BYKdb

Dataset for cluster tadcd of phylum acidobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

286 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2V7VMF7      MDVGQPAGFPGYDMDTFRTGVGYEVGPSMRASMGYERQRVPGAPDRPVIEAEADSVFLKV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      TDDRGPAGSGQVEVAYRDQRSPRAAAAGQRFRGLNYAATLRRAVGVNTLVELGGGRATDV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      SGFEANAFYVSSFARGGLTVALPWELSLHAGRGGLGLEPLPTGRERDRAPARRRPLWLVR
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      GSEPVVRPPPLPARGLPARPARLQHPRLRSRDPRIHRPARDRPVPRQGHRGEGHAVKSLA
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LLLAALVLPGARMVAQEAPRPPATPAPEYVVGPGDILQITVYGNEELSRAPTVQSNGTIG
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LPLLGDVAVTGLSASEIQRKLTALLARDFLVNPQVEVKVKEYQSQFVSVVGEVNNPGRKA
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      -----MEAPNSIQATVPLTATAGPISVTTPAGTGTSSAPFKSATRFENTDPALTYTSGWD
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LRGRTRLFDVLIEAGGFTPRASGEVVITRREGTFDNGGHSLRLQFSGASPAPKDLVNLEV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      RTSTLRPWSVGTAAVASTAGQQVTFTFSGTDLTWIGFRGPQAGIARVSLDGVFIQQLDMY
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      PLQNGDLITASAKYYVTVEGEVVRPGRYPLEEETTISTAVIAAGGLTRFAKNDVRIRRVS
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      SVAEEVQAEVFKATGLASGNHTLLIEVTGTSNPASTGSYVAVDAFDIAPQVPATVNITSP
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      --------------------------------------------------------MAQE
A0A2V9R9V4      --------------------------------------------------------MSDQ
A0A321LE75      --------------------------------------------------------MSDE
A0A2V8R8U7      ---------------------------------------------------------MIQ
A0A2V8QMP4      ---------------------------------------------------------MMQ
A0A2V8R4S3      ---------------------------------------------------------MMQ
A0A2V8NJ55      --------------------------------------------------------MMSQ
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ---------------------------------------------------------MSQ
A0A317I2L9      --------------------------------------------------------MMSQ
A0A2V8LLF9      ---------------------------------------------------------MTH
A0A352FRF4      ---------------------------------------------------------MTQ
A0A2V8MKV0      ---------------------------------------------------------MTQ
A0A2V8PYY8      ---------------------------------------------------------MTQ
A0A1Q7YKQ8      --------------------------------------------------------MVSQ
A0A352F3R7      ---------------------------------------------------------MAQ
A0A0B6WXT1      ----------------------------------------------------------MQ
A0A3B9MEU8      --------------------------------------------------------MMSQ
A0A2V8MHG6      -----------------------------------------------------------M
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      -----------------------------------------------------------M
A0A1Q7NJH5      -----------------------------------------------------------M
A0A2V8PJY0      -----------------------------------------------------------M
A0A1Q7Y6W9      --------------------------------------------------------MKES
A0A2V8NC68      --------------------------------------------------------MKES
A0A399WK13      ----------------------------------------------------------MK
A0A352FLX4      -----------------------------------------------------------M
A0A2V8RTL7      ----------------------------------------------------------MK
A0A3E0PCJ6      ----------------------------------------------------------MR
A0A3M1S4R8      ----------------------------------------------------------MR
A0A1Q7YFI6      -----------------------------------------------------------M
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ----------------------------------------------------------MK
A0A3M2D6Y5      ----------------------------------------------------------MR
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      -----------------------------------------------------------M
A0A2V8MM59      -----------------------------------------------------------M
A0A2V8PFE8      -----------------------------------------------------------M
A0A2V8PWS6      -----------------------------------------------------------M
A0A2V8LCT5      -----------------------------------------------------------M
A0A352FTJ9      -----------------------------------------------------------M
A0A2V8G155      --------------------------------------------------MSDT------
A0A2V8HDM7      --------------------------------------------------MSDT------
A0A2V8DRT9      --------------------------------------------------MADQFQLDPG
A0A2V7VYF3      --------------------------------------------------MSKR------
A0A1F2SVH2      --------------------------------------------------MSEE------
A0A2V8AJG9      --------------------------------------------------MSEQFSSNPG
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------MSVPSQ
A0A1F2T595      -------------------------------------------MSTQIPPEFSQKAPASQ
A0A2V8JQV5      -----------------------------------------------------------M
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ---------------------------------------------------------MLP
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          -----------------------------------------------------------M
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      -----------------------------------------------------------M
A0A2V9BCA0      -----------------------------------------------------------M
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ----------------------------------------------------------MS
A0A1F2TPT3      ---------------------------------------------------------MSD
A0A2V8JTQ2      -------------------------------------MSESFELMNQRARDFDPVQLPRV
A0A2V8UZY0      -------------------------------------MSKYFELMNRLRRD-SPLAVSAC
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      -------------------------------------------------------MSQQS
A0A350UIQ4      -------------------------------------------------------MPKPT
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      -------------------------------------------------------MPYDP
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      -----------------------------------------------------------M
A0A2V8XIF4      -----------------------------------------------------------M
A0A3N5XQP8      -----------------------------------------------------------M
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      -------------------------------------------------------MNESI
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      -MWRCIPTTFSSFRAAPARRPGGARWKRCWAWARASAQAPRSIAVNRDLFRVNHSRADST
A0A2U3KC61      -------------------------------------------------MPLQPKRNNSD
A0A2V9Y2R7      -------------------------------------------------MDSPIVVRSAD
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ---------------------------------------------------------MDQ
A0A399WUJ8      ---------------------------------------------------------MDQ
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      -------------------------------------------------MYLLFQFSIQL
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------MACWSALLGRNRMQDCCS
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      -------------MCSARMRQTFITNNFLSASEHPRRRLWSLWACWSALLGRNRMQDCCS
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ----------------------------------------------------MVGLNFFL
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ---------------------------------------------------------MEK
A0A3E0PHB0      ---------------------------------------------------------MES
A0A3M2D491      -------------------------------------------------------MNKER
A0A357F267      ---------------------------------------------------------MEQ
A0A353C9L6      -------------IDGLKYGRFGVIRSKNRENTADIWYKTRLRKFCRVGDVQGQESSMEQ
A0A2V8RQV0      ---------------------------------------------------------MEQ
A0A2V8SJH5      ---------------------------------------------------------MEQ
A0A2V9QB26      ------------------------------------------------------MTEPMD
A0A2V9VYY4      -------------------------------------------------MALQPTRNNSD
A0A2V9KIE8      -----------------------------------------------------------M
A0A352F549      ---------------------------------------------------MKEPSDLSK
A0A3B9MLP9      ---------------------------------------------------MKEPSDLAK
A0A3D5SQ87      ---------------------------------------------------MKEPSDLAK
A0A2V8NW86      ---------------------------------------------------MDKHELPPT
A0A2V8ZHL8      ---------------------------------------------------------MPP
A0A2V9B240      ---------------------------------------------------------MPH
A0A2V9CBM2      -------------------------------------------------------MGEQN
A0A2V8XN17      -------------------------------------------------------MDDQN
A0A2V8WX45      -------------------------------------------------------MEDQK
A0A1Q6YR79      -------------------------------------------------------MDDQN
A0A1Q7VA32      -------------------------------------------------------MDDQN
A0A2V9EY85      -------------------------------------------------------MDDQN
A0A2V9H8K0      -------------------------------------------------------MDDKN
A0A2V9FFE5      -------------------------------------------------------MDDRD
A0A2V9GM43      -------------------------------------------------------MDDRD
A0A1F2RFI7      -------------------------------------------------------MSEEM
A0A1F2RZS3      -------------------------------------------------------MEENN
A0A1F2USE2      ---------------------------------------------MGEEIPDSKREVPDG
A0A2V9C238      -------------------------------------------------------MDPEN
A0A1F2Q9F5      -------------------------------------------------------MSDEK
A0A1F2QQH9      -------------------------------------------------------MSDEK
A0A1F2QXK7      -------------------------------------------------------MSDEK
A0A2V9DEM9      -------------------------------------------------------MDPEN
A0A2V9CYQ5      -------------------------------------------------------MGEQN
A0A2V9BWU8      -------------------------------------------------------MSEPN
A0A2V8ZG48      -------------------------------------------------------MSEQN
A0A2V8Y334      -------------------------------------------------------MGEQQ
A0A2V9AY68      -------------------------------------------------------MSEQN
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      --------------------------------------------------------MVGD
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7V2Z1      ----------------------------------------------------------MA
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      -----------------------------------------------------MSRYFNK
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      -------------------------------------------------MSTQFRDSTDS
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      PETGKTEILEADLKAIRNGKETDLLLXXXEDGDAPMSTAPPVFDPPSERELDLRY-----
A0A2V7YYV7      --------------------------------------------------MELGR-----
A0A2V7Z0J5      --------------------------------------------------MELNR-----
A0A2V7Z3M4      --------------------------------------------------MELNR-----
A0A399Y5V2      ------------------------------------------MTESHATTLELRD-----
Q01X01          -----------------------------------------------------ME-----
A0A3M2D9H8      --------------------------------------------------MLPRD-----
A0A2V8JK38      PSGSTVSGTDKAKTPGRRAGKDKLVRINHRKYPEIVENLPRNLATQEEDETHLLA-----
