BYKdb

Dataset for cluster orphancd of phylum bacteroidetes

[Download (right click)] [Edit] [Sequences] [Repertoires]

221 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A519SD85      ------------------------------------------------------------
A0A3M1TXY5      ------------------------------------------------------------
A0A2E0VQ27      ------------------------------------MTFNKEYKMIIRPLLK--------
R6U429          ------------------------------------------------------------
A0A5C8AF42      ------------------------------------------------------------
A0A239K409      ----------------------MVMIDKEAQKMGNRQNEQESFIDSFFKYVR--------
A0A1V5S1J9      ------------MDNNQQYTQNQYTSQANAFSDDDGGGQKFDIMLWVLRFLK--------
A0A0A2EYC8      -----------------MENTNN-IPNIQTFSEEE-ASS-FNLMEWVMRFLK--------
A0A2G6H6Y4      -----------------METSNNQIQSMQQFSEEDNTSS-LSVMEWIMRCVR--------
A0A1M3DPL8      -----------------MNMEEENKDIKTSDFTDEESS--FDIMEWVMLFVS--------
A0A1V5F519      --------------------MNPDTGSINQNFTEEESS--FDFQKWLHLFIK--------
A0A2G6R1T9      --------------------MEENSLNQQQFDDSEESG--FDFMSWVILLVQ--------
A0A350V3E4      ------------------------------------------------------------
A0A6J4K208      -------------------------------MKNSSSREKMGWTYVLRNLRR--------
A0A1M6MYT6      -------------------MKKQQNDKDILNFYGQLEEESLISKKTLFKCFR--------
A0A2P8CDS1      ----------------------MDTQNPLTPNQPTTFSRPRNYRKYFFLLLS--------
A0A353WYK7      ----------------------------------MEQNQQFDFDKLQMVFKR--------
A0A355BP94      -------------------------MSKQLNSPTTDPIEGFDLDKLWVLLKK--------
A0A136LSC7      -------------------------MLQPKEIGP--QVQSIDTEKLSAVIRK--------
A0A5C7N8Q5      ------------------------MLKEPKDIGPLTEVQSIDTEKLAAVFRK--------
A0A2W4RDE8      -----------------------------------MEEEKINIKKIFHKLIS--------
A0A0L8VEV2      ------------------------MKTMEDFSKSLEREDMLAIKKFFHKLKR--------
A0A1I2A9Z9      ------------------------MKTMEEYSNSLEREDMLSVKKFFHKLVR--------
A0A212J9Z9      -------------MDNN--NKKVIESDPYFEEVKTKTNISFDFVLWFYRILK--------
F5IV23          -------------MDNN--NKKVIESDPYFEEVKTKTNISFDFVLWFYRILK--------
F8X2T0          -------------MDIN--NKPGADTDPYFEEIKSKTTLSFDFVLWFYRILK--------
A0A1M3LAG1      -------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVLWFYRILK--------
A0A212K6G4      -------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVLWFYRILK--------
A0A4Y9IPG7      -------------MDIN--NKPGADTDPYFEEIKAKTTLSFDFVLWFYRILK--------
A0A2V3PNY7      -----------MEQNIN--RPADFGTDPYFDEVQAKTKFTFDFVLWFYRILK--------
A0A6G7WQ31      -----------MEQNIN--RSPDFSTDPYFDEVQAKTKFSFDFVLWFYRILK--------
A0A6G7X5K8      -----------MEQNIN--RSPDFSTDPYFDEVQAKTKFSFDFVLWFYRILK--------
A0A1M5DFS8      -----------MEQNINTTRPNDYGADPYFDEVQAKSKFSFDFVLWFYRILK--------
A0A4Y8KZS5      -----------MEQSLN--KPNDFGTDPYFDEIQAKTKFSFDFVLWFYRILK--------
A0A142HHS5      MASTENAELEELIRRASTGGEAAPPTGASFAEEDTEDGDNFDLSTLVLVARR--------
A0A660LQT8      ------------------------MEDKDNITPSQETKNGVDIVDVLYLCLD--------
A0A2M6GH67      ------------------------------------------FITLLVVTRK--------
A0A389LWV6      --------------MESTNTKSTNFSIDDTNFQHPGNTSSFDLVLWIFRILK--------
A0A1G9B1T9      ------------------------METSRYSHTQALKSDPIDLSVITKKIIR--------
A0A350PNH9      -----------------MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYLCLV--------
A0A354LNT9      -----------------MIQNNQATMQNVLVRRPQQAEDFIRLQDLMYLCLV--------
A0A161LWY6      ---------------METNNNNQYQNYPLSNSDMEEDESGFDIIEWLFKILR--------
A0A6I3N9U6      ---------------METNNNNQYQNYPLSNSDMEEDESGFDIIEWLFKILR--------
A0A3D0FMX4      --------------------MATDTNVQNQDFTNQDDRIQFDVMEWVFKFLS--------
A0A1M3MEI8      ---------------------MEQPVKPRERVIPEEEESGFDIMEWVAHFIG--------
A0A1J5HQM0      ---------------------MEQNKPANP--FSEEEESSFDIMEWVNIFLH--------
A0A653AC35      -------------------MEENPYNTQYPQQFTEEEESSFDIKEWAFLFLH--------
E4T131          ---------------------MDKFNLEKP--FNSEEESGFDIMEWVSYFLN--------
A0A521H707      ----------------------------MAKKKISNLNEEFDFKLFTIIARK--------
A0A1F3D6P8      -------------------------------MTKETDSGIALIKHYLQDIAY--------
A0A356Z058      -------------------------------MTKETDSGIALIKHYLQDIAY--------
A0A3D1BT36      -----------------------------MSKNNETKSESLKIKEFIFKVFS--------
A0A5R9QZP0      -----------------------------MSLNNNHPEEGFNIKEFILLTFR--------
A0A3D3HL11      --------------------------MQLMTNNNDSQSEAFNIKEFLAEALS--------
A0A6L8U6G9      ----------------------------MTNNQNDSQSEAINIKEFITEALS--------
A0A352ME00      -----------------------------MLKTIEPDSSIAPLKYFILKVAS--------
A0A6L8UH35      -----------------------------MLKTNDSDASIAPIKYFIFKVAS--------
A0A2W7RD29      ------------------------MNNKSESDPLLLSSQKIDFSVFFKRLGK--------
A0A3N2NDY8      ------------------------MSDNINVTQESEAAEEFSLKDFLACCLS--------
D7JEV9          ---------------------MEQNNNISNNTFNEEETSSFNFMEWAIRFLK--------
A0A4R6H3B7      ------------------------MKTMEEYSNSLEREDMLSVKKFFHKLVR--------
A0A3P1Z8V4      ---------------------MIQSSSSHPDYPHLPSDSDTNILPVLLKCWGIFRR----
A0A2W7QSQ0      --------------------------MRKINKKVNSNEEPINIKLILRTILK--------
R7F6L5          ---------------MANQIKENEAANISPYYEQAAPASLVSVQGFLSFVRH--------
A0A7C5MRV2      --------------------------MRPVLKSRGTGNEEINLSKIWDLFEN--------
A0A553GA49      --------------------------------MNLENDQSNDLKNVLHKVGK--------
A0A497D6F6      ------------------------------------------------------------
A0A5M4AAB9      ------------------------------------------------------------
F4KR18          ----------------MNEFEYPKAILLNSNLKDSSDSQVDYWGLLHKFILS--------
A0A229I3A5      -----------------------------MARP-NQEEDFIRIQDLLYLCLT--------
A0A3R6HJB3      -----------------------------MARP-NQEEDFIRIQDLLYLCLT--------
R6NN15          -----------------------MSETQQHTRPAAKADDFIRIQDLYYLCLA--------
C9LKL0          -------------------------MEYSQKNEVQNSEFKIVPFLLLCYHVFLA------
A0A3D0QPV7      --------------------MIDEKIQRQSESFSQYKERITNFSNEFELGLFLYIARKSL
A0A496KT23      ----------------MQRSAENFSQNSSFISQTSSVSILELLRDAWLLCLA--------
L1M9T3          -----------------------------------------MVRDGFYLCLA--------
A0A3C0I8F1      ---------DYFVKKIIPPTTVFLERNHENINKILEESEGMDIVNDFDFEKFVEILRGSI
R5JJI4          ------------------------------------------------------------
A0A0A2DQN2      ---------------------------------MIRQVSDVNLLDVLRYLVS--------
A0A0A2F2N5      ---------------------MTPQSSSKQTKSAGTVVADINLIDLFFYLLG--------
L1NGW4          ----------------------MANTQETTSTQPAEKGLEVNLVDIFFYLLR--------
Z4WRA0          ----------------------MANTQETTSTQPAEKGLEVNLVDIFFYLLR--------
U2K8K9          ------------------------MPEQQITNRPSDKGADLNLVDIFMYLYR--------
A0A069ZM60      -----------------------MSTQTNRSNQAGEKAAEVNLLDIFFYLLR--------
J6GV98          -----------------------MSTQTNRSNQAGEKAAEVNLLDIFFYLLR--------
A0A134B4F8      -----------------------MSTQTNRSNQAGEKTAEVNLLDIFFYLLR--------
A0A134B8C7      -----------------------MSTQTNRSNQAGEKTAEVNLLDIFFYLLR--------
A0A3D2HF71      ------------------MTSPSPLNNPSQPYYIPPEEEGLDFKRYLSLFIS--------
A0A4Z0EKR0      ------------------------MTNDELFPLKTEQPETADLKSVLLSYAR--------
B5CTK0          -----------------------MAEKKQATDLLKGEDSSFNIGEILHMFLS--------
A0A1M6B6D5      ---------------------------MSEEFETNEAGTTFDFKGFLIRLLR--------
A0A451FS66      ---------------------------MNQEFDIKQADGSFDFKGFFDRLLR--------
A0A2E3GN39      ------------------------------------------------------------
A0A3D1MEL0      ------------------------------------------------------------
A0A519UDD1      ------------------------MANDDLFPVSREQPGTFDARRILLQYTR--------
A0A2A4N9A6      ----------------------------MKENQIQNPLPDLDIGLLIGIFRK--------
A0A6C0GGI1      -------------------------------MANQPNESKLDLKQLFSRYFT--------
A0A368D1N7      -----------------------MSEPSKKKQQSSVLYDKFNVGLLLYVLRK--------
A0A3B8TU58      ------------------------------------------------------------
A0A1T5IIR6      ---------------------------MKTAPRKVTRNEQVNLVDLFYYLIG--------
F0R0C9          ------------------------MAIPNNPTRPKQGDDFIRIQDLFYLCLA--------
A0A6L6NXQ0      ------------------------------------------------------------
A0A6N8DCX3      ------------------------MDLLLQELQGGKPDDALRVKEFFYLCLA--------
A0A3E0QD27      --------------------------MGKKKITNLNEEFDFKLFSIIAKKNA--------
A0A0M1W1I6      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS--------
A0A4R4GHU2      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS--------
I8WPR6          ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS--------
A0A0K2HKS3      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS--------
B6W3W8          ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS--------
A0A4R4GSI6      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS--------
A0A076IRY8      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS--------
A0A3A6AD54      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS--------
A0A3A6MIU7      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS--------
I8WPP8          ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS--------
A0A372Y7D2      ------------------MIRMSEQKDMSGDKTLSGGGFNINPVDIIMYLLS--------
A0A3E4JJC9      ------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLS--------
A0A3E4WDQ0      ------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLS--------
A0A414H9P2      ------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLS--------
C3R5A8          ------------------MIRMSEQKDLSGDKATSGGGFNINPIDIVMYLLS--------
A0A1C5XJA7      ---------------------------MQNNIQSNKNDQNINLLDLLMYLAS--------
A0A285T4L1      ---------------------------MQNNTLSNKNEQSINLVDLFVYLLS--------
A0A3E5BU42      ---------------------------MQNNTLSNKNEQSINLVDLFVYLLS--------
R7CUW4          ---------------------------MQTTSNNNRNEQGINVVDLLVYFAS--------
A0A416GGJ1      ---------------------------MQTNKKVDSG---LNLIDVFSFLAS--------
D1JY72          ---------------------------MSGDKTLSGGGFNINPVDIIMYLLS--------
D7J4K6          ---------------------------MQNNSLSNKNEQGVNLVDLSVYLLS--------
Q8ABP9          ---------------------------MQNNSLSNKNEQGVNLVDLSVYLLS--------
A0A5M6AHF7      ---------------------------MQNNSLSNKNEQGVNLVDLSVYLLS--------
A0A6L4IA73      ---------------------------MQNNSLSNKNEQGVNLVDLSVYLLS--------
D6D2Z5          ---------------------------MQNNSLSNKNEQGVNLVDLSVYLLS--------
A0A1T3EDR4      -----------------------MIRNSKYINIRGTWGENFHILDLFKYALG--------
A0A174SDD8      -------------------------MEKHKKLAVTEEEKSINIVDLFIYLLV--------
A0A1H7RFH3      -------------------------MEKHKKLAVTEEEKSINIVDLFVYLVV--------
A0A139L1N2      -------------------------MEKHKKLAVTEEEKSINIVDLFVYLVV--------
A0A174TVL8      -------------------------MEKHKKLAVTEEEKSINIVDLFVYLVV--------
A0A1H8BJR6      -------------------------MEKHKKLAVTEEEKSINIVDLFVYLVV--------
R9H6G0          -------------------------MEKHKKLAVTEEEKSINIVDLFVYLVV--------
A0A412GR09      -------------------------------MAVTEEEKSINIVDLFVYLVV--------
A0A6I0S0M4      -------------------------------MAVTEEEKSINIVDLFVYLVV--------
A0A081PBV5      ----------------------MDNLNNINLMPKAKEEKSINLLDILKYLLF--------
A0A1I2AN85      ----------------------MDNLNNINLMPKAKEEKSINLLDILKYLLF--------
A0A4U0GMP3      ----------------------MENSAATNYLVQEKEEKSINVIDILKYLLF--------
A0A1H6CKR6      --------------------------MNKDFLIKDKQTQSINVLDVLKYLLS--------
A0A235E1C0      ---------------------MVNHSTNKPFQGKGKQDQSLYVLDILRYLLA--------
R6D982          -------------------------MEKQVKKILAEEDKSINLVDILMYLLS--------
A0A1F0I8C4      -------------------------MEKQRKLALTEEEKSVNIVDVFMYLIA--------
A0A3A5RIJ2      -------------------------------MALTEEEKSVNIVDVFMYLIA--------
A0A515IZJ5      -------------------------------MALTEEEKSVNIVDVFMYLIA--------
A0A5M5NLR3      -------------------------------MALTEEEKSVNIVDVFMYLIA--------
A0A0D5BSQ0      ------------------------MINQNKQNV--QKDGIINVLDILKYFLF--------
A0A1T3F6P5      ----------------------MDTINQKNQVVGNKKEHSVNVLDILKYLLH--------
A0A0W8EPA0      ----------------------MDTINQKNQVIGNKKEHSVNVLDILKYLLH--------
A0A365UKN1      ----------------------MDTINQKNQVIGNKKEHSVNVLDILKYLLH--------
A0A4R6WE41      ----------------------MVKNKDTEGVVQEQRDPSLNVLDVLKYLLS--------
A0A2T5RP38      ----------------------MNTLNQKEYRIGERKEQTINVLDLLKYLLH--------
A0A1A6CF06      ----------------------MNQYSKNSV----QKENTINVLDIFKYLLF--------
A0A1T3D6S8      ----------------------MNQYNKHSV----QKENTINVLDIFKYLLF--------
A0A1P8E011      --------------------------MKTTHYNQLQKDKSINVLDVLAHLLY--------
A0A1V3N3U3      ----------------------MNNILERTGAGAERKNNSVNVLDIFKYLLF--------
C2FUH6          ------------------------MVNNQITQNITKADKSVNIIDLFKYLMI--------
A0A0B8T471      ---------------------MDNTNYNPYIESREKEGKSLNLIDLIKYLLL--------
A0A4R7D2K0      ---------------------MDNTNYNPYIESREKEGKSLNLIDLIKYLLL--------
A0A2X2J8S4      -------------------MENRPEVVNNQFFGA-KNNSTFNVLDIIKYLLF--------
A0A3C0S618      -------------------MENRPEVVNNQFFGA-KNNSTFNVLDIIKYLLF--------
A0A4P7DRF9      -----------------------MSKISNTYMQK-QQEKSINILDLFRYLLA--------
A0A239XXC4      --------------------------MNKSFQGKGKQDQSLYVLDILRYLLG--------
A0A4U9K473      --------------------------MSKPFQGKGKQDQSLHVLDILRYFLS--------
A0A3M1Y2F5      ------------------------------------------------------------
A0A7C7CKY6      ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A6L3FBV2      ------------------------------------------------------------
A0A6L3FIH8      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6L6NZ03      ------------------------------------------------------------
A0A642EJV3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A6L4ENN1      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A519SD85      ------------------------------------------------------------
A0A3M1TXY5      ------------------------------------------------------------
A0A2E0VQ27      ASPVLIGLITIAILVTRRAVT-YMTPEYRAGGAIKINNLNYTQAAINLFGEENEKNLPRQ
R6U429          ----------------------MRDLASFTGGLSRMRSSGS-------------------
A0A5C8AF42      --------------------------------VIQLDNQDNAKDIIELENINSKQD----
A0A239K409      YWYLFLLGLLITVGTAYVYIQ-HATPLYLISGTLLIKTSGNEGQLSESAAFSDLNTFKTS
A0A1V5S1J9      SWYLFVISLAIFLSIAYVKNR-SWQPNYKSSALVIIEENKGLSGAQAALMQ-GFS-----
A0A0A2EYC8      YWYLFAIGVVIALTIAYYQNR-SFVPIYNSSLRLLLK-QE---SGSFLSMQ-NFNSG--F
A0A2G6H6Y4      YWYLFVIGASIGFGLAFYKNQ-KVVPNYLSYSQILLEDKK---ADSFATLQ-NYS-----
A0A1M3DPL8      HWYLILISVFVFMFLAYMQNR-KWLPSFKSSATVIIDESRGSMNSAQVLMQ-GFG-----
A0A1V5F519      NWYLFLIFIPFFLIGGYLKNR-SWMPLYQSVGTIIINENKYR-SSSQGFMQ-GFG-----
A0A2G6R1T9      YWYLFVIFGVLAFGASYLKNR-SWVPVYFSSGKLMIDPNAGQ-NNPQ-FMQ-GFG-----
A0A350V3E4      --MPILLSLAVGLVVSYFYAY-SQVDIYASASSMRLSKPKENVLEN-------------K
A0A6J4K208      RWYLFALALAFAVAGAYLYLQ-FTPRVYNLTATLLVDGPGPAVPGSDAPPA---------
A0A1M6MYT6      NWYWYVVAVIVAGALAWLYVQ-YTTSVYEIKSSMLVEEGKSGSPLGSGGANSENIFLGLG
A0A2P8CDS1      HWYWFVIAFILTVTGIWLYYR-YSHPVYAVSSTMLIHEQQNQNPLTTQKDPESNVFQGFG
A0A353WYK7      SLPVLIMLLIFSVATAYLTIR-YTKDLYQSESVLQLDIKSEAQVLGFRSF--DEDIN---
A0A355BP94      NALIIILLFLSTNLIAYLKIR-WTKDEFESYSELKLEVKQDATALGIKQFAEDQNRN---
A0A136LSC7      NLVWIVLIFIAVNLAAYLTIR-YTKDLFESESEMKLDIKRDATELGIKTYMEDQNVN---
A0A5C7N8Q5      NLIWIILIFIAANLAAYLTIR-YTKDLFESESEMKLDIKRDATELGIKTYIEDQNMN---
A0A2W4RDE8      KWYYFPLGLLITMPLAYAYIQ-LTEPRYLVRASMLLKGEKDKGPSQFLKGM--------E
A0A0L8VEV2      NWYWFMIAGIIGGAGGYLLTQ-VTPPSYELNSLFLIKKKDNAQV--------QLDLPFSN
A0A1I2A9Z9      NWYWFMIVGIIGVGLGYLKTQ-VTAPAYKLESLFLIKTDNKGGL--------RMDFPLPS
A0A212J9Z9      YWYLFIISVALFLGYAYIKNK-SWVPVFYVQALMILEDRNTASVVAGSVPTGTLLR----
F5IV23          YWYLFIISVALFLGYAYIKNK-SWVPVFYVQALMILEDRNTASVVAGSVPTGTLLR----
F8X2T0          YWYLFVISVVLFMAYAFIKNK-SWVPLYGIQAMIILEDRGSSMIS-GAVPLGSILR----
A0A1M3LAG1      YWYLFVISIALFMAYAFIKNK-SWVPFYGIQAMIILEDRGSSMIS-GAVPLGSILR----
A0A212K6G4      YWYLFVISIALFMAYAFIKNK-SWVPFYGIQAMIILEDRGSSMIS-GAVPLGSILR----
A0A4Y9IPG7      YWYLFVISIALFMAYAFIKNK-SWVPFYGIQAMIILEDRGSSMIS-GAVPLGSILR----
A0A2V3PNY7      YWYLFALSLALFLGYAYIKNK-SWTPLYQSGAVLMMESRGNAGVAIGSVQLGTLVQ----
A0A6G7WQ31      YWYLFAISLALFLGYAYLKNK-SWTPLYQSGAVLMMEQRGNSGVAMGAVQLGSLVQ----
A0A6G7X5K8      YWYLFAISLALFLGYAYLKNK-SWTPLYQSGAVLMMEQRGNSGVAMGAVQLGSLVQ----
A0A1M5DFS8      YWYLFVLSLALFLGYAYLKNK-SWTPLYRSGAVLMMESRGNSGVAMGAVQLGSLVQ----
A0A4Y8KZS5      YWYLFILSLALFLGYAYLKNK-SWTPLYRSSATLMMEPRGNNGVAMGSVQLGSLVQ----
A0A142HHS5      SLPWVIFLLTLGITSSWLYMR-YTKPIYEATSILKIDDHSDASALGLGMAMGGAENNQAS
A0A660LQT8      RWYWFVVSVLLFLGLGMYMIL-RTPPVYNRYASVLIKDNQSSKNTSIDQQL---------
A0A2M6GH67      SLIWIVFLIMLGLGASYLFLR-YTKPVYRSSSTLKIDERSQAGALGLGGPLGNA-----A
A0A389LWV6      YWYLFLVVILLSLSLALLKNK-TWTPTYKTSSTILINENKGQQVSDLTTGF--------A
A0A1G9B1T9      KWYLLLGSLLLTLALAYVVIL-TTPEVYKVSSSMLVRDESATGNQQFMEGI--------G
A0A350PNH9      RWRWFVISLVVTLGIATYHLL-STPCVYQRTASILIKEDGKSQSINSDVAS-MFSDM--G
A0A354LNT9      RWRWFVISLVVTLGIATYNLL-STPCVYQRTASILIKEDGKSQSINSDVAS-MFSDM--G
A0A161LWY6      HWYLFVIALAISLSISFIANR-TWKPSYQVSARVILGGGQASAS-----QQMVMQGV--N
A0A6I3N9U6      HWYLFVIALAISLSVAFIANR-TWKPSYQVSARVILGGGQASAS-----QQMVMQGV--N
A0A3D0FMX4      VWYLYVICLAIAFGISIYSNR-KWVPTYRTAGTLIINEY---GSQASNALMQGF-----G
A0A1M3MEI8      HWYLFVIGLVIAFGLSYMQNR-KWLPEYKSTGSVIIDDS-RTMMNSAQVMMQGF-----G
A0A1J5HQM0      FWYLFVIFVIISLGMAYLKNR-TWIPSYKSAGTMLIEEY--KITNNTQAMMQGF-----G
A0A653AC35      YWYLFVIFIALALGAAYLKNR-SWIPSYQSTGTLMIEES-SRNNSGSQVLMQGF-----G
E4T131          NWYLFVIGIILSLGLAYIENR-SWLPTFQTEGRVLIDENRSSNANSSQALMQGF-----G
A0A521H707      NAYWLFLLLTISSTFAFLYLR-YTHPIYLSQATLKIGTVNTASAVLNIQNSQALDILGSN
A0A1F3D6P8      FKYFYIICLVILLTVAFLFNK-YSSRLYEVKASIGPVQNDASSLLTSNDLFMGLKALQSN
A0A356Z058      FKYFYIICLVILLTVAFLFNK-YSSRLYEVKASIGPVQNDASSLLTSNDLFMGLKALQSN
A0A3D1BT36      YKYYFISSIILLGLMAFLLNK-FTPAVYEVNSIIGPVENKQSSLLESSDIFSGLGSLSQS
A0A5R9QZP0      YKYLYLLSIVVFLLLGYTYNK-FVPTVYQVNSVIGPVEDRRTTFLESSRQFSVLGSQSQT
A0A3D3HL11      YKYFYIASFFICLLIAFLVNR-FSPTVYEVNSVIGPVEDRRSSMLGSNDLFSGLGALAES
A0A6L8U6G9      YKYFYIASFFICLLIAFLVNK-FSPTVYQVNSVIGPVEDKRSSMLGSNDLFSGLGALAES
A0A352ME00      LKYLYMALIVLCLAIAFFYNH-FSKKVYEASASLSPVEDKTSSLLKSNELFSGIQSLESL
A0A6L8UH35      LKYLYIFVLILCLAIAFFFNK-YSSKVFEASATLSPVENKTSSILSSNQLFGGLNPLQTI
A0A2W7RD29      KWPLFLLTGIICLFIAHTSYK-STVTTYEINSKLFIYTEGQSIN--------FFEKLQNV
A0A3N2NDY8      KWRWFTVSIVLFCCLGVLYVL-RQQPVYSRSMELLIKDQDGGGGVADISNA--FSSL--G
D7JEV9          YWYLFVLGVFISLAIAYYQNR-SFVPIYNSSLRMLLKQEAGSLS--------YMQGQGFN
A0A4R6H3B7      NWYWFMIVGIIGVGLGYLKTQ-VTAPAYKLESLFLIKTDNKSSN-----LRMDFPLS--S
A0A3P1Z8V4      YWYWFALSTVLSLIAGYVYQQ-MQDRVYSGEAVILIDSSSDSSH----GGMRSRSKNSLN
A0A2W7QSQ0      SWYLFPIFILLFCGVAYYYIK-TITPEYLISSVIIIKEGERNNNVTENSIVSDLENM---
R7F6L5          RWYWYVISVAVCVGIAWLMLA-RSPRLYTKSETILIKDPTFGNS-----AS-SVDLSEVG
A0A7C5MRV2      SWYYVVVTLAISILACWLYLR-YTKPLFMAVTTVRVEEDKSPGR-----GLGMLENFGFG
A0A553GA49      HWKLYVISITLFLGIGVLFNKFSEPKVNISAKLVVHESRRNMID-----PSSFMPGS--E
A0A497D6F6      ------------VSIAYVYKR-YATPIYEITSSLLLEVGNSNSPLTNKNANEDNVFQGFG
A0A5M4AAB9      -----------------MYYK-YTHPIYEVSASILIEEQQNQNPLITAADKQPNVFQGFS
F4KR18          KWYLYLAFSIICIGLAYVYYK-NQQPVYAITSKLLIRERERDY-----GPGADFVKQNIN
A0A229I3A5      QWRWFILSLVVTCGIAIYYNL-TTPNVYQRTASLMIKDESKAQGIGGDVAS-MFSDM--G
A0A3R6HJB3      QWRWFILSLVVTCGIAIYYNL-TTPNVYQRTASLMIKDESKAQGIGSDVAS-MFSDM--G
R6NN15          KWRWFVLSLVICLGIAFIYLL-KTPPVYTRTASLLIKEESKGQSLSGDVGA-SFSDL--G
C9LKL0          KWRWFAFSIIVCVACGWYYQQ-IQPRVYTRQATMLIEGGNGSGRGGFSSSRNRGSGL--N
A0A3D0QPV7      RWVLLFLITSLLAAWLYLRYT---PPVYESLSVIQISEENNMKQ-----VIPGINSF---
A0A496KT23      HWKWFLLSVIVCLGGAYYHLL-RTPKTYVASASILIKPDNNRGNSPDQLLA-RQRMI--V
L1M9T3          HWKWFVLSLLVCLSSATYYLL-RTPKTYVASASILIKPDSNKGNTPDELLA-R-RMN--V
A0A3C0I8F1      PFIILIVGLSLGGSYLFLRYT-KALFQSSSDLRLSIRDEAQPGG--------LPIQT--A
R5JJI4          ----------------------------------MIRDDSKGGS-----ISESTAFADIS
A0A0A2DQN2      YWKWFVLSVLICAGYMYYRSA-QQPYTYMSEVTVIIQDPSQRTSIDFDFIN--------P
A0A0A2F2N5      YWKWFLLSILLCTGYMYYKSA-KQAYTYESVVTVIVRDPAQRTSIDLDLVG---------
L1NGW4          FWYLYVICVGIVVAFALYRTA-KQPYIYEASVKVFIKDASQRSMMDADVLR--------Y
Z4WRA0          FWYLYVICVGIVVAFALYRTA-KQPYIYEASVKVFIKDASQRSMMDADVLR--------Y
U2K8K9          YKFLYILCVGIVVALALYRNA-RQPFTYEGVVKIFIRDASQRTMVDDNMLR--------Y
A0A069ZM60      FWWLYLLSVGVVLAVALYRNA-KQPYVYESSVKIFIKDASQRAMMDTEMLR--------Y
J6GV98          FWWLYLLSVGVVLAVALYRNA-KQPYVYESSVKIFIKDASQRAMMDTEMLR--------Y
A0A134B4F8      FWWLYLLSIGVVLAVALYRNA-KQPYVYESSVKIFIKDASQRAMMDADVLR--------Y
A0A134B8C7      FWWLYLLSIGVVLAVALYRNA-KQPYVYESSVKIFIKDASQRAMMDADVLR--------Y
A0A3D2HF71      NWYWFAGALLIALSIAYSINR-WSEDVYSVSSTLLIKDEQLMGGLSSGTTT-LFPGM--E
A0A4Z0EKR0      YWYLFLIAVALCLGAAFIYLRYYTVSVYSVYSTLLIKDEKTGQNLS---NADVLNDL--S
B5CTK0          NWYWFLVSVILCLFFGWYTLQ-KAIPTYKRMATVLIKDNSSGSM---SESA-VFEDI--A
A0A1M6B6D5      NWPLFLIFLAITFSIAYYINV-RKLPVYLIENLVSIRDDQNPFF-----TSNTSLVF--N
A0A451FS66      SGPLFLISFLITFSIAYYFNI-RKLPIYQMENLVAIKDDQNPFF-----TTTTSLTF--N
A0A2E3GN39      --------MLLSSGVAHIFLH-FSTRIYSSKGVLIHIAGEEKQS-----LL-GLDKTLPN
A0A3D1MEL0      --------MLLSSGIAHIFLH-FSTRIYSSKGVLIHIAGEEKQS-----LL-GLDKTLPS
A0A519UDD1      YWYLFLIGAILGVTAAFVHLHYYAVPQYTVYSTMLIKDDKSGQSLSSADNTGVLNDL--S
A0A2A4N9A6      SFLLFCLIFAMAMFGVWLFLR-YTPPIY--QAVTHIRAASNKAVELGTFVN-FLEKD--K
A0A6C0GGI1      KWYYFLISLAIALTVAYFHIK-LSKRVYGVSATVLIENESAGNKAAGELLE-VIDAQ--K
A0A368D1N7      SFKWFFLFMLLSSGIAHIFLH-FSTRIYSSKGVLIHIAGEDKQNLLGLDKT-LPSQN--F
A0A3B8TU58      --------MLLSSGVAHIFLH-FATRVYDSKGVIIHIGGEQKQNLLGFDRD-FQKQ---F
A0A1T5IIR6      NWYWFLLCVLLALGVAYYRYS-RMPFVYSSGVTAIIKNPGDELR-----TA-RLETY--D
F0R0C9          KWRWFVVSLVLTLGIAVYYLL-TTPPVYTRAASLLIKEDSKGQSLSGDVGS-TFADM--G
A0A6L6NXQ0      -------------------------------------------------AS-MFAEL--G
A0A6N8DCX3      KWRWFVVSVLSCVCVAVFYIL-CTPPLYTRSAFLMVKEDTKGKAIGSDVAS-MFADL--G
A0A3E0QD27      YWLFVILTICFTSAFLYLRYT-LPIYESRGILKIGTVNTANAVL-----NI-GSNQA--L
A0A0M1W1I6      KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
A0A4R4GHU2      KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
I8WPR6          KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
A0A0K2HKS3      KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
B6W3W8          KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
A0A4R4GSI6      KWYWFVLSVSLFGGYTWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
A0A076IRY8      KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
A0A3A6AD54      KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
A0A3A6MIU7      KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
I8WPP8          KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
A0A372Y7D2      KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
A0A3E4JJC9      NWYWFILSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
A0A3E4WDQ0      NWYWFILSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
A0A414H9P2      NWYWFILSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
C3R5A8          NWYWFILSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
A0A1C5XJA7      KWKWFIMSVLIFGGIAWYKYA-TAPLVYFGSATVIIKDPSSKTT-----TT-GLDRF--D
A0A285T4L1      KWKWFVLSVLLFGGLAWYHYA-TSPLVFFRNVTVIIKDPSNKTS-----TA-GLDRY--D
A0A3E5BU42      KWKWFVLSVLLFGGLAWYHYA-TLPLVFFRNVTVIIKDPSNKTS-----TA-GLDRY--D
R7CUW4          KWKWFLISVLVCGGLAWLSYA-RSPLVYFRSATVIIKDPSNKTS-----TA-GLDRY--D
A0A416GGJ1      KWKWFLLSVLVFGSAAWLYYA-RKPFVYFRSATVIIKDPSNKTT-----TA-GFDRY--D
D1JY72          KWYWFVLSVSLFGGYAWYQYA-KLPFIYSRSATVMIKDAYSNNI-----GR-GLDRF--N
D7J4K6          KWKWFVLSVLLFGGMAWYHYA-KSPLVFFRSVTVIIKDPSNKTS-----TA-GLDRY--D
Q8ABP9          KWKWFVLSVLLFGGMAWYHYA-KSPLVFFRSVTVIIKDPSNKTS-----TA-GLDRY--D
A0A5M6AHF7      KWKWFVLSVLLFGGMAWYHYA-KSPLVFFRSVTVIIKDPSNKTS-----TA-GLDRY--D
A0A6L4IA73      KWKWFVLSVLLFGGMAWYHYA-KSPLVFFRSVTVIIKDPSNKTS-----TA-GLDRY--D
D6D2Z5          KWKWFVLSVLLFGGMAWYHYA-KSPLVFFRSVTVIIKDPSNKTS-----TA-GLDRY--D
A0A1T3EDR4      YWYWLVLSCIFFGGYYYYRYS-KSLYVYRDKEVVMIKKQSSAPI-----TS-AFLQS--A
A0A174SDD8      HWKWFVLSILLFGGCFWYIYC-KTPFEYSRVAIVMIKTPANSRS-----TM-QLNNS--D
A0A1H7RFH3      HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--D
A0A139L1N2      HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--D
A0A174TVL8      HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--D
A0A1H8BJR6      HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--D
R9H6G0          HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--D
A0A412GR09      HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--D
A0A6I0S0M4      HWKWYLLSILLFGGCFWYIYC-KTPFTYSRVAIVMIKTPANSRS-----TM-QLNNS--D
A0A081PBV5      QWKWFLLSIFIFGGYYLYQYS-KTPFIYSRSETIMIKTPLNTMP-----GT-RITRA--N
A0A1I2AN85      QWKWFLLSIFIFGGYYLYQYS-KTPFIYSRSETIMIKTPLNTMP-----GT-RITRA--N
A0A4U0GMP3      HWKWFVLSILIFGGYYLYQYN-KTAFIYSRTQTVMIKTPANTVS-----TA-RISRS--N
A0A1H6CKR6      NWRWYLLSILIFGGYFYYQYN-KTPFLYKSSQTVMIKTASNTIS-----SS-RITRP--N
A0A235E1C0      NWKWFLLSILVFGGFYYYQYS-KTPFLYKKEQTVMIKTATNSMS-----AS-RITRP--N
R6D982          YWKWYVLSILICGGYFWYDYS-RTPFVYSRSATVMIKTPANTPS-----AI-RLIRS--G
A0A1F0I8C4      HWKWYFLSILLFGGCFWYFYC-KTPFVYSRVAIVMIKTPTNSRS-----AM-QLYGS--N
A0A3A5RIJ2      HWKWYFLSILLFGGCFWYFYC-KTPFVYSRVAIVMIKTPTNSRS-----AM-QLYGS--N
A0A515IZJ5      HWKWYFLSILLFGGCFWYFYC-KTPFVYSRVAIVMIKTPTNSRS-----AM-QLYGS--N
A0A5M5NLR3      HWKWYFLSILLFGGCFWYFYC-KTPFVYSRVAIVMIKTPTNSRS-----AM-QLYGS--N
A0A0D5BSQ0      HWKWFALSVLIFGGYYYYQYS-KTPFVYNRSEVVMIRTPSNTPT-----TA-RITRS--S
A0A1T3F6P5      NWKWFALSILVFGGYYYYQYS-KTPFVYNSSETVIVKTPSNTPT-----TA-RITRS--F
A0A0W8EPA0      NWKWFALSILLFGGYYYYQYS-KTPFVYNSSEIVIVKTPSNTPT-----TA-RITRS--F
A0A365UKN1      NWKWFALSILVFGGYYYYQYS-KTPFVYNSSEIVIVKTPSNTPT-----TA-RITRS--F
A0A4R6WE41      YWPWFLASILLFGGYYLYDYS-KTPFMYGQAQTVLIKTPANTPA-----TA-RFTRA--S
A0A2T5RP38      NWKWFALSILVFGGYYYYQYC-KTPFVYSRSEVVMIKNSSNTPT-----TA-RITRT--N
A0A1A6CF06      HWKWFALSILIFGGYFYYQYS-KSPFIYNRSEVVMIKTPSNTPT-----TA-RITRS--F
A0A1T3D6S8      HWKWFALSILIFGGYFYYQYS-KSPFIYNRSEVVMIKTPSNTPT-----TA-RITRS--F
A0A1P8E011      HWKWFALSILLFGSYYYYQYA-KSPFIYRSAETIIIKTPMNTPR-----TA-RISRT--N
A0A1V3N3U3      HWKWFVLSVLCFGLYFYYGYS-KSPFIYRSTEMVMIKTPLNTPA-----TA-RITNT--N
C2FUH6          HWKWFALSVLLFGGYYYYQYS-RSTFMYRSSEMVMIKTPMNTPS-----TA-RITRT--N
A0A0B8T471      HWYWFVLSVLLFGGYYYYQYS-KTQFLYSRSQTVMIKSTTNTLS-----VS-RATRL--N
A0A4R7D2K0      HWYWFVLSVLLFGGYYYYEYS-KTQFLYSRSQTVMIKSTANTLS-----VS-RATRL--N
A0A2X2J8S4      HWPWFLLSVCIFGGYYYYQYS-KTTFSYRQASTVMIKTPANTPS-----SA-TLTRS--G
A0A3C0S618      HWPWFLLSVCIFGGYYYYQYS-KTTFTYRQASTVMIKTPANTPS-----SA-TLTRS--G
A0A4P7DRF9      NWKWFLLSVLIFGGYYYYQYS-KTPYLYSQSETVMIKTASNTMV-----AT-RIARP--N
A0A239XXC4      NWKWFLLSILIFGGYFYYQYS-KTPFLYKKDQTVMIKTATNSMS-----AS-RITRP--N
A0A4U9K473      NWKWFLLSILLFGGYYYYQYS-KTPFLYKKDQTVMIKTANNSIS-----AS-RITRP--N
A0A3M1Y2F5      ------------------------------------------------------------
A0A7C7CKY6      ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A6L3FBV2      ------------------------------------------------------------
A0A6L3FIH8      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6L6NZ03      ------------------------------------------------------------
A0A642EJV3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A6L4ENN1      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A519SD85      -------------------------VLLSAVNSL---KYKIVFES-----KKGL------
A0A3M1TXY5      ---------------------------------L---DFGISYYL-----KEGL------
A0A2E0VQ27      NE----------NFLAEVEVFQTRDLIRKTLENL---HWELTTYR-----VGDV------
R6U429          ------------NVYNEMEAFSSPDLMCSVVKRL---GLETSYVE-----KQFL------
A0A5C8AF42      ------------DISSEIELMRSQFMFERAIKRT---SYNVSLFS-----KGQV------
A0A239K409      K-----------NFDNEIEVLKSYRLMRRVLSKL---PVNISYYV-----EESL------
A0A1V5S1J9      VERGYR------NVNNQVIMFGSYELISRVIAKQP--ELTIDYYT-----QGRF------
A0A0A2EYC8      SRQDQT------NIENQILLLQSQDLIGRTIDSLP--NFKIDFYR-----KLKF------
A0A2G6H6Y4      SRGSGK------GVENQIVILKSWDMVTRTIDSLP--QFKIDFFK-----ILTF------
A0A1M3DPL8      IQESYR------NVNNQVIMISSYDLMSRVVDSLP--EFQIEYIS-----KGRF------
A0A1V5F519      LEEAYQ------NVNNQVIILNSYDLIGKVVDSLP--FMKVDYLT-----IGRF------
A0A2G6R1T9      VESGHK------NMANQVILLTSRDLISQVVDNLP--EMRVEYIS-----KGKF------
A0A350V3E4      IFSDIEGELPERYINNEVEILKSFAIREKTAASL----------------LDSF------
A0A6J4K208      ------------GLEDEKNLLSSFRRIRTAVEGL---HFQVSYFH-----THWF------
A0A1M6MYT6      MMNSMR------NIHNQIAVLSSTPIVSRTLDEL---DFSVNYYS-----IGRF------
A0A2P8CDS1      LFQGKQ------NTENQIQILKSWTQVRTTLEHF---NFEATYYK-----IGRF------
A0A353WYK7      ------------NLSKEIELLKSKLFFTRVAEVI---NNDVNVFA-----YGKV------
A0A355BP94      ------------LVAGEIEQMKSKLFFSRVLDSL---DLGISYYS-----LGNV------
A0A136LSC7      ------------QVSGEIEQIKSKIFFNQVLDSL---DFEVSYYS-----LGKV------
A0A5C7N8Q5      ------------VVSGEIEQIKSKLFFNKVLDSL---DLSVSYYS-----LGKV------
A0A2W4RDE8      LFQSAT------DLEDEIGIIKSFSNVESAIKRL---NFGISYYT-----EKNF------
A0A0L8VEV2      AMGGNI------NLLNHIGILTSHSINRQVLENL---DWTTSWYE-----ELLL------
A0A1I2A9Z9      AFGGNI------NLQNNIGIITSYSINRQVMENL---DWSTSWYH-----ELMF------
A0A212J9Z9      ------------NTENQQIVLKSYGLTERTVKSLPA-KMRIEYYI-----QTRF------
F5IV23          ------------NTENQQIVLKSYGLTERTVKSLPA-KMRIEYYI-----QTRF------
F8X2T0          ------------NTENQQIVLESYGLTERTVKNLPK-KMHIDYFI-----QTRF------
A0A1M3LAG1      ------------NTENQQIVLESYGLTERTVKNLSK-KMHIDYFI-----QTRF------
A0A212K6G4      ------------NTENQQIVLESYGLTERTVKNLPK-KMHIDYFI-----QTRF------
A0A4Y9IPG7      ------------NTENQQIVLESYGLTERTVKNLPK-KMHIDYFI-----QTRF------
A0A2V3PNY7      ------------NSINQQMLLNSYDMVVRAVAKLP--QMRVDYFK-----KSKF------
A0A6G7WQ31      ------------NSVNQQMILNSYDMVVRTIAKLP--QMRVDYFK-----KGKF------
A0A6G7X5K8      ------------NSVNQQMILNSYDMVVRTIAKLP--QMRVDYFK-----KGKF------
A0A1M5DFS8      ------------NSVNQQMILNSYDMVVRTVAKLP--QMRVDYFL-----KTKF------
A0A4Y8KZS5      ------------SSVNQQMILNSYDMVVRTVGKLP--QMRVDYFL-----KTKF------
A0A142HHS5      ------------QLAGEVELIKSGLTYKRLKQTV---PLDINYYT-----QGTV------
A0A660LQT8      ---AQIGVGKASNVNNEMLAFQSPALTENVVRRL---KLDVNYSV-----SGFF------
A0A2M6GH67      AEQNMV------SLSGEVELINSDIIYRDLKENL---NLKVNYYA-----MGNV------
A0A389LWV6      VSQGLR------NVNNQMIMYGSYDLISKSVDKL---DISTDIYH-----KGLL------
A0A1G9B1T9      LFEPQT------KISDQTAMLTSFDIIRRTLEKL---DFGVTYYK-----HDQF------
A0A350PNH9      ISGGKS------NVNNELIAIQSPAVLLEAGKQL---KLDVNYSE-----DGTF------
A0A354LNT9      ISGGKS------NVNNELIAIQSPAVLLEAGKQL---KLDVNYSE-----DGTF------
A0A161LWY6      LNMAYK------NNDNQMIMFTSNDLVERAINKI---NANVDYYT-----TGHF------
A0A6I3N9U6      LNMAYK------NNDNQMIMFTSNDLVERAINKI---NANVDYYT-----TGHF------
A0A3D0FMX4      VDVGYR------NVNNQVIMMGSYDLMCRVVDSLP--FMRTDYIS-----RGRF------
A0A1M3MEI8      IQDAYR------NVNNQVIMLGSYDLLGRVVDSLP--ALSIDYIS-----QGRF------
A0A1J5HQM0      VDAGYK------NTRNQIIMLSSYDLIGRVVDSLP--QMRVDYIS-----KGNF------
A0A653AC35      VQSGYR------SLENQRYILTSYDFISRVVDSMP--SLNIDYIS-----KGRF------
E4T131          IQSGYK------NAKNQIIMLGSNDLFSKVVDSLP--FLKVDYIS-----KGSF------
A0A521H707      Q------------FAGDIELLRSRVMISRVLDRM---PLDVGYFA-----HGKV------
A0A1F3D6P8      R-----------NLESGISNFISFPTVSSTISSM---NLEIGYFR-----EKHH------
A0A356Z058      R-----------NLESGISNFISFPTVSSTISSM---NLEIGYFR-----EKHH------
A0A3D1BT36      R-----------NLENDINSLKSFSLISETIKNL---ALEIGYFI-----ESDD------
A0A5R9QZP0      S-----------NLENDMNSLSSFSLVSKTIKDL---GLEISYYE-----QPVRFANKKS
A0A3D3HL11      R-----------NLENDINSLNSFSLVATTIRSM---NLEVGYFA-----GKNT------
A0A6L8U6G9      R-----------NLENDINSLNSFSLAATTIRNL---NLEIGYFA-----GKNS------
A0A352ME00      R-----------NIENDIKNLSSFELVYSTVNSM---NLEVSYFS-----ESKK------
A0A6L8UH35      D-----------NIENDISNLSSFGLVYSTVAKM---NLEVSYFS-----EEHK------
A0A2W7RD29      TNSQNV------LLDNEVVIIKSNPVIKSTLEVL---DLKVGYYVPPETTSKNF----WS
A0A3N2NDY8      LVSSNT------NVNNELISLSSPAVMYEVVKNL---GLDVNYST-----PGRF------
D7JEV9          SVMNRLDQT---NIENQILLLQSQDLIGRTIDSLP--KFRVDFYK-----KLQF------
A0A4R6H3B7      AFGGNI------NLQNNIGVITSYSINRQVMENL---DWSTSWYH-----ELMF------
A0A3P1Z8V4      TLMQLNGINVGDNLENELFILSSLRLMKQVVATL---GLEVDYTC-----REGL------
A0A2W7QSQ0      --KSTI------TVENELEKLKSKSLLMDAVIKN---KGFINYYN-----AEDF----FK
R7F6L5          VMPKYA------NLENEIAIFTSPDLMENVVKAY---NLNNFYSY-----NDGF------
A0A7C5MRV2      PFRD--------NIQSEIQLLRSRSIVTVALSEM---DISAAYYL-----VGTL------
A0A553GA49      LFSGRN------TFQNSLISLNARPLLEQVVNKL---NIDVFYYQ-----PKVL------
A0A497D6F6      ITDSDR------NIFNQLIVLTSTPILNRTLEEL---DFDINYYS-----VGRV------
A0A5M4AAB9      LFNGNQ------NIENQIQILKSWSLIYNTLEHF---NFEVTYSE-----RGFF------
F4KR18          FAAAAE------DASNEIEMLTSFALMKAVVEDL---GLETRYYW-----KHKF------
A0A229I3A5      MGNMKS------NVNNELIAIQSPAVLLETGKRL---KLDVDYAI-----DGRF------
A0A3R6HJB3      MGNMKS------NVNNELIAIQSPAVLLETGKRL---KLDVDYAI-----DGRF------
R6NN15          LFQPNT------NVNNELVSLQSPAVMYDVVKRL---HLEVDYST-----EGSF------
C9LKL0          TMMDFNGVTIGDNLSNELFILTTRRLMRKVVDSL---GLDVDYTT-----KNAL------
A0A3D0QPV7      -EDEQS------GVDKALELMRSEFLFKKSIEKL---DFTVSFFS-----EGQI------
A0A496KT23      EGASDA------QMTNEILALSSATITRTVAERL---NLDVEYTH-----KGMF------
L1M9T3          ESGLDA------QMTNEMLSLKSVTITRAVAERL---NLDVEYTH-----KGMF------
A0A3C0I8F1      PINNNA------HLLGEIEFIKSELLHEEVIKKM---NLGLTIYA-----QGNI------
R5JJI4          FLGGKR------NVDNEVLVFQSRHLMEKVARRL---HLDMSYKV-----KNGL------
A0A0A2DQN2      RQRGRA------NIENERLILRSQRIIENALKKI---DAQVSYKY-----KKEF------
A0A0A2F2N5      -RRSRV------NIENERLQLRSRVVIANAIKAI---NGHVHYGI-----IDGL------
L1NGW4          MRSFRL------NMDNEKMQMSSRRVLERAVKTV---NANVYYQV-----QSGL------
Z4WRA0          MRSFRL------NMDNEKMQMSSRRVLERAVKTV---NANVYYQV-----QSGL------
U2K8K9          MRNTRL------NVSNERIQLSSRRVMQRTVRLS---GANVFYNV-----KSGL------
A0A069ZM60      ARAARL------NMDNEHVQLVSRRVLERTVKMA---NANVFYNV-----KSGL------
J6GV98          ARAARL------NMDNEHVQLVSRRVLERTVKMA---NANVFYNV-----KSGL------
A0A134B4F8      TRSTRL------NMDNERMQLVSRRVMERTVKMA---NANVLYNV-----KSGL------
A0A134B8C7      TRSTRL------NMDNERMQLVSRRVMERTVKMA---NANVLYNV-----KSGL------
A0A3D2HF71      AFRSQQ------NLKNEMGILRSFTLNYRVMQEMPDFHVDYTAVG-----RRGI------
A0A4Z0EKR0      TFKATR------NIDNEIQVLRSKSLMTRVVTEL---GLFTKYSI-----EGKV------
B5CTK0          TVRAER------NVSNEMLVFKSNRLMQIVARRL---HLDVNYLI-----EEGL------
A0A1M6B6D5      WGGTSD------KVNTSVITLRSRSHNEKVVERT---QYYLTYLR-----DGEY------
A0A451FS66      WGGTTD------KVNTSVITLQSRSHNEKIVERL---QFYLTYLR-----DGKF------
A0A2E3GN39      QDFTPT------DFQQDVRVITSPIIVNKAFSQK---GLNYVFYE-----VGDF------
A0A3D1MEL0      QNFTPT------DFQQDVRVITSPIVVNTAFSQK---GLNYIFYE-----VGDF------
A0A519UDD1      TFKSTR------NIDNETEVIKSKSLMNRVAKEL---GLFTSYYI-----EGQV------
A0A2A4N9A6      NKMLLE------ELQEEIAILKSVFMIKKTLTTM---NYGVSYFA-----EGDL------
A0A6C0GGI1      KYI---------EVEDQIGLLTSFNMVQKAIARL---DFGVSYYL-----IPDI----LI
A0A368D1N7      TPT---------DFQQDVRVITSPIVVNKAFRQK---GLNYIFYE-----VGDF------
A0A3B8TU58      TNT---------DFQQDIRVLTSPLVINNAYSDK---GLNLLFYD-----VGNF------
A0A1T5IIR6      QMINKV------SVTNEQLQLRSLTIMTEVVKAL---DADVNYLD-----RIKF------
F0R0C9          LFQANT------NVNNELLSLQSPAVMLDVVKRL---HLHTDYLT-----DGTF------
A0A6L6NXQ0      LTQASA------NVNIELLAMRMPSAIKEVVKRL---GLDTDYRV-----NGFL------
A0A6N8DCX3      LTQASA------NVNNELLAMRMPSAIKEVVKRL---GLDTDYRV-----NGFL------
A0A3E0QD27      EVLGSN------QLAGDVELIRSRVIVSRVVGAL---PLDVSYYA-----HGKV------
A0A0M1W1I6      TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
A0A4R4GHU2      TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
I8WPR6          TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
A0A0K2HKS3      TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
B6W3W8          TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
A0A4R4GSI6      TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
A0A076IRY8      TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
A0A3A6AD54      TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
A0A3A6MIU7      TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
I8WPP8          TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
A0A372Y7D2      TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
A0A3E4JJC9      TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
A0A3E4WDQ0      TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
A0A414H9P2      TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
C3R5A8          TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
A0A1C5XJA7      NFINKV------NVANEMLQFNSKRLIREVVSRT---HADVSYKM-----KDGL------
A0A285T4L1      NYINKV------NVANEILQFRSKRLMREVVQRL---HADVDYRV-----EEGL------
A0A3E5BU42      NYINKV------NVANEILQFRSKRLMREVVQRL---HADVDYRV-----EEGL------
R7CUW4          NFINKV------NVANEILQFRSKKLMREVVQRV---HADVDYLI-----QDGL------
A0A416GGJ1      NYINKV------NVANEILQFRSKRLMREVVQRM---HGDVDYLI-----EDGL------
D1JY72          TY-SYT------NVSNEILQFQSHKLMRDVVNRL---HANVCYLI-----MDDL------
D7J4K6          NYINKV------NVANEILQFRSKRLMREVVQRL---HADVDYRV-----ESGL------
Q8ABP9          NYINKV------NVANEILQFRSKRLMREVVQRL---HADVDYRV-----ESGL------
A0A5M6AHF7      NYINKV------NVANEILQFRSKRLMREVVQRL---HADVDYRV-----ESGL------
