4P7DRF9      SYGYGYGGYGYG-YGY-GYGNH--------KKK---------KSIFNIFKKR--------
A0A239XXC4      -GGYGYGGYGYG-YGY-GYSAQ--------QKR---------GFFSRLFGKK--------
A0A4U9K473      -YGYGYGGYGYG-YGY-GYGAQ--------KKK---------RFLL--------------
A0A3D4RLG4      -------GYGYG-YGYGGKNDYNYYSDDE-------------------------------
A0A3N2LCI3      -------RYGYG-YGYG-YGYNYGSGEKKEE-----------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A519SYE7      -------GYGYG-YGYGSYGMGY-------------------------------------
A0A5Q4EKA0      -------GYSYG-YYYGGYGSGYGYYDDQINIVKRSFWKRILGLGSKKL-----------
A0A3D4CJE1      -------GYGYG-YGYG-------YYED----VPEKQVWWKAIFNKK-------------
A0A4Q5ZQ60      -------GYGYG-YGYG-YGYGYGYYDE--QEKKGLLGRIKDKFKKA-------------
A0A519Q885      -------GYGYG-YGYG--TYGMGYYEEPSQGKPSISQRFKRLFS---------------
A0A519TAP8      -------GYGYG-YGSSGTGYGMGYYDEAVQ-PPTLGQKIKSFFS---------------
A0A2K8ZAP1      -------SYNYG-DYM-DLTKKFD------------------------------------
A0A2T4XEQ1      -------KY-YS-YND-YLEYTEEKEEVA-------------------------------
A0A2T2TDL4      -------KYRYR-HYD-QYGPYDQYRSLPEEASA--------------------------
A0A348PT57      -------GYGYG-YGY-GYTSGNGYYSEDNEEEEPKLNFLRNLRSKLKNDDN--------
A0A3D1AEJ6      -------GYGYG-YGY-GYGYGNDKDK---------------------------------
A0A3D3LSK1      -------SYGYY-YNY-YYYYSGDSKKKNN------------------------------
A0A496L711      -------GYGMP-KKM-GNYYVTEEFEQDDVSILEKLIYKISDMTKKIRNIKK-------
R7JFY1          -------GYGYG-YGY-GYGYGNEKKRK--------------------------------
A0A1V5S5I3      -------GYHYD-YGS-KSYYGK-------------------------------------
A0A2M7VVW6      -------NYSYG-NKD-GYYYDDTQKEKLTKRIFKKKK----------------------
A0A656PYT8      -------GYGYG-YGY-GYGYGEDESQKSSAVIDSRYNLTQRLKDFLGLNDKK-------
A0A413V760      -------GYGYG-YGY-GYGYGNESH-------GHKHGRYESLKNLFSRFFKRS------
A0A641LIG3      -------GYGYG------------------------------------------------
A0A641LPE6      -------GYGYG-YGY-GYGYGNEGY-------GHKHGMKKGLKKFLGWILKR-------
A0A1T4NDR5      -------KYYSH-YNY-QYQPKARKRKKK-------------------------------
A0A3D5KRM7      ---------SYK-YGY-GYGYG--------------------------------------
A0A3M1NUH2      -------------YGY-KYRYRHYDRYTQYTSEYGTYGYRDVKELLKDKES---------
A0A359ATS6      -------GYRYG-YKY-GYHYGSEKKKTWWGNKG--------------------------
A0A1V6HYH8      -------KYGK--YGY-EYKYDIYGYYTDNEEKQSNTKKSMKKYFNYFYKKNK-------
A0A2E0MDX6      -------GYGYG-YGY-GYGYGYGGNH-GYYEEK-PQKEKTTFNKIFSKK----------
A0A2M7KCE1      ---------GYN-YGY-GYGYGNSEYHTDYYDESITKKKKNIFTKIISHL----------
A0A523GUD4      -------DHKY--YGY-DY-YNYNTNDK--------------------------------
A0A641X2Z6      -------GYYYY-YGS-DSTSGGGHSSL-----------KVRWKLRRY------------
A0A519PJW5      -------GYGYG-YGY-GYGYGYGSYGMGYYEE-PVQKPTLSQRIKGLFS----------
A0A519T3R9      -------GYGYG-YGY-GYGYGYGTYGMGYYEEMDNRKLTVGQRLKRLFS----------
                                                                            

A0A3M1Y2F5      ---
A0A1G1TG88      ---
A0A661XXA6      ---
A0A2T2UAJ4      ---
A0A519SD85      ---
A0A4Q3SEI4      ---
A0A3M1TXY5      ---
A0A2E0VQ27      ALS
R6U429          ---
R5DEG6          ---
A0A5C8AF42      ---
A0A642EJV3      ---
A0A161LWY6      ---
A0A212J9Z9      ---
F5IV23          ---
F8X2T0          ---
A0A1M3LAG1      ---
A0A212K6G4      ---
A0A4Y9IPG7      ---
A0A2V3PNY7      ---
A0A1M5DFS8      ---
A0A4Y8KZS5      ---
A0A239K409      ---
A0A350V3E4      ---
A0A1M6MYT6      ---
A0A2P8CDS1      ---
A0A5M4A2I9      ---