A0A2V9IXG5      --------------------------------------MQDLNVSESLPQLDIRY-----
A0A2V9J2P4      --------------------------------------MQDLNVSESLPQLDIRY-----
A0A1Q7RLS4      --------------------------------------------MEEKREIHLLD-----
A0A2V2R525      ------MKEDQITKHSSIHDLDSPYNVFPFPPVIQTGER------QDQSQASLAF-----
A0A321LPW6      RVELERVSTA----RVALDAAPPPR---YPALAGAAGTEYGLGYPEEYGRIHLLE-----
A0A2V9R9V4      KRYPDNLPPEVTFRQLPARQAHDSGAVIYPEIDLP---RYG----EAED-FHLRM-----
A0A321LE75      RTDIERIKPE----EMAFGRPGYPRAVGYPEAYATGSYGYG----EADDRINIRA-----
A0A2V8R8U7      DERL--V-------P-AGRGLDNSLADLTQAKPFGRYDRYN----SAPAETNVRE-----
A0A2V8QMP4      DNRL--L-------PLTPETLDRPLRDLAQPSP--VAV-------SSNEPVNLRD-----
A0A2V8R4S3      DNRL--L-------PLTPETLDRPLRDLAQPSP--VAV-------SSNEPVNLRD-----
A0A2V8NJ55      DNRL--L-------PLTSTSLDRPLSDLAQ-SK--KYYGV-----SATSETHLRD-----
A0A2V8Q7I0      ------M-------PAVDRGLEKPQTD----QI--RSYGP-----AANEPTQLRD-----
A0A2V8S6K4      DNRLLPL-------PTPAGNIDRPLRDLTQPAV--QVTGSY----SLPEPTHLRD-----
A0A317I2L9      DNRLMPM-------PAVERSLDKPLTDLN--AA--RSYGP-----AANEPTQLRD-----
A0A2V8LLF9      DEHLVPA-------RT-GRDFDSTLADLTQSKPYGKYARYG----TTQSETNVKE-----
A0A352FRF4      DERLVPA-------RP-ARDLDRTLAELTQSKGYGGRYG-G----GSPAEVNLKE-----
A0A2V8MKV0      DERLIPA-------RA-GRELDRSLADFATAKPYERY---G----AAGVETSLRD-----
A0A2V8PYY8      DERLIPA-------RA-GRELDRSLADFATAKPYDRY---G----ATAVETSLRD-----
A0A1Q7YKQ8      DNRLLPL-------PQ-ERGLDRPLSSLPHSKSYG-Y---G----AAAESTHLRD-----
A0A352F3R7      DNRLLPV-------SALDRSIDRPLADLVPAKPYG-----T----SGSEPTTLRD-----
A0A0B6WXT1      DNRLLPL-------SQTEQQLDRPLHDLTLGQP-------A----TFIEQAHLRE-----
A0A3B9MEU8      DNRLLPV-------SALDRSIDRPLADIAQAKPYG-----V----SGADTTTFRD-----
A0A2V8MHG6      KEPTELIEKSNGS-RDVGGVLERSLTPYTRYDSYEDES---------NGYSRLRD-----
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      KEPAELIEKSNGS-RDVGGVMERSLAPYTRYDSYADES---------NGYHRLRD-----
A0A1Q7NJH5      KEPTELIEKSNGS-RDVGGPWDRSLAPYTRYDSYADDS---------NGYSRLRD-----
A0A2V8PJY0      KEPTELIEKSNGS-RDVGGPWDRSLAPYTRYDSYADDS---------NGYSRLRD-----
A0A1Q7Y6W9      RELITRVKEANEL-EVAGETFSPSPSAYKGYDSAAEDE------------VHLLD-----
A0A2V8NC68      SRPTETTALVHGN-GNSGEPLM-QPSFRQDYRYMGEDSFQT----SGGGYARLRE-----
A0A399WK13      ETRNIITTTSPEP-VELQRPPDPAIPTTGR-YPGYSATPQG----EGFQ---LID-----
A0A352FLX4      NQSTNLSRTNTVPIGDEHIGLERTNGGHVLPGVMQGAYSYE----REERGSRLLD-----
A0A2V8RTL7      EIRELVPTKPNDTVVELERPFETHVIPGTGRYPAYRDVYGP----EGFQ---IVD-----
A0A3E0PCJ6      ESRDIVRNPRTES-AEVERPFEAVAPITNYGYARYRNEDLR----EHSP---LFE-----
A0A3M1S4R8      ESRELISTRSAGR-EELEPRWQ--SPSYYPSYKSFSEGSAK-----------IFE-----
A0A1Q7YFI6      EKETQLVKASVEP-RVVELQANGNGAGLPYGSYAYGSSEPQ----EESGFSRLQA-----
A0A136KC10      --------------MEMERPADPTIAATGR-YPGYPQTGQA----EGFQ---LID-----
A0A2V8SEX6      ETREIIQKPLNEP-VELERHFEPQIVPAGR-YPSYREN-VA----EGFQ---LLD-----
A0A3M2D6Y5      KTNELIVREAQEN-TEVEFRSQPFVSSGNY-YSAATRD-SA----GSLK---LRE-----
A0A0B6WWQ6      ----MMKGDPEKE-PQSLIRLDASAPYPKL-YADYDHRWER----EERTQQIVAG-----
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      NPSNELIRKEPAD-TAIGRPADSNGIPHSY-NYGVDPNA-E----SEVH---LLD-----
A0A2V8MM59      NEGTKLARVETEP-QDLDRRLDDHGP-RPY-AYGYGTNGFD----GEVN---LLD-----
A0A2V8PFE8      NQATKLVKREDEP-GEIDRRFDGSANYRGP-VYGYGPESSE----GEVH---LLD-----
A0A2V8PWS6      NQGTKLVKREDEP-GEMDRRFDDAANYRGG-VYGYGPEGSE----GEVH---LLD-----
A0A2V8LCT5      NEATKLVRRDDQP-REIDRRTGDTTSYRTA--YGYNMDAGE----NEVH---LLD-----
A0A352FTJ9      NEATKLVKQDE-S-RPVERRSDESQPYR-G--YGYGADAGD----GEVH---LLD-----
A0A2V8G155      --------------------KEGLRMMGAPAPG----DYALNDAALPPASPHVVN-----
A0A2V8HDM7      --------------------KEGLRVVGAPAPG----DYALNDAALPPASPHVVN-----
A0A2V8DRT9      DLDNQKKNLAP---------RPRRAVRAASGKP--------AAAEHALEEVHLSD-----
A0A2V7VYF3      ----------IGHDETAEDTRPQAESYWNDDRD---------ADNAAPEEAHLLE-----
A0A1F2SVH2      --------------------SPRIAMAGEDARAQTSPVYGYGSNVLGDTEVHLLD-----
A0A2V8AJG9      PAAAGRLEMAPGLDSIDAGAAPPISAAAPNGRG---PAYGYGSNVIGDGEVHLLD-----
A0A2G6PYV5      --------------------------------------MQDNQPFDQQADFNIFH-----
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      FERKSPESSVLGLDAAPDAGLAPQPSAATGGSGYGYGYGYSGSMPSGDSELSFIH-----
A0A1F2T595      GSGSESPVFNAVPSNGSGGSGYGSGSYGGYSGYGYGTSVTSDS------ELTLVH-----
A0A2V8JQV5      DMEFSEHDLTNKGNGEPSQDPVRKVSKSGKPQQSPAYSGPMTS------PAGVFD-----
A0A2V9AC41      ---------MEQVNQPSPYFIKRTARVEQGTIDLNEFAVVDDQ------VHPLRE-----
A0A2V8K4L4      ----------MRNHDDSSNLPVPFTPPPGNQLSTPLQARFMPEPQEEASREGVVA-----
A0A2V8NCZ3      ----------MKDQDDSSNLPVPFKSARGSQLPTPVPARFTAE--DDSSREGVVA-----
A0A2V9MAM9      VSKLSKAPQRPSHSLSRAEFQRLARPSPEALAAGTSAEIETG-------SLSIIE-----
A0A2V9M454      ---------MNGDELVPLNSGPVTPPPNRNGSGP----HSYIDLEQVDAFGQLRA-----
A0A2V9IVR7      ---------MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRA-----
A0A2V9ILE2      ---------MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRA-----
A0A2V9LGY4      ---------MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRA-----
A0A2V9J4D6      --------MTHRSRFTPSSASLRPGSSNAPPSFA--PLPSCASAGG--------------
A0A2V9L9C5      ----------MREEFGKSGTLVGRAINDSPEPIH--PIISITSAGEFE--RPSVL-----
A0A2N9M9N1      -------------MAENDKLIPVSAVSSDRLGYSGYPVTDLDPAGSEA--YSFQS-----
A0A2V9JEC4      --------MPRNTDHEQTASARSETALSERPAIGEYVVPQLEDAEGGA--SAFRV-----
A0A2V9LPQ3      -----MADIQKLTTTEPAPLARRRAASSESIGFG--LLPT--DFDGFS--SVLRV-----
A0A348V070      MDKITPTTPTTGARQTQQNL-----------------------------LEQILY-----
A0A2Z5G3A3      --------------------------MKTLPSPQSIYTPIPET------PLTISD-----
A0A2V7UGP8      ------------------------------------MDVLSQK------EINLVD-----
A0A239MKT6      ---------------------------MAFDNNDASIASDLNDAEQGSSDLTLES-----
A0A3E0PCN7      -MQKNKQLALRPKEEGQETIVYGDYEGDYFDSSYYGGAPAPSE------RQQLMA-----
A0A2V8IYW3      --------------------------------------MIPGH------KYTPQD-----
G2LEI9          PQEHPNNNVMLAPTAAELDLATPTVQDRMRRRGSYQYTLPQEDA-----GQPIRQ-----
A0A317J121      -------MRHLNHDQPEPGNNRLPALPNSYFVQPGELTIEPAS------SSPGID-----
A0A2V7YW66      ----------------------------MSPLSPVPFEEEPEGAAEPASELNFGE-----
A0A2V7Z0V0      ----------------------------MSPLTPVPLDDEPEVAPEPESELNLTE-----
A0A2V8GFD4      --MSDNEQHQHHEIRIDMPADSAFASARDAVEKDGVERLPPGSGEMVDGTLSGFD-----
A0A2V8HSS5      --MSDNEQHQHHEIRIDMPADSAFASARDAVEKDGVERLPPGSGEVVDGTLSGFD-----
A0A2V8KP55      ----------------------------------------EED------ETHLLA-----
A0A399WNU1      -MQSNFQVVKRNSRQDPESLDFYDQDDLYPESYYGDSIQEPTE------KQQLFN-----
A0A2V9CG11      -----------------------------MESPPNREVATAGG------YDSFLD-----
A0A2V2R0I6      MADEHKLVRRESGSNVPVEIVPPANRLPAWELSPR--------------EPHLYD-----
A0A2V8XAR9      MADDNKLVPRENGSNGPVELVPLPARLPSWELSPR--------------EPHLYD-----
A0A2V8VZA0      MADENKLVPRENGSSGAVEVVSLSNRVPSFELSPR--------------EPHLYD-----
A0A1Q7CB82      MADENKLVPRENGSSGAVEVVSLSSRVPSFELSPR--------------EPHLYD-----
A0A2V8WIU1      MADENKLVPRENGSSGAVEVVSLSSRVPSFELSPR--------------EPHLYD-----
A0A1Q6Y9F5      MADENKLVPRENGSNGAVELVSLQSRVPSFELSPR--------------EPHLYD-----
A0A2V9EVV8      MADENKLVPRENGSNGAVELVSLQSRVPSFELSPR--------------EPHLYD-----
A0A2V8YF91      MTDENKLVSRGNGSNGAIELAPVTPRFVSFDLSPR--------------EPHLYD-----
A0A2V8XZK2      MAEENKLVPRENGSNGAVELVPNTPRFASFELSPR--------------EPHLYD-----
A0A2V8ZTX6      ----------------HVELAPLPNRFASFDLSPR--------------EPHLYD-----
A0A2V9BT79      MTDENKLVPHENGSNGNVELVPIPGRFASFDLSPR--------------EPHLYD-----
A0A1Q8B793      EENGSKLAAHDNGANGAVEIIQAPLRMPVFDLSPH--------------EPHLYD-----
A0A2V9BCA0      EENGSKLAAHDNGANGAVEIIQAPLRMPVFDLSPH--------------EPHLYD-----
A0A2V9BWU9      MDESTALMQRDRRAGSSFEVITAHPQFSSWETPPR--------------EPHLLD-----
A0A2V9DKX2      MDESTALIQRDRRAGSSFEVITAHPQLSSWETPPR--------------EPHLLD-----
A0A2V9JSI3      --------MTNDNALAPIEHVPFERVGYRKPSVVTVEAEEFDS------PLDLRH-----
A0A2V9WI32      MGESLMDSGIVRRRSDTSTLEQLPTEIQFPADPARSYAPLPEE------GFLLRE-----
A0A2V8IVN9      DIRNFDPSVKLRFEEAANPEDAVLRAPGEAAGGGYASYPDIVGGSGEGGEPHLLD-----
A0A1F2TPT3      EPRSNPPAEATPPDDIRLSMEGTAEPALRRYENDALWQGLEGE------DRHFQY-----
A0A2V8JTQ2      ALSSG--------------------PNPANHYLPRVG---APD------EVFAAG-----
A0A2V8UZY0      DIGPEEPENLEVHGTRAAPRFVRSLPNHPPHPVARASDERASD------EMFAAG-----
A0A3N5YNR8      -----------MGDLIRREYSSIPDPSIRIQRNTEYQWASDDD------SLDIRR-----
A0A350UEK1      PPP---GDARDHDSRLPARFEIVEAGVPHRLEGPQVNYYGSPAPEEDPDSGGLLD-----
A0A350UIQ4      PPSNPQGDSASANSRLPVKFEIVDA--PPANSDP---YYGGPQFDSDEEEGGLLE-----
A0A3N6A5T6      -------MADLMIPGTEGLPTQIRPSPSPNWAHQKPKAPSKVE------VPHLRD-----
A0A1F2Q9L4      -----------------------MVARRPAAPDKIGFEVEPES------EFHISQ-----
A0A1H5SQF5      LQDVTSRSASTHRRSAFRR------------------------------EMHLSD-----
A0A3E0NV31      -----------MDRESYFNEDLRRHGGGGVGPGARRGDNDPSE------GIKVRQ-----
A0A3N5M5V0      ------------MGDLIRREPSSFADPTIRMQRTGNYQWGPDED-----SLDVRR-----
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      KPSEFPLDKTDRRRNELSRGAEQRPTVYKYVESPSTEVGASPG------YDSLLD-----
A0A2V8XIF4      QASQFSIEKSKRRPNGLSANGKQRPVLYAYLDSPAAEGAATPG------YDNLLE-----
A0A3N5XQP8      ADLAKQSRQGMQERGGGPRLFEPSPSSRD--------------------RSTVRF-----
A0A2Z5G7H4      ---------------------------------MGPRADVRER------PITLGD-----
A0A2V9L5B5      DVHQRRGLVQGDQDSSGESQHAIEPAFSRSLQESEVLDVSPEE------VPHLLD-----
A0A2V9LK56      --------MDEIQNSNGFQGASLAPRTTA-LPDSRVLDIGPEK------VPSLFD-----
A0A2V9L7I0      --------MDESENLQRDPVRALARTATQPLEKPEILDVSPEE------VPDLID-----
A0A522PPT0      --------MDSNEITPINQTGNVERLNGHYLREEDVLDVLPEE------SPRLLD-----
A0A2V9KCS3      SGALMDQIVHLPKGPQRELIRRTNGGVPASGSLPYGDSPVDQEYGADAVSGGLLY-----
A0A2U3KC61      ALEALEPIDPLPVKGPQSVYPH-----------FAQPQNS------------ILH-----
A0A2V9Y2R7      NLPGQRSLEILDQTPPSCQIPY-----------SYNSYSASGH------AINLLH-----
A0A372IT17      ---MTSPTHILER-----------------------DAMAVYD------EWTVAD-----
A0A136JPP4      DQRLTPLPKGLELNQPAGDLTTSYA--------AYYDHESQSG------KRTLRQ-----
A0A399WUJ8      DQRLTPLPRGLDLNQPHGELPAAYT--------AYYDHESQSG------QRTLRQ-----
A0A2V9NGH6      ---MDSAPLIAANTRVLRELPSAHPVEFRRQFGFGIYNPATFQ------DSVVHE-----
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      GRQMEPSPVMQI-GNQVREM-GPASMQIGRNI-AAIHPAMAAQ------DSILRE-----
A0A2V9QD92      ---MEPSPVMQI-GNQVREM-GPASMQIGRNI-AAIHPAMAAQ------DSILRE-----
A0A2V9WPZ6      GVGMDSGPLVHTNGQMIREVQAPYPVEFSRQLLTGIYPNAPAQ------DSVLRE-----
A0A2V9ZLH4      ---MEPGSLIPSNGQPVRELQAIAPVEFSQQVGPGVYPPLPTN------DSVLRE-----
A0A2V9RQF1      ---------MPANAQGLRESPDPLPVEVNRTTQHYAYPVLPSQ------DSVLRE-----
A0A2V9YDK8      ---MDSGPLVQTNGQTIREVQPVYPVEFGRQMLTGIYPTLHPQ------DSALRE-----
A0A2V9V8F7      GVGMDSGPLVHTNGHMIREVQAPYPVEFSRQLLTGIYPNAPAQ------DSVLRE-----
A0A2V9XGR9      ---MDSGPLVHTNGQMIREVQAPYPVEFSRQLLTGIYPNAPAQ------DSVLRE-----
A0A2V9V3Q5      ---MALGPLVPHNDG-FREIQPAEPTELIKPIGPGLYTVLPSQ------ESALRE-----
A0A2V9NWS3      GASMASGPLIPANGQMLREISSLSSFDLNR-QLAAYYPNAPIQ------DSVVRE-----
A0A2V9USA9      ---MDSGPLVPANSGVVREI-PLTSPEFGRAAVPQVYPVLPSQ------ESAAGE-----
A0A2V9XW18      ---MDLGPLAPLGTPTIREIQPSQNVDLVRPQDPRFYPPLASH------ESGARE-----
A0A4R1LC91      ------------------------MKALTGSQANF-AQNSLDG------ELTIKG-----
A0A3M2BZG9      -MKMIPSSEQPLPRPAV-RDDFLAYDAAPATATPVPPMPGDAG------ELDVAK-----
A0A1Q7N5R7      -----MPDHTSLRRTPPPPLTAADLSRAGTAVEKF--SPNGDE------GPDWHR-----
A0A3M1SIV3      DERLLPLPKELEANKNAITYQEEGPRYFASYA--Y-GDDILEK------KFNPRD-----
A0A3E0PHB0      NDRLLQIPEIQERRSKK-SLQTAPQDYPPAYSPFY-DDEALGD------SRSIRE-----
A0A3M2D491      DERLLPLPKEIQEYELT-S------RYYPSYGG---STELVEQ------RFDPRE-----
A0A357F267      DQRLTHLPKAVDLRANG-G------DYGSGYSSFY-DEEIADG------RRSLQQ-----
A0A353C9L6      DQRLTPLPKSADLRANA-S------EYGSSYSSFY-DEEVIEG------KRTVQQ-----
A0A2V8RQV0      EQRLTTLPHLGELRHSK-H------EYAGSYSGAY-SDEVIEG------RRTVQQ-----
A0A2V8SJH5      DQRLTPLPKSLDLRASK-T------EYPATYAGFY-DDEVSEG------RRSIQQ-----
A0A2V9QB26      KHALPPASHDLVLRKSE-GSPGHGEAGSY----LY-GHRDELE------PGGFVE-----