A0A6L4IA73      NYINKV------NVANEILQFRSKRLMREVVQRL---HADVDYRV-----ESGL------
D6D2Z5          NYINKV------NVANEILQFRSKRLMREVVQRL---HADVDYRV-----ESGL------
A0A1T3EDR4      E--SPV------NIKDEMLQLQSKELLRQVIPYM---GGDKSYKI-----SKGL------
A0A174SDD8      FA-GQV------NVASEILQFKSKELMRKVIDRL---QANICYTV-----HEGL------
A0A1H7RFH3      FT-GLV------NVASEILQFKSKELMRKVIDRL---QANISYTV-----YDGL------
A0A139L1N2      FT-GLV------NVASEILQFKSKELMRKVIDRL---QANISYTV-----YDGL------
A0A174TVL8      FT-GLV------NVASEILQFKSKELMRKVIDRL---QANISYTV-----YDGL------
A0A1H8BJR6      FT-GLV------NVASEILQFKSKELMRKVIDRL---QANISYTV-----YDGL------
R9H6G0          FT-GLV------NVASEILQFKSKELMRKVIDRL---QANISYTV-----YDGL------
A0A412GR09      FT-GLV------NVASEILQFKSKELMRKVIDRL---QANISYTV-----YDGL------
A0A6I0S0M4      FT-GLV------NVASEILQFKSKELMRKVIDRL---QANISYTV-----YDGL------
A0A081PBV5      YY-NTV------NVASEILQLRSKELMRKTIDRI---EGDISYTV-----KKGL------
A0A1I2AN85      YY-NTV------NVASEILQLRSKELMRKTIDRI---EGDISYTV-----KKGL------
A0A4U0GMP3      SY-NVV------NVAGEILQLRSKELMRRTISRL---NADVSYSV-----RQGL------
A0A1H6CKR6      NIYNSV------NVNSEILQLRSKELMRNTIGAL---DANISYKR-----QNGL------
A0A235E1C0      NFYNIV------NVNSEILQLRSQELMRNTISLL---NADVSYTK-----EEGL------
R6D982          DYMGQV------NMATERLQFQSKALMRKVISRL---NADVSYAV-----RDGL------
A0A1F0I8C4      DFMGQI------NVASEILQFKSKELMRKVIDRL---QANVSYMV-----YDGL------
A0A3A5RIJ2      DFMGQI------NVASEILQFKSKELMRKVIDRL---QANVSYMV-----YDGL------
A0A515IZJ5      DFMGQI------NVASEILQFKSKELMRKVIDRL---QANVSYMV-----YDGL------
A0A5M5NLR3      DFMGQI------NVASEILQFKSKELMRKVIDRL---QANVSYMV-----YDGL------
A0A0D5BSQ0      SA-NVI------SVKDEILQLKSKELMRQTIDRI---GADISYKI-----RKGL------
A0A1T3F6P5      GA-NSI------SVKDELLQLKSKELMRLVVDRI---NADKSYKV-----HRGL------
A0A0W8EPA0      GA-NSI------SVKDELLQLKSKELMRLVVDKI---EADKSYKV-----HKGL------
A0A365UKN1      GA-NTI------SVKDELLQLKSKELMRLVVDRI---NADKSYKV-----HRGL------
A0A4R6WE41      AGYNSV------SVASETLQLRSKELMRQAVEHL---GADISYSH-----KVGL------
A0A2T5RP38      VS-SSV------SVKDEILQLRSKELMRQTIDRL---GADISYKV-----HRGL------
A0A1A6CF06      SG-GGV------SVKDEILQLKSKELMRQVVDKV---GADKSYKI-----HSGL------
A0A1T3D6S8      GG-GGV------SVKDEILQLKSKELMRQVIDKV---GADKSYKI-----HSGL------
A0A1P8E011      EAYNSI------SVASEILQLKSKELMRQTVTRI---GAEMSYTV-----GDGL------
A0A1V3N3U3      NAVGSV------SVTSEILQLKSKELMRETIGRI---GAETSYSI-----RKGL------
C2FUH6          SAFNSV------SVAGEILQLNSKELMRRTIDRL---NADVSYVI-----RNGL------
A0A0B8T471      SYYNTV------NVAGEILQLRSKELMRNTISSL---RSDVSYSV-----QHGL------
A0A4R7D2K0      SYYNTV------NVAGEILQLRSKELMRNTISSL---RTDISYSV-----EQGL------
A0A2X2J8S4      MSYNTV------NLATEMLQLKSKELMRETVESI---KADVSYVV-----RRQL------
A0A3C0S618      MSYNTV------NLATEMLQLKSKELMRETVESI---KADVSYVV-----RRQL------
A0A4P7DRF9      NFYNAV------NVNSEILQLRSKELMRNTIDSL---NTDISYSV-----KSGL------
A0A239XXC4      NFYNMV------NVNSEILQLRSQELMRNTISLL---NADISYSR-----KEGL------
A0A4U9K473      NFYNFV------NVNSEILQLRSQELMRNTISLL---NADVSYGR-----KDGL------
A0A3M1Y2F5      ------------------------------------------------------------
A0A7C7CKY6      ------------------------------------------------------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ------------------------------------------------------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A6L3FBV2      ------------------------------------------------------------
A0A6L3FIH8      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6L6NZ03      ------------------------------------------------------------
A0A642EJV3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A6L4ENN1      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A519SD85      -----RWTNTYPNE-PLKVS-------------TVKTDKKSSSYYFQ----FSQLDNEKF
A0A3M1TXY5      -----KTRQTYHYA-PFEVQ-------------LDSSHVQIVGAKFF----VRPISDTEY
A0A2E0VQ27      -----RLSEIYEER-PFKID-------------YGVNDDKALDKTIY----FDYLGEGRF
R6U429          -----RTRDLFTNS-PLAL--------------VRAGDNNASSFSFE----IMKEGEDAF
A0A5C8AF42      -----LTEEKYLSS-SFYVT-----------------PFELKDSSLINVPIFVAFDGKSI
A0A239K409      -----KERELYGSELPIKVV-------------AHSLDSTAYGREVT----VSFNGGKSY
A0A1V5S1J9      -----KSTNLYKAA-PILIT-------------KTFVSPQAYEREFT----IQDLGNNNF
A0A0A2EYC8      -----KNRPMYGRS-PIDIE-------------IISTPDAGFWQYYL----YQKQNDNEF
A0A2G6H6Y4      -----KQKALYENL-PINVE-------------ILSTYDNSFDNYYR----FEVTGEKSF
A0A1M3DPL8      -----KTRNLYEWT-PISID-------------ADFISPQAYDILFK----LNIKPDGTF
A0A1V5F519      -----KTRNLYTTT-PIIIE-------------ADYVAPEAYELLFK----ISLHPNGTF
A0A2G6R1T9      -----KTRNLYKMS-PIQIE-------------TNYISTEAYGVLFK----IEINEDGSY
A0A350V3E4      --------QVLKGKIPFYLL----------------------------------------
A0A6J4K208      -----LPREEYGDL-PFRVV-------------LDSTQGQAVGVPVY----VKLIDEQLY
A0A1M6MYT6      -----AATERYQDV-PFMVV-------------WEEDHPQIINADFY----LTIQPDGKL
A0A2P8CDS1      -----RTIELYKDV-PFHIE-------------LDRSHPQLLDANFD----LHFLPNNRV
A0A353WYK7      -----LFEERYQNS-PFFVE-------------Y-KIEPQYFDHPFD----VDILNSKKF
A0A355BP94      -----LEHEMYRRS-PFKAR-------------CIGNVESFQDQPIF----VDFVEGNKY
A0A136LSC7      -----LTDEMYKRS-PFRIK-------------ASHINPKHYDQPIY----FDFLDNNEV
A0A5C7N8Q5      -----LTDEMYKRS-PFLVT-------------TTQINPKHYDQSIF----LDFQDNNQF
A0A2W4RDE8      -----KTAEHYGNT-PFTIH-------------LDSSVHQLINVPIY----IERLSSSKY
A0A0L8VEV2      -----RDDEMYGNE-PFEIL-------------YDRQAMNLEGIPIH----IQMLDTSNF
A0A1I2A9Z9      -----RNEELYKNE-PYDVL-------------FDRNAMNLEGIPVY----VQMLDSTNY
A0A212J9Z9      -----KYISLYTDT-PIEIE-------------MID----IKPEAYNYAYEVTYIDQEKC
F5IV23          -----KYISLYTDT-PIEIE-------------MID----IKPEAYNYSYEIAYIDQEKC
F8X2T0          -----KYISLYTDS-PIEIA-------------IDSLETDITPEAYSKVFDVSYVSDSQI
A0A1M3LAG1      -----KYISLYTDS-PIEIV-------------IDSLETDITPQAYSKVFDVAYVSDSQI
A0A212K6G4      -----KYISLYTDS-PIEIA-------------IDSLETDITPGAYSKVFDVAYVSDSQI
A0A4Y9IPG7      -----KYISLYTDS-PIEIA-------------IDSLETDITPQAYSKVFDVAYVSDSQI
A0A2V3PNY7      -----KVENWYGVT-PVTIE-------------AKY----VAPSAYSIVFEIEPINSEKC
A0A6G7WQ31      -----KADNWYGLT-PVTIE-------------AKY----VAPSAYSIVFEIEPINSEKC
A0A6G7X5K8      -----KADNWYGLT-PVTIE-------------AKY----VAPSAYSIVFEIEPINSEKC
A0A1M5DFS8      -----KTENLYGVT-PITIE-------------AKY----VAPSAYSIVFEVEPIDSDKC
A0A4Y8KZS5      -----KTENLYGMT-PISIE-------------AKY----VAPSAYSIVFEIEPINADKC
A0A142HHS5      -----LETELFGNC-PYRVT-------------YVISDPAYYNHKFD----VEYIDAKHY
A0A660LQT8      -----HDETLYGKTLPIQVQ-------------F-LSLSDERSAMLD----ITYERDGHF
A0A2M6GH67      -----LNEELYNNA-PFKID-------------YEIRDGSFYDKEFK----VNFIDNNTF
A0A389LWV6      -----KSVSYYKAS-PILIK-------------SNFISEEAASLDFR----IRGIDTTAY
A0A1G9B1T9      -----IQHEIYKRR-PFDVE-------------LDSLSDQLIGVPIY----VRFLSSNRY
A0A350PNH9      -----HPVALYGRTLPVTVH-------------F-YSLNDMQSANLD----VEVKHGNLF
A0A354LNT9      -----HPVALYGRTLPVTVH-------------F-YSLNDMQSANLD----VEVKHGNLF
A0A161LWY6      -----KVSNLYGYA-PIEIK-------------GDNISDAVSGLEFD----FRDIDGVTY
A0A6I3N9U6      -----KVSNLYGYA-PIEIK-------------GDNISDAVSGLEFD----FRDIDGVTY
A0A3D0FMX4      -----KDTYLYRYT-PVVFE-------------PSEIRPEGYEHLYK----LDIGTNGQL
A0A1M3MEI8      -----KVRNLYGQS-PVVIH-------------TDYIAPEAYGILFK----LSISEDGTF
A0A1J5HQM0      -----KTRNLYNAS-PIQIN-------------PDYIAPEAFNLTFK----LDLNANGTF
A0A653AC35      -----KTRNKYNES-PIAII-------------ADFVSPNAYGILFK----VNVKTDGSY
E4T131          -----KTRNLYKTT-PIIIQ-------------TDYIAPEAYGVLFK----IKLHSNGSY
A0A521H707      -----IDHEMYTKS-PFSVE-------------YELTDSSYFDRRFF----IDFEGDSKF
A0A1F3D6P8      --LFRQVSELYLRS-PYVVI-------------MDKSHIQPIDVKLR----VFILSDTTF
A0A356Z058      --LFRQVSELYLRS-PYVVI-------------MDKSHIQPIDVKLR----VFILSDTTF
A0A3D1BT36      --ILGQVRQVYPNS-HYTVN-------------IDKSHIQPINARFY----INIVSDTTY
A0A5R9QZP0      LGFINKPLQTYGNN-KYIVN-------------IDKSHSQAINTRYY----IEILDESRF
A0A3D3HL11      --IFQKPTQVYLGN-PFSVI-------------IDKSHIQPINTRFR----VDILDDQSY
A0A6L8U6G9      --LFRKPTQVYLGN-PYTVS-------------IDKSHIQPINARFE----IDILDDQTY
A0A352ME00      --LLKQTNELFGTT-PFTVS-------------IDKSHIQPIGANIY----VSILDESSF
A0A6L8UH35      --FFKQTQEIYGYL-PFTIT-------------IDKSHIQPVNTKIY----ITHLDDSTF
A0A2W7RD29      FNKSNLPIEIYEDA-PFEIE-------------LKENDKSIEEKFFR----ISWVDSLSY
A0A3N2NDY8      -----HEKTLYGSNLPVNVK-------------F-HDLEEQQCAGFR----IELGKDGNV
D7JEV9          -----KNRPMYATS-PIDID-----------------IISISDISYGKYYLYQRKDNDYF
A0A4R6H3B7      -----RNEELYKNE-PYDVL-------------FDRNTMNLEGVPVY----VQMLDSTNY
A0A3P1Z8V4      -----HNVALYRDR-PFTVH-------------FDRPSKRYTRMEAV----INPDNTVTL
A0A2W7QSQ0      -----TKIDPFQSSIDITVD-------------SISKSFISPSESFE----IQPISETKF
R7F6L5          -----KDVDIYHQE-PGIIS-------------SPDAANADASYSFK----YIVKPDGTV
A0A7C5MRV2      -----VTAEMYKDDSPFIVS-------------YDSTGKVAYNKMFS----LFYLGGNKF
A0A553GA49      -----YDKNLYTSS-PFQVV-------------LDKNYLQLTGAEFY----VEILSKDLF
A0A497D6F6      -----KSREIYKES-PFEVI-------------WDYEHPQLIYADFL----LEILPDGKL
A0A5M4AAB9      -----RTTELYHDL-PFEIE-------------FDDRHSQLIDTNFD----LKFLSDNKV
F4KR18          -----SEYDAYGNF-PIVVD------------------------TFK----LNPSAESTF
A0A229I3A5      -----HKEALYGADLPVTVD-------------F-VGFTDEQSGSFK----LQLKGDGSY
A0A3R6HJB3      -----HKEALYGADLPVTVD-------------F-VGFTDEQSGSFK----LQLKGDGSY
R6NN15          -----YAQVRYGQNLPVTVS-------------F-AGLADNETAALT----VEPAQSKGI
C9LKL0          -----HRIALYDNR-PFDVS---------------FGTKTSVPANFQ----AEIMPGGKV
A0A3D0QPV7      -----LTENKYPAK-YLRFSDLTIIDSTIFGERI-----------------DIFSNSNQI
A0A496KT23      -----HDKVIYGSELPVKVE-------------F-LNIGEEQRASFG----LSLQADGRV
L1M9T3          -----HPKVIYGSELPVKTE-------------F-LNISEEQTASLS----LTLMADGRV
A0A3C0I8F1      -----LDNELYGNV-PFEIKWWATANNPWFDKRFDVQIVDPKHFVLA-------------
R5JJI4          -----REDELYTHS-PITVL-------------F-PESEERQVIEMT----VTPVDSATV
A0A0A2DQN2      -----RMIELYKAS-PIRVS-------------FVDSLELYDSFFVS----YKDENQVSV
A0A0A2F2N5      -----RPIELYKSA-PIQVT-------------FADSLDQYHQFEVT----YKDASSI-V
L1NGW4          -----RTLELYTAA-PFSMR-------------FLDSLEKVATYEVR----FKDAGHVSI
Z4WRA0          -----RTLELYTAA-PFSMR-------------FLDSLEKVASYEVR----FKDAGHVSV
U2K8K9          -----RTLELYDEA-PFKVT-------------FLDTLDVANTFRVS----YQDASHVSI
A0A069ZM60      -----RTLELYSDA-PFSMK-------------FLDTTERKSTYEVA----FQDAGHVRV
J6GV98          -----RTLELYSDA-PFSMK-------------FLDTTERKSVYEVA----FQDAGHVRV
A0A134B4F8      -----RTIELYTDA-PFSMK-------------FLDTLERGSSFDVA----FQDASHVRV
A0A134B8C7      -----RTIELYTDA-PFSMK-------------FLDTLERGSSFDVA----FQDASHVRV
A0A3D2HF71      -----VEKRIYNKS-PFIVI---------------YDSLNKQTIGEKVNVKILSAKKYKI
A0A4Z0EKR0      -----RDTEIYGNELPIKVI-------------LGKLEPTAGGVNFT----VRPKSVDTF
B5CTK0          -----HMKELYTQA-PISVR-------------F-FDVDEAETLSLT----VLPHSEKEV
A0A1M6B6D5      -----QQEDAYKQT-PFFVEVDTAKSQMLNHQ-IKVVFKDSLTFNLS----VSFEEAKNI
A0A451FS66      -----QLIDAYKQT-PFLIRVDTTKAQVLNQQ-FKVVFKDSVNFNLS----VSFEEGKNI
A0A2E3GN39      -----RSLEIYPNP-YFTID-------------SFYQDPKMRRVSID-YSVLINQQKDSV
A0A3D1MEL0      -----RSLEIYPNP-YFTID-------------SFYQDPKMRRVSID-YSILINQQKDSV
A0A519UDD1      -----KDIEQY-GR-NLPIK-------------VLLTTADSTAAG---KSFIVRVRPDNA
A0A2A4N9A6      -----LTQELYKSS-NYKVD-------------FMVKDPIIYQVRFN-IEILNTREFKLL
A0A6C0GGI1      NNLGDQVVEEKVTE-EFPFR-------------VILDPSSNQLLNVPIYVKILSKNKYQV
A0A368D1N7      -----RSLEIYPNP-YFTID-------------SFYQDYKMRRVSID-YSILINQQKDSV
A0A3B8TU58      -----RSLEIYPNP-YFSVD-------------SFYQAPELTKINID-YHMFLSRKKDSI
A0A1T5IIR6      -----RDVELYTSQSPVRMA-------------FNREKSDPGSVSVT----VIPEDAGHI
F0R0C9          -----YKQVLYGQTLPFSIS-------------F-FGLQDNETASLT----LRQGASGKL
A0A6L6NXQ0      -----HKETLYGKELPVKAV-------------L-PGLEDAESVSFT----IQLLPGGKV
A0A6N8DCX3      -----HKETLYGKELPVKAV-------------L-PGLEDAESVSFT----IQLLPGGKV
A0A3E0QD27      -----IDHEMYLSS-PFRIEYEIEDSAIFSIPFY-LDFESEKVFHLR----YPTHEGEKV
A0A0M1W1I6      -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRIQNRKQV
A0A4R4GHU2      -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRIQNRKQV
I8WPR6          -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRIQNRKQV
A0A0K2HKS3      -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRILNRKQV
B6W3W8          -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRILNRKQV
A0A4R4GSI6      -----REEELYTQA-PVKVS-------------F-PEEEDHLDFNLT----VRILNRKQV
A0A076IRY8      -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRILNRKQV
A0A3A6AD54      -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRILNRKQV
A0A3A6MIU7      -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRILNRKQV
I8WPP8          -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRILNRKQV
A0A372Y7D2      -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRILNRKQV
A0A3E4JJC9      -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRTLNRKQV
A0A3E4WDQ0      -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRTLNRKQV
A0A414H9P2      -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRTLNRKQV
C3R5A8          -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRTLNREQV
A0A1C5XJA7      -----RNVELYTKS-PVAVS-------------F-ADMLPEQYVAFT----VTLLNKDSV
A0A285T4L1      -----RMNELYNQS-PINVS-------------F-INVMPERYISFT----VTPKNAKQV
A0A3E5BU42      -----RMNELYNQS-PINVS-------------F-INVMPERYISFT----VTPKNAKQV
R7CUW4          -----RYNELYTQS-PVRLS-------------F-PDAMPEQGLALT----VQPKSERSV
A0A416GGJ1      -----RHIELYTKA-PVTVS-------------F-PGMSPNGAVQFK----LKMLNLKEA
D1JY72          -----REEELYTQA-PVKVS-------------F-PEEEDHLDFSLT----VRILNRKQV
D7J4K6          -----RMNELYTLS-PVNVS-------------F-INVLPERHISFV----VTPKDDATV
Q8ABP9          -----RMNELYTLS-PVNVS-------------F-INVLPERHISFV----VTPKDDATV
A0A5M6AHF7      -----RMNELYTLS-PVNVS-------------F-INLLPERHISFV----VTPKDDATV
A0A6L4IA73      -----RMNELYTLS-PVNVS-------------F-INLLPERHISFV----VTPKDDATV
D6D2Z5          -----RMNELYTLS-PVNVS-------------F-INLLPERHISFV----VTPKDDATV
A0A1T3EDR4      -----RDYELYTDS-PVEVI-------------L-LGETSLSGYSLK----VEPLDGGSV
A0A174SDD8      -----RPVELYTES-PVRVA-------------F-LEAGTDEAHSLS----VTPKSNVQV
A0A1H7RFH3      -----RPVELYTES-PVRVT-------------F-LDAGMDEAHSLS----VTPKSRQQV
A0A139L1N2      -----RPVELYTES-PVRVT-------------F-LDAGMDEAHSLS----VTPKSRQQV
A0A174TVL8      -----RPVELYTES-PVRVT-------------F-LDAGMDEAHSLS----VTPKSRQQV
A0A1H8BJR6      -----RPVELYTES-PVRVT-------------F-LDAGMDEAHSLS----VTPKSRQQV
R9H6G0          -----RPVELYTES-PVRVT-------------F-LDAGMDEAHSLS----VTPKSRQQV
A0A412GR09      -----RPVELYTES-PVRVT-------------F-LDAGMDEAHSLS----VTPKSRQQV
A0A6I0S0M4      -----RPVELYTES-PVRVT-------------F-LDAGMDEAHSLS----VTPKSRQQV
A0A081PBV5      -----REYELYKDA-PVKVQ-------------F-IDAKPEVGFSLQ----IEAVDQDHV
A0A1I2AN85      -----REYELYKDA-PVKVQ-------------F-IDAKPEVGFSLQ----IEAVDQDHV
A0A4U0GMP3      -----RNTELYTDA-PIQIS-------------F-EDVRTEDNFSFT----VSRNDDSTV
A0A1H6CKR6      -----RTLELYKTS-PFLVK-------------F-VDANPNMPQEFT----LKSLGKNQL
A0A235E1C0      -----RTIELYKTS-PFIVR-------------F-VNAPANAGFSFN----LKYKGNNQV
R6D982          -----RQKELYMAA-PVRVH-------------F-LVSEPEAELSLL----VTPKNERQV
A0A1F0I8C4      -----RPRELYTEA-PIRVA-------------F-MDAIPGERCFLS----VIPKNQQQV
A0A3A5RIJ2      -----RPRELYTEA-PIRVA-------------F-MDAIPGERCFLS----VIPKNQQQV
A0A515IZJ5      -----RPRELYTEA-PIRVA-------------F-MDAIPGERCFLS----VIPKNQQQV
A0A5M5NLR3      -----RPRELYTEA-PIRVA-------------F-MDAIPGERCFLS----VIPKNQQQV
A0A0D5BSQ0      -----RDYELYKKS-PVQVK-------------V-EGKSSEDNYAFT----VIPVDMKHV
A0A1T3F6P5      -----RDYELYKKS-PVQVQ-------------V-EGKSSEDSYNFT----VVPLDANNV
A0A0W8EPA0      -----RDYELYKKS-PVQVK-------------V-EGKSSEDSYNFT----VVPVDANNV
A0A365UKN1      -----RDYELYKKS-PVQVQ-------------V-EGKSSEDSYSFT----VVPVDANNV
A0A4R6WE41      -----RVYELYDKS-PIKVK-------------I-LKGLPQDTWSLL----ITPISKDSV
A0A2T5RP38      -----RDYELYKKS-PVKVV-------------F-SNKSPESRYGFT----IIPIDAKNV
A0A1A6CF06      -----RDYELYKKS-PVQVK-------------V-EGKTQADSYGFT----VTPIDTRYV
A0A1T3D6S8      -----RDNELYKKS-PVQVK-------------V-EGKTHADSYGFT----VTPVDTRYV
A0A1P8E011      -----RRKELYTAS-PIKVI-------------V-PQTKPEDSFSFT----VTPVGGKEV
A0A1V3N3U3      -----RDIELYRTS-PVKVD-------------L-AGAGPTSQYNLL----IIPLDAQTV
C2FUH6          -----RDQELYTQS-PVKVT-------------W-MDKKPDQSFSFT----LTPLDGKYV
A0A0B8T471      -----RTVELYRNS-PFEVK-------------F-LNIKPESNFSFT----LTAIDSTKV
A0A4R7D2K0      -----RKVELYRKS-PFEVK-------------F-LNIKPESNFSFT----LTAIDSTTV
A0A2X2J8S4      -----RDYELYNES-PVLVQ-------------F-VNYNPSGSFSFT----ITPRDNKSV
A0A3C0S618      -----RDYELYNES-PVLVQ-------------F-VNYNPSGSFSFT----ITPRDNKSV
A0A4P7DRF9      -----RTLELYRKS-PYLVE-------------F-EGINQNAGFSFN----LRRKDANEV
A0A239XXC4      -----RSVELYKTS-PFIVR-------------F-RNAAPQSGFSFN----LKYKGNNQV
A0A4U9K473      -----RSVELYKTS-PFIVR-------------F-INVPSSAGFSFN----LKYKGNNQV
A0A3M1Y2F5      ------------------------------------------------------------
A0A7C7CKY6      -----LGKTTYQKPVEIGVW-------------QKLEHAEILITVHD-------------
A0A1G1TG88      ---------------------------------MKVTPTQYF------------------
A0A661XXA6      ---------------------------------ISLLDTSRFILSYN-------------
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A6L3FBV2      ------------------------------------------------------------
A0A6L3FIH8      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ------------------------------------------------------------
A0A519TAP8      ------------------------------------------------------------
R5DEG6          ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6L6NZ03      ------------------------------------------------------------
A0A642EJV3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A6L4ENN1      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A519SD85      EL----------------YINDEKRIYKFDQV--------IIHENLQIKVQRPLVRVLNT
A0A3M1TXY5      EIEADEKSAEIWNIAEDALVHELEPFVFNKRL--------RFGQPYTDQNLSFTLHRNPD
A0A2E0VQ27      RF----------------FDGSPKDSAHATIV--------DQGQLIEKNGLLLTI--EPD
R6U429          VI--------------KDWHVAGEEMEYAKIKG-------RLNDTLDTPVGKLVIAPTML
A0A5C8AF42      SV-------------------------NYAHLGKNYALKGKLNERLSNTHFEISIDSPIP
A0A239K409      NL----------------------EEGGKTFKF-------EFGEVVRRPYGTFTILTSDA
A0A1V5S1J9      EI----------------SAPGTKQLPELKISG-------KYGIPIQNSSFFIQVDKSAI
A0A0A2EYC8      TI----------------KIFDNEDVELETVKG-------RYNEPVGCKYFLIKVTKNSN
A0A2G6H6Y4      NI----------------SVLDEHDEVLEVVDG-------EYGEPIGCKYFLVKVLRDER
A0A1M3DPL8      TV----------------TEDEESMPKGFNING-------RIGYPLQHHLMFITINDISG
A0A1V5F519      TI----------------SPHNNNSMPSSPING-------HIGVPLQHNLFFMTVNSVSD
A0A2G6R1T9      VI----------------SDDKGVIDEDLEIRG-------KIGVPVKSKLFVINVTKDIE
A0A350V3E4      -------------------------------------------------------SATPE
A0A6J4K208      RLKVHGENVPVFDLRTDRQVAVIPLIAVDKVL--------RVGRPYRDPHLGFRIEFLKK
A0A1M6MYT6      ELKIEEEDEVMVFNYKDKTVLDELDSYSYSEEA-------TPGTRISTDEFAFKILLNEH
A0A2P8CDS1      EMTIQGKKAVR-YDYRNEKELQPEKEIEETRTF-------PIDSFVASDDYAFRIIPAA-
A0A353WYK7      IL-------------------------RLKKGDQVIENTYSFGEEIVCDGFVFMLALSPH
A0A355BP94      QL-------------------------WV--GENGTKQTGTLGEPVVVSDANFVIELSPN
A0A136LSC7      SL-------------------------RL--KGAVST-RGSMGNPVEFDGTVLTITKTNY
A0A5C7N8Q5      TL-------------------------RL--GDAGPTVSGTMNKPVELDKTILIVNKTIF
A0A2W4RDE8      MVSVRGKEVPTYDVITNTVKDRVPVVDIQEVV--------DINKPFQSKNLSFSITFNDA
A0A0L8VEV2      QIEVKGKKMVYGKEVEIEFSQKG-----------------KFGELFSNDYFNFTL--YPK
A0A1I2A9Z9      RIIVDEKTMYYGREIEIKIDQRG-----------------VFGEIFENDYFHFTL--YPK
A0A212J9Z9      EI---------------SYKENPESETKISLIA-------PFDQEIDYKLFRIKLHKTPN
F5IV23          EI---------------SYKENPESETKISLIA-------PFEQEIDYKLFKIKLHKTPN
F8X2T0          RV---------------SYKDGLDGEPEEAFNV-------VFDSPVENKFFKGTIRKTKN
A0A1M3LAG1      RV---------------SYKDGLDGEPEEAFNV-------VFDSPVENKFFKGTIRKTKN
A0A212K6G4      RV---------------SYKDGLDGEPEEAFNV-------VFDSPVENKFFKGTIRKTKN
A0A4Y9IPG7      RV---------------SYKDGLDGEPEEAFNI-------VFDSPVENKFFKGTIRKTKN
A0A2V3PNY7      RI---------------FY-EGSETTQPFSMEV-------PYDQFVQEPRFYIKITKSPR
A0A6G7WQ31      RI---------------FY-AGSETTAPFSMEV-------PYGQFVQEQRFYIKINKSPR
A0A6G7X5K8      RI---------------FY-PGSETTAPFSMEV-------PYGQFVQEQRFYIKINKSPR
A0A1M5DFS8      RI---------------FY-PGSENTAPFSMEV-------PYNQYVQESRFYIKINKTDR
A0A4Y8KZS5      RI---------------FY-PGSESTPPFSMEV-------PYNQFVQESRFYIKINKTDR
A0A142HHS5      RL-------------------------NVTVGNAKLGGNYEFGQLVKLPGISLRLLSASS
A0A660LQT8      EL--------------TNFVTNLDRKIEKTQVVKG-----HFGQIVNTPVGRVRV--TPT
A0A2M6GH67      KL-------------------------VYLIGEEEITGEYKVGEPINKKEIYLVLNRTPN
A0A389LWV6      EI----------------TFDGAKNIAPFSIVG-------NYGTSLQHNLFFVTV--DKT
A0A1G9B1T9      EISVEADEASVYQMAEEKFAPTKARDVLIQNVQ-------KVGQPVRTPYLNFTLIRNEQ
A0A350PNH9      SI----------VHVSGTDKAGNQVESDEEVQG-------KLGQTVRTAMGHVCV--DQA
A0A354LNT9      SI----------VHVSGTDKAGNQVESDEEVQG-------KLGQTVRTAMGHVCV--DQA
A0A161LWY6      EI----------------AHQKDKQLDELRYTG-------RYGSLLNTPYFSVVV--NKT
A0A6I3N9U6      EI----------------AHQKDKQLGELRYTG-------RYGSLLNTPYFSVVV--NKT
A0A3D0FMX4      TV----------------SIADEDTKNPMTFNT-------IYGQTFDCGLFSGLFMPTEY
A0A1M3MEI8      LI----------------TEEEENLRKGFALRG-------RLGKTFQHNLFFITVNMAEG
A0A1J5HQM0      TI----------------TVDENKQYENFKLNG-------NIGEPISNNLFFITINNTNS
A0A653AC35      II----------------TDENS---LNIKIKG-------YLNQPIQHNLFFLTIAPTNQ
E4T131          TI----------------SVDDKNLFSKFQING-------RYGRPLQHNLFFLTVHNVNK
A0A521H707      RLSYS-----------TALSKQSGTFPVNTWI------------TIPGLKFKITI--KDY
A0A1F3D6P8      RLVIDQNTVSLYNYLDNQIVIENVPLKVDTIC--------RFNETIRGKTFKFSV--SFN
A0A356Z058      RLVIDQNTVSLYNYLDNQIVIENVPLKVDTIC--------RFNETIRGKTFKFSV--SFN
A0A3D1BT36      RLTVSEDDVSFYNYLDNKVISAGHMLNIDTVY--------KFNQTIASPYFRFSV--SKN
A0A5R9QZP0      RLSVYDDGAKLYNYLDNKVTSRGNRIEFDSIC--------TFNETITTPYFKFSV--NLN
A0A3D3HL11      RLTASEDEASYYNYIDNAVVSTENRVRIDTIC--------RFNETVTSYNYKFSI--GFN
A0A6L8U6G9      RLTASEDEVAYYNYIDNAVVSDKNIFHLDTIC--------RFNETISSFNFKFSI--ALN
A0A352ME00      RLTASQKKVSYYNYVDNQIISEDNFFEIDTIC--------KFNETISNKVVRFSV--ALN
A0A6L8UH35      RITISDKNVSLYNYVDNMILNDDYDLEVDTIC--------KFGETIQNKAFKFSV--TNN
A0A2W7RD29      SV-----RFVGDEPTTSMFNSNQDEGSGKSYVC-------KFNEWCGLPFLTLRTRLLEA
A0A3N2NDY8      VL--------------SKFHLETPDGDEEIEKEVKAK---IGAGPIETPVGKVSIAANGN
D7JEV9          TI--------------KVFDNEDVE--LETVEG-------RYNEPVGCKYFLIKV--IEN
A0A4R6H3B7      RI----------------IVDEKTMYYGREIEVKIDQRG-VFGEIFENDYFHFTL-----
A0A3P1Z8V4      TD-------------FEGIRGLSSEQENLKLKV-------PFGVKTKTPIGTLTL--YKE
A0A2W7QSQ0      LL---------------------ILDEDKQKEF-------EYGQKIKFSFGIISIQKKPA
R7F6L5          IL--------------KDFNKGGTELPDKPLSC-------KLGATVKTPVGAIAI---DR
A0A7C5MRV2      KL-------------------------VYTKRQESVEGQYYFGETINIDGFKFQVVKRET
A0A553GA49      TLKVEVDE--------GELHNFLNASSEQLVEDWEFKHTYRFGESIENENFNFTV--LLK
A0A497D6F6      LIKVEDEHAAIFDFLNSEIVTY-VTNLSFSKEA-------AYNEVIKTDYFSFII--KPK
A0A5M4AAB9      KIKTKSRKAIRYDYLRKTELSE-PHAVNNSRTF-------DIDEQIKSADYSFRI--IPI
F4KR18          KITPLNNYSFRFSQGSKTE-TQ-RFGTLFSNQF-------GV----------FRI--NRI
A0A229I3A5      VI--------------SKLKGVTRD--NLPVDDSDEITG-RIGQIIRTPLGKIKV--DKA
A0A3R6HJB3      VI--------------SKLKGVTRD--NLPVDDSDEITG-RIGQIIRTPLGKIKV--DKA
R6NN15          -----------------KLTSFVHN--GEKVD--GEVVG-TLNDSLVTPIGKIVI--RPA
C9LKL0          RL--------------FDFKLN-GEEYSDDIET-------APEQAVKTPLGVLKI--SKN
A0A3D0QPV7      TL--------------NCRNQTFTT---------------ESGGLLQSPWFRARITVADP
A0A496KT23      IL--------------DNFTKDGASLSGTVMG--------KVGERCVTPVGLVKF--VAN
L1M9T3          LL--------------ENFVRDGQNLGGSVLS--------QVGKRCATPIGLLKL--TPT
A0A3C0I8F1      ----------------FEQGRG-----VIKQKY-------QFNDTIHLSGMSLVL--IPK
R5JJI4          RL--------------SDFSLSIAGEEIRSAEVVDA----RLNDTISTPVGTMVV--TPT
A0A0A2DQN2      S----------------YNEEEHIF---------------LLGDTISIGKNRLII--EPN
A0A0A2F2N5      LS--------------REGGETKQV---------------QLGEEVTYEKSRLIV--VPS
L1NGW4          QP--------------QGSSKAQDV---------------PLNVPVQLGPDRFII--EPR
Z4WRA0          LP--------------QGSSKAQDV---------------PLNVPVQFGPDRFII--EPR
U2K8K9          KL--------------GKDGRTQVI---------------PVGEPIRIGETRFIV--EAR
A0A069ZM60      TP--------------VHTGKSQVV---------------PLNVPVQLGDERFII--EPH
J6GV98          TP--------------VHTGKSQVV---------------PLNVPVQLGDERFII--EPH
A0A134B4F8      TP--------------ASTGKSQVI---------------ALNVPVQLGEERFII--EPR
A0A134B8C7      TP--------------ASTGKSQVI---------------ALNVPVQLGEERFII--EPR
A0A3D2HF71      EI---------------------DGERNFSKEM-------NFGDRFNEQGFDFIIELRDK
A0A4Z0EKR0      EL--------------DDYSGHMYSY--------------HFGEQIQKPYGTFSIIAGGA
B5CTK0          TI--------------TDIITSSGESVNKSFYI-------PLNDTVSTPIGRILI--SPT
A0A1M6B6D5      NL--------------QNYNSKEKK--SLFVEAGDFSKDFKIGEPVNTPFFNGIF--VPN
A0A451FS66      NL--------------QNYTTKEKS--SLFIDTDVFSKDYKLGESISTPFFSGTF--IPN
A0A2E3GN39      RL-----DYIYQGKSWGGFLKPGKPYSDENIYL-------AISN-------------LDQ
A0A3D1MEL0      RL-----DYIYQGKSWGGFLKPGKPYVDENIYL-------DISN-------------LDQ
A0A519UDD1      FDLDDYTGHITT--------------------H-------KFGQQIRKPYGTFTVIATGL
A0A2A4N9A6      YSIDKKYDNIYN-----------------------------FGTWIRTEFADFKVSLKES
A0A6C0GGI1      QVVGGETAYIYNISTNKTIGETTTP--EINKIV-------NLGDPFKDEHLNFKI--FLN
A0A368D1N7      RL-----DYIYQ---GKSWGGFLKP-----------------GKPYADENIYLAISNLDQ
A0A3B8TU58      RL-----EYIYK---GSTWGGHLKP-----------------GKPFIDENIFISISNFDE
A0A1T5IIR6      RL--------------QTSAGS-QL-------V-------ALGDTVALGRGKVVF--LPT
F0R0C9          EL--------------SDFTRNGEKVE-GISEG-------KLNDTIASPVGKLLV--EPT
A0A6L6NXQ0      EL--------------DDFKSSERDLESGTVTG-------TLNDTLQTPLGKIIP--VPT
A0A6N8DCX3      EL--------------DDFKSSERDLESGTVTG-------TLNDTLQTPLGKIIP--VPT
A0A3E0QD27      KA--------------FQTNVW-NKVPGLKFRM-------TVQNWAAIQKQEINL--QDE
A0A0M1W1I6      RL--------------SDFSTD-AT--SITLTA-------NLGDTIQSPIGKIVV--SPT
A0A4R4GHU2      RL--------------SDFSTD-AT--SITLTA-------NLGDTIQSPIGKIVV--SPT
I8WPR6          RL--------------SDFSTD-AT--SITLTA-------NLGDTIQSPIGKIVV--SPT
A0A0K2HKS3      RL--------------SDFSTD-AT--SITLTA-------NLGDTIQSPIGKIVV--SPT
B6W3W8          RL--------------SDFSTD-AT--SITLTA-------NLGDTIQSPIGKIVV--SPT
A0A4R4GSI6      RL--------------SDFSTD-AT--SITLTA-------NLGDTIQSPIGKIVV--SPT
A0A076IRY8      RL--------------SDFSTD-AT--SITLTA-------NLGDTIQSPVGKIVV--SPT
A0A3A6AD54      RL--------------SDFSTD-AT--SITLTA-------NLGDTIQSPVGKIVV--SPT
A0A3A6MIU7      RL--------------SDFSTD-AT--SITLTA-------NLGDTIQSPVGKIVV--SPT
I8WPP8          RL--------------SDFSTD-AT--SITLTA-------NLGDTIQSPVGKIVV--SPT
A0A372Y7D2      RL--------------SDFSTD-AT--SITLTA-------NLGDTIQSPVGKIVV--SPT
A0A3E4JJC9      RL--------------SDFSTD-AT--GITLTA-------NLGDTIQSPVGKIVV--SPT
A0A3E4WDQ0      RL--------------SDFSTD-AT--GITLTA-------NLGDTIQSPVGKIVV--SPT
A0A414H9P2      RL--------------SDFSTD-AT--GITLTA-------NLGDTIQSPVGKIVV--SPT
C3R5A8          RL--------------SDFSTD-AT--GITLTA-------NLGDTIQSPVGKIVV--SPT
A0A1C5XJA7      EI--------------TDFSMA-EN--GERQVV-------ELNDTISLNEGKVVV--VPT
A0A285T4L1      LL--------------SDFTGI-PAANDKTYTM-------RLNDTLTIGSERILI--TGT
A0A3E5BU42      LL--------------SDFTGI-PAANDKTYTM-------RLNDTLTIGSERILI--TGT
R7CUW4          TL--------------SRFSWM-EA--DSTCTV-------AMGDTVRVHGQRLVV--TPT
A0A416GGJ1      QI--------------TTLGDA-GK----TYKV-------QLRDTTAIGNFKIAV--TPT
D1JY72          RL--------------SDFSTD-AT--SITLTA-------NLGDTIQSPIGKIVV--SPT
D7J4K6          TL--------------SGFGGLPAA--KDSYDV-------RLNDTLAVGGERILV--TGT
Q8ABP9          TL--------------SGFGGLPAA--KDSYDV-------RLNDTLAVGGERILV--TGT
A0A5M6AHF7      TL--------------SGFGGLPAA--GESYEV-------RLNDTLAVGGERILV--TGT
A0A6L4IA73      TL--------------SGFGGLPAA--GESYEV-------RLNDTLAVGGERILV--TGT
D6D2Z5          TL--------------SGFGGLPAA--GESYEV-------RLNDTLAVGGERILV--TGT
A0A1T3EDR4      LI--------------REWQSK-KL--EKPFKL-------SLNKPTRLPFGELLV--KGS
A0A174SDD8      EL--------------SDFSRG-ME--QRKV-V-------KLNDTIQTALGKLVV--FAA
A0A1H7RFH3      EL--------------ADFSRG-ME--QRKV-V-------NLNDTIHTALGRLIV--FAA
A0A139L1N2      EL--------------ADFSRG-ME--QRKV-V-------NLNDTIHTALGRLIV--FAA
A0A174TVL8      EL--------------ADFSRG-ME--QRKV-V-------NLNDTIHTALGRLIV--FAA
A0A1H8BJR6      EL--------------ADFSRG-ME--QRKV-V-------NLNDTIHTALGRLIV--FAA
R9H6G0          EL--------------ADFSRG-ME--QRKV-V-------NLNDTIHTALGRLIV--FAA
A0A412GR09      EL--------------ADFSRG-ME--QRKV-V-------NLNDTIHTALGRLIV--FAA
A0A6I0S0M4      EL--------------ADFSRG-ME--QRKV-V-------NLNDTIHTALGRLIV--FAA
A0A081PBV5      AL--------------SSFSKG-NT--SQVLKI-------KLNQTVRTPIGLLKV--TRS
A0A1I2AN85      AL--------------SSFSKG-NT--SQVLKI-------KLNQTVRTPIGLLKV--TRS
A0A4U0GMP3      LM--------------SGFSKG-DM--EQRFIV-------KFNEKVRTPVGVLAV--RPT
A0A1H6CKR6      EL--------------SEFSNQEEA--GKPLVV-------ALNQTVNTPIGKVII--TPN
A0A235E1C0      EL--------------SNFSNT-DP--EKTVTV-------KLNAETKTPVGNLII--SAN
R6D982          EL--------------SDFSRG-AE--SRKT-V-------NINDTVETALGRLVV--SAT
A0A1F0I8C4      EL--------------AEFSKG-TE--LRRV-V-------NLNDTVHTALGKLVV--FAA
A0A3A5RIJ2      EL--------------AEFSKG-TE--LRRV-V-------NLNDTVHTALGKLVV--FAA
A0A515IZJ5      EL--------------AEFSKG-TE--LRRV-V-------NLNDTVHTALGKLVV--FAA
A0A5M5NLR3      EL--------------AEFSKG-TE--LRRV-V-------NLNDTVHTALGKLVV--FAA
A0A0D5BSQ0      VI--------------KNWSNT-NK--NEEFKV-------VLNQSVVTPIGKVLI--KPS
A0A1T3F6P5      II--------------KNWNPS-NK--DKEIKI-------ALGKLTSTPIGKLLI--NPS
A0A0W8EPA0      II--------------KNWNPA-SK--DKEIKV-------ALNSLTSTPVGKVLI--TPS
A0A365UKN1      II--------------KNWNPE-NK--DKEIKV-------ALNRLTLTPVGKVLI--TPS
A0A4R6WE41      EI--------------GGWKDN-TD--RAPVRL-------AIGQAFRTPLGEIQL--DST
A0A2T5RP38      IV--------------KDWNKN-VD--GQEVKV-------VLNQLTKTPFGEIII--VPS
A0A1A6CF06      LL--------------KKWNET-SE---EELKI-------ELNRWVVTPAGKVFI--TPT
A0A1T3D6S8      LL--------------KKWNET-SD---EELKI-------ELNRWVVTPVGKVFI--TPT
A0A1P8E011      VL--------------SNWSEG-DA--ALEVDA-------TLDKPVNTPFGQVIV--QSA
A0A1V3N3U3      LL--------------SGRIAG-KE--QQEIRV-------PLNKTVNTTLGRLTV--RPT
C2FUH6          LL--------------KKWSNG-DR--AKELKI-------ELNKESNTPVGRIVV--TAE
A0A0B8T471      RF--------------AT-VDG-DV--ENYTTI-------PIGKEIKTPFGNMVV--DTT
A0A4R7D2K0      RF--------------AT-VDG-DV--ESYTTI-------PIGKEIKTPFGNMVV--DST
A0A2X2J8S4      LV--------------VENVGK-DK--EKVYIA-------PLNKAIKTSFGGIRI--LAT
A0A3C0S618      LV--------------VENLGK-DK--EKVYIA-------PLNKAIKTSFGGIRI--LAT
A0A4P7DRF9      EL--------------SDFSTN-KE--AKSIIV-------PLNQLVNTPVGKMII--QFN
A0A239XXC4      EL--------------SSFSNS-DP--DKTITV-------KLNSEVKTPVGNLII--SAN
A0A4U9K473      EL--------------SMFSND-EL--AKPIIV-------KLNAETKTPVGNVII--SAN
A0A3M1Y2F5      ------------------------------------------------------------
A0A7C7CKY6      ----------------------------------------FTRISYQQ------------
A0A1G1TG88      ------------------------------------------------------------
A0A661XXA6      ----------------------------------------LGEKEFEQEYKFSSPVINED
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A6L3FBV2      ------------------------------------------------------------
A0A6L3FIH8      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      ------------------------------------------------------------
A0A4Q3SEI4      ------------------------------------------------------------
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3D4CJE1      ------------------------------------------------------------
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      ---------------------------------------------------------SAA
A0A519TAP8      ----------------------------------------------------------MQ
R5DEG6          ------------------------------------------------------------
A0A3N2LCI3      ------------------------------------------------------------
A0A6L6NZ03      ------------------------------------------------------------
A0A642EJV3      ------------------------------------------------------------
A0A6H9Q899      ------------------------------------------------------------
A0A6L4ENN1      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A519SD85      ------------------IRFKYLSTPEFVNQIRK-SLKVDDSQAN---NILSLRYSNSN
A0A3M1TXY5      ----------FEVKKGQRFYFVIHGLKDLAERYQS-ALKVEAVSKE--ARLLNITSEGPV
A0A2E0VQ27      SAFLKLK--PNSLKPGDLFALKVNSEDALIGQYKSDKLFVKPVDKE--VSIIKVYFNHEL
R6U429          YDQWKKP-----------IVISWVNAKKLAKAYNK-SLSVSLSGKE--STVLVLTLTDRF
A0A5C8AF42      -SEFKDE------SSDNELYFVFNSVESYAARLLP-SLQIVPVDPE--AKTIQITFQGNN
A0A239K409      --------FPQKSPKQKKIIVVFENINTLAKYYSD-WLKVEPINAK--ASVLNISITDPV
A0A1V5S1J9      -YRRNFN-----------ICFKLLNPENLAITYSA-KLSFDFLMTG--ASVVQASISGTV
A0A0A2EYC8      -YHSANS-----------VNFVFRNRDNLVMEFAS-KLQIN-LLPN--TSVLNISVASDN
A0A2G6H6Y4      -YNEIPQ-----------FYFRFRTRMSLIQEFVG-RLEVA-PIDK--TSVLNLSLASNN
A0A1M3DPL8      -NNSAKD-----------LYFKFRTKESLIGEFSS-KLALNFVMDG--SSVLEISMVSET
A0A1V5F519      -NVKEFE-----------MYFRFRTRETLIEDFKS-RLSSRYVIEG--SSILEISLISET
A0A2G6R1T9      -FSNK-T-----------MFFRFRTKTSLVNEFSG-LYPE--FINK--SSVLSISLQSPT
A0A350V3E4      ------------------NQVDPKSKNQIANVLSA-VTEISQKRG---LDIVSIKTESPS
A0A6J4K208      PGQFDAE----------GRFFVINSLADQAGQYQR-RLRVHPLGEG--SRTLRLSIRGTL
A0A1M6MYT6      ----------FNPESDNEFKFRFHSPQELIRQYQN-QLEVALKSDE--TTILDLTLRDRN
A0A2P8CDS1      -----------DSKLEGNYRVVFHSLDELTADYLN-RLTVAPISKE--GTIVKLSTTCEN
A0A353WYK7      ---------YRKDNDNVHYFFKINSPQSNIRYLMD-NTEVKPLDFK--AKTISVTFKDFN
A0A355BP94      ---------ATPDFKN-HFFFVMNSRNRLLDFLSS-NLRIEPINFD--ANTIRVTFRDFN
A0A136LSC7      ---------FTENDGN-NYYFVLNSRKSLIEYLSK-NIQVDPLNFN--ANTIRVSFRDHN
A0A5C7N8Q5      ---------FTENDGN-NYFFVLNSRKTLIDYLSK-NIQVDPLNFN--ANTIRVSFRDHN
A0A2W4RDE8      ---------FKLEPDS-KMFFRINNQVSLAERYRN-QLNIEPISKE--SNIVQLTIEQAV
A0A0L8VEV2      YAKRGNQ-----------YYFTFNNFENQVKKYMN-RLVIEEPEDK--ADLIYLSLIDQV
A0A1I2A9Z9      NVKRGET-----------YFFTFNNFEGLVRNYSG-RLMIEETEEQ--ADLIRLSMVDEV
A0A212J9Z9      FRKDVKG--AFKPDIS-TFNFRFLSEAQLIGMYSG-RIGSAL-QNN--SSILSISMSGTN
F5IV23          FRNDVKG--AFKPDIS-TFNFRFLSEGQLIGMYSG-RIGSDL-QNN--SSILSISMSGTN
F8X2T0          ----------FKRDFL-PFSFRFFTNSQLTGMFSG-RVSTALKTEN--STALTVSMYGTD
A0A1M3LAG1      ----------FKHDFL-PFSFRFFTNSQLTGMYSG-RVSTALKTEN--STALTVSMYGTD
A0A212K6G4      ----------FKRDFL-PFSFRFFTNSQLTGMYSG-RVSTALKTEN--STALTVSMYGTD
A0A4Y9IPG7      ----------FKRDFL-PFSFRFFTNSQLTGMYSG-RVSTALKTEN--STALTVSMYGTD
A0A2V3PNY7      ----------FAPNFE-PFSFRFVSKEELIGRYSG-RISSGLVRDG--STALGISIFGSS
A0A6G7WQ31      ----------FAANFE-PFSFRFVSKEELIGRYSG-RISTGMIREG--STALGVSIYGSS
A0A6G7X5K8      ----------FAANFE-PFSFRFVSKEELIGRYSG-RISTGMIREG--STALGVSIYGSS
A0A1M5DFS8      ----------FTPNFT-PFSFRFISKEELIGRYTG-RTSSGYQREG--SSALAISIYGTS
A0A4Y8KZS5      ----------FTPNFT-PFSFRFISKEELIGRYTG-RTSSGYQREG--STALAVSIFGTS
A0A142HHS5      PAELDAI-----------YHFVIVDDNTINSYLDH-NLKAEVLNPI--ANTIQISFLDNN
A0A660LQT8      -NHFD----VVEHQP---IHVLRTTMRKAIEHY-N-NVEITLADKG--AEILNMSFNDVS
A0A2M6GH67      FNPFVLE------QN---YHFVINSDGALNNYFRS-NLAVEIINPS--ANTISISFTDFN
A0A389LWV6      -DQFP----HTVKYE---LNFNFLSRGQQIADYNN-RLNCSFLLDG--ASVMEISLVGKV
A0A1G9B1T9      ---------EPLDTLS-QYSFMIHPLERVTEQYQK-KLVVAPFEEG--SDILVLTTTGEI
A0A350PNH9      -PGYSAFINGHESRK---LHVTRTNLYAMTNHIKA-SLSASISEEK--ATVIDLTYKDQL
A0A354LNT9      -PGYSAFINGHESRK---LHVTRTNLYAMTDHIKA-SLSASISEEK--ATVIDLTYKDQL
A0A161LWY6      ---------DNFEPRK-KINFAFLSNAYLIDYFTP-RISLSFVTQN--STVLAVSLVGTV
A0A6I3N9U6      ---------DNFEPRK-KINFAFLSNAYLIDYFTP-RISLSFVTQN--STVLAVSLVGTV
A0A3D0FMX4      -MTEKTT-----------IYFRFRSQESLVADFSS-RLTLNFVAEG--SSVLTIQLVSET
A0A1M3MEI8      VVHGKKE-----------VYFRFRSRESLISDFSG-RLRLNFVMEG--SSVLEISLASAT
A0A1J5HQM0      -YYAERE-----------LYFQFRSRESLISDFAS-RLTFNFVQEG--SSVLEIAMNSET
A0A653AC35      -NRQEYD-----------TYFIFRTRESLIGDFMS-RLNVNYVSDG--SSVLAVSLVSPT
E4T131          -YMGNTE-----------MYFKFRTKESLVNDFIS-RFSTSYVTEG--SSVLRINFVSDT
A0A521H707      -GQIKKQILATTNDEP--YYIIFYNPETVIDQYYA-DATVTVMNQY--AQTVRISFKDQN
A0A1F3D6P8      -RDFYTR--ETNMEDF--YYFSFFHLDYLTKDYLK-KLEVEPISPK--TSLIILKFRGRN
A0A356Z058      -RDFYTR--ETNMEDF--YYFSFFHLDYLTKDYLK-KLEVEPISPK--TSLIILKFRGRN
A0A3D1BT36      -QDYLNQ--RPVDEER--SFFMMNHIDIITEQYLN-RLTVESVSLK--STLINVFFQGEN
A0A5R9QZP0      -KDLYKG--TQASKTK-AHFFEFNHLDVISRRYLR-KLAIAPVNIR--STLININFKGEN
A0A3D3HL11      -KEYYNP--KLSGETD--YYFEFYHLDQLTRTYLR-RLKVEPVSIR--SSLINVLFHGEN
A0A6L8U6G9      -KEIYNQ--QLAKETE--FSFVFYHLDQLTKSYLK-RLKVEPVSIR--SSLINLLFTGEN
A0A352ME00      -KDFPLK--KTEDKSR--YYFKFNHLDYLAKGYLK-QLEIEKASPL--ASIINVRFSENN
A0A6L8UH35      -RNYVSN--PTQNKHK--YFIKFNHLDYLAKRYLK-SMDIHRISPL--ASIINIKFTDNN
A0A2W7RD29      -KNDGN------------FLFKIRNEESLISEFSG-NLAIYPATTG--GSILDIRLITNN
A0A3N2NDY8      -YTAPKG--KKNKPVT-EIIVERDGMQSTVETYGG-LVKADLADKD--ADVIDLSMKDVS
D7JEV9          -KAFRDV--DK-------VHFRFRHRQELIAEFSS-KLAIQLIPN---TSVLNISVLSDN
A0A4R6H3B7      ---YPKN--VKRGET---YFFTFNNFEGSVRSYLE-RLMIEETEEK--ADLIRLSMVDEV
A0A3P1Z8V4      -TPFR-R--FPKGTP---IVVHHYSNEIAARIYKK-ALTAAEYSKE--SSLLLLTCTDIN
A0A2W7QSQ0      -S----D--DFATEMG-NVLVELVNPQVAAENYSR-VLEFQNPSVK--SSTLYIRLYDTS
R7F6L5          -PEWV-S--DYVDKT---IHYSHVPVRPVAESIVG-GLKATYEAKE--GTLIALSYTSTS
A0A7C5MRV2      -ARYSLV--PGIE-----YRWQAIKWKSLVGRALG-GLKVEQSGYL--VPILKVSQIDFV
