BYKdb

Dataset for cluster orphancd of phylum aquificae

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A662CMM0      ------------------------------------------------------------
A0A7C0Y829      MIRSALERQKKKTAELRQKAIDYNILKREVETNRRIYELLLQRSKEMDVEASVRSTSIRP
                                                                            

A0A662CMM0      -------------------------------------------------MEKLLRLPVLG
A0A7C0Y829      IDRASIPLSPYKPRKMLNLLLSLIVGLMGGVFLAFFLEYLDNTIKTPDEVEKLLRLPVLG
                                                                 :**********

A0A662CMM0      VVPSITLKKRKKEEKADGLLIDFYAVNSPKSPAAEAFRMVRTSLMLAAAGQPPKTVLVTS
A0A7C0Y829      VVPSITLKKRKKEEKADGLLIDFYAVNSPKSPAAEAFRMVRTSLMLAAAGQPPKTVLVTS
                ************************************************************

A0A662CMM0      PQVGGGKTLIALNLAAAYAQMESRVLLVDCDLRRARLHRVLNVKANPGLSNYLAGRVDLG
A0A7C0Y829      PQVGGGKTLIALNLAAAYAQMESRVLLVDCDLRRARLHRVLNVKANPGLSNYLAGRVDLG
                ************************************************************

A0A662CMM0      QIVHQVDGILGDGVTIDFISAGTVPPNPVELLNSKSFVHLLELLRERYDHIVMDSPPLVG
A0A7C0Y829      QIVHQVDGILGDGVTIDFISAGTVPPNPVELLNSKSFVHLLELLRERYDHIVMDSPPLVG
                ************************************************************

A0A662CMM0      FADALVLSRLVDGTILVLRNQQTPKPAAKYARDRLFQVGGNILGVVVNDVRVERGAYYYG
A0A7C0Y829      FADALVLSRLVDGTILVLRNQQTPKPAAKYARDRLFQVGGNILGVVVNDVRVERGAYYYG
                ************************************************************

A0A662CMM0      KYSGYYYYYSKYYSYGSSPELPGKS
A0A7C0Y829      KYSGYYYYYSKYYSYGSSPELPGKS
                *************************

© 1998-2021Legal notice