A0A2V9VYY4      DFEALAPIDPLPVNGHQ-PLHTYFGEPHN----------------------ALLH-----
A0A2V9KIE8      GKSEILPGDRLNRIAPV-SMEQVRGQ-------EF-LEVGHEE------APHLMD-----
A0A352F549      ALEIILKNSALEQSNGS-SHNGHGNPPIV----AYGEEASPEG------EMHLRD-----
A0A3B9MLP9      ALDIILKNSSLEPTNGS-LRNGYATPPIV----AYGEEASPEG------EMHLRD-----
A0A3D5SQ87      ALDIILKNSSLEPTNGS-LRNGYATPPIV----AYGEEASPEG------EMHLRD-----
A0A2V8NW86      SHELVPRKSTEAYPGHG-EAGSYLHGRRD----EF-E------------HGGFVE-----
A0A2V8ZHL8      GVKDMPDNEALSLRGAK-LPVLESPQSPAFPVLGI-DVQDFES------FSYLQA-----
A0A2V9B240      KVKDMPDNQALSLRGPR-LPVPESPHLPAFPVLGT-DVQEFES------FSYLQT-----
A0A2V9CBM2      QSEPYSHAHRLARK-RG-SLEASVVELAD----SY-EIIGPEE------GIDLRA-----
A0A2V8XN17      QVELYGRGHRLDRRGPG-APDSRVIELPD----SY-EILESGE------ALDLRS-----
A0A2V8WX45      QVELYGRGHRLDRRGPG-ALDGRVVELPD----SY-EILESDE------GLDLRA-----
A0A1Q6YR79      QVELYSRGHRLDRRGPG-ALDGRVLELPD----SY-EILEPGE------ALDLRS-----
A0A1Q7VA32      QVELYSRGHRLDRRGPG-ALDGRVLELPD----SY-EILEPGE------ALDLRS-----
A0A2V9EY85      QVELYGRSHRLDRRGPG-ALDSRIIELPD----SY-EILEPGE------ALDLRS-----
A0A2V9H8K0      QVELYGRDQRLERRGPD-ALNTRVIEMPD----SY-EILESAE------ALDLRS-----
A0A2V9FFE5      QVELYGRRHQLERRGPD-ALNTRIVELPD----SY-EILESGE------ALDLRS-----
A0A2V9GM43      QVELYGRRHQLERRGPD-ALNTRIVELPD----SY-EILESGE------ALDLRS-----
A0A1F2RFI7      SLEKIPPLKGE--------VPATTTVAAY----TI-SQEEEAA------TPSFLD-----
A0A1F2RZS3      SLERVSRGQID--------APASVPVSSY----PV-EVLEEQD------SFPLLE-----
A0A1F2USE2      RIERYEPSPPM--------LARPEPPVPV----AY-ETVETEE------APDLLA-----
A0A2V9C238      KIKLYEPAVRK--------WERLRPTPAV----RA-EPLEMKE------SADLLA-----
A0A1F2Q9F5      SVERYEPAART--------LERRRPGVPA----PL-QTLEMEP------AADLLS-----
A0A1F2QQH9      SVERYEPAART--------LERRRPGVPA----PL-QTLEMEP------AADLLS-----
A0A1F2QXK7      SVERYEPAARA--------LERRRPGVPA----PL-QTLEMEP------AADLLS-----
A0A2V9DEM9      KIKLYEPAVRK--------WERLRPTAAV----RA-EPVEMKE------SADLLA-----
A0A2V9CYQ5      QSEPYRHAHRLVRRTGN-GLEASVVELAD----SY-EILGPEE------GIDLRA-----
A0A2V9BWU8      KLEPFAQGPRSGHGGLR-FMDNRVVDLSD----SY-EIIEAEE------PVDLRA-----
A0A2V8ZG48      KVELYARDARFERARLG-FLDHRIVDLSD----SY-EILEPDE------PLDLRA-----
A0A2V8Y334      NVELYSRGPRFERGGRA-FLDHRVLDLSD----AY-EIVEPEE------PLDFRA-----
A0A2V9AY68      KVELYARRPRFERGGSV-LLDNRVLDLSD----SY-EILEPDE------PLDLRA-----
A0A257VBK0      --------------------------------MADSDPPQVQAEFSAAQDVDLLH-----
A0A2V7XDY0      ----------------------------------MPSPVPAPAGGSSESPIDFRY-----
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      KEMVENNLTPALPAPLEALPGRNLPVPMEVYRTSNLMP----EVEAAPSSVPLSH-----
A0A2V8TTB0      MKKFENNL-PAVP---------------EVYRAAAPVPVIDAEFEPQAPQVPLAH-----
A0A1F2TCR2      ------------------MFDTHDLQQAPAIAIEAPPQLPMPPVAQSQQPLHVLD-----
A0A2N9LQU7      ------------------MQNIPEQQLARVTARGRISGPVPLPPALRNPDVSLGE-----
A0A2P6WFK7      -----------MRPAACQESHMPEIEQDSLATMRESGLKRFGNDSVTERELSVTE-----
A0A1F2V330      -----------------------------------------MPSDGTGKEISVLA-----
A0A2V8U914      ------------------------------------------------------------
A0A662EE63      --------------MRHRDIDMDRWMPADQGAMPPGGPAMGGWVDDQGHEIDVME-----
A0A2V7W309      ------------------------------------------MDLNTQQEVHLSQ-----
A0A2V8TLH7      -------------------------------------MSENLPIVEEQREVHLLD-----
A0A1Q7ZJT1      -------------------------------------MPDSLNPLEEKREIHLLD-----
A0A2V8VC99      -------------------------------------MPETLAPLEEKRDVHLLD-----
A0A348UZU3      -----------------------------------MSENYVDPQSLETAEIDLRK-----
Q01XL7          --------------MNDHYEPESNGSGPHGLPVGPDVRMLPSPSDGWVPEPTKIS-----
A0A2V8ERZ5      --------MLPSSPPDAPAPSTTAVTAGSPSHAGSSHGQGSAPHYAPEQDVHLLD-----
A0A2V8GTX0      --------MFTPGGLSTTGP---AAGSPPPVPVHQPQARKTAGLFSPDPNIHLFD-----
A0A2V8J0X9      --------MFDTQEVRAQLP---AEVSPSALIALPSSTSQST---------HVLD-----
A0A523DUV7      -----------------------------MDPQDSHHQEHTNLIAGLSGEFDLKY-----
A0A372IRG7      -----------------------MQGSAIAPQGQQELHPPGGVPPHESPAFTPAD-----
A0A1F2U158      ----------------MSESSPAHPTPASAPTSSGAPRAPQPLTYAVDKDVHILD-----
A0A2V8F6S9      ----------------MADSTPSGSRPASSASNSNGGVAP-PLTYGTDGDVHILD-----
A0A4Q1SCH5      -----------------------MNQPAAASPLQAQPAAFSSPGVGDSEGISFRE-----
A0A2W0BGU4      ----MTNPLMKSDPATRRELVDYEIAPHPTPEPITIAPRYYPDPNASPEAGSLAL-----
A0A2W0BVQ9      ----MTNPLMKSDPATRRELVDYEIAPHATPEPITISPRYYPAPNSGPEAGSLAL-----
A0A3D1ASD2      -----------------MSEMRLDRSNLPALPSTYSVSHITAEPEARETTVPLTH-----
A0A2N9MK30      ---------MNTSLQELTIVEERGPRSLPVAAGFGPAQPASWDLEPEEQTLPLSH-----
A0A1I6MH75      --------------------MDRQTTETTSPTGVPHTPGGGFAAATAATETTLSD-----
E8WVF6          --------------------MSSDNPYSNPGPGMSQAQQPTFVAPS--NDTTLSE-----
A0A1H5Z7N3      -------------------MIPVRAQTSQASESEVVMPQAMQDRAS--GDTTLSD-----
A0A2V9YHT3      -----------MDSGKLIRAEDAGNGKSSLDFPPPLLPAGYFPATL--PQPALLD-----
A0A1G7JVV8      -------------------MPPLTNQPSD---RVVPETNAGFSAIT--AESALSE-----
A0A1H4T6W9      -----------------------MNQPVT---H-DPANPAGFTSTA--ADSALSE-----
I3ZEU5          -------------------MPPATNQPVP---T-DPASPTGFTTTS--ADSALSE-----
A0A5B9EBI2      -------------------MGPQNPQQPL----PPTTDYRAAASAP--TDASLSE-----
A0A239HDF6      --------------------------------------MPGSIPQA--ADASLAD-----
A0A4Q0T270      ---------------------MADDGPGT---GTPHAPLGGLSTSG--SETTLAE-----
A0A1Q3QQB6      -------------------MGLQNTQPSAD-GDTSELNSPRFGSAV--TDTALSD-----
A0A3N1K1G7      -------------------MGPKETPPVA---GAPDLSPSAFSSTA--TDTTLSE-----
A0A428MDU2      -------------------MGLENPQQPGP--GAPETNPTGFSTTV--TDTTLSE-----
A0A4V2G466      -------------------MGPQSAQTPSHTGGASETTPPAFSTAT--TDTTLSE-----
A0A4Q7YNP3      -------MGNTFNTNGIDRRPVGIVARDESGETFPKSWTANDRVEQ--RTSLFAE-----
A0A2V9MN96      -----------------------------------------PYRIG--GQHPLLS-----
E8UZE1          ------------------------------MKNPGIPDEVAARSSF--SAVGLPE-----
A0A2V7V2Z1      YSFGYRLRSSSRCPAPTWPPGPSRSERRRGSPAVSPSASSGYEGEP--QEAHLWE-----
A0A2V7X2F7      ------------------------------MASPSQPPPSEPAG-----EDHLWD-----
A0A2V7V2I1      ---------------------------------MSTTAPAGQAGVP--EETHLWE-----
A0A2V7U3M2      ---------------------------MEGTSPVTPTPPTSSESEA--QETHLWE-----
A0A2V7UHT0      -------------------MWPRRTVLSKELSSVTPIPPAGSEGEP--QEAHLWE-----
A0A2Z5FVL3      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A2V9KBD6      --------------------MDLSRPEPRLPPKVPSPRVQRVVGAP--DEALAST-----
A0A2W0AJ66      --MTRYFELTGEPAPDSAA-QTLVQTPPNLKPGLPNRYTQKVVEAL--EETFLGN-----
A0A1Q7RBU1      --MSKYFELMNQLGRDSAAVQ-----LTRAAPNLPNRYPQRLIDAP--EQMSTAG-----
A0A2V9JPV9      DEERRYFELMNQHPRNSLAVQPPSRGVPRSTPNLSNRYPQRVIDAP--EQVSAAG-----
A0A3E0P0A3      ------------------------MNLRQRTVAPRESDEAFAGSGD--DLKLIAE-----
A0A2V8EXP2      LQHRLTMASADAENAGAARAADSGPAAAAPPPTAYGYGSNVVGDDQ----VHLLD-----
A0A2W4RYA1      -MPDINLDDLDDASRRGAAGDGQPPAGATVPSRAGAQHAHGLDEDH--GDVHLRD-----
G8P0Y7          --------------MSTGRMRGEFAEPVRHDSPRLASLQEMYRPPA--REHSISD-----
A0A5M8T4U7      ---------------------MAIEPQSEHQLDRVMINPATIAAPS--ESLSLMD-----
A0A3P0X3W6      ------------MSSVYNNKPRILPASAPPSQIAHYTGPQAAAEPD--ELLPMQH-----
A0A1E3Y9R6      -----------------------------MAHLPNA-GGRQASAKG--GGWHPTD-----
A0A2W4TLP2      -----------------------------MAHLPPAHGGRAARRGG--SSWHPTD-----
A0A3R9WF43      ------------MDRSPPKVSITKKEHRSFLAEMQTRAHLAPVNAS--EYESLSG-----
A0A317HKM4      -----------------MSLDSHRPARSDPDSDDARGTGSPDTWGT--DTLQIRD-----
A0A523E0N1      ----------------------------MSTERLPPDYSDYAPEIY--PRASLRE-----
A0A523ECP2      -------------MELKKSEQGSNANWAPPPTPTSEPERVDFHPPE--SETHLRD-----
A0A2W0C122      -------------MDARELIKSNPAELSAQNTPASQGIHYGWARLV--PLNPVQR-----
A0A2W0AUU7      -------------MDARGLMKWNSTDISTQQSSASQNLHRASSRRV--PLNPMQV-----
A0A2W0BQL1      -------------MDARGLMKWNSTDISTQQSSASQNLHRASSRRV--PLNPMQV-----
A0A4Q1SDL1      --------------------------------MNNYLLEAPPTHVE--PGLTLGD-----
A0A3P0XH15      -------------------MEGPAVQPERQVAAGPQLAPEQAI-------ITPSD-----
A0A4R1LAZ7      ---------------------MEGPRTTTRVSPAGDMQAELPVNER--SILTPGD-----
A0A3M1WQW8      ----MSERDERTHLPAPADTGAMDRNVVTRLYPIGYGHERYGTAVE--RDVHLLD-----
A0A3N1JHC1      ---------MRTPAGKLRAIAPAETPGPRLPSAGTLDPFRSSTVYG--TPEEQID-----
C1F294          ---------------------MDTLDPQRQSGSAIASADEKTVAPQ--STINLSD-----
A0A2V9KA79      ---------------------------------------MQNGTAN--TSASLTN-----
A0A522PSP1      ------MNFNITERSDAVLRSAGPEEATRLAPDNQKGTWGFPTEPA--ISLALSR-----
G8P085          ---------------MRVQTTQPDTEGKLDQRSLTEADSASA--------LSLGD-----
A0A4Q1SGQ1      ---------------MNEKALLAGRPLEWTDLLTRPRRE-----------WTMLD-----
Q1ILD9          -----------------MSATNLATRKDLLPQNGKGARWQPSESDG--QKIDFDG-----
Q1IJZ6          -------------------MDSLFRKSELPPLGVSEQSTTNAGLED--EDLSLRQ-----
A0A2V8TCE6      -------------------MTSPREAE-----------------------SEIRE-----
A0A522TBE8      ---------------MPKAVQQPSPIPPPQPVAGRAGAPAPWWQAT--EEAGPQAERPAG
Q1ITG0          ----------------------MEKFSQIENVQGASRTSWADVQED--READLLH-----
A0A3N5PCI5      -------------------MSDTQQPPSEHDAVTSRAEPQ----------WQLED-----
A0A3M1Q0S9      -------------------MTESSEQRE----------------------FNLRD-----
A0A2Z5G448      -------------------MQGPDPASERQQGTSVAGKPAGSDRQD--FILTPAD-----
A0A3M1VZ38      -------------------MIQQDPQN-QE--------------------FNLRS-----
A0A4Q1SD29      -------------------MQGWSAPP-QEPQKVASSPAVGSVQEH--TVFTPAD-----
A0A3M1PY35      -------------------MAASEPYR-REPPTGGE--------------WDLDA-----
A0A3M1VMP2      -------------------MPAMTVPG-VGP--GGD--------------WDLAA-----
                                                                            

A0A2V7VMF7      -------YAGLVWRSRV-FIVALGLVGLGLGFVVALLQTPQYRAGAM--IQI---EPP--
A0A2V7YYV7      -------YLRVARHRLW-MIIACPILAALSAGIVSFALPPVYEAHAA--LLV--------
A0A2V7Z0J5      -------YLRVVRHRLW-MIVACPLLAAVTAGVVSFALPPVYEAKVD--LAV--------
A0A2V7Z3M4      -------YLRVVRHRLW-MIVACPLLAAVTAGIVSFAVPPVYEAKVD--LAV--------
A0A399Y5V2      -------YLGILRRRKW-FIILPTVVILVAAITASLLTTPIYEASAD--VLI---QSN--
Q01X01          -------CARTLYRRKA-TVLWITFFAVIAAALISVAQPRMYESQAS--IQV---QGV--
A0A3M2D9H8      -------YLFLAKRWAW-LLGVGVLIGLIGGLIYSLVQEPVYQATTK--VMVLGAPQS--
A0A2V8JK38      -------YWRVIVTRRW-TVVAVFATIVLLTLIWTLKQKPMYAATIT--IQI---ERE--
A0A2V9IXG5      -------ILHVLWTGKW-VILACMLVALALAAVNNNFQKVSYRAQAQ--IQI---DAP--
A0A2V9J2P4      -------ILHVLWTGKW-VILACMLVAMALAAVNNNFQKVSYRAQAQ--IQI---DAP--
A0A1Q7RLS4      -------YWRTIWRGRW-TILSIFVVVFTLVAIGTFTQKPVYRASVT--VEI---TPQ--
A0A2V2R525      -------YVQIIRKHFL-MIIALTALCTLTTAVYMARKPDVYGAAVR--VQI---DVE--
A0A321LPW6      -------VWRTIRKRRW-LIAATVVIVTSIVTVEMFRIKTAYQASAM--IEI---GKD--
A0A2V9R9V4      -------LWRIVRKRRW-LIIGIASIITTLVTIDVFRTKPLYEATTT--IEI---GRD--
A0A321LE75      -------IWRTVRKRLW-LISLIALIVTTIVTLEMFRTKSMYKASTT--IEI---EKE--
A0A2V8R8U7      -------YLYVILKRKW-LILSLVLVVTSLVTIQAYRQPSIYEGGTT--IRI---ESK--
A0A2V8QMP4      -------YLAVVLKRKW-LILSLMVVITSLVAIQMYRLPSIYEAQAT--IQI---EQK--
A0A2V8R4S3      -------YLAVVLKRKW-LILSLMVVITSLVAIQMYRLPSIYEAQAT--IQI---EQK--
A0A2V8NJ55      -------YLAIILKRKW-LILSLVVVVTSLVTIQMYRQPPIYEAETT--IQI---E-Q--
A0A2V8Q7I0      -------YLFVVLKRKW-LILSLCLVVTSLVAVQMFRQPSIFQAETT--IRI---E-R--
A0A2V8S6K4      -------YLNIVLKRKW-LILSLVTVVTTLVAIQMYRLPSIYEAKTT--IQI---EPK--
A0A317I2L9      -------YLFVILKRKW-LILSLCLVVTSLVAVQMFRQPSIYEAETT--IRI---EQR--
A0A2V8LLF9      -------YFFIILKRKW-LIMSLLLVVTSLATIQAYREPSIYQASTM--IRI---EGR--
A0A352FRF4      -------YLFVVLKRKW-LIMSLVLIITSLATIQAYREPSIYEGATT--IKI---EQK--
A0A2V8MKV0      -------YLFVILKRKW-LILSVALVITSMAAIQQYRQPSIYDGIAQ--LKI---EEK--
A0A2V8PYY8      -------YLFVILKRKW-LILGVVLVITSMAAVQQYRQPSIYDGIAQ--LKI---EEK--
A0A1Q7YKQ8      -------YLNVVLKRKW-LILTLMLVVTSLVAIQMYRLPPIYQAEAT--IQI---EPK--
A0A352F3R7      -------YLFVVLKRKW-LILSLVLVITSLVTIQSFRAPSIYEGETT--IRI---EQR--