A0A553GA49      -EGLNID--KLVGKK---LFFVIKSNRQVVDESKD-NLKIEATQLD--ATAISINLVSTN
A0A497D6F6      -RERN------KIETA-TYKFRFNIRSDLLKQYKN-DLSVNMLSQE--TSIIELSLKTLN
A0A5M4AAB9      -SSLP------L--QG-RYRINFNSLNELTNEYLE-KLTVYQVSLK--SSILKLKTTCEN
F4KR18          -GALP------ISSDS-SMYVSFQDTKGLARNYQH-NLSVELSDEKNHSSVLILGLRDVV
A0A229I3A5      -PAFTQF--VSGEDES-VLYVSRSNVYAMTDRIKG-SLSASLSDVK--STVIDLTYKDVL
A0A3R6HJB3      -PAFTQF--VSGEDEP-VLYVSRSNVYAMTDRIKG-SLSASLSDVK--STVIDLTYKDVL
R6NN15          -AAFVDW--QKSSEP---LTVSRSGLNSAVSRYSA-GLSVALQSEK--TTIVDLTFKDVC
C9LKL0          -ATFE-E--FSKGKV---ITVDYIPADLAARRYQG-EISATVQDQE--SSLIVLTCQDIN
A0A3D0QPV7      -QTIQ-A--IQSENK---LYFVFNHPDQLLTQYFP-AINVQVLNAS--AKTLQISMRDHN
A0A496KT23      -TGY--R--RGMTDE---YKVTRSPISAVAAVVRG-SFNIALSNKA--STIIDIQYSDVN
L1M9T3          -NAY--R--KGMTDE---YDIKRSSISTTAAIVRS-RFDVQLSDKA--STIIDIRYSDVN
A0A3C0I8F1      -PAIN------ISKN---YYFIINSRYALLSYLQS-KLKVDIINHN--AGIIRISFKDHN
R5JJI4          -LYYT-D--TYYGKP---VYITKSNMEKVVEGYLR-RINISLASKT--ATIINLVLDDVS
A0A0A2DQN2      -PNYT-S--PWIARQ---IQVSRVPVPALAVAYQG-SLSIGQPEGR--ATILSLSITEAS
A0A0A2F2N5      -KGYN-E--PWPNKA---IKITRLPVKDLAASYQG-RLFIGQPENR--ATVLSLTLTDNS
L1NGW4          -SNFN-S--PWEHKT---INVIRHPLVGTARYYQN-AVAISQPQEK--SSTLMLSLQDRT
Z4WRA0          -SNFN-S--PWEHKT---INVIRHPLVGTARYYQN-AVAISQPQEK--SSTLMLSLQDRT
U2K8K9          -KTFN-A--PWAYSE---IQVSRIPFVDAVRFYQH-SVAITQPEAQ--TSTLTLTLRDKT
A0A069ZM60      -QNFN-T--PWEYKH---IEVNRMPFTQTVRYYQH-AILVAEPENR--ASTLTLRLQDRT
J6GV98          -QNFN-T--PWEYKH---IEVNRMPFTQMVRYYQH-AILVAEPENR--ASTLTLRLQDRT
A0A134B4F8      -QNFN-A--PWEHKH---IEVTRMPFTQTVRYYQH-AIMVAEPENR--ASTLAIRLQDRT
A0A134B8C7      -QNFN-A--PWEHKH---IEVTRMPFTQTVRYYQH-AIMVAEPENR--ASTLAIRLQDRT
A0A3D2HF71      -NNFVFD--PNASNR---YYFYFVSPQSLANIYRS-KLSVSPVEEE--ASLVTLTVTGTN
A0A4Z0EKR0      ------N--KWLGTK---IIVQFQDINQVANYYNS-AIGIAPVNTR--ASVLNLTLTDPI
B5CTK0          -LYYGKG--EF--SP---LIVRKVNLKSIANSFAA-RLTIAQALAG--STMLNLSIIDSS
A0A1M6B6D5      -PDVI----SKMGTP---YYLVFSEYDATVKRYL--DINIAPLSSG--SSVLQMRMTGHN
A0A451FS66      -EEVI----SNPGTP---YYFIFQDYDTTVKNYL--NTKVTPESKG--SSVLRLTVIGSN
A0A2E3GN39      -KLLEGS--AESQKS---ILFKVYTDEQLSNELMA-ITSIEP-NKE--TFAILVSARHPS
A0A3D1MEL0      -KLLDES--AENQKS---ILFKVYTDEQLSNELMA-ITSIEP-NKE--TFAIQVSARHPS
A0A519UDD1      -QNMPA-------TK---IIVRFQDILKVADYYNK-AIGVQPINKN--ASILYLSLTDPI
A0A2A4N9A6      -DAIITD--SKSNIY---YFLINNLDEQARFKFAP-AIQTLITNLS--ARTMILNFRDPN
A0A6C0GGI1      -PYYETY--LTKGKK---FFFIINNIGNLTKGYQA-KISAKPISRD--SRILNLYAEGTV
A0A368D1N7      -KLLEGN--AENQKS---ILFKVYTDEQLSNELMA-ITSIEP-NKE--TFAIQVSARHPS
A0A3B8TU58      -SLLTDE--FEGEKN---IFFNVYDNNRLADEMLS-NIKIEP-NKE--TFSVAITGKHPS
A0A1T5IIR6      -ARYS-P--DQYGQS---IRIQKIPVNWAAQAYIS-RLSIAH---D--KQILTLVEQDYN
F0R0C9          -PYYN-I--GFHEP----VYVSRSSLHGATGAYSS-RLSVVLSDEK--STVINLSFQDVC
A0A6L6NXQ0      -PFYS-A--TEKYPL---IHLSRTNLYDCVDGCIE-NLEAELSSED--ATVIELSYKDIS
A0A6N8DCX3      -PFYS-A--TEKYPL---IHLSRTNLYDCVDGCIE-NLEAELSSED--ATVIELSYKDIS
A0A3E0QD27      -AYYF----------------IINNSTTLVERYFK-NLTVVLMNQV--AQTILIKFNDNN
A0A0M1W1I6      -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A4R4GHU2      -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
I8WPR6          -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A0K2HKS3      -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
B6W3W8          -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A4R4GSI6      -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A076IRY8      -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A3A6AD54      -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A3A6MIU7      -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
I8WPP8          -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A372Y7D2      -LYYT-D--KWFNTP---ITIRRQSTDIMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A3E4JJC9      -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A3E4WDQ0      -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A414H9P2      -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
C3R5A8          -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
A0A1C5XJA7      -NYMT-E--SWIGVP---VKVSKMPLDAVVSVYRN-SIAVKQEEEE--SSILTLALKDNS
A0A285T4L1      -DRWG-Q--AWTERD---IRVSKNPLNAVAGRFQG-SMGIRQEEDE--SSILVLSLKDDS
A0A3E5BU42      -DRWG-Q--AWTERD---IRVSKNPLNAVAGRFQG-SMGIRQEEDE--SSILVLSLKDDS
R7CUW4          -NYYA-A--SWTDVP---IRVQKRPLESVVNRYKG-ALGIQQEEEE--SSILTLALKDSS
A0A416GGJ1      -NFLN-K--SWIGQE---ITVRKNPLESVVSYYSG-NFAIRQEEDE--SSILTLALRDFS
D1JY72          -LYYT-D--KWFNTP---ITIRRQSTDTMASLFRS-NLNISQAEND--ASILYLSLRDYS
D7J4K6          -DHWG-K--SWTGRE---IHVVKNPLNAVAGRLQG-SMGIRQEEDE--SSILVLSLKDGS
Q8ABP9          -DHWG-K--SWTGRE---IHVVKNPLNAVAGRLQG-SMGIRQEEDE--SSILVLSLKDGS
A0A5M6AHF7      -DHWG-K--SWTGRE---IHVVKNPLNAVAGRLQG-SMGIRQEEDE--SSILVLSLKDGS
A0A6L4IA73      -DHWG-K--SWTGRE---IHVVKNPLNAVAGRLQG-SMGIRQEEDE--SSILVLSLKDGS
D6D2Z5          -DHWG-K--SWTGRE---IHVVKNPLNAVAGRLQG-SMGIRQEEDE--SSILVLSLKDGS
A0A1T3EDR4      -PHYG-T--PYYGKS---IRVEKLPLERSVVYFLG-QLKIKHLGED--TSVLELSIEDSS
A0A174SDD8      -ENYG-E--SCFGKP---IVVTCKPLEEMVSFWLN-NLSIRQMSGD--AALLRIAMNDLS
A0A1H7RFH3      -ENYG-E--SSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
A0A139L1N2      -ENYG-E--SSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
A0A174TVL8      -ENYG-E--SSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
A0A1H8BJR6      -ENYG-E--SSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
R9H6G0          -ENYG-E--SSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
A0A412GR09      -ENYG-E--SSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
A0A6I0S0M4      -ENYG-E--SSFGKP---VLVTCKPPEEMVSFWLY-NLAIKQMSGD--AALLHLTMNDLS
A0A081PBV5      -PGYK-V--SDFDKP---VIVRKYPREAMVGYYMA-NLKIQQMEED--ASLLQVFVEDSS
A0A1I2AN85      -PGYK-V--SDFDKP---VIVRKYPREAMVGYYMA-NLKIQQMEED--ASLLQVFVEDSS
A0A4U0GMP3      -DAYS-L--AAFTNE---IRVSKNPREAMVGYFMG-RMNIRQMEDD--AALLQISMEDNS
A0A1H6CKR6      -PESKYR--VNVSEP---IQVSKTPIDAMVGYFLS-NLEIVQM-ED--VAILQMTMEDTS
A0A235E1C0      -SDKKFR--VNLSED---ITITKSPIESMVGYFLG-NLDIVQM-ED--VEILKMTLEDAS
R6D982          -ENYD-S--SCWGKP---VKVSKQAREKMVYFFLS-NLSIKQVNGD--VALLNIMMDDFS
A0A1F0I8C4      -ENYG-G--DWMERA---VKVISHPQEDMVSFWLS-NLTIRQMSGD--AALLRITMDDWS
A0A3A5RIJ2      -ENYG-G--DWMERA---VKVISHPQEDMVSFWLS-NLTIRQMSGD--AALLRITMDDWS
A0A515IZJ5      -ENYG-G--DWMERA---VKVISHPQEDMVSFWLS-NLTIRQMSGD--AALLRITMDDWS
A0A5M5NLR3      -ENYG-G--DWMERA---VKVISHPQEDMVSFWLS-NLTIRQMSGD--AALLRITMDDWS
A0A0D5BSQ0      -KFYK-K--DYYGTE---IQVTKSPRESMTGYFVG-NLVVKQMEED--TSLLQITLSDNS
A0A1T3F6P5      -RYYK-K--DYYGVE---IQVVKSPRESVMGNFVG-NLSIKQMEEE--ASLLQVTITDDS
A0A0W8EPA0      -KYYK-K--DYYGVE---IQVTKFPREAVMGNFVG-NLSIKQMEEE--ASLLQVTISDDS
A0A365UKN1      -KYYT-K--DYYEVE---IQVAKLPREAVMGSFVG-NLTINQIEEE--ASLLQLTIKDDS
A0A4R6WE41      -SHYL-P--GSFGKS---IRVEKFAREYMVNFFLS-NLKIKQMEDD--AFLLQMHLEDRS
A0A2T5RP38      -KYYH-K--DNYGES---ILVTKYPREEMMLGLMG-NLKVKQMEED--ASLLQVSLDDLS
A0A1A6CF06      -KFYN-K--DYYGKD---IQVTKSPREAVMGYFIA-NLKIKQMDED--TSLLQVSIEDVS
A0A1T3D6S8      -KFYS-K--DYYGKD---IQVTKLPREAVMGYFIA-NLKIKQMDED--TSLLQVSMDDVS
A0A1P8E011      -LKPN-K--ALPQQE---VKVEKFALEGMVNYFIS-TISITQMEED--ASLLQIVAEDTN
A0A1V3N3U3      -KFYK-A--GVFGEE---IQVRKYDREDIVGYFLG-NLKITQLEED--ASLLQIVIEDQN
C2FUH6          -KQFT-A--STVGED---IQVTKYAHEAMVGYIMG-NLKIQQMEED--ASLLQITLEDQS
A0A0B8T471      -AKFT-S--SYYGEQ---VTVSKNAMESMVGYFLS-RMRIEQMEDD--ASLLQMSLEDVS
A0A4R7D2K0      -KHFT-P--SYYGEQ---VTVSKNAMESVVGYFLS-RMRIEQMEDD--ASLLQMSLEDVS
A0A2X2J8S4      -PYYT-K--AAYDQE---ISVNKLSSIDMANALLG-RLSITQTTDD--ASLLQIAMEDSN
A0A3C0S618      -PYYT-K--AAYDQE---ISVNKLSSIDMANALLG-RLSITQTTDD--ASLLQIAMEDSN
A0A4P7DRF9      -PNLNYR--KSSDEQ---ITITKSPIDAMVGYFLG-KLQIRQ-LED--VELLQVTMEDSN
A0A239XXC4      -SDKSYR--VNLSEQ---ITITKNPIESMVSYFLG-NLKILQ-MED--VEILQMTLEDAS
A0A4U9K473      -PDKKYR--VNLTED---ITITKTPINAMVGYFLG-NLKITQ-MED--VEVLQMTMEDSS
A0A3M1Y2F5      ------------------------------------------------------------
A0A7C7CKY6      -----------NQFQENPYFFTFNNVHYVINHYQQ-SLDIRLLNQA--AKTIEVTLRDKN
A0A1G1TG88      ----------GPASLAAKYHFTIQDQGTVNAYLEK-NLAVDISSAD--ANTIQISFTDFN
A0A661XXA6      FEFNMVLSPSWNSSMGTEFYFIIRSHDALMDYIEA-NLSVEPVNVE--ANIFKVSFKDYN
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A6L3FBV2      ------------------------------------------------------------
A0A6L3FIH8      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      ------------------------------------------------------------
A0A2P8G5K0      -----------------------------------------------------MSVQDVL
A0A4Q3SEI4      ---------------------------------SD-NIRATPAGKL--STVINLTMNDEV
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3D4CJE1      -----------------------------------------------------IAFQSAN
A0A7C7LI79      ------------------------------------------------------------
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      PALQPAPAAASWPPNEPDTRGAALE-------LDL-DLSEAPHLTL--SDLPPVPVTPPP
A0A519TAP8      LLVDSVPGRALPVGDDPQYHFVILNDGAVINYLDK-NLDVTVVNPS--ANTIQISFTDNN
R5DEG6          -MVVVPSLYYGDKYFNTTVQVTKSPLQNVALRFQS-GLQATLASKT--ATIINLTLQDVS
A0A3N2LCI3      ------------------------------------------------------------
A0A6L6NZ03      ------------------------------------------------------------
A0A642EJV3      -------------------------------SCSS-NLSVSLNSEK--ASVIDLSFKDNS
A0A6H9Q899      ------------------------------------------------------------
A0A6L4ENN1      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A519SD85      IYLSADILNAILASYLKFDKDQREISLTQTSKFITSLSDQLS-LKTIASSVALQKFKEVD
A0A3M1TXY5      VSMQNQFINTLLNTYIQNDLEKQREIGRKMLMLIDEQLTGVT-DSLRKAEFSLRGFRAGT
A0A2E0VQ27      PEKAQTFVNTLMKTYIEEGRKSREQQVAETLEYLEKQLEVVK-KRLGDAEAGLAGYRSEN
R6U429          PSRADNILSTLIDVYNEQWVEDKNRSARNTTAFINDRLVVIE-KELGGVEEHLKDYKAEH
A0A5C8AF42      PQLCHDISLAVAEAFIEYDEEVKRKGSENILQFIDQQLDSLA-GELKSSKDSLMLYQRQS
A0A239K409      PERGRDVINKLMQDYREEELEGKNLIAASTIKLIDDRLNGLS-AELIEIEKDVEQYKRQN
A0A1V5S1J9      PERDCDFLNGLCEEFLADNLARKNDAAIKTIEFIDEQLSTIA-DSLRISEGRLKDYKANN
A0A0A2EYC8      PIRDVDFLSKHAKSFLDDNLDKKNYEADKTIQFINDQLSVIS-DSLSRSESNLNSFKIAN
A0A2G6H6Y4      PARDIDFLNQHSKSFLSNNLDRKNSEAEKTIHFINDQLSNVS-DSLSRSEAKLNSYKIEH
A0A1M3DPL8      PRRDVDFINKLCDIYLMSNLERKNDAATKTIQFIDEQLENVS-KSLATSEDNLSDFRKRN
A0A1V5F519      PDRDVDFINKLSEIYLEENLKKKNDVASKTIQFINEQLSEVS-KSLSVSEDEMTRFRRDN
A0A2G6R1T9      PQRDVDFINKLFEVYLANNLERKNEQARKTIKFIDEQLTGIK-QTLKGSENDITEFRRSN
A0A350V3E4      PQEAALISNCYAEAYADYSMKFNRGHLTLNREFLEKQVQEKY-NSLLQTEDKLTNFLRTE
A0A6J4K208      PDKEAAFLNGLLRVHLREGQERQHRQHRDVIAWIDRQLGLDG-GDAAEAPEPVPAEALPQ
A0A1M6MYT6      VRKGMAFLNKLTEVYQLDNLEKKNENANRTIQFINSQLASIS-DSLSVSESRMEDFQSEH
A0A2P8CDS1      PQKGIDFLNEMMQVYQTHNLDKKNIIATKTIFFITSQLANVS-DSLSASQKIRERFQSRN
A0A353WYK7      KYKAQDILMAIDTLYIYYTQLEKNRVNDQKIKFLNEQLHQTE-STLSELENYFENFTIDN
A0A355BP94      PLKVYTVVNKIDSVYLYYSNEQKNQANRQKIDWLNQELHQVE-NKMEGFENYFEDFTLKN
A0A136LSC7      AHKAYDVVNKIDSLYIVYSNQQKNLANKQKIEWLNNELVQVE-EKMEGYENYFESFTLQN
A0A5C7N8Q5      ALKAYDVVNKIDSLYIIYSNQQKNLANKQKIDWLNNELVQVE-RKMEGYEDYFESFTLQN
A0A2W4RDE8      PQKGVDFINAVMRVYLDNELYKKNQLGLRTIAFIDEQLMGVS-DSLRRVEGTLESFRARS
A0A0L8VEV2      PQKGADYLNELSRVYLAYELREKNHTSATTIDFIDSQLKDVI-DTLQVAGNKFTSFRSQN
A0A1I2A9Z9      PQKAADYLNELSRVYLTYELREKNHASATTIDFIDSQLKDVI-DTLKVAGNNFTSFRSRN
A0A212J9Z9      PAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLIN-DSLDISRFKLERFQKET
F5IV23          PAKDVDYLNVLLKEFENYNLALKNEQAELTIEFLDNQLKLIN-DSLDISRFKLEKFQKET
F8X2T0          PAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVIN-DSLNISRLKLEQFQKET
A0A1M3LAG1      PAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVIN-DSLNISRLKLERFQKET
A0A212K6G4      PAKDMDYLKALLDKFQDYNLALKNQQADLTIKFLDAQITVIN-DSLNISRLKLERFQKET
A0A4Y9IPG7      PAKDMDYLKALLDEFQDYNLALKNQQADLTIKFLDAQITVIN-DSLNISRLKLERFQKET
A0A2V3PNY7      PAQDVDFLRALLQEFEEYNLTLKNEAADRTIAFIDKQMGIIA-DSLQQSEIIFKDFQDET
A0A6G7WQ31      PAQDVDFLRALLKEFEDYNLTLKNEAADRTIAFIDRQMGIIA-DSLQQSEASFKDFQDET
A0A6G7X5K8      PAQDVDFLRALLKEFEDYNLTLKNEAADRTIAFIDRQMGIIA-DSLQQSEASFKDFQDET
A0A1M5DFS8      PAQDVDFLKALLKEFEEYNLTLKNEAADRTIAFIDRQMTLIS-DSLEQSEQTFKTFQDET
A0A4Y8KZS5      PLQDVDFLRALLKEFEDYNLTLKNEAADRTIAFIDRQMALIS-DSLQQSETTFKRFQDET
A0A142HHS5      RFKAQRIVNALDTVYRDVKLAYKQETTENSLAYLDKQLEENG-QNLAKAEDNLKIFVQQN
A0A660LQT8      QERAEDVLRMLIDAYNEAWLADKNQIAVNTSKFINERLQVIE-NELGNVDKNISSYKSAN
A0A2M6GH67      PRKAQDIINRVDSAYLVQKLLVKNQATQQQLKFLDEQIQATK-DDVTRYEKAMQDFAIQN
A0A389LWV6      TQRDIDFLKILNQEFFDDNLKRKNATAERAIEFINEQLLILK-DSISSAESKLNAYQSQA
A0A1G9B1T9      VEKELMFLNSLMETYIEDEVKNKNLLGLRTINFIDKQIATVA-DSLSQVEQSLRSFRDRT
A0A350PNH9      TQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIE-RELGDVDKDISSFKSRN
A0A354LNT9      TQRAEDVLNTIISVYRKNWMEDKNQMTVSTSHFITERLGVIE-RELGDVDKDISSFKSRN
A0A161LWY6      YQRDIDFLNALCDEFLLDNLNRKNEEANRTISFIDKQLSDIS-DSLRTSESHLQHFRKAN
A0A6I3N9U6      YQRDIDFLNALCDEFLLDNLNRKNEEANRTISFIDKQLSDIS-DSLKTSESHLQHFRKAN
A0A3D0FMX4      PERDKEFIDKLCDIYLLQSLERKNKVAESTIQFIDQQLDTIR-KSLASSESAMTDFRKRN
A0A1M3MEI8      PARDVDFINKLCEVYLISNLERKNDAASKTITFIDKQLESVA-EELSMSEDEFTSFRRRN
A0A1J5HQM0      PERDIDYINKHVTMSLLQNLERKNDAANKTINFIDEQLQNVS-KSLTVSQGEMTDFRQRN
A0A653AC35      PQRDIDFLNKLSELFLAENLERKNDAANKTMRFIDEQLSDVK-KSLEASEGAMTQFRQSN
E4T131          PDRDIDFINKLCETFLADNLSRKNDAANKTIQFIDEQLKGVS-KSLTTSESQMTNFRQSN
A0A521H707      SQKASDFVNTMVDEFNRYDKERKSEGADKSLQFIDETVLGID-TQLRLSEYSVEAFKKEH
A0A1F3D6P8      IEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEIS-DSLVISESKLRNYRSAN
A0A356Z058      IEKIVSFLNRYTDAILEENLAKKNKIALSTIKFIDSQISEIS-DSLVISESKLRNYRSAN
A0A3D1BT36      LDLTVDFLNTFLQTYLDNNLSKKNTIALNTVNFIDSQISEIS-ESLSSSQSELRDYRSTH
A0A5R9QZP0      LDLTVDFLNNYLQTYLNDNLSKKNNVAFNTINFIDAQISDIS-DSLVKSESELRNFKASN
A0A3D3HL11      RRLTIDFLNKFIQSYLDENLAKKNKIAINTIDFIDSQISEIS-DSLTQSESKLRDYRSAN
A0A6L8U6G9      RRLTIDFLNNFIQAYLDDNLSKKNKIALNTIDFIDSQISEIS-DSLTISESKLRDYRSAH
A0A352ME00      LDKTINFLNRYLSTFLEGNLAKKNNMASKTVNFIDSQVSDMA-DSLVRSESALKNYRSAN
A0A6L8UH35      LEKTIKFLNQYLNSFLDDNLGKKNKIALSTVNFIDSQISEIS-DSLNISESQLRNYRAAN
A0A2W7RD29      PAKGEDFLNQLMNNYLFIELDDKNSIATNTINFISNQIQNVS-DTLGVIENELQNFRAAN
A0A3N2NDY8      TQRAVDVLNEIVAVYNDNWVYDKNRVAVATSSFIDDRLRLIE-RELGNVDNEIFDFKRDH
D7JEV9          PLRDVDFLTRHAQSFLDDNLDKKNYEADKTIQFINDQLGIIS-DSLSRSESNLNSFKVAN
A0A4R6H3B7      PQKAADYLNELSSVYLTYELREKNHASATTIDFIDSQLKDVI-DTLKVAGNNFTSFRSRN
A0A3P1Z8V4      KHRAEDVLNEVCNIYKKDIVDNKNRVAQRTAEFIDERLTLIS-RELSDVEHRLATFKQNN
A0A2W7QSQ0      PEMGKQIMSSVIEGYNQRIINQKNETALKTINFINERLGIVK-NDLEEFEKSGENFKTRN
R7F6L5          PYRCEDVLNGVVQAYNDQWINDKKAIADATSDFISERLSVIE-QELGNVDSDISSYKART
A0A7C5MRV2      AKFASDFLNTLMKVYEKEDISRKQQAATQALDFIAEQLDTIK-SSVNSAEQILQEFKQDK
A0A553GA49      FNMGKEFLDKYIETVIEYDLQRKNHIAFSTIDFIDDHLSDVF-DSLSIAEQSLQDFKTDQ
A0A497D6F6      VAKGIDFLNTLVAVYQAYTLERKNENASRTINFISTQLQTVS-DSLGISENAMQAFQSKH
A0A5M4AAB9      TEKGIAFLDMLMRVYQEHNLKKKNTIATKTIFFITSQLSEVR-DSLKASQKIRERFQSNN
F4KR18          PQRGIDIVNRLVDKFNQLKSEVNTEITLKTLELIDGRLANIS-AELASAESTVESYKLNN
A0A229I3A5      AKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIE-RELGDVDKNISAFKSSN
A0A3R6HJB3      AKRAEDVINNIIIVYRKNWLEDKNQMTISTSHFITERLGVIE-RVLGDVDKNISTFKSSN
R6NN15          IQRAEDILNTVIAVYNENWIKDKNQIAVSTSMFINDRLGVIE-SELGHVDENISTFKSEN
C9LKL0          IARATDIINTLFSCYKQDVVDNKNRVGQNTAHFIDERLSLIG-SELAGVEGRLASLKESN
A0A3D0QPV7      KAIAHDIVYAITHAFNEFALERKNESSKKILDFIDSQIDTVY-TKLKNSELELQAFRQLN
A0A496KT23      TARAKDAIDMLISVYNENWVRDRNQISVSTNEFIKERLAVIQ-RELGSVDQNIAGYKSAN
L1M9T3          TARAKDAIDMLISVYNENWVKDRNQISVSTNEFIKERLSVIQ-RELGNVDQNIAGYKSAN
A0A3C0I8F1      AEKVRDIVNVIDTVYLEKTLAAKSQATLQQTNYLNEQLEKVD-EELTKYESLLEGSLIEN
R5JJI4          TARAEDILNMLIAVYNEDVINDKNQIAVNTSKFINDRLIIIE-RELGSVDANIESFKREN
A0A0A2DQN2      KQKATDLLGALVEAYNEEVNTLRTQISVNTTEFINNRLISLE-EELESMENNREELLIEN
A0A0A2F2N5      KQRATDLLEAIVDAYNTETSSVRNQIAVNTARFINERIANLS-EELDALASNIDSFQRAN
L1NGW4          KQRALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLS-KELGIVENEMESFLVTN
Z4WRA0          KQRALDILTAQVAAYNQEEVEMRSQISVNTANFVNERIAVLS-KELGIVENEMESFLVTN
U2K8K9          LKRALDILAAQVMAYNQEEVEMRNQVSKNTAEFVNERLEALS-RELGVVEQDMTRFSARN
A0A069ZM60      KKRALDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALG-KELGLVEGDMERFLMNN
J6GV98          KKRALDILLAQVSAYNQEEMDMRNQVSKNTADFVNERLAALG-KELGLVEGDMERFLMNN
A0A134B4F8      KKRALDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALG-KELGLVEGDMERFLMNN
A0A134B8C7      KKRALDILLAQVSAYNQEELDMRNQVSKNTADFVNERLAALG-KELGLVEGDMERFLMNN
A0A3D2HF71      PEQEADYLNKLMDVYIEFGLENKNRTADQTIDFIEKQLAIIS-DSLHLAENSLESFRLAN
A0A4Z0EKR0      AGKAKDVLNKLMDVYNREAIEEKNLTTANTLKFLDDRLEKLA-YGLSGTEKVVEKFKSAN
B5CTK0          VARADDVLNTLIAVYNEDLINDKNQIAINTSNFISERLNIIE-KELGNVDSNIETFKRQN
A0A1M6B6D5      KAKLVDYLNMSVQVLSEDMLERKNLFATKTIRFIDSSLAEKS-IELSLVEDELNDFRRNN
A0A451FS66      KAKLVDYLNTSIQILSEDMLERKNLYATKTIQFIDSSLAKKS-AELNSVQDELNKFRNKS
A0A2E3GN39      KSKAALTVELLMEAFMDFHLDQKMESLEQSISFLDKQIDSIK-PLYDDALIAVRNAEAQK
A0A3D1MEL0      KSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLDQQIDSIK-PLYDDALIAVRNAEAQK
A0A519UDD1      PAKAKDILNKLMEVYNKEAIEDKNLLATNTLRFLDDRLAYLT-SDLSSVEKLVEQYKSTK
A0A2A4N9A6      PAKAADFLNNLVQSYMEYGLDKRKESIINSANFIEDQLQKIEIQLLNSTNKLMNINLDTK
A0A6C0GGI1      AAKEAKFLDTLISVYLETDLIEKQEANIKAIAFINSQLSTVA-NQLENS------KQALE
A0A368D1N7      KSKAALTVELLMEAFMDFHLDQKMESLEQSIAFLDQQIDSIK-PLYDGALIAVRNAEAQK
A0A3B8TU58      KAKALVMVDLLIESFLNFHLYQKTESIKQSISFLDEQIDSIK-PLYDEALVAVRNAEAQK
A0A1T5IIR6      AQRAADIINMLVVKYNEAAIREKNRVAVHTEDFINERLAIIE-EELGGVEGELARFKSSN
F0R0C9          IQRAEDVLNTVIAVYNENWVKDKNQIAVSTSMFINERLGVIE-GELGNVDENISSYKSEH
A0A6L6NXQ0      IPRAEDVLNTVITVYNEEWMKDKNQITVSTSRFISERLEALE-HELGKVDSDISTYKSEN
A0A6N8DCX3      IPRAEDVLNTVITVYNEEWMKDKNQITVSTSRFISERLEALE-HELGKVDSDISTYKSEN
A0A3E0QD27      AVKASDFVNSIMDEFNEYDRERKSEGAIKSLDFINETVAGID-VELRASEGSLEQFKKDN
A0A0M1W1I6      TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENELQSYKQNN
A0A4R4GHU2      TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENELQSYKQNN
I8WPR6          TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENELQSYKQNN
A0A0K2HKS3      TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENELQSYKQNN
B6W3W8          TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENELQSYKQNN
A0A4R4GSI6      TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENELQSYKQNN
A0A076IRY8      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENELQSYKQNN
A0A3A6AD54      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENELQSYKQNN
A0A3A6MIU7      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENELQSYKQNN
I8WPP8          TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENELQSYKQNN
A0A372Y7D2      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENELQSYKQNN
A0A3E4JJC9      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENELQSYKQNN
A0A3E4WDQ0      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENELQSYKQNN
A0A414H9P2      TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENELQSYKQNN
C3R5A8          TARAEDVLNMLITVYNEETIKDKNQIAINTSSFINERLVIIE-KELGGVENELQSYKQNN
A0A1C5XJA7      SERAEDILNMLVNVYNEETIRDKNQVAVNTANFINERLIIIG-QELGDVESDLESFKREN
A0A285T4L1      PLRAEDVLNTLVNVYNEEALNDKNQVAVNTSEFINERLLIIE-RELGGVETELEAFKQSN
A0A3E5BU42      PLRAEDVLNTLVNVYNEEALNDKNQVAVNTSEFINERLLIIE-RELGGVETELEAFKQSN
R7CUW4          PVRAEDVLNMLITVYNEEAIKDKNQVAVNTANFINERLIIIE-RELGGVESDLESFKRSN
A0A416GGJ1      PERAEELLNTMINVYNEEAIEDKNQVAINTANFINERLIIIE-KDLGVVESDLETFKSSN
D1JY72          TARAEDVLNMLITVYNEETIKDKNQIAINTSNFINERLVIIE-KELGGVENELQSYKQNN
D7J4K6          PLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIE-RELGGVETELESFKQHN
Q8ABP9          PLRAEDVLNTLVNVYNAEAVNDKNQVAVNTSEFINERLLIIE-RELGGVETELESFKQHN
A0A5M6AHF7      PLRAEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIE-RELGGVETELESFKQHN
A0A6L4IA73      PLRAEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIE-RELGGVETELESFKQHN
D6D2Z5          PLRAEDVLNTLVNVYNEEAVNDKNQVAVNTSEFINERLLIIE-RELGGVETELESFKQHN
A0A1T3EDR4      SKRGVSFLKSLVAVYNALYLDDKKRIAQSTGEFIADRLKIVE-GELSGVEQKIEDFKLSN
A0A174SDD8      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDIEDLKKAN
A0A1H7RFH3      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDIEDLKRAN
A0A139L1N2      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDIEDLKRAN
A0A174TVL8      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDIEDLKRAN
A0A1H8BJR6      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDIEDLKRAN
R9H6G0          PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDIEDLKRAN
A0A412GR09      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDIEDLKRAN
A0A6I0S0M4      PTRAADILDMLITIYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDIEDLKRAN
A0A081PBV5      LQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQ-SELGSVESNLENLKVSN
A0A1I2AN85      LQRADDLITTLITVYNEDAVEDKNKVAINTAQFIMDRIQIIQ-SELGSVESNLENLKVSN
A0A4U0GMP3      PRRAEDVITMLITVYNEEAIDDKNRIAVNTADFIRERIDIIE-SELGLVESDLERLRIAN
A0A1H6CKR6      PMRAAEMITNLITVYNNMTINDKKALGDTTANFIRDRIAIIE-TELSGVESQIEGMKTSN
A0A235E1C0      PLRAEDMVTKLIEVYNQMTIEDKKTVANNTADFINDRIVIIE-KELSSVESSLEGMKTQN
R6D982          PLRAGDVLNMLITVYNEEAIEDKNRIAVNAAQFIRERIEIIE-DELGSVETDIEVMRKES
A0A1F0I8C4      PVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDIEDLKRAN
A0A3A5RIJ2      PVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDIEDLKRAN
A0A515IZJ5      PVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDIEDLKRAN
A0A5M5NLR3      PVRAADILDMLITVYNEEAIKDKNRIAVNTAEFIKERLQIIE-HELGSVETDIEDLKRAN
A0A0D5BSQ0      SERASDILTLLVQVYNEVYLQDKNKIAVNTAKFIKDRLVIIE-AELGAVESNIENLKVAN
A0A1T3F6P5      PERAADILTSLIIVYNEVYLQDKGKIAENTANFIKDRLAIIE-GELGAVESNVENLKVAN
A0A0W8EPA0      PDRAADILTSLITVYNDVYLQDKGKIAENTANFIKDRLAIIE-GELGAVESNVENLKVAN
A0A365UKN1      PERAADILTSLITVYNDVFLQDKGKIAENTANFIKDRLAIIE-GELGAVESNVENLKVAN
A0A4R6WE41      ARRAGDILTELITVYNRTALEDLNQTAVNTADFIKNRLQIIE-EELYEVETDIEKLKVNN
A0A2T5RP38      SERADDILGTLIKMYNEIYLQDKNKIAVNTANFIKDRLAIIE-SELGAVEANIENLKIDN
A0A1A6CF06      SDRADDMLTTLINVYNEVYLQDKNKIAVNTADFIKERLAIIE-GELGAVESNIENLKIAN
A0A1T3D6S8      SDRADDMLTTLINVYNEVYLQDKNKIAINTADFIKERLAIIE-GELGAVESNIENLKIAN
A0A1P8E011      PLRATALIAEMINVYNEVALQDKNQIGVNTANFIRERLAIIE-QELGSVESSIEDLRTQN
A0A1V3N3U3      PQRAAALIAEMITVYNEISLKDKNQIGVNTANFIKERLAIIQ-QELGSVESNIEQLRQSN
C2FUH6          IKRANDIITTLITVYNEFSLEDKNQIAINTAQFIRERLQIIE-SELGNVENNIEQLKTAN
A0A0B8T471      AERAADMLSTLVTVYNKETVEDKNRVAKNSAEFIKERIAIIE-TELGGVETDLEQMKARN
A0A4R7D2K0      AERAADMLSTLVSVYNQETVEDKNRVAKNSAEFIKDRIAIIE-DELGGVETDLEQMKARN
A0A2X2J8S4      PQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILS-EELGSVEGDLEKIKVNN
A0A3C0S618      PQRAADIINNLIRIYNINSINDKNQIARNTADFINNRVAILS-EELGSVEGDLEKIKINN
A0A4P7DRF9      PLRAADMITKLIKVYNVMTIKDKNMIAHNTADFIRDRIAIIE-EELSSVESDIEGMKIQN
A0A239XXC4      PLRAEDMITKLIEVYNQMTIEDKKTVANNTADFINDRIVIIE-KELSSVESSLEGMKTQN
A0A4U9K473      PMRAEEMISKLIEVYNEMTVQDKKKIANNTANFINDRLVIIE-KELSSVESDLEGMKTQN
A0A3M1Y2F5      ------------------------------------------------------------
A0A7C7CKY6      SKKASDIVNAIAEEFINYDILKKAKSANKVLTFIDDQLGIVY-DKLRTSENKMQSFKKQN
A0A1G1TG88      PRKAQRIVNKVDTVYQRAKVLREQENTARTLRYLDQQLEVNY-DNLERAENRYQGFVEQT
A0A661XXA6      VNKAHALISAIDTLYYKYSLNEKNRANKNKIEYLNTQLTETE-NKLDDFEKYFEDVTISN
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A6L3FBV2      ------------------------------------------------------------
A0A6L3FIH8      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      -------MKQLISRYQKASIGEKNKVADNTIAFINANLARIS-SELVQVETRIEHFRKRH
A0A2P8G5K0      PRKGEAILNQLIARYQKASIGEKNKVADNTIAFINNNLARIS-SELALVETNIEHFRKRH
A0A4Q3SEI4      PERGENILDNLLTVYNKAAISDKNVMSSNTLDFVEERIRFVV-KELDSIETKLQNYRTKT
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ------------------------------------------------------------
A0A519SYE7      ------------------------------------------------------------
A0A7C7CFR2      ------------------------------------------------------------
A0A3D4CJE1      ARKAHDIVTALANEFTKYDIEERSKSSRNVLGFIDKQLDKYY-NKLKVSENKLQKFQKEN
A0A7C7LI79      ----------IAQEFIDYDIKKKAKSANKVLAFIDEQLTLVY-EKLRTSENKMQSFNKQN
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      PAGQA-------------------------------------------------------
A0A519TAP8      PEKAAHIINNIDTVYLQEKLDRKKQSSALSLEFIDQVIADND-KRWRAAEEAHTEFVRRN
R5DEG6          IPRAEDVINTLISVYNTDAINDKNQIVMNTSNFINDRLIVIE-KELGDVDSDIESYKREH
A0A3N2LCI3      ------------------------------------------------------------
A0A6L6NZ03      --------------------------------------------ELGNVDDDISSFKSEH
A0A642EJV3      TQRAEDVLSMLISVYNENWVKDKNQIAVSTSMFINERLGVIE-RELGNVDEDISSYKSEH
A0A6H9Q899      ------------------------------------------------------------
A0A6L4ENN1      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A519SD85      NDIISPLAISHN-----VKAYS----DLNEELKRISIAEQTLKFVYKDLTKGIPD-----
A0A3M1TXY5      NIVDIGVTSKDL-----TDQLT----ELERQRAALAVAGQYYEYVLED-IQADNS---LA
A0A2E0VQ27      QLINSTQETDAV-----LRELT----QLNLQKVDLDMKTSELKRLQEY-LLSGNS---LS
R6U429          NITDIQSLSAAY-----LGEST----EYKSMSFEVNNQLAIAKFIKEY-LENPAH---DG
A0A5C8AF42      NLPDPEAVGTTI-----SENIS----KLQDQQFEIDEEIRSLNLVSSK-LKSDPNRLEIY
A0A239K409      KLADVASQSKVY-----VEESN----TYQKQLAEWSVQIDVLETIETY-ISNSKENSYR-
A0A1V5S1J9      FVVA-SVGGSNL-----MGQYT----QLDAMQTDLRLKESYLNYLTNY-LKSNVE---EG
A0A0A2EYC8      KMYG-QNNSILL-----TNKME----ALEEQGKIIKLRDEYFKYLRNY-LKNNID---SE
A0A2G6H6Y4      KIYS-SDMTSVL-----VGQME----KLKNQGKQIKLRDEYFKYIKRY-LNKNIQ---TE
A0A1M3DPL8      QLINVSSLTDEL-----LSKAA----SFDEELNQIRLKETYIAYVEKY-IQTNLN---EG
A0A1V5F519      QIIDISSHGSEL-----MSKAN----SLDEKKAELKLKETYLNYLTKY-LTGNFE---EG
A0A2G6R1T9      QIVDITTHTSEI-----VEKST----EYNERKSALRLKEKYLNYLADY-IKTNLS---SG
A0A350V3E4      NVVELNAQANSI-----ISSLSGIEGDYNRSLIDVQSTTRALTDIKGELDKYDPK---AT
A0A6J4K208      PRPGEGLRDALL-----------------AERERARNRVQLYEGLLQS-LGRENEMI---
A0A1M6MYT6      QIVNISAQSEQL-----LERMR----ELDQERIAMETQNKYYHYLRDY-INTTASRELET
A0A2P8CDS1      NLLDVSYQSQQL-----LDQLV----KLEDQKSLLETQHQYYQYLETY-LSRNDN--LQS
A0A353WYK7      RTTDMNVSLSRT-----ITMLE----ELDSIKMKLNDQLDNFNEIYDKLLDTADL---QL
A0A355BP94      KSSDLTTELRQT-----IYALN----QVDSQRFSLNKRILELNGYIEE-LSTGKL---VQ
A0A136LSC7      KSSDLTLDLKKT-----IAAIN----VVDSQRYSLNKQLAELNTLIDQ-ITASDF---AN
A0A5C7N8Q5      KSSDLTLDLKNT-----IATIN----RVDSQRFNLNKRLIELNALIEH-ITTEDF---SS
A0A2W4RDE8      NVIDIRTSAQTL-----TNNLD----KLETERANLEVKLKYYQYILQS-LQSGKN---TD
A0A0L8VEV2      QIVDIGQEGGII-----VQRLV----DLDKERSLAQSHLDYYRNLQKY-LSDTEK---MQ
A0A1I2A9Z9      QIVDMSQEGGII-----VQRLV----DLDTERSMIQSHLDYYKNLQQY-LDDTEK---MK
A0A212J9Z9      GVYDVSSQSLRI-------ALD----SADREKDALALREKSVLLLTEK-MKEKIL---GT
F5IV23          GVYDVSSQSLRI-------ALD----SADREKDALALREKSVLLLTEK-MKEKIL---GT
F8X2T0          GVYEVSSATVRR-------ELD----VADVDRDQVAMREKTVLFTTQK-IKEGIM---GS
A0A1M3LAG1      GVYEVSSATVRR-------ELD----VADVDRDQVAMREKTVLFTTQK-IKEGIM---GS
A0A212K6G4      GVYEVSSATVRR-------ELD----VADVDRDQVAMREKTVLFTTQK-IKEGIM---GS
A0A4Y9IPG7      GVYEVSSATVRR-------ELD----VADVDRDQVAMREKTVLFTTQK-IKEGIM---GS
A0A2V3PNY7      GLYRITKSDGRV-------ELE----SVMKSIGEVKAQEDLILRLTDE-ISNSIL---NK
A0A6G7WQ31      GLYRLTKTDGRS-------ELE----NVMQSIGEVKAQEDMILRLTDE-INSSIL---NR
A0A6G7X5K8      GLYRLTKTDGRS-------ELE----SVMQSIGEVKAQEDMILRLTDE-INSSIL---NR
A0A1M5DFS8      GLYRIQGGDQRA-------DRD----AVLQGIAENKAQEELILRLTDE-INNSIL---SN
A0A4Y8KZS5      GLYKIEGGDKRL-------ERN----DILTAMAENKAQEDIILRLTDE-IKSSIL---NS
A0A142HHS5      GTYDAKGELGTI-----TNKLE----KIEEDRFKLEQKLTLLADVSQR-AAAER------
A0A660LQT8      LLSDTDEASKLY-----IKKTE----ENTDKMMDLNNQIYMTRYVSQL-ISNDKK---KY
A0A2M6GH67      KTYDVRGEIAKS-----MARLE----ELYKERSDLGLQINLLRDIHNL-VAHDSD---LE
A0A389LWV6      GIFSSDNSLRSS------TELV----DLDKKKAEIRLRKEYTKFLQDN-LKKE-----DG
A0A1G9B1T9      RTVDIGTTARDL-----NTKLD----ELQKTREDLLIDYRSYQNLFQY-LEQNDY---TE
A0A350PNH9      LLPDVETAAQQY-----MQKSG----DVDKQILELNSRLSMARYLRDF-LTGKVG---KN
A0A354LNT9      LLPDVETAAQQY-----MQKSG----DVDKQILELNSRLSMARYLRDF-LTGKVG---KN
A0A161LWY6      QILDLNAYGSTI-----LGHLT----SYDEKRLQYNLKESYLNYLADY-IKKNVN---NQ
A0A6I3N9U6      QILDLNAYGSTI-----LGHLT----SYDEKRLQYNLKESYLNYLTDY-IKKNVN---NQ
A0A3D0FMX4      EIVDIQSYSSEL-----LGKVN----AYDQERLAMRLKETYFEYLTNY-LNTTME---QG
A0A1M3MEI8      QIIDVGSFSGDL-----LSKAA----AYDTEINQLKLKESYLDYLVKY-VKTNLQ---DG
A0A1J5HQM0      QIINVDTHAGEL-----LGKSN----SYESQFSTLKLKETYLDYLTKY-LRTNME---DG
A0A653AC35      QIVDMSSHSTEV-----LGKAT----AYDEKQNELQLRESYFNYLTDY-LKTNLE---AG
E4T131          KIVDVSSHTSDL-----LGKAT----KYDGQQAELKLREDYLTYLTKY-LKTNLE---DG
A0A521H707      LIIDPLQNAEDA-----LAHIN----LLIDQRIEVQLQLAVLQRIEKN-INSDEN---TE
A0A1F3D6P8      QVMDLSFQGKSL-----YEKLE----QIETERANLQIQERYYNYIINN-FKSSND---MS
A0A356Z058      QVMDLSFQGKSL-----YEKLE----QIETERANLQIQERYYNYIINN-FKSSND---MS
A0A3D1BT36      QVTDLSYQGQQA-----LNQME----QIDNEKATLQAQQRYYNYIIDY-FNNNQD---IA
A0A5R9QZP0      QVTDLSYQGQQA-----LTQIT----AVDNEISSLNVQEKYYNYILDY-FDQNQD---IT
A0A3D3HL11      QVTDLSYQGQQA-----LEQMR----QIENERSMLQVQERYYNYILDY-FDKNQD---MT
A0A6L8U6G9      QVTDLSYQGQQA-----LEAMR----EIENERTTLQVQERYYNYVLDY-MEKNQD---MS
A0A352ME00      QVMDLSFQGQRV-----YEQMT----DIDNERANLKVQERYYNYVINY-FKMNAD---VS
A0A6L8UH35      QVMDLSFQGQQT-----FEQMT----LIQQERATLQLQQRYYNYVINY-FKANQD---MA
A0A2W7RD29      QTTNISSEGEVI-----FGRLQ----SMGEELAKEKIKKEYLLSLDRY-LRNNDF---DN
A0A3N2NDY8      RVPNLEEAAKTQ-----MKQSV----EMSNKMLEVTNQMSMSIYLRDY-LNNPGN---AK
D7JEV9          KMYGQNNTSIL------TERME----SLENQGKQIRLRDEYFKYLRNY-LKNNID---NE
A0A4R6H3B7      QIVDMSQEGGII-----VQRLV----DLDTERSMIQSHLDYYKNLQQY-LDDTEK---MK
A0A3P1Z8V4      SIVDLTATATAM-----TQQSI----QARQKTIELETELSVASFLADH-LRSSGK---GK
A0A2W7QSQ0      NITDISMNSKIY-----LENTA----ETRKQVAEVSGKIDILESIELT-MNNQSG---QF
R7F6L5          MSPDLEAQAQIN-----MARSS----ELQNQQYDLSNQIQILNYVRGE-LSREG----ID
A0A7C5MRV2      EFISVDLKVGFD-----MESMK----RNAELQSHHVLKLMEINRLSTD-IARGNR---EL
A0A553GA49      QVVDVNLKAGQI-----YENLR----AIGIEKDQLEAHVNNLEFLNEN-FQKDEDFSAHS
A0A497D6F6      KLLNISIQSEQL-----LDQVN----ELEKEKVVLETKNKYYKYLREY-IINNQE---LE
A0A5M4AAB9      QLLDVGYQSQQL-----LDQLV----KLEDQKNLLETQHQYYKYLENY-LLQNGD---LE
F4KR18          DII-----AETT-----TDLSI----TLEDVNNLVKEQRKVELQQKML-QAMKSD---LQ
A0A229I3A5      LLPDVEAAAQQY-----MQKST----EVDKQIMDLNSRLAIAQYIRNY-LTGKVG---KN
A0A3R6HJB3      LLPDVEAAAQQY-----MQKST----EVDKQIMDLNSRLAIAQYIRNY-LTGKVG---KN
R6NN15          LLPDVQAASQLY-----MTERS----QAQSQILTLNTQLSMARYIRNY-LTAASS---RN
C9LKL0          RIVDFKTAADQY-----SSMSV----TARQSSVDLQSQVSVARYLKDF-MQNNSN---KH
A0A3D0QPV7      KVQNFEGVSKNY-----LERLT----ELEGQLLKVDIDEELIIEVERA-LKEYHNESDIY
A0A496KT23      LLPDVEQSGNMA-----VNQAN----EAEAKARELSTQVYMTRHVKEY-LTDGRH---EN
L1M9T3          LLPDVEQSGSMA-----MAQAN----DAEIKARELSTQTYMTRHVREY-LTDGRH---EN
A0A3C0I8F1      KTTDLLSKFSTS-----VKESE----NFGEKKAEITNLLNLLDQLEVQ-AQNDSI---IT
R5JJI4          QLTDITSETGMY-----LQNTS----RYKQEGLSLENQLSIVKYIKEY-LVDPQK---GS
A0A0A2DQN2      QFINPASLAESY-----MNRTQ----TNQNGRIELEAQERLIAYMQSY-LKDASK---TN
A0A0A2F2N5      NFIAPEVVAGAY-----TSRAQ----TGHEASFEIDAQKRLARYFLDF-INNPSK---RS
L1NGW4          RTLDFDAKMGRY-----NTRSV----DYEVQAMEIETQLKLVSFMLSN-LSSPQK---QT
Z4WRA0          RTLDFDAKMGRY-----NTRSV----DYEVQAMEIETQLKLVSFMLSN-LSSPQK---QT
U2K8K9          KTIDFTSKVESY-----NARSL----EEEDASIKIEKQLKLVSYMLSQ-LNSPSK---RN
A0A069ZM60      RTLDFEGKVGVY-----NSRSL----ESEAEALQIETQLKLISYMLSE-FSNSHR---KN
J6GV98          RTLDFEGKVGVY-----NSRSL----ESEAEALQIETQLKLISYMLSE-FSNSHR---KN
A0A134B4F8      RTLDFEGKVGVY-----NSRSL----ESEAEALQIETQLKLISYMLSE-FSNSHR---KN
A0A134B8C7      RTLDFEGKVGVY-----NSRSL----ESEAEALQIETQLKLISYMLSE-FSNSHR---KN
A0A3D2HF71      RLIDLSREGVAI-----QNRLE----EIDKEKTSLMLQKNYYEYLKDY-IDTKKE---SG
A0A4Z0EKR0      QLTDITTQASNY-----TSQAN----SYDKQLSEWAIQIDVLESIEGY-LEKNAG---NY
B5CTK0          RLTDVNSEASMY-----LASSS----SYQQEGVGIENQLTLAKYIKSY-LTDPSK---NF
A0A1M6B6D5      VIFDLNIEGAEL-----NEKLN----ALDLRKEAAARELDYYNTLQEY-LVTRSDY--RD
A0A451FS66      AVYDLATEGSEL-----NSKLN----ALDLRKEAVNRELNYFITLQEY-LTTRTDY--RD
A0A2E3GN39      GYRNIEALGGGL-----YKDIK----DLQKKLVRIEYVTSVLEWFAVM-IQQEEDLSLAS
A0A3D1MEL0      GYRNIEALGGGL-----YQDVK----ELQKKLVRIEYVTSVLEWFAVM-VQQEEDLSLVS
A0A519UDD1      GLTDVSTQASVY-----TSQAS----TYNTQLSELAIQIDVLESLERY-LVTTAG---RY
A0A2A4N9A6      TIANISRVFQSEGKYIINDNPE----FLIAQKINDLKLEINIIDTVNY-YL--------N
A0A6C0GGI1      GYKRTYGTERGVAKLNAYERLE----ALQLQRSDYTTRLRSLNNTLDY-MIT-------G
A0A368D1N7      GYRNIEALGGGL-----YEDVK----ELQRK----LVRIEYVTSVLEW-FAVMVQ---QE
A0A3B8TU58      GYRNIEALGGGL-----YADVK----NLQQK----LVRLDYLISVLGW-FAVMVE---QE
A0A1T5IIR6      KIMDVDYTANMY-----LGDSR----GYNAEIVAVETKLALSNYLKDH-VVSGAE---SY
F0R0C9          LLPDVQAASNLY-----MAQSS----ETNAQILALNTQLSMARYIRNY-LTAASS---RN
A0A6L6NXQ0      LLPDAEKASMLF-----MEQAQ----ENDNRLIAISTQAAIAKYIREH-LTGGKK---RN
A0A6N8DCX3      LLPDAEKASMLF-----MEQAQ----ENDNRLIAISTQAAIAKYIREH-LTGGKK---RN
A0A3E0QD27      MIIDPRQNASEA-----LTHIN----KLIEQRVEMQLQLAVMNRLERD-ITSDSE---VE
A0A0M1W1I6      DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGY-LVDPSK---ET
A0A4R4GHU2      DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGY-LVDPSK---ET
I8WPR6          DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGY-LVDPSK---ET
A0A0K2HKS3      DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGY-LVDPSK---ET
B6W3W8          DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGY-LVDPSK---ET
A0A4R4GSI6      DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGY-LVDPSK---ET
A0A076IRY8      DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSY-LVDPSK---ET
A0A3A6AD54      DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSY-LVDPSK---ET
A0A3A6MIU7      DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSY-LVDPSK---ET
I8WPP8          DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSY-LVDPSK---ET
A0A372Y7D2      DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSY-LVDPSK---ET
A0A3E4JJC9      DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSY-LVDPSK---ET
A0A3E4WDQ0      DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSY-LVDPSK---ET
A0A414H9P2      DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSY-LVDPSK---ET
C3R5A8          DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKSY-LVDPSK---ET
A0A1C5XJA7      QTLDISSSASMY-----MGESQ----KYNSSALELETQLRLAQYIKEY-LTDPKK---EA
A0A285T4L1      QLMDIGSLAGQY-----MGEAQ----TYSADALEQETQLKLAQFIKEY-LTDPTK---NR
A0A3E5BU42      QLMDIGSLAGQY-----MGEAQ----TYSADALEQETQLKLAQFIKEY-LTDPTK---NR
R7CUW4          QIVDISSAAGMY-----MTESQ----KYNADALELETQLRLANFIKDY-LTDPSK---ET
A0A416GGJ1      QLMDVSSTAGMY-----MSESQ----KYGADGMELETQLRLAQYIKEY-LIDPAK---ET
D1JY72          DIIDIGSAASMS-----MSDKR----QYSSTTQELELQARMARYIKGY-LVDPSK---ET
D7J4K6          QVMDIGSLAGRY-----MGEAQ----AYSADALEQETQLKLARFIKEY-LTDPTK---SR
Q8ABP9          QVMDIGSLAGRY-----MGEAQ----AYSADALEQETQLKLARFIKEY-LTDPTK---SR
A0A5M6AHF7      QVMDIGSLAGRY-----MGEAQ----AYSADALEQETQLKLARFIKEY-LTDPTK---SR
A0A6L4IA73      QVMDIGSLAGRY-----MGEAQ----AYSADALEQETQLKLARFIKEY-LTDPTK---SR
D6D2Z5          QVMDIGSLAGRY-----MGEAQ----AYSADALEQETQLKLARFIKEY-LTDPTK---SR
A0A1T3EDR4      QGMDAQSLKSLS-----LSEQG----ENKSQGMKIDMDISLLEMLSSY-LKDADK---SK
A0A174SDD8      NGVDINMAAGMY-----IQDSR----QYESSIKELDTQLQLVTFIKQY-LQDSSK---DD
A0A1H7RFH3      NGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQY-LQDSSK---ED
A0A139L1N2      NGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQY-LQDSSK---ED
A0A174TVL8      NGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQY-LQDSSK---ED
A0A1H8BJR6      NGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQY-LQDSSK---ED
R9H6G0          NGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQY-LQDSSK---ED
A0A412GR09      NGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQY-LQDSSK---ED
A0A6I0S0M4      NGVDIDMAAGMY-----IQDSR----EYESSIKELDTQLQLVTFIKQY-LQDSSK---ED
A0A081PBV5      QGIDVNAASQMY-----VSEGM----MHESAGNDVQTQLKLVEMMQNY-MRDADK---KD
A0A1I2AN85      QGIDVNAASQMY-----VSEGM----MHESAGNDVQTQLKLVEMMQNY-MRDADK---KD
A0A4U0GMP3      QGLDLASSRQMY-----SSESQ----TYYAEGNAAETQMKLVELMKQY-LEDAER---RN
A0A1H6CKR6      QGLDVKSAGEQY-----WSDSR----GYDASSKEIETQMKLVEIMRQR-LDDPSK---RD
A0A235E1C0      QGLDVKSAGEQY-----WTESR----TYQSSSKELATQMKLVEIMRQR-LSDPSR---VD
R6D982          DWGDINTAASMY-----VSDGR----KYESSLKELDTQLQLVSFIKQY-LQDAAK---ED
A0A1F0I8C4      NGVDINTVAGIY-----IQDSR----QYELLIKELDTQLQLVTFIRQY-LQDSGK---EE
A0A3A5RIJ2      NGVDINTVAGIY-----IQDSR----QYELLIKELDTQLQLVTFIRQY-LQDSGK---EE
A0A515IZJ5      NGVDINTVAGIY-----IQDSR----QYELLIKELDTQLQLVTFIRQY-LQDSGK---EE
A0A5M5NLR3      NGVDINTVAGIY-----IQDSR----QYELLIKELDTQLQLVTFIRQY-LQDSGK---EG
A0A0D5BSQ0      QGIDVETAGSMY-----LAEKN----QYKTDRTKVETDIRLAEMMRSY-LGSRDQ---KN
A0A1T3F6P5      QGIDVATAGGLY-----LNEKN----QYKTEGAKIETDIRLAEMMRSY-LTNRGK---QN
A0A0W8EPA0      QGIDVATAGGLY-----LNEKS----QYKSEGAKIETDIRLAEMMRSY-LTNKGK---QN
A0A365UKN1      QGIDVATAGGLY-----LNEKN----QYKTEGAKIETDIRLAEMMRSY-LNNRGK---QN
A0A4R6WE41      QGVDVGTAGQLY-----VAEGR----AFQTQRTQIETDKRLVEMMRDY-LTADGK---SK
A0A2T5RP38      QGLDIETAGGMY-----LSESN----QYKTEKTKTETDLRLAEMMRSY-LNNKN----RN
A0A1A6CF06      QGIDIATAGGMY-----LSESS----QYKTEGTKIETDIRLAEMMHSY-LNNKNK---RN
A0A1T3D6S8      QGMDVATSGNMY-----LSESN----QYKTEGTKIETDIRLAEMMHSY-LTNKNK---RN
A0A1P8E011      QGMDASTVGTAY-----FEDSR----LYQSERNKVETDINLAQMMRGY-LSDGSK---KN