A0A353WYK7      ---
A0A355BP94      ---
A0A136LSC7      ---
A0A5C7N8Q5      ---
A0A1V5S1J9      ---
A0A0A2EYC8      LFK
A0A2G6H6Y4      ---
A0A1M3DPL8      ---
A0A1V5F519      ---
A0A2G6R1T9      ---
A0A2W4RDE8      ---
A0A0L8VEV2      ---
A0A1I2A9Z9      ---
A0A142HHS5      ---
A0A660LQT8      ---
A0A350PNH9      ---
A0A354LNT9      ---
A0A2M6GH67      NFT
A0A389LWV6      ---
A0A1G9B1T9      ---
A0A3D0FMX4      ---
A0A1M3MEI8      ---
A0A1J5HQM0      ---
A0A653AC35      ---
E4T131          ---
A0A521H707      ---
A0A1F3D6P8      ---
A0A356Z058      ---
A0A3D1BT36      ---
A0A352ME00      ---
A0A3D3HL11      ---
A0A5R9QZP0      ---
A0A2W7RD29      SSK
A0A3N2NDY8      ---
D7JEV9          K--
A0A4R6H3B7      ---
A0A2W7QSQ0      ---
R7F6L5          ---
A0A553GA49      ---
A0A497D6F6      ---
A0A5M4AAB9      ---
F4KR18          ---
C9LKL0          ---
A0A3D0QPV7      ---
A0A496KT23      ---
L1M9T3          ---
A0A3C0I8F1      ---
R5JJI4          ---
A0A3D2HF71      ---
A0A0A2DQN2      ---
A0A0A2F2N5      ---
L1NGW4          ---
Z4WRA0          ---
U2K8K9          ---
A0A069ZM60      ---
J6GV98          ---
A0A134B4F8      ---
A0A134B8C7      ---
A0A4Z0EKR0      ---
A0A229I3A5      ---
A0A3R6HJB3      ---
B5CTK0          ---
A0A1M6B6D5      ---
A0A451FS66      ---
A0A2E3GN39      ---
A0A3D1MEL0      ---
F0R0C9          ---
A0A2A4N9A6      ---
A0A368D1N7      ---
A0A3B8TU58      ---
A0A1T5IIR6      ---
A0A3E0QD27      ---
A0A0M1W1I6      ---
A0A4R4GHU2      ---
I8WPR6          ---
A0A0K2HKS3      ---
B6W3W8          ---
A0A4R4GSI6      ---
A0A076IRY8      ---
A0A3A6AD54      ---
A0A3A6MIU7      ---
I8WPP8          ---
A0A372Y7D2      ---
A0A3E4JJC9      ---
A0A3E4WDQ0      ---
A0A414H9P2      ---
C3R5A8          ---
A0A1C5XJA7      ---
A0A3E5BU42      ---
R7CUW4          ---
A0A416GGJ1      ---
D1JY72          ---
D7J4K6          ---
Q8ABP9          ---
A0A5M6AHF7      ---
D6D2Z5          ---
A0A1T3EDR4      ---
A0A174SDD8      ---
A0A1H7RFH3      ---
A0A139L1N2      ---
A0A174TVL8      ---
A0A1H8BJR6      ---
R9H6G0          ---
A0A412GR09      ---
A0A4Q5DX00      ---
A0A081PBV5      ---
A0A1I2AN85      ---
A0A4U0GMP3      ---
A0A1H6CKR6      ---
A0A235E1C0      ---
R6D982          ---
A0A1F0I8C4      ---
A0A3A5RIJ2      ---
A0A515IZJ5      ---
A0A5M5NLR3      ---
A0A0D5BSQ0      ---
A0A1T3F6P5      ---
A0A0W8EPA0      ---
A0A365UKN1      ---
A0A4R6WE41      ---
A0A2T5RP38      ---
A0A1A6CF06      ---
A0A1T3D6S8      ---
A0A1P8E011      IKH
A0A1V3N3U3      ---
C2FUH6          ---
A0A0B8T471      ---
A0A4R7D2K0      ---
A0A2X2J8S4      ---
A0A3C0S618      ---
A0A4P7DRF9      ---
A0A239XXC4      ---
A0A4U9K473      ---
A0A3D4RLG4      ---
A0A3N2LCI3      ---
A0A1H6Z2F8      ---
A0A2P8G5K0      ---
A0A519SYE7      ---
A0A5Q4EKA0      ---
A0A3D4CJE1      ---
A0A4Q5ZQ60      ---
A0A519Q885      ---
A0A519TAP8      ---
A0A2K8ZAP1      ---
A0A2T4XEQ1      ---
A0A2T2TDL4      ---
A0A348PT57      ---
A0A3D1AEJ6      ---
A0A3D3LSK1      ---
A0A496L711      ---
R7JFY1          ---
A0A1V5S5I3      ---
A0A2M7VVW6      ---
A0A656PYT8      ---
A0A413V760      ---
A0A641LIG3      ---
A0A641LPE6      ---
A0A1T4NDR5      ---
A0A3D5KRM7      ---
A0A3M1NUH2      ---
A0A359ATS6      ---
A0A1V6HYH8      ---
A0A2E0MDX6      ---
A0A2M7KCE1      ---
A0A523GUD4      ---
A0A641X2Z6      ---
A0A519PJW5      ---
A0A519T3R9      ---
                   

© 1998-2020Legal notice