A0A0B6WXT1      -------YWAIVYKRRW-LILSLALAVTSLVAIYMYRQPNVYEAMVT--IDI---EPR--
A0A3B9MEU8      -------YLSVVLKRKW-LILSLVLVITSLVTIQSFRAPSIYEGETT--IRI---EQK--
A0A2V8MHG6      -------YWRSVRKHLW-LVMGIVVLVSGVTAMYMARQRDIYESLAR--VQV---DSE--
A0A2V8P7N1      ----------------------------------------------K--VQV---DSE--
A0A2V8M3M6      -------YWRSVRKHFW-LIIAILILVTGITAIYMARQPDVYESLSK--VQV---DSE--
A0A1Q7NJH5      -------YWRSIRKHVW-LVIGIVVVVTGLTAVYMARQPDVYESASR--VQV---DSE--
A0A2V8PJY0      -------YWRSIRKHVW-LVIGIVVLLTGLTAVYMARQPDVYESASR--VQV---DSE--
A0A1Q7Y6W9      -------YWRSIRKRLW-LVISITVLMTTLAAIYMARKPDIYTAQAR--VQV---DLE--
A0A2V8NC68      -------YWCSIRKHIW-LVMGIILLITMLATIYMARQPDVFEARAR--VQV---DLE--
A0A399WK13      -------YWRAVRKRLW-LVVGIAVVMTTLATIYIARKPNVYRAKAV--VQV---DNE--
A0A352FLX4      -------YWRIVSKHLW-LILGISVLIPTLVAIYVVRKPDIYESQAR--IQV---DLE--
A0A2V8RTL7      -------YWRAIRKRLW-LVVGIAVLITTLAAIYMARKPNIYLASSV--VQV---DLE--
A0A3E0PCJ6      -------YWRIIRKRLW-LVLGITVLLTTVTAIYMARKPNVYMASAT--VQV---DLE--
A0A3M1S4R8      -------YWNAIRKRLW-LIVGLVVLVTTLTAIYVARQPNVYEARAR--VQV---DLE--
A0A1Q7YFI6      -------YWQSVRKHLW-LIIGIVVLITMIAAVYMARQADIYEAKSR--VQV---DLE--
A0A136KC10      -------YWRAIRKRLW-LVAGIAVVMTTLATIYIARKPNVYRAKAV--VQV---DNE--
A0A2V8SEX6      -------YWKAIRKRLW-LVAGIAVLVTTLVAIYMARKPDIFSATAR--IQV---DLE--
A0A3M2D6Y5      -------YWNAIRKRLW-LIVSIAILVTTLTAIYVARKPNIYEAKAR--IQV---DLE--
A0A0B6WWQ6      -------YWRAVRRYLW-LVIGLVALAAAATAIYMARQPDLYLARAR--VEI---GSE--
A0A3B9MK99      ---------MCIRDR----VISVLVLITTISVIHVARKPDIYQASAR--VQV---GLE--
A0A352EX26      -------YWRAVRKRLW-LVIGIVILITTLAVINAAQKPDIYSANAR--VQV---DLE--
A0A2V8MM59      -------YWRAVRKRLW-LVIGVAALITAMAVIYAARKPDVYEAASQ--VRV---DLE--
A0A2V8PFE8      -------YWRAIRKRLW-LVLGVAALITALSTVYVARKPDVYEAKSQ--VQV---DLE--
A0A2V8PWS6      -------YWRAIRKRLW-LVLGVAALITALSTIYVARKADVYEASSR--AQV---DLE--
A0A2V8LCT5      -------YWRAIRKRLW-LVIGVAALLTTLALVYVARKPDIYEAKSQ--VQV---DLE--
A0A352FTJ9      -------YWRAIRKRLW-LVIGVAVLMTTLAIIYVARKPDIYESSSR--VQV---DLE--
A0A2V8G155      -------SLMVVYRRRW-TVVTAFVLATAGATVYTFSQPRLYEARTR--LLI---ETE--
A0A2V8HDM7      -------SLMVVYRRRW-TVVTAFVLATAGATVYTFSQPRLYEARTR--LLI---ETE--
A0A2V8DRT9      -------YVKIMYRRRW-PAGTAFMLVVLVVLVYTFTATPIYKARVQ--LLI---EDE--
A0A2V7VYF3      -------HLRVLYKRRW-TAVTTFVLVVLAMMLRTLNGIPVYEARVQ--LLI---DVE--
A0A1F2SVH2      -------YVKVLYKRRW-TALTAFLIVVLSVSVYTFTATPVFEARVQ--ILI---EKE--
A0A2V8AJG9      -------YVKVLYKRRW-TAITAFLVVFLSVTIYTFTATPIYEAKVQ--ILI---EKE--
A0A2G6PYV5      -------YIGLLRKHFF-LTLSLLILGLGLAYLAWLVKPPLYKSSVL--IKM---NHL--
A0A2V8F956      ------------------MAITTFLLVVGSVTVYTFTATPIFEAKTR--LLI---EAE--
A0A1F2S1W5      -------YLQVLYRRRY-VAATAFLVVVLSVALYTFTAVRIYEGTVR--ILI---ERD--
A0A1F2T595      -------YLQILYRRRY-AAITVFLATVVTVALFTFTATRVYEGSVR--ILI---ERD--
A0A2V8JQV5      -------YWRVFLNRKG-TVLIAAVLGTAIGLLISFPRTPIYQARTT--LEI---QGL--
A0A2V9AC41      -------YWLTIKRHRW-LIVMTALAILACAMLYLFTRIPLYTAEAT--VLI---ERK--
A0A2V8K4L4      -------YWRMVMRHKW-IVVLVAFLGTVAGILFTLPQTPIYQSSTS--LEV---QGL--
A0A2V8NCZ3      -------YWRMVMRHKW-IVILVAFLGATAGILITLPQTPIYQSTTL--VEV---QGL--
A0A2V9MAM9      -------YLRVLRRHSL-LLAVITAATVGAAFLVSIAQPRLYQSVAS--VEV---QGL--
A0A2V9M454      -------TWDILLKHQW-LILVTAFVLTLLVTVYSYKMKPVYRATAR--VDV---EAE--
A0A2V9IVR7      -------YWRMLVRHGW-TILTVAFVVTMLVALISFRLQPVYQATAR--VEI---EAA--
A0A2V9ILE2      -------YWRMLVRHGW-TILTVAFVVTMLVALISFRLQPVYQATAR--VEI---EAA--
A0A2V9LGY4      -------YWRMLVRHGW-TILTVAFVVTMLVALISFRLQPVYQATAR--VEI---EAA--
A0A2V9J4D6      ----------KSFRWRW--------LSWISVTIYTFKAERVYQATAR--LDI---EAE--
A0A2V9L9C5      -------RAIAVLRKRWWEVLSVAMVVLISVTIYTFKAERVYQATAR--LDI---EAE--
A0A2N9M9N1      -------YWEIL-RKRRSTVFAAAFLVTLLVTVVVYRMKPIYRATAR--MEV---QAE--
A0A2V9JEC4      -------YWHVL-KRRWPTVITVASAVTLLATLISLKMQPVYKATAR--LEV---KGE--
A0A2V9LPQ3      -------YWEIVYRRRWQIVAITVAAVTIMA-IYSFKVNPIYRATAH--VEI---EAE--
A0A348V070      -------YWHAVLRWKW-TGLTVAVLIVALTLVYILISPHIYTASGT--IWI---DE---
A0A2Z5G3A3      -------MGALVVRRRA-IIAGVTFAFLAIASLYCLLSTRRYMATGT--IQI---QKD--
A0A2V7UGP8      -------YWNVLKRRRW-VVFTAVVVLVITVTLGSFLIPPSYQAICT--LQI---ERE--
A0A239MKT6      -------VWEFLRRRKI-WIALGIVLGFLSGLAVYLHTPPLYTATAI--VEL---NKD--
A0A3E0PCN7      -------AIGVLRKYWL-MIVAITLLGSLAAVVYVAQKPDYYTATVR--IQV---NNE--
A0A2V8IYW3      -------VLDAVNRRKW-LLICPVLVFGIAAFLITRSLPNLYQSETT--ILV---VPQRV
G2LEI9          -------AFLTILRYKF-TVILCVVLTMTVTGLALSRMQPVYEASSH--IEV--------
A0A317J121      -------YWHLLRKYLI-LLSLFAVAGAAAGFFSVAFLNPVYQSRAL--LEV---Q----
A0A2V7YW66      -------YLGIARRHWK-LAAVCCLLGLAGAAVHYAITPKAFQATAT--IQI---ERR--
A0A2V7Z0V0      -------YLGMLRRHWR-LAAVCCALGLAGAGIHYAITPKAYQASTI--IQI---ERR--
A0A2V8GFD4      -------YLRILYKRRW-LCLAVFVLTLGSVVMYTFTATPIYEARTQ--ILI---ETE--
A0A2V8HSS5      -------YLRILYKRRW-LCLAVFVLTLGSVVMYTFTATPIYEARTQ--ILI---ETE--
A0A2V8KP55      -------YWRVIVTRRW-TVVAVFATIVLLTLIWTLKQKPMYAATIT--IQI---ERE--
A0A399WNU1      -------LLSILKKHWL-LVLSITLIGTFLVIVYEAQKPDFYEASVR--VQV---NNE--
A0A2V9CG11      -------YWRILIRHKK-MLLLVTLAGLIAAILIGLVQTPVYRARTS--LEI---QDF--
A0A2V2R0I6      -------YLLVLRKHQW-LILSFMLAVVTIVAIATFRMQPVYTATAR--IEI---DRE--
A0A2V8XAR9      -------YLLVLRKHQW-LILSFMLAVVTIVTISTFRMQPVYNATAR--IEI---DRE--
A0A2V8VZA0      -------YLLILRKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTR--VEI---DRE--
A0A1Q7CB82      -------YLLILRKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTR--VEI---DRE--
A0A2V8WIU1      -------YLLILRKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTR--VEI---DRE--
A0A1Q6Y9F5      -------YLLILRKHQW-LILSFMLAVVTIVAIATFRMQPVYVATAR--IEI---DRE--
A0A2V9EVV8      -------YLLILRKHQW-LILSFMLAVVTIVAIATFRMQPVYVGTAR--IEI---DRE--
A0A2V8YF91      -------YLLILRKHLW-LIVSFMLTVVTIVAIANFRMKPVYVATAR--IEI---DRE--
A0A2V8XZK2      -------YLLILRKHQW-LILSFMLAVVTIVAIATFRMQPVYVATAR--VEI---DRE--
A0A2V8ZTX6      -------YLLILRKHQW-LILSFMLAVVTIVSIATFRMQPVYVAIAR--IEI---DRE--
A0A2V9BT79      -------YLLILRKHQW-LIVSFMLSVVTIVSIATFRMQPVYVATAR--IEI---DKE--
A0A1Q8B793      -------YLLILRKHQW-LILTFLLTVVTIVSIATFRMKSVYVAPAR--IEV---DRE--
A0A2V9BCA0      -------YLLILRKHQW-LILTFLLTVVTIVSIATFRMKSVYVAPAR--IEV---DRE--
A0A2V9BWU9      -------YWRILRKYQW-SILSFLLTVVTFVTIATLRMHPVYEATAR--VEI---DNE--
A0A2V9DKX2      -------YWRILRKYQW-SILSFLLTVVTFVTIATLRMHPVYEATAR--VEI---DNE--
A0A2V9JSI3      -------YWNNLVKRRW-TVVTVAFVVSTVVAMVNFRMPPVYEARVS--VEV---EGE--
A0A2V9WI32      -------YGRILKKRKW-VVISTWLIIAILATVYALHMTPVYDATGR--IAI---NRE--
A0A2V8IVN9      -------YVRVLYKRRW-IAGTAFTVVMLLVTVYTFTVTPIYQATTK--LLI---ESD--
A0A1F2TPT3      -------YLAVLYKRRW-IAITALLVVLTFAINRNFTAVPVYEASVR--VLL---DAE--
A0A2V8JTQ2      -------MWRIIRDRKW-TIAAFALVVVGIVVTASLLMEPQYKAVGR--VVVVFHRDN--
A0A2V8UZY0      -------LWRIIQDRKW-TITAFALVVVAIVLTASYYMKPRYEAVGR--VVVVFHREN--
A0A3N5YNR8      -------YFQVLLKRKW-LIGLVVGAVLLLVGLQSFTTTPLYRATAR--VQI---DPE--
A0A350UEK1      -------YWRILRRRKG-TLIIGAVAGLLIGIASTLPRTPIYQAKTT--LEI---QSF--
A0A350UIQ4      -------YWRILRRRKG-TLVIGATVGLLLGIAVTLPQTPIYQAKTT--LEI---QSF--
A0A3N6A5T6      -------YWNVVLKRKW-LVLTVLVTVVVGTAVQTMTTTKVYRSTAR--VRI---DPE--
A0A1F2Q9L4      -------WLGVVRRRRL-LLILVAGLVAAISIVLYFMTPRQYRATTV--LQI---ERR--
A0A1H5SQF5      -------ALVILRKKLW-LIVGCVVVGVGLAVLLTSLMQRRFSSTVT--IEV---HKE--
A0A3E0NV31      -------LIESIRVRIF-TVVLVWLLTVVVMVVHVWTQTPLYRSTAT--LEI---EPK--
A0A3N5M5V0      -------YFQILRKRKW-LIVAVVTTVLVLVAVQSFTTTPLYRATAR--IQI---DPE--
A0A2V9AEW6      ----------------M-TLLGFAVVGLLASIMISLVQTPIYRVRTS--LEI---Q----
A0A2V8WQK6      -------YWHILIRHRM-TVLRFAVAGLLGAIVVSLVQTPIYRVRTS--LEI---Q----
A0A2V8XIF4      -------YWHLLAQHKM-TLLAFGVCGLVAAILFSFIQTPTYRVRTS--LEI---Q----
A0A3N5XQP8      -------YWEAIIKYRR-FVLLVLFLVVALVALETFTATPLYRASVR--VEV---DAE--
A0A2Z5G7H4      -------LRHIFRRRRR-VMVSCVGGCVALAVLVCVFCTRRYQAFGE--IQV---QKD--
A0A2V9L5B5      -------YWQVVLKRRW-TVLVCLLVVFTTVAIGTLKKRPVYEGKVL--LEI---NPE--
A0A2V9LK56      -------YWQIILKHRW-LLISTLLIVFSIVAVGTLKQKPSFQGSIL--VEI---DPD--
A0A2V9L7I0      -------YWQLILKRRW-TVLVCLLAVFTTVAIGTLKQRPVYVGKVL--LEI---NPE--
A0A522PPT0      -------YWHVMLKRRW-AVLTCLLIVFTTVAIGTFKQKPIYAGKIL--IEI---NPE--
A0A2V9KCS3      -------YWHMILRRKW-TVLIIGFVGTLSGFLVSLPQTPVYRSRTS--VEI---QAL--
A0A2U3KC61      -------YWQILRKRKW-AVLATFAIVFALSVIKTLRETRLYQATSK--VAI---FEE--
A0A2V9Y2R7      -------YWHVLRKRKW-AVLVTLIVVWVLSAVATMKQTRLYEAVSQ--LAI---FPE--
A0A372IT17      -------LLSILRRRRR-IVLGMVFALLLLVTLYCLLITPLYQATGE--IEI---QRE--
A0A136JPP4      -------YVRVVTKRLP-MIGAIAVVVTAAAAFYSFRQPSIYSASTE--MLI---EPR--
A0A399WUJ8      -------YVRVITKRLP-LIGAIAIVVTAAAAFYSFRQPSIYSASTE--MLI---EPR--
A0A2V9NGH6      -------YLRVLIKRKW-VVISSVVMIFVVVAIATLKATPVYDATGS--IAI---NKL--
A0A2V9PYE6      ---------------------------------------------------------M--
A0A2V9NL07      -------YLRVLIKRKW-IVVGTLAAIFGASLVATLRITPIYDAVGS--IAI---NKP--
A0A2V9QD92      -------YLRVLIKRKW-IVVGTLAAIFGASLVATLRITPIYDAVGS--IAI---NKP--
A0A2V9WPZ6      -------YLRVLIKRKW-TILFCLAGIFIMVAISSLKMTPVYEASGS--IAV---NKA--
A0A2V9ZLH4      -------YLRILIKRKF-VALSCVVVIFLLVLIATLRMTPIYDAAGS--IAI---NKL--
A0A2V9RQF1      -------YLRVLIKRKW-IVISSVTVIFGVVAIATLKSIPIYDASGS--IAI---NKS--
A0A2V9YDK8      -------YLRVLIKRKW-TIILCFSGIFIAVAIASLKMTPIYEASGS--IAV---NKT--
A0A2V9V8F7      -------YLRVLIKRKW-TVLFCLAGIFIMVAISSLKMTPVYEASGS--IAV---NKA--
A0A2V9XGR9      -------YLRVLIKRKW-TILFCLAGIFIMVAISSLKMTPVYEASGS--IAV---NKA--
A0A2V9V3Q5      -------YLRVLLKRKW-IIIACVVGIFAAVAIASLRQTPVFDAVGR--IAI---NKA--
A0A2V9NWS3      -------YMRVLIKRKW-VIISCLAIIFGAVSVVTMRSTRIYDATGS--IAI---NKS--
A0A2V9USA9      -------YIRVLAKRKW-VIFSCVAAIFAVVAIASLKMTPIYEANGS--IAI---NKP--
A0A2V9XW18      -------YLRTLIKRKW-IVIICLVTIFSVVAIATLKTTPVYEAGGT--IAI---NKP--
A0A4R1LC91      -------LWALLRRRRS-VVYGTTLVLFGAAILYCLLSTRRYEVTGE--VQV---QKT--
A0A3M2BZG9      -------YLGALQRRWP-LILIFCALAAAYSLVRYSLTTKMYQATAV--IQI---ERR--
A0A1Q7N5R7      -------YLTVVWRYRW-WILAATALGTIGGAAASRFLPPRYVAQAT--IWI---QTS--
A0A3M1SIV3      -------YLLVIHKRLP-LIIALVLVITTLTALYMYRQPSIYQATAI--LLI---EPP--
A0A3E0PHB0      -------YFNIVYKRLP-LILAATIIVTAAVAFYMFRLSDQYAAAAT--MIV---EPP--
A0A3M2D491      -------YLIIIYKRLP-MIIALVVIVTSLVAFYMYRQPSIYEARAV--LLI---EPR--
A0A357F267      -------YFNIVYKRLP-MILTLAIIVTAATAFYMYRQKSVYQATTE--MLI---EPR--
A0A353C9L6      -------YFRIVYKRLP-LIIAIVTIVTAAAAIYMYRQPTVYQATTD--MII---EPR--
A0A2V8RQV0      -------YFNIVYKRLP-LILALTILVTAAAAFYMYRQASVYQASTQ--LVI---EPR--
A0A2V8SJH5      -------YFNVVKKRLP-IILAITLLATVAAALYMYKQPSLYQATTE--MVI---EPR--
A0A2V9QB26      -------DWRILCRHTG-ILAGITLMGALAGVLLSIWQSPVYRARTA--LEI---QNI--
A0A2V9VYY4      -------YWHVLTKRKW-VVLPTFAIVFALSAIATLSETRLYQATSK--VAI---FPE--
A0A2V9KIE8      -------YWHLILKRRW-TVLTALLAVFLTVAIGTFKQKPGYSGTAL--LEI---NPE--
A0A352F549      -------YWKTIRKRLW-LIIGLALIVGSVTALRQARQPDIYQARAR--VQV---GTQTY
A0A3B9MLP9      -------YWQTIRKRLW-LIIGLALIVSTIAALKQARQPDIYQARAR--VQV---DTETY
A0A3D5SQ87      -------YWQTIRKRLW-LIIGLALIVSTIAALKQARQPDIYQARAR--VQV---DTETY
A0A2V8NW86      -------DWRILCRQKD-ILAWITFLGALAGVLLTIWQSPVYRARTA--LEI---QNI--
A0A2V8ZHL8      -------YWNIVNKRRW-TIATVAFIATLLVAIASFKMTPIYEATAR--LDI---EAD--
A0A2V9B240      -------YWNIINKRRW-TIVTVAFIVTLLVAIASFKMVSIYEATAH--LDI---EAD--
A0A2V9CBM2      -------CGHIVRRRLS-TILAVFFVVFVVIAIATLKQKPTYRAQVV--LEI---QKE--
A0A2V8XN17      -------YGRILRKRLP-TILVVFFILFTGILIATLKQKPVYRAQVL--LEI---QKE--
A0A2V8WX45      -------YGRILHKRLP-TILIVFFILFTTILVVTLKQRSVYRAQVL--LEI---QKE--
A0A1Q6YR79      -------YGRILRKRLP-TILVVFFILFTGILIATLKQKPVYRAQVL--LEI---QKE--
A0A1Q7VA32      -------YGRILRKRLP-TILVVFFILFTGILIATLKQKPVYRAQVL--LEI---QKE--
A0A2V9EY85      -------YGRILRKRLP-AILVVFFILFTAILIYTLKQKPVYRAQVL--LEI---QKE--
A0A2V9H8K0      -------YGRILRKRLP-TILIVFFILFTAILIATLKQRPVYRAQVL--LEI---QKE--
A0A2V9FFE5      -------YGRILRKRLP-SILVVFFILFTVILIATLKQRPVYRAQAL--LEI---QKE--