A0A1V3N3U3      QGVNIETAGEMY-----LNDSR----QFQSARTKIETERKLTQLMQRQ-LHDANK---RN
C2FUH6          QGVDVNVAGEMY-----LSESR----QHLEERNKLETDIRLVDMMRSH-LDNKTK---RN
A0A0B8T471      EGMDVNTATGVF-----WGESR----EYQSTTRGIETQLRLVELMRQR-IDNTES---RN
A0A4R7D2K0      EGMDVNTATGVF-----WGESR----EYQSTTRGIETQLRLVELMRQR-IENDVD---RN
A0A2X2J8S4      NGMDVAEVGGMY-----IEDSR----SYRLEATKIDTDLKLAEMMSDY-LSKSDK---QT
A0A3C0S618      NGMDVAEVGGMY-----IEDSR----SYRLEATKIDTDLKLAEMMSDY-LSKSDK---QT
A0A4P7DRF9      QGLDVKAAGEQY-----WSESR----GYQSTSKDIETQKKLVEIMRQR-LNDPAR---AR
A0A239XXC4      QGLDVKSAGEQY-----WTESR----TYQSSSKELETQMKLVEIMRQR-LSDPSR---VD
A0A4U9K473      QGLDVKSAGEQY-----WTESR----GYQSSSKELGTQMKLVEIMRQR-LSDPSR---VD
A0A3M1Y2F5      ------------------------------------------------------------
A0A7C7CKY6      KLSKQDDLLTVY-----VERLD----HFESQLIDLELESDLLKDIT-----ATIA---GE
A0A1G1TG88      KTYDVRSEVAAL-----AAKGE----DLEEQRLKLNQNLVLLSDISRMVQQTHIT---RN
A0A661XXA6      RTVSLDEDVKRT-----VTIMN----NLDSQQVRLQDRLADLNSIINEIKDGQIV-----
A0A3D4RLG4      ------------------------------------------------------------
A0A2T2UAJ4      ------------------------------------------------------------
A0A6I0DZQ5      ------------------------------------------------------------
A0A6L3FBV2      ------------------------------------------------------------
A0A6L3FIH8      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      RVIDMAEDSRQA-----LQNLN----TNASEEKQLAVHLKIVKLLEGHLR----------
A0A2P8G5K0      RIIDMAEDGRQA-----LQKSA----TNALEEKELAIRLKIVRLLEAHLL----------
A0A4Q3SEI4      GVVDLSEQGKLY-----LQSVG----ENDRMMTDLHIQTAMLDEVEKYVL----------
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      ---------------------------------MLQMEFNILTEIAKSLE--------QD
A0A519SYE7      -------DISGL-----KDRLE----QQQLTREKLIQNLRLLDDVQQMVARGQLT---RS
A0A7C7CFR2      -------ELES----------------------------SMLDDIENMIA--------NK
A0A3D4CJE1      KISGSSEFSAMY-----MEKLN----RLENQLIDLDLQINVLKEIQNKAK----N---AN
A0A7C7LI79      KMAGKGDFITIY-----VGKLD----NLESELLDLELEQNMLKEINTMIT----N---TE
A0A4Q5ZQ60      ------------------------------------------------------------
A0A519Q885      VGFGMDNDLVEL-------------------RLELEQNLELLDEVGALAEQERLT---VR
A0A519TAP8      KTYDVKGDMATL-----KNGLE----QQQEARQKLQDKLRLLSDINGLMNRDQLT---RN
R5DEG6          QLTDISSETGMY-----LQTSS----QYRQEGLSLENQLSLAKYIKNYLT----------
A0A3N2LCI3      ------------------------------------------------------------
A0A6L6NZ03      LLPDVQAAANMY-----MTQAN----EANAAIRELNNQAYMARYIKNYLT----------
A0A642EJV3      LLPDVQAASSMY-----MAQSS----AANAQILSLNNQLYMTRYIRNYLA----------
A0A6H9Q899      ------------------------------------------------------------
A0A6L4ENN1      ------------------------------------------------------------
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      ------------------------------------------------------------
A0A519SD85      -------RLSYDV---------QDI--PDV-QLQDMTSKYQDLVIKRNHLLK--QYTI--
A0A3M1TXY5      EV-----VAPAST---------G-I--EDP-LLTSLLVDLARLKQERAAIRL--TAKE--
A0A2E0VQ27      D------FSPNFE---------A-L--SDP-IFRGSYLKAQSYEEQRQDYLQ--KYTL--
R6U429          A------LIPANS---------G-L--TNS-TVESQIGEYNQLVLSRDRLVS--GSSS--
A0A5C8AF42      R------LLPEML---------GKS--YEQ-SLTGQIASLYDLLEKKEDLLY--RVTD--
A0A239K409      -------LVPSTL---------S-I--EDP-TLQELISRFNELQLERERLLR--TTEK--
A0A1V5S1J9      AI-----IAPDNL---------G-V--SDA-NLSSLVSQFTEMQLKRKEIGV--------
A0A0A2EYC8      SL-----ASPTTI---------G-I--QEP-RLIALVDKYNELQIKLLDLGV--------
A0A2G6H6Y4      SL-----ASPTTI---------G-I--QEP-RLISLVDKYNELQLQLIDLGV--------
A0A1M3DPL8      AI-----IAPSNI---------G-L--NEP-MLMTIVQQINDLLLKRSELTE--------
A0A1V5F519      TV-----VAPSNL---------G-L--NEP-LLMQLVQQINELYLQRSELTE--------
A0A2G6R1T9      NI-----IIPTNT---------G-L--NES-TLVVLAQQFNELLEERNSTSR--------
A0A350V3E4      D------YFESKI--------------TDP-YVAELQGEIARLEIQRDLAKT--GNDELV
A0A6J4K208      -------ALPVSP--------------PDT-ALQQRLGRYNDLLREREQLQL---DNA--
A0A1M6MYT6      V------IAPSAM---------G-I--EDP-LLNNLILQLNDLINERLSQTS-IRQNS--
A0A2P8CDS1      L------VAPTTV---------G-I--DDP-LLVNLLQELSQLNIEKTTLSA-TVKDP--
A0A353WYK7      G------NSELRM--------------LSS-EVAQDINRLEELKKEMNILKG--AYKT--
A0A355BP94      V------A-PRNF--------------LPE-YLNTRIEEYLKLVRGKERLAL--SYKD--
A0A136LSC7      A------IRPANS--------------FPE-SILQRIEELHKKTRERDKLAL--AYNE--
A0A5C7N8Q5      T------SRPTRS--------------LPE-SINQRMEELYKQARERDKLGL--AYNE--
A0A2W4RDE8      I------VAPSTF---------G-V--DDP-LLSNLLIELSKLNQERSGLNY--SARE--
A0A0L8VEV2      EV-----VAPSVV---------G-I--VDE-SLNNLVTQLSDLYRQREVFSY--TVQE--
A0A1I2A9Z9      QV-----VAPSVV---------G-I--VDD-ALNNLVVHLSDLYRQREVISY--TAQE--
A0A212J9Z9      DDL----MDPASM---------N-I--RNP-KLSEFVVTYNELLQKARNLGA--------
F5IV23          DDL----MDPASM---------N-I--RNP-KLSEFVVKYNELLQKARNLGA--------
F8X2T0          SEL----IDPVSI---------G-L--TDEIKLSRYVEEYNQELRKSKNLGP--------
A0A1M3LAG1      AEL----IDPISI---------G-L--TDEIKLSRYVEEYNQELRKSKNLGP--------
A0A212K6G4      AEL----IDPISI---------G-L--TDEIKLSRYVEEYNQELRKSKNLGP--------
A0A4Y9IPG7      AEL----IDPISI---------G-L--TDEIKLSRYVEEYNQELRKSKNLGP--------
A0A2V3PNY7      TEL----IDPTAL---------G-L--NEP-KLARSIGEYNNLVNKLSSMGS--------
A0A6G7WQ31      TEL----VEPSAL---------G-I--TEA-KLTQSIGEYNSLINKLASMGS--------
A0A6G7X5K8      TEL----VEPSAL---------G-I--TEA-KLTQSIGEYNSLINKLASMGS--------
A0A1M5DFS8      TEL----IDPSAF---------G-I--SDT-KLSQSVGEYNKIVKKLASMGE--------
A0A4Y8KZS5      TEL----VSPNAF---------G-I--NEP-KLSQSIADYNNIIKKLASMGE--------
A0A142HHS5      -------LTPSDE-VTVDQTIPGLALLEDP-ALSQQLNNLNALQQNLRRIRR--SYQD--
A0A660LQT8      D------LLPVNS---------G-I--NST-AIESMIGDYNSNVLQRNRLVM--NSST--
A0A2M6GH67      Q------IIPSLK---------Q-I--EDA-ELSTKIAELSSLQRSYKILLL--SYKK--
A0A389LWV6      N------LVPPSS-----------MGIQDV-ELAVLVSKYNDIFFEIK------GLGS--
A0A1G9B1T9      V------IAPSVR---------N-I--NDE-VMSGLLRNLIELNQQRAQLKT--SVRQ--
A0A350PNH9      Q------LLPANI---------G-I--DSP-GIEQQITEYNKQQLERNNLVA--NSSE--
A0A354LNT9      Q------LLPANI---------G-I--DSP-GIEQQITEYNKQQLERNNLVA--NSSE--
A0A161LWY6      EL-----LTPSSL---------G-I--VDP-VLTGLLTQYNETIRKLL------QTTP--
A0A6I3N9U6      EL-----LTPSSL---------G-I--VDP-VLTGLLTQYNETIRKLL------QTTP--
A0A3D0FMX4      TV-----IAPSTM---------G-L--DAQ-ALGTLVTQLNDLQIKRAELSE--------
A0A1M3MEI8      SI-----VAPTNL---------G-L--NEP-MLMALVQQINELIMKRAELPE--------
A0A1J5HQM0      SI-----IAPSSL---------G-L--NEP-MLMGLVSQINDLNLKRSELSE--------
A0A653AC35      AI-----VAPASL---------G-L--NEP-MLMTLVQQFNDAVTLRNETTE--------
E4T131          AI-----VAPSSL---------G-L--SEP-MLMKLVEQVNDLYNQRSDLTE--------
A0A521H707      S------LLPLLS---------GTY--IDG-VIQGLITKIQALEDQKTTLKF--LATE--
A0A1F3D6P8      G------VVPPSA---------MNV--ADP-IMNQLITQLLLLYSQRSGIAS--NNAE--
A0A356Z058      G------VVPPSA---------MNV--ADP-IMNQLITQLLLLYSQRSGIAS--NNAE--
A0A3D1BT36      G------LAPPSA---------ANV--SDP-IMNTLVLELLDLNSQRSAILS--NNVQ--
A0A5R9QZP0      G------LSPPSS---------ANV--IDP-IMNSMILELLELNAERSAILS--SKAE--
A0A3D3HL11      S------LAPPSS---------SNV--VDP-ILSSMIMELQQSSAERANILS--NNAE--
A0A6L8U6G9      S------LSPPSA---------ANV--VDP-IMNSLVLELFALNSERATILS--NNAE--
A0A352ME00      G------LAPPSA---------MNV--SDP-IINQMITNLNDLNAQRSTIIA-GSNPQ--
A0A6L8UH35      G------VVPPSA---------MNV--SDP-ITNQMISELLNLYNQRSTITA-GSSTD--
A0A2W7RD29      I------VVPSLV---------G-I--TDP-TINSLIDELINLQNEKSNQLV--TLTD--
A0A3N2NDY8      S------VIPVNT---------G-I--GSP-TLEAQISNYNNLLLTRNTLAA--SSSD--
D7JEV9          S------LASPTT-----------IGIQEP-RLIALVDKYNELQIKLLDLGV--------
A0A4R6H3B7      QV-----VAPSVV---------G-I--VDD-ALNNLVVHLSDLYRQREVISY--TAQE--
A0A3P1Z8V4      E------VIPAVA---------G-F--TNA-ALAQQITEYNRLVLTRNRYAV--NSND--
A0A2W7QSQ0      D------LIP------------GGLADLDP-SLSGLLTQYNTLQRDKQRIIR--IVQP--
R7F6L5          E------TLPSNM---------G-I--ANT-GLESQIQVYNQQVIERNRLLK--TTGA--
A0A7C5MRV2      S-------LPYSI---------EGQ--TDP-ILTSLISSYNGLVQEKLAALQ--SYTA--
A0A553GA49      V------TLMSNL--------------NNE-VLNDLLNEYIGLVGRKQHLLE--NKQA--
A0A497D6F6      TI-----IAPSAM---------D-I--DDP-LLNALILELNNLSIEKSSM-T-SVKNT--
A0A5M4AAB9      SL-----VAPSTV---------G-I--DDP-LLVNLLQDLNQLNIELSTLAA-TVHDP--
F4KR18          DTSSKFKLIPINP---------A-L--YDG-KIRDLIQPYNDLVMERERFLT-KGQTS--
A0A229I3A5      Q------LLPTNT---------G-I--ESP-GIEQQITEYNKSQLERNNIVA--NSSE--
A0A3R6HJB3      Q------LLPSNT---------G-I--ESP-GIEQQITEYNKSQLERNNIVA--NSSE--
R6NN15          Q------LLPANS---------G-L--ESA-NIENQISEYNNLQLQRNNLVA--NSSE--
C9LKL0          Q------LIPVLN-----------L--PDA-TFAGLVNEYNTMMIERNSTEK--NSSP--
A0A3D0QPV7      N------VLSILS---------GTR--FES-ELSGMVKELHVLILTKEKEKF--SSTS--
A0A496KT23      Q------VLPSNS---------G-I--NNA-SIQSQINDYNTRLLERNRLLA--TSSA--
L1M9T3          Q------VLPSNS---------G-I--NNP-SIQAQINDYNSKLLERNRLLA--TSSA--
A0A3C0I8F1      T------LMPEVN-----------L--PGI-DFNSLILKINALFSEIASISY--YKTD--
R5JJI4          D------LIPANT---------G-I--SDN-SVESQIKEYNDMLLKRDKLVA--GSSN--
A0A0A2DQN2      E------FLPLNI---------G-I--MSP-ALDESIGQFNQIKQERDLWMQATGASQ--
A0A0A2F2N5      E------YLPQNI---------G-L--NNA-ALETAITAYNQVKPEYDRWLATTGGME--
L1NGW4          E------YMPLNI---------G-V--SDP-NLDGYIAKYNQLKGDRDRLVKASEGST--
Z4WRA0          E------YMPLNI---------G-V--SDP-NLDGYIAKYNQLKGDRDRLVKASEGST--
U2K8K9          E------LMPLNI---------A-M--PDP-ELDGYITQYNQLKFQRDKLVESSGGST--
A0A069ZM60      G------YLPLNV---------G-V--PDQ-ALDGYIAQYNQLKSQRDKLVEGAGGST--
J6GV98          G------YLPLNV---------G-V--PDQ-ALDGYIAQYNQLKSQRDKLVEGAGGST--
A0A134B4F8      G------YLPLNV---------G-V--PDQ-ALDGYIAQYNQLKSQRDKLVEGAGGST--
A0A134B8C7      G------YLPLNV---------G-V--PDQ-ALDGYIAQYNQLKSQRDKLVEGAGGST--
A0A3D2HF71      E------IIAPSV-----------MGVTDQ-LLIRLVEELSQLQKQKKQLSL--NLLE--
A0A4Z0EKR0      S------AVPSTL---------G-I--KDE-TLLALIGKFNELQQERKRMLR--TTEP--
B5CTK0          N------LIPTNT---------G-ISGADV-NIESSIATYNAMLLKRDKLID--SSSD--
A0A1M6B6D5      V------PAPSVA---------G-I--SES-SVVAGVGKIVSLAEQRNKLQY--SFKE--
A0A451FS66      V------PAPSVA---------G-I--SEG-SIIAGVGKIVALAQERNKLQY--SFKE--
A0A2E3GN39      T------QLSGEE-----------F--DGI-TRALSVDEILKLEYEKESALM--QVTP--
A0A3D1MEL0      T------QLSGEE-----------F--DGV-TRALSVDEILNLEYEKESALM--QVTP--
A0A519UDD1      T------TVPSSL---------G-I--KDG-TLTSLIGKYNELQIERQRLLP--NLEP--
A0A2A4N9A6      N------NISLENIILLPKE-------AYV-TIIGQLRELEL---QKKFLAQ--HETE--
A0A6C0GGI1      Q------DLEMSQVPITA----G-I--NDQ-IIIDLVRQLDILYQERAKLAL--SIRS--
A0A368D1N7      E------DLNLASTQLSGEDFDG-V--TRA-LSVDEILKLEY---EKESALM--QVTP--
A0A3B8TU58      E------DLSLASTQLSGADFEG-I--ING-LSVSEILNLEA---EKEKALM--QVTP--
A0A1T5IIR6      R------LIPGNM---------G-L--EDN-SMDEVIARYNDLVLQRDRLVA--ASST--
F0R0C9          Q------LLPANS---------G-I--ESA-NIEQQIGEYNTMQLQRNNLVA--NSSE--
A0A6L6NXQ0      Q------LIPVNL---------G-L--ENT-DIEGLITEYNTVQLKRNNLIT--NSSD--
A0A6N8DCX3      Q------LIPVNL---------G-L--ENT-DIEGLITEYNTVQLKRNNLIT--NSSD--
A0A3E0QD27      S------LLPFLS---------GSY--SDG-VILSIVSKIHELEDKRSNLRF--IATD--
A0A0M1W1I6      E------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKRDKLIE--GSSD--
A0A4R4GHU2      E------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKRDKLIE--GSSD--
I8WPR6          E------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKRDKLIE--GSSD--
A0A0K2HKS3      E------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKRDKLIE--GSSD--
B6W3W8          E------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKRDKLIE--GSSD--
A0A4R4GSI6      E------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKRDKLIE--GSSD--
A0A076IRY8      E------LIPSNT---------G-I--ADI-NIETQITAYNANKLKRDKLIE--GSSD--
A0A3A6AD54      E------LIPSNT---------G-I--ADI-NIETQITAYNANKLKRDKLIE--GSSD--
A0A3A6MIU7      E------LIPSNT---------G-I--ADI-NIETQITAYNANKLKRDKLIE--GSSD--
I8WPP8          E------LIPSNT---------G-I--ADI-NIETQITAYNANKLKRDKLIE--GSSD--
A0A372Y7D2      E------LIPSNT---------G-I--ADI-NIETQITAYNANKLKRDKLIE--GSSD--
A0A3E4JJC9      E------LIPSNT---------G-I--ADI-NIETQITAYNANKLKRDKLIE--GSSD--
A0A3E4WDQ0      E------LIPSNT---------G-I--ADI-NIETQITAYNANKLKRDKLIE--GSSD--
A0A414H9P2      E------LISSNT---------G-I--ADI-NIETQITAYNANKLKRDKLIE--GSSD--
C3R5A8          E------LIPSNT---------G-I--ADI-NIETQITAYNANKLKRDKLIE--GSSD--
A0A1C5XJA7      D------LIPSNT---------G-I--SDM-NIENQIGMYNAAKLKRDRLIS--DSSD--
A0A285T4L1      D------LIPSGT---------G-I--SDA-SVEGQINQYNALKLKRDKLIA--DSSE--
A0A3E5BU42      D------LIPSGT---------G-I--SDA-SVEGQINQYNALKLKRDKLIA--DSSE--
R7CUW4          D------LIPSNT---------G-L--SDM-NIESQINLYNTAKLKRDRLIS--DSSE--
A0A416GGJ1      D------LIPANT---------G-L--SDA-SVESQINTYNELKLRRDKLID--DSSD--
D1JY72          E------LIPSNT---------G-I--ADI-NIETQIAAYNANKLKRDKLIE--GSSD--
D7J4K6          D------LIPSGT---------G-I--SDA-AVEGQINQYNALKLKRDKLIA--DSSE--
Q8ABP9          D------LIPSGT---------G-I--SDA-AVEGQINQYNALKLKRDKLIA--DSSE--
A0A5M6AHF7      D------LIPSGT---------G-I--SDA-AVEGQINQYNALKLKRDKLIA--DSSE--
A0A6L4IA73      D------LIPSGT---------G-I--SDA-AVEGQINQYNALKLKRDKLIA--DSSE--
D6D2Z5          D------LIPSGT---------G-I--SDA-AVEGQINQYNALKLKRDKLIA--DSSE--
A0A1T3EDR4      G------LLPSNM---------G-L--SGG-NIEQQIQAYNSFFLKRNRLME--GGNN--
A0A174SDD8      E------LIPSNI---------G-L--EDL-NIESQIARYNETLLRRNRLMN--GSSS--
A0A1H7RFH3      E------LIPSNI---------G-L--EDL-NIETQISRYNETLLRRNRLMN--GSSS--
A0A139L1N2      E------LIPSNI---------G-L--EDL-NIETQISRYNETLLRRNRLMN--GSSS--
A0A174TVL8      E------LIPSNI---------G-L--EDL-NIETQISRYNETLLRRNRLMN--GSSS--
A0A1H8BJR6      E------LIPSNI---------G-L--EDL-NIETQISRYNETLLRRNRLMN--GSSS--
R9H6G0          E------LIPSNI---------G-L--EDL-NIETQISRYNETLLRRNRLMN--GSSS--
A0A412GR09      E------LIPSNI---------G-L--EDL-NIETQISRYNETLLRRNRLMN--GSSS--
A0A6I0S0M4      E------LIPSNI---------G-L--EDL-NIETQISRYNETLLRRNRLMN--GSSS--
A0A081PBV5      D------LIPNNT---------G-L--VDV-NIENRINEYNTASLRRNRLLE--GSSS--
A0A1I2AN85      D------LIPNNT---------G-L--VDV-NIENRINEYNTASLRRNRLLE--GSSS--
A0A4U0GMP3      D------LIPNNT---------G-L--VDM-NIESQINEYNVALLKRNRLVE--GGSF--
A0A1H6CKR6      E------LIPSNT---------G-L--VDQ-SIESIITEYNTLLLRRNRLTA--GNSS--
A0A235E1C0      D------LIPSNT---------G-L--VDN-NIEDIISEYNTLLLRRNRLMS--GNSS--
R6D982          E------LIPGDI---------G-L--TDA-VIEGQIARYNEALLRRNRLRS--GSGG--
A0A1F0I8C4      E------LIPGNI---------G-L--TDI-NIESQIARYNETLLRRNRLVS--GSSS--
A0A3A5RIJ2      E------LIPGNI---------G-L--TDI-NIESQIARYNETLLRRNRLVS--GSSS--
A0A515IZJ5      E------LIPGNI---------G-L--TDI-NIESQIARYNETLLRRNRLVS--GSSS--
A0A5M5NLR3      E------LIPGNI---------G-L--TDI-NIESQIARYNETLLRRNRLVS--GSSS--
A0A0D5BSQ0      A------LIPNST---------G-L--VDA-NVETQITEYNTALLKRNRLAE--GGNT--
A0A1T3F6P5      N------LIPNNT---------G-L--VDS-GVEGQIAEYNKALLKRNRLAE--GGNT--
A0A0W8EPA0      N------LIPNNT---------G-L--VDS-GVEGQIAEYNKALLKRNRLAE--GGNS--
A0A365UKN1      N------LIPNNT---------G-L--VDS-GVEGQIAEYNKALLKRNRLAE--GGNS--
A0A4R6WE41      E------LIPNNT---------G-L--VDA-NVEGQIVEYNKALLRRNRLEE--GSSM--
A0A2T5RP38      E------LIPNNT---------G-L--VDA-SVESQIAEYNMALLKRNRLAE--GGNT--
A0A1A6CF06      A------LIPNNT---------G-L--VDT-GVESQIADYNTALLKRNRLAE--GGNS--
A0A1T3D6S8      A------LIPNNT---------G-L--VDT-GVESQIAEYNTALLKRNRLAE--GGNS--
A0A1P8E011      E------LIPNNT---------G-L--VDA-SVETQINDYNTTLLRRNRLIE--GSSD--
A0A1V3N3U3      E------LIPNNT---------G-L--VDG-GVEAQITEYNRALLRKNRLVE--GSST--
C2FUH6          E------LIPSNT---------G-L--VEA-NIENQITDYNTTLLRRNRLVE--GSST--
A0A0B8T471      D------LIPSNT---------G-L--VED-NIEAQITEYNEVLLKRNRLVG--GDNS--
A0A4R7D2K0      D------LIPSNT---------G-L--VED-NIESQITEYNEVLLKRNRLVS--GDNS--
A0A2X2J8S4      A------LIPNNT---------G-L--IDG-NIEGQIQAYNTLQIRKNKLME--DGNS--
A0A3C0S618      A------LIPNNT---------G-L--IDG-NIEGQIQAYNTLQIRKNKLME--DGNS--
A0A4P7DRF9      D------LIPSNT---------G-L--VDG-NIESIISEYNSVLLKRNRLQA--GENS--
A0A239XXC4      D------LIPSNT---------G-L--VDN-NIEGIISEYNTLLLRRNRLMS--GNSS--
A0A4U9K473      D------LIPSNT---------G-L--VDG-SIEEIIAEYNTLLLRRNRLMS--GNSS--
A0A3M1Y2F5      --------------------NINDP------FLQSLMGKLTELVSERAELDF--SVTA--
A0A7C7CKY6      KELDAYNLLPVLTG------TPYKD------EIGDLISNLHNLLATKEQALY--TITA--
A0A1G1TG88      EEETVEQSIPGL-G------DINDP------VLSQLLGQLNGMQWDQERVRR--SYTG--
A0A661XXA6      -------IMPTL-D------DKFPA------HIISLINELNLLINDREKLGL--SYRE--
A0A3D4RLG4      ----------------MHKYKATSK------ICRKKNWRWSLSNAITELMTT--TXTQ--
A0A2T2UAJ4      -------------------------------------------------------GGK--
A0A6I0DZQ5      ------------------------------------------------------------
A0A6L3FBV2      ------------------------------------------------------------
A0A6L3FIH8      ------------------------------------------------------------
A0A3D3LSK1      ------------------------------------------------------------
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      --AKPSAAIPSAL-------YPQEG------NFEALIGKYNEMELSRTRALA--SLAP--
A0A2P8G5K0      --EKPAAAIPSAL-------YPQEG------TFEALAGKYNEMQMARIMALA--TLAP--
A0A4Q3SEI4      AKDRQIGVVPAITS------VK-DP------MLGQLLNSLFESEMQYEKLKK--TIPG--
A0A348PT57      --------------------SK--------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      NEVDIYRLIAILAG------SEFSG------MVSRMLQNLQDLLIEREQLLY--QVTP--
A0A519SYE7      ENETVANNLPGLTELNDPLLAGMLN------ELDEQQRSLRLTLLSQTNKTF--AVQR--
A0A7C7CFR2      EDIDVYNLLPALTG------SSFQD------EISRLVNSLHELLAKKEEILY--TATP--
A0A3D4CJE1      DNMQVYDLLSILAG------TDYES------TINGLITNLQRLLDKKQQLQN--EVTP--
A0A7C7LI79      D-IDVYKLLPVLTG------ASFQE------EITDLLSKLNALLSSKEEVLY--TATT--
A0A4Q5ZQ60      ----VESFLPSLSL------VN-DQ------MLGEQMKALVELQKQHALLMG--SAKK--
A0A519Q885      ENQTVTQNIPGLVD------LS-DP------VLVQLLEQLNKEQINLARVKR--SYKE--
A0A519TAP8      EDETVADNLPGLTE------LE-DP------VLVGLLDLLDSQQRSLRLTLK--SQTD--
R5DEG6          DPGKNSDLIPANTG------IS-DV------NIESQIGEFNEMLLKRDKLIS--NSSS--
A0A3N2LCI3      ------KMLPMNSG------VA-NV------DIQSQITDYNNLVLQRNSLLA--KSSD--
A0A6L6NZ03      NENNKHQLLPANSG------IE-NA------SLATQLNEYNTKLLERNSLVS--HSSV--
A0A642EJV3      NDANRTQLLPANSG------IE-SA------NIESQIAEYNKQLLQRNSLVA--NSST--
A0A6H9Q899      --------LPANSG------IE-SV------NIESQIAEYNKQLLQRNSLVA--NSSA--
A0A6L4ENN1      -------------------------------------------LLQRNSLVA--NSSA--
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A2T4XEQ1      ------------------------------------------------------------
A0A2K8ZAP1      -MKNTNAAISENIETIRQQLI------------------------------------SNR
A0A519SD85      -SSKFVTDIDQEIEIFRNSITNNLLLQHKLLT-------------------------EKG
A0A3M1TXY5      -RSPKVQNIDAKINNVRQAILKNVNTSIRANN-------------------------IAI
A0A2E0VQ27      -QHPLILNLDQKIKETRAFLNESVNSTLENLQ-------------------------QKT
R6U429          -ENPLVLDYNNSIAALKIAINRSIENLISTLK-------------------------LQA
A0A5C8AF42      -ENSEVKALNSKIQTKLNSIRKSVAAILERLY-------------------------ANS
A0A239K409      -INPIILSIDQQLQSLRVNILENIHNIKGGLV-------------------------LTR
A0A1V5S1J9      -KSPLYAKYTRDIDAVKAQMYEALKNIRVGLD-------------------------IQK
A0A0A2EYC8      -KNPQYDIVFNQISQTKAQLNELISSVSDIYK-------------------------IES
A0A2G6H6Y4      -KNPQYEIVIAQIEQIKKQLKELIASVSDVYS-------------------------IET
A0A1M3DPL8      -KNIFHSKYTREIDNLKTAINEVIKNTKASIN-------------------------IQK
A0A1V5F519      -KNLYYAKYTKAIENVKTSIFELIKNMRASLE-------------------------IEK
A0A2G6R1T9      -KNPVYKKLTREINNIKASINEAIKSMRKSIQ-------------------------IEK
A0A350V3E4      KNSKSLKDINNKVAELKRSLDEKLNILKEGANSNSPEEMRSLTSKYFETKVLNNQNKIKE
A0A6J4K208      -PAGRISKVNAQIQKTRVGLVEYAGSLANRAR-------------------------QRT
A0A1M6MYT6      -EHPTIVRLNAQIASVKNSLRENVDNIISQSD-------------------------MAL
A0A2P8CDS1      -DHPRMRQLNIQMETTKRTLLENSRNIMHQSE-------------------------ITL
A0A353WYK7      -NTFAYRKKKEEINFLRERIIGYVEESRKGIY-------------------------DKL
A0A355BP94      -NTFAYQQKDQELNAARTALFTQLAEIKKQWL-------------------------GAM
A0A136LSC7      -NTFAFRQKEREVSLVKDELFNQLSTLKKEWL-------------------------ADM
A0A5C7N8Q5      -NTFAFRQKQKEVTLLKDELFSQLSTLKKDWL-------------------------ADM
A0A2W4RDE8      -GNPLAQVIELKITNLKASITENVSNIIDATN-------------------------IAL
A0A0L8VEV2      -KNPKLILVNNQIEMVKRNLQENLKNLINNAI-------------------------VQI
A0A1I2A9Z9      -KNPKLILIGNEIEMVKRNLRENLKNLINNAI-------------------------IQV
A0A212J9Z9      -KNPLYNKTIDELNDLRVKILQEIQVSQINLQ-------------------------NQK
F5IV23          -KNPLYNKTIDELNDLRVKILQEIQVSQINLQ-------------------------NQK
F8X2T0          -KSPIYMTAINKLNESRVQILRELQLIQVKLQ-------------------------DQK
A0A1M3LAG1      -KSPIYMTAINKLNESRVQILRELQLIQVKLQ-------------------------DQK
A0A212K6G4      -KSPIYMTAINKLNESRVQILRELQLIQVKLQ-------------------------DQK
A0A4Y9IPG7      -KSPIYMTAINKLNESRVQILRELQLIQVKLQ-------------------------DQK
A0A2V3PNY7      -AHPMYAKSEQSLTNLRINILEELRALQDRVQ-------------------------NKK
A0A6G7WQ31      -AHPMYAKSEQSLTNLRIKILEELRGLQDRIQ-------------------------NKK
A0A6G7X5K8      -AHPMYAKSEQSLTNLRIKILEELRGLQDRIQ-------------------------NKK
A0A1M5DFS8      -AHPLYAKSEQSMNNLRIKILEDLRNAQDKVQ-------------------------EKK
A0A4Y8KZS5      -AHPLYSKSEQSMNSLRIKILEDLRTAQDKIQ-------------------------EKK
A0A142HHS5      -RLEAVQGPLAQLKFAQATLQHQLVQAQKQLR-------------------------GQI
A0A660LQT8      -SSPLIADLEDRISKQRQVIGVSINNWLLTLQ-------------------------NQV
A0A2M6GH67      -TTQTVKIREEEMRLTKEAVTELLQQNIDLLQ-------------------------NQT
A0A389LWV6      -ENPIYKRYKLQLTDIKSSINQSIVSMKNSIG-------------------------IEE
A0A1G9B1T9      -SLPAIEELDAKVKSIRAQLHENVNNLIATTK-------------------------YKI
A0A350PNH9      -QNPLVADYDQSLASMRHSIVTSIDNFVVTLN-------------------------SQL
A0A354LNT9      -QNPLVADYDQSLASMRHSIVTSIDNFVVTLN-------------------------SQL
A0A161LWY6      -QNPFYAKYQEELNKLKGSLTDALRNVRAAFS-------------------------IEK
A0A6I3N9U6      -QNPFYAKYQEELNKLKGSLTDALRNVRAAFS-------------------------IEK
A0A3D0FMX4      -KNIYYDKYTTDMQNIKVAILEVLSSMRASMD-------------------------IEK
A0A1M3MEI8      -KSMFHSKYTREIETVKNAINEMVRNMQVSMD-------------------------IQK
A0A1J5HQM0      -KNMYYAKYTRDIDHIKVAINEVTKNMRASLE-------------------------IEK
A0A653AC35      -KNPLYSKYNREVEALRTSINEVLKNMKTSLA-------------------------LDK
E4T131          -ANPYYAKFTKQIETSKLTILEVIKSMRASLE-------------------------IEK
A0A521H707      -HNAAVISLEKDIAFQRSNLILSLNNAREALI-------------------------QKI
A0A1F3D6P8      -KNLFLGQIDNKIKVQKQAIIETVTNNLNTLN-------------------------LSL
A0A356Z058      -KNLFLGQIDNKIKVQKQAIIETVTNNLNTLN-------------------------LSL
A0A3D1BT36      -KSLFLEQIENKINLQKQTIIENVKNNLNTLS-------------------------LTL
A0A5R9QZP0      -KSLFLGQIENNIRLQKQSIVENVKNNLNALN-------------------------LKI
A0A3D3HL11      -KNLFLGQIENKIRLLKQAIIENVKNNLNTLN-------------------------LTQ
A0A6L8U6G9      -KNLFLGQIENKIRLQKQAIIENVKNSLNTLN-------------------------LTQ
A0A352ME00      -KNIFIGQIDSKIDFQKQIILENFTNNLNTLT-------------------------LSL
A0A6L8UH35      -KNIFLGQIDNRIRMQRQAIIENFTNNLNTLT-------------------------LSL
A0A2W7RD29      -SSPIVIEQQKRIVISKKNTLELVKSAISNID-------------------------ISI
A0A3N2NDY8      -TNPLVVDYDGQIKGLREAIVNAINGQIVALN-------------------------KSL
D7JEV9          -KNPQYDVVISQIRQIKTQLNELINSVSDVYK-------------------------IEK
A0A4R6H3B7      -KNPKLILIGNEIEMVKRNLRENLKNLINNAI-------------------------IQV
A0A3P1Z8V4      -DTPAVRDLDRQLEALRSAINTSLANHVKSIE-------------------------LEL
A0A2W7QSQ0      -NNPQLLSLNDQIVNVKSNILANISSIKSNLL-------------------------ISK
R7F6L5          -NNPQVVEKDEALRTMKRNIQHTAATYATSLN-------------------------TRL
A0A7C5MRV2      -SHPKVKEMDSKLEELRFSISENIASIKNNTE-------------------------QKI
A0A553GA49      -KSPQLRELTFQISNLKNTILVNLQYELDASR-------------------------LAL
A0A497D6F6      -EHPKLKRLNAQIENAKSNLLENVNNIISQSE-------------------------LAL
A0A5M4AAB9      -EYPRMRQLRIQMETTKRTLLENSRSIMHQSE-------------------------LTL
F4KR18          -N-PVVQSNNQKLKSLQSSINLAIDHMQDDLN-------------------------MQQ
A0A229I3A5      -QNPLVADYDQSLTSMRKSISASLDNFVVTLK-------------------------TQL
A0A3R6HJB3      -QNPLVADYDQSLTSMRKSISASLDNFVVTLK-------------------------TQL
R6NN15          -QNPLVVDMDESLRSMRRSIVSSVDNLITTLN-------------------------TQI
C9LKL0          -NSPLVKDLDSKLTTMRNTILSSVRSYVKTLE-------------------------MRA
A0A3D0QPV7      -KSTYMKSLDYQIDIQLKMINQAITSLKNQFS-------------------------KRK
A0A496KT23      -QNPAVMDLETQLGSIRRGIIQSLDNELDMLK-------------------------TQQ
L1M9T3          -QNPAVMDLETQLGSIRRGIIQSLDNELDMLK-------------------------TQQ
A0A3C0I8F1      -NNATLKVKRTQLIKYQKELRAQINEAQRMLN-------------------------KEI
R5JJI4          -KNPIVIDLNNSLGAMKQTIIRSVDNLIVGLN-------------------------IQL
A0A0A2DQN2      -DNPIVERYNQSMHVARAAVARALKDAAAAIS-------------------------IKL
A0A0A2F2N5      -DHPMVQKYAKAMEQTRMSISHTLEGYIKSLD-------------------------LQL
L1NGW4          -ENPVIAEYDRGLAQIRQNAISSLNQYANVLR-------------------------VRL
Z4WRA0          -ENPVIAEYDRGLAQIRQNAISSLNQYANVLR-------------------------VRL
U2K8K9          -QNPVIAEYDATLDQLRKSATEILNQQASALR-------------------------ARL
A0A069ZM60      -ENPVITEYDNALSQLRKNAIESLNQQAAVLR-------------------------MRL
J6GV98          -ENPVITEYDNALSQLRKNAIESLNQQAAVLR-------------------------MRL
A0A134B4F8      -ENPVITEYDNALSQLRKNAIESLNQQAAVLR-------------------------MRL
A0A134B8C7      -ENPVITEYDNALSQLRKNAIESLNQQAAVLR-------------------------MRL
A0A3D2HF71      -STGPLRVLEGNIANTRIAISNNIADGLANIE-------------------------KSI
A0A4Z0EKR0      -SNPIVQNINEQLASLRISILENLRNIKKGLQ-------------------------ITS
B5CTK0          -KNPVVVNLNNSLSALKQTIIRSIDNTIVALN-------------------------VKL
A0A1M6B6D5      -DAPVFNDIDRQIDAVKIVLLENIRSSKSLMN-------------------------EEI
A0A451FS66      -GAPVFNDIDRQINAVKSVLLENIRSSRSLKA-------------------------DEI
A0A2E3GN39      -EHPTVVLIERNLDKARATLIAQVEINIDKFQ-------------------------QEK
A0A3D1MEL0      -EHPTVVLIERNLDKARATLIAQVEINIDKNQ-------------------------QER
A0A519UDD1      -SSILIQNVNEQLANLRANTLENLRNIKKGLQ-------------------------ITS
A0A2A4N9A6      -LGPNTKLINGQIKANKKILLYSIKAIRATLF-------------------------AQL
A0A6C0GGI1      -DNPLYQQQQEKIVNTRNTIIENLRRLVSVVN-------------------------SSL
A0A368D1N7      -EHPTVVLIERNLDKARATLIAQVEINIDKNQ-------------------------QER
A0A3B8TU58      -EHPAIVLIERNLDKARVTLVAQVRINIERYQ-------------------------QER
A0A1T5IIR6      -TSPAVLKLENTLGSLRSNILGMISNLQTSLE-------------------------IQR
F0R0C9          -QNPLVKDLDQSLASMRRAIITSVDNLMVTLD-------------------------TRI
A0A6L6NXQ0      -QNPLIADLDQSLASMRTSIVSSIDNLVMSLD-------------------------TQR
A0A6N8DCX3      -QNPLIADLDQSLASMRTSIVSSIDNLVMSLD-------------------------TQR
A0A3E0QD27      -KNAAVISLEQDIDFQKKNLVMSIQNARLSIR-------------------------EKI
A0A0M1W1I6      -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
A0A4R4GHU2      -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
I8WPR6          -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
A0A0K2HKS3      -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
B6W3W8          -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
A0A4R4GSI6      -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
A0A076IRY8      -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
A0A3A6AD54      -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
A0A3A6MIU7      -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
I8WPP8          -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
A0A372Y7D2      -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
A0A3E4JJC9      -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
A0A3E4WDQ0      -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
A0A414H9P2      -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
C3R5A8          -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
A0A1C5XJA7      -KNPVVEELNSSLRAMKQSIIRAVDNMIVSIN-------------------------VKR
A0A285T4L1      -SNPVVEELNNAIHALRQSIIRAVDNMIVSIN-------------------------MKR
A0A3E5BU42      -SNPVVEELNNAIHALRQSIIRAVDNMIVSIN-------------------------MKR
R7CUW4          -KNPVVEELNNSLRAMKQTIIRAVDNMIVSLN-------------------------VKR
A0A416GGJ1      -KNPVVEEMNNSLRAMKQNIVRAVDNLIVSLN-------------------------VRR
D1JY72          -KNPIVQELNKNLIAMRQNIIRAIDNMIVSID-------------------------VKL
D7J4K6          -SNPVVEELNNSIHALRQSIIRAVDNMIVGIN-------------------------MKR
Q8ABP9          -SNPVVEELNNSIHALRQSIIRAVDNMIVGIN-------------------------MKR
A0A5M6AHF7      -SNPVVEELNNSIHALRQSIIRAVDNMIVGIN-------------------------MKR
A0A6L4IA73      -SNPVVEELNNSIHALRQSIIRAVDNMIVGIN-------------------------MKR
D6D2Z5          -SNPVVEELNNSIHALRQSIIRAVDNMIVGIN-------------------------MKR
A0A1T3EDR4      -KNPVVRDLDASLVSLRQEIQRSLDHSIRGLV-------------------------QRR
A0A174SDD8      -NNPVVQELNRTMQTMKQNIYRALDNLSTTLR-------------------------LKK
A0A1H7RFH3      -NNPVVQELNRTTQTMKLNIYRALDNLSASLR-------------------------LKK
A0A139L1N2      -NNPVVQELNRTMQTMKLNIYRALDNLSASLR-------------------------LKK
A0A174TVL8      -NNPVVQELNRTMQTMKLNIYRALDNLSASLR-------------------------LKK
A0A1H8BJR6      -NNPVVQELNRTMQTMKLNIYRALDNLSASLR-------------------------LKK
R9H6G0          -NNPVVQELNRTMQTMKLNIYRALDNLSASLR-------------------------LKK
A0A412GR09      -NNPVVQELNRTMQTMKLNIYRALDNLSASLR-------------------------LKK
A0A6I0S0M4      -NNPVVQELNRTMQTMKLNIYRALDNLSASLR-------------------------LKK
A0A081PBV5      -ENPIVQDLNITLAAMRKNIYRAMENAVSGLQ-------------------------IKI
A0A1I2AN85      -ENPIVQDLNITLAAMRKNIYRAMENAVSGLQ-------------------------IKI
A0A4U0GMP3      -SNPIIQDLDNALQAMRKNIDRSIENTLAGLR-------------------------IKL
A0A1H6CKR6      -ENPIVQDLNTALNALRDNISRAVDNVLTGYR-------------------------IKV
A0A235E1C0      -ENPIVQDLNNALSQVRQNIARAIDNVISGFR-------------------------IRM
R6D982          -NHPVVQELTRSVETMRQNINRSINNQVTSLK-------------------------LKR
A0A1F0I8C4      -NNPVVQELDRSMQTMRQNIFRALDNLSASLK-------------------------QKK
A0A3A5RIJ2      -NNPVVQELDRSMQTMRQNIFRALDNLSASLK-------------------------QKK
A0A515IZJ5      -NNPVVQELDRSMQTMRQNIFRALDNLSASLK-------------------------QKK
A0A5M5NLR3      -NNPVVQELDRSMQTMKQNIFRALDNLSASLK-------------------------QKK
A0A0D5BSQ0      -SNPVVLDLDEALKAMRNNIGRAVDNTLRGLN-------------------------VRL
A0A1T3F6P5      -ANPVVLDLDDALAAMRTNIGRAVDNALRGLN-------------------------IKL
A0A0W8EPA0      -SNPVVLDLDDALGAMRTNISRAVDNAVRGLN-------------------------IKL
A0A365UKN1      -SNPVVLDLDDALAAMRTNISRAVDNALRGLN-------------------------VKL
A0A4R6WE41      -ANPVVQELDQGLDAMHTNILRAINNTLSGLQ-------------------------VKI
A0A2T5RP38      -LNPVVVDLDEALKSMRNNINRAVDNALRGLT-------------------------IKM
A0A1A6CF06      -ANPVVLDMDEALNSMRNNISRAVDNALKGLN-------------------------IKL
A0A1T3D6S8      -ANPVVLDMDESLNAMRNNISRAVDNALKGLN-------------------------IKL
A0A1P8E011      -ANPVVQDLDRALQAMRGNIGRAVDNAIGGLK-------------------------IKA
A0A1V3N3U3      -ANPVVQDLDKALAAMHENISSAVDNAVAGLD-------------------------LKI
C2FUH6          -ENPIVQDLDKALGAMRGNIDRAVENATEGLR-------------------------VKM
A0A0B8T471      -ANPIVKDMDAALRAIRDNISRSVDNAAMGLR-------------------------IRI
A0A4R7D2K0      -ENPIVKDMDAALRAIRDNISRSVDNAAMGLR-------------------------IRI
A0A2X2J8S4      -ENPIVKEIDKSLNTMRSGIERTLGNTISGLQ-------------------------VKK
A0A3C0S618      -ENPIVKEIDKSLNTMRSGIERTLGNTISGLQ-------------------------VKK
A0A4P7DRF9      -NNPIVQDMDNALVAMRENIVRAVDNVITGFN-------------------------IKI
A0A239XXC4      -ENPIVQDLNNALSQVRQNIARAIDNVISGFR-------------------------IRM
A0A4U9K473      -ENPIVQDLNNALTQVRQNIARAIDNVISGLR-------------------------IRM
A0A3M1Y2F5      -DNPNIDRINLEISRVKSSLLENINNRVSSTE-------------------------FEL
A0A7C7CKY6      -NSEEAKSLDYQIDVQKRLLVAMLEALSNKLV-------------------------NKQ
A0A1G1TG88      -ATEAVQQKNAQMDYTLSSILRQITQARKALA-------------------------NRI
A0A661XXA6      -NTYTYKARQKEIDLLKSDLLGQIENAKENTI-------------------------EDE
A0A3D4RLG4      -KNVYYAKYTKDIENVKTAINEVVGSMRASLE-------------------------IEK
A0A2T2UAJ4      -GVGYVAEQRRGLAQSRIELNGLQARLDV-------------------------------
A0A6I0DZQ5      -------KYTREIETVKNAINEMVRNMQVSMD-------------------------IQK
A0A6L3FBV2      -----------------------------GLN-------------------------IQL
A0A6L3FIH8      -----------------------------GLN-------------------------IQL
A0A3D3LSK1      ---------------------------------------------------------NKI
A0A496L711      ------------------------------------------------------------
A0A1H6Z2F8      -GHPDIRSIEKQMEVLRTNLFDAIQNQKQELA-------------------------LSI
A0A2P8G5K0      -EHPQLRSLEKQIEVLRNNLLDAIGLQIQELT-------------------------VNA
A0A4Q3SEI4      -GNPTMYTLKTQIENLRPAILESIQNQRASLN-------------------------ANR
A0A348PT57      ------------------------------------------------------------
A0A7C3PTI0      ------------------------------------------------------------
A0A5Q4EKA0      -ESSQIQALNHQINIQRKLVVESITTLKNNLD-------------------------ARI
A0A519SYE7      -DQADIQETRAALERQLSRDQALVRQQLARLD-------------------------KLD
A0A7C7CFR2      -ESEAIKKVDYQINVQKKLLVATIRSLSKKLD-------------------------LKK
A0A3D4CJE1      -DSEILKTLNLQIEAQRDLIIESLRSLLDKLL-------------------------TQR
A0A7C7LI79      -QSEEIKAFNYRIEVQKKLLIASIKALVNKCE-------------------------VRK
A0A4Q5ZQ60      -ATFAVKSKEEEITFVKNNIAESVKKNKKLAQ-------------------------DKI
A0A519Q885      -STFAVEDQEANIIITRQAVRKQLIQARKLLQ-------------------------KKL
A0A519TAP8      -KTFAVQRNQAVIRDTRELLQR--------------------------------------
R5DEG6          -KNPVVQDLNNSLIAMKQTIIRSVDNLIVGLN-------------------------IKI
A0A3N2LCI3      -KNPLVVQLNEQMDQMRHAILASVDNSINALN-------------------------MQI
A0A6L6NZ03      -KNPLVREMDKSLDDMRSALITSIDNQMVALR-------------------------AQI
A0A642EJV3      -ENPLVVDMDQALASMRGAIIRSIDNQIVTLN-------------------------SQI
A0A6H9Q899      -ENPLVVDMDQALASMRGAIIRSIDNQIVTLN-------------------------SQI
A0A6L4ENN1      -ENPLVVDMDQALASMRGAIIRSIDNQIVTLN-------------------------SQI
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A6A0Y068      ------------------------------------------------------------
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      ------------------------------------------------------------
                                                                            

A0A2T4XEQ1      --------------------DV--------------NIAESIYL----TISRQYAETALW
A0A2K8ZAP1      NQLVANNQRMEGMIRTVP--GK--ERALLNITRQQ-GIKNNLYT----YLLQKREETALS
A0A519SD85      NLIRKTSDSIQRKLSQLP--NK--ERLLGELQSRF-DVDRKVYN----YLSEKKLEAEIA
A0A3M1TXY5      SNVNERIEALRTRLRRLP--ES--ERILTNIKRNF-DHSSEVHK----YLLQKRAETAIA
A0A2E0VQ27      LELESQIAEVNQKVERFP--EK--ERQLVVLQRQV-ALNEALYN----YLMRKYTELSIM
R6U429          DKVAAEETNIMNKISNTS--GQ--ELQLLSIERQQ-KIKEELYI----YLLQKREENEIA
A0A5C8AF42      RSVQGKIQGFESEFFELP--EK--KMEFSRLKNIQ-DLNEKYFT----LLTEKKVLYSIS
A0A239K409      RNLKDRTNLYDAKINSVP--LV--ERELQEIDRQR-GIKQQLYK----YLLEKREESSLA
A0A1V5S1J9      ADMQNRLQKLSAGMQELP--YK--EQQLLNIQRKF-KINDDYYT----FLVQKRADAQIQ
A0A0A2EYC8      DAYQKDLNELNNLLIAAP--NK--ELRMLDYERRY-KINDSYYT----FLLQKRSEAQIR
A0A2G6H6Y4      DLYKKDLNTLKSELVEAP--SK--ELRMLDYQRRF-RINDEYYT----YLLQKRAAAEIL
A0A1M3DPL8      DDLNTRLASVQKQIETLP--EQ--ELEMVGIERNY-RMNDSYYT----MFLQKRAEAQIL
A0A1V5F519      NEVNRLLADVNSQIAELP--KK--ELEIIGIERNY-KVNDNYYT----FFLQKRAEAEIQ
A0A2G6R1T9      QDIDSKIAAVRSKMNMLP--KK--ETQMTALTRQY-KIDDNYYN----FFISKKAEAQIQ
A0A350V3E4      SLLRGYLNKYQEKFNKLP--AQ--SIEYANLERER-LANEKVYL----MLLEKYQEALIN
A0A6J4K208      LLLDRSIAKATPSPPATP---------LPEVRRQL-KLDDKMYRSIHDYLLTRRAEAGMA
A0A1M6MYT6      ENLNQRIRQFEAQVRRLP--AT--ERNYVNIERKY-KLNNETYI----FLMQKLSEAQIA
A0A2P8CDS1      NDLTKRIDNLQQRTRNLP--SV--ERNYVNIERRY-QLNNDTYT----FLLQKLSEAQIA
A0A353WYK7      DEINLKKNRLETDFSSLP--SK--STEYAKTERYY-DLYEEFYL----SLMKNKAQFELA
A0A355BP94      LELNQKKESLEKKFASMP--DK--STQYSKNQRFY-KLYEEFYL----SMMQAKAEFEIA
A0A136LSC7      AELGKRKEKLERAFAEMP--DK--NTQFSKNQRYY-KLYEEFYL----TMMQSKAEFEIA
A0A5C7N8Q5      AELGRRKEKLEREFAEMP--DK--NTQFSKNQRYY-KLYEEFYL----TMMQSKAEFEIA
A0A2W4RDE8      NDLNQRIARLNAQLERLP--RN--ERELVKIQRRY-DFSDNVYN----YLLEKRAEAGIA
A0A0L8VEV2      QGLDRRVDQVNRQLSAHP--KT--EQQMMNMQRMY-DLNNELYT----FLLKKRAEAAIT
A0A1I2A9Z9      QGLDRRIEKVNQQLTAYP--KT--EQQLMNMKRMY-DLNNELYT----FLLKKRAEAAIT
A0A212J9Z9      DALVRKYEVLQLKIDNLP--PQ--ERDLIKFQREF-RVNEMYHQ----YLTQRQYEAKIQ
F5IV23          DALVRKYEVLQLKIDNLP--PQ--ERDLIKFQREF-RVNEMYHQ----YLTQRQYEAKIQ
F8X2T0          DLLVKKYQNLDLKLDNLP--PQ--ERDLIKYQREY-NVNEMYHQ----FLTQRQYEAKIQ
A0A1M3LAG1      DLLVKKYQNLDLKLDNLP--PQ--ERDLIKYQREY-NVNEMYHQ----FLTQRQYEAKIQ
A0A212K6G4      DLLVKKYQNLDLKLDNLP--PQ--ERDLIKYQREY-NVNEMYHQ----FLTQRQYEAKIQ
A0A4Y9IPG7      DLLVKKYQNLDLKLDNLP--PQ--ERDLIKYQREY-NVNEMYHQ----FLTQRQYEAKIQ
A0A2V3PNY7      ESLDNNTKEIEDKMATLP--AQ--EREYIRYEKRY-QVNDAYYT----YLRQRRYEATIQ
A0A6G7WQ31      EDLNNSTREIESRMSTLP--AQ--EREYARYEKKY-QVNDAYYT----YLRQRRYEATIQ
A0A6G7X5K8      EDLNNSTREIESRMSTLP--AQ--EREYARYEKKY-QVNDAYYT----YLRQRRYEATIQ
A0A1M5DFS8      ENLNSRLASVESEMSTLP--AQ--EREYARYEKRY-QVNDAYYT----YLRNKRYEATIQ
A0A4Y8KZS5      ELLNASLSSVETEMTTLP--AQ--EREYARYEKVY-KVNDAYYT----YLRNKRYEATIQ
A0A142HHS5      ALLDTQQGKLSNELQLIP--GK--ETELERLKRPL-GLYGNSYQ----MLLEKKVEYNIK
A0A660LQT8      KSLTSQEGTLTSKMAQAP--NQ--ASYLQSISREQ-KVKESLYI----FLLQKREENELS
A0A2M6GH67      ATLTRDINAIEAELKQMP--AR--VTEWARLQRPF-ENVEGAYR----QLINRRLDFNIA
A0A389LWV6      ADLNQRYSKLSAEVASLP--DK--ERKLLTHERDF-KINDSYNT----YLLQRRIESQIQ
A0A1G9B1T9      ESVENQIEELDSQINLLP--KN--EQELINIERKF-QFSDNQYN----YLLQKRTEVGIA
A0A350PNH9      GNLQANEAQTTSQIASNP--SQ--AKYLQTVGRQQ-KVKEALYL----FLLQKREENELS
A0A354LNT9      GNLQANEAQTTSQIASNP--SQ--AKYLQTVGRQQ-KVKEALYL----FLLQKREENELS
A0A161LWY6      KDIDTQSRKASGQLATLP--DI--ETQMNSFERQF-KMNDTYYT----YLLQKRAEAQIQ
A0A6I3N9U6      KDIDTQSRKASGQLATLP--DI--ETQMNSFERQF-KMNDTYYT----YLLQKRAEAQIQ
A0A3D0FMX4      KDLELRFSEVRAGINALP--EK--ELEMVALERNY-RIDDNYYT----FFLQKRAESEIQ
A0A1M3MEI8      KDLNRRYAEVQQEINQLP--AK--ELEMIGIERRY-KMNDSYYT----LFLQKRAEAEIL
A0A1J5HQM0      NDLKEKNDKVNKEIEQLP--SK--EIEMTSIARKY-KMDDNYYT----FFLQKRAESEIL
A0A653AC35      EDLNKKLYAVKQQITALP--QK--EMEMVTLERKY-RVDDNYYT----FFLQKRAEAAIQ
E4T131          SDFNKRLSVVNKQIEELP--EK--ELEQIAIQRKY-KMDDNYYT----FFLQKRAESEIL
A0A521H707      KSLDERMNEFEQIFLTLP--AQ--EAELARLNRLY-LVNEKFYQ----LLLEKKVEFAIT
A0A1F3D6P8      NELNYRADKLSREISQLP--RT--ELNMVGLQRKF-DLSDVIYT----YLLQKRSEAAIT
A0A356Z058      NELNYRADKLSREISQLP--RT--ELNMVGLQRKF-DLSDVIYT----YLLQKRSEAAIT
A0A3D1BT36      NELDYRAEKLSSQIARLP--RT--ELNMVSMQRQY-NITDAIYT----FMLQKRSEAGIA
A0A5R9QZP0      NELNYRRNKLSREISRLP--KT--ELNMVSMQRQF-NITDAMYT----FLLQKRSEAAIS
A0A3D3HL11      NELDYRESKLSGEISRLP--RT--ELNMVSMQRQF-NLTDQIYT----FLLEKKAEAAIA
A0A6L8U6G9      NELDYREGKLSGEISRLP--RT--ELNMVSMQRQF-NLTDQIYT----FLLEKKAEAAIA
A0A352ME00      NELDYRQNKLSKEASSLP--RT--EMNMVSMKRKF-DLNDEIYT----FLLQKRSEAQIS
A0A6L8UH35      NELDYRENKLSREISQLP--RT--EMNMVGMKRKF-DLNDAIYT----YLLQKRSEAAIA
A0A2W7RD29      DDLNYRISEISKDFRKLP--FT--EQNLIKIEREF-TLNEGIYN----FLLQKRAEAAIS
A0A3N2NDY8      RNMEGAKGAAESQLASGS--TQ--AKYLLSVERQQ-KVKESLYL----YLLQKREENELT
D7JEV9          SSYQSDLSALNKLLVEAP--NK--ELRMLDYERRY-KINDSYYT----FLLQKRSEAQIR
A0A4R6H3B7      QGLDRRIEKVNQQLTAYP--KT--EQQLMNMKRMY-DLNNELYT----FLLKKRAEAAIT
A0A3P1Z8V4      RAARSTQSRFDGQAGAIP--VK--EREALDIVRQQ-NLKEALYT----FLLNKREEVALQ
A0A2W7QSQ0      RNFETTLNENSYKAQSIP--GI--ERELVEISRNT-DLKQEQYQ----YLLRKRDEAVLT
R7F6L5          SGVRSQESVTNSRLATAP--RQ--ANYLLSVERQQ-KVKESLYL----FLLQKREENELA
A0A7C5MRV2      GFYKAELSKSRNNLQSIP--QT--QRIYQGLMREH-KVKESILS----TLLEKQAEAQIA
A0A553GA49      QQIRSKISTLNVELNRLP--ET--QRNLTTYERNF-RLNDAIYT----FLIQKRSEAQIA
A0A497D6F6      TDVKNRLWRYERRIQTLP--ET--ERNYINIERKY-QLNNETYT----FLLQKLTDAQIA
A0A5M4AAB9      QDISKRTDSLRKQTRSLP--AV--ERDYVNIERSY-QLNNNNYN----FLLQKLSEAQIA
F4KR18          NKLKYHYDQSSNHLRSVP--SK--ERGLSDRVRIQ-SIKENLYV----YLLQKREETALA
A0A229I3A5      GTLQANEAATTSQIASNP--NQ--AKYLQTVGRQQ-KVKEALYL----FLLQKREENELS
A0A3R6HJB3      GTLQANEAATTSQIASNP--NQ--AKYLQTVGRQQ-KVKEALYL----FLLQKREENELS
R6NN15          HSLEKSDQRATERIAANP--SQ--AKYLLSVERQQ-KVKESLYL----FLLQKREENELS
C9LKL0          KSARSNESVINGEVSRAP--GL--ERRALSIGRQQ-NLKEALYT----YLMNKREEVALQ
A0A3D0QPV7      GSLKDKIRQYETIYYGLP--EK--EIEHARMERMF-AINEKYHT----MLLEKKTEYEIS
A0A496KT23      RVTESSHSEATSKISANP--RQ--ASYLLSVERQQ-KVKESLYL----FLLQKREENELS
L1M9T3          RATEASHSEATSRISANP--RQ--ASYLLSVERQQ-KVKESLYI----FLLQKREENELS
A0A3C0I8F1      GALQSKFSRAQGEFLKIP--SK--ETELKRIKRLH-TIYEAFYS----QMLNKKAEIGIS
R5JJI4          KNIREQEEQTTKRIEAVP--TQ--QKYVLTVERQQ-KIKEELYL----YLLNKREENALT
A0A0A2DQN2      KEMRYQDNQAYAELVTLP--PK--ERQWLDAERQY-KMKEALYT----QLLSKREENLFA
A0A0A2F2N5      REIEIRNRQGLAEMMAVP--NK--QRQWLDIERQQ-RMKEALYT----QLLSKREENTLA
L1NGW4          KDAQGTQSSLLSQLPDVS--NK--GREKAEIDRKI-AIRERLYT----ELLNKREEYALM
Z4WRA0          KDAQGTQSSLLSQLPDVS--NK--GREKAEIDRKI-AIRERLYT----ELLNKREEYALM
U2K8K9          KSVERDQSALFSKLPGVT--EE--GRTKADIDRRL-AIQEGLYT----ELLSKREEYALR
A0A069ZM60      KDIQGQQSSLLSKLPEVS--NQ--GREKADIDRRL-EIRQRLYT----ELLNKREEYALR
J6GV98          KDTQGQQSSLLSKLPEVS--NQ--GREKADIDRRL-EIRQRLYT----ELLNKREEYALR
A0A134B4F8      KDAQGQQSSLLSKLPEVS--NQ--GREKADIDRRL-EIRQRLYT----ELLNKREEYALR
A0A134B8C7      KDAQGQQSSLLSKLPEVS--NQ--GREKADIDRRL-EIRQRLYT----ELLNKREEYALR
A0A3D2HF71      SEADKRLNEVEREIMKLP--ST--ERQMINIQRKF-DINNTVYT----FLLEKRAEAGIA
A0A4Z0EKR0      NSLKASSGQFQSKIKKVP--GM--ERELLEINRQK-SIKQNIYS----YLLQKREEAALS
B5CTK0          KNLQAQEARTASRIAAVP--TH--QKYILSVERQQ-KIKEELYL----YLLNKREENALA
A0A1M6B6D5      RTINRDIGRYEAEIRKLP--KE--QQELLKIERRY-NLSEGTYN----MFLAKRSEAGLV
A0A451FS66      NSINQDIGRYESEIRKLP--KE--QQDLLNIERRY-NLSEGTYN----LFLAKRSEAGLV
A0A2E3GN39      DAVVAEINKLLEELDLLP--LF--EAEYLRLKRDY-EVKSSFYN----SLLDRKASFTLS
A0A3D1MEL0      DAVVAEINKMLEELDLLP--LF--EAEYLRLKRDY-EVKSSFYN----SLLDRKASFTLS
A0A519UDD1      ANLKASSGQFQTKIKQVP--GI--ERELLEINRQQ-SIKQNIYS----YLLQKREETALS
A0A2A4N9A6      ALIDKAVRQ-KQKLDSEVNFDA--AIEYLRVSTAY-KMEKKYYE----RLLEKHANLQIH
A0A6C0GGI1      AVTNQSISQLENNIFRLPQDQR--QLEQLQSKKDYNEQTVAFYE----Q--KRAAAEILL
A0A368D1N7      DAVVAEINKLLEELDLLP--LF--EAEYLRLKRDY-EVKSSFYN----SLLDRKASFTLS
A0A3B8TU58      QLMIDEINKILEELDVLP--LF--EAEYLRLKRDY-ETKAMFYN----NLIERKSSFSLS
A0A1T5IIR6      RDLSDRERNAVAKFSSMP--TK--ERQMLEIQRQQ-SIKQELYL----FLLNKREENALS
F0R0C9          RSLQRSEQQTTERLAANP--SQ--AKYLLSVERQQ-KVKEALYL----FLLQKREENELS
A0A6L6NXQ0      NELLRNERRTTAKIAVNP--DQ--TKYLQTVGRQQ-KVKEALYL----FLLQKREENELS
A0A6N8DCX3      NELLRNERRTTAKIAVNP--DQ--TKYLQTVGRQQ-KVKEALYL----FLLQKREENELS
A0A3E0QD27      NNIDERIREFEGNFLKLP--SQ--EAELSRLSRLF-EINQKFYQ----LLLEKKVEFSIT
A0A0M1W1I6      NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALS
A0A4R4GHU2      NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALS
I8WPR6          NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALS
A0A0K2HKS3      NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALG
B6W3W8          NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALG
A0A4R4GSI6      NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALG
A0A076IRY8      NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALS
A0A3A6AD54      NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALS
A0A3A6MIU7      NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALS
I8WPP8          NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALS
A0A372Y7D2      NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALS
A0A3E4JJC9      NEARSRAGEAQWRGTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALS
A0A3E4WDQ0      NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALS
A0A414H9P2      NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALS
C3R5A8          NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALS
A0A1C5XJA7      NDAQNREMRVQERLSAMP--TK--ERQMLSIERQQ-KIKESLYL----FLLNKREENALS
A0A285T4L1      NDARSRQAQAQARFTTVP--TK--ERQMLSIERQQ-KIKESLYM----FLLNRREENALS
A0A3E5BU42      NDARSRQAQAQARFTTVP--TK--ERQMLSIERQQ-KIKESLYM----FLLNRREENALS
R7CUW4          NDAQNREMRAQSRVTSIP--TK--ERQMLSIERQQ-KIKESLYL----FLLNRREENALS
A0A416GGJ1      RDALSRETRAQVRFSSIP--KK--ERKMLSIERQQ-KIKESLYM----FLLNRREENALT
D1JY72          NEARSRAGEAQWRVTNIP--RQ--QQQMLSIERQQ-RIKEELYL----YLLNKREENALG
D7J4K6          NDARSRQEQAQARFTTVP--TK--ERQMLSIERQQ-KIKEALYM----FLLNRREENALS
Q8ABP9          NDARSRQEQAQARFTTVP--TK--ERQMLSIERQQ-KIKEALYM----FLLNRREENALS
A0A5M6AHF7      NDARSRQEQAQARFTTVP--TK--ERQMLSIERQQ-KIKEALYM----FLLNRREENALS
A0A6L4IA73      NDARSRQEQAQARFTTVP--TK--ERQMLSIERQQ-KIKEALYM----FLLNRREENALS
D6D2Z5          NDARSRQEQAQARFTTVP--TK--ERQMLSIERQQ-KIKEALYM----FLLNRREENALS
A0A1T3EDR4      RQASALEQRALGQMLKVP--SK--EREQYSIYRSH-AVKENLYL----YLLNKREENALN
A0A174SDD8      QDYSLQENQVRQKVQAVP--RK--QREMLSVERQQ-KVKESLYI----FLLNKREENALS
A0A1H7RFH3      QDYSLQENRVRQKVQAVP--RK--QREMLSIERQQ-KVKESLYI----FLLNKREENALS
A0A139L1N2      QDYSLQENRVRQKVQAVP--RK--QREMLSIERQQ-KVKESLYI----FLLNKREENALS
A0A174TVL8      QDYSLQENRVRQKVQAVP--RK--QREMLSIERQQ-KVKESLYI----FLLNKREENALS
A0A1H8BJR6      QDYSLQENRVRQKVQAVP--RK--QREMLSIERQQ-KVKESLYI----FLLNKREENALS
R9H6G0          QDYSLQENRVRQKVQAVP--RK--QREMLSIERQQ-KVKESLYI----FLLNKREENALS
A0A412GR09      QDYSLQENRVRQKVQAVP--RK--QREMLSIERQQ-KVKESLYI----FLLNKREENALS
A0A6I0S0M4      QDYSLQENRVRQKVQAVP--RK--QREMLSIERQQ-KVKESLYI----FLLNKREENALS
A0A081PBV5      NNLKKEQTQARNKAMAVP--AK--QRMMLSVERQQ-KVKEELYL----LLLNKREENAIN
A0A1I2AN85      NNLKKEQTQARNKAMAVP--AK--QRMMLSVERQQ-KVKEELYL----LLLNKREENAIN
A0A4U0GMP3      RNAQREGGAARSKVQSIP--PK--ERVMLSVERQQ-KVKEELYI----FLLNRREENSLN
A0A1H6CKR6      RNLRQEENAAIGRARSMP--AK--QRMMLSVERQQ-KVKEELYI----FLLNKREENAIN
A0A235E1C0      SNMKDEENAAIGKARSLP--SK--QRIMLSAERQQ-KVIEELYI----FLLNKREENAIN
R6D982          TEISGQERLARRKVRDVP--GK--QREMLSVERQQ-KVKESLYL----FLLNKREENALN
A0A1F0I8C4      NDYTVQENRVRQKVQAVP--RK--QREMLSVERQQ-KVKESLYV----FLLNKREENALN
A0A3A5RIJ2      NDYTVQENRVRQKVQAVP--RK--QREMLSVERQQ-KVKESLYV----FLLNKREENALN
A0A515IZJ5      NDYTVQENRVRQKVQAVP--RK--QREMLSVERQQ-KVKESLYV----FLLNKREENALN
A0A5M5NLR3      NDYTVQENRVRQKVQAVP--RK--QREMLSVERQQ-KVKESLYV----FLLNKREENALN
A0A0D5BSQ0      NNAKQEEATAQSKTLQIP--QQ--ERAILSIERQR-KIKEELYL----FLLNKREENALN
A0A1T3F6P5      NNTRQEEGVAQSKMLQMP--QK--ERTMVSVERQR-RVKEDLYM----FLLNKREENALN
A0A0W8EPA0      NNTRQEESIAQGKMLQMP--QK--ERTMVSVERQR-RVKEDLYM----FLLNKREENALN
A0A365UKN1      NNTRQEEGIAQGKMLQMP--QK--ERTMVSVERQR-RVKEDLYM----FLLNKREENALN
A0A4R6WE41      NNVQREENQVKGQVMQIP--GK--QRMILEVERKQ-KVKEDLYL----FLLNKREENALN
A0A2T5RP38      RNAQREEEQAIGKTLQMP--KK--QRAMLSVERQH-KVKEELYL----YLLNKREENALN
A0A1A6CF06      NNARQEGRTAQAKVLQMP--QK--ERTMLSIERQH-KVKEELYL----FLLNKREENALN
A0A1T3D6S8      NNARQEGRTAQAKVLQMP--QK--ERTMLSIERQH-KVKEELYL----FLLNKREENALN
A0A1P8E011      GNMKKEENVARGKAMQVP--QK--QRVMLSVERQQ-KVKEELYL----YLLNKREENAIN
A0A1V3N3U3      RNAQQEESMAKGKALQVP--KK--QRIMLSVERQQ-KVKEELYL----YLLNKREENALN
C2FUH6          QKARSEEQQARGKVIQMP--QK--QRIMLSVERQQ-KVKEELYV----FLLNKREENALN
A0A0B8T471      RNLQQEEAASRAKAQSLP--AK--QRMMLSIERQQ-KVKEELYI----LLLNRREENALN
A0A4R7D2K0      RNLQQEEAASRAKAQSLP--AK--QRMMLSIERQQ-KVKEELYI----LLLNRREENALN
A0A2X2J8S4      NNAVKEENRASGKSRQMP--QK--QRLVLSIERQQ-KVKESLYV----FLLNKREENAIN
A0A3C0S618      NNAVKEENRASGKSRQMP--QK--QRLVLSIERQQ-KVKESLYV----FLLNKREENAIN
A0A4P7DRF9      RNLQQEENAAIRKAQSLP--TK--QRMMLSVERQQ-KVKEELYI----FLLNKREENAIN
A0A239XXC4      SNMKDEENAAIGKAKSLP--SK--QRIMLSAERQQ-KVIEELYI----FLLNKREENAIN
A0A4U9K473      SNLRDEENAAIGKARSLP--SK--QRIMLSAERQQ-KVIEELYI----FLLNKREENAIN
A0A3M1Y2F5      ESVEDQIRTANGRLSRLP--RN--ERMLTQMGRTY-ESINELYS----YLQKKKTEAEIA
A0A7C7CKY6      ESLHQKVKEIESKFFNLP--TQ--ELEYARILRLF-TINEKFYT----SLLEKKAEYSIS
A0A1G1TG88      ALLDRQQNKLDAKQQGLP--SR--ATEQARLQRPL-ALAEGTYT----MLMGKKVDYNIQ
A0A661XXA6      SDLVNQKIQLNQQLKKLP--SK--STEYNKVKRFY-TLYEEIYL----SLMQSKNEFEIA
A0A3D4RLG4      KDLQNRYKEVEKEIPNLP--TK--ELQMVAIERNY-RIDDNYYT----FFLQKRAETEIQ
A0A2T2UAJ4      --LNERLRENRQKLEQIP--TQ--SIKLAQPQRER-RSTEQIYS----FVQEKLQEARLA
A0A6I0DZQ5      KDLNRRYAEVQQEINQLP--AK--ELEMIGIERRY-KMNDSYYT----LFLQKRAEAEIL
A0A6L3FBV2      KNIREQEEQTTKRIEAVP--AQ--QKYVLTVERQQ-KIKEELYL----YLLNKREENALT
A0A6L3FIH8      KNIREQEEQTTKRIEAVP--AQ--QKYVLTVERQQ-KIKEELYL----YLLNKREENALT
A0A3D3LSK1      GIVNSLSSQYNAQIKTLP--SQ--VIEYAKLERDK-LAAEKLYA----ALESNYQESLIN
A0A496L711      ---------------------------MLDYERRY-KINDSYYT----FLLQKRSEAQIR
A0A1H6Z2F8      SAIHAYGKGFEAEISRLP--GH--QRALLSQSREQ-GIQQELYL----FLLKKRMETAIS
A0A2P8G5K0      AAIRKYGKESEAEISKLP--AH--QRAFLAQSREQ-GIQQELYL----FLLKKRVETAIS
A0A4Q3SEI4      SKLGAGTGMYTSILKGIP--KK--ERDLLDISRQQ-AIKNDAYS----FLLQKREEAAIS
A0A348PT57      ------------------------EIEYARIERVY-NSNEKYYT----LLLEKKTEYAIS
A0A7C3PTI0      ---KKAKEFEFDKLSTLP--ED--EVEYARLQRLY-AINEKFYT----LLLEKKTEYSIS
A0A5Q4EKA0      KEILSKIESYEGILLNHG--GRYSLIEYSMLQRVH-TINERFYN----QLVEKKAEYSIS
A0A519SYE7      ATLNTRL-------MAMP--DL--ATQQDRLKRPL-DLYANTYS----QLLNQKLNFGIQ
A0A7C7CFR2      QTLESKIKEVEDKFYNLP--TQ--ELEYARLLRLF-TINEKFYT----NLLEKKAEYSIS
A0A3D4CJE1      NEVAQKIKEFEQKFYNIP--AK--ELEYARLERMF-SIDEKFFT----LLLEKRTEYSIS
A0A7C7LI79      ETLKGKINEIEAKFINLP--TK--ELEYARLLRLF-SINEKFYT----TLLEKKAEFSIS
A0A4Q5ZQ60      ASLSNTIMQAENELLKLP--SK--ETDLTRLRRFY-NLYEQSYL----LLMEKKIQFGIA
A0A519Q885      GLLGDQDSKLENKRRVLP--LL--ATQEARLQRPL-ELYSGAVR----DLMQKQLEYEIQ
A0A519TAP8      ------------------------------------SLYASTYQ----RLVDRKMDFNIQ
R5DEG6          KNIRAQEEQTSRRISAVP--TQ--QKEVLSVERRQ-KIKEELYL----YLLNKREENELT
A0A3N2LCI3      SSLQGSQASTTSKIASNP--SQ--AKYLLSVERQQ-KVKESLYL----FLLQKREENELS
A0A6L6NZ03      RSLEAIGGQATSQIASNP--KQ--SKYLLSVERQQ-KVKESLYL----YLLQKREENELS
A0A642EJV3      KSLRQTEQQTTSRIAANP--TQ--AKYLLSVERQQ-KVKEALYL----FLLQKREENELS
A0A6H9Q899      KSLRQTEQQTTSRIAANP--TQ--AKYLLSVERQQ-KVKEALYL----FLLQKREENELS
A0A6L4ENN1      KSLRQTEQQTTSRIAANP--TQ--AKYLLSVERQQ-KVKEALYL----FLLQKREENELS
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ------------------------------------------------------------
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      ------------------------------------------------------------
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
R7JFY1          ------------------------------------------------------------
A0A1V5S5I3      ------------------------------------------------------------
A0A2M7VVW6      ------------------------------------------------------------
A0A413V760      ------------------------------------------------------------
A0A656PYT8      ------------------------------------------------------------
A0A6A0Y068      ---------------------S--------------------------QAFTAYNTRIVT
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      --------------------ML--------------------------TAGTTADFQILS
                                                                            

A0A2T4XEQ1      EQTQF-GLGRPLDYA-VAP-LSPFKPNKRLFILIGIFLGGAVGVGLAFGR-EFLNRTIDG
A0A2K8ZAP1      AASRV-SDSRIVDPA-HTT-SQPVKPVKLMIFALFAVVGLVIPIGVITAK-DTVNNHVLR
A0A519SD85      RAAVI-PGAVIIDKA-DYP-EEPNLPLPVTLYTSSALFGLAGGITFIFLK-RKINPFVNI
A0A3M1TXY5      LATDI-ANKFVVDEAKQVG-SGPVSPKVGLIYAVAFVLSLGLPLAIMLVY-DFFNEKISG
A0A2E0VQ27      QQSDL-FPHKIIEHA-VRP-KATVAPNKSLYYGMAFLLALLAGMFYAYLR-SYVKETVSS
R6U429          SLVNV-GNTRLVMEP-AGE-DMPQSPNKKMIMLIALILGAGIPFGIFFMI-NQLDTRVKT
A0A5C8AF42      DAGYA-SNNRILSRP-AVN-NTPVSPNRKLIYVTFVFFGIVIGLGIMFFK-YLTFNEINM
A0A239K409      LATSA-PNSLVLRPA-IIE-GVPVEPKKQTVFLLAFIAGLGVPLASIFIK-NAFNRKVQQ
A0A1V5S1J9      KASNS-PDNIILDKA-RLA-SMTNAGEKNKAYTMFLAIGLLVPVAIIVLL-ELMVPYIRT
A0A0A2EYC8      KASNS-PDNAVMQKA-RTM-SLINAKEKQNKYIVFLLIGLAVPAALIILK-ELLNNAIRT
A0A2G6H6Y4      KASNT-PDNTVLQTA-MIS-GQLNDKEKRTNYLIFIVLGLMIPVVLIVLK-EFMNSAVRT
A0A1M3DPL8      KASNT-PDNNILDRA-RTT-SVTNQGTKSKTIMMYFLIGILLPSVFIILK-ELLNNTIRT
A0A1V5F519      KASNT-PDNNILDQA-RTV-SLINADVKSNTMFMFILLGILIPSLIIVLK-EVLNNTIRS
A0A2G6R1T9      KAANS-PDNEVVEQA-RVR-FVVNGGKKKETTMTYLLFGLMIPAIFLIAR-ELLNNTIRG
A0A350V3E4      EESQP-NNVKIIDYG-KVP-KAPSKPNRFLIITIGLLIGLGLGYGFALLR-NILDVSVKS
A0A6J4K208      LATGR-TGSMIVDEARPDG-QKPVYPDAPLVYTVAALLGLLLPLGLLTLR-HFMRNRIIN
A0A1M6MYT6      KASNI-PDSQMIEEAKMAG-TGPVEPQKRKIYALALLLALAFPTGIIILL-DLLNTKILS
A0A2P8CDS1      KASNM-PDNEIIDPARMEG-NTPISPNNMTIYLVALLFGIFLPAGGIILK-NEFDNKVRT
A0A353WYK7      QAGTV-TDFKILSSA-SLP-SNPIAPNKILIWAGAIIASVILSFLFIIIR-YLLHNSVSS
A0A355BP94      QAGST-PDLKILSSA-ILP-GRPVAPNRYLILGIGLVAGLVINFFFISIV-YLLSNKITS
A0A136LSC7      QAGST-PDFKILSPA-TLP-IKPISPSKVMVLGIGFVAAIVLCLFFIGLV-YLLNNKITS
A0A5C7N8Q5      QAGST-PDFKILSPA-TLP-TTPISPSKIMVLGIGFVAGIVLSIFFIGLV-YVLNNKITS
A0A2W4RDE8      IASNV-VEKSVVDEAMMVG-SAPVSPNKRMIYAAAFILGFGGALGLLILK-DFLNDNIVT
A0A0L8VEV2      HASNV-SDTEVLDEARPEL-AELMGPYLTFNVAGGLLAGLFVPFMVIMLA-TYFYDRIKS
A0A1I2A9Z9      HASNV-SDTQVLDEARPEL-ASRLGPNLVINVAGGMLAGLFIPFVVIMLA-TYFYDRIKS
A0A212J9Z9      KASNT-PDNFIWEAPRQMG-GAVNGGEIGKNYTYYFIIGLILPLCFVVLKEEILNFSITT
F5IV23          KASNT-PDNFIWEAPRQMG-GAVNGGEIGKNYTYYFIIGLILPLCFVVLKEEILNFSITT
F8X2T0          RASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITS
A0A1M3LAG1      RASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITS
A0A212K6G4      RASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITS
A0A4Y9IPG7      RASNT-PDNFIWEYPRMVG-GAMNTGEKSKNYMYFLMIALVIPLIFVVVKEEVLNFAITS
A0A2V3PNY7      KASNI-PDNFIMEAPRQKG-GPVNGDEKRKNYTFYFFIGLGLPLLFVIAKEEIFNLVIST
A0A6G7WQ31      KASNI-PDNFIMEEPRQKG-GPVNGDEKSKNYTFFFLIGLALPLAFVVCKEEIFNHAIST
A0A6G7X5K8      KASNI-PDNFIMEEPRQKG-GPVNGDEKSKNYTFFFLIGLALPLAFVVCKEEIFNHAIST
A0A1M5DFS8      KASNI-PDNFVLEEPRQLG-GPVNGDEKKKTYTFYLAIGLAIPLIFVICKEELFNYAIST
A0A4Y8KZS5      KASNI-PDNFVLEEPRQMG-GPINGDEKNKTYTFYLAIGLAIPLIFVICKEELFNYAIST
A0A142HHS5      NAGTT-ADFQILSPA-FAP-EEPISPKKLLVYAIGLAGGLILGLGLIGTR-YLMHNTITS
A0A660LQT8      IAFTA-YNTRIITPP-MGS-NKPISPVKRNILLIALGLALALPFGIFYLR-EMLDTRVRG
A0A2M6GH67      KAGTT-ADFQILQPA-SLP-AAPIKPDKLMVYAIGLASGLFLGIGLIAAR-YFMHNTITN
A0A389LWV6      LASNM-PDNLVLDNA-RTT-GLVNAGDISNTYVYFVVTGLILTIIFIFLKEVLLKTSIQS
A0A1G9B1T9      VASNA-STKKVVEEARLDG-RTPVSPNKILILLTAIVLGLALPVGALILA-DMFQDKISS
A0A350PNH9      KAFTA-YNTRIITPP-TGD-TKPVQPVRRNIILVAFVLGVLIPVVVIFIR-ENMNTTVRG
A0A354LNT9      KAFTA-YNTRIITPP-TGD-TKPVQPVRRNIILVAFVLGVLIPVVVIFIR-ENMNTTVRG
A0A161LWY6      RASNV-PDNTILERA-RMI-SITNGGDKKKSMMMALALGLIIPLLIIILK-EYLKTKVMD
A0A6I3N9U6      RASNV-PDNTILERA-RMI-SITNGGDKKKSMMMALALGLIIPLLIIILK-EYLKTKVMD
A0A3D0FMX4      KASNT-PDNDRLDKA-RIL-ECTNAGAKNANRTKYLLLGLIIPFLFVILR-ELLNNKVRT
A0A1M3MEI8      KASNT-PDNNILDRA-RVI-NVVNQGEKSKTTLLFLLLGLVVPAGFVVVK-ELLNVRIMT
A0A1J5HQM0      KSSNT-PDNNILDRA-RII-AVTNDGTQSKTTLTFLIIGLLIPAAFVALR-EFSNGTIRS
A0A653AC35      KASNS-PDNNILDKA-RIM-GVTNGKVISKNYMTYGLIGFLIPFLIVLLT-ELLNNTIRN
E4T131          KASNT-PDNDILDKA-RIV-GVTNSDKRSKTTMVFLLFGLLIPTFIVILI-ELLNNTVHS
A0A521H707      KAGII-TNNIVLEQGKPAL-NPL-SPNRKLILAGSLLVGFILSFVIIFVK-YLFYNEITS
A0A1F3D6P8      MASNY-PDFEVIEPAREFT-KKIIVPRPKLSYLLAIFFGLAIPTTFIFIR-NFFNNKISS
A0A356Z058      MASNY-PDFEVIEPAREFT-KKIIVPRPKLSYLLAIFFGLAIPTTFIFIR-NFFNNKISS
A0A3D1BT36      MASNH-PDYEVLESARSIT-SSIIKPKKMINYIASFFLGLLIPSLIIILK-DFFNEKITR
A0A5R9QZP0      MASNY-PDYEILEPARLVT-SSVISPKTTINYLLSLFIGFIIPSIFTLLK-VFFSQKVSS
A0A3D3HL11      MASNY-PDYEILEPARDVT-ASIIAPRTNLNWLIALFMAFMVPTIYIILK-NFFNEKISS
A0A6L8U6G9      MASNY-PDYEILEPARDIT-ASIIAPRSSLNWIIALFMAFMIPTLYIILR-NFFNEKITS
A0A352ME00      LASTR-PDYEIVEPARTIT-SRIVAPKSAINYMMALFFGLLLPTLYLMIR-DFFDDKIRS
A0A6L8UH35      LASNY-PDYEILEPAREIT-SKIVSPKDFINYLIAVFMGLLIPTMYLVLR-DFFDDKIRS
A0A2W7RD29      KASNI-NNNKIIEQA-KAN-ALPIGPRKLNFYGYAIIITFLLPVIITFLQ-ETVFKKLVD
A0A3N2NDY8      QKFTA-DNTRIITPP-TGS-LQPVAPKVKFILAICMFFGLCVPGVAIYII-SATDTKVRS
D7JEV9          KASNS-PDNAVMQKA-RTS-QLVNANQKQKKYMIFFFIGLAIPAVLIILK-ELLNNAIRT
A0A4R6H3B7      HASNV-SDTQVLDEA-RPELAFRLGPNLVINVAGGMLAGLFIPFVVIMLA-TYFYDRIKS
A0A3P1Z8V4      LAIEE-ANVRVVEEP-LFA-SRPISPRKGIIMLIALLLGILIPSFAFWLL-DLFDHTVSG
A0A2W7QSQ0      LEVTGVSSAQMVDPP-IAS-LKPVKPNKLMIMAAALGLGLSLPLGLILVN-YLVTSKVTS
R7F6L5          QAFKS-YNTQVVRQP-AGP-GAPISPVSTNTYLIAVLIGLIIPSGVYVVK-ANLDNKVRS
A0A7C5MRV2      KASIV-SSVYILDRA-LTP-RAPISPLAQKVYIIGCGLGVCLGLLLILLS-GMLKNTVSY
A0A553GA49      KASNL-PAFELIDYP---AFDGRAAPKKSRNLILMVFFGLLLPTIYVLLN-ESYFEKISD
A0A497D6F6      RASNV-SDSRVIEDA-HIKGIGPVEPKKSRIYLIALFLGLFVPALIILMK-YFSTNKITT
A0A5M4AAB9      KASNT-PDNEVIDPA-RIIGDKPVKPNNIKTGIAALLLGIFFPSTLIIIR-NALDNKVRT
F4KR18          LVSNY-ANALLFDPPYSSIG--PVGPNKIKIFAAAGMGGLAIPFFLILVL-ELLKNSVQT
A0A229I3A5      KAFTA-YNTRIITPP-TGD-NTPVEPVRRKILLIALVLGFLIPMVVIYIR-EKANTTVRG
A0A3R6HJB3      KAFTA-YNTRIITPP-TGD-NTPVEPVRRKILLIALVLGFLIPMVVIYIR-EKANTTVRG
R6NN15          QAFTA-YNTRVITPP-TGS-MAPTAPMKKNILLVALALGVLIPVVFVFLQ-ETLNTRVRG
C9LKL0          LAVND-ANVRLVEDP-LGS-NTPISPSRSTIILISLLIGLLIPTLILTIR-RLMDITVSG
A0A3D0QPV7      LAGQT-TGNQILEQA-TIP-KLPVSPKKRMIVIAFFFIGILFSSVMIVIR-YLMHNEITT
A0A496KT23      QAFTA-YNTQIIETP-HIT-GIPPQPVSRNILLTAFLIGLAIPAAFVFGR-EALNSTVRG
L1M9T3          QAFTA-YNTQIIETP-HVT-GTPATPVSKKILGIALLLGLGIPAALIFAR-EGFNTTVRG
A0A3C0I8F1      RSAIV-PEFVILAPA-SQP-TKPIYPVPTNIYSLGLAAGVVLSLLLVAIR-YLLNNTVAN
R5JJI4          QAITE-SNARIIDPA-SGS-SVPVAPKSMMILLAAIVLGGTIPMIVLWLL-NVTDTKVRT
A0A0A2DQN2      QTITN-NNAYILDLG-VGT-SAPISPVPSRSILLGIVLGLFIPAAYAILK-LLTDTKIHS
A0A0A2F2N5      QTAQS-NNAYVMDFD-TGS-NSPISPNTTRTLLISFAIGLFIPTAFFLLK-LLADTKVRT
L1NGW4          QAMTQ-DSAYILDMN-DAP-APPVSPNKTRTVLLAILIGLALPTIGLIIR-LLADNKVRT
Z4WRA0          QAMTQ-DSAYILDMN-DAP-APPVSPNKTRTVLLAILIGLALPTIGLIIR-LLADNKVRT
U2K8K9          QSMTQ-DSAYILDMN-DAPNTPPVSPNTLRTIVLAFLLGLALPTIFLIVR-LLTDNKVRT
A0A069ZM60      QAMTQ-DSAYVLDMD-DAP-SKPISPNTLRVVLIAILIGLVLPSVYLIIR-LLADNKVRS
J6GV98          QAMTQ-DSAYVLDMD-DAP-SKPVSPNALRVALIAILIGLVLPSVYLIIR-LLADNKVRS
A0A134B4F8      QAMTQ-DSAYVLDMD-DAP-SKPVSPNTLRVVLIAILIGLVLPSVYLIIR-LLADNKVRS
A0A134B8C7      QAMTQ-DSAYVLDMD-DAP-SKPVSPNTLRVVLIAILIGLVLPSVYLIIR-LLADNKVRS
A0A3D2HF71      RASTV-SDNRIIDYAGVYS-STMIKPKERQNFMLAIILGLFFPGIGILLL-DYFNNKIID
A0A4Z0EKR0      LAATT-AIARVIDPA-TGG-DYPISANSRTIYLMALLLGLAIPFGGIYTN-NLLDNKVQS
B5CTK0          QSITE-SNVRTIDPA-SGS-NTPIAPDRMRIWMISFLIGIGIPAVFLMLL-KMTDTKVRT
A0A1M6B6D5      KAANV-SDVLVIDPAKDTG-GGQIGPNTQLNYMMAGLIGFFVPILLIFVR-AFFDTKVES
A0A451FS66      KAANV-SDVVIIDTAKDTG-GGKIGPNTQLNYVMAGLLGLFIPLFIIFGM-AFFDTKVEY
A0A2E3GN39      RAGIV-SDYIILEMP-KIA-EKHVAPDDSFIRFVGLAIGAILSLILVVFR-YVTHKEIIN
A0A3D1MEL0      RAGIV-SDYIVLEVP-KIA-EEHVAPDDSFIRFVGLAIGAILSLILVVFR-YITHKEIIN
A0A519UDD1      LAATA-SVARVLDPA-MGG-NFPVSPNGRTIYLMSLLLGLGLPLAGIYAA-NLLNNKVQT
A0A2A4N9A6      AAGII-NDVVILAEA-SVP-KIQEYPSPVYAMLTGIISFLMLSLITVIFR-YMLHNKISH
A0A6C0GGI1      ATNAP-SKKRVDYAK-MVG-NGPMSPKTNAIYLIAFLVGLFIPAGGILAY-DLVNNTIKS
A0A368D1N7      RAGIV-SDYIILEMP-KIA-EQHVAPDDSFIRFVGLAIGAILSLILVVIR-YITHKEIIN
A0A3B8TU58      KAGIV-SDYTILENP-KIA-KNHISPNDSFIRFVGLAIGAILSLILVVFR-YITHKEIIN
A0A1T5IIR6      QAMAD-DNIRVVDPA-VAN-LTPTSPQRMKIVMLAILIGLLIPGVILIAR-LFLDTKIRT
F0R0C9          QAFTA-YNTRVITPP-TGS-MLPTAPVRRNILLVAFALGLLIPVVIVFVR-ENMNTKVRG
A0A6L6NXQ0      QAFTP-YNMRILTPP-SGN-LEPVAPQKKKILAVAFLLGLMFPAGCILLR-ENMNTTVRR
A0A6N8DCX3      QAFTP-YNMRILTPP-SGN-LEPVAPQKKKILAVAFLLGLMFPAGCILLR-ENMNTTVRR
A0A3E0QD27      KAGII-SNNIVLERG-KPA-VNPLSPNRRLVIAGSLLLGFIISFLIIFVK-YLFYNEITT
A0A0M1W1I6      QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRN
A0A4R4GHU2      QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRN
I8WPR6          QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRN
A0A0K2HKS3      QATTE-TDARVLDPA-GGG-DTPISPNGRSMIMAGIMKGIALPAIVLLLF-LFFDTRIRN
B6W3W8          QATTE-TDARVLDPA-GGG-DTPISPNGRSMIMAGIMKGIALPAIVLLLF-LFFDTRIRN
A0A4R4GSI6      QATTE-TDARVLDPA-GGG-DTPISPNGRSMIMAGIMKGIALPAIVLLLF-LFFDTRIRN
A0A076IRY8      QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRN
A0A3A6AD54      QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRN
A0A3A6MIU7      QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRN
I8WPP8          QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRN
A0A372Y7D2      QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRN
A0A3E4JJC9      QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRN
A0A3E4WDQ0      QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRN
A0A414H9P2      QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRN
C3R5A8          QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGVMKGIALPAIVLLLF-LFFDTRIRN
A0A1C5XJA7      QAMAD-NNARVIDSA-EAT-KYPISPNRNKILALGILLGLALPTVSFLVI-MFMDTRIHS
A0A285T4L1      QAMAD-NNARTIDSV-DGP-VGPIAPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVRS
A0A3E5BU42      QAMAD-NNARTIDSV-DGP-VGPIAPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVRS
R7CUW4          QAMAD-NNARIIDSA-EGG-DSPISPRRNRILLLGLLVGIALPGVGCLLV-LFLDTRVHG
A0A416GGJ1      QAMAD-NNARLIDEA-DKG-SGPIAPVRNRILILGLLAGIALPGVACLLI-LFLDTRVHG
D1JY72          QATTE-TDARVLDPA-GGG-DAPISPNGRSMIMAGIMKGIALPAIVLLLF-LFFDTRIRN
D7J4K6          QAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHS
Q8ABP9          QAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHS
A0A5M6AHF7      QAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHS
A0A6L4IA73      QAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHS
D6D2Z5          QAMAD-NNARTIDSV-DGP-AGPISPVRNRILLLGVLVGLAVPGVVFLMI-LFMDTRVHS
A0A1T3EDR4      AAIGE-AKLHVVDHA-VIS-HVPISPNILISVFTGLGIGFLVWVALLLLR-LFLNTTVKS
A0A174SDD8      QAMVD-NNARVLDPV-SGS-NIPISPNKYKKLMLGVGCGVIVPSVILLLM-LILDTGVHN
A0A1H7RFH3      QAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHN
A0A139L1N2      QAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHN
A0A174TVL8      QAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHN
A0A1H8BJR6      QAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHN
R9H6G0          QAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHN
A0A412GR09      QAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHN
A0A6I0S0M4      QAMVD-NNARVLDPV-SGS-NIPISPNKYKKLLLGVGCGVIVPSVILLLM-LMLDTGVHN
A0A081PBV5      QAMTE-DNVRIIDPA-SGS-DAPIYPSRIKKLALGVGIGIALPAIVFLLM-LMLDTGVRS
A0A1I2AN85      QAMTE-DNVRIIDPA-SGS-DAPIYPSRIKKLALGVGIGIALPAIVFLLM-LMLDTGVRS
A0A4U0GMP3      QAMTD-DNVRIIDPA-SGS-SAPIYPSRFSKVALGVGIGAAIPAVVLLLM-LLLDTGVRN
A0A1H6CKR6      QAMTD-DNIKVIDSA-NTS-NYPFYPSLLKKLALGIGIGLAIPTAILLLI-LMLNTKIRY
A0A235E1C0      RAMTD-DNIRVIDSA-SGS-DAPFYPSKFKKVAIGVAIGIAVPAAILLLM-LLLNTKIRN
R6D982          QSMVD-NNARIIDSA-SGS-NAPFYPNKYKKLLLGGGMGILIPTVILLLI-LIVDTRVRN
A0A1F0I8C4      QAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVPTVVLLLI-LVLDTRVHS
A0A3A5RIJ2      QAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVPTVVLLLI-LVLDTRVHS
A0A515IZJ5      QAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVPTVVLLLI-LVLDTRVHS
A0A5M5NLR3      QAMVD-NNARILDPV-SGS-NIPISPNKYNKVLLGAGCGVIVPTVALLLI-LVLDTRVHS
A0A0D5BSQ0      EAIAE-SNLRIVDPP-TGL-DFPVSPNKLKKLSIGVAIGAVLPAVVLLSM-LMLNTGVRG
A0A1T3F6P5      EAVTE-ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAIGTVLPAVVLLSM-LMLNTGVRG
A0A0W8EPA0      EAVTE-ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAIGAVLPAVVLLSM-LMLNTGVRG
A0A365UKN1      EAVTE-ANLRIVDPP-VAT-DSPIYPSRTKKVMTGVAMGAVLPAVVLLSM-LMLNTGVRG
A0A4R6WE41      QAMTE-DNIRIVDPA-YGS-EAPMYPSRLRKVGMGLAVGTVLPAVVLLLM-LMLDTGVRS
A0A2T5RP38      EAMTD-ENIRVVDPA-SGP-DVAVYPNRLKKIFTGVALGTAVPAVILLSM-LVLNTGVRG
A0A1A6CF06      EAITE-ANLRIVDPP-VGD-AYPIYPNRLKKVFTGVAIGTVLPMIVLLSL-LLLNTAVRG
A0A1T3D6S8      EAITE-ANLRIVDPP-VGD-AYPIYPNRLKKLFTGVAIGTVLPMIVLLSL-LLLNTAVRG
A0A1P8E011      QAMTE-DNIRVIDPA-IVS-FDPVAPSRMRKLGLGMAIGFILPAIVIMTL-SILDTGVRR
A0A1V3N3U3      LAMTE-DNIRIIDRA-SVA-TSPIFPSKFRKVATGIGIGLILPTVILLFL-LVFNTGVRS
C2FUH6          KAMTD-DNIRIIDPA-SGS-DAPVYPVRFKKVMTGVGIGIVLPAAVLLCL-LIFNTGVRG
A0A0B8T471      QAMTD-DNLRVVDPP-SGS-EAPIYPSKARKVMTGVGFGVVLPTVVLLLL-LLLDTKVNG
A0A4R7D2K0      QAMTD-DNLRVVDPP-SGS-EGPIYPSKARKVMTGVGFGVVLPAVVLLLL-LLLDTKVNG
A0A2X2J8S4      QAMTD-DNIKVIDPA-SGS-FAPVYPNKFKKVGLGVAIGLVIPSLLLILM-LVVDSGVRN
A0A3C0S618      QAMTD-DNIKVIDPA-SGS-FAPVYPDKFKKVGLGVAIGLVVPSVILILL-LIVDSGVRN
A0A4P7DRF9      QAMTD-DNIRIIDSA-SGS-DWPIYPNKLKKLAIGIGIGLAIPAIVLLLM-LLFNTKIRN
A0A239XXC4      RAMTD-DNIRVIDSA-SGS-NLPFYPSKLKKVAIGVAIGIAVPAAILLLM-LLLNTKVRN
A0A4U9K473      REMTD-DNIRVIDSA-SGS-DLPFYPSKFKKIALGVAIGIAVPAAILLLM-LLLNTKVRN
A0A3M1Y2F5      LANLT-VDLMIIDPA-RYT-GKESRNSRMLIMALALILAIGLPAGFLVVL-SYFSDKVST
A0A7C7CKY6      RAGFV-SKNEILERS-LPP-TIPVSPDRRMIYALSLIVGLILSVGLLLVT-YLLHDVVTS
A0A1G1TG88      KAGTT-ADFQILFPA-SEP-RVPISPVRLMVYAIGLAGGLFLGLGLIAVR-YLLHNTITN
A0A661XXA6      IAGST-TKIKILSPA-TMP-DSPIKPNKTIIYMAGGVSFIVLSFIFIVIS-YLAHDKIDG
A0A3D4RLG4      KASNT-PDNAVLDKA-RTT-YITNAKQQRKTMISYLALGFLLPLVLSVLI-ELIYNKLRI
A0A2T2UAJ4      EQSEI-GYAEIIRSA-APG-RPVGPDTR-RNLLLGLMLGLVAGGGLVVLR-EQLDTRIYQ
A0A6I0DZQ5      KASNT-PDNNILDRA-RVI-NVVNQGEKSKTTLLFLLLGLVVPAGFVVVK-ELLNVRIMT
A0A6L3FBV2      QAITE-SNARIIDAA-SGS-SAPVAPKTMTIFLASIVLGLAIPVGVFWLL-NVTDTKVRT
A0A6L3FIH8      QAITE-SNARIIDSA-SGS-STPVAPKTMMILMVSVALGLGIPMGVFWLL-NVTDTKVRT
A0A3D3LSK1      ERTQT-IKSYVIDPG-YDD-NSPIGPDRRNMNIFGIIAGLIIGLAFALMR-IYFNKNLST
A0A496L711      KASNS-PDNAVMQKA-RTS-QLVNANQKQKKYMIFFFIGLAIPAVLIILK-ELLNNAIRT
A0A1H6Z2F8      RSANI-ANARVIDPP-KAS-PLPVSPNRQLTILVAFLAGLLAPACVIYVG-QIFNNKITS
A0A2P8G5K0      RSANI-ANARVIDPP-KAS-RLPVYPNRELTILIAVFTGILTPLGVLYTS-QIFNNKITS
A0A4Q3SEI4      YAAVV-ADSRTINHA-TAS-FLPISPEKTFVYLVSIVIGLLIGFSFVIIK-ELLTHKVQF
A0A348PT57      EAGFI-SENRVLRRA-STS-RIPISPVKPIIYASFLALGLILSFLLIGIR-YILNNDISG
A0A7C3PTI0      EAGNV-SLHEILEKS-LPP-TSPVSPSKKLVVISAFMVALFVSFGLVLVR-YILHNDINS
A0A5Q4EKA0      KAGYV-SQSVILERS-RVP-GQPISPKPRGVYASSLLAALFLGIGVFLLK-YLFYNEIPS
A0A519SYE7      QAGTT-ANFQILSPA-YPP-GEPISPVRALVYAIGLASGLALGLGLIATR-YLMHNTITS
A0A7C7CFR2      KAGFV-SKNMILESA-TVP-TSPISPDSSKVIALVLIIASFLSAAMLVIS-YLLHNEITS
A0A3D4CJE1      EAGFV-PQHTILEQA-EIP-NVPIKPNKKLIFVVFVFGSLVLGIGFVVIK-YLFHNEITS
A0A7C7LI79      KAGFV-SKNAILEVG-VPP-IIPVSPDKQKVFTLGTLVALFLSGLLLIIS-YLLHNNIIS
A0A4Q5ZQ60      KAGTT-DNSQILSPA-SLP-TLPIYPNKMLVYAIGIAASFFLSIVLVTAR-YFLHNTITN
A0A519Q885      NAGTI-PDFQILSAA-ATP-DEPISPKKILVYAIGLAGGLILGLGLIGVR-YLMHNTVTS
A0A519TAP8      QAGTT-PEFQILSPA-SPP-SEPITPVRLLVYAIGLAGGLILGLGLIATR-YLMHNTVTG
R5DEG6          QRMTE-SNARIIDPA-AGS-NAPVAPKAMMILLASVVLGCAIPAGILWLL-MVSDTKVRS
A0A3N2LCI3      QAFTA-YNTRVVNKP--AS-FGPTAPNTRNILMMSFLLGLAIPFGVVYLM-ESNNTKVRG
A0A6L6NZ03      QAFTA-YNTRIITKP-GGS-MIPTAPVKKNIFLVAFALGILIPVVIVFMR-ENMNTRVRG
A0A642EJV3      QAFTA-YNTRIVTPP-HGS-MLPTSPVHKNIFMVAFALGLLIPIVIIFMR-ENMNTRVRG
A0A6H9Q899      QAFTA-YNTRIVTPP-HGS-MLPTSPVRKNIFMVAFALGLLIPVVIIFMR-ENMNTRVRG
A0A6L4ENN1      QAFTA-YNTRIVTPP-HGS-MLPTSPVHKNIFMVAFALGLLIPIVIIFMR-ENMNTRVRG
A0A1T4NDR5      ------------------------------------------------------------
A0A3D5KRM7      ---------------------------------------------------MVENSESDS
A0A3M1NUH2      ------------------------------------------------------------
A0A7C1IBE4      --------------------------MKIVGKVSKALNKVESVHKPDFTS-PAPPDEPQV
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ------------------------------------------------------------
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ------------------------------------------------------------
R7JFY1          ---------------------------------------MAIPAGILWLR-WANDTRIRS
A0A1V5S5I3      --------------------MIPTAPVKKNIALVAIVLGLLIPVVIVFIR-ENMNTKVRG
A0A2M7VVW6      -----------------------------MIMATGVLLGIVISLIILILK-YVLKNTIST
A0A413V760      ---------------------------------------LGIPMGVFWLL-NVTDTKVRT
A0A656PYT8      -------------------------------------------------M-EILDTTIRG
A0A6A0Y068      PPHGS---------------MLPTSPVHKNIFMVAFALGLLIPIVIIFMR-ENMNTRVRG
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ------------------------------------------------------------
A0A6L8U2P8      ------------------------------------------------------------
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      AASAP---------------DAPISPKKMLVYAIGLAGGLVLGLGLIGVR-YLMHNTVTS
                                                                            

A0A2T4XEQ1      LDKLKGSGYPI------LAVIPDFTEYVKKKYEEKSKVAVKGRLVSTNWFSLLDNIS---
A0A2K8ZAP1      RSDVE-EVTQI--PI--IGEVIKER-------------------QLGTESFVFKSRMHS-
A0A519SD85      AEDIL-QHTIT--PV--LATLRRSTDSN----------------DLLSKNLILQEAPRS-
A0A3M1TXY5      DQDIE-ACTNI--PI--LGYIAR---------------------YEKSNNYIIEKDSRT-
A0A2E0VQ27      KDELEEKLPQY--PI--IGEVYRL---------------------------TRKTPPGF-
R6U429          RNDLT--NMQV--PF--LAEIPQLGQGAGILNK-----MRKKMCDDANTKIVVAPSNRN-
A0A5C8AF42      LDDLK-KLLPS--RASILGGVPLFKSEMEFSQL------------------VVHESPKS-
A0A239K409      RADVE-RATTA--PV--LGEVSY---------------------NDTKDVIVVSESSKT-
A0A1V5S1J9      ESEVI-SMAPK--QYQLLGVIMHTD-------------------RKT--PVIVDKYPKS-
A0A0A2EYC8      EKDIE-KAIKN--KFQIIGTVRHTK-------------------HKADEKVIAAKYPNS-
A0A2G6H6Y4      EKDVD-IATKN--RFDIIGSVLHTK-------------------HKTEDKVIAPKYPNS-
A0A1M3DPL8      SRDVE-K--MS--AFPLIGLVRHTN-------------------STD--PYLIVNNPRS-
A0A1V5F519      IKDIE-K--RS--VFPVIGMIRHAK-------------------NDL--PDLTLKNPKS-
A0A2G6R1T9      QKDVE-K--NS--KFPIIGNIRHTK-------------------KAN--PLLTLKHPRS-
A0A350V3E4      PEDLE--NIGI--SL--IGWVPTFMREPKAGRH-----------THTEQELVLAYNSDS-
A0A6J4K208      QTDIQ-LNTAI--PT--LGVVGY---------------------NEKAGNYLVAYSSKS-
A0A1M6MYT6      KDDVE-ALTDY--PI--IGHVFNNR-------------------KESESHTLVLDKPNS-
A0A2P8CDS1      PEDLE-NLTKY--PI--LGHIIHDD-------------------QAAISHTALLDHPNS-
A0A353WYK7      EKDIE-HITPT--SI--LGSIPFV--------------EKLK--GRDSDRLVIDKVPKS-
A0A355BP94      LQEIE-RTIHV--PV--LGVIP-----------------EMR--RNTTSPFYIVENPRS-
A0A136LSC7      VKEVE-RGINL--PM--LGAIP-----------------ASH--HTVQSLFHVIDNPKS-
A0A5C7N8Q5      VKEVE-RGINL--PM--LGAIP-----------------ASN--HTVQSLFHVIDNPKS-
A0A2W4RDE8      HEDLE-QYTRI--PF--LGVVSHG--------------------SRREQSNVVANALS--
A0A0L8VEV2      AEDIE-EYTDI--PV--IGNIVNS--------------------GIGSEYLAAIDNPRS-
A0A1I2A9Z9      AEDIE-EYSDI--PV--IGNIVNT--------------------GIGAEFLAAIDNPRS-
A0A212J9Z9      KEECE-KISGF--PV--IGTIENV--------------SKKL--N--NGVVLVKNYPKS-
F5IV23          KEECE-KISGF--PV--IGTIENV--------------SKKL--N--NGVVLVKNYPKS-
F8X2T0          KEECE-KISGL--PV--IGTIENI--------------SKKL--A--GGVVLVKNFPKS-
A0A1M3LAG1      KEECE-KISGL--PV--IGTIENI--------------SKKL--A--GGVVLVKNFPKS-
A0A212K6G4      KEECE-KISGL--PV--IGTIENI--------------SKKL--A--GGVVLVKNFPKS-
A0A4Y9IPG7      KEECE-KISGL--PV--IGTIENI--------------SKKL--A--GGVVLVKNFPKS-
A0A2V3PNY7      KEDCE-RLSGL--PV--IGTIENI--------------SKKL--SSSGSTTLVKNFPKS-
A0A6G7WQ31      KEDCE-RLSGL--PV--IGTIENI--------------SKKI--SSSGSTTLVKNFPKS-
A0A6G7X5K8      KEDCE-RLSGL--PV--IGTIENI--------------SKKI--SSAGSTTLVKNFPKS-
A0A1M5DFS8      KEDCE-RLSGL--PV--IGTIENI--------------SKKM--SS-NSTTLVKNFPKS-
A0A4Y8KZS5      KEDCE-RLSSL--PV--IGTIENI--------------SKKM--PS-GNTTLVKNFPKS-
A0A142HHS5      VNELE-RNTKA--SV--LGVIPTYDKEQLNISR------------------LIVDKNPK-
A0A660LQT8      RRDME--NLDI--PH--IGEIPHMDASVESWTSKLLVKLGLKKLPQRLDKNEVVVKPQNA
A0A2M6GH67      LGEVE-RNTKA--PV--LGVVPRYTKEKLLVSK------------------LIVHKNPK-
A0A389LWV6      RSEVE-KISEL--PI--LGTIEH---------------------TERKEMMVLYKYPKS-
A0A1G9B1T9      REEVA-NIISM--PL--VGEVPR---------------------LRRKENALVYSRPRS-
A0A350PNH9      RNDLK--NITI--PF--LGEIPYCISR---KNRPTLLQRIQFWKKPKETLQIVVKAGKR-
A0A354LNT9      RNDLK--NITI--PF--LGEIPYSISR---KNRPTLLQRIQFWKKPKETRQIVVKAGKR-
A0A161LWY6      KRDIE-KLSPF--PY--IGSLPHA--------------------THDDATITVLKRPKS-
A0A6I3N9U6      KRDIE-KLSPF--PY--IGSLPHA--------------------THDDATITVLKRPKS-
A0A3D0FMX4      TREAE-ALSHY--KL--LAQVRH---------------------TRGSNPTEVVDHPRS-
A0A1M3MEI8      NRDVE-KYSSF--PL--IGMIRH---------------------TNSDNPFIVAANPRS-
A0A1J5HQM0      NKDIE-KNSKF--TM--IGSVRH---------------------TNSNDPLITINNPRS-
A0A653AC35      AKDVE-KNSPF--SL--IGAVRH---------------------TQNKDPMLAAHRPRS-
E4T131          TKDVE-KNSVF--PL--IGAVRH---------------------TKSTDPLVVSKNPRS-
A0A521H707      LDEIN-LYTNA--AL--LGIIPKYKSEIPVSQL------------------LVDKNPKS-
A0A1F3D6P8      IYDLE-SLINQ--SG--MGVIFNNNYK---SEA------------------VVLEAPKS-
A0A356Z058      IYDLE-SLINQ--SG--MGVIFNNNYK---SEA------------------VVLEAPKS-
A0A3D1BT36      AYEIE-DVLGK--PV--LSTIYNNSFK---YED------------------VVHKAVGS-
A0A5R9QZP0      VRDIE-RVIHQ--PI--LNLIYTNYHN---TEN------------------VNTEFPNS-
A0A3D3HL11      VRDVE-HMIGQ--PV--MNLIYTNFYK---TES------------------VVKDYPGS-
A0A6L8U6G9      VRDVE-RIIGQ--PV--MNLIYKNYYK---SES------------------VVKDYPGS-
A0A352ME00      INDAE-YMLHR--SV--MSVIYSNNLK---SEA------------------VVAEFPKS-
A0A6L8UH35      LNDAE-YLLHK--PI--LSVIYSNNHK---SES------------------VVAEFPKS-
A0A2W7RD29      PSEIE-KLLNI--PV--IGSIPVAEGK---TNV------------------QLVDYPNS-
A0A3N2NDY8      RKDLD--RMSA--PF--AGEIPFVGKK---SIKDRMARLLPAKKNSKELERVVVAVKEGS
D7JEV9          EKDIE-RATRN--RFPTIGSVRHT--------------------KHKADERVIASKYPN-
A0A4R6H3B7      AEDIE-EYSDI--PV--IGNIVNT--------------------GIGAEFLAAIDNPRS-
A0A3P1Z8V4      RQDVE-NALDI--PI--VGELPHV--------------------KKTTDQTLVYDVDTDQ
A0A2W7QSQ0      KRVIE-KILNA--QI--LGEIAKN--------------DQNG---------VIAISPKSI
R7F6L5          REDVE--NIGI--PF--IGEIPQKGRK---KLG-----KDSS--SERQ---VVVRADST-
A0A7C5MRV2      REEVE-NMSVT--PI--IGVVRRS--------------NESL--KQKYPLLKSVEHPKS-
A0A553GA49      IEDYR-FSFKA--PV--LGQITLC--------------SNGS---------KKIFEPSNE
A0A497D6F6      VDDIK-EITNA--PV--VGLVFNT--------------RKDY--KGNT---LILDKPGS-
A0A5M4AAB9      LDDLK-LLTDS--PV--LGQIPHD--------------EQVL--PSQI---PLLEHPNS-
F4KR18          EEDLKSMLPEK--TI--MGVINHQ--------------KG----KKQH---SLLSKSQN-
A0A229I3A5      RKDLK-K-VNV--PF--LGEIPFSISR---KNRPTLEQRIKFWKKPKEVRMIVVKAGKR-
A0A3R6HJB3      RKDLK-K-VNV--PF--LGEIPFSISR---KNRPTLEQRIKFWKKPKEVRMIVVKAGKR-
R6NN15          KKDLE-N-LSI--PF--VGEIPLYGKV---RRSGLFHKKV----TPLTETKVVVKEGSR-
C9LKL0          RHDVE-EATTI--PL--VGELPTWEEG---GDD------------------GLITTCSS-
A0A3D0QPV7      LHEIT-RISNA--SLGILGIIPKY--------------KEDI--PVSQ---LIVDKNPK-
A0A496KT23      RKDLE-D-YSM--PL--VGELPLKGKK---RPVWKRWRKEKI--VAAPN--MVVADQKR-
L1M9T3          RKDLE-D-MSV--PL--VGELPFKGKK---RPVWQRWRKQTI--VAQPN--MVVADQQR-
A0A3C0I8F1      QKELE-KIIIA--PV--LGVIPF---------------HNKQ--KNAKYSKLVILDNPK-
R5JJI4          RKELD-NILTI--PF--LGDIPR---------------HGTR--KGEDTDAIVVHESGR-
A0A0A2DQN2      RRDVV-DQVSL--PF--LGEIPL---------------NTTK--KGG--EGIGVSEQGT-
A0A0A2F2N5      RKDVL-ERVSI--PY--LGDIPQ---------------SDTN-------LFVAVEPQGS-
L1NGW4          RKDIL-DRLTI--PF--LGDIPK---------------EDAP--GRK--QPRGAREQGS-
Z4WRA0          RKDIL-DRLTI--PF--LGDIPK---------------EDAP--GRK--QPRGAREQGS-
U2K8K9          RKDIL-DRLTI--PF--LGDIPK---------------EER----AKSGHTRGVREQGG-
A0A069ZM60      RKDVM-DRVSI--PF--LGDIPR---------------EEKR--GGKKSQPRGVREQGG-
J6GV98          RKDVM-DRVSI--PF--LGDIPK---------------EEKR--GGKKAQPRGVREQGS-
A0A134B4F8      RKDVM-DRVSI--PF--LGDIPR---------------EEKR--GGKKSQPRGVREQGS-