A0A2V9GM43      -------YGRILRKRLP-SILVVFFILFTVILIATLKQRPVYRAQAL--LEI---QKE--
A0A1F2RFI7      -------YWRVLRKRRW-TVLGLLLLVVVTVMIGTLKQKPVYRAKAV--LQI---DKE--
A0A1F2RZS3      -------YWRVLQKRRW-TILSILLLVVVTVMIGTLKQRPIYEAKTV--IQI---DRE--
A0A1F2USE2      -------YWRVVQKRRW-TILTIFFVFLTLVLLWTLKQKPIYGATVL--LEI---EKE--
A0A2V9C238      -------YWRVLRKRRW-TILTVFFVLFTVVLLGTLKQKPIYRAKAL--LEV---AKE--
A0A1F2Q9F5      -------YWRILRKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKAL--LEI---ERE--
A0A1F2QQH9      -------YWRILRKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKAL--LEI---ERE--
A0A1F2QXK7      -------YWRILRKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKAL--LEI---ERE--
A0A2V9DEM9      -------YWRVLRKRRW-TILTVFFVLFTVVLLGTLKQKPIYRAKAL--LEV---AKE--
A0A2V9CYQ5      -------CGHIIRRRLS-TILTVFFVVFVGIAIATLKQKPTYRAQVM--LEI---QKE--
A0A2V9BWU8      -------YGRILRKRFA-TVAIVFFLVFAGSLIATLKEKPVYRAQVL--LEI---QKE--
A0A2V8ZG48      -------YGRILRKRLP-TILIVFFLVFTVGLIATLKEKPIYRAQLL--LEI---QKE--
A0A2V8Y334      -------YARILRKRFS-TVLIVFFLVFAVTLIATLKEKPLYRAQVL--LEI---QKE--
A0A2V9AY68      -------YGRILRKRFS-TILIVFFLVFAATLIVTLKEKPVYQAQVL--LEI---QKE--
A0A257VBK0      -------WVQILWDQRF-WIAGVTAAVVILVALYTFLATPIYSATAT--VYV---QTY--
A0A2V7XDY0      -------YGNLLWKNRI-LLATAAVLGLALGLVIAFAQTPEYRASVM--VQI---DPP--
A0A350UQT3      --------VSRIDEEMW-KIGAFILVVLIATAVISLRLTPVYESTAT--LYV---DRQ--
A0A2U3JZ71      -------YLWILRRNWW-KMLLFVSCAVAATLMVSARLIPVYESTST--IDI---DRQ--
A0A2V8TTB0      -------YLWILRKHGW-TIAGFVVAAVLGTLIVSLRLTPVYESTVT--VDI---DRQ--
A0A1F2TCR2      -------RLSAVFKHRR-VAGAAFVIVVMAMMVQTYSTIPLYLATAR--VMI---EDE--
A0A2N9LQU7      -------IWLKIWKRRV-AASLFASGIFLAVILYTFLKKPVYESVAQ--IRV---DSS--
A0A2P6WFK7      -------ISRTIFKHKL-LILLTALTVFGIITLRTLTMTPVYESAVR--LQV---DPS--
A0A1F2V330      -------LLDIVMRRKL-FVLIPAAVLIVAVGIYTVYQPPLYRAQAL--LGV---EPG--
A0A2V8U914      --------MRVLYRRRV-TLLSVTLAGVFIAALLSMAQPRLYRSVAS--LEV---QGV--
A0A662EE63      -------YARLLWSRRW-LVLAVLLSTVVLTTAWSVTRPKLYRAATK--LIV---EPT--
A0A2V7W309      -------YWNVIRKRWK-VAAAIVLVVMIGTFLASYFSKPLYQSWIQ--IEV---EEE--
A0A2V8TLH7      -------YWRTISRGRW-TILSVFVVIVTLVAIGTFTQKPVYRARAT--VEI---TSQ--
A0A1Q7ZJT1      -------YWRTIWRGRW-TILSIFVVVFTLVAIGTFTQKPVYRASVT--VEI---TPQ--
A0A2V8VC99      -------YWRIIWRGRW-TILTIFVVVVTLVAIGTLTQKPVYRAQAT--IEI---SPQ--
A0A348UZU3      -------YIDIFYRRRW-TVISLTLIAVALSLIISFVTRPVYKARGT--VMI---EKE--
Q01XL7          -------YWKIAWGHKF-ILLLCIFAGALGGTAYVILKTPEYAAAST--VEL---IGF--
A0A2V8ERZ5      -------RLAVIYRYRR-ICAATFVLVSAALIIQGYSTVQMYQAQAR--LLI---EDE--
A0A2V8GTX0      -------RLAIIIKHWK-ACAAIAVLVIAGMMYQTFTTVPLYRAQAR--IQI---DEE--
A0A2V8J0X9      -------RLNAVFKHRR-LSGTAFVLVVTAMMVQTYSTIPVYEAWSR--VQI---QDE--
A0A523DUV7      -------GLRLLWVGKS-WILVIALLGLGVGFLATFLQVPIYSARAL--VQI---DPP--
A0A372IRG7      -------FRKIIIKRKW-VILFCVLVGVGIAFYHIFTTIPQYEAISR--MSI---DFS--
A0A1F2U158      -------RLAVVYRYKR-IALSVFLLTALALMIQGYSGEQVFQAKAQ--VLI---EDE--
A0A2V8F6S9      -------RLAVLYRYRR-IAITVFVLTTAALMIQGYSTTPMFEARAQ--IEI---DAE--
A0A4Q1SCH5      -------IFRAILKGKW-FILASTVLCGAIALIYITVTKPVYEADGI--VRI---DPN--
A0A2W0BGU4      -------YWNILLRRRW-SILAVVFLATLTATLASLKMKPVYKATAR--IEV---EAD--
A0A2W0BVQ9      -------YWNILLRRRW-SILAVVFLATLTATLASLKMKPIYKATAR--IEV---EAD--
A0A3D1ASD2      -------YVWVLRRHKW-KILGFVLACCIATLLVSTRLTPIYAATAT--VDV---DRQ--
A0A2N9MK30      -------YLWVLRRHRW-KILSFIGVSAIATLIVSARLTPMYEATVT--VDV---DRK--
A0A1I6MH75      -------ALMTLRKRKW-VLVACVLLGMVYGSYDAITQPRLYESHSR--IQV---RSG--
E8WVF6          -------ALITLRKRRM-VLIIAVVLGTLFGFYKSVTQIKPYEAYGR--LEV---NTG--
A0A1H5Z7N3      -------AWLTIRKRKY-WILAAALIGILLALYQSATQPRLFEAYGN--IEI---RSG--
A0A2V9YHT3      -------YWHILVKRKA-VVLITLAVVFALVAFRTYRTTPLYESTGR--VAI---YHE--
A0A1G7JVV8      -------ALNVLRKRKW-VLIIAAILGILYGVYQAATQPIVYVATGR--IQV---AKP--
A0A1H4T6W9      -------ALAVIRKRRW-ILIACAIVGILYGYYLASTQPIIFTATGR--IQV---HEA--
I3ZEU5          -------ALAVIRKRKW-ILVACAVIAILYGYYTASTQPIIYTATGR--IQI---HEA--
A0A5B9EBI2      -------AILVLRKRRW-VLLIAIAVGLAYGMYRSVSQPRLYIATGR--IEV---RSG--
A0A239HDF6      -------ALLTLRKRRW-VLIVAFVLGAAFGLYRAFFQPRIFEAYGR--IQV---RTG--
A0A4Q0T270      -------ALTTLRKRKW-VLILAVLIGFAYGYWKASSQPRLFEAYAR--IQV---RSG--
A0A1Q3QQB6      -------AILTLKKRRK-ILILAILLGLGYGIYKAQTQPKLYEAVGR--IQV---RSG--
A0A3N1K1G7      -------AIITLRKRRW-ILIVAVLLGLIYGVYKAETQPKLYEAYGR--IQV---RSG--
A0A428MDU2      -------ALITLRKRRW-ILITSVVLGIAYGVYKAETQPKLFEAFGR--IEV---RSG--
A0A4V2G466      -------TLITLRKRKR-ILLVFVLLGLIYGIYRAETQPRIYEAFGR--IQV---RSG--
A0A4Q7YNP3      -------YLRILSRHRW-MIFASAIAGILLSFLLSFASLPYYRARTS--LDI---QSL--
A0A2V9MN96      -------YWRILKKRKW-TIVATFAIILVLAIIATLRMPRLYEAASR--IAI---YPE--
E8UZE1          -------IYRLLKRRKW-LVLLIFLVFVAASALYTLRLPKRYEALCK--IDI---DLS--
A0A2V7V2Z1      -------YIYVILRRRR-LVLAVFLGVAALATFRSLLTRPVYEASAQ--ILI---ERD--
A0A2V7X2F7      -------YLAVVLRHRK-FALAIFLTATAVATIRTLLTRPVYMATAQ--ILI---ERE--
A0A2V7V2I1      -------YLHVVLRRRR-LVLAVFLTVAAAATVRTLLTRPVYEADVQ--ILI---ERE--
A0A2V7U3M2      -------YIYIVLRRRR-LVLAVFVAVTALATLRALLTRPVYEASAQ--ILI---ERD--
A0A2V7UHT0      -------YIYVVLRRRR-LVLAIFLGVAALATLRALLTRPVYEASAQ--ILI---ERD--
A0A2Z5FVL3      ---------------------------------MCILMTRRYTAVAE--IQV---QKP--
A0A1V6HR88      --------MKVFTARWR-LIALTTLLAIAGGVLAYLVTPKEYRATTT--ILI---ERR--
A0A2V9KBD6      -------LWRIIRPHKW-ITAGFTLAVVAIVTVASLVMKPQYDAVGRMVVVF---HRD--
A0A2W0AJ66      -------LWRVVRSRKK-IIAAFAVMVVSTVMTASFLMKPRYDAVGR--VLF---FRE--
A0A1Q7RBU1      -------LWRIIRNRKW-TIAVFALVVVAIVVTASLLMKPQYEAVGR--VVF---HRE--
A0A2V9JPV9      -------LWRIIRNRKW-VIALFALVVVAIVATASFLMKPQYEAVGR--VVF---HRE--
A0A3E0P0A3      -------YGSILLRGWK-VLIAFAVLGLALGIARYLSAPVVYSATSQ--IQI---ERR--
A0A2V8EXP2      -------YVKVLHKRRV-AALTAFLLVFVSTAVYTFTAKPIYESKVQ--ILI---EKE--
A0A2W4RYA1      -------YVRILYKRRW-LMASAFLTVMVAVALYTFTATPLYEARTR--LLI---DSD--
G8P0Y7          -------YWHILLKRKW-IVIVSVAIVLITTALISLHTTPIYEAVTK--ITI---SPP--
A0A5M8T4U7      -------VWRVVMKQRF-VILAVTIISFAAATVYSFRTKSVYESGGR--LQI---NPN--
A0A3P0X3W6      -------YMWLLRRAWW-KIALFVVTCTALTAVACFLMTPVYEATVR--LAV---DSK--
A0A1E3Y9R6      -------YLRVLYKRRW-VAIPGFLLVFVSGAIGSIRTVPVYEARTQ--III---EKD--
A0A2W4TLP2      -------YLRVLYKRRW-VAIPGFLLVFLSGAIGSIRTVPVYEARTQ--LII---EKD--
A0A3R9WF43      -------LLRVLRRRWR-SAVLVAVVIALLGTVAVLLMTPRYSATAT--IEV---NRE--
A0A317HKM4      -------YARIVYRRRW-IIFLIVVAGLIGGALYNWTAPRIFEAGAT--LQI---EGD--
A0A523E0N1      -------IYFVLLKHRW-PFVAVILATWMFAFISKYTETPYYRATAL--IQI---DWG--
A0A523ECP2      -------YWYIILKRRW-VILAVFISVLSYTAVKALMRQPVYSATTI--LQI---DRG--
A0A2W0C122      -------VVRLLHKHVW-IILGCTSLSVSVSVLYAMRQPRLYRATTN--IAI---DRD--
A0A2W0AUU7      -------VFRLLHKHLW-TIAACTSLALSISLLYAVHQPRLYRATAN--IAI---DRD--
A0A2W0BQL1      -------VFRLLHKHLW-TIAACTSLALSISLLYAVHQPRLYRATAN--IAI---DRD--
A0A4Q1SDL1      -------LSKIIRRRRR-TVYSIFGAILLLAILYCIFATRRYMATGI--VQL---QKD--
A0A3P0XH15      -------IRKILIKRKW-LILAGIVVGLAFAAVYILTTIPQYEAIAL--IDI---NEG--
A0A4R1LAZ7      -------VRKIFIRRKW-LLLAFALIGLGAGVLFLLMSVPLYEATAR--IDI---DPG--
A0A3M1WQW8      -------YWRIIKKRKW-IVLGVLMMVVTVVAIRMYRARPIYQASGK--VII---NQQ--
A0A3N1JHC1      -------YLLLLRRHRF-AVMMIFALCLLGGLLYAFFVPKSYKAQTV--LEI---TGI--
C1F294          -------LRKLFLKRKW-IILICVLAGIGVALYHVETATPQYEAVSS--VSI---DMN--
A0A2V9KA79      -------LVAIFKRRLW-LVLATTFVGTLCGGGASVLLPVRYRAQVL--LAA---ESA--
A0A522PSP1      -------YWGAIRRHAL-RIAIFVAATFLFTGIILLRLPRKYESTCV--IRL---DPS--
G8P085          -------IAQMLGRHKW-FILACIVIGTVVAVVYVKSVTPIYEATAS--IRI---DPG--
A0A4Q1SGQ1      -------LWQVMRRRRR-WVLWPTGAALLLATLYWLLATPRFQANGE--IEV---QRE--
Q1ILD9          -------LFRIIVRRRK-LLAAGVLLGILLATAYCILKTRRYEGEAT--VYV---HPE--
Q1IJZ6          -------VIRILRKRKN-LILGAAGACLACALLLSFVMRSYYNSSAT--IEI---QKD--
A0A2V8TCE6      -------FWSILVRRQW-AIYTVAGLVLGLTALRLLMVQSTYKAKAL--VEI---QRS--
A0A522TBE8      SGTPWVYYGRLLQRNLW-RLVTFVCVVTAVATLIALTRPKQYAAVTT--LQV---DAL--
Q1ITG0          -------VLYVLRRHLQ-MIIGVTAFGVLVAILFCLFMKPRYEGMAD--LNV---HPE--
A0A3N5PCI5      -------VFAVLYKRRW-IALFTFLIAAAGVVTYTMSVTPIYEAHTQ--LLL---QQR--
A0A3M1Q0S9      -------YWQIVVRRRW-LIVTCVLVATVAALVSSLLATPVYRATCT--LAI---ERT--
A0A2Z5G448      -------FRKILIKRQF-IILACLATGLILGAVITFFTTPVFESTAR--IDI---NPD--
A0A3M1VZ38      -------YWQILVRRRW-LIGTCVLVTTVAAAVSSFLATPIYKATTT--ISI---ERR--
A0A4Q1SD29      -------LRKVVFKRKW-IILACLLLGLGIGLYFALATIPQYEATAR--VHI---DFS--
A0A3M1PY35      -------LRRVLWQRRW-LVAAIALEVLLVGAVVTFLRTPLYEASAR--LII---EKT--
A0A3M1VMP2      -------VRKVLWQRRW-LVAAIAAEVFLLTALVTFLRTPVYTASAR--LLI---ERT--
                                                                            

A0A2V7VMF7      APTFMTVTD-------ALAGMGNYWQNADF--YNTQFRVLKS----KTLGSRVVERLK--
A0A2V7YYV7      LPSN-LGTSDPNVIPLTPDQI-----------LRTYALLLTQ----RKLLDEVIADLR--
A0A2V7Z0J5      KPAQLLPSTDPNAPSISATTI-----------LATYALFMTE----PPLLNKVIADLG--
A0A2V7Z3M4      RPAQLLPSTDPNAPSVSSATI-----------LATYALFMTE----PPLLNKVISDLR--
A0A399Y5V2      KRSSV----IADVAMPAEDPARE---------LQTQIQVITS----RPVAEETAKRLQ--
Q01X01          NENFLNLRDIFPTAAPSADSAVY---------VQTQAEMLQQ----DALLERVVKKLR--
A0A3M2D9H8      ----------------------------NLSDILNQNTELLS----QTFTELLVTRPV--
A0A2V8JK38      TPSLVNLRDYYQADSDTYVDYM----------LQSYFRILKS----RSLARRVVTELH--
A0A2V9IXG5      -------PFLPSPGADFNAQSSYYLNIDRY--FKTEKQKLTS----RRMHLLFAGRLK--
A0A2V9J2P4      -------PFLPSPGADFNAQSSYYLNIDRY--FKTEKQKLTS----RRMHLLFAGRLK--
A0A1Q7RLS4      SRKVSPVAEVAETGMAQYGWYAEERY------FNTQYEIIKS----RDVARRVFDRLD--
A0A2V2R525      SNPA---SGINGKPVVINNSASAPDY------FETQLEILKG----SGLLRRVVKTLD--
A0A321LPW6      VQA----VQGPSAAAVQDDS--DNFYPLVR--IKTYMIELKS----RPLLSDVAARLR--
A0A2V9R9V4      NGA----RINSNGLFIQEED-----YLNVT--MNTSEVILKS----LPLLEDVVVQLR--
A0A321LE75      NRT----LVKSGDVVISTDESDDAYYTSLV--MKTKIRTLMS----RPLLEDVVIHLG--
A0A2V8R8U7      PAPV---LATGQV--I-INAPADANF------WGTQLKLLQN----PQLARQVVLSLE--
A0A2V8QMP4      KGGV---LQTAGAGNL-IIRGSDPNY------WNTQLQKLKT----QKLARQVILRLD--
A0A2V8R4S3      KGGV---LQTAGAGNL-IIRGSDPNY------WNTQLQKLKT----QKLARQVILRLD--
A0A2V8NJ55      KKNI---LQTKEL--I-LNTGTDPYY------WNTQLKLLEN----PELARQVAITLD--
A0A2V8Q7I0      KQNV---LVSKDF--V-LNSQPDANF------WGTQITLLQS----PALARQVALTLD--
A0A2V8S6K4      RNAL---IKTKDI--V-VNAGADPAY------WGTQLKLLEN----PSLLRQVIMRLG--
A0A317I2L9      KSNI---LQSDKL--V-IGGQLDPNF------WGTQLKLLES----PALARQVALTLD--
A0A2V8LLF9      PQSV---LSTGNLIIS---GQPDPNF------WGTQLRLLQN----PLLARQVIVSLD--
A0A352FRF4      TPSI---LQSGNGGGI-VIGQSDPNF------WGTQLNLLHN----EALARQVIVRLD--
A0A2V8MKV0      PPNI---LSSSQIVIT----QRDPNF------WGTQIKMLQN----PSLARQVILTLD--
A0A2V8PYY8      PPNI---LSSSQLVIV----QRDPNF------WGTQIKMLQN----AQLARQVILTLD--
A0A1Q7YKQ8      HDSI---LKAGNNVVINTGGGDDAQY------WNTQIKLLES----QQLARQVALTLD--
A0A352F3R7      PMSV---LQTKE--IV-ITGQNDPNF------WGTQLKLLEN----PALARQVVLTLD--
A0A0B6WXT1      R-SV---LQTKGDVQV-VSVPNDPNY------WSTQIKLLQN----PQLARQVALTLD--
A0A3B9MEU8      PMSV---LQTKE--IV-INAQSDPSF------WGTQLKLLEN----PALARQVVLTLD--
A0A2V8MHG6      TANNPAIGALKGNSIFLNNPSQDPTY------FNTQIQILTS----AGLLGRVAKTLD--
A0A2V8P7N1      TANNPAIGALKGNPIFLNNSSQDPTY------FNTQIQILTS----AGLLGRVARTLD--
A0A2V8M3M6      TANNPAIGALKGNPIFLNNPSQDPTY------FNTQIQILTS----AGLLGRVARTLD--
A0A1Q7NJH5      TANNPAIGALKGNPIFLNYPSQDPTY------FNTQIQILTS----AGLLGRVAKTLD--
A0A2V8PJY0      TANNPAIGALKGNPIFLNNPSQDPTY------FNTQIQILTS----AGLLGRVAKTLD--
A0A1Q7Y6W9      N-INPALGTNR-NGVNINYRISDPAY------FNTQLQILNS----PGLLRRVVKTLD--
A0A2V8NC68      I-NNPALGSIKGNSIVLNTPYQDPTY------FNTQLQILSS----AGLLSRVVKTLD--
A0A399WK13      QVNPDL-VTTDRARPISNA---DPSY------FNTQLQLLWS----ESLLRRVVKEHN--
A0A352FLX4      NANPLLGGMSKNSNVILNSETNDPAY------FNTQLQILTG----PGLLRSVAKTLD--
A0A2V8RTL7      QTNPDL-ITNDRQRVLSNP---DPSY------FNTQLQLLNS----DTLLRRVVKEHN--
A0A3E0PCJ6      QANQDL-VTPDRRMPVMTS---DPAY------FNTQLQLLNS----EVLLRRVVKELN--
A0A3M1S4R8      QGNPQL-QVSDRPTLLPNP---DPAY------FNTQLQLLTS----DSLLRRVVKEMN--