A0A134B8C7      RKDVM-DRVSI--PF--LGDIPR---------------EEKR--GGKKSQPRGVREQGS-
A0A3D2HF71      KKDIE-KRTSA--PI--IGFIGHNTFK---TDL------------------PAVEHTGS-
A0A4Z0EKR0      QQDVS-AMTPT--PI--LGEISHN--------------NSNE--S------VVVTNGNR-
B5CTK0          KKDIE-NKLSI--PF--LGEIPKY--------------QGKD--D------IIIHENGR-
A0A1M6B6D5      VKDLE-AITPI--PM--IGVI-----------------GKNH--SETV---LAVLSKPK-
A0A451FS66      VKDLA-KITPI--PL--FGVI-----------------GKNH--SGNI---LAVLSHPK-
A0A2E3GN39      IEDIT-SQTET--SL--LGVIQRY--------------SEKL--PMSS---IVVTNRPK-
A0A3D1MEL0      IEDIT-SQTET--SL--LGVIQRY--------------SEKL--PMSS---IVVTNRPK-
A0A519UDD1      QQDVA-SVTEA--PI--LGDIAHN--------D-----TGDT---------VVVARESR-
A0A2A4N9A6      LSDID-RSTNA--TV--LGIIPQF--------K-----REEM--PISQ---LVVEKNPK-
A0A6C0GGI1      KDDVR-GVTNI--PV--LGLIGHS--------D------GKN--GI-----LAKTDNHK-
A0A368D1N7      IEDIT-SQTET--SL--LGIIQRY--------S------EKL--PVSS---IVVTNRPK-
A0A3B8TU58      IEDVT-SQTET--AL--LGVIQRY--------S------EKL--PMSS---IVVTNRPK-
A0A1T5IIR6      RKEIE-ENIDV--PF--LAEIPLNGTL---RGIVFKQGKHKQ--GHDDPSPFVYDPTSH-
F0R0C9          KKDLE--CLSM--PF--AGEIPLAGES---RRKHLFASKTYD--APRG---IVVKQGKR-
A0A6L6NXQ0      RKDIA--RLAV--PF--IGEIPLDTSG---KKKRLLRKQVED--EKR----IVVKEGSR-
A0A6N8DCX3      RKDIA--RLAV--PF--IGEIPLDTSG---KKKRLLRKQVED--EKR----IVVKEGSR-
A0A3E0QD27      LDEIN-LYTDA--AL--LGIIPK---------Y-----KNEI--PVSQ---LLVDKNPK-
A0A0M1W1I6      RKDIE-DVVTV--PF--LGEIPKDSSK---RKI-----ENKK--TAHG---IAVRAQGR-
A0A4R4GHU2      RKDIE-DAVTV--PF--LGEIPKDSSK---RKI-----ENKK--TAHG---IAVRAQGR-
I8WPR6          RKDIE-DAVTV--PF--LGEIPKDSSK---RKI-----ENKK--TAHG---IAVRAQGR-
A0A0K2HKS3      RKDIE-DAVTV--PF--LGEIPKDSSK---RKI-----ENKK--TAHG---IAVRAQGR-
B6W3W8          RKDIE-DAVTV--PF--LGEIPKDSSK---RKI-----ENKK--TAHG---IAVRAQGR-
A0A4R4GSI6      RKDIE-DAVTV--PF--LGEIPKDSSK---RKI-----ENKK--TAHG---IAVRAQGR-
A0A076IRY8      RKDIE-DAVTV--PF--LGEIPKDSSK---GKT-----ENKE--TAHG---IAVRAQGR-
A0A3A6AD54      RKDIE-DAVTV--PF--LGEIPKDSSK---GKT-----ENKE--TAHG---IAVRAQGR-
A0A3A6MIU7      RKDIE-DAVTV--PF--LGEIPKDSSK---GKT-----ENKE--TAHG---IAVRAQGR-
I8WPP8          RKDIE-DAVTV--PF--LGEIPKDSSK---GKT-----ENKE--TAHG---IAVRAQGR-
A0A372Y7D2      RKDIE-DAVTV--PF--LGEIPKDSSK---GKT-----ENKE--TAHG---IAVRAQGR-
A0A3E4JJC9      RKDIE-DAVTV--PF--LGEIPKDSSK---GKT-----ENKE--TAHG---IAVRAQGR-
A0A3E4WDQ0      RKDIE-DAVTV--PF--LGEIPKDSSK---GKT-----ENKE--TAHG---IAVRAQGR-
A0A414H9P2      RKDIE-DAVTV--PF--LGEIPKDSSK---GKT-----ENKE--TAHG---IAVRAQGR-
C3R5A8          RKDIE-DAVTV--PF--LGEIPKDSSK---GKT-----ENKE--TAHG---IAVRAQGR-
A0A1C5XJA7      RKDIL-GAVSV--PF--LGEIPLD--------K-----NYKS---SRK---GAANAYGYG
A0A285T4L1      RKDLK-GAVSI--PF--LGEIPQD--------K-----EAAK----------TGVAVGRD
A0A3E5BU42      RKDLK-GAVSI--PF--LGEIPQD--------K-----EAAK----------TGVAVGRD
R7CUW4          RKDIE-KAVSV--PF--LGEIPLD--------K-----EAAR--QHGR---TAKASVGQD
A0A416GGJ1      RKDLE-GVVTA--PL--LGEIPLD--K---KLA-----KKKK--TVHG---PRLFLDKQD
D1JY72          RKDIE-DAVTV--PF--LGEIPKDSSK---RKI-----ENKK--TAHG---IAVRAQGR-
D7J4K6          RKDLK-GAVSI--PF--LGEVP----------Q-----DKEA--AKAG---VAVGEED--
Q8ABP9          RKDLK-GAVSI--PF--LGEVP----------Q-----DKEA--AKAG---VAVGEED--
A0A5M6AHF7      RKDLK-GAVSI--PF--LGEVP----------Q-----DKEA--AKAG---VAVGEED--
A0A6L4IA73      RKDLK-GAVSI--PF--LGEVP----------Q-----DKEA--AKAG---VAVGEED--
D6D2Z5          RKDLK-GAVSI--PF--LGEVP----------Q-----DKEA--AKAG---VAVGEED--
A0A1T3EDR4      REEIE-SALNI--PF--LGEIPYS--------R-----SKSE--SGMG---VFVYHTGK-
A0A174SDD8      RKEVE-SIVSA--PF--LADIPQT--------P-----KAMA--NVHE---VVGRARGL-
A0A1H7RFH3      RKEIE-SIVSA--PF--LADIPQT--------P-----KAMA--NVHE---VVVRARGL-
A0A139L1N2      RKEIE-SIVNA--PF--LADIPQT--------P-----KAMA--NVHE---VVVRARGL-
A0A174TVL8      RKEIE-SIVSA--PF--LADIPQT--------P-----KAMA--NVHE---VVVRARGL-
A0A1H8BJR6      RKEIE-SIVSA--PF--LADIPQT--------P-----KAMA--NVHE---VVVRARGL-
R9H6G0          RKEIE-SIVSA--PF--LADIPQT--------P-----KAMA--NVHE---VVVRARGL-
A0A412GR09      RKEIE-SIVSA--PF--LADIPQT--------P-----KAMA--NVHE---VVVRARGL-
A0A6I0S0M4      RKEIE-SIVNA--PF--LADIPQT--------P-----KAMA--NVHE---VVVRARGL-
A0A081PBV5      RKDIE-EVLSV--PF--LGEIPFT---------------LKD--KGGE---AVVEEKGR-
A0A1I2AN85      RKDIE-EVLSV--PF--LGEIPFT---------------LKD--KGGE---AVVEEKGR-
A0A4U0GMP3      RKDIE-GAVTT--PF--LGEIPFS-------DK-----RRRS--KEGN---LVIEAQGG-
A0A1H6CKR6      RKDIE-DNISV--PL--VGEIPFS--------T-----DLKT--AKSD---IVIKEQGT-
A0A235E1C0      RKDIE-DAVSV--PF--LAEIPFS--------T-----EMKS--AKSE---IVIKEQGV-
R6D982          RKDME-AVVSA--PF--LAEIPKS--------A-----EKVT--EIND---IMVRARGQ-
A0A1F0I8C4      RKEIE-ASVSA--PF--LADIPQV--------S-----KTEA--DAQE---VMVRARGL-
A0A3A5RIJ2      RKEIE-ASVSA--PF--LADIPQV--------S-----KTEA--DAQE---VMVRARGL-
A0A515IZJ5      RKEIE-ASVSA--PF--LADIPQV--------S-----KTEA--DAQE---VMVRARGL-
A0A5M5NLR3      RKEIE-ASVSA--PF--LADIPQV--------S-----KTEA--DAQE---VMVRARGL-
A0A0D5BSQ0      RQDLE-DVLSV--PF--LGEIPLM--------R-----SRKQ--GKSD---VLVSKSGR-
A0A1T3F6P5      RQDLE-NVLTV--PF--LGEIPLA--------K-----GRRQ--GNGD---ILVSQSGR-
A0A0W8EPA0      RQDLE-NVLTV--PF--LGEIPLA--------R-----GRRQ--GNGD---VLVSQSGR-
A0A365UKN1      RQDLE-NVLTV--PF--LGEIPLA--------R-----GRKQ--GNGD---VLVSQSGR-
A0A4R6WE41      RQDIQ-KVVTA--PF--LGELPM---------------EKKY--DDKG---IAVSKTGR-
A0A2T5RP38      RQDLE-NVLSV--PF--LGEIPLA--------R-----GRRQ--GKGD---ILVSGSGR-
A0A1A6CF06      RQDLE-NVLSV--PF--LGEIPLA--------R-----SRRQ--GKGD---ILVSKTGR-
A0A1T3D6S8      RQDLE-NVLSV--PF--LGEIPLA--------R-----NRRQ--GNGD---VLVSQSGR-
A0A1P8E011      RQDIE-EAIDV--PL--LGEIPLA--------T-----NKRT--SQNN---ILVSAMGR-
A0A1V3N3U3      RQDVE-TVLSV--PF--LGEIPLS--------K-----RKSE--QHAV---FRVEKTGR-
C2FUH6          RQDIE-SVLDI--PF--LGEIPQA--------G-----KRKT--DSNK---VLVSKTGR-
A0A0B8T471      RKDIE-EAVSV--PF--LGEIPFS--------K-----QTIR--ANDD---VVVNEQGR-
A0A4R7D2K0      RKDIE-EAVTV--PF--LGEIPFS--------R-----QTMR--ANDD---VVVNEQGR-
A0A2X2J8S4      RKDLE-EGLSV--PF--LGEIPLA--------K-----KNKH--TVGN---VSVSQTGR-
A0A3C0S618      RKDLE-DGLSV--PF--LGEIPLA--------K-----KNKH--TVGN---VSVSQTGR-
A0A4P7DRF9      KRDIE-SEVSI--PF--AGEIPFS--------T-----DMQS--AKQE---VVVKEQGT-
A0A239XXC4      RKDIE-DAVSV--PF--LAEIPFS--------T-----EMKT--AKSD---IVIKEQGV-
A0A4U9K473      RKDVE-DAISV--PF--VGEIPFS--------T-----EMKS--AKSE---IVIKEQGV-
A0A3M1Y2F5      YQELK-KATPI--PV--LGTVIKNDD---------------------GLEVIKQSTSYS-
A0A7C7CKY6      VQEIK-IHTSA--RI--LGIVPSYKN-------DI-----------PVSQLLVNQNSKS-
A0A1G1TG88      TRELE-RSTQA--AV--LGVIPTYDK-------EKM----------EVSRLVVNDNPKS-
A0A661XXA6      IADVE-RNTAA--TL--LGSVPKYKS-------AK-----------EHAKIIVNEHPKS-
A0A3D4RLG4      PKEVE-RLSSF--PL--IGSLRHVRS---------------------QNPTLVQKNPRS-
A0A2T2UAJ4      PDDLR-EHGHH---V--LGVVPSMTPLIDDEFGGQETIEIDG--RSVNTLLAMLVSPMS-
A0A6I0DZQ5      NRDVE-KYSSF--PL--IGMIRHTNS---------------------DNPFIVAANPRS-
A0A6L3FBV2      RKELD-EVLTI--PF--LGNIPRHSN-------NKG---------EDSDGIVVRENSRD-
A0A6L3FIH8      RKELD-EVLTI--PF--LGNIPRHGN-------NKG---------EDSDGIVVRENSRD-
A0A3D3LSK1      PEELE-SKGVSLLSW--IPNIEQITD-------KSD----------PTNDFIVAKKPSS-
A0A496L711      EKDIE-RATKNRFQI--IGSVRHTKH-------K------------ADERVIASKYPNS-
A0A1H6Z2F8      KDDIS-RQCDV--TI--IGEISQQSR-------ADR---------------LSRNNVRS-
A0A2P8G5K0      KEDIQ-RQCDV--MI--LGEISQQSR-------TGL---------------LKVADNRS-
A0A4Q3SEI4      RHDIE-RLTTI--PV--VAEVIKVKA--------------------KTADVYNNTKRQL-
A0A348PT57      VHDLS-RLMNPRISL--LGVVPKYSK-------NI-----------PLSQLIIDKNPKS-
A0A7C3PTI0      LNEIT-KMTNASISV--LGIVPRYKK-------EI-----------PVSQLLVDKNPKS-
A0A5Q4EKA0      LHDIL-KYTQA--PV--IGVIPKYKS-------E-I----------PPNQLLVLKKPKS-
A0A519SYE7      VQELE-RGTRA--AV--LGVIPTYDK-------EKL----------EVSRLIVDKNPKS-
A0A7C7CFR2      VNELT-SGGRK--SL--LGIIPSYTK-------D-I----------PVSQLLVDKHPKS-
A0A3D4CJE1      VADIT-QEGKAKLGV--LGVIPKYKK-------E-I----------PVSQLIIDKNPKS-
A0A7C7LI79      ITDIS-KQTSA--AI--LGVIPTYKK-------D-I----------PITLLLVDKNPKS-
A0A4Q5ZQ60      LKELE-RNTMA--PL--LGIVPSYTK-------EKL----------PVSRLIVDLSPKS-
A0A519Q885      VAELE-RNTKA--TV--LGVIPSYTK-------EQM----------SISRLVVDKNPKA-
A0A519TAP8      VAELE-RGARA--AV--LGVIPTYDK-------EKL----------EVSRLVVDKNPKA-
R5DEG6          RKDVE-GVLSV--PF--LGEIPMRDK-------KDK------------NEVVVHENGRD-
A0A3N2LCI3      RKDVE-H-LAV--PF--LGELPQDGH-------EKK----KE--AGEANTIVVKGGKLD-
A0A6L6NZ03      RKDLE-G-LSV--PF--IGEIPLSIR-------GKKRV---K--SHEAHTIVVKEGNRD-
A0A642EJV3      RKDLE-N-LTI--PF--IGEIPLFTR-------KKKGILGKK--PQEVKAVIVKEGNRD-
A0A6H9Q899      RKDLE-N-VTV--PF--IGEIPLFTR-------KKKGIFGKK--PQEVKAVVVKEGSRD-
A0A6L4ENN1      RKDLE-N-LTI--PF--IGEIPLFTR-------KKKGILGKK--PQEVKAVIVKEGNRD-
A0A1T4NDR5      ---------------------------MTNVE------------NKMLKDLISIYDSSN-
A0A3D5KRM7      LDNIR-YSKTRIMPL--DAEVL-------------------------QDNRIIMGLYND-
A0A3M1NUH2      ---------------------------------------------------------MS-
A0A7C1IBE4      ISSST-VAEERKRKV--AAKAPSLPPDLGAST------------ENWDERLVHAIETFS-
A0A2T2TDL4      ------------------------------------------------------------
A0A359ATS6      ---------------------------------------------------------RD-
A0A1V6HYH8      ------------------------------------------------------------
A0A2E0MDX6      ------------------------------------------------------------
A0A2M7KCE1      ------------------------------------------------------------
A0A523GUD4      ---------------------------MLKSP------------ITDIEHLKEARNDTP-
R7JFY1          MKDVQ-DRT--ALPL--LGEIP--------AL------------EKNQEKLVVKEGSRD-
A0A1V5S5I3      RKDLE-SL---SLPF--AGEIPLAVSGKGKKK------------VHNAKKIVIRQGNRD-
A0A2M7VVW6      MDEIT-KFSNGAVGI--LGTVP----TYNREI------------PISQ--LVINRDPKS-
A0A413V760      RKELD-GVL--TIPF--LGNIP----RHGNNK------------GEDSDGIVVRENSRD-
A0A656PYT8      RKDIE-DKL--SIPF--LGDIP----EYHGST------------RQGS--VVVRDNGRD-
A0A6A0Y068      RKDLE-NLTIPFIGE--IPLFTRKKKGILGKK------------PQEVKAVIVKEGNRD-
A0A3D1AEJ6      ------------------------------------------------------------
A0A641X2Z6      ---------------------------------------------METITLIADRDAKS-
A0A6L8U2P8      --------------------------MSVIYS------------NNLKSEAVVAEYPKS-
A0A7C6G639      ------------------------------------------------------------
A0A519PJW5      ------------------------------------------------------------
A0A519T3R9      IGELE-RNTKASVLG--V-------IPTYSKE------------QMSVSRLVVDKNPKS-
                                                                            

A0A2T4XEQ1      --PVTESYRRLHNNI--------IYS--QPD-------LEVKTILVTSPGKGEGKTTTAV
A0A2K8ZAP1      --VIGEQIRALRTNL--------LFL--NGDA------QKNQVILFTSSISGDGKSFMSL
A0A519SD85      --LFSESLRSLRSNL--------FSL--IN--------KDCNMICITSEISGEGKSLISK
A0A3M1TXY5      --SFAESFRSLRVKM--------LFV--VEG-------DKKKVIGVTSSSSGEGKTFCAT
A0A2E0VQ27      --SLVSGLTANLRDL--------PKP--ETK-------GQAQLFVLSSNMPNEGKTFVSA
R6U429          --SINEAFRVLRTNL--------DFM--TGGQ------EGCHKVMITSFNPTAGKTFVLM
A0A5C8AF42      --MLAESMRKIRTNL--------SYI--K---------PDYKTIAISSSISGEGKTFVAL
A0A239K409      --AIAELFRLIRTNL--------QFV--VQG-------GERKVILVTSSVSGEGKTFFSL
A0A1V5S1J9      --AITEAFRVIRTRI--------EFL--SGK-------SKGISVMVTSSQSGDGKSYISA
A0A0A2EYC8      --YFVEQLRVIRTKI--------ELI--LKR-------KERITMLVSSTESGDGKTYISL
A0A2G6H6Y4      --YFVEQLRVIRTKV--------EII--LGR-------KEAITMLISSTESGDGKTYMSL
A0A1M3DPL8      --SFTEMFRIIRTRI--------EFI--AKR-------KTDITIMVTSSESGDGKTYFCI
A0A1V5F519      --SFTEMFRVIRTRV--------EFV--VRR-------KTDIVMMVTSVDAGDGKTFFST
A0A2G6R1T9      --SFTEMFRVIRTRI--------EFI--VQR-------KTGIMMLGTSTESGDGKTYVNI
A0A350V3E4      --VPAEAFRTLRTRL--------QFS--KLEP------EPIKTILITSSIPREGKTIISS
A0A6J4K208      --ALAESFRSLRVNL--------QYL--FLD-------TGKKVIGITSSGQGEGKTFCAS
A0A1M6MYT6      --PASEPYSAIRTKL--------ELI--TKG-------KEHAVIAVTSSFPSEGKTYNAI
A0A2P8CDS1      --PVGETYRALRMKL--------KFM--LNG-------TEQPVIAVTSTGSDEGKTFTAM
A0A353WYK7      --EISEAFRSIRTNL--------EFI--KRT-------DKNTVIAITSTVSGEGKTFVTV
A0A355BP94      --IVSEAIRTLRTNL--------DFF--TSS-------ETNKIIVISSTVSGEGKSFLAM
A0A136LSC7      --IVSEAIRTLRTNL--------EFF--NTG-------EKCKVITITSTVSGEGKSFLAM
A0A5C7N8Q5      --IVSEAIRTLRTNL--------EFF--NTG-------EKSKVITITSTISGEGKSFLAM
A0A2W4RDE8      --PVGESFRSLRVNL--------QYL--TLG-------KEVNVIGITSSRESEGKTYCSV
A0A0L8VEV2      --AIAESFRELRTNL--------QFI--VPGLK-----NKSLVIGVNSVIPGEGKSFTAA
A0A1I2A9Z9      --AIAESFRELRTNL--------QFV--APKKN-----NECTIIGVNSVISGEGKSFTSA
A0A212J9Z9      --SFAESFRNMRVRI--------EYM--AQR-------ENKITVLVTSTEPADGKTFIAT
F5IV23          --SFAESFRNMRVRI--------EYM--AQR-------ENKITVLVTSTEPADGKTFIAT
F8X2T0          --SFAESFRNMRVRI--------EYM--AQR-------ENKITILVTSTEPADGKTFIAT
A0A1M3LAG1      --SFAESFRNMRVRI--------EYM--AQR-------ENKITILVTSTEPADGKTFIAT
A0A212K6G4      --SFAESFRNMRVRI--------EYM--AQR-------ENKITILVTSTEPADGKTFIAT
A0A4Y9IPG7      --SFAESFRNMRVRI--------EYM--AQR-------ENKITILVTSTEPADGKTFIAT
A0A2V3PNY7      --SFAESFRNMRIRI--------EYI--AQK-------ETGISTLITSAEPGDGKTFIAG
A0A6G7WQ31      --SFAESFRNMRIRI--------EYM--AQK-------ESGISILITSAEPGDGKTFIAG
A0A6G7X5K8      --SFAESFRNMRIRI--------EYM--AQK-------ESGISILITSAEPGDGKTFIAG
A0A1M5DFS8      --SFAESFRNMRIRL--------EYM--AQK-------ETGISVLVTSAEPGDGKTFIAG
A0A4Y8KZS5      --SFAESFRNMRIRL--------EYM--AQK-------ETGISLLVTSAEPGDGKTFIAG
A0A142HHS5      S-SVSEAIRSIRTNL--------DFI--SPS-------NKKRLISVTSTISGEGKTFVTV
A0A660LQT8      N-IINEAFRVLRSNF--------EFC--TNKF------GKGAVTMVVSANPNSGKTFVTM
A0A2M6GH67      S-AISESIRSIRTNL--------DFI--SSA-------KKKRLISITSTVSGEGKTFVAV
A0A389LWV6      --SFAENFRHLRSRM--------IYL--TKR-------DSPIVMLITSTEPRDGKTFVAC
A0A1G9B1T9      --AAAESFRTIRSNL--------LLQ--NHVN------GASKTLLVTSSVSNEGKTLCSV
A0A350PNH9      D-IVNEAFRVLRTNL--------EFM--IGTH------PEQNVIILTSFNPGSGKSHLAG
A0A354LNT9      D-IVNEAFRVLRTNL--------EFM--IGTH------PEQNVIILTSFNPGSGKSHLAG
A0A161LWY6      --AIAEAYRMVRTRI--------KFV--SRQ-------MDASCVIVTSTESGDGKTHFCL
A0A6I3N9U6      --AIAEAYRMVRTRI--------KFV--SRQ-------MDASCVIVTSTESGDGKTHFCL
A0A3D0FMX4      --SYAEQLRALRTRI--------EFV--VRR-------KTGIMVLTTSAQSGDGKTYLST
A0A1M3MEI8      --SFTEMFRIIRTRI--------EFI--TQR-------KDKITIMVTSSESGDGKTYFSL
A0A1J5HQM0      --AFTEMFRVIRTRI--------EFI--VQR-------KKNIMVAVTSSESGDGKTYFSI
A0A653AC35      --SFTEMFRVIRTRI--------EFI--VQR-------KTNISILTTSAESGDGKTYFCT
E4T131          --AYTEMFRIIRTRI--------EFI--VQR-------KTNIIVMTTSTESGDGKTYFSI
A0A521H707      --AISESFRSVRTNL--------QFI--SNE-------SGPKVIAITSTISGEGKTFIAI
A0A1F3D6P8      --AIAESFRNLRSSL--------FLK--LKS-------EKSKVIVITSSQPKDGKSFISF
A0A356Z058      --AIAESFRNLRSSL--------FLK--LKS-------EKSKVIVITSSQPKDGKSFISF
A0A3D1BT36      --PIAESFRNLRSNL--------FFR--SKT-------NPLKVILVTSCQPQDGKSFVAM
A0A5R9QZP0      --SLAESFRNLRTNI--------FLK--FKS-------KPLKVILVTSALPQDGKSFIAF
A0A3D3HL11      --SIAESFRNLRSSL--------FLK--FRS-------EPQKVIMITSAQPQDGKSFVSS
A0A6L8U6G9      --SIAESFRNLRSSL--------FLK--FRS-------EPHKVLMVTSSQPQDGKSFVSS
A0A352ME00      --AISESFRNLRSSL--------FLK--SDH-------EKSKVILITSSQPQDGKSFVSL
A0A6L8UH35      --AVSESFRNLRSSL--------FLK--AGH-------EQSKVILITSSQPQDGKSFISF
A0A2W7RD29      --KVAESFRLLRTNL--------NFI--LPN-------SESTVLLVSSVLPAEGKSFTSV
A0A3N2NDY8      RDAVSESFRIVRGNI--------DFM--IRGK------EGGNVIMITSFNPGSGKSFISF
D7JEV9          S-YFVEQLRVIRTKI--------EFI--LKR-------KEKITVLISSTESGDGKTYISL
A0A4R6H3B7      --AIAESFRELRTNL--------QFV--APKKN-----NECTIIGVNSVISGEGKSFTSA
A0A3P1Z8V4      NSPSAEAFRLLRYGL--------HFM--N---------RTAKVFLITSASPGQGKSFVSR
A0A2W7QSQ0      S-PAAEQLRMIRSNL--------KFQ--SG--------DNNKVILVSSSMSGEGKTFFCL
R7F6L5          N-VINEAFRVVRTNL--------DFF--LTSDK-----KGAQVIMVTSANPGSGKTFITM
A0A7C5MRV2      --SLSESIRAIRTNM--------QFI--NSEKE-----EGSKIVSITSTVSGEGKSFITI
A0A553GA49      DAVVAESFRKLRTNL--------GFW--PWKDT-----LEGRVVLFTSTMPGEGKTFCSY
A0A497D6F6      --PASEQYRSVKNKI--------NFI--SGK-------KSNPVIAFTSSIANEGKSFSAL
A0A5M4AAB9      --PLGESYRALRTKL--------KFI--QNG-------NEHNVIAVTSTAAGEGKTFTAL
F4KR18          --TLTERFRTLRTNL--------QFH--QRE-------KTKSIL-VTSSTSDEGKTFVAT
A0A229I3A5      D-IVNEAFRVLRTNF--------EFT--IGTH------PEQNVIVFTSFNPGSGKSHIAA
A0A3R6HJB3      D-IVNEAFRVLRTNF--------EFT--IGTH------PEQNVIVFTSFNPGSGKSHIAA
R6NN15          D-VVNEAFRVLRTNL--------EFV--SGEN------GKGQVILMTSFNPGSGKTFLTV
C9LKL0          DAPIVEAFRMLRYGL--------NFM--R---------HSAKVCVVTSSTPGQGKSFISR
A0A3D0QPV7      S-LISEAFRTIRTNM--------QFL--TAD-------KDAKLVSVTSTISGEGKTFVAI
A0A496KT23      D-ILNEAFRTVRTKL--------EFT--LGFD------GRNKVVMLSSLNPGSGKTFITA
L1M9T3          D-IINEAFRTVRTKL--------EFS--MGFD------NGCKVIMVTSMNPGSGKTFITA
A0A3C0I8F1      S-TINEALRSVRTNL--------DFV--LNKSGGLNDTSTSKVISITSTISGEGKTFVAA
R5JJI4          D-SVSEAFRIIRTNM--------EFM--RVKS------DNLQVVMFTSANPGAGKTFVSS
A0A0A2DQN2      D-LTSEAFRILRSNM--------DFM---GQNG-----VMPKRIVLTSFGAEAGKSYISY
A0A0A2F2N5      D-AITEAFRVLRTNM--------GFM--KKYGR-----TSGQRIMCVSFGANAGKTFTTY
L1NGW4          D-ETSESFRVLRENL--------RFM--IGSGD-----TPSKKIIFTSFGESAGKSYVSY
Z4WRA0          D-ETSESFRVLRENL--------RFM--IGSGD-----TPSKKIIFTSFGESAGKSYVSY
U2K8K9          D-ETSEAFRVLRENM--------RFM--IGSAA-----GKTKKIIFTSFGESAGKSYVSY
A0A069ZM60      D-ETSEAFRVLRENM--------RFM--IGTGG-----KKAKKVIFTSFGESAGKSYVSY
J6GV98          D-ETSEAFRVLRENM--------RFM--IGTGG-----KKAKKVIFTSFGESAGKSYVSY
A0A134B4F8      D-ETSEAFRVLRENM--------RFM--IGTGG-----KVAKKVIFTSFGESAGKSYVSY
A0A134B8C7      D-ETSEAFRVLRENM--------RFM--IGTGG-----KVAKKVIFTSFGESAGKSYVSY
A0A3D2HF71      --SLAESLRSVRTNL--------KYF--MKD-------ISNPVIAVSSTITGEGKTFVAV
A0A4Z0EKR0      S-PIAEMFRLIRTNL--------HFA--AVG-------RKKTVFLITSSMSGEGKTFFSI
B5CTK0          D-SISEAFRIIRTNM--------DFM--RMKK------DNMKVVTFTSMMPGAGKTFVSM
A0A1M6B6D5      S-AIAEAFRSLRSSL--------QFL--YKQQG----ITGAKTVLLTSSVSGEGKTFCSI
A0A451FS66      S-AIAEAFRSLRSSL--------QFL--YKQHG----VTGAKTVLFTSSVSGEGKTFCSI
A0A2E3GN39      S-GISESFRGVRSNL--------EFL--D-AD------KGFRSIAVTSTIPGEGKTFVAI
A0A3D1MEL0      S-GISESFRGVRSNL--------EFL--E-AE------KGFRSIAVTSTIPGEGKTFVAI
A0A519UDD1      T-PIAEMFRLVRTNL--------NFV--A-IG------REKTVLLITSSMSGEGKTFFSI
A0A2A4N9A6      A-GITEALRSLRANL--------QFI--S-TN------PGPKIMAITSTISTEGKTFVAI
A0A6C0GGI1      S-ALSEAFRSLRVNL--------QYL--A-AG------MDQKAIGITSSVSGEGKTFCAI
A0A368D1N7      S-GISESFRGVRSNL--------EFL--E-EE------KGFRSIAVTSTIPGEGKTFVAI
A0A3B8TU58      S-GISESFRGVRSNL--------EFL--A-AE------KNFRSIAVTSTIPGEGKTFVAI
A0A1T5IIR6      T-VFTEAMRMLCTNL--------SFL--DSGK------KAPFVIATTSYSSSSGKTFITA
F0R0C9          N-IINEAFRVLRTNL--------EFM--TSEN------EKANVILLTSFNPGSGKTFLSL
A0A6L6NXQ0      N-AMNEAFRVLRTNM--------EFM--SGNG--------TEVILLTSFNPGSGKTFLTV
A0A6N8DCX3      N-AMNEAFRVLRTNM--------EFM--SGNG--------TEVILLTSFNPGSGKTFLTV
A0A3E0QD27      S-AISESFRSVRTNL--------QFI--S-NE------PGPKVVAITSTISGEGKTFVAI
A0A0M1W1I6      D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
A0A4R4GHU2      D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
I8WPR6          D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
A0A0K2HKS3      D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
B6W3W8          D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
A0A4R4GSI6      D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
A0A076IRY8      D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
A0A3A6AD54      D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
A0A3A6MIU7      D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
I8WPP8          D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
A0A372Y7D2      D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
A0A3E4JJC9      D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
A0A3E4WDQ0      D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
A0A414H9P2      D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
C3R5A8          D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
A0A1C5XJA7      DNVVTEAFRILRTNM--------SFM--AKKD------RPLQVITFTSFNSGAGKSFVAF
A0A285T4L1      DGMLSESFRILRTNM--------AFM--AKKD------KPMQVITFTSFNEGAGKTFVSR
A0A3E5BU42      DGMLSESFRILRTNM--------AFM--AKKD------KPMQVITFTSFNEGAGKTFVSR
R7CUW4          DSIVSEAFRILRTNM--------AFM--SRKD------RPTQVITFTSFNEGAGKTFISC
A0A416GGJ1      D-IIAEAFRILRTNM--------AFM--AKKG------VPVKVITFTSFREGAGKTFILR
D1JY72          D-IVSEAFRIIRTNM--------DFM--RVKS------KNMQVVTFSSFGPGAGKTYVSS
D7J4K6          G-MLAESFRILRTNM--------TFM--VKKD------KPMQVVTFTSFNEGAGKTFISR
Q8ABP9          G-MLAESFRILRTNM--------TFM--VKKD------KPMQVVTFTSFNEGAGKTFISR
A0A5M6AHF7      G-MLAESFRILRTNM--------TFM--VKKD------KPMQVVTFTSFNEGAGKTFISR
A0A6L4IA73      G-MLAESFRILRTNM--------TFM--VKKD------KPMQVVTFTSFNEGAGKTFISR
D6D2Z5          G-MLAESFRILRTNM--------TFM--VKKD------KPMQVVTFTSFNEGAGKTFISR
A0A1T3EDR4      D-ALSEAFRILRTNI--------TFM--VNSG------ISPQVITYTSFSAGVGKTFNTL
A0A174SDD8      D-ALSESFRILRTNL--------GFM--LSQT------QERKVITLTSFNIGAGKTFISI
A0A1H7RFH3      D-ALSESFRILRTNL--------GFM--LSQT------QERKVITLTSFNIGAGKTFISI
A0A139L1N2      D-ALSESFRILRTNL--------GFM--LSQT------QERKVITLTSFNIGAGKTFISI
A0A174TVL8      D-ALSESFRILRTNL--------GFM--LSQT------QERKVITLTSFNIGAGKTFISI
A0A1H8BJR6      D-ALSESFRILRTNL--------GFM--LSQT------QERKVITLTSFNIGAGKTFISI
R9H6G0          D-ALSESFRILRTNL--------GFM--LSQT------QERKVITLTSFNIGAGKTFISI
A0A412GR09      D-ALSESFRILRTNL--------GFM--LSQT------QERKVITLTSFNIGAGKTFISI
A0A6I0S0M4      D-ALSESFRILRTNL--------GFM--LSQT------QERKVITLTSFNIGAGKTFISI
A0A081PBV5      D-YTSEAFRILRTNI--------GFM--A-AG------KEQRVITFTSFNIGAGKTFTAI
A0A1I2AN85      D-YTSEAFRILRTNI--------GFM--A-AG------KEQRVITFTSFNIGAGKTFTAI
A0A4U0GMP3      D-PVTEAFRILRTNI--------GFM--ASAD------KTLQVITFTSFNIGAGKTFTAM
A0A1H6CKR6      D-EVTEAFRIFRTNL--------GFM--SAGD------KSQKVITFTSFNVGAGKTFSVI
A0A235E1C0      D-EVTEAFRIFRTNL--------SFM--SSGD------KKQKVITFTSFNVGAGKTFSVI
R6D982          D-ALSESFRILRTNL--------GFV--ASQS------PGQKVVTLTSFNVSAGKTFVSV
A0A1F0I8C4      D-PLSEAFRILRTNL--------GFM--ISQP------QEQKVITLASFNMGAGKTFVSV
A0A3A5RIJ2      D-PLSEAFRILRTNL--------GFM--ISQP------QEQKVITLASFNMGAGKTFVSV
A0A515IZJ5      D-PLSEAFRILRTNL--------GFM--ISQP------QEQKVITLASFNMGAGKTFVSV
A0A5M5NLR3      D-PLSEAFRILRTNL--------GFM--ISQP------QEQKVITLASFNMGAGKTFVSV
A0A0D5BSQ0      D-PLTEAFRILRTNI--------NFM--AKNG------EPPRVITFTSFSAGVGKTFSAL
A0A1T3F6P5      D-PLTEAFRILRTNI--------NFM--TKDE------HPPKVITFTSFSAGVGKTFSVL
A0A0W8EPA0      D-PLTEAFRILRTNI--------NFM--TKDE------HPPQVITFTSFSAGVGKTFSVL
A0A365UKN1      D-PLTEAFRILRTNI--------NFM--TKNE------HPPKVITFTSFSAGVGKTFSVL
A0A4R6WE41      D-PLTEAFRILRTNI--------NFM--AING------APPQVITFSSFTIGAGKTFNVM
A0A2T5RP38      D-PLTEAFRILRTNI--------NFM--TKDD------APPKVLTFTSFSAGVGKTFSVL
A0A1A6CF06      D-PLTEAFRILRTNI--------NFM--TKDE------HPPKVITFTSFSAGVGKTFSVL
A0A1T3D6S8      D-PLTEAFRILRTNI--------NFM--TKDE------HPPKVITFTSFSAGVGKTFSVL
A0A1P8E011      D-PLTEAFRILRTNM--------SFM--AREG------KHPQTITLTSFIPGVGKTFTSL
A0A1V3N3U3      D-PLTEAFRILRTNI--------NFM--SREG------RAPQVITFTSFGVEVGKTFSSI
C2FUH6          D-VLTEAFRIIRTNI--------GFM--SRNG------NSPQVITFTSFSIGAGKTFTAL
A0A0B8T471      D-PATEAFRILRTNI--------GFM--SSAE------REIRVITFTSFNVGAGKTFTAV
A0A4R7D2K0      D-PATEAFRILRTNI--------GFM--SSAE------REIRVITFTSFNVGAGKTFTAI
A0A2X2J8S4      D-ALTEAFRILRTNI--------NFM--SRGG------VPPKVITFSSARVGAGKTFSVI
A0A3C0S618      D-ALTEAFRILRTNI--------NFM--SRGG------VPPKVITFSSARVGAGKTFSVI
A0A4P7DRF9      D-EVTEAFRIFRTNL--------GFM--SSGD------KEQKVLTFTSFNVGAGKTFSVI
A0A239XXC4      D-EVTEAFRIFRTNL--------SFM--SSGD------KKQKVVTFTSFNVGAGKTFSVI
A0A4U9K473      D-EVTEAFRIFRTNL--------SFM--SSGD------KSQKVITFTSFNVGAGKTFSVI
A0A3M1Y2F5      --PLAECFRAVRVHIYNKLTNKREKI--DVSE------R-GILLGVCSTWSDEGKSFCAA
A0A7C7CKY6      --LIAESFRAIRTNL--------QFI--SNEP------G-SKIIAITSTISGEGKTFVSM
A0A1G1TG88      --AISEAIRSIRTNL--------DFI--SSAK------K-KRLISVTSTISGEGKTFVTV
A0A661XXA6      --ALSESMRSIRTNM--------QFM--LPET------K-SKVYSITSTIGSEGKTFIST
A0A3D4RLG4      --SYTEMLRTIRTKI--------EFI--VGRK------Q-NIVLSITSTQSGDGKTFLAT
A0A2T2UAJ4      --AAAEAYRRIRTNL--------RFA--KPDD------D-LQTMAVSSADKGDGKTTTCA
A0A6I0DZQ5      --SFTEMFRIIRTRI--------EFI--TQRK------D-KITIMVTSSESGDGKTYFSL
A0A6L3FBV2      --SVSEAFRIIRTNM--------DFM--RVKS------EKLQVVMFTSANPGAGKTFVSS
A0A6L3FIH8      --SVSEAFRIIRTNM--------DFM--HVKS------EKLQVVMFTSANPGAGKTFVSS
A0A3D3LSK1      --QISEAFKALRTRI--------TFS--KLED------KPLKTILVTSSLPSDGKTIVSV
A0A496L711      --YFVEQLRVIRTKI--------EFI--LKRK------E-KITVLISSTESGDGKTYISL
A0A1H6Z2F8      --LLREQFRSLRTNI--------QFV--VGER------Q-NTVVLLTSSMADEGKSFVAM
A0A2P8G5K0      --LIKEQFRSLRTNI--------QFT--TGER------P-HMVILLTSAMANEGKSFVAM
A0A4Q3SEI4      --SFIEQFRQLRASV--------ALN--GRKL------K-YRRILVTSSIAGEGKSFIAN
A0A348PT57      --VMAEAFRTLRTNL--------DFF--QTDN------E-KKIIAVTSTISGEGKTFVAI
A0A7C3PTI0      --LIAEAFRSIRTNL--------QFI--SNEP------G-SKLMAVTSTISGEGKTFVAI
A0A5Q4EKA0      --LISESLRAIRTNL--------QFI--NNDP------G-PKLVAVTSTISGEGKTFFAM
A0A519SYE7      --SVSEAIRSIRTNL--------DFI--SPAG------K-KRIISITSTISGEGKTFVAV
A0A7C7CFR2      --LIAEAFRSIRTNL--------HTS--NSDP------G-PKVIAITSTVSGEGKTFVAI
A0A3D4CJE1      --VISESFRTIRANL--------QFI--SNKP------G-SKVMAITSTVSGEGKTFVAI
A0A7C7LI79      --LIAEAFRSIRTNL--------QFI--DGSE------G-PKIIAVTSTVASEGKTFVTI
A0A4Q5ZQ60      --AISESIRSIRTNL--------EFI--SSSA------K-KRIISVTSTIGGEGKTFVAV
A0A519Q885      --SVSEAIRSIRTNM--------EFI--NAAN------K-KRLISITSTISGEGKTFVAV
A0A519TAP8      --SVSEAIRSIRTNL--------DFI--SPSN------K-KRIISVTSTISGEGKTFVAV
R5DEG6          --SVSEAFRIVRTNM--------DFM--RVKE------KNMQVVMFTSFNPGAGKTFVSI
A0A3N2LCI3      --IINEAFRVLRTNV--------EFM--CNSS------EGNKVIAMTSFNPGSGKSFVSM
A0A6L6NZ03      --IMNEAFRVLRTNL--------EFM--IGKD------QSSNVIVVTSFNPGSGKSFLTM
A0A642EJV3      --IINEAFRVLRTNL--------EFM--TGKD------KTSNVIIMTSFNPGSGKSFLTM
A0A6H9Q899      --IINEAFRVLRTNL--------EFM--TGKD------KTSNVIIVTSFNPGSGKSFLTM
A0A6L4ENN1      --IINEAFRVLRTNL--------EFM--TGKD------KTSNVIIMTSFNPGSGKSFLTM
A0A1T4NDR5      --PATEAYRALRTNI--------MYK---NFD------APIKVINITSATQGEGKSTTCL
A0A3D5KRM7      --QRADLFRVLRTNI--------LKQ---LRE------NNWNSFFITSATPGAGKSWVAT
A0A3M1NUH2      --PVVESYRHLRTNI--------QFS---RPD------TVVETIVVTSPSVEEGKSTTAA
A0A7C1IBE4      --GVAESFRKLRTMI--------LHP---ESG------EPPRSVMVVSCDPQEGKSFVCA
A0A2T2TDL4      -------------------------LQLGRPD------ETNTTVLVTSPGSGDGKSLTAA
A0A359ATS6      --VINEAFRVVRTNL--------EFM-DGSGE------PDSNVLMLTSFNPGSGKTFLTM
A0A1V6HYH8      ---------------------------------------------MTSTISGEGKTFVAI
A0A2E0MDX6      --------------M--------QFI---ANN------EGSKIITVTSTISGEGKTFVAI
A0A2M7KCE1      ----SEAFRSVRSSL--------EFI---KNI------KESKTIAISSTISGEGKTFIAL
A0A523GUD4      --GNAEIMRLLSKLD--------TFR----NG------THKQTVMITSALSGEGKSTIST
R7JFY1          --AVSEAFRILRANM--------DFM--RGGD------EHMQVLLFTSMNAGAGKTFISS
A0A1V5S5I3      --IVNEAFRVLRTNL--------EFMLDAKTG------GKAGVTLFTSFNPGSGKTFLAM
A0A2M7VVW6      --VISEAFRTIRTNL--------QFI--S-KS------EESKLMAITSTISGEGKTFCAI
A0A413V760      --SVSEAFRIIRTNM--------DFM--RVKA------ANLQVVMFTSANPGAGKTFVSS
A0A656PYT8      --SVSEAFRLIRSNL--------GFM--SVKS------GKLQIIMVTSSNPHAGKTFVTT
A0A6A0Y068      --IINEAFRVLRTNL--------EFM--TGKD------KTSNVIIMTSFNPGSGKSFLTM
A0A3D1AEJ6      ----MDFMRVKQDNI--------------------------KVITTTSTSVGSGKTFVSS
A0A641X2Z6      --PVAEAYRTIRTNI--------QFS--NVGQ------E-LKTIIVTSATPNEGKSTTIS
A0A6L8U2P8      --AIAESFRNLRSTL--------FLK--SDHE------K-SKVILITSSQPQDGKSFVSL
A0A7C6G639      ------MFRVIRTRI--------EFI--VQRK------S-KIMLLITSAEFSDGKTYFCT
A0A519PJW5      -----EAIRSIRTNL--------DFI--SPSN------K-KRLISVTSTISGEGKTFVTV
A0A519T3R9      --SVSEAIRSIRTNL--------DFI--SPAS------K-KRLISITSTISGEGKTFVTV
                                                               *     **:    

A0A2T4XEQ1      NLAGILAESGKR-VLIIDFDFRRPNLHKTLGES--QT---PGILELLFDGV---HFDDVI
A0A2K8ZAP1      NLGASLALVNRK-TVIVDMDMRKPKLHKSLHIE--NK---LGLSNYLTGEA---DLDNLL
A0A519SD85      NLAYAFAITGKK-VILVDADLRKPKLHESFNTG--NQ---MGLTNYIHSDL---ALEQII
A0A3M1TXY5      NLAATLAHAGKQ-TLLIDTDLRRPKVQTYFRTE--HH---AGLSDFLCGEV--DYVNEII
A0A2E0VQ27      RIAKAMAAYGYK-VLLLDLDVRKPELHEELGMD--NS---DGFCEAIKSDR--HALDLVQ
R6U429          NMAATMALKGAK-VLLLDLDLRKGTLGKALEHNK------SGISAFLNGKL--ESIVPEI
A0A5C8AF42      NLAGIIAMSGKK-TILLDLDLRKPKVHLGLNTN--NN---YGMSGLIINKF---TLEQCI
A0A239K409      NLGASLALTGKN-VVVLDFDLRKQSILADLGLA--CE---FGITDYLSFNT--VTVEEML
A0A1V5S1J9      NIAGVFAMTGRK-TILVDLDMRKPSINTGL---YLSVN--KGISNYLANQI--SLDEAIV
A0A0A2EYC8      NLAGVFALQKKK-VLLIDFDIRKPNLTRNLGD-IIKTK--SGFVNYMIGDC--TIEEAIE
A0A2G6H6Y4      NLAGVFGLQNKK-VLLIDFDIRKPNLTENLQESLSKHK--VGFVNYMIGEC--SLEEAID
A0A1M3DPL8      NLACIYAMASPK-TLLVDMDIRKPSVYQTI---GCDNN--MGVSNFLANQC--SLDEIIV
A0A1V5F519      NMAGVYGMTGHK-TLLIDMDIRKPAINRRF---NVNHP--KGVTNYLINEC--TLDEIIN
A0A2G6R1T9      NLASVYGMTGKK-TLLIDMDIRKPSVGDRL---GISEK--AGVTNYLIGEN--ELDDLII
A0A350V3E4      NLAASFALSS-R-VLLLDCDFRKPRMHNIFNMK--RY---PGLCDYLFGTV---TIEEAV
A0A6J4K208      NLSVVMAQSGKK-TLLIDADLRKPRIAARFDID--NA---AGLASYLTGAH---KADDII
A0A1M6MYT6      NIASSVALSNKT-AVILDLDLRKSRINEDIGLK--IE---KNVVDYILGKA---TLEEIT
A0A2P8CDS1      NLAASFALLGQK-AVLLDLDLRNSKMAEMHNYD--KN---RGVSNYLLGEM---RLEDIT
A0A353WYK7      NLGGVISLLKSK-VVLVDLDMRKPRLQKVFYHN--IQA--KGVSTILIEKH--SVEECIL
A0A355BP94      NLGGILAMSNKK-VILLDLDMRKAKEILHARVT--DPS--KGISTLLIHKT--TLEESIT
A0A136LSC7      NLGGVLALSRKR-VILVDLDMRKPKSEKYPTGN--DSS--MGMSTILIKKN--NWQECVL
A0A5C7N8Q5      NLGGVLALSRKR-VVLVDLDMRKPKSEKYPTGN--DSP--LGMSTILIKKN--KWQECVV
A0A2W4RDE8      NLAAAMANSRRR-TILIDADMRRPKVASYFQLE--ND---KGLSNYLIGEA---SLKEII
A0A0L8VEV2      NLASMIALNNKR-VLLIDCDLRKPSLHNRLKYK--NK---EGLSTYLTDFS---SFDDIF
A0A1I2A9Z9      NLASMIALNNKK-VLLVDCDLRKPSLHNRLKYK--NK---EGLSTYLTDFS---TFEDIF
A0A212J9Z9      NIASVYQLMGKK-VIIVDLDLRRPSVAKTLQID--SQ---KGISNYLIGQV--TLDEIIY
F5IV23          NIASVYQLMGKK-VIIVDLDLRRPSVAKTLQID--SQ---KGISNYLIGQV--TLDEITY
F8X2T0          NVASVYQLMGKK-VIIVDLDLRRPSVGKTLQVD--AQ---KGISNYLIGQV--TLEEIII
A0A1M3LAG1      NVASVYQLMGKK-VIIVDLDLRRPSVGKTLQID--AQ---KGISNYLIGQV--TLDEIII
A0A212K6G4      NVASVYQLMGKK-VIIVDLDLRRPSVGKTLQID--AQ---KGISNYLIGQV--TLDEIII
A0A4Y9IPG7      NVASVYQLMGKK-VIIVDLDLRRPSVGKTLQID--AQ---KGISNYLIGQV--TLDEIII
A0A2V3PNY7      NIASVYQLTGKK-VVLIDFDLRRPSVGKLLSIE--SK---KGVSNYLIGQV--TLDEITI
A0A6G7WQ31      NVASVYQLTGKK-VVLIDFDLRRPSVAKLLNIE--SK---KGVSNFLIGQV--TLDEITL
A0A6G7X5K8      NVASVYQLTGKK-VVLIDFDLRRPSVAKLLNIE--SK---KGVSNFLIGQV--TLDEITL
A0A1M5DFS8      NIASVYQLTGRR-VVLIDFDLRRPSVAKLLNLQ--SK---KGVSNFLIGQV--SLDEITV
A0A4Y8KZS5      NIASVYQLTGRR-VVLIDFDLRRPSVAKLLNTQ--TK---KGVSNFLIGQV--SLDEITI
A0A142HHS5      NLGGIIALSGQR-VVILDLDMRKPKVNLAFDAE--NV---RGISTILIDRH--TVAECIQ
A0A660LQT8      NLAMSMVIKNKK-AVVVDLDLRKAATSLFVGRPK------YGIANYLNGQG---TLDEIV
A0A2M6GH67      NLGGIIALSDQK-VVILDLDLRRPKVNLAFDAE--NN---IGISTILIERH---SVPECI
A0A389LWV6      NLASAYQMTGKK-TLMIDFDLRRPALSKALDLD--TQ---KGLSNFLIGKA--SLADVVI
A0A1G9B1T9      NLASSFAVANNR-TIIIDADLRRPRVHNILEKT--NG---VGLSNYLQGTA---DMSEII
A0A350PNH9      NIAMSLAIKKKK-VLVIDGDLRRGATSMLVGSPG------EGLSDYLNGRT--DDLEGII
A0A354LNT9      NIAMSLAIKKKK-VLVIDGDLRLGSTSMLVGSPG------EGLSDYLNGRT--DDLEGII
A0A161LWY6      NYASMCAMTGEP-TILVDMDLRKPSVSKRLSLE--NE---TGITNCMLGQV--SLDDAII
A0A6I3N9U6      NYASMCAMTGEP-TILVDMDLRKPSVSKRLSLE--NE---TGITNCMLGQV--TLDEAII
A0A3D0FMX4      NLAALYAMSGKK-TLLMDMDIRKPNIHEKLGTS--IE---KGLTNYLIGEI--SKQEMIQ
A0A1M3MEI8      NLASVYGLASPR-TLLVDLDIRKPSIHKRLGVE--NS---LGLTNFLVGQC--KAQDIIM
A0A1J5HQM0      NMAGVYSMASKK-VLLVDLDIRKPSIHERFNIN--PS---QGITNFLVGQA--TLDEVII
A0A653AC35      NLASVYAMSGLK-TILVDMDIRKPSINERLSIS--EK---DGVTNYLIGEK--PLDKLIL
E4T131          NLASVYAMASKK-TILVDMDIRKPSVNQRFNIV--HP---LGVTNYLVGQC--ALDEIIL
A0A521H707      NLAGVIAFSEKK-VVIIDLDMRKPKIHLGFNVE--NI---RGMSTILIGKD---TTDFCI
A0A1F3D6P8      NLAASIAIVGYK-TIIIDCDLRKPTLHEKFKED--NS---SGISNFMVKNA---TVTEII
A0A356Z058      NLAASIAIVGYK-TIIIDCDLRKPTLHEKFKED--NS---SGISNFMVKNA---TVTEII
A0A3D1BT36      NLASSIASVGHK-TIILDCDLRRPTLHDKFKID--NE---GGITKYLTDKN---VDNDII
A0A5R9QZP0      NLATAIAAVGHK-TIIIDCDLRKPTLHMKLKKD--NP---FGISNFMNKEV---TAQEII
A0A3D3HL11      NLAASIASVGHK-TVLLDCDLRRPTLHEKLKIV--NS---VGLSNYMVNNA---STKEII
A0A6L8U6G9      NLAASIASVGHK-TVLIDADLRRPTLHEKLKIV--NS---VGLSNYMVRNV---SSKEIL
A0A352ME00      NLSSSIASVGYK-TVLIDCDLRRPTLHIKLKED--NA---KGISNFMIKKA---TADEII
A0A6L8UH35      NLASSIASVGYK-TILIDCDLRRPTLHSKLKVE--NR---MGLTNYMTKNA---SLNEII
A0A2W7RD29      NLATAFALTELK-VLIIDCDLRKPKVSDYLGVD--NT---AGLSNYLSRRV--DDESTIV
A0A3N2NDY8      NLSASFALKGKK-VLVVDGDLRHGSASQFVDMPS------KGLSNYLTGNT--DNWQSLV
D7JEV9          NLAGVFALQNKK-ILLIDFDIRKPNLTKNLGGMVKNK---LGFVNYMIGDC---SLNEAI
A0A4R6H3B7      NLASMIALNNKK-VLLVDCDLRKPSLHNRLKYK--NK---EGLSTYLTDFS---TFEDIF
A0A3P1Z8V4      NLAVALSMTGKK-VLLVDTDVRKQNLTAGFTNG--RK---KGLTEYLIGDS--EAPHDII
A0A2W7QSQ0      NLAATLSIVDKK-VVVVDLDLRRPSIFKSLNIK--SK---HSLFDYLNHDI--KDLKEII
R7F6L5          NLAVALALKHKR-VLMIDFDLRRAALSNAFGSPR------EGIANYLCGAD---QMSDIV
A0A7C5MRV2      NLGGIISLLNVK-VVILDMDLRKPKLHFSFGHD--NS---AGVSTYLVNQN---TLPEIL
A0A553GA49      NLAQSLASLGKK-TVILDFDLRKGDLSENYFKS--EN---KGISMFLSNQ---VELDDII
A0A497D6F6      NIASLYALSKKK-TVLLDLDLRMSSMAKNLELD--TD---KGVVSYLTGE---AGIDDIT
A0A5M4AAB9      NLAASFALLGKK-TVFLDLDLRNSRIGKKMGYE--SN---RGASNYILNE---MSINDIT
F4KR18          NLAMSFALAKKK-TIVVDFDLRKPSISKYFEGN--AE---IGLSSFLINQ---LEVEEVI
A0A229I3A5      NMAMSLAIKKKK-VLLIDGDLRHGSTSMLIHSPG------EGLSDYLNGRI--ADIHDIL
A0A3R6HJB3      NMAMSLAIKKKK-VLLIDGDLRHGSTSMLIHSPG------EGLSDYLNGRI--TDIHDIL
R6NN15          NIAATLAIKGKR-VLVIDGDLRRGSTSVYVGSPH------HGLSNYLAGKV--QRIEDVI
C9LKL0          NLAAIMGMANKR-VLLVDADIRKRTLSSKFGRS-------NGLTGWLVDEEEKLSLDEII
A0A3D0QPV7      NLAGMIAFSGKK-VVILDLDMRKPKIHIGFGTD--NE---VGMSSLLIGRD---QLEQCI
A0A496KT23      NLSAAFSLKGKR-VLVMDLDLRKASLSDYVGQPK------VGISNYLSGQI--EDWHEII
L1M9T3          NLSTAYALKGKR-VLVMDLDLRKASLSQYVGNPQ------IGLSNYLSGQI--NDWHKII
A0A3C0I8F1      NLAGIIAMLNLK-VLIIDFDMRRPKVHIAFDREEEDNL--KGTSTILIGRH--TPQECIQ
R5JJI4          NLAMSIAQTNKK-VVLVDVDIRKGTLSGIFSNPS-GR---MGLTHYLSGRT--DGLDDII
A0A0A2DQN2      NLAKSLVFAGKS-VVLIDIDIRKRTLTRKLNFE--HN---MGLTSYLSGMD--VSIDELI
A0A0A2F2N5      NLARSLIFADKK-VVIVDLDLRKGMMSKRLEMS---G---RGMTNYLSDDS--IKIEDVL
L1NGW4          NLAKTLTFSGST-VVIVDLDLRKGTLSRRAHVA---G---QGVTEYLVDKA--MPVEKII
Z4WRA0          NLAKTLTFSGST-VVVVDLDLRKGTLSRRAHVA---G---QGVTEYLIDKA--MPVEKII
U2K8K9          NLAKTLTFSGHR-VVLVDLDLRKGTLSHRAGII---G---KGVTEYLSDPT--VQVDQII
A0A069ZM60      NLAQTLTFAGHS-VVLVDLDLRKGTLSRRIGLA---G---MGATEYLSNPD--VRLDQIL
J6GV98          NLAQTLTFAGHS-VVLVDLDLRKGTLSRRIGLA---G---MGATEYLSNPD--VRLDQIL
A0A134B4F8      NLAQTLTFAGHS-VVLVDLDLRKGTLSRRIGLA---G---MGATEYLSNPD--VRLDQIL
A0A134B8C7      NLAQTLTFAGHS-VVLVDLDLRKGTLSRRIGLA---G---MGATEYLSNPD--VRLDQIL
A0A3D2HF71      NLAAIIALPGKK-VLLIDLDLRKPKAHKILGNND-NT---EGISKYLIGES--KIEDIII
A0A4Z0EKR0      NLGASLAITDKR-TLLLDLDLRNPKVAQRLALP--AG---PGITDYLVSSD--ILISDII
B5CTK0          NLALSFALTDKK-IILMDLDIRKGTLSAHSKR---KE---LGVTDYLSGKI--ADLNQII
A0A1M6B6D5      NLASIFALSDKK-TIIIDLDLRKPKVGAAFNIQ--NS---MGVVNYLINEA---DLDGII
A0A451FS66      NIASIFALSEKR-TVIVDLDLRKPKVSGAFNMD--NS---IGVVNYLINEA---DLDTIT
A0A2E3GN39      NLAAIIAMQGKR-VLLVDVDLRKPRIHKIFDLP--NS---AGMSTLLNKRS--TKEDITF
A0A3D1MEL0      NLAAIIAMQGKR-VLLVDVDLRKPRIHKIFDLP--NS---AGMSTLLNKRS--TKEDITF
A0A519UDD1      NLGASIALTGKR-VVLLDLDLRNPRVASELNML--KS---IGLSNYLVNDD--ISIKNIL
A0A2A4N9A6      NMAGIIALSGKK-VIILDLDLRKPRIHKAFEID--NA---KGMSTILIGKD--KVEDCIF
A0A6C0GGI1      NLSTVLALSGKR-TVLIDVDLRKPKVAAYLGLK--NT---TGLSSYLIKSS--TLEEIIQ
A0A368D1N7      NLAAIIAMQGKR-VLLVDVDLRKPRIHKIFDLP--NS---SGMSTLLNKRS--IKEDIIF
A0A3B8TU58      NLAAIIAMQGKR-VLLVDVDLRKPRVHKIFNLP--NS---AGMSTLLNKRS--IKEDVTF
A0A1T5IIR6      NMASCLADAQKR-VILVDTDMRKRSLSGVFALKH-KT---KGLSNYLYDLD--LTLDDIL
F0R0C9          NIAGSLALKGKK-VLIIDGDLRKASVSAFIDS---PK---TGLSDYLGRKT--DAIDTAV
A0A6L6NXQ0      NIAASLAIKGKR-VLVIDGDLRHGSLSSYIGS---PG---IGLSDYLAKRT--DDLKGVI
A0A6N8DCX3      NIAASLAIKGKR-VLVIDGDLRHGSLSSYIGS---PG---IGLSDYLAKRT--DDLKGVI
A0A3E0QD27      NLAGVIAFSEKR-VVIIDLDMRKPKIHLGFNVE--NT---KGMSTILIGKD--EA-DNCI
A0A0M1W1I6      NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-EE---KGMTSFLAGKA--TT-DEII
A0A4R4GHU2      NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-EE---KGMTSFLAGKA--TT-DEII
I8WPR6          NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-EE---KGMTSFLAGKA--TT-DEII
A0A0K2HKS3      NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-EE---KGMTSFLAGKA--TT-DEII
B6W3W8          NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-EE---KGMTSFLAGKA--TT-DEII
A0A4R4GSI6      NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-EE---KGMTSFLAGKA--TT-DEII
A0A076IRY8      NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-KE---KGMTSFLAGKA--TT-DEII
A0A3A6AD54      NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-KE---KGMTSFLAGKA--TT-DEII
A0A3A6MIU7      NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-KE---KGMTSFLAGKA--TT-DEII
I8WPP8          NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-KE---KGMTSFLAGKA--TT-DEII
A0A372Y7D2      NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-KE---KGMTSFLAGKA--TT-DEII
A0A3E4JJC9      NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-KE---KGMTSFLAGKA--TT-DEII
A0A3E4WDQ0      NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-KE---KGMTSFLAGKA--TT-DEII
A0A414H9P2      NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-KE---KGMTSFLAGKA--TT-DEII
C3R5A8          NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-KE---KGMTSFLAGKA--TT-DEII
A0A1C5XJA7      NLADSLAYTKKK-VILIDLDIRKGSLSHRMHK---HG---VGMTNYLADET--IALDDII
A0A285T4L1      NLAMSLVLTKKR-VVLVDLDIRKGTLSRHFSK---HP---VGVTNYLADES--IALDDII
A0A3E5BU42      NLAMSLVLTKKR-VVLVDLDIRKGTLSRHFSK---HP---VGVTNYLADES--IALDDII
R7CUW4          NLAMSFVYARKR-VVVIDLDIRKGTLSRHLGE---HR---TGVTNYLADTT--VTVDDII
A0A416GGJ1      NLAVSLMAAKKK-VVVLDLDIRKRTLSRHFAKH---P---YGMTNYLSDAS--IRLEDIL
D1JY72          NLAASFAQTDKK-VILIDMDIRKGTLTSHTRLHT-EE---KGMTSFLAGKA--TT-DEII
D7J4K6          NLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK---HP---VGVTNYLADDS--IRLDDII
Q8ABP9          NLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK---HP---VGVTNYLADDS--IRLDDII
A0A5M6AHF7      NLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK---HP---VGVTNYLADDS--IRLDDII
A0A6L4IA73      NLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK---HP---VGVTNYLADDS--IRLDDII
D6D2Z5          NLAMSLVLTRKR-VVLVDLDIRKGTLSRHFHK---HP---VGVTNYLADDS--IRLDDII
A0A1T3EDR4      NLAASFSYMKKR-VVLVDLDLRKGTLSTRVGLE--GK---AGVSHYLSGLL--RDINTVI
A0A174SDD8      NLAASLVQTEKK-IVLLDLDLRKGKLSEMSHCT--QV---KGVAHYLSNPS--IEVNDII
A0A1H7RFH3      NLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR--QV---KGVAHYLSDSS--VEVTDII
A0A139L1N2      NLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR--QV---KGVAHYLSDSS--VEVTDII
A0A174TVL8      NLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR--QV---KGVAHYLSDSS--VEVTDII
A0A1H8BJR6      NLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR--QV---KGVAHYLSDSS--VEVTDII
R9H6G0          NLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR--QV---KGVAHYLSDSS--VEVTDII
A0A412GR09      NLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR--QV---KGVAHYLSDSS--VEVTDII
A0A6I0S0M4      NLAASLVQTEKK-IVLLDLDLRKGKLSEMAHCR--QV---KGVAHYLSDSS--VEVTDII
A0A081PBV5      NLAASFRYLNKK-VLLLDLDLRKGTLSNRVNAQKEKG---LGVTNFLANPK--VTVDDII
A0A1I2AN85      NLAASFRYLNKK-VLLLDLDLRKGTLSNRVNAQKEKG---LGVTNFLANPK--VTVDDII
A0A4U0GMP3      NLAASFSFLQKR-VVLLDLDLRKGTLSKSLKGRRK------GVTHYLSDAN--VAWSDIV
A0A1H6CKR6      NLGVSLTYLKKR-VVLVDLDLRKGTLSNITKFP--MP---IGATHYLSDSA--ITVDEII
A0A235E1C0      NLGVSMTFLKKK-VVLVDLDLRKGTLSNITKFP--MP---IGVTHYLSDSA--ITVDEII
R6D982          NLSASLVQADKK-VILIDLDLRKATLSLIAKARGNGI---KGMAHYLSNKS--ISMDDII
A0A1F0I8C4      NLAASLVQAEKK-IIMIDLDLRKGRLSHFAHAK--RV---KGVAHYLSNPL--VSADDII
A0A3A5RIJ2      NLAASLVQAEKK-IIMIDLDLRKGRLSHFAHAK--RV---KGVAHYLSNPL--VSADDII
A0A515IZJ5      NLAASLVQAEKK-IIMIDLDLRKGRLSHFAHAK--RV---KGVAHYLSNPL--VSADDII
A0A5M5NLR3      NLAASLVQAEKK-IIMIDLDLRKGRLSHFAHAK--RV---KGVAHYLSNPL--VSADDII
A0A0D5BSQ0      NLATTLSYLEKK-VVVIDLDLRKGTLSSRIDLL--HG---KGVSHYLSSPS--VSVDEVL
A0A1T3F6P5      NLAATLSYLDKK-VVVLDLDLRKGTLSSRTGLL--HG---KGTSHYLSNSS--IQISDIL
A0A0W8EPA0      NLAATLSYLDKK-VVVLDLDLRKGTLSSRTGLL--HG---KGTSHYLSNSS--IKISDIL
A0A365UKN1      NLAATLSYLDKK-VVVLDLDLRKGTLSSRTGLL--HG---KGTSHYLSNSS--IKISDIL
A0A4R6WE41      NLSATVSYLKKR-VVMVDLDLRKGTLTRRMGIK--FR---KGVTHYLSDSS--VKIDDVL
A0A2T5RP38      NLATTLSFLEKK-VVVIDLDLRKGTLSSRVDLL--HG---KGSSHYLSSPS--ISIDEII
A0A1A6CF06      NLAATLSYLDKK-VVVIDLDLRKGTLSSRVDLL--HE---KGTSHYLSNSS--ISVDEIL
A0A1T3D6S8      NLAATLSYLDKK-VVVLDLDLRKGTLSSRTGLL--HG---KGTSHYLSNPS--IKISEIL
A0A1P8E011      NLSSTLSFLNKK-VIVVDMDLRKGTLSERMGII--HG---KGLSHYLSDVN--LELEEII
A0A1V3N3U3      NLSATLSFMEKR-TVVVDLDLRKGTLSSRLGLL--DK---IGCSHFLADAT--VTLDTVI
C2FUH6          NLAATLSFLDKK-ILILDLDLRKGTISSRVNVK--SA---LGVSHYLSNSQ--VAIDDII
A0A0B8T471      NLAASLTFLLQN-VVLLDLDLRKGTLSDHLKLG--SV---KGVTHFLADPA--VSLDHIT
A0A4R7D2K0      NLAASLTFLLQN-VVLLDLDLRKGTLSDHLKLG--SV---KGVTHFLADPA--VSLDHIT
A0A2X2J8S4      NLATTLSFLNKR-VIMVDLDLRKGTLSSRIPVP--VR---KGITHYLSDKE--LNLSEVI
A0A3C0S618      NLATTLSFLNKR-VIMVDLDLRKGTLSSRIPVP--VR---KGITHYLSDKE--LNPSEVI
A0A4P7DRF9      NLGVSFTFLKKR-VVLVDLDLRKGTLSHKTKVP--MP---VGITHYLADSN--TQIDDII
A0A239XXC4      NLGVSMTFLKKK-VVLVDLDLRKGTLSNITKFP--MP---IGVTHYLSDSS--VTVDEII
A0A4U9K473      NLGVSMTFLKKK-VVLVDLDLRKGTLSNITKFP--MP---IGVTHYLSDSA--VTIDEII
A0A3M1Y2F5      NLAASFGIGGYN-TLLVDLDLRNPSQPEYFR--YPRQM---GISNGLLGPE--RSHWKKW
A0A7C7CKY6      NLAGIIALANKK-VIIIDLDLRKPKIHLGFN--SDNKN---GISTILSGV---DKVEDTI
A0A1G1TG88      NLAGIIAMSGQR-VIVLDLDMRKPKVNLAFG--AENVK---GVSTILIDR---HSVAECI
A0A661XXA6      NMGALLAMAGKK-VIILDMDLRRPKVHKAFD--KESSD--CGMSTLLIKK---HNLSECI
A0A3D4RLG4      NLAALYGMTGKK-TLLIDLDIRKPNIHEKLG--VDAGL---GVTNYLIGE---CEIEDIL
A0A2T2UAJ4      NLALALASAGKR-TIVVDADLRRPWMHEMLN--VDRDL---GLSQVLY-E---GELDPEA
A0A6I0DZQ5      NLASVYGLASPR-TLLVDLDIRKPSIHKRLG--VENSL---GLTNFLVGQ---CKAQDII
A0A6L3FBV2      NLAMSIAQTNKK-VVLLDVDIRKGTLSGIFSN-SSNRM---GLTHYLSGST--DKLDDIV
A0A6L3FIH8      NLAMSIAQTNKK-VVLVDVDIRKGTLSGIFSN-SSNRM---GLTHYLSGST--DKVDDIV
A0A3D3LSK1      NLAGSFALDNKK-VILIDCDLRKPRVHTVFE--FDRFP---GLSDFLFHH---VNFEDIV
A0A496L711      NLAGVFALQNKK-ILLIDFDIRKPNLTKNLSGMVKNKL---GFVNYMIGD---CSLNEAI
A0A1H6Z2F8      HLAHSLALASRK-VLLVDFDLRKPTLASLLN--LRP-E---GVTEHIA-----LEKDLLI
A0A2P8G5K0      HLAHSLALAGKK-VLLVDFDLRKPSLATLLN--LRP-N---GVTECIA-----SGHEPLI
A0A4Q3SEI4      NLALSLAISGKK-VVLVDLDLRHPKTTTMHD--LNGQR---GVAEFLENNE--VPVSTIM
A0A348PT57      NLGGILAFSDKK-VIILDLDMRKPRIHKGFN--STNEY---GMSTYLSNR---DNLKDII
A0A7C3PTI0      NLAGIIAYSDKK-VIILDLDMRKPKIHLGFN--VPNLK---GMSTLLIGK---DQVEDCI
A0A5Q4EKA0      NLAGILAFSNKK-VIVIDFDMRKPKIHLGFN--VENIN---GVSTILSNI---DTIDDCI
A0A519SYE7      NLSGIIALSGQR-VVILDLDMRKPKVNLAFG--AENVR---GISTILIER---HTVAECI
A0A7C7CFR2      NLSGIIAFSDKK-VVILDLDLRKPKIHLGFN--YDNEH---GISTILSGK---DKLEDCI
A0A3D4CJE1      NIAGIIAYSGKK-VIILDLDMRKPKIHLGFN--VENDR---GMSTLLIGN---DSLNNCI
A0A7C7LI79      NLAGIIAFSEKK-VIVLDLDLRKPKIHLGFN--FENKK---GISTILSNK---DRIEDCI
A0A4Q5ZQ60      NLAGIIAQSGQR-VVILDLDMRKPKVNLAFE--AENIR---GMSTILIEK---HSVQECI
A0A519Q885      NLAGIIALSGQR-VVILDLDMRKPKVNLAFG--AENIQ---GVSTILINR---HTVAECI
A0A519TAP8      NLGGIIALSGQR-VIILDLDMRKPKVNLAFD--ADNVR---GISTILIER---HTLEECI
R5DEG6          NLAMSFALTHKK-VVLVDLDIRKGTLSSHVQ--VSD-M---GVTNYLSGRI--DNVDEII
A0A3N2LCI3      NLGMAIALKGKK-VLIVDGDMRHGSTSAYMG--SPA-K---GLADYLGGAV--SEVDTLI
A0A6L6NZ03      NIAMSLAIKNKK-VLVIDGDLRHASASAYIH--SPE-V---GLSNYLGGQV--DKLSDII
A0A642EJV3      NIAVSLAIKGKK-VLVIDGDLRHASASSYID--SPD-K---GLSDYLGGRI--DNLDEII
A0A6H9Q899      NIAMSFAIKGKK-VLVIDGDLRHGSASSYID--SPD-K---GLSDYLGGRI--DKLDEII
A0A6L4ENN1      NIAVSLAIKGKK-VLVIDGDLRHASASSYID--SPD-K---GLSDYLGGRI--DNLDEII
A0A1T4NDR5      NLAVVFSQLNKK-VLVMDLDLRIPTIHKKLRIRNT-----MGITDLLNGRA--TVDN---
A0A3D5KRM7      NLAIAIALEGNQTVLLVDADLRHPSICNHLGLNCK-----FGLIDYLSGVT--SLEQ--I
A0A3M1NUH2      NLAVVMAEAGRR-TVLIDADLRRPRVHQLFGRELG-----PGLAHFLVQEP--RFDE--E
A0A7C1IBE4      NLGVSFAHSVKEQALVIDCDLRRPSLQSLFGLKHA-----RGLTEYLRDGD--NISD--M
A0A2T2TDL4      NLATVTAQAGHS-TLLIDGDLRRPRLHEVFDVSRT-----PGITEALQNDL--DEH---A
A0A359ATS6      NMAISLAIKGKS-VLVIDGDLRRGSISDYVDTPK------IGLSDYLGKRI--DTPEEII
A0A1V6HYH8      NLGGILALSNKK-VLIIDTDLRRPKMSITFNNLND-----FGLSNYLLGEC--NIEQ--C
A0A2E0MDX6      NLGGIIAFSEKK-VIILDLDMRKPKTHIGFNVQNT-----IGMSTLLIGQS--SLED--C
A0A2M7KCE1      NLGGIYSFQGKK-TILIDLDLRKPRFHLCFNTDNS-----KGLSTILIGKN--KVHD--C
A0A523GUD4      NIAIASSRNRQRPSLIIDFDLRRPRLHHIFKVDKE-----PGVVDAVTNQI--SFQE--L
R7JFY1          NLAASLVLTHQK-VVLLDLDIRKGTLGKQAGYRGE------GITNYLSGKV--TDVTSLI
A0A1V5S5I3      NTAAVFALKGKR-ILVIDGDLRHGSASAYLGSRHK------GLSDYLGKRE--NNLDGLI
A0A2M7VVW6      NLSGIIAMSGKK-VIILDLDMRKPKIHLGFGVKNDK-----GMSTILIDK---DQIKECI
A0A413V760      NLAMSIAQTNKK-VVLVDVDIRKGTLSGIFSNSSNR----MGLTHYLSGST--DKLDDII
A0A656PYT8      NLAMTLALADKK-VVIVDLDLRRRTLSKQMGQRDNR----NGVSGYISGTI--ANLNDIV
A0A6A0Y068      NIAVSLAIKGKK-VLVIDGDLRHASASSYIDSPD------KGLSDYLGGRI--DNLDEII
A0A3D1AEJ6      NLAASLAMTGKK-VLLMDMDIRKGTLGKGVDTHKNIEGYDIGLTSYLSKIV--TKVESLI
A0A641X2Z6      NLAVVMAQAGHK-VLLMDCDMRNPTQHKLFKLTN------KGLSNCISASE--EVRE--V
A0A6L8U2P8      NLASSIASVGYK-TILVDCDLRRPTLHIKLKEDNS-----RGLSNYMIKKA--SIED--I
A0A7C6G639      NLASTYGMTGLK-TLLIDMDIRKPSINERLELSEN-----DGVTNYLIGEK--SLDE--L
A0A519PJW5      NLGGIIALSGQR-VIILDLDMRKPKVNLAFDAENV-----RGISTILIDRH--SVAE--C
A0A519T3R9      NLAGIIALSGQR-VVVLDLDMRKPKVNLAFGAENI-----KGVSTILIDRH--SVAE--C
                . .           :.:* *.*                   .    :             

A0A2T4XEQ1      RETA-----YPGIHCLTTGRRSPNPASVAQSDKLKSIVEGVKDQYD--YVVIDSAPYGII
A0A2K8ZAP1      HPII----GHENYYIITAGSLPLNPSELLSSPRLANLLQELKERFE--YILVDSPPIGLV
A0A519SD85      RKTS-----IENLEFIPSGPLPINPSELLENEKIDVLINSLKRMYD--IIIFDSAPVGIV
A0A3M1TXY5      HSTH-----IENLHIIPAGNPSNNPTDLISNSRMKELVEACMDEYD--HIIFDTPPIGLV
A0A2E0VQ27      NTSD------ENLYFIPAGQYDDSLEGKVFSAKALDIIHDLRWHFD--MVIVDVAPIGLF
R6U429          QNIK------ENLDLISVGSLPPNPAELLVSEKFDKMMDELSARYD--YIFMDCPPVDIV
A0A5C8AF42      QHST-----IEDLDFITAGPIPPNPSELLLSDRFKEIVEELKQTYD--VIIIDNPPIGLV
A0A239K409      NQSD----QVPNLFIVGSGAIPVNPAELMMSNRVEQLFEELQKKFD--YILIDTAPVGQV
A0A1V5S1J9      KHPD------YKFDILPVGVVPPNPGELIKSDNMNNLISILKETYD--YIVFDTSPIGLV
A0A0A2EYC8      STP-------YGFDFLKAGVIPPNPGEFVRRPQLLEMINLLKEMYD--YVVIDSSPLGLV
A0A2G6H6Y4      TTG-------YGFDFLKAGVMPPNPGEFVRSPKLEQMITELKSMYD--YIIIDTSPLGLV
A0A1M3DPL8      RPDG------AEFDFITAGTVPPNAGELIRSDNLKDMFDELRKRYE--YIIVDTSPIGVV
A0A1V5F519      VVPE------VNYDVIFAGTVPPNPAELIRSEKIIEMMGELRKRYD--YIILDSSPIGLV
A0A2G6R1T9      KNDD------FSFDVLLGGTVPPNPGELIRSEKLKGMLKELRTRYE--YIIIDTSPI---
A0A350V3E4      RETS-----FPNLHIMTCGTIPTNPAELIASKHMQTFLNMMKPKYD--YILIDSPPLATV
A0A6J4K208      QATA-----TENLYIIPSGPLPASPLNLLGTPRMEALLEKVRQEYD--YVILDTPPLGLV
A0A1M6MYT6      HKTK-----HPRLKVIPAGPHPPNPLQMLTDKNLSGLIDQLKKQYD--VVIVDTPPVGMV
A0A2P8CDS1      FRST-----HPYMWLIPSGSFPPNPGELLADKKLKELIELLKEEYD--VIVIDSSPL-LV
A0A353WYK7      KTNL------ENLDYISSGPIPPNPSELIHTGSFDKMIGDLKSKYD--VVIIDTPPVGLV
A0A355BP94      KTDM------AGFDYIPSGPHPPNPSELLLSKAFEDLLAELRTRYD--YIVIDTPPVGLV
A0A136LSC7      KTSL------ENFDFIPSGPHPPNPSELLLNGEFSDFLEELRATYD--YVVIDTPPVGLV
A0A5C7N8Q5      KTSL------ENFDFIPSGPHPPNPSELLLNGEFSDFLEELRANYD--YIVIDTPPVGLV
A0A2W4RDE8      NETG-----IKGYDVITSGPIPPNPLDLIGTPRMAELLNELKQSYH--TIIIDSPPIGFV
A0A0L8VEV2      RQTR-----VENLQFVSAGPIPPNPSELLENGKFEELIERCRDMFD--YIVFDNPPLSLV
A0A1I2A9Z9      RQTR-----VDNLQFVSAGPIPPNPSELLENGKFEELIDRCRNIFD--YIVFDNPPLSIV
A0A212J9Z9      SHPD------YGFDIIPAGTLPPNPSELIKTAKTKQVLEHLKEMYD--YVIIDCSPVGLV
F5IV23          SHPD------YGFDIIPAGTLPPNPSELIKTAKTKQVLEHLKEMYD--YVIIDCSPVGLV
F8X2T0          SHPD------YGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLV
A0A1M3LAG1      SHPD------YGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLV
A0A212K6G4      SHPD------YGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLV
A0A4Y9IPG7      SHPD------YGFDIIPAGTLPPNPSELIKTAKTKQLLEHLKEEYD--YVIVDCSPVGLV
A0A2V3PNY7      THPE------YEFDVITAGTLPPNPSELIKTKKTKDLLDHLKSKYD--YVIVDCSPIGLV
A0A6G7WQ31      THPE------YEFDIITAGTLPPNPSELIKTKKTKDLIDYLKTKYD--YVIVDCSPIGLV
A0A6G7X5K8      THPE------YEFDIITAGTLPPNPSELIKTKKTKDLIDYLKTKYD--YVIVDCSPIGLV
A0A1M5DFS8      THPE------YEFDVITAGTLPPNPSELIKTKKTKDLIEYLKTKYD--YVVVDCSPIGLV
A0A4Y8KZS5      THPE------YEFDVITAGTLPPNPSELIKTKKTRDLIEYLKTRYD--YVIVDCSPIGLV
A0A142HHS5      HTSI------ESLDFISAGPTPPNPSELILNPRFDLMIQELYRTYD--VILIDTPPVGLV
A0A660LQT8      CKYR-----DTDLDVIPVGIMPPNPTELLYAERMDQLFTELKERYD--YIFLDCPPVEIV
A0A2M6GH67      QKTA-----IPNLDFIPAGPTPPNPSELILNPKFDEMLEELRQLYD--VIIVDTPPIGIV
A0A389LWV6      SHPD------FGFDILPAGTIPPNPSELINSEMTKKLLSFLSKEYE--YIILDCSPVGLV
A0A1G9B1T9      QPTD-----QENLYVITAGKSDGHPGEILLSERLPQLINKLKMEFK--FVVLDTPPVKIV
A0A350PNH9      CHGE-EYGLVKDFDVLPIGTMPPNPTELLFTDRLEKMIRQMRGEYD--YVFIDCPPVEIV
A0A354LNT9      CHGE-EYGLVKDFDVLPIGTMPPNPTELLFTDRLEKMIRQMRGEYD--YVFIDCPPVEIV
A0A161LWY6      KKSP-----EINFDLLLAGTIPPNPGEMIRSPKLLELINELKMRYH--YVIIDTSPVGIV
A0A6I3N9U6      KKSP-----EINFDLLLAGTIPPNPGEMIRSPKMLELIKELKSRYH--YVIIDTSPVGIV
A0A3D0FMX4      HDPS------YEFDIIYAGSIPPNPGELIRSDQVVELLEELRSEYD--YIVIDSSPIGLV
A0A1M3MEI8      RPDG------AGFDFIPAGTIPPNAGELIRSEKLRTLFAKLKEYYD--YIIVDTSPIGVV
A0A1J5HQM0      HIPE------LEYDFLPGGTVPPNAGELIRSEKLVEMFQELRNRYE--FIVVDTSPIGIV
A0A653AC35      KKDG------INFDILLAGTVPPNPGELIRSDKLREMFKELESRYD--YVIVDTSPIGLV
E4T131          KLPK------VDFDILPAGSIPPNPGELIRSEKLGKMFEELRTRYD--FIIVDSSPIGMV
A0A521H707      NKSS-----LANLDFITAGPIPPNPSELILSQRMNELLDYLKSKYD--IIIIDTPPVGIV
A0A1F3D6P8      RNTS-----VENLSFIPAGPLLPNPSELIESGVLDELMNFLKKEYD--YIIVDTSPVGLV
A0A356Z058      RNTS-----VENLSFIPAGPLLPNPSELIESGVLDELMNFLKKEYD--YIIVDTSPVGLV
A0A3D1BT36      LKTF-----VDNLDFIPAGPVLPNSSELIEAGALDKLIQYLEDNYE--YIIIDTTPSGMV
A0A5R9QZP0      FDSG-----IKNLSYIPAGPTLPNAAELIEAGKLDSLITHVQNDFN--YVIIDSTPTGLV
A0A3D3HL11      KKTD-----VDNLWFIPAGPILPNSSELIEAGVLDSLIEELKQQFD--YVIIDSTPAGLV
A0A6L8U6G9      RKTD-----IDNLWFIPAGPILPNSSELIESGVLDELIEELKGNFD--YVIIDSTPAGLV
A0A352ME00      RNTA-----ITNLDFISAGPVIPNPSELMESGILDNLINYLKTKYD--YIIIDTTPVGIV
A0A6L8UH35      RHTN-----IENLSFIPAGPVIPNPSEMMELGVLDGLIGELKSRFD--YIIIDTTPVGIV
A0A2W7RD29      KATS-----IPGLSCITSGPYPPNPSELIANKEIIKLLIKMKDQFD--IIILDTPPLGIV
A0A3N2NDY8      VPVA-GQ---NGMSVMPIGHRPPNPSELLDNGRIGQFLDEARKEYD--YIFVDCPPTDVV
D7JEV9          ESTP------YGFDFLKAGVIPPNPGEFVRSHKLLEMLAELQSMYD--YIIIDSSPLGLV
A0A4R6H3B7      RQTR-----VDNLQFVSAGPIPPNPSELLENGKFEELIDRCRNIFD--YIVFDNPPLSIV
A0A3P1Z8V4      HTDG-VC---KGVDFLPAGTIPPNVSELLMSERFEQMIATLRQHYD--FILLDTTPCFAV
A0A2W7QSQ0      TPSG-IN---SNMDIIGLNKSIENASEIITSQKIIKLINSLKSSYD--HIIIDTSPIGLV
R7F6L5          QHNVNDV---EGLDLIGVGNLPPNPSELLYSERLKTLLSTMEQEYD--FIFFDCPPIEVV
A0A7C5MRV2      TKTQ-----YKNLDIITSGPIPPNPAELIQSNRMTELLDELRKQYD--YILIDTPPIGLV
A0A553GA49      EKQE-----GKNISYIAAGHLPPNPSELVESDKTLEMLAELKTRYD--FIILDAGPTSVT
A0A497D6F6      FSSK-H----PDLDIIPAGPIPSNPAELLIDERLEKLMDKLKSTYD--MIIVDTSPVGVV
A0A5M4AAB9      FNTP-H----PYLHIIPAGSIPPNPGEMLADIQLMELTALLKQEYE--TIIIDSSPL-LV
F4KR18          QTSG-DL---PNLDYISGGPFIPNVSEQLTEQQLSVLFAYLKSKYD--VIIIDSSPIGVV
A0A229I3A5      YKGE-ENGLVKNFDVIPIGTIPPNPTELLFTPLLEQMIKTMREEYD--YVFIDCPPIEVV
A0A3R6HJB3      YKGE-ENGLVKGFDVIPIGTIPPNPTELLFTPLLEQMIKTMREEYD--YVFIDCPPIEVV
R6NN15          VPAS-ET---VRFDVLPIGTIPPNPTELLAGERLQTLLADFRTRYD--YILIDCPPIELV
C9LKL0          IKDG-VA---KQVDFLPAGMLPPNPSELLMSSRLEALVEEARELYD--FIIIDTTPILAV
A0A3D0QPV7      RKSE--M---ENLHFITAGPIPPNPAELIINGKLDSILEELKRIYD--IVIVDLPPVGLV
A0A496KT23      TPLD-------RVDVLPCGVIPPNPAELLSTERFAEMIKAAREEYD--IIFLDCPPVEIV
L1M9T3          IPLG-------QVDCLPSGVIPPNPAELLSTSRFRDLIETVRQEYD--LIFIDCPPVEIV
A0A3C0I8F1      HTPI------ENLDFIPSGPIPPNPSELILRPICDEFIKQLTLSYD--VIILDTPPIGLV
R5JJI4          GASE-EY---GKLDIIFSGPVPPNPAELLLSERFDRLITELRKRYD--YIIVDNVPAGMV
A0A0A2DQN2      QQDP-NC---EMLSIIPAGTIAPNPTELLLSKRLDSLIDELGRRYD--YVIMDNVPFGVV
A0A0A2F2N5      RQDK-NC---PSLHVIPIGSSAPNPAELLMSERLDALMDELSARYD--YVLIDGVPFGIV
L1NGW4          HKDP-NF---SKLAIIPAGAIPPNPAELLLGHRLDDLAQELSDRFD--FVIFDNVPFGSV
Z4WRA0          HKDP-NF---SKLAIVPAGAIPPNPAELLLGHRLDDLAQELSDRFD--FVIFDNVPFGSV
U2K8K9          RKDP-NA---PKLSVIASGAVPPNPAELLLGERLDELADKLSEQFD--FVVFDNVPFGSV
A0A069ZM60      RKDP-NA---PKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSV
J6GV98          RKDP-NA---PKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSV
A0A134B4F8      RKDP-NA---PKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSV
A0A134B8C7      RKDP-NA---PKLQVITSGAVPPNPAELLLGERLDELAAKLAEQFD--FVLFDNVPFGSV
A0A3D2HF71      KTEV------ENLWYAPAGPIPPNPAELIESESMKEFIDKAKKDFE--FIIIDTPPAAVV
A0A4Z0EKR0      RESE-QV---PNLFIISSGPIPPNPAELLLSSKFAQLIEELKENFD--YIIMDTPPVGQV
B5CTK0          VKGK-LH---ANLDMIYAGAVPPNPAELLLSERLDQMIEELRTRYD--YIIVDNVPAGMI
A0A1M6B6D5      QKTE--I---DTLDVITSGPIPPNPSELLLGERLDQLLGLLKDQYD--YIILDSPPMGLV
A0A451FS66      QKTE--V---DYLDVIPSGPTPPNPSELLIGERMDEFMERLKERYD--YIILDSPPIGLV
A0A2E3GN39      STSE------ENLWAVPAGPIPPNPSELIGGEPFINFIDEVKTSFD--VVIFDTPPIGLV
A0A3D1MEL0      STPE------ENLWAIPAGPIPPNPSELIGGDSFVNFLDEVKTSFE--VVIFDTPPIGLV
A0A519UDD1      RLSE-KV---PDLFIIGSGPIPPNPAELIMSPKLAYLIEELKKSFD--YILIDTPPVGQV
A0A2A4N9A6      KSNI-D-----TLHFIPSGPIPPNPAELIINQRTEELLAVLRKQYD--LIVIDTPPIGIV
A0A6C0GGI1      PTKV-K-----NFDVISSGPIPPNPVEMIELKEMRDLIAKLKAEYD--YVIVDTPPLSFV
A0A368D1N7      STPE-E-----NLWAIPAGPIPPNPSELIGGDSFVNFLDEVKTLFE--VVIFDTPPIGLV
A0A3B8TU58      STSE-E-----NLWAIPAGPIPPNPSELIGGDSFVNFIEEIKTSFD--VLVFDTPPIGLV
A0A1T5IIR6      FKD--VK---SGIDFIPAGAVPPNPTELLGRPRLEELIEALRQKYD--YILLDGVPIQML
F0R0C9          VEAP-QC---PGLYILPVGTLPPNPTELLAEDRFGKLVAGLRDRYD--YIFIDCPPIEIV
A0A6L6NXQ0      HKVDVRY---AGLDMIPVGTMPPNPTELLSGEYMRELVTEMRARYD--YIFIDCPPVDIV
A0A6N8DCX3      HKVDVRY---AGLDMIPVGTMPPNPTELLSGEYMRELVTEMRARYD--YIFIDCPPVDIV
A0A3E0QD27      RKSN-L----TNLDFITAGPIPPNPSELILSRKMVELVEYLKSKYD--VVIIDTPPVGIV
A0A0M1W1I6      KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVV
A0A4R4GHU2      KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVV
I8WPR6          KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVV
A0A0K2HKS3      KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVV
B6W3W8          KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVV
A0A4R4GSI6      KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVV
A0A076IRY8      KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVV
A0A3A6AD54      KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVV
A0A3A6MIU7      KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVV
I8WPP8          KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVV
A0A372Y7D2      KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVV
A0A3E4JJC9      KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVV
A0A3E4WDQ0      KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVV
A0A414H9P2      KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVV
C3R5A8          KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVLITELRNRYD--YIFVDNVPVGVV
A0A1C5XJA7      HDCG-KD-----YDFINAGTSAPNPAELLMDSRLDSMMEELRKRYD--YIVVDNVPVGLV
A0A285T4L1      HTDE-KS---GGLDIISSGTVAPNPAELLMDSRLDTMMAELRKRYD--YVIVDNVPVGIV
A0A3E5BU42      HTDE-KS---GGLDIISSGTVAPNPAELLMDSRLDTMMAELRKRYD--YVIVDNVPVGIV
R7CUW4          RKGE-H------FDIIASGPVAPNPAELLLDSRLDTLIAELRTRYD--YIIVDNVPVGIV
A0A416GGJ1      VKGN-GV---DIPDAILAGPVAPNPAELLLENRLDELIEELKTMYD--YVIVDNVPIGII
D1JY72          KHNE-IC---ENLDFIPAGPIAPNPSELLLSEQLEVMIAELRNRYD--YIFVDNVPVGVV
D7J4K6          HTDG-KF---DNLDIISSGTVAPNPAELLMDERLDAMVEELRQRYD--YIIVDNVPVGIV
Q8ABP9          HTDG-KF---DNLDIISSGTVAPNPAELLMDERLDAMVEELRQRYD--YIIVDNVPVGIV
A0A5M6AHF7      HTDG-KF---DNLDIISSGTVAPNPAELLMDERLDTMVEELRQRYD--YIIVDNVPVGIV
A0A6L4IA73      HTDG-KF---DNLDIISSGTVAPNPAELLMDERLDTMVEELRQRYD--YIIVDNVPVGIV
D6D2Z5          HTDG-KF---DNLDIISSGTVAPNPAELLMDERLDTMVEELRQRYD--YIIVDNVPVGIV
A0A1T3EDR4      YHRE-IG---LGVDVIPLGAIAPNPVELLLSKHLDELIEALKLKYD--YVIVDGVPMGIV
A0A174SDD8      LRDA-FG---EGLDLVPIGVIAPNPTELLLSKRLDELVDKLRERYD--YIIVDNVPIGLV
A0A1H7RFH3      VQDT-FG---EGLDLVPIGVIAPNPTELLLSKRLDKLVAELKERYD--YIIVDNVPIGLV
A0A139L1N2      VQDA-FG---EGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLV
A0A174TVL8      VQDA-FG---EGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLV
A0A1H8BJR6      VQDA-FG---EGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLV
R9H6G0          VQDA-FG---EGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLV
A0A412GR09      VQDA-FG---EGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLV
A0A6I0S0M4      VQDA-FG---EGLDLVPIGVIAPNPTELLLSKRLDKLVVELKERYD--YIIVDNVPIGLV
A0A081PBV5      YQGL-VG---GIIDVIPIGVIAPNPVELLLSTRLDELIIELKKRYD--YIIVDNVPVNLV
A0A1I2AN85      YQGL-VG---GIIDVIPIGVIAPNPVELLLSTRLDELIIELKKRYD--YIIVDNVPVNLV
A0A4U0GMP3      YKNE-FA---NSVDIVPIGTIAPNPVELLLGGRLDELIAALKSNYD--YVIVDNVPVALV
A0A1H6CKR6      YKDR-VD---ANIDIVPIGVIAPNPVELLLSERLDRLFVELKERYD--YIIVDNVPLGIV
A0A235E1C0      YKDR-TD---AEIDIVPIGVIAPNPVELLLSDRLDTLINELKERYD--YIIVDNVPLGIV
R6D982          MKDG-FG---ERIDLIPVGVIAPNPAELLLSGRLDELIGHLRERYD--YIIVDGVPVGMV
A0A1F0I8C4      LHDA-FG---EGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVV
A0A3A5RIJ2      LHDA-FG---EGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVV
A0A515IZJ5      LHDA-FG---EGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVV
A0A5M5NLR3      LHDA-FG---EGLDLIPIGVIAPNPTELLLNRRLDELIVKLRRRYD--YIIVDNVPIGVV
A0A0D5BSQ0      HKSE-VA---NGVDFVPIGAIAPNPVELLLSKRLDELINELKERYD--YVIIDGVPVGIV
A0A1T3F6P5      HKSE-VA---EGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVV
A0A0W8EPA0      HKSE-VA---EGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVV
A0A365UKN1      HKSE-VA---EGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVV
A0A4R6WE41      YKSD-LS---EGVDCVPIGVLAPNPVELLLSQRLDELIGELKLRYD--YIIVDGVPVAIV
A0A2T5RP38      HKSD-VA---EGVDFIPIGAIAPNPVELLLGKRLDELITKLKERYD--YVIIDGVPVGIV
A0A1A6CF06      QKSE-LL---ENVDVIPIGAIAPNPVELLLSKRLDELINELKNRYD--YIIIDGVPTGVV
A0A1T3D6S8      HKSE-VA---EGVDFIPIGAIAPNPVELLLGKRLDELITELKGMYD--YVIIDGVPTGVV
A0A1P8E011      HYNL-HG---KNVDYISIGMEAPNPVELLLSKRLDQLISDLRNRYD--YIIIDGVPTGIV
A0A1V3N3U3      YPVK-GL---EFLDCVPIGLIAPNPVELLLSARLDELIAELRKRYD--YIVVDGVPLGIV
C2FUH6          CKSG-IA---DNVDIISIGMVAPNPVELLLGKRLDELIADLRNRYD--YIIVDGVPVGLV
A0A0B8T471      YKAN-VG---NGVDVIPIGVIAPNPVELLLSKRLDVLIAQLKERYR--YIVVDNVPIDLV
A0A4R7D2K0      YKAN-VG---NGVDVIPIGVIAPNPVELLLSKRLDVLITKLKERYR--YIVVDNVPIDLV
A0A2X2J8S4      YKTE-VS---DNIDIIPIGVIAPNPVELLHSDRLDNLIAELKKQYD--YIIIDSVPVEII
A0A3C0S618      YKTE-IS---DNIDIIPIGVIAPNPVELLHSDRLDNLIAELKKQYD--YIIIDSVPVEII
A0A4P7DRF9      YKDR-IA---DGLDIIPIGVIAPNPVELLLSERLDNLFAELKNRYD--YIIVDNVPLGIV
A0A239XXC4      YKDR-TD---SEIDIVPIGVIAPNPVELLLSERLDQLIAELKERYD--YIIVDNVPLGIV
A0A4U9K473      YKDR-VD---ADIDIIPIGVIAPNPVELLLSERLDNLIAELKERYD--YIIVDNVPLGIV
A0A3M1Y2F5      IIKD----VESQIDILPAGPHLPNSIDLLDTGAFEELIEELPLHYQ--YVIVDLPPIMQA
A0A7C7CKY6      -SKS----NVDNLDYITAGPIPINPSELIISEKMDELLVYLKSSYD--MIVIDNPPVGIV
A0A1G1TG88      -QHT----SIDALQFISAGPTPPNPSELILSPRFDQMLNELYESYD--VVMIDTPPVGLV
A0A661XXA6      -TKS----HIEDLDFIGAGPVPPNPSELILREAFDEILEKLRGLYD--VILLDTPPIGIV
A0A3D4RLG4      -HKD----TSYNFDFLLAGTIPPNPGELIRTDKLVSLLQELRKQYD--FIIIDTSPIGQV
A0A2T2UAJ4      -YAT----EVENLFVIPAGDTVPNPAELLGSNRMKEFVEALEAKFD--YVLIDTPPALLF
A0A6I0DZQ5      -MRP----DGAGFDFIPAGTIPPNAGELIRSEKLRTLFAKLKEYYD--YIIVDTSPIGVV
A0A6L3FBV2      GRSE----EYDKLDVIFSGPVPPNPAELLLSERFDRLITELRQRYD--YIIVDNVPAGMV
A0A6L3FIH8      GRSE----EYDKLDVIFSGPVPPNPAELLLSERFDRLITELRKRYD--YIIVDNVPAGMV
A0A3D3LSK1      -RDS----GFDNLSVITAGTIPPNPSEMLGSLQMKKFLELVESKYD--IVILDSPPLISV
A0A496L711      --ES----TPYGFDFLKAGVIPPNPGEFVRSHKLLEMLAELQSMYD--YIIIDSSPLGLV
A0A1H6Z2F8      QQCA----NGPPFDFIAAGMQS--MDDTMLSPKIAGLIPALKAGYD--YVLLDSPPVGLV
A0A2P8G5K0      QQNS----SETSFDFLAAGQQSPGTGEIILSPKVADLISTLKIRYD--YVLLDSPPVGLV
A0A4Q3SEI4      -YPT----SNEKIFVVPAGYSDVNPTELLLNGDINGLLTKLEATFD--FVLIDTCPVDPV
A0A348PT57      -RKS----ELDGLHFITAGPIPPNPSELIISGNLTKGLDELKKIYD--IIIIDNPPVGLV
A0A7C3PTI0      -QHS----SLENLHFITAGPIPPNPSELIISKKMDEILAHLKTQYD--VIVIDNPPVGLV
A0A5Q4EKA0      -QPS----RVKNLDFITAGPVPPNPSELILTPRMDEMINYLKSKYD--YVIVDNPPVGIV
A0A519SYE7      -QHT----NIESLDFISAGPTPPNPSELILSPHFDQMLAELHRTYD--VILIDTPPVGLV
A0A7C7CFR2      -NTS----TIPNMDVITAGPIPPNPSEMILSQQMQDLIEKLKLKYD--MIVIDNPPVGIV
A0A3D4CJE1      -KHS----ALKGLDFITAGPIPPNPSELIINGNLTEIIEELKQTYD--LVIIDNPPIGLV
A0A7C7LI79      -QSS----TLKNLDVITAGPIPPNPSELIISKKMDELIEFLKTKYD--ILVIDNPPVGIV
A0A4Q5ZQ60      -QHS----RLSNLDFISAGPTPPNPSELILNDKFDLVLQELKEIYD--VILIDSPPVGLV
A0A519Q885      -QHT----SIESLDFISAGPTPPNPSELILSPRFDQMLQELHRHYD--VIMIDTPPVGLV
A0A519TAP8      -QHT----SIESLDFISAGPTPPNPSELILNPRFDQMLAELHRSYD--VILIDTPPVGLV
R5DEG6          QKGE----LYDKLDIIHAGPVPPNPAELLLSDRLEALIAELRERYD--YIILDNVPAGVV
A0A3N2LCI3      VKTP----ECQNMQVLPIGSIPPNPTELLESPRFGELIGELKSRFD--YVIIDCPPIEVV
A0A6L6NZ03      VTDK----QHPSFSFIPVGTIPPNPTELLFDDRLQDAIHTLKQQYD--VVLIDCPPVELV
A0A642EJV3      VPDP----KHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYD--YVLIDCPPVELV
A0A6H9Q899      VPDP----RHKSMDILPVGTIPPNPTELLFDERLKQAIDAVRERYD--YVLIDCPPIELV
A0A6L4ENN1      VPDP----KHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYD--YVLIDCPPVELV
A0A1T4NDR5      VVKP----VFKNIDVITTGTKIIYHSEFIQSTALMNFIERMKDEYD--IILLDCPPVGIV
A0A3D5KRM7      LIHP----KIENLVLLPGKESKVNYSELISSPKMIEFIKETKSRYESRIIIFDVPPLFVA
A0A3M1NUH2      LVAT----PIDNLWIIPAGKVVPRSSELFATRVMRDFIESLRARFD--VIILDTPPVRVA
A0A7C1IBE4      IYAT----GLPKLSIIPSGSPPDNPSELLSSDRMSAMLDELADMADNRLLVLDSPPFHVA
A0A2T2TDL4      MKRP----LIDNLCVLPAGTEVENPAKVLGSSRFRDFLQRAEQYFD--HVIVDSSPVLAT
A0A359ATS6      VVDK----KHPTLHILPVGTIPPNPTELLVEERLKELINRMRSRYD--YILIDCPPIDVV
A0A1V6HYH8      IKGT----EINNLFYFPAGSLPEYPNELLTSSKMDELLENLKKYYD--IIILDTPPIGLI
A0A2E0MDX6      IQKS----HLENLHFITAGPIPPNPAELIISNKMTDVINELKNLYD--VIVIDTPPVGIV
A0A2M7KCE1      IKKS----KIANLDYITAGPIPPNPSELTAGNEILNVINELKQIYD--VIIIDTPPLGLV
A0A523GUD4      IKDS----GFPNLKIITSGNLNDSPIKIFNAQNIKAFLETASSFYD--YIVVDAPPVIPV
R7JFY1          CQDE----LVPGLDVIHAGPVPPNPAELLQNKRLDAMIAELRTRYD--YILLDNVPAGLV
A0A1V5S5I3      QENP----DIPGFFLLPAGTIPPNPTELLAEPMFKEAIERLRGNYD--YIFIDCPPIDIV
A0A2M7VVW6      HHSE----L-TNLDFITSGPIPPNPSELIISGKLDEVIAELKKEYD--LVVLDNPPIGLV
A0A413V760      GRSE----EYDKLDVIFSGPVPPNPAELLLSERFDRLITELRKRYD--YIIVDNVPAGMV
A0A656PYT8      FQSG----LHENLDIIFAGLQPPNPAEMLLSEKFDEFMADLRKRYD--YVVIDSVPAMAV
A0A6A0Y068      VPDP----KHKSMDILPVGTIPPNPTELLFDERLKQTIDTVREQYD--YVLIDCPPVELV
A0A3D1AEJ6      IQDQ----DYPNIDIIRSGPEPPNPAELLLSPRLDELIRELREMYD--FIVIDNVPAGMV
A0A641X2Z6      IQKT----GIENLELLASGPVAPNPSELLGSKRMEQLLEQLKPDYD--YILIDTPPIMPV
A0A6L8U2P8      IRNT----AIPNLDFISAGPVIPNPSELMESGVLDHLINQLKTQYD--YIVIDTTPVGIV
A0A7C6G639      ILKK----EKYNFDILLGGTVPPNPGELIRSEQLKQMFLALRERYD--YIIVDTSPIGLV
A0A519PJW5      VQHT----SIESLDFISAGPTPPNPSELILHPRFDLMLQELYRTYD--VILIDTPPVGLV
A0A519T3R9      VQHT----SIEALDFISAGPTPPNPSELILSPRFDQMLQELYRSYD--VIMIDTPPVGLV
                                                                 :..*  *    

A0A2T4XEQ1      TDAAPMMKMADGIVVSVRFNKT-QTNELAQTLENLENIHVS-ILGLSLVGYDHK------
A0A2K8ZAP1      TDSQVIAPYADATIFVVRHDHT-PKNYIKMVDALYKEQRFQ-KLSIVLNGVGKG------
A0A519SD85      TDSTPILKKADINLFILRCGVS-RQEYINTPEAIKQKLMLD-NIYIVFNDFLPD------
A0A3M1TXY5      SDYLILMHLTDYNIYVVRHNVT-EVADLKLINELFETGKIQ-NIGLLLNGVASL------
A0A2E0VQ27      DDSIVLMRKSTANLFLIRKGTT-RLRQLKPINELLDSFQIP-NLYLVLNGVRQK------
R6U429          ADTSIIAKHADYTVFVIRAGLF-DKRALPAVEDAYERGVYN-HMAVILNGVDTT------
A0A5C8AF42      SDGIKNLTEADIPIYVFKSHYS-KRNFAFRVKELFEMQQLN-QLNVILNGVQTS------
A0A239K409      SDAFSLSKYVDLTVCLVRYNYT-PKHEIENINDILYNNKFK-QPMIVLNGAKKF------
A0A1V5S1J9      TDAYGIIESVDIILYAVRAEQT-NKSFYKKAMSQLEANNVK-KVGLIFNDVNLK------
A0A0A2EYC8      ADAYALFSTVDIKLLIVRSLKT-NKVEFTDLAKRLYADNVE-DIYVILNDVDKS------
A0A2G6H6Y4      TDSYALFPMVDVKLLVVRSFKT-SKREFSELTRRLYMDKVK-NVYIILNDVDRS------
A0A1M3DPL8      ADAYSFAALSDINLFVIRSNKT-NKQFVKTLSNQLKEDTKS-RFYSILNDVEIE------
A0A1V5F519      TDSFSLASLADVNLLVVRNNKT-HKDFFKNVVNQIVTDKLS-NFYVVFTDVETD------
A0A2G6R1T9      ----------------VRNEKT-NKAFFKRINEQIVSDKFN-NFYIVLNDINIT------
A0A350V3E4      TDAELLSSYVDGTVVVSLASKT-RLDLLVNTIDTLNKINDT-FIGVILNNFDYQ------
A0A6J4K208      SDFLVLLKYTDFNMYIVRHRLT-ERAGLNKINELYNSNRLR-NVGILINGARAL------
A0A1M6MYT6      ADFFLLRDMFDAAVFIVRHKST-PKKPLKDILEELESHQIE-ELGIIVNNVYRT------
A0A2P8CDS1      ADLFQYSHLCNAYLYVSRQGVT-PQPAIKSALQEISNQHIR-NVGILLNDI--R------
A0A353WYK7      TDGILALKKSDIALFVVRSGFS-KKSFIQNIDRLVKAHHLD-QSSIIFNANRSS------
A0A355BP94      TDGIMAMKRADLSIYVVRANYS-RKEFLSNLERIVSINKLS-HVAVVLNALPTS------
A0A136LSC7      TDGVMAMKRSDLSIYVFRANYS-HKDFLQNLARVVTLNKLT-HVSSVLNAIPLS------
A0A5C7N8Q5      TDGVMAMKRSDLSIYVFRANYS-RKDFLQNLARVVTLNKLV-HVSTVLNAIPLN------
A0A2W4RDE8      SEYIILMKYTDANIYVVRSDYT-TKYNLDRINKLYDERKVT-NISILLNDVKYS------
A0A0L8VEV2      SDGIVIGQKVDINLFVTRQDYS-KKNEVRFIDHVNKKKAMK-NAGIILNDIHLS------
A0A1I2A9Z9      SDGIIIGQKVDINLFVTRQDYS-KKNEVKFIDHVHRKKSMK-NPGIVLNDIHVS------
A0A212J9Z9      SDAYILSEIADTTLFVVRRAKT-NKSFFKSVITQLKYDGVE-DIALVFNDVKGR------
F5IV23          SDAYILSEIADTTLFVVRRAKT-NKSFFKSVITQLRYDGVE-DIALVFNDVKGR------
F8X2T0          SDAYILSSMADTTLFVVRRAKT-NKAFFKSVITQLGFDGVE-NIALVFNDVKGR------
A0A1M3LAG1      SDAYILSSMADTTLFVVRRAKT-NKAFFKSVITQLGFDGVE-NIALVFNDVKGR------
A0A212K6G4      SDAYILSSMADTTLFVVRRAKT-NKAFFKSVITQLGFDGVE-NIALVFNDVKGR------
A0A4Y9IPG7      SDAYILSSMADTTLFVVRRAKT-NKAFFKSVITQLGFDGVE-NIALVFNDVKGR------
A0A2V3PNY7      SDAYILSKYVDTTLFVVRRGKT-NKAFFKSVVSQMRNDGLE-HAALVFNDVKGR------
A0A6G7WQ31      SDAYILSKYVDTTLFVVRRAKT-NKAFFKSVVNQMRNDGLE-HAALVFNDVKGR------
A0A6G7X5K8      SDAYILSKYVDTTLFVVRRAKT-NKAFFKSVVNQMRNDGLE-HAALVFNDVKGR------
A0A1M5DFS8      SDAYILSKYVDTSLFVVRRAKT-NKAFFKSVVNQMRNDGLD-HVAIVFNDVKGR------
A0A4Y8KZS5      SDAYILSKYVDTTLFVVRRAKT-NKAFFKSVVNQMRNDGLE-HVALVFNDVKGR------
A0A142HHS5      TDGILIMRKADVPIYIVRANYS-RKTFLKNMNRLMRNNQFT-RMTTILNDAKAQ------
A0A660LQT8      ADAAIISRHADLTLFVVRAHLL-ERSMLPEINDFYRSNRYP-NMVTVLNGTLDT------
A0A2M6GH67      TDGTLVMRKADIPIYIVRADYS-KKEFLKNINKVIKTNKFN-KLTVILNDAKAQ------
A0A389LWV6      SDAHFLAKLADVVLYVVRNEKT-NRNFFKHTISEFKGDVTSGKMAIIYNDVDLD------
A0A1G9B1T9      TDALVLSAYSDINILVARRGVT-SKSQLMDVEELHQNNTLH-NLYVVLNDVQAT------
A0A350PNH9      ADTQIIEKLADRTIFVVRSGLM-QRSMLGDIEQFYKDKKFK-NMSLILNGTKAQ------
A0A354LNT9      ADTQIIEKLADRTIFVVRSGLM-QRSMLGDIEQFYKDKKFK-NMSLILNGTKAQ------
A0A161LWY6      SDAYPLAPISDCVIYITRSRKT-NKKFFKSVINQLKTDRMQ-HVGVVLNDIDAN------
A0A6I3N9U6      SDAYPLAPISDCVIYITRSRKT-NKKFFKSVINQLKTDRMQ-HVGVVLNDIDAK------
A0A3D0FMX4      TDAYALIERSDITLFVVRYNKT-QRNFCREVLAQMEEDGKQ-NIYIVFSDLPHE------
A0A1M3MEI8      ADAYSFADLSDINLFIVRSDKT-HKLFLRTLTAQLKSDNVH-DFYSILNDVELK------
A0A1J5HQM0      ADAYAIAHLSDINIFVARSGKT-SKSHFAKISKQLKSDNV--EAYCILNDVMSE------
A0A653AC35      ADAYSLAPLMDANIFVVRSEKT-NKSFFKKLNAQLKADNIK-NLYLVINDVDSQ------
E4T131          TDAYSLAQHSDVNLFVVRNGKT-NKTFFKKLCAQLKLDNIP-QLYTVLNDVLDD------
A0A521H707      TDGVEIIQNADYPIYIIRAHYS-KRMFMQNLNKLIEEYKIR-NLAVVLNGVETS------
A0A1F3D6P8      ADATQLIRYATHILLVTRINYT-RKDILEHVLKNFSSNRIT-NYDAVLNSLPLD------
A0A356Z058      ADATQLIRYATHILLVTRINYT-RKDILEHVLKNFSSNRIT-NYDAVLNSLPLD------
A0A3D1BT36      ADAAQLIKYSSINLLVCRNNHT-RKDVFNSVLNFYKTHNIE-NFDIIYNDVEIK------
A0A5R9QZP0      SDAVALMNYASHILMVCRNNHT-IKNVFFDVLNFFKANRID-NFDIVYNDLDKK------
A0A3D3HL11      ADATLMIKYASYILLVCRNDYT-RKDVFTDVLNLFRTNNIT-DYDIVFNDLNLK------
A0A6L8U6G9      ADASLMVKYASFILLVCRNEYT-RKDVFTDVLNLFQTNNIN-NFDIVFNDLNLK------
A0A352ME00      ADAILMMKYASKVLMVIRNNYT-RKDIFANVINNLKSNKLT-NYDIVYNDLNLH------
A0A6L8UH35      ADAILMMKYASKVLMVMRNNYT-RKDILVNVINNLRINKLN-NYDIVYNDLNLH------
A0A2W7RD29      SDSMSLFPLVDVSLLAFKCGYN-NHKGIVELNKLKSNDFIK-KVYCILNGVDSH------
A0A3N2NDY8      VDTQIVEKYVDRTIFVVRAGLL-DRKALEEIDAIYRNKRFK-QMSIVLNGTEAA------
D7JEV9          ADAYALFSVVDIKLLVVRSFKT-NKMEFTDLSKRLYSDNIE-DIYIILNDVDKS------
A0A4R6H3B7      SDGIIIGQKVDINLFVTRQDYS-KKNEVKFIDHVHRKKSMK-NPGIVLNDIHVS------
A0A3P1Z8V4      ADAGIVSRVAEVTLFVMRVGVQ-SKHGLPAVAELYRSRKIG-NICLVINDCDIK------
A0A2W7QSQ0      ADAYSLSEIVDLVVYVVRMNYT-RVDNLHALAEIIDENIFK-QNFVVLNDSNEY------
R7F6L5          ADSRILNEYVDTTIFVIRAGLF-DRRMLKSIRNLYAERRYN-NMCLLLNGTSVG------
A0A7C5MRV2      TDGTTILKLSDIALYVIRADYS-KKSFASNPDQLVEDHDIK-NLYIVLNSVSAA------
A0A553GA49      AESLVLGKMADLILVVMRVNYT-LKKEFKEIIEELDGSFGK-KVTVVLNGVKVS------
A0A497D6F6      ADTLQITSQFDIIIFVVRQRMT-KKQVFKSAIEELQNFNVD-KLGVLFNDVSSR------
A0A5M4AAB9      ADVFQFSNLWDTLLFVTRQGIT-LKPAAKSALQEISSQNTN-RLGLLLNDISIN------
F4KR18          SDGMLLNNYVDNTLFVVRSNFT-KKATIAKAREIFEQNKLV-NPAIIFNGVKKQ------
A0A229I3A5      ADTPIYEQFADRTIFVVRAGLM-ERSMLPEVNALYKEKKFK-NMTLILNGTKAH------
A0A3R6HJB3      ADTPIYEQFADRTIFVVRAGLM-ERSMLPEVNALYKEKKFK-NMTLILNGTKAQ------
R6NN15          ADTHIIGKYADRTIFVVRAGLL-ERSMLPELEALYIEHKFK-NMTVLLNGTEGN------
C9LKL0          SDASIVDRVADVTLFVIRVGVQ-VRAFLPELEKMNKDKKYR-HLCIALNDVDVK------
A0A3D0QPV7      TDGIPIVQMADYPIYVFRANYS-KKNFVQNADRLVNENNIQ-RLSVVLNSVDTD------
A0A496KT23      ADAEIINPHADLTLFIVRASLM-ERSYLKDIERWYAEKKYN-NLTLLLNGTTDA------
L1M9T3          ADAEIINPVADLTLFVVRAGLM-ERSFLNDIERWYLDKKFH-NLTLLLNGTTDA------
A0A3C0I8F1      TDGVLLMQKAEVPIYIFKANYS-KKAFSKSINKLILKNNFT-NLSVVLNAVNKR------
R5JJI4          ADASIVNRVADLTIFVVRSGVM-DRRQLPELEKMYREEQLC-NMCVVLNGVSYE------
A0A0A2DQN2      ADASIVNRAADLTLFIIRAERM-DRRMLPELERLYQEQVLT-NMAIILNGVNHN------
A0A0A2F2N5      ADATIVNRVVDLTLFILRSGTV-DRRVLPDLQLLYDEKILN-NMAIVLNGISSQ------
L1NGW4          ADAAIANRIADLTIFVLRAARL-DKRALPELQRLYDNEILR-NMSIVLNGASDG------
Z4WRA0          ADAAIANRIADLTIFVLRAARL-DKRALPELQRLYDNEILR-NMSIVLNGASDG------
U2K8K9          ADAAIANRVADLTIFILRAAKL-DRRALPELQRLYDDHILT-NMAIVLNGATES------
A0A069ZM60      ADAAIANRIADLTIFVLRAGRL-DRRALPELQHLYDENILT-NMSIVLNGATES------
J6GV98          ADAAIANRIADLTIFVLRAGRL-DRRALPELQHLYDENILT-NMSIVLNGATES------
A0A134B4F8      ADAAIANRIADLTIFVLRAGRL-DRRALPELQHLYDENILT-NMSIVLNGATES------
A0A134B8C7      ADAAIANRIADLTIFVLRAGRL-DRRALPELQHLYDENILT-NMSIVLNGATES------
A0A3D2HF71      TDALLLADLADFYIFVVRQRFS-SKNTVELIEELYRNETIG-RIGIVMNDISLT------
A0A4Z0EKR0      ADAFTFSAFADISIYLVRYNMT-IKSQLKIIRNIYKSKSLI-APMIVLNDAKQS------
B5CTK0          ADAAIVNRIADWTLYIVRAGVL-DRKQLPDVDALYKSGQFT-NMALILNGVDFK------
A0A1M6B6D5      SDALVLTKHVDATLYMVRQNYT-HKNMLTFVNEKFRRGEVK-HISIVINEYVEK------
A0A451FS66      SDAMEIIKYADATLYMVRHNRT-RKNMLTFVNEKYKRGEIK-HISIVLNEYVEK------
A0A2E3GN39      TDSIPVISTVNNPIYVLRADYS-HRSFVGHIESTKENLQVP-SLSIIMNDYGRG------
A0A3D1MEL0      TDAIPVISGTNNPIYVLRADYS-HRSFVGHIESTKDNLKVT-NLSIVLNDYGRG------
A0A519UDD1      SDAFALKPLIDLTIYVVRYNYT-KKAQLTIPRNIYNSKTLS-HTMIVLNDAKEI------
A0A2A4N9A6      SDGIDIIRKADYPLYIFRADYS-KKDFVKIMNKLMNDHKIS-KLALILNESGGG------
A0A6C0GGI1      AEYMILKEYLDANIFVVRANYT-KREVLDTINELYESKAIN-NLSIVIND----------
A0A368D1N7      TDAIPVISRANNPIYVLRADYS-HREFVGHIESIKDNLKVP-NLSIVLNDYGRG------
A0A3B8TU58      TDSIPVISKVNNPIYVMRADYS-HRSFVGHIESTKENLQIP-NLSIIVNDYGRG------
A0A1T5IIR6      ADPIVLNRVVDINLFILRSGQL-DRRILPQLDELNDKHHLH-NMAIVFNGPQIK------
F0R0C9          ADTQIIEKVADRTLFIVRAGLL-ERSMLAELETIYQEKRFK-NMAVILNGTLDG------
A0A6L6NXQ0      ADTQILEKVTDRTFFVVRAGLM-ERNMLPEVENLYKQKKLK-NMAVILNGTENE------
A0A6N8DCX3      ADTQILEKVTDRTFFVVRAGLM-ERNMLPEVENLYKQKKLK-NMAVILNGTENE------
A0A3E0QD27      TDGVDVIQNADYPIYIIRAQYS-KRMFINNLNRLIEESKVR-NLAVVLNGVETS------
A0A0M1W1I6      ADAAITNRIADLTIFVVRVGKL-DRRMLPELEKIYRSGQLN-NMSLVLNGAIVK------
A0A4R4GHU2      ADAAITNRIADLTIFVVRVGKL-DRRMLPELEKIYRSGQLN-NMSLVLNGAIVK------
I8WPR6          ADAAITNRIADLTIFVVRVGKL-DRRMLPELEKIYRSGQLN-NMSLVLNGAIVK------
A0A0K2HKS3      ADAAITNRIADLTIFVVRVGKL-DRRMLPELEKIYRSGQLN-NMSLVLNGAIVK------
B6W3W8          ADAAITNRIADLTIFVVRVGKL-DRRMLPELEKIYRSGQLN-NMSLVLNGAIVK------
A0A4R4GSI6      ADAAITNRIADLTIFVIRVGKL-DRRMLPELEKIYRSGQLN-NMSLVLNGAIVK------
A0A076IRY8      ADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-NMSLVLNGAIVK------
A0A3A6AD54      ADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-NMSLVLNGAIVK------
A0A3A6MIU7      ADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-NMSLVLNGAIVK------
I8WPP8          ADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-NMSLVLNGAIVK------
A0A372Y7D2      ADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-NMSLVLNGAIVK------
A0A3E4JJC9      ADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-NMSLVLNGAIVK------
A0A3E4WDQ0      ADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-NMSLVLNGAIVK------
A0A414H9P2      ADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-NMSLVLNGAIVK------
C3R5A8          ADAAITNRIADLTIFVVRVGKL-DRRMLPEVEKIYRSGQLN-NMSLVLNGAIVK------
A0A1C5XJA7      ADATIANRIADITIFVVRAGRL-DKRQLPDIEKLYQEKVLN-NMALILNGADLE------
A0A285T4L1      ADATISNRISDLTIFVVRAGKL-DRRQLPDLEELYRDNKLC-NMSLILNGVDPS------
A0A3E5BU42      ADATISNRISDLTIFVVRAGKL-DRRQLPDLEELYRDNKLC-NMSLILNGVDPS------
R7CUW4          ADATIANRIADLTVFVVRSGRL-DRRQLPDIESLYEDKKLH-NMALVLNGVDPH------
A0A416GGJ1      ADASIANRVADLTLFVVRAGSV-DRRLLPEIEDLYENKKLN-NMAVVLNAVEHR------
D1JY72          ADAAITNRIADLTIFVVRVGKL-DRRMLPELEKIYRSGQLN-NMSLVLNGAIVK------
D7J4K6          ADATITNRISDLTIFVVRAGRL-DRRLLPDMEELYRDNKLR-NMAIILNGVGPH------
Q8ABP9          ADATITNRISDLTIFVVRAGRL-DRRLLPDMEELYRDNKLR-NMAIILNGVGPH------
A0A5M6AHF7      ADATITNRISDLTIFVVRAGRL-DRRLLPDMEELYRDNKLR-NMAIILNGVGPH------
A0A6L4IA73      ADATITNRISDLTIFVVRAGRL-DRRLLPDMEELYRDNKLR-NMAIILNGVGPH------
D6D2Z5          ADATITNRISDLTIFVVRAGRL-DRRLLPDMEELYRDNKLR-NMAIILNGVGPH------
A0A1T3EDR4      ADANIIDRISELTLFIIREGKL-DRRMLAELENIYQERKLS-NLGIVFNGVRIG------
A0A174SDD8      ADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-NMAVVLNGTEKG------
A0A1H7RFH3      ADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-NMAVVLNGTEKG------
A0A139L1N2      ADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-NMAVVLNGTEKG------
A0A174TVL8      ADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-NMAVVLNGTEKG------
A0A1H8BJR6      ADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-NMAVVLNGTEKG------
R9H6G0          ADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-NMAVVLNGTEKG------
A0A412GR09      ADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-NMAVVLNGTEKG------
A0A6I0S0M4      ADATVVNRITDLTLFIVRVGKI-DRRQLPELERLYQEHKLN-NMAVVLNGTEKG------
A0A081PBV5      ADASIVDRISELTIFVVRSGKM-DRRQLPEIQSLYDQRKIS-HMAVLLNGVRLN------
A0A1I2AN85      ADASIVDRISELTIFVVRSGKM-DRRQLPEIQSLYDQRKIS-HMAVLLNGVRLN------