A0A1Q7YFI6      VNNPGI-GAMKNTSYILEQQYQDPTY------FNTQIQILSS----PGLLSRVVKTLD--
A0A136KC10      QVNPDL-VTNDRARPISNA---DPSY------FNTQLQLLWS----ESLLRRVVKEHN--
A0A2V8SEX6      QVNQDL-VTSDRQRPISNP---DPSY------FNTQLQLLDS----ENLLRQVVKEHS--
A0A3M2D6Y5      QNNPQL-QVTDRPALLSNP---DPAY------FNTQLQLLTS----DSLLRRVIKEMN--
A0A0B6WWQ6      EDSALS-LSPTGGPVVINRS-SDPTY------FSTQLQILTG----SQLLRRVVRTLD--
A0A3B9MK99      NNAD---LVGKT-PYYFGPT-NDPVY------FNTQLQILGS----PGLMRRVVKTLD--
A0A352EX26      NNGA---LVGKT-PYYMGSM-NDPVY------FNTQLQILGS----QALARRVVKTLD--
A0A2V8MM59      NNPM---YEGKTTQLIYSPV-NDPAY------FNTQLQILTS----QGLLRRVVKTLD--
A0A2V8PFE8      NNPM---YAGKSVPMIYSPV-NDPAY------FNTQLQILTS----PGLLRRVVKTLD--
A0A2V8PWS6      NNPM---YAGKSVPMIYSPV-NDPAY------FNTQLQILTS----PGLLRRVVKTLE--
A0A2V8LCT5      NNPM---YAGKTAPMIVSPV-NDPAY------FNTQLQILTS----QGLLRRVVKTLD--
A0A352FTJ9      NNPM---YAEKAAPMIVNPI-NDPAY------FNTQLQILTS----PGLLRRVVKTLD--
A0A2V8G155      NPNVVNFKAVIDEDQTKA----------EY--YQTQYNIIQS----RAIARRALDELK--
A0A2V8HDM7      NPNVVNFKAVIDEDQTKA----------EY--YQTQYNIIQS----RAIGRRALDELK--
A0A2V8DRT9      KSNVVSFKEVIEQDKATN----------DY--YQTQYRILQS----RSLARRTLDRMG--
A0A2V7VYF3      APKVLNFKDVFDQGHSPY----------DYEFTETQQKLLTS----RSLARKTLDALR--
A0A1F2SVH2      ATNVVTFKEAYEQNQVTD----------DY--YQTQYKILQS----RALARRTLDALK--
A0A2V8AJG9      NTNVVTFKEAFEQNQIAD----------DY--YQTQYKILQS----RALARRTIDGLK--
A0A2G6PYV5      SMDVIGFTEKLQWNPYRE----------EY--FKTEFRIIKS----LPVAEEVARTLGVK
A0A2V8F956      NRNVVSFKAVLDEDQTRA----------DY--YQTQYNLLQS----RALALRTIDQLK--
A0A1F2S1W5      DPNVVSFQEVLEQNEVTD----------DY--YETQYRLLQG----RGLARRTIDALN--
A0A1F2T595      DPNVLSFQQVFEQSDGAD----------DY--YETQYRILQG----RGLARRTIDALD--
A0A2V8JQV5      NDNLLNTREVNPSAPSVISTAF------EE--IQTQIKILKS----DSLIGQAMKRFG--
A0A2V9AC41      APQILKVQDTRADSIDSGDYNN------EF--YKTQYEILRS----PALAERVIREEG--
A0A2V8K4L4      NENFLNLENLNPTSSPSGYLDPS-----YE--ILTQVKVFQS----RSLLQQTTERLL--
A0A2V8NCZ3      NENFLNMQNLNPTSVTGGW---G-----YE--IMTQVRVLQS----RSLMEKVTERLL--
A0A2V9MAM9      NENFLNLRDVNPTATAPTHSED------SY--IETQAEILRQ----DSLIGRAFNRLP--
A0A2V9M454      EPLLQSLNDLFR--TEQADD--------SF--LASQISILQS----DNLAWETIQQLG--
A0A2V9IVR7      TPEIRTLSDLFE--AMPADD--------MF--LQTQVNVLQS----DNLAWQTIEQLR--
A0A2V9ILE2      TPEIRTLSDLFE--AMPADD--------MF--LQTQVNVLQS----DNLAWQTIEQLR--
A0A2V9LGY4      TPEIRTLSDLFE--AMPADD--------MF--LQTQVNVLQS----DNLAWQTIEQLR--
A0A2V9J4D6      TPMNLSAESLYRNESTPADE--------TF--LLTQTQVLRS----DNLAWETIQQLK--
A0A2V9L9C5      TPMNLSAESLYRNESTPADE--------TF--LLTQTQVLRS----DNLAWETIQQLK--
A0A2N9M9N1      TPALQTLNELGP--SGATDA--------AF--LQTQVDLLQN----NNLSWQTMQELG--
A0A2V9JEC4      MPQLQTINEIDR--HAPVDS--------TF--LQTQVDLLQN----DSLMWQTIHRLD--
A0A2V9LPQ3      APLTMSVSDRFR--SMPADE--------AF--LKTQALVIGS----DHLAWETIGQLG--
A0A348V070      TQSVLPFEELSRLSGG------------IN--SQSHAMLLKS----RSLAADVIEKMK--
A0A2Z5G3A3      SSDALRLESMMQGGAADEDALDEN----IT--LQTQTNILQS----DSLALRVIEDLH--
A0A2V7UGP8      QPNVLTFQQVQPVGYDYMSYN-------DF--YQTQYRLLAS----HNVARKAMLKLD--
A0A239MKT6      SSSGLGLQELSGLSDSLSGGMELN----TD--MLTHQRILQN----DNTALSVISSLN--
A0A3E0PCN7      NNPAVGNDTSSSVILNSGSDP-------AY--FATQLQILEG----PGLLRRVVRTLG--
A0A2V8IYW3      PESYIRSTVT------------------NR--IEDRLRSIRE----QVLSRSMLEPII--
G2LEI9          APEKELYSSSGRIAFVPYSVDP------DY--LNTQIRKISS----PSLLVEVVKTLK--
A0A317J121      APTVTLFKNSGVSGNDEVSQ--------VN--IQTQIQLLRS----SSFLRRVMERLQ--
A0A2V7YW66      --NLTPLGNGGQNPWLENYWNM------EF--YPTQYELLQS----RGLAERVVKSLD--
A0A2V7Z0V0      --NLTPLGN-TQNPWLENYWNM------EF--YPTQYELLQS----RGLAERVVKSLD--
A0A2V8GFD4      NPNVVSFQEVVDQNKTTL----------DY--YQTQYRILQS----RAIARRSIADPF--
A0A2V8HSS5      NPNVVSFQEVVDQNKTTL----------DY--YQTQYRILQS----RAIARRSIADPF--
A0A2V8KP55      TPSLVNLRDYYQADSDTYVD--------YM--LQSYFRILKS----RSLARRVVTELH--
A0A399WNU1      SNPAAGEGTASSIILNPGSDP-------TY--FATQLQIIEG----PGLIRRVVKNLD--
A0A2V9CG11      NENFLDLKSVDPTVTADDYTTGA-----SY--FETQVKLLQS----ESLLERVIEKLN--
A0A2V2R0I6      NSNILPFQGPEAYDFYSDSE--------SY--IETQSKILTS----ETLALQTIRNSG--
A0A2V8XAR9      NANILPFPGADSYDYMMDLE--------NY--IETQSKILTS----ETLALQTIRNTG--
A0A2V8VZA0      NANILPFQGTDSYDYMMDLE--------NY--IETQSKILTS----ETLALQTIRNNA--
A0A1Q7CB82      NANILPFQGTDSYDYMMDLE--------NY--IETQSKILTS----ETLALQTIRNNA--
A0A2V8WIU1      NANILPFQGTDSYDYMMDLE--------NY--IETQSKILTS----ETLALQTIRNNA--
A0A1Q6Y9F5      NANILPFQGAESYEYMMDLE--------NY--IETQSKILTS----ETLALLTIRNNA--
A0A2V9EVV8      NANILPFQGAESYEYMMDLE--------NY--IETQSKILTS----ETLALLTIRNNA--
A0A2V8YF91      NANLLPFQGADPYDYTVDFD--------NY--IETQAKILTS----ETLALQTIRNGG--
A0A2V8XZK2      NANILPFQGADSYDYMVDSE--------NY--IETQAKILTS----ETLVLQTIRDSG--
A0A2V8ZTX6      NANILPFPGGESFDYMVDSE--------NY--IETQAKILTS----ETLALQTIRNNG--
A0A2V9BT79      NANILPFQGADSYDYMMDSD--------NY--IETQSKILTS----ETLALQTIRNNG--
A0A1Q8B793      NANFLPFQPADPYAYLLDQE--------NY--IETQSKILTS----ETLALQTIRSVG--
A0A2V9BCA0      NANFLPFQPADPYAYLLDQE--------NY--IETQSKILTS----ETLALQTIRSVG--
A0A2V9BWU9      NTNFLPFK-SDSYEMYMDME--------NY--IETQSKILQS----ETLALQTIQSAG--
A0A2V9DKX2      NTNFLPFK-SDSYEMYMDME--------NY--IETQSKILQS----ETLALQTIQSAG--
A0A2V9JSI3      APEVQSISNFYRGTPSDE----------AF--LRTQVKVLES----DSLAWQTIQQLG--
A0A2V9WI32      NSVNLGFKDSDQGTIGADYEDYN-----IA--LETQIRILQS----DALAFQVIKNLK--
A0A2V8IVN9      SPNVVSFKEVINEEQTKA----------DY--YQTQYNILQS----RSLARRTLETLK--
A0A1F2TPT3      RLNLVNVEDVIDQR--------------RP--LDTELAILRS----RWLAAKTVASLG--
A0A2V8JTQ2      DSGVLGFRGADTSLLDDPEDR-------TA--IDTQIRILQT----DALAMQVIKNLQ--
A0A2V8UZY0      DSGVLGFKGVDTSLLEDPEDR-------AA--IDTQIGILQT----DALAMQVIKDLH--
A0A3N5YNR8      SASILPYQPLNESAERYLSSE-------IY--LQTQLEILQS----RALARRVVDRLN--
A0A350UEK1      NQNFMNMGNLQEVTEGSGPAGNM-----VD--LQTQIKILQS----DTLVDRVTAQLS--
A0A350UIQ4      NQNFMNMGNLQEVTEGAGPSGST-----ID--IQTQIKILQS----DTLLERVHSLMN--
A0A3N6A5T6      STNILPYEDVYQAADQGIAME-------TY--LQTQFKILQG----RTLAERIVKQLQ--
A0A1F2Q9L4      PTSAAAMQQPMQIDDWFDAQ--------SF--YPTQYRLLQS----RGLAERVVKNLR--
A0A1H5SQF5      GGTSLSLEDLSGAGQQLIGGDQLS----VD--LLTQQAVIGN----ENIAMKVLEDLG--
A0A3E0NV31      -QNLLPYQDLSARGGDQ-----------SN--IETQITLLRS----GNLLAKVVERLE--
A0A3N5M5V0      SENILPYKDVYEGPERYLSSE-------VY--LQTQLEILQS----RALARRVVDRLN--
A0A2V9AEW6      GTNFQEMKGID---SNGNYVSQE-----SY--VETQVKLLQS----ESLIEHVIDKMK--
A0A2V8WQK6      GPNFPEMKGAN--DSNGSYASPE-----SY--VETQVKILQS----ESVIEHVIDKLK--
A0A2V8XIF4      STNFVEIKGGDPSGSTASIASPE-----SY--VETQVRRLQS----ESLLERVIDKLK--
A0A3N5XQP8      PAKVLPYQEIYQVAMDPRSME-------SD--LRTQYSILQS----RTMARGVIKRLN--
A0A2Z5G7H4      SSDALGLD--SMMGGAEDASDALDAN--IT--LQTQADLLES----DTLALQVIEALE--
A0A2V9L5B5      EPQVLNFREVSQEAPTVDVD--------SY--RETQYKILRS----RTLAEKVVNDLH--
A0A2V9LK56      PPSVVNFKEILQVASA-DVE--------SY--RETQYRVLES----RSLAESVVKDLE--
A0A2V9L7I0      EPQVLSFKEVTQAAPTVDVD--------SY--RETQYKVLQS----RTLAEKVVNDLR--
A0A522PPT0      EPQVLSFQQIAQAGPSWDLQ--------SY--RETQYQILKS----RSLAERVVRDLR--
A0A2V9KCS3      NDNLMNTR------QIDPTPGTNDMYVQTD--ILTQIKILQS----DSLMERVVTKLK--
A0A2U3KC61      NPNVLGFK------DVENNLP--DFDYQAT--LETQAAILRS----DVLALKVIKAMH--
A0A2V9Y2R7      NLNALGLK------DGDGGSPGEDWDYNVT--LETQTAILRS----DALALKVIETMH--
A0A372IT17      PSGAFGLDNGVLGDTSHEASDALENS--MS--IETQAGILES----DTLALHVIRALD--
A0A136JPP4      KAAPTAKDAININFGLDET---------TY--YNTQLQLLQN----PDLMKKAVVALG--
A0A399WUJ8      KAAPT--DAININLGGDET---------TY--YNTQLQLLQN----PDLMKKVVLALG--
A0A2V9NGH6      DPALISFKDSANA-GPDYYDP-------SD--LDTEVGILKS----DLLAFQVIKQLN--
A0A2V9PYE6      DPALISFKDSPSV-GPDYYDP-------SD--LDTEVGILKS----DLLTFQVIKQLN--
A0A2V9NL07      DPMLQNLRDPGNS-GMDYYDP-------TD--LDTEVRILHS----DLLALQVIKQLN--
A0A2V9QD92      DPMLQNLRDPGNS-GMDYYDP-------TD--LDTEVRILHS----DLLALQVIKQLN--
A0A2V9WPZ6      DPGLVNFKDSGSM-SIDYYDP-------AD--LDTEVKILQS----DLLALQVIKQLN--
A0A2V9ZLH4      DPSFINFKDSASA-S-DYYDP-------AD--LDTEVKILKS----DLLALQVIKQLN--
A0A2V9RQF1      DPALLNIKDSANA-PIEYYDP-------AD--LDTEVRILKS----DLLALQVIRQLN--
A0A2V9YDK8      DPGLVNFKDSGSV-SVDYFDP-------AD--LDTEVKILQS----DLLALQVIKQLN--
A0A2V9V8F7      DPGLVNFKDSGSM-SIDYYDP-------AD--LDTEVKILQS----DLLALQVIKQLN--
A0A2V9XGR9      DPGLVNFKDSGSM-SIDYYDP-------AD--LDTEVKILQS----DLLALQVIKQLN--
A0A2V9V3Q5      DSNLVTFKDSMPV--MDYYDP-------TD--LDTETRILQS----DILALQVIRQLN--
A0A2V9NWS3      DPALLNFKDSPSA-AVDYSDP-------TE--LDTEVRILKS----DLLALQVIRQLD--
A0A2V9USA9      DST-LNFQNSATF-SLDYYDP-------TE--LDTEVKILQS----DLLALQVIKELN--
A0A2V9XW18      DTT-LNFQNSATF-SLDYFDP-------TE--LDTEVKILQS----DLLAMQVIRELN--
A0A4R1LC91      -----PADSLGLDVSGNGGAGGDALDANIT--METEANILQS----DTLALKVIKELH--
A0A3M2BZG9      --QLATIA------MGGATNWLEEWWNLEY--YPTQYRLLRS----RGMAERVIQNLH--
A0A1Q7N5R7      GGNGPERGPIGANQLLVASAW-------TD--LLKSYVVLDA----VARERRLYLQARPR
A0A3M1SIV3      KPKIQSKDTININFGYDL----------NY--YNTQEKLLES----PELMKEVVVKLG--
A0A3E0PHB0      KPKATDSQSVILNFGYDQ----------NY--YNTQLQLMRS----EDVMRDVVVKMK--
A0A3M2D491      RPKIQSKDTININFGYDM----------NY--YNTQEKLLES----PELIKEAVIKLG--
A0A357F267      KPKVTSKDSININFGNDA----------NY--YATQLQLLQN----ADLMRRVVVDLG--
A0A353C9L6      RPKVTSKDAININFGQDA----------NY--YQTQLMLLRN----RDLVKQVVIDLG--
A0A2V8RQV0      KPKVTSKDSININFGNDA----------NY--YNTQLELLKN----PELMKKVVISLG--
A0A2V8SJH5      KPKVQSKESININFGNDA----------NY--YNTQLELLQS----HDLMKEVVIRLG--
A0A2V9QB26      NEDFLNIK------QVTPVSEGNSSTALTE--IATQVRLLQS----ESLIKRVLTKLK--
A0A2V9VYY4      VPNVLGFKDAENI-APDYEYE-------AT--LETQVAILRS----DALALKVIEGMR--
A0A2V9KIE8      PPNVLNFK--EVLQISNQDVD-------SY--RETQFRVLES----RTLAERVVRDLA--
A0A352F549      SPALGASRGESFYPENGYMEP-------EY--FNTQVQILTS----PTLLRRVAKNLD--
A0A3B9MLP9      SPALGASRGGSYYVDNTYMDP-------EY--FNTQVQIISS----PTLLRRVAKTLD--
A0A3D5SQ87      SPALGASRGGSYYVDNTYMDP-------EY--FNTQVQIISS----PTLLRRVAKTLD--
A0A2V8NW86      NEDFLNIK------QVNPVSEGDSSTVLTE--IATQVRLLQS----ESLIKRVLTKLR--
A0A2V8ZHL8      TAQIQSFN--DLY-RQVPTDE-------AF--IGTQIQVLES----DNLAQRTIEQLG--
A0A2V9B240      TPQIQSLN--DLY-RQVPTDD-------AF--IGTQIQVLES----DNLAQRTIEQLG--
A0A2V9CBM2      NPDIPTIQ--ELY-QLETVSD-------DY--LRTQYDILAS----DSLARRVIDQLR--
A0A2V8XN17      NPDIPTIK--EMY-ELDAVSD-------AY--LRTQYSILAS----ESLARQVIDQLQ--
A0A2V8WX45      NPDIPTIK--ELY-ELEAVSD-------AY--LRTQYNILAS----ESLSRRVIEQLR--
A0A1Q6YR79      NPDIPTIK--EMY-ELDAVSD-------AY--LRTQYSILAS----ESLARRVIDQLQ--
A0A1Q7VA32      NPDIPTIK--EMY-ELDAVSD-------AY--LRTQYSILAS----ESLARRVIDQLQ--
A0A2V9EY85      NPDIPTIK--ELY-ELDAVSD-------AY--LRTQYSILAS----ESLARRVIDQLQ--
A0A2V9H8K0      NPDIPTIK--ELY-ELDAVSD-------AY--LRTQYSILAS----DSLARHAIGQLG--
A0A2V9FFE5      NPDIPTIK--ELY-ELDAVSD-------AY--LRTQYSILAS----ESLARRAIDQLR--
A0A2V9GM43      NPDIPTIK--ELY-ELDAVSD-------AY--LRTQYSILAS----ESLARRAIDQLH--
A0A1F2RFI7      SSNIFSFK--DFVADIDPFDE-------SY--LETAYKVLQS----RTLARRVIDKLQ--
A0A1F2RZS3      SPNILSFQ--GFVAEMNPYDD-------SY--LETAYKVLQS----RSLAYRVINKLN--
A0A1F2USE2      NPGLATVQ--ELF-ELDAVSD-------TY--LETQYKILGS----ESLARRVINQLR--
A0A2V9C238      NPNILTVQ--ELF-ALDTVSD-------TY--LETQFKILQS----DTLARRVIEGLR--
A0A1F2Q9F5      GPNILTVQ--ELF-QIESASD-------TY--LETQYRILES----ESLARRVVDQLR--
A0A1F2QQH9      GPNILTVQ--ELF-QIESASD-------TY--LETQYRILES----ESLARRVVDQLR--
A0A1F2QXK7      GPNILTVQ--ELF-QIESASD-------TY--LETQYRILES----ESLARRVVDQLR--
A0A2V9DEM9      NPNILTVQ--ELF-ALDTVSD-------TY--LETQFKILQS----DTLARRVIEGLR--
A0A2V9CYQ5      NPDIPTIQ--ELY-QLETVSD-------DY--LRTQYDILAS----DSLARRVIDQLR--
A0A2V9BWU8      NADIPTIK--DLY-ELESVSD-------SY--LKTQYTILAS----DSIARRVIDQLH--
A0A2V8ZG48      NPDIPTIK--DLY-ELESVSD-------SY--LKTQYSILAS----ESVARQVIDQLH--
A0A2V8Y334      NPDIPTIK--DLY-ELESVSD-------SY--LKTQYSILAS----ESVVRRVIDQLH--
A0A2V9AY68      NPDIPTIK--DLY-ELESVSD-------SY--LKTQYSILAS----ESVARRVIDQLH--
A0A257VBK0      S--RQPMSGF------NPTGASSWMEEQKF--YNSQQQIMTS----SVVMQDVVDKLK--
A0A2V7XDY0      T--PTFMSV-------QEALGGGYWQNADF--YNTQFRVLRS----SALGEKVLDRLK--
A0A350UQT3      E--AKGIVGQE-----SQANVPSALDAESF--LASQIRLLQS----DSVVRPVAQRFR--
A0A2U3JZ71      M--PSAIIG-------QESTRTVANDSDQF--LATQAKLIQS----DSVLRPVAQQYR--
A0A2V8TTB0      M--PTGVLG-------PESLQNATNDADQF--LATQMKLIQS----DSVLRPVVDKFR--
A0A1F2TCR2      R--SIAVANL------NANDPMFWQDSTQY--YNTQYSILKS----RVLGQRVVRRLH--
A0A2N9LQU7      Q--QGSLGLEDL----VSQKLADSDSEGGR--LQTELTILQC----PPVSMQVIKNLD--
A0A2P6WFK7      R--SSSLGLDEM----ISQKLGGSDDINSV--LQTEVKVIQS----DTVAMRVIDSLE--
A0A1F2V330      A--RNY----------VQTMDGSVARVQDQ--LLTIREVLFS----RPVLEPVMRNFH--
A0A2V8U914      N--ENFLNLRDI----DPAATPNASSNDVY--VKTQSEILQQ----DALIEQASDKLN--
A0A662EE63      SSINNN----------QFDAFVSYWQLDRY--ISDQVQVLET----DRLAKRVVDQLG--
A0A2V7W309      S--QNVT---------IEDLFGIASSDQEF--LQTQYELLKS----RGLAMRVIEDHK--
A0A2V8TLH7      A--SKVAPVADVSQ--LGTSNFGWSAEERY--FNTQNEIIKS----RDVAQRVFDKLD--
A0A1Q7ZJT1      S--RKVSPVAEVAE--TGMAQYGWYAEERY--FNTQYEIIKS----RDVARRVFDRLD--
A0A2V8VC99      S--RKVSPVADVAE--MGASQYGWFAEERY--FNTQYEIIKS----RDVARRVFDRLD--
A0A348UZU3      ---PNILSFEDIFQ--------IETFRDDY--FQTQYKLLQS----RSLAERTIERLK--
Q01XL7          N--QSFMNMSQVD---PQAGTDMTTASASN--IQTQTRILTS----RSMLARVAERMS--
A0A2V8ERZ5      R--STAVPGL------QNDANQYYEDPEPY--YQTQYKILKG----RDLTRRVVRKLR--
A0A2V8GTX0      Q--TTAQVDF------KQPELVY-SDPEPY--YQTQYKILQG----RDLALRAVKRVK--
A0A2V8J0X9      R--TTQVGTL------NASDPAFWQESGPY--YQTQYSILQS----RGLGRRVVRKLD--
A0A523DUV7      G--QNISQLSNP----YPTSAFNYFDYRNY--YNTQYRIIRS----KSLGERSIEKLD--
A0A372IRG7      R--STNIGIEDI----IESKLSGGEESDQK--LQTELRIMQS----DSVVMDVINSLD--
A0A1F2U158      R--STAMPGI------AAAD--YYQDPIPY--YNTQYRILRG----RDLARRVVKRID--
A0A2V8F6S9      R--ATALPGI------TTPDNTYYEDPEPY--YKTQYRIIKG----RELTRRVVKKLN--
A0A4Q1SCH5      R--SGTLGLTDALL----------GANSDE--VPTEIGILGS----AQVALSALEMLT--
A0A2W0BGU4      T--PQTQMLNDRYQ--------QLQTDQDF--LRTQIQVLQS----DNLAWRTIEELR--
A0A2W0BVQ9      T--PQTQMLNDRYQ--------QLQTDQDF--LRTQVQVLQS----DNLAWRTIEQLG--
A0A3D1ASD2      M--PTNVLG-------QDSGRAPVNDADEY--LATQINLIKA----DSVVRPVVQKLR--
A0A2N9MK30      V--PTAVVG-------QDSTQTGLNDADQF--LATQIKLIQS----DAVLRPVADQYH--
A0A1I6MH75      A--SNEYRVSA-----VPGM-GQDTQTK----MNTEIAIMQS----DTLLLTVARELN--
E8WVF6          A--SNQFKLSP-----FSGL-GDDPQQK----MMSEIAIITS----DTLLTTVAKEMN--
A0A1H5Z7N3      A--SNEYKIGA-----ATGGSGIESSSA-H--LPTQVSILKS----DTLLLTVARDLD--
A0A2V9YHT3      S--QTLTGFKD-----SVPIDADDWDYTVA--METQVRIMQS----DSLALKVAHDLG--
A0A1G7JVV8      N--GQASLGVA-----TGNLTGSLQSED----LETEVLIISS----ESLMLSVAQEMN--
A0A1H4T6W9      N--STAT-----------QMMGSSLSQETN--LENELGIIMS----DSLLLNVARNMN--
I3ZEU5          N--SAAT-----------QLMGSVGSQETN--LENELGIITS----DSLLLNVARNMN--
A0A5B9EBI2      S--SNEYRLTT--------VGAPDTSNH----LTTQSSILTS----ETLLLTVARELN--
A0A239HDF6      S--ADQYKLTS-----PVGL-GQDTMTQ----MMTETAILQS----DTLLLTVAKDLD--
A0A4Q0T270      S--SNEYKVSA-----STGI--SDPQTK----MMTEIAILQS----DTLMLTVAREMN--
A0A1Q3QQB6      S--SNEYRLSA-----VQALGGTDTASK----MLTEIAILRS----DSLMLTVARDMN--
A0A3N1K1G7      S--SNEYRVTA-----VQGYAGDAQSSR----MLTEIAILQS----DSLMLTVARELN--
A0A428MDU2      S--SNEYRVSA-----VQGYASDTAASK----MLTEVAILQS----DSLMLTVAREMD--
A0A4V2G466      S--SNEFRVSA-----VPGMASDS-GQR----MLTEVAILQS----DSLMLSVAREMD--
A0A4Q7YNP3      N--SDFMNMRAV----APTGEGNGSSAETN--VQTQIKLLQS----DTLLQRTKARLA--
A0A2V9MN96      N--SNVLGLKDL----ENGGMSEDWDYNVS--LETQLSILRS----DALALKVVEALH--
E8UZE1          T--PKSVLA-------LDSQSTASVATEQK--MATQLSILES----QSIAWKVIEELK--
A0A2V7V2Z1      T--PSVLTFKEVAQ--------VDAARDDY--YQTQYKLLQS----RALVRRVIESMS--
A0A2V7X2F7      K--SNVLSFKDVTE--------VDAAKDDY--YQTQYRLLQS----RSLARRVVESLN--
A0A2V7V2I1      N--PNVLTFKEVAR--------VDSERDDY--YQTQYKLLQS----RALVRKVIEEMD--
A0A2V7U3M2      T--PNVLTFKEVAQ--------VDAARDDY--YQTQYKLLQS----RLLARRVIETMN--
A0A2V7UHT0      T--PNVLTFKEVAQ--------VDAARDDY--YQTQYKLLQS----RALARRVIESMN--
A0A2Z5FVL3      N--SDSLTLDSNAAS-PAGGDTDPNSASMN--LETQATVLES----PALAMKVIEDLH--
A0A1V6HR88      L--SIPVQS-------AVEAAWENYYSMEF--YPTQYRLLQS----RGLAERTVQNLR--
A0A2V9KBD6      ND-SGVLGFKG-----VDTSLLEDPEDRAA--IDTQISILQT----DALALKVIQDLR--
A0A2W0AJ66      DEGAGVLGFKG-----PGSSLPEDADERAA--INTQIGILES----DGLASQVIHDLH--
A0A1Q7RBU1      ND-SGVLGFKS-----VHPSLLEDPEDRAA--IDTQIGILQT----DALAMQVINDLH--
A0A2V9JPV9      ND-SGVLGFKG-----VDTSLLEDPEDRAA--IDTQIGILET----DTLAMQVINDLH--
A0A3E0P0A3      A--PNLL---------GGQMFAQPWWNPEF--FPTQEQLLKG----RGLAEAVTRDLA--
A0A2V8EXP2      N--ANVVTFKEVFE--------QNQVADDY--YQTQYKILQG----RALARRTLDALR--
A0A2W4RYA1      ---PNIVSFEGVVD--------QEQAQPDY--YTTQINLLRS----RLLARRTIEALD--
G8P0Y7          T--SNPLNFKD-----NNSSSSALEDPQAG--INTQVKILQS----DTMAELVIHRMN--
A0A5M8T4U7      V--PKVGLQ-------GYGDQERSSADTSA--IQTELLILQS----DSVLLQTAEKLD--
A0A3P0X3W6      V--PASVIG-------QDSATPNISDVEEF--LTTEIDLLQS----DAVLRPVAKAYH--
A0A1E3Y9R6      A--RRNTSIN------TVLEERESWYQDDF--YPTQYRVLQS----RTLAQRTARVLA--
A0A2W4TLP2      A--RRATSIN------TVLEDRDSWYQDDF--YPTQYRILQS----RTLASRTAAAIE--
A0A3R9WF43      D--HEEASGPR-----TDTPSDSADDLKAE--VQTDTSILQS----DGLVLRVIKDLD--
A0A317HKM4      T--NILALDRPLVD--------QRDWMSTF--LPTQVGILMS----ADLARTAHDELT--
A0A523E0N1      K--INVV---------QDVMINPSRTYADI--YGTQEKIVNS----RQLAEHVVEDLE--
A0A523ECP2      R--INLVQDVMVQD--------YWSGYDEF--YPTQQRVLMS----RNLSRRIVKHLR--
A0A2W0C122      S--NATVPLNKAFA----SALGDADDYSVS--LETQIRVLAS----RSLAEVVVRKLD--
A0A2W0AUU7      S--NAGVSLNKTFA----SPLGDADDYSVS--LETQIHVIAS----RSLALAVVRKLD--
A0A2W0BQL1      S--NAGVSLNKTFA----SPLGDADDYSVS--LETQIHVIAS----RSLALAVVRKLD--
A0A4Q1SDL1      T--DSGLSMSDLQNNAAAGGGDDALAANIN--LETQSQILQS----DTLALRVIEDLN--
A0A3P0XH15      Q--QSNIGISELVQ----QEQGGIEADLTR--TATEIAIMQS----DTVSLDVINSLD--
A0A4R1LAZ7      R--STNIGINDLIE----QKLTGGEGSSDR--MQTEIRIMQS----DSVSMAVINSQD--
A0A3M1WQW8      T--PVPLAN-------RQEALPYSSNDTQY--LRTQINVLQS----RTLARRVIEELS--
A0A3N1JHC1      N--QDFMNTR------DADPYANGVTQDSY--LETQIMLLKN----EVVADRVAMVMA--
C1F294          K--STGVELT------SLASSSGGLQSQDR--VETQLHIMQS----NTIAWNVIKTLK--
A0A2V9KA79      P--TRDYLRL------------GGYGDAIH--IQDQLRIIKEHLYKPALLERIIREFG--
A0A522PSP1      V--PVSVVN-------NQPGTVSLDSMDVL--FATATKEIIT----PAVVTPAILKLG--
G8P085          R--IGSLGLADLTG--------TQADSAEL--IATEMAIIKS----DAVAIDTMHSLS--
A0A4Q1SGQ1      S--AAAFGLDNSVNGEPSQAEGDSLDYSMT--LETESKILES----PTLALRVMHDLE--
Q1ILD9          G--SDVLGSMPDLG--LS----SGMDWNSQ--LATQIKILQS----DALAWDVVKRLR--
Q1IJZ6          Q--DASLGSALDTL--ASTVGGGSGDTKTE--VQTQVAILQS----DDLAIETIERTG--
A0A2V8TCE6      S--PDVLAFR-DII--RTDP--SYQGYSAF--YETQYRILQS----RAVARRAAERLD--
A0A522TBE8      G--AQVVGDE-HLQ--RA----STADSDAL--VLTDQTVMTS----PAVLLQVVEQLH--
Q1ITG0          E--SAALDMG-ALG--DLATGAGGLDWSSK--LETQARILKS----DTLAWDVISQLR--
A0A3N5PCI5      A--SIVTFEG-AAD--PQA------NERGY--LETQHRLLRS----RSLARRVIDALN--
A0A3M1Q0S9      G--VRVLRET-LSS--AEP---SWLDYQNW--YNTQYQIMQS----DEVLRRAVDLLD--
A0A2Z5G448      R--STNLGIS-DLL--NSKA--GGNDESTR--LLTEARILQS----DSVIFAVIESEN--
A0A3M1VZ38      G--VRLLNTS-LTA--TEP---SWLDYQNW--YNTQYRIISS----DAVLRYAVKQLD--
A0A4Q1SD29      R--SANIGIE-DLI--QQQLG-GGGNAEDK--LQTEVEIMQS----ETVAMEVINSLD--
A0A3M1PY35      M--PRVLDSE-DVV--SAPV--GFFDTERF--YQTQYLLMRD----PAVLERALDNDG--
A0A3M1VMP2      T--PRVLDTE-DVV--PMVW--NEYEIQRF--YQTQYLLLRD----PAVLRDALDRYG--
                                                       .                    

A0A2V7VMF7      -LDD-------RPPF---------------------------------------------
A0A2V7YYV7      -LKT--------------------------------------------------------
A0A2V7Z0J5      -LKT--------------------------------------------------------
A0A2V7Z3M4      -LNT--------------------------------------------------------
A0A399Y5V2      -LNV-------PPE--------------AIQA----------------------------
Q01X01          -LED-------RPEYQRSSSLWDRLRPGTSQA----------------------------
A0A3M2D9H8      -LEA--------------------------------------------------------
A0A2V8JK38      -EEL-------EKEFAAPQRGFLAAQAGNLKKISSVEKTEQASDDEG-------------
A0A2V9IXG5      --QQ-------NPRFQN-------------------------------------------
A0A2V9J2P4      --QQ-------NPRFQN-------------------------------------------
A0A1Q7RLS4      -LYN-------HPLF---------------------------------------------
A0A2V2R525      -LEH-------NKAFFRPQM-GQRTTWQRLLDMVGMGRDSGDSSQPV---DDGVLMTSSV
A0A321LPW6      -LDQ-------RPEFLAAED--RRGVWSAIKSIGGRSALREAGESPPEQ------ASDAA
A0A2V9R9V4      -LDQ-------NPAFL-ASQ--KKSVWESLHEIAGKIQRDDASAPPAVF------TATAM
A0A321LE75      -LDH-------NPQFMEVTR--KKSLVEAVQTIGSKFKQEVTSELPVLE------PGVQI
A0A2V8R8U7      -LQK-------NPSFLGGQA--QSSVFASLKRIFSGERIATPPAQNPA--AEQTVTMDEM
A0A2V8QMP4      -LQN-------SPAFFGTNR--GTGVIAGLRHIIARGKPTPTPQPAAG--GVPVLSDAEL
A0A2V8R4S3      -LQN-------SPAFFGTNR--GTGVIAGLRHIIARGKPTPTPQPAAG--GVPVLSDAEL
A0A2V8NJ55      -LQN-------NPTFFEGQA--SSGFFASIRRIFFGDKPAPAHVD-----KVPVVVNPTI
A0A2V8Q7I0      -LQH-------NPTFFGGQS--QGGIFASIKRMFAGDKAKPKISAPGPT-GLDVVRAAQL
A0A2V8S6K4      -LQN-------NPSFLGGQS--RPSIFTTLRRAFSRNKAQTNEQPQPADGGLTVANEAAP
A0A317I2L9      -LQH-------NPNFFGGGS--QGGFFASLRRILSGDQRRTKAKPAEPT-KLELVGESQL
A0A2V8LLF9      -LQH-------NSRFLSGQA--QTSIVASLKRIFSRENAPAS-SPSTNA-TVEPISEEDL
A0A352FRF4      -LPH-------NPTFFGPQG--QSTIFASLKRIFSRDSVPKT-SPTPAA-GSVPLNEEAL
A0A2V8MKV0      -LPH-------NPNFLGGRA--NSGLFNSLKYLFSRTKIAPAPAPAASS-GEQTITQDEL
A0A2V8PYY8      -LQH-------NPNFLGGRA--NGGLFNSLKYLFSRTKNAPSPAPATGS-SETTMSEDEL
A0A1Q7YKQ8      -LQN-------NSAFLGNQS--QHGLFTALRRIFSSERTTNA-SPATRT-NLPVISPERV
A0A352F3R7      -LQH-------NPAFFGGQT--QGGVFSSLRRIFSKPKKATV-APAAPA-GLVVVGESEV
A0A0B6WXT1      -LPN-------NPAFLSGQA--GPSLTSSLRRILSRRKKEEN-E---QG-KLQVVTDSEV
A0A3B9MEU8      -LQH-------NPAFFGGQS--QGGVFASLRRIFAKPKKASE-SPAVSS-GLTVVGESEV
A0A2V8MHG6      -LEH-------NEGFLHPQSATRPSVWESLKGLVGLSKSQSKPREPE-G------YVLRP
A0A2V8P7N1      -LEH-------NQAFLHPQSAQDLSFGESLKGLIGLRKSQSKTKEQE-G------YVLRP
A0A2V8M3M6      -LEH-------NQAFLHPQSAQDLSFGESLKGLIGLRKSQSKTKEQE-G------YVLRP
A0A1Q7NJH5      -LEH-------NQAFLHPQSAQNLSFWESLKGLIGFKKSQSKTKEQE-E------YVLRP
A0A2V8PJY0      -LEH-------NQAFLHPQSAQNLSFWESLKGLIGFKKSQSKTKEQE-E------YVLRP
A0A1Q7Y6W9      -LEH-------NQAFVHPQSQSNRSTWQSILQMIGLSRSSTQEQNQQ-A-SQDIPLTTNV
A0A2V8NC68      -LEH-------NQAFLNPQSFNKRSTWDSIKRMFGLSDKKEREQEQK-L--DDAPLVDRI
A0A399WK13      -LDA-------NKEFQAAAKASSGSMLGRLLRSVGLASGDKQKQEES----VPIDPNSTL
A0A352FLX4      -LEH-------NPDFLRETSSKNKSTWLDIRGMLGLKAKTPPQSSTP----DVLPQSSSS
A0A2V8RTL7      -LDA-------NKDFQAAKNAHGTSAWRSMMKAVGLASDKSSNSPDANT-QKSEETNSSL
A0A3E0PCJ6      -LDT-------NEAFRKDSAEGSGSALRGMLTALGLASDDSKKEDVVE--EVPLASNTEL
A0A3M1S4R8      -LET-------NKEFQEERNRQQASTWRAILRSIGLAREETKKTRDLE--EV--LAGMNL
A0A1Q7YFI6      -LEH-------NQAFLNPQAAQSRSTWENLKRMFGFGRPANNQQSVP-Q-NMMPLVDSSL
A0A136KC10      -LDA-------NPEFQALARTDSTSTFGRILRSVGLASGETQKSEQLA----AIDPNSTL
A0A2V8SEX6      -LDT-------NKEFLTARSEG-TGILRAMLRAVGLA-SDPKKDTAPND-EFAASANSSL
A0A3M2D6Y5      -LDT-------NKEFQEEKNQQRASAWRAFLRSIGLVREERRKEDTKID-EITPGMN--L
A0A0B6WWQ6      -LEH-------NPEFLRPRAVRDLSPWLNLRRMLMLGTGQEKSAGQRGT-RGQMPLPSEI
A0A3B9MK99      -LEH-------NPDFFK-GTIQKRSTWQTIKRMAGFASADPPDVTAK-P-KDELQLRPAV
A0A352EX26      -LEH-------NPDFFK--GTQKRTTWQTVKMMAGFDNNVPKPDQSK-P-NDVLQLRTTV
A0A2V8MM59      -LEH-------NKGFLSPQSSQPHSTWQTIMQMSGFANPDPK-AGKQ-S-KE-LPLTTSF
A0A2V8PFE8      -LEH-------NQAFLRPQSLRQPSTWKTILQMWGVSGPEKKDPSTQ-P-KE-LPLTSTV
A0A2V8PWS6      -LEH-------DQAFLRPQTLRQRSTWKTILQMWGVSGPEKKDPSTQ-P-KE-LPLTSTV
A0A2V8LCT5      -LEH-------NQAFLRPQTAQPHSTWKTILQMLGVGGREKKETKQQ-N-NV-LPLTTSV
A0A352FTJ9      -LEH-------NQAFLRPTAAQPHSTWKTIVKMLGAGA-EKKDTVPA-P-NV-LPLTSAM
A0A2V8G155      -LWN-------TPPFGGTAP--------------ADSPFSLRRVIALVHTTNAGPPPPPP
A0A2V8HDM7      -LWN-------TPPFGGTAP--------------ADSPFSLRRVIALVHTTNAGPPPPPP
A0A2V8DRT9      -AW-----------------DTFDSAKAPKKMSIRTAVASVVAPVFHLFVARKAIEPEQT
A0A2V7VYF3      -MWQ-------HPYFGGPTPNTTSSSSTRGAIGFTNGILALVRGAFQSKAETIGREKRAP
A0A1F2SVH2      -LWD-------HPQFNPKPDDSLTMRK------IALAPVVLVAGWFKPAQPL---EPPLP
A0A2V8AJG9      -LWE-------HPLLKPN-DDNLTVGK------IAAAPAAFVSSWFRTAAPV---GMPGS
A0A2G6PYV5      YFREQEQEDAQPKNL------------------------LDLGTVNEPREKTQKTKEDQA
A0A2V8F956      -LWE-------TPPFRNDKRFSLKRMMLGAPALVGQYAVSGISRTGDAASDFSGTGGSAA
A0A1F2S1W5      -LWS-------HPQFTQPARPTVRSVIMMPVNAVARWFEPPRPVEPPDAAET--------
A0A1F2T595      -LWR-------HPSLNQPPRLTIRGILFWPVGKLASWFEPARPPQAADAAET--------
A0A2V8JQV5      -LTH-------SADPLTRLTRWRIALGIAKTSAA--------------------------
A0A2V9AC41      -LQN-------LPLFGGKADKADSQKGLVANLKDGLKERVKGFVPDKPKVNAPPPDPA--
A0A2V8K4L4      -KEK-------KTGY------------------------GTSTDRLAAWRKVLHIAPKQA
A0A2V8NCZ3      -NDK-------KTPY------------------------GTSSDRLAAWRKVFHLSSKPA
A0A2V9MAM9      -AER-------RGGLVLPGWSERLLPVFAPRSPGG-------------------------
A0A2V9M454      -LAR-------LPNS----------------------------GQTSPADGRVLGTPPA-
A0A2V9IVR7      -LGE-------NPAF----------------------------APPLKGASPQRGESAE-
A0A2V9ILE2      -LGE-------NPAF----------------------------APPLKGASPQRGESAE-
A0A2V9LGY4      -LGE-------NPAF----------------------------APPLKGASPQRGESAE-
A0A2V9J4D6      -LAD-------DPSF----------------------------TKGPQKQRKESIDSAD-
A0A2V9L9C5      -LAD-------DPSF----------------------------TKGPQKQRKESIDSAD-
A0A2N9M9N1      -LANGNTELGVGGDL----------------------------WPVSTSRSTVA------
A0A2V9JEC4      -LES-------RPEF----------------------------NPRRTASSKSQLESLPP
A0A2V9LPQ3      -LAE-------NGAF----------------------------IPQTPKDASGQRAPEPR
A0A348V070      -LHS-------HPEF------------------------IAPKLPVKLQKEGVQPDNP--
A0A2Z5G3A3      -LDK-------TPDFESKFNPIDMVLGI-----------FSPGGASDPPGASLQQSP---
A0A2V7UGP8      -LRN-------DPVVNRLVNR------------------VRHKGPFTRLAEIVRHSPLDE
A0A239MKT6      -LMQ-------EPPYNEIPKG------------------KLHDVYERERSLPLKDAP---
A0A3E0PCN7      -LEK-------NPEFLQPNQGE------QSTVWQNVLKMFGFYQTKSMTPVEFADKETED
A0A2V8IYW3      ------------------------------------------------LEFDLYPEQRKQ
G2LEI9          -LDR-------DPKFLATGPTTLSAALLDLIRSPRGPRKPPQSETKSAELPEASPTPATT
A0A317J121      -LET-------VPPP------------------------PVQNDIFSRLRRRLTTNTQDP
A0A2V7YW66      -LME-------DPAF------------------------NPGAAARKDGGRGPTAEDDD-
A0A2V7Z0V0      -LME-------DPAF------------------------NPGAA--REGAKGGTAEADE-
A0A2V8GFD4      -LAT-------NAQLSGGGRQMFDLQSLFNSVVAYVNGKMTGEAYSKSTAVDET------
A0A2V8HSS5      -LAT-------NAQLSGGGRQMFDLQSLFNSVVAYVNGKMTGEAYSKSTAVDET------
A0A2V8KP55      -EEL-------EKEF----------------------------AAPQRGFLAAQAGNLKK
A0A399WNU1      -LEH-------NPTFFRPGKDQDTTVWQNVARMFGLYSQPVRNQAESAPPAKNTLDLKTD
A0A2V9CG11      -L-------------------------------------REARKSHSIVRRMLRLSNSQH
A0A2V2R0I6      -LSA-------RPEF------------------------STPTGPSEAVAIGTL----AN
A0A2V8XAR9      -LSA-------RPEF------------------------SSPNGPSEAMASGSL----AN
A0A2V8VZA0      -LST-------RPEF------------------------SSPNGPSEAVASGSL----AN
A0A1Q7CB82      -LST-------RPEF------------------------SSPNGPSEAVASGSL----AN
A0A2V8WIU1      -LST-------RPEF------------------------SSPNGPSEAVASGSL----AN
A0A1Q6Y9F5      -LST-------RPEF------------------------SSPNGPSEAVASGSL----AN
A0A2V9EVV8      -LST-------RPEF------------------------SSPNGPSEAVASGSL----AN
A0A2V8YF91      -LSD-------RPEF------------------------SGPGGPSEAVASGSL----TN
A0A2V8XZK2      -LTA-------RPEF------------------------SVGGGPSEAVASGSL----AN
A0A2V8ZTX6      -LAL-------RPEF------------------------AASGGPSEAVASGNL----AN
A0A2V9BT79      -LAL-------RPEF------------------------AESGGISEAVANGNL----AN
A0A1Q8B793      -LAG-------HPDF------------------------SEGGKPSEAVTTGSL----AN
A0A2V9BCA0      -LAG-------HPDF------------------------SEGGKPSEAVTTGSL----AN
A0A2V9BWU9      -LVE-------LPEF--------------------------GGQPGKASKPASVPVNAAN
A0A2V9DKX2      -LVE-------LPEF--------------------------GGQPGKASKPASVPVNAAN
A0A2V9JSI3      -IDQ-------SAEFSPPRGGKPVSPA---------------------------------
A0A2V9WI32      -LDN-------NPAF---------------------------------------------
A0A2V8IVN9      -LWE-------SGEFVTNKR-------------------GIVQTLAGGVASLFGKKAPEP
A0A1F2TPT3      -LIQ-------NEPVAGRGAGNGVGKRDGQAGKSGPDGWWSAASLFVSRAFGGFPPPPRA
A0A2V8JTQ2      -LDK-------NPKFTARGGRA--------------------------------------
A0A2V8UZY0      -LNK-------NPKFTGRVEQP--------------------------------------
A0A3N5YNR8      -LAN-------DPRFSVPVREGVVTSQLSWLKRTVSNLRPGRSDAPKTGADESGAGR---
A0A350UEK1      ------------------------------------------NG---TTPAEPAA-PGRL
A0A350UIQ4      ------------------------------------------PGEEVAAPAEPASTPSRI
A0A3N6A5T6      -LHE-------NPSFNAETSGGLLTDSLAGLIGGTIALLKGRQPETPDSAENRLDKDE--
A0A1F2Q9L4      -LAD-------DPVF------------------------NPGRSRLPGGSGGAVTASDDA
A0A1H5SQF5      -LTN-------SQPFLA----------------------LRPANATASGQSLLETDP---
A0A3E0NV31      -LTT-------RPEFVRSVDRG----------------------------FFLDAAEAGL
A0A3N5M5V0      -LAN-------DPRFEVPVREGLVTSQLGSVKKAMSGLFSKSDSGAAAANRESMPGM---
A0A2V9AEW6      -LHK-------EQPTT-----------------------AWGIFASRVHRLFAFSRTGRL
A0A2V8WQK6      -LQK-------ERPRT-----------------------GWRGLASRVQRIFAFSKASNL
A0A2V8XIF4      -LRK-------ERPAT-----------------------GWRAFESRVQRFFDLSKTPHL
A0A3N5XQP8      -LTN-------ERLLQLREKSGVISETLRQVMRAVRGVIDRLIDEGGPGGQN--------
A0A2Z5G7H4      -LET-------TRDYQPRYDALGSIFRL-----------LSPSGPADPLNASLENSP---
A0A2V9L5B5      -LYQ-------SPEFYRNRGLF-----------------GLYESDPEKIPS-SDPGPPDT
A0A2V9LK56      -LYR-------LPEFYRSRRLF-----------------GLFESDPARIPSPTED--LDP
A0A2V9L7I0      -LYL-------SPEFYRNQMFF-----------------GLFESDPEKIPSISQPGLPDT
A0A522PPT0      -LYR-------YPEFYQSRSFL-----------------GLVAKDPEKIPSASDPNPPDP
A0A2V9KCS3      -LDK-------KPAA------------------------LEQPTKLSAWRKALGLPQPAA
A0A2U3KC61      -LDP-------NPQ---A---------------------EDAMQPDPARE----------
A0A2V9Y2R7      -LDK-------DPRFVGS---------------------TAASQPNPGAQGLSELKPNND
A0A372IT17      -LES-------TQNFFPAKKRGLTIPGWIFFW----------RSPLEPRSVPLEEAP---
A0A136JPP4      -LQR-------EPDLFGS--SN---RGFFASIKSLFVSPKSPETPKGALPVLTGTENADP
A0A399WUJ8      -LQR-------DPDLLGQ--SD---RGFFATIKSLFSGPAKAQAPQGTLPVLTGTENADP
A0A2V9NGH6      -LDK-------RPEF------------------------GGSGQ-AQSTSLELTTDILQP
A0A2V9PYE6      -LDK-------RPDF------------------------GGSGP-AQSTSLGLTTDILQP
A0A2V9NL07      -LDQ-------MPEF------------------------GGHGA-PPASSLALTTDAFEA
A0A2V9QD92      -LDQ-------MPEF------------------------GGHGA-PPASSLALTTDAFEA
A0A2V9WPZ6      -LDK-------RTEF------------------------GGKPD--SASSLNLAPDPLQT
A0A2V9ZLH4      -LDR-------RVEF------------------------GGKGDMPSPNALGITTDELQI
A0A2V9RQF1      -LDK-------RPEF------------------------GGKGE-SSGNSLALTTDALQP
A0A2V9YDK8      -LDK-------RSEL------------------------GRKPD--DASSLNLAPDPLPT
A0A2V9V8F7      -LDK-------RTEF------------------------GGKPD--SASSLNLAPDPLQT
A0A2V9XGR9      -LDK-------RTEF------------------------GGKPD--SASSLNLAPDPLQT
A0A2V9V3Q5      -LDK-------RPEY------------------------GGQSA----PQPNLVADPLQN
A0A2V9NWS3      -LDK-------RAEF------------------------GGNGQVPSPNSVQLTTDSLQV
A0A2V9USA9      -LDH-------SGGP------------------------NGRAP----SSLELTPDPLQV
A0A2V9XW18      -LDR-------RPEI------------------------AGQAPPIPSPSLDLT-DPLQI
A0A4R1LC91      -LES-------SPDFKPMF-NP---IGWALGL-------VSPKGPADPPNAPLEDSP---
A0A3M2BZG9      -LLQ-------DPTFTGR---------------------SADLLPGAADATTVDD-----
A0A1Q7N5R7      DMAV-------MATFAVADQYR---PGR-----------YHLKVDRTGQHFSLQDEDGTE
A0A3M1SIV3      -LYR-------TPDLIIR--RN---SGITALFKSIFESEKDK---QEQIVLPVINESDFQ
A0A3E0PHB0      -LYE-------KDSLYGG--KS---RGIFETLGAMFTGGPKN--SEEAGALPVVDSVD--
A0A3M2D491      -LYR-------NPELFKG--QG---RGVIASIKSLFSGGSDE--PSKTQSLPVLSENN-D
A0A357F267      -LYR-------EPDLFGD--GD---RGFFAAVTSIFSSTKEEEKEKEADSLPIVSDTA-E
A0A353C9L6      -LYR-------EPNLFGA--SE---RGILASLRSIFTGSGQN--AEVPSALPVVSEPE-L
A0A2V8RQV0      -LYR-------NKTLFGG--QN---AGILAGIKSLFSRSKAQ--TEEANALPVISDTE-Q
A0A2V8SJH5      -LYK-------EADVFGE--ED---RGLLSGVRSMFSSRKAN--SGPDNSLPVVSELP-A
A0A2V9QB26      --DR-------FPEDPKVRTSR---FSLWRKA-------------------SLPETKPSD
A0A2V9VYY4      -LYQ-------DPRFTAVKQSS---PES-----------------------AMGEPSMQP
A0A2V9KIE8      -LYR-------SPEF-----YR---KSILF---------GLMETTPANVPSPTDNAPPDV
A0A352F549      -LEH-------NRTFLDGRVEN---RSTWRSLLTMFGFSQKQAEAPKNQN-VLPDVNSSP
A0A3B9MLP9      -LEH-------NRTFLDSHVDN---RSTWQSLMRMFGLGSNPKNSAVAENGALPDRGNQP
A0A3D5SQ87      -LEH-------NRTFLDSHVDN---RSTWQSLMRMFGLGSNPKNSAVAENGALPDRGNQP
A0A2V8NW86      -DRF-------AEDPKVKTSRF---SLW--------------------RKAVLPELKLSD
A0A2V8ZHL8      -LA-----------------RE---PGWVLAA-------GSGNDGLPAQP----------
A0A2V9B240      -LA-----------------RD---PAWALAV-------GLGNDVPPVQL----------
A0A2V9CBM2      -LDT-------VSEF-----NA---PQLFS-W-------KWKKKAPTSQTFTVGPIPA--
A0A2V8XN17      -LEA-------LPEF-----NS---PRWWQFW-------PSKKKSPPPQTFTIGPVSEAR
A0A2V8WX45      -LDT-------LPEF-----NS---PRWWQIW-------PKTKKPSTAQTFAIGPVPAGG
A0A1Q6YR79      -LET-------LPEF-----NS---PKWWQFW-------PRNKKSPAPQTFAIGPVPETR
A0A1Q7VA32      -LET-------LPEF-----NS---PKWWQFW-------PRNKKSPAPQTFAIGPVPETR
A0A2V9EY85      -LET-------LPEF-----NS---AKWWQLW-------PRKKKSPAPQTLAIGPVPEAP
A0A2V9H8K0      -LET-------LPEF-----NS---PRWWRFW-------QERRKPSTTQTLATGPVPEVR
A0A2V9FFE5      -LET-------LREF-----NS---RKWWQLW-------PETRKPSTTQTFTVGPLPQVR
A0A2V9GM43      -LET-------LREF-----NT---RKWWQLW-------PETRKPSTTQTFAVGPVPQVR
A0A1F2RFI7      -LDK-------LPEY----DEK---PSW---F-------AKLLSKSRSESQQLPAEDLAL
A0A1F2RZS3      -LAH-------SPEFAKEQESS---PSW---L-------GTLWPGGAEQPEGPLSPEEQL
A0A1F2USE2      -LDQ-------RAEF-----NP---PQPWWSW-------GGKETAAAAPTLVVGTSEPEQ
A0A2V9C238      -LDK-------LEEF-----NP---RASQLGD-------AKPQNAAAAQSFTAGDT--ER
A0A1F2Q9F5      -LDQ-------LAEF-----SR---PGFRLRG-------GKRETPASPQTFAVGAAGVAR
A0A1F2QQH9      -LDQ-------LAEF-----SR---PGFRLRG-------GKRETPASPQTFAVGAAGVAR
A0A1F2QXK7      -LDQ-------LAEF-----SR---PGFRLRG-------GKRETPASPQTFAVGAAGVAR
A0A2V9DEM9      -LDM-------LEEF-----NP---RASQLGD-------AKPQNAAAPQSFTAGDT--ER
A0A2V9CYQ5      -LDT-------VSEF-----NA---PPL-LSW-------KWKKKAPRSQTFTVAPIPA--
A0A2V9BWU8      -LDS-------LPEF-----NA---PKW-WSL-------KRFARAPQKQAFALGPAPVAH
A0A2V8ZG48      -LDT-------LPEF-----NR---PKW-WQF-------GKRLSLPRKQTFALDPVRPGQ
A0A2V8Y334      -IDA-------LPEF-----NS---PKW-WQF-------RKKAFKPRNQTFALDQESSAR
A0A2V9AY68      -LDS-------LPEF-----NK---PKW-WQL-------QERFFTPHKQTLALDPAGRAR
A0A257VBK0      -LQS-------HEAFKDVKDP---------------------------------------
A0A2V7XDY0      -LKD--------------------------------------------------------
A0A350UQT3      -LLE-------SEQQ------------------------------------------LAK
A0A2U3JZ71      -LLD-------TEAEGS----------------------------------------DAT
A0A2V8TTB0      -LRE-------VEKDAL----------------------------------------EQP
A0A1F2TCR2      -LQD-------NPAFNGQAPPRRGPLIAVRNARASLGKAIRRLITRPIQTPAVEP--AAP
A0A2N9LQU7      -LGH-------REEFAGKTLMASVTAID-----------------------------PVK
A0A2P6WFK7      -LAK-------RPAFAGK-YAASAKLTN-----------------------------PSA
A0A1F2V330      -L-------------------------------------------------------LPM
A0A2V8U914      -LAE-------RPEFQPHSGFWERLREA-----------------------------SPR
A0A662EE63      -LAS-------LPEFEGRKPGP--------------------------------------
A0A2V7W309      -LLN-------DRDFYGPGVEGK----------------------------------TKA
A0A2V8TLH7      -LYH-------HPMFRKSSDP---------------------------------------
A0A1Q7ZJT1      -LYN-------HPLFKKSVDS---------------------------------------
A0A2V8VC99      -LYN-------HPLFKETTDP---------------------------------------
A0A348UZU3      -LWE-------KKEFSGGKNVTG----------------------------------EDL
Q01XL7          -LEM-------TPIASTPTTFFTKLRAHIPF--------------------------AQK