A0A4U0GMP3      ADAAIVDRISELTLFVVRAGKM-DRRQLPELDKLHRQGKLT-NMAILLNGIRKG------
A0A1H6CKR6      ADADIVNRITDVTIFVVRAGKM-DRRQLPDIQKLYSSGSLT-NLAILLNGVKFT------
A0A235E1C0      ADADIVNRITDVTIFVVRAGKM-DRRQLPDIQKIYDSSALT-NMAILLNGVKFG------
R6D982          ADVSISNRISDVTLFIVRAGKL-DKRQLPELERLYQEHKLN-NMAVVLNGTKQG------
A0A1F0I8C4      ADASVVNRISDLTLFIVRVGKL-DRRQLPELERLYQEHRLN-NLAVVLNGAKKG------
A0A3A5RIJ2      ADASVVNRISDLTLFIVRVGKL-DRRQLPELERLYQEHRLN-NLAVVLNGAKKG------
A0A515IZJ5      ADASVVNRISDLTLFIVRVGKL-DRRQLPELERLYQEHRLN-NLAVVLNGAKKG------
A0A5M5NLR3      ADASVVNRISDLTLFIVRVGKL-DRRQLPELERLYQEHRLN-NLAVVLNGAKKG------
A0A0D5BSQ0      ADASIIDRVADLTLFIIRVGKM-DRRQLPEIEKIYQEKKLS-NLAIVLNGMKLN------
A0A1T3F6P5      ADASIIDRVADLTLFIIRIGKM-DRRQLPEIEKLYQEKKLS-NLAIVLNGMKLN------
A0A0W8EPA0      ADASIIDRVADLTLFIIRIGKM-DRRQLPEIEKIYQEKKLS-NLAIVLNGMKLN------
A0A365UKN1      ADASIIDRVADLTLFIIRIGKM-DRRQLPEIEKLYQEKKLS-NLAIVLNGMKLN------
A0A4R6WE41      ADGSIISRISDLTLFVIRAGKM-DRRQLPELEKLYQSNKLA-RLGVVLNGVKLG------
A0A2T5RP38      ADASIIDRVADLTLFIIRIGKM-DRRQLPEIEKIYQEKKLS-NLAIVLNGLKLN------
A0A1A6CF06      ADASIIDRVADLTLFIIRIGKM-DRRQLPEIEKIYQEKKLS-NLAIVLNGLKLN------
A0A1T3D6S8      ADASIIDRVADLTLFIIRIGKM-DRRQLPEIEKLYQEKKLS-NLAIVLNGLKLN------
A0A1P8E011      ADATVVDRVSDLTLFVIRAGKM-DKRQLPEIQKIYAEKRLS-NLAIILNGLKLG------
A0A1V3N3U3      ADASIVDRISDLTLFMIRAGKM-DRRQLPEIEKIYRDRKLS-NLAVALNGIKL-------
C2FUH6          ADASIVNRISDLTIFMVRVGKM-DRRQLPEIEKIRQEGKLS-NMSVILNGLKQG------
A0A0B8T471      ADAAVVNRISELTVFVVRAGAM-DRRLLPEIEKIYRKGKLN-NMAILLNGIRKL------
A0A4R7D2K0      ADAAVVNRISELTVFVVRAGAM-DRRLLPEIEKIYRKGKLN-NMAILLNGIRKL------
A0A2X2J8S4      ADAYITDRVSELTIFVIRSGKM-DKRELPDIEKIYQSKKLS-NMAILFNGVNSG------
A0A3C0S618      ADAYITDRVSELTIFVIRSGKM-DKRELPDIEKIYQSKKLS-NMAILFNGVNSG------
A0A4P7DRF9      ADAKIVNRITDVTLFVVRAGKM-DKRQLPEVQKIYESGDLT-NMAILLNGVKFN------
A0A239XXC4      ADADIVNRITDVTIFVVRAGKM-DRRQLPDVQKIYDSSALT-NMAILLNGVKFG------
A0A4U9K473      ADADIVNRITDVTIFVVRAGKM-DRRQLPEIQKIYDSGSLT-NMAIVLNGVKFG------
A0A3M1Y2F5      SDYMLVEKWLDFTAFVVRHQQT-RLQDLERINELFEQERIG-KIGLLINHVANP------
A0A7C7CKY6      TDGISSIQKADYPIYVVKANYS-KKHYLNSIDRLREESKIQ-NMAVILNGVEFG------
A0A1G1TG88      TDGILIMRRADIPIYIVRADYS-RKAFIKNMNRLMRTNNLT-RMCTILNDAQSK------
A0A661XXA6      TDGLLAMQKADLPIYILRAGYS-KLSFIGNINRLMATGRYP-NLSVILNNVSNK------
A0A3D4RLG4      PDAFALIEQTDLTLYVIRCMQT-NKYFCKNTLQQMEADYKD-KVQLVFSDMPVEKKRK-R
A0A2T2UAJ4      SDVLGLAPRCDGTLLVVAAGET-DGRAFDHAAEMLADGEAD-VAGAVLNQFDASSSVL--
A0A6I0DZQ5      ADAYSFADLSDINLFIVRSDKT-HKLFLRTLTAQLKSDNVH-DFYSILNDVELKSNSYSR
A0A6L3FBV2      ADASIVNRVADLTIFVVRSGVM-DRRQLPELENMYRQEQLR-NMSVILNGVPSD------
A0A6L3FIH8      ADASIVNRVADLTIFVVRSGVM-DRRQLPELENMYRQEQLR-NMSVILNGVPSE------
A0A3D3LSK1      TDSEILYNLTDGTVLVAQAEKTDKKAFFKTYNQLKRINPHN-LLGAVLNNFKFN------
A0A496L711      ADAYALFSVVDIKLLVVRSFKT-NKMEFTDLSKRLYSDNIE-DIYIILNDVDKS------
A0A1H6Z2F8      ADARLLGPYADMTLYIVRQHFT-FIHQLAELQKASEQ--LP-DLQIVINGTRDL------
A0A2P8G5K0      ADARLLGAHADMTLYIVRQHFT-FIHQLAEIQNARNQSLLP-DLHVVLNGTRSL------
A0A4Q3SEI4      TDAYILSESCDLTVFVVRHNFT-PKSMIEMLEESHKVGALK-NISIVFNGIRSR------
A0A348PT57      TDGIASLKLADYPIYIFRNEYS-KKSFIDNINRIFIENKIT-NLSAVLNSVDLSRARYGS
A0A7C3PTI0      TDGINIIQKADYPIYIFRAEYS-KRNFIQNVDRLFNENGIK-RLSIVLNGVDVQ------
A0A5Q4EKA0      TDGMKSILMADYPIYIFKANYS-KRMFIQNVNRLIGESHIS-KLSVVLNAVDKE------
A0A519SYE7      TDGILIMRKADVPIYIARANYS-RKVFLKNLNRLMSNNQFT-KMCTVLNDAKAQ------
A0A7C7CFR2      TDGISIIQQADYPIYVFRANSS-KKNYISNVDRLITESKVK-NLAVVFNGVDTD------
A0A3D4CJE1      TDALYTISMADYPIYVLRANYS-KKEYLKNAYRIYEENNIH-KLSLVLNSVDFE------
A0A7C7LI79      TDGISIIQNADYPIYVFRADFS-KKNYVKNVDRLINESNIG-KLSVVLNGMDTE------
A0A4Q5ZQ60      TDGILIMRKADVPLYIVRANYS-KKVFLKNVNKLIKGHGFS-KLALILNDAQTS------
A0A519Q885      TDGILIMRKADIPIYIVRANYS-RKTFLKNLNRLMRNNQFG-RMCTILNDAQAQ------
A0A519TAP8      TDGILIMRKADVPIYIVRANYS-RKAFLKNLNRLMSNNQFS-KMCTILNDAKAQ------
R5DEG6          ADAVIVNRVADLTIYVVRAGRM-DRRALPEVEKLYREGKLR-NMSLILNGTVYK------
A0A3N2LCI3      ADAQIIDKFADRTFFVIRAGLF-DRSMLPELDRLYEEKKYR-NMSFILNGSRND------
A0A6L6NZ03      ADTQIIEKLADRTVFVVRAGLL-ERSMLPELENIYREKKYK-NMS---------------
A0A642EJV3      ADTQIIEKLADRTVFVVRAGLL-ERSMLAELEKIYEEKKYK-NMSLILNGTEGS------
A0A6H9Q899      ADTQIIEKLGDRTIFVVRAGLL-ERSMLAELEKIYGEKKYK-NMSLILNGTEGS------
A0A6L4ENN1      ADTQIIEKLADRTVFVVRAGLL-ERSMLAELEKIYEEKKYK-NMSLILNGTEGS------
A0A1T4NDR5      TDALIVSKYSDGTILVCESDKN-DKKTLIRVKYQFDEVESK-VLGVVITKADFG------
A0A3D5KRM7      DDALLYMSYCDAALFVVEDEKN-TVDEIKHSMKILEETNL---LGIVLNKSRQP------
A0A3M1NUH2      TDAALLATQCDLTLVVVRAGQT-REGELEFAMESLAAVGAP-AIGTVFNGFDVS------
A0A7C1IBE4      AETLVLSQLVDKVVLVVRWGKS-GRENIKKMVDRIGREKI---IGVVFNAFEFN------
A0A2T2TDL4      ADGPLLSDLCETTLCVARAGTT-TEAELDHAMEVLSGIGAN-VAGVVFNGFDIS------
A0A359ATS6      ADTAIIEKLADRTIFVVRAGLL-ERSMLVELEKIYNEQKYK-NMCVILNGTTGN------
A0A1V6HYH8      SDTTKFVLLADTTVYVFRSEYS-KKEFIVNLEKLKQELNPK-EIIIVLNGFNDK------
A0A2E0MDX6      TDAFPIISKVDYPVYIVRAHFS-KKVFLKNIQMLRDKKKIK-NLSVILNGAGGD------
A0A2M7KCE1      TDALNIFKSCDYPIYVVKAHYS-KRSFLYNLNHLLLEKHIE-NLSVVVNGIDIE------
A0A523GUD4      SDPLIIGKFVDNVILVAKAGET-PKRVIKRAVDMIHNVEIE-ISGIILNNMRNV------
R7JFY1          ADAQIVARLADLTICVIRAGVL-DRRQIPALEML--SRRFP-KFSLVLNYVKGH------
A0A1V5S5I3      ADTQIIEKLADRTVFVVRAGLL-ERDMLPELQRMYDEHRFK-NMALVLNGTDGG------
A0A2M7VVW6      SDAMEMLKKADYPIYVFKSEYS-RKNFINNLNKLIVENGIK-KLSIVLNGVDYS------
A0A413V760      ADASIVNRVADLTIFVVRSGVM-DRRQLPELENMYRQEQLR-NMSVILNGVPSD------
A0A656PYT8      ADALITDRLADLTIYVIREGLL-DRRQLPDIEKLYREKKFH-NMSIVLNGSTGG------
A0A6A0Y068      ADTQIIEKLADRTVFVVRAGLL-ERSMLAELEKIYEEKKYK-NMSLILNGTEGS------
A0A3D1AEJ6      ADAMISNRVTDLTLYIIRAGKM-DRRMLPEIEQLYREERLK-NMAVILN-----------
A0A641X2Z6      TDAAVLSGKVDGLVMLVSSGEV-TPAAAKEAKQRLLQAGAH-ILGVILNKVELA------
A0A6L8U2P8      ADAILMMKYASKVLMVIRNNYT-RKDVFANVLSNLKANKMT-NFDIIYNDLSLH------
A0A7C6G639      ADAYSLAPMMDANLFVARSGKT-NKSFFKRLNDQLKDDKLK-HFYVILNDINMD------
A0A519PJW5      TDGILIMRKADVPIYIVRANYS-RKAFLKNMNRLMQNNQFS-RMCTILNDAKAA------
A0A519T3R9      TDGILIMRKADVPIYIVRANYS-RKTFLKNLNRLLHNNQLS-RLCTILNDAQAQ------
                                                                            

A0A2T4XEQ1      -----------------I----------SSDYYYQN------KYKYYSYN----------
A0A2K8ZAP1      -----------------E------------SLSY--------SYNYGDYMDLTKKFD---
A0A519SD85      -----------------N----------FFSHYNKSKQILPYPNGY--------------
A0A3M1TXY5      -----------------S------------------------DYGYLDTD-----YG---
A0A2E0VQ27      -----------------A------------------------KKGA--------------
R6U429          -----------------S---------KSYGYGH-------YGYGY-GYG-----YG---
A0A5C8AF42      -----------------K---------RSSAYGY--------GYGY-NYG-----YG---
A0A239K409      -----------------N----------SNKYGY--------GYGY-VKK----------
A0A1V5S1J9      -----------------K----------L-EYS---------RYYD-SYG----SYGKKS
A0A0A2EYC8      -----------------K----------V-------------GYGY-GYS----KYKKMG
A0A2G6H6Y4      -----------------K----------T-GYGYGYG----YGYGY-GYG----GSKKNN
A0A1M3DPL8      -----------------S----------A-SYSQYYSRKYVYGRSK-SYGLGTYGYGYGY
A0A1V5F519      ------------------------------------------GNYY-SYK---YGYSSKY
A0A2G6R1T9      -----------------S----------K-AYGR-------YGYGY-GYG---YGYGYGY
A0A350V3E4      -----------------A------------TYGS--------YYKY-YYY----YYGSEK
A0A6J4K208      -----------------S------------------------AYGY-SDK----TYK---
A0A1M6MYT6      -----------------K---------SNRGYGY--------GYGY-GYG-----YG---
A0A2P8CDS1      -----------------I---------NNQPLGD--------RYNY-SYM-----YG---
A0A353WYK7      -----------------K------------NYGY-------GSYGK-SYG----YYE---
A0A355BP94      -----------------G------------KT-----------YG---YG----YYH---
A0A136LSC7      -----------------G------------NY-----------YG---YG----YYE---
A0A5C7N8Q5      -----------------G------------KY-----------YG---YG----YYE---
A0A2W4RDE8      -----------------R----------VNGYSY--------SYKY-KQK----KYKQRS
A0A0L8VEV2      -----------------K----------HAHVG---------AYGA-DYS-----HRKNS
A0A1I2A9Z9      -----------------K----------HAHVG---------SYGA-DYS-----YKKKS
A0A212J9Z9      -----------------E--------------------------GY---------YG---
F5IV23          -----------------E--------------------------GY---------YG---
F8X2T0          -----------------E--------------------------GY---------YG---
A0A1M3LAG1      -----------------E--------------------------GY---------YG---
A0A212K6G4      -----------------E--------------------------GY---------YG---
A0A4Y9IPG7      -----------------E--------------------------GY---------YG---
A0A2V3PNY7      -----------------E--------------------------GY---------YG---
A0A6G7WQ31      -----------------E--------------------------GY---------YG---
A0A6G7X5K8      -----------------E--------------------------GY---------YG---
A0A1M5DFS8      -----------------E--------------------------GY---------YG---
A0A4Y8KZS5      -----------------E--------------------------GY---------YG---
A0A142HHS5      -----------------G----------SYGYGY--------GYGY-GYG-----YG---
A0A660LQT8      -----------------Y----------K-SYGH-------HRYGY-RYG-----YR---
A0A2M6GH67      -----------------G------------------------GYGY-GYA----------
A0A389LWV6      -----------------G------------NYYA--------SRNYYGKS----SYYHKH
A0A1G9B1T9      -----------------K------------------------GHGY---------YE---
A0A350PNH9      -----------------G----------G-RYGHYY------RYGY-HYG-----YG---
A0A354LNT9      -----------------G----------G-RYGHYY------RYGY-HYG-----YG---
A0A161LWY6      -----------------T----------G-GYGY--------NYSYQRYG-----YG---
A0A6I3N9U6      -----------------T----------G-GYGY--------NYSYQRYG-----YG---
A0A3D0FMX4      -----------------RSGRYN-YNSKSYHYGYG------YGYGYGGYG-----YG---
A0A1M3MEI8      -----------------SNS-YSRYYSRKYAYGNSRRYGTKSGYGY-GYG-----YG---
A0A1J5HQM0      -----------------ESR-YSRYYSRRYGYGYG------YGYGS-GYG-----YG---
A0A653AC35      -----------------KSSYYGRYSN--------------YGYGY-GYG-----YG---
E4T131          -----------------ESK-YTKYKL--------------YKYAY-LFG-----FS---
A0A521H707      -----------------K----------F-KYGYGYGYGYGYGYGY-GYG-----YYDDE
A0A1F3D6P8      -----------------T----------S-PYR---------------------------
A0A356Z058      -----------------T----------S-PYR---------------------------
A0A3D1BT36      -----------------E----------S-RYG---------------------------
A0A5R9QZP0      -----------------K----------S-TYG---------------------------
A0A3D3HL11      -----------------K----------S-RYG---------------------------
A0A6L8U6G9      -----------------K----------S-RYG---------------------------
A0A352ME00      -----------------K----------S-SYR---------------------------
A0A6L8UH35      -----------------K----------S-SYR---------------------------
A0A2W7RD29      -----------------Y----------HIGSNK--------NYGY--YE----VYK---
A0A3N2NDY8      -----------------S----------RKSYG---------AYGY---------YG---
D7JEV9          -----------------K-------------IGY--------VYGY-GYG----MHK---
A0A4R6H3B7      -----------------K----------HAHVG---------SYGA-DYS-----YKKKS
A0A3P1Z8V4      -----------------A----------R-TYGY--------GYGY-GYG----------
A0A2W7QSQ0      -----------------S------------------------GSKF-GYG----YYS---
R7F6L5          -----------------H----------NYGYGY--------GYGY-GYG-----YG---
A0A7C5MRV2      -----------------N----------R-RYG---------GYGY-KV-----------
A0A553GA49      -----------------R----------QRYYNY--------SAYY-AKP----NLN---
A0A497D6F6      -----------------D----------M-------------KHGY-GY-----TLG---
A0A5M4AAB9      -----------------N----------Q-------------FDRY-NNH----SYG---
F4KR18          -----------------N----------D-------------AYGY-SYK----DYG---
A0A229I3A5      -----------------G----------G-RYGS--------HYGY-GYG-----YG---
A0A3R6HJB3      -----------------G----------G-RYGS--------HYGY-GYG-----YG---
R6NN15          -----------------G----------SYRYGY--------RYGY-HYG-----YG---
C9LKL0          -----------------A----------KYGYGY--------GYGY-GYG-----YG---
A0A3D0QPV7      -----------------R-------GSSGYNYGY--------GYGY-GYG-----YG---
A0A496KT23      -----------------L----------G-RYGY-------HKYGY-GYG----GYG---
L1M9T3          -----------------L----------G-RYGY-------HKYGY-GYG----GYG---
A0A3C0I8F1      -----------------F------------SYGY--------GYGY-GYG----AY----
R5JJI4          -----------------R----------R-SYGY--------GYGY-GYG-----YG---
A0A0A2DQN2      -----------------S----------S-SYGY--------GYSY-GYG----YYG---
A0A0A2F2N5      -----------------N----------K-GYGY--------GYGY-GYG-----YG---
L1NGW4          -----------------G----------H-GYGY--------GYGY-GYG-----YG---
Z4WRA0          -----------------G----------H---GY--------GYGY-GYG-----YG---
U2K8K9          -----------------G----------H---GY--------GYGY-GYG-----YG---
A0A069ZM60      -----------------G----------H---GY--------GYGY-GYG-----YG---
J6GV98          -----------------G----------H---GY--------GYGY-GYG-----YG---
A0A134B4F8      -----------------G----------H---GY--------GYGY-GYG-----YG---
A0A134B8C7      -----------------G----------H---GY--------GYGY-GYG-----YG---
A0A3D2HF71      -----------------G------------YYGYGLRYGYAGGYGY-SYG-----YN---
A0A4Z0EKR0      -----------------N------------GNNY--------GFGY-GYG-----YP---
B5CTK0          -----------------H----------AHKYGY--------GYGY-GYG-----YG---
A0A1M6B6D5      -----------------S----------GK--GY--------GYGY-GYG-----YGGSS
A0A451FS66      -----------------S----------GRGFGY--------GYGY-GYG-----YGDGS
A0A2E3GN39      -----------------VSGSYYNYGYGY-GYGY--------GYGY-GYG-----YG---
A0A3D1MEL0      -----------------VSGSYYN--YGY-GYGY--------GYGY-GYG-----YG---
A0A519UDD1      -----------------N--------------GN--------NYGY-GYG-----YG---
A0A2A4N9A6      -----------------S-----QYGYGY-GYGY--------GYGY-GYG-----YG---
A0A6C0GGI1      ----------------------------I-NFST--------VYGL-SYN----------
A0A368D1N7      -----------------VSGSYYNYGYGY-GYGY--------GYGY-GYG-----YG---
A0A3B8TU58      -----------------VSGSYYN----Y-GYGY--------GYGY-GYG-----YG---
A0A1T5IIR6      -----------------K----------RRGYGFGSY-----GYGY-GYG-----YG---
F0R0C9          -----------------N----------N-RYGY--------KYGY-KYG-----YH---
A0A6L6NXQ0      -----------------S----------G-RYGY--------RYGY-KYG-----YR---
A0A6N8DCX3      -----------------S----------G-RYGY--------RYGY-KYG-----YR---
A0A3E0QD27      -----------------R----------F-RYGY--------GYGY-GYG-----YG---
A0A0M1W1I6      -----------------T----------S-GYG---------GYGY-GYG-----YG---
A0A4R4GHU2      -----------------T----------S-GYG---------GYGY-GYG-----YG---
I8WPR6          -----------------T----------S-GYG---------GYGY-GYG-----YG---
A0A0K2HKS3      -----------------T----------S-GYG---------GYGY-GYG-----YG---
B6W3W8          -----------------T----------S-GYG---------GYGY-GYG-----YG---
A0A4R4GSI6      -----------------T----------S-GYG---------GYGY-GYG-----YG---
A0A076IRY8      -----------------T----------G-GYG---------GYGY-GYG-----YG---
A0A3A6AD54      -----------------T----------G-GYG---------GYGY-GYG-----YG---
A0A3A6MIU7      -----------------T----------G-GYG---------GYGY-GYG-----YG---
I8WPP8          -----------------T----------G-GYG---------GYGY-GYG-----YG---
A0A372Y7D2      -----------------T----------G-GYG---------GYGY-GYG-----YG---
A0A3E4JJC9      -----------------T----------G-GYG---------GYGY-GYG-----YG---
A0A3E4WDQ0      -----------------T----------G-GYG---------GYGY-GYG-----YG---
A0A414H9P2      -----------------T----------G-GYG---------GYGY-GYG-----YG---
C3R5A8          -----------------T----------G-GYG---------GYGY-GYG-----YG---
A0A1C5XJA7      -----------------R----------H-GYGY-------GSYGY-GYG-----YG---
A0A285T4L1      -----------------R----------R-GYG----------YGY-GYG-----YG---
A0A3E5BU42      -----------------R----------R-GYG----------YGY-GYG-----YG---
R7CUW4          -----------------R----------H-GYG----------YGY-GYG-----YG---
A0A416GGJ1      -----------------T----------V----Y--------GYGY-GYS-----YQ---
D1JY72          -----------------T----------SGYGGY--------GYGY-GYG-----YG---
D7J4K6          -----------------R----------R---GY--------GYGY-GYG-----YG---
Q8ABP9          -----------------R----------R---GY--------GYGY-GYG-----YG---
A0A5M6AHF7      -----------------R----------R-GYGY--------GYGY-GYG-----YG---
A0A6L4IA73      -----------------R----------R-GYGY--------GYGY-GYG-----YG---
D6D2Z5          -----------------R----------R-GYGY--------GYGY-GYG-----YG---
A0A1T3EDR4      ------------------------------AFGY--------GYGY-G------------
A0A174SDD8      -----------------S----------S-GYGY--------GYGY-NYG-----YG---
A0A1H7RFH3      -----------------S----------S-GYGY--------GYGY-NYG-----YG---
A0A139L1N2      -----------------S----------S-GYGY--------GYGY-NYG-----YG---
A0A174TVL8      -----------------S----------S-GYGY--------GYGY-NYG-----YG---
A0A1H8BJR6      -----------------S----------S-GYGY--------GYGY-NYG-----YG---
R9H6G0          -----------------S----------S-GYGY--------GYGY-NYG-----YG---
A0A412GR09      -----------------S----------S-GYGY--------GYGY-NYG-----YG---
A0A6I0S0M4      -----------------S----------S-GYGY--------GYGY-NYG-----YG---
A0A081PBV5      -----------------K----------G-GYGY--------GYGY-GYG-----YG---
A0A1I2AN85      -----------------K----------G-GYGY--------GYGY-GYG-----YG---
A0A4U0GMP3      -----------------K----------M-GYGY--------GYGY-GYG-----YG---
A0A1H6CKR6      -----------------N----------T-GYGG--YGYGYGGYGY-GYG-----YG---
A0A235E1C0      -----------------S----------SYGYGY--GGYGYGGYGY-GYG-----YG---
R6D982          -----------------R----------R-GYGY--------GYGY-GYG-----YG---
A0A1F0I8C4      -----------------S----------R-GYGY--------GYGY-GYG-----I----
A0A3A5RIJ2      -----------------S----------R-GYGY--------GYGY-GYG-----I----
A0A515IZJ5      -----------------S----------R-GYGY--------GYGY-GYG-----I----
A0A5M5NLR3      -----------------S----------R-GYGY--------GYGY-GYG-----I----
A0A0D5BSQ0      -----------------G----------Y-GY----------GYGY-G-S-----YG---
A0A1T3F6P5      -----------------G----------Y-GYGY-------GGYGY-G-S-----YG---
A0A0W8EPA0      -----------------G----------Y-GYGY-------GGYGY-G-S-----YG---
A0A365UKN1      -----------------G----------Y-GYGY-------GGYGY-G-S-----YG---
A0A4R6WE41      -----------------S----------G-AYGY-------GRYGY-G-N-----YG---
A0A2T5RP38      -----------------G----------Y-GYGY-------GGYGY-G-S-----YG---
A0A1A6CF06      -----------------G----------Y-GYGY-------GGYGY-G-S-----YG---
A0A1T3D6S8      -----------------G----------Y-GYGY-------GGYGY-G-S----------
A0A1P8E011      -----------------Q----------S-------------GYGY-GYG-----YG---
A0A1V3N3U3      ----------------------------H-GPGY--------GYGY-GYG-----YG---
C2FUH6          -----------------R----------R-GYGY--------GYGY-GYG-----YG---
A0A0B8T471      -----------------K----------S-SYGY--------GYGY-GYG-----YG---
A0A4R7D2K0      -----------------K----------S-SYGY--------GYGY-GYG-----YG---
A0A2X2J8S4      -----------------K----------R-GYGY--------GYGY-GYG-----YG---
A0A3C0S618      -----------------K----------R-GYGY--------GYGY-GYG-----YS---
A0A4P7DRF9      -----------------D----------T-RYGYGSYGYGYGGYGY-GYG-----YG---
A0A239XXC4      -----------------N----------N-PYGY--GGYGYGGYGY-GYG-----YG---
A0A4U9K473      -----------------N----------S-AYGS--YGYGYGGYGY-GYG-----YG---
A0A3M1Y2F5      -----------------A----------QFRHGD--------ASYY-TYGK---------
A0A7C7CKY6      -----------------K----------GLGQNQ--------NLGY-GYS----------
A0A1G1TG88      -----------------G----------AYGYGY--------GYGY-GYGSG--------
A0A661XXA6      -----------------K----------T-------------GFGY-SYGDV--------
A0A3D4RLG4      LGRKSYGYAY-------N----------SYGYGY--------GYGY-GGKND--------
A0A2T2UAJ4      -----------------Q----------SYGYNY--------GYAY-SYRRL--------
A0A6I0DZQ5      YYSRKYAYGNSRRYGTKS----------GYGYGY--------GYGY-GYTKVSDKKN---
A0A6L3FBV2      -----H-----------K--------------GY--------GYGY-GYG-Y--------
A0A6L3FIH8      -----H-----------R----------GYGYGY--------GYGY-GYG-Y--------
A0A3D3LSK1      -----------------T----------SYGYYY--------NYYY-YYSGD--------
A0A496L711      ------------------------------KIGY--------VYGY-GYGMP--------
A0A1H6Z2F8      ---------------------------------H--------RYQY-NYY----------
A0A2P8G5K0      ---------------------------------H--------RYQY-NYY----------
A0A4Q3SEI4      -----------------G----------FFKGKY--------GYGY-GYG-R--------
A0A348PT57      YGRGYG-----------A----------KYGYGY--------GYGY-GYG-Y--------
A0A7C3PTI0      -R---------------K----------AYGYNY--------GYGY-GYG-Y--------
A0A5Q4EKA0      -Y---------------S----------SYGYDK--------GYSY-GYYYG--------
A0A519SYE7      -----------------G----------SYG--Y--------GYGY-GY-----------
A0A7C7CFR2      -----------------S----------VFGNDY--------NYGY-GY-----------
A0A3D4CJE1      -Q---------------G----------QYGYGY--------GYGY-GYG----------
A0A7C7LI79      -SKYGY-----------G----------SYEHGY--------GYGY-GYA----------
A0A4Q5ZQ60      -GIYGY-----------G-----------YGYGY--------GYGY-GYG-Y--------
A0A519Q885      -GSYGY-----------G-----------YGYGY--------GYGY-GYG----------
A0A519TAP8      -GAYGY-----------G-----------YGYGY--------GYGY-GSSGT--------
R5DEG6          -H---------------G----------TYGYHY--------GYGY-GYG-Y--------
A0A3N2LCI3      -Q---------------G----------RYGYSH--------TYRY-GYG-Y--------
A0A6L6NZ03      ------------------------------------------------------------
A0A642EJV3      -G---------------G----------RYGYRY--------GYRY-GYH-Y--------
A0A6H9Q899      -G---------------G----------RYGYRY--------GYRY-GYH-Y--------
A0A6L4ENN1      -G---------------G----------RYGYRY--------GYRY-GYH-Y--------
A0A1T4NDR5      -----------------------KK--------Y--------YSHY-NYQ----------
A0A3D5KRM7      -----------------------IP-------SY--------KYGY-GYG----------
A0A3M1NUH2      -----------------------MA----YGYKY--------RYRH-YDR----------
A0A7C1IBE4      -----------------------ILDKKIQGVGY--------HNYY-AEE----------
A0A2T2TDL4      -----------------------MA------------------YGY-KYR----------
A0A359ATS6      -----------------------GG-------RY--------GYGY-RYG----------
A0A1V6HYH8      -----------------------FI--KQSKYG---------KYGY-EYK----------
A0A2E0MDX6      -----------------------KKYGGFRKYGY--------GYGY-GYG----------
A0A2M7KCE1      -----------------------KS-----RYG-----------GY-NYG----------
A0A523GUD4      -----------------------LP--YYYDHKY-----------Y-GYD----------
R7JFY1          -----------------------HG-------GY--------GYGY-GYG----------
A0A1V5S5I3      -----------------------NS-----RYGY--------RYGY-HYD----------
A0A2M7VVW6      -----------------------NK---YYSYGY--------NYNY-SYG----------
A0A413V760      -----------------------HK-----GYGY--------GYGY-GYG----------
A0A656PYT8      -----------------------AR--RGYGYGY--------GYGY-GYG----------
A0A6A0Y068      -----------------------GG-----RYGY--------RYGY-RYG----------
A0A3D1AEJ6      ------------------------------GTGS--------GIGY-GYG----------
A0A641X2Z6      -----------------------HT----HGYGY--------YYYY-GSD----------
A0A6L8U2P8      -----------------------KS-------------------SY-RH-----------
A0A7C6G639      -----------------------AS----RYGGY--------TKNY-GYG----------
A0A519PJW5      -----------------------GS----YGYGY----------GY-GYG----------
A0A519T3R9      -----------------------GS------YGY----------GY-GYG----------
                                                                            

A0A2T4XEQ1      -----DYLEYTEEKEEVA--------------------------
A0A2K8ZAP1      --------------------------------------------
A0A519SD85      ---YSSYYQSI---------------------------------
A0A3M1TXY5      ---INGYVKKGKKRKRYEAIN-----------------------
A0A2E0VQ27      ---YARYLKKRKPAPALS--------------------------
R6U429          ---Y-GYGYGNNVQD-----------------------------
A0A5C8AF42      --YYEGDSEIEKGNLLNRLWSFISSKFRR---------------
A0A239K409      --------------------------------------------
A0A1V5S1J9      GYYY----YDKKFKSPRSQYLNYFDNTEEEL-------------
A0A0A2EYC8      NYYV-TEEFEQDDISMLEKIIDKIGEKTKRIRNIHSSRLFK---
A0A2G6H6Y4      AYYV-TAEFEKENTTAFQRVIEFVGDITKKIRNIKK--------
A0A1M3DPL8      GYTS-SGRSKHKGN---NTYFQYYQDDEKDI-------------
A0A1V5F519      GYYT-S--KGQKNI---DEYRKYYDDNN-EI-------------
A0A2G6R1T9      GYGY-G--VKNKKD---NQYTHYYNDDDIDI-------------
A0A350V3E4      GKESAGTNGKSTNGVNTNGSQKEKIIKPN---------------
A0A6J4K208      ---Y-GYGD-----------------------------------
A0A1M6MYT6      ---Y-GYGHDTDSNQ-----KKGKTKTKGRSIFKPS--------
A0A2P8CDS1      ---Y-GYKTQKPKNRPAAYWRKVNSKKQAQTT------------
A0A353WYK7      --------------EPEYLESNLFATFKSLFSK-----------
A0A355BP94      --------------EDQKKRSLIRKIFRS---------------
A0A136LSC7      --------------DKTPRRKRWIKIFGLK--------------
A0A5C7N8Q5      --------------DRTPRMRRWTKIFGLK--------------
A0A2W4RDE8      YKAV----------------------------------------
A0A0L8VEV2      SYYYFDSSPSYTG-------------------------------
A0A1I2A9Z9      SYYYFESSPSYTG-------------------------------
A0A212J9Z9      TSRYYGDRTYYLKKNSYYHDDYFEN-------------------
F5IV23          TSRYYGDRTYYLKKNSYYHDDYFEN-------------------
F8X2T0          TSRYYGDKTYYLKKNSYYHDDYFES-------------------
A0A1M3LAG1      TSRYYGDKTYYLKKNSYYHDDYFES-------------------
A0A212K6G4      TSRYYGDKTYYLKKNSYYHDDYFES-------------------
A0A4Y9IPG7      TSRYYGDKTYYLKKNSYYHDDYFES-------------------
A0A2V3PNY7      TSRYYGDKSYYLKRNSYYHDDYFEK-------------------
A0A6G7WQ31      TSRYYGDKSYYLKRNSYYHDDYFEK-------------------
A0A6G7X5K8      TSRYYGDKSYYLKRNSYYHDDYFEK-------------------
A0A1M5DFS8      TSRYYGDKSYYLKRNSYYHDDYFEK-------------------
A0A4Y8KZS5      TSRYYGDKSYYLKRNSYYHDDYFEK-------------------
A0A142HHS5      ---Y-GTKGMGYYDETEQKPTLGKRIKSLFS-------------
A0A660LQT8      ---Y-GYGIDYGKS------------------------------
A0A2M6GH67      ---Y-GYGYSNSYYDLEEKEGVLTRLKRNFT-------------
A0A389LWV6      NSYYNNDEFVDEQNQN----------------------------
A0A1G9B1T9      --------------------------------------------
A0A350PNH9      ---Y-GYHYGSDKNGGAKIGK-----------------------
A0A354LNT9      ---Y-GYHYGSDKNGDAKIGK-----------------------
A0A161LWY6      -----TYGNNPVTKDYIKDYYEEE--------------------
A0A6I3N9U6      -----TYGNNPVTKDYIKDYYEEE--------------------
A0A3D0FMX4      ---Y-GYGYGSRKKGT----NHYYTDE-DE--------------
A0A1M3MEI8      ---Y-GYTKVSDKKNSDGTYYQYYQDDAHDI-------------
A0A1J5HQM0      ---Y-GYGNTRKKKEASEKYFQYYQDD-REI-------------
A0A653AC35      ---Y-GYAQLKKKKEY-DKNTHYYEDD-DDI-------------
E4T131          ---Y-GYTSKKKKGDA-EKYFHYYQDD-TEI-------------
A0A521H707      ARKNLSFFEKFKNRFSRK--------------------------
A0A1F3D6P8      --HYTSYYLKK---------------------------------
A0A356Z058      --HYTSYYLKK---------------------------------
A0A3D1BT36      --RYHGYYKKPKAFTARK--------------------------
A0A5R9QZP0      --GYDTYYHNNPKRKK----------------------------
A0A3D3HL11      --RYDNYYKQ----------------------------------
A0A6L8U6G9      --RYDNYYKQ----------------------------------
A0A352ME00      --HYSNYYIKN---------------------------------
A0A6L8UH35      --HYSNYYIKN---------------------------------
A0A2W7RD29      --------------DNKGLVNRVKNYLRSSK-------------
A0A3N2NDY8      --------------------------------------------
D7JEV9          ---KMGNYYVTEEFEQDDVSILEKLIYKISDMTKKIRNIKK---
A0A4R6H3B7      SYYYFESSPSYTG-------------------------------
A0A3P1Z8V4      ---Y-GYGNNLDETASRKWWQLW---------------------
A0A2W7QSQ0      -----GKDTDVVSTRA----------------------------
R7F6L5          ---Y-GYGYAYGDDNDKKKKKRKKS-------------------
A0A7C5MRV2      ---Y-GSGYYSDDKPQEPWWKFWKKLRS----------------
A0A553GA49      --------------------------------------------
A0A497D6F6      ---Y-GYGLGYGRTAKK---------------------------
A0A5M4AAB9      ---Y-GYENNYKKKISKELKPQRRSQKTEV--------------
F4KR18          ---Y-A--------------------------------------
A0A229I3A5      ---Y-GYNYNKEKNGGGKILNNWIIE------------------
A0A3R6HJB3      ---Y-GYNYNKEKNGGAKS-------------------------
R6NN15          ---S-SYYYGNEKQK-----------------------------
C9LKL0          YGNY-SYGYGEQYNNRKSKKKLSGRLLSKLRK------------
A0A3D0QPV7      ---Y-TYGGNYYTERTNATEKKIRFFRRKNKK------------
A0A496KT23      ---Y-GYGYGS---------------------------------
L1M9T3          ---YGGYGYGK---------------------------------
A0A3C0I8F1      ---Y-GKRSVAYYNDSESNYKPIRWINRIYKRAMSFRK------
R5JJI4          ---Y-GYGYGNEHHGNNKQGVAKRIINKLIAFFK----------
A0A0A2DQN2      ---Y-GYGYGHLGKKSLRKRFVERMKMFFVS-------------
A0A0A2F2N5      ---Y-GYGYGY-GNKKERSGIFSRFRKS----------------
L1NGW4          ---Y-GYGYGY-GN-KKKKGILYRLGLKK---------------
Z4WRA0          ---Y-GYGYGY-GN-KKKKGILYRLGLKK---------------
U2K8K9          ---Y-GYGYGY-GNKKKKKTLLQRLGIRR---------------
A0A069ZM60      ---Y-GYGYGY-GNKKKKKGLLRRLGLR----------------
J6GV98          ---Y-GYGYGY-GNKKKKKGLLRRLGLR----------------
A0A134B4F8      ---Y-GYGYGY-GNKKKKKGLLRRLGLR----------------
A0A134B8C7      ---Y-GYGYGY-GNKKKKKGLLRRLGLR----------------
A0A3D2HF71      ---Y-YGDYVYSRYGHSGEGKYYIEE------------------
A0A4Z0EKR0      ---------------------VKEKMKKKATG------------
B5CTK0          ---------------DTKTKHKKKS-------------------
A0A1M6B6D5      YKSY-GNGYHEAIKKPSLWKRMKKSITKK---------------
A0A451FS66      YKSY-GDGYHGPLGKKSLADRIKNIFKQT---------------
A0A2E3GN39      ---Y-GYGYGYYSDSDNTRKKERSSLFSIFRKKS----------
A0A3D1MEL0      ---Y-GYGYGYYSDPDNTRKKERSILFSRFRKKT----------
A0A519UDD1      ---Y-EQDKSHHKQKAAL--------------------------
A0A2A4N9A6      ---Y-GYGYGYYAEDASRNKSLWERITNSKFISLLKN-------
A0A6C0GGI1      -----GKANGYYKN------------------------------
A0A368D1N7      ---Y-GYGYGYYSDPDNTRKK-----KRSSLISRFRKKS-----
A0A3B8TU58      ---Y-GYGYGYYSDPDETREN-----ERTGFFSRFRKNS-----
A0A1T5IIR6      ---Y-GYGYGYGYGDEPKKKRFLGIFKRK---------------
F0R0C9          ---Y-GYGSKDYYNNE----------------------------
A0A6L6NXQ0      ---Y-GYGNDK--NTD----------------------------
A0A6N8DCX3      ---Y-GYGNDK--NTD----------------------------
A0A3E0QD27      ---Y-GYGYGYYDDEAKKPLTTWQAFKARLGKK-----------
A0A0M1W1I6      ---Y-GY--------VDGSESSWKRLFKKKS-------------
A0A4R4GHU2      ---Y-GY--------VDGSESSWKRLFKKKS-------------
I8WPR6          ---Y-GY--------VDGSESSWKRLFKKKS-------------
A0A0K2HKS3      ---Y-GY--------VDGSESSWKRLFKKKS-------------
B6W3W8          ---Y-GY--------VDGSESSWKRLFKKKS-------------
A0A4R4GSI6      ---Y-GY--------VDGSESSWKRLFKKKS-------------
A0A076IRY8      ---Y-GY--------VDGSESCWKRLFRKKS-------------
A0A3A6AD54      ---Y-GY--------VDGSESCWKRLFRKKS-------------
A0A3A6MIU7      ---Y-GY--------VDGSESCWKRLFRKKS-------------
I8WPP8          ---Y-GY--------VDGSESCWKRLFRKKS-------------
A0A372Y7D2      ---Y-GY--------VDGSESCWKRLFRKKS-------------
A0A3E4JJC9      ---Y-GY--------VDGSESCWKRLFRKKS-------------
A0A3E4WDQ0      ---Y-GY--------VDGSESCWKRLFRKKS-------------
A0A414H9P2      ---Y-GY--------VDGSESCWKRLFRKKS-------------
C3R5A8          ---Y-GY--------VDGSESCWKRLFRKKS-------------
A0A1C5XJA7      ---Y-GNN------KNK---------------------------
A0A285T4L1      ---Y-GKR------KNK---------------------------
A0A3E5BU42      ---Y-GKR------KNK---------------------------
R7CUW4          ---Y-GRY------GYGNKKHGRN--------------------
A0A416GGJ1      ---Y-KGG------E-----------------------------
D1JY72          ---Y-VDG------SESSWKRLFKKKS-----------------
D7J4K6          ---Y-GYG--------------YGKHGRRK--------------
Q8ABP9          ---Y-GYG--------------YGKHGRRK--------------
A0A5M6AHF7      ---Y-GYG--------------YGKHGRRK--------------
A0A6L4IA73      ---Y-GYG--------------YGKHGRRK--------------
D6D2Z5          ---Y-GYG--------------YGKHGRRK--------------
A0A1T3EDR4      ---------------QELKGGLWSRFLRMFRRV-----------
A0A174SDD8      ---Y-AAT-------QKKKGGWWRRKGKK---------------
A0A1H7RFH3      ---Y-AAT-------QKKKGGWWRRKGKK---------------
A0A139L1N2      ---Y-AAT-------QKKKGGWWRRKGKK---------------
A0A174TVL8      ---Y-AAT-------QKKKGGWWRRKGKK---------------
A0A1H8BJR6      ---Y-AAT-------QKKKGGWWRRKGKK---------------
R9H6G0          ---Y-AAT-------QKKKGGWWRRKGKK---------------
A0A412GR09      ---Y-AAT-------QKKKGGWWRRKGKK---------------
A0A6I0S0M4      ---Y-AAT-------QKKKGRWWRRKGKK---------------
A0A081PBV5      ---Y-GYG-------NETKKTIWDKLFGKR--------------
A0A1I2AN85      ---Y-GYG-------NETKKTIWDKLFGKR--------------
A0A4U0GMP3      ---Y-GYG-------NTKT-------------------------
A0A1H6CKR6      ---Y-G---------NRKKKSFFQKLLGR---------------
A0A235E1C0      ---Y-G---------QPKKKGFFSRLFGKN--------------
R6D982          ---Y-SYG------NDEKKKNWFFGKRKKESV------------
A0A1F0I8C4      ---------------DVEKSGWWSRMKKRMKR------------
A0A3A5RIJ2      ---------------DVEKSGWWSRMKKRMKR------------
A0A515IZJ5      ---------------DVEKSGWWSRMKKRMKR------------
A0A5M5NLR3      ---------------DVEKSGWWSRMKKRMKR------------
A0A0D5BSQ0      ---Y-GYG-------EEKKKSVFDWFKRS---------------
A0A1T3F6P5      ---Y-GYG-------EEKKKSVFDWFKRS---------------
A0A0W8EPA0      ---Y-GYG-------EEKKKTIFNWFKRS---------------
A0A365UKN1      ---Y-GYG-------EEKKKSIFDWFKRS---------------
A0A4R6WE41      ---Y-SYG-------NEK-KSIWKKIFG----------------
A0A2T5RP38      ---Y-GYG-------EEKKKSVFDWFKRS---------------
A0A1A6CF06      ---Y-GYG-------EEKRKSIFSWFKRS---------------
A0A1T3D6S8      ---Y-GYG-------EEKKKSVFDWFKR----------------
A0A1P8E011      ---Y-GYG-------REEGQNSWRKIARSIRTIFTRKIKH----
A0A1V3N3U3      ---Y-GYG-------NTEQQVWYKRWWRKIKS------------
C2FUH6          ---Y-GYS-------NEKRHNLFSSLLEKIKGL-----------
A0A0B8T471      ---Y-QKE-------KAGLRGFFNRLFRR---------------
A0A4R7D2K0      ---Y-QKE-------KAGLTGFFRRLFQR---------------
A0A2X2J8S4      ---Y-RYG-------DDK-KSFWKKVFNK---------------
A0A3C0S618      ---Y-RYG-------DDK-KSFWKKVFNK---------------
A0A4P7DRF9      ---Y-GNH-------KKK-KSIFNIFKKR---------------
A0A239XXC4      ---Y-SAQ-------QKR-GFFSRLFGKK---------------
A0A4U9K473      ---Y-GAQ-------KKK-RFLL---------------------
A0A3M1Y2F5      -----KYAKVYGAMHT----------------------------
A0A7C7CKY6      ------YGYGYYQEESEFVKKTLLQRLLNS--------------
A0A1G1TG88      -----TYGQGYYEDHGSAPPPTLAQKLGRLFK------------
A0A661XXA6      -----YTSSPYYQE------------------------------
A0A3D4RLG4      --------YNYYSDDE----------------------------
A0A2T2UAJ4      --------YEYYRDEDKGAPEPSGIRAWWGG-------------
A0A6I0DZQ5      ---SDGTYYQYYQDDAHDI-------------------------
A0A6L3FBV2      -----GYGYGYGNEGYGHKHGMKKGLKKFLGWILKR--------
A0A6L3FIH8      -----GYGYGYGNESHGRKHGRYENLKKLFSRLLKHS-------
A0A3D3LSK1      -----SKKKNN---------------------------------
A0A496L711      -----KKMGNYYVTEEFEQDDVSILEKLIYKISDMTKKIRNIKK
A0A1H6Z2F8      --------------------------------------------
A0A2P8G5K0      --------------------------------------------
A0A4Q3SEI4      -----KKVYGDHVYKSEAVQRKA---------------------
A0A348PT57      -----TSGNGYYSEDNEEEEPKLNFLRNLRSKLKNDDN------
A0A7C3PTI0      -----GYGYGYGYYDDLKKDDDRSVVKKIFTN------------
A0A5Q4EKA0      -----GYGSGYGYYDDQINIVKRSFWKRIL-------GLGSKKL
A0A519SYE7      -----GYGYGYGSY-----------------------GMGY---
A0A7C7CFR2      -----AYNYGYGYYDEESDSKKRSFWQRLFGRTLIQRGFWH---
A0A3D4CJE1      ------YGYGYYED--VPEKQ--VWWKAIFNKK-----------
A0A7C7LI79      ------YGYGYYDE--ESEKHKSPWYRKIFRS------------
A0A4Q5ZQ60      -----GYGYGYYDE--QEKKGLLGRIKDKFKKA-----------
A0A519Q885      -----TYGMGYYEEPSQGKPSISQRFKRLFS-------------
A0A519TAP8      -----GYGMGYYDEAVQ-PPTLGQKIKSFFS-------------
R5DEG6          -----GYGYGQRKKK-----------------------------
A0A3N2LCI3      -----GYGYGYNYGSGEKKEE-----------------------
A0A6L6NZ03      --------------------------------------------
A0A642EJV3      -----GYGSGYHYGSD----------------------------
A0A6H9Q899      -----GYGSGYHYSSDEKRVGGG---------------------
A0A6L4ENN1      -----GYGSGYH--------------------------------
A0A1T4NDR5      ---YQPKARKRKKK------------------------------
A0A3D5KRM7      ---YG---------------------------------------
A0A3M1NUH2      ---YTQYTSEYGTYGYRDVKELLKDKES----------------
A0A7C1IBE4      ---YY---------------------------------------
A0A2T2TDL4      ---YR-HYDQYGPYDQYRSLPEEASA------------------
A0A359ATS6      ---YK-YGYHYGSEKKKTWWGNKG--------------------
A0A1V6HYH8      ---YDIYGYYTDNEEKQSNTKKSMKKYFNYFYKKNK--------
A0A2E0MDX6      ---YG-YGYGYGGNH-GYYEEK-PQKEKTTFNKIFSKK------
A0A2M7KCE1      ---YG-YGYGNSEYHTDYYDESITKKKKNIFTKIISHL------
A0A523GUD4      ---Y----YNYNTNDK----------------------------
R7JFY1          ---YG-YGYGYGNEKKRK--------------------------
A0A1V5S5I3      ---YG-SKSYYGK-------------------------------
A0A2M7VVW6      ---NK-DGYYYDDTQKEK-LTKRI---------------FKKKK
A0A413V760      ---YG-YGYGYGNESHGH-KHGRYESLKNLFSR------FFKRS
A0A656PYT8      ---YG-YGYGYGEDESQK-SSAVIDSRYNLTQRLKDFLGLNDKK
A0A6A0Y068      ---YH-YGYGSGYH------------------------------
A0A3D1AEJ6      ---YG-YGYGYGNDKDK---------------------------
A0A641X2Z6      ---ST-SGGGHSSLKVRW--------------KLRRY-------
A0A6L8U2P8      ----------YSNYYIRN--------------------------
A0A7C6G639      ---YG-YSYGYGGYGYGYGYGYGRKKRLKEANKYAQYYDDDSEV
A0A519PJW5      ---YG-YGYGYGSYGMGY-YEE-PVQKPTLSQRIKGLFS-----
A0A519T3R9      ---YG-YGYGYGTYGMGY-YEEMDNRKLTVGQRLKRLFS-----
                                                            

© 1998-2021Legal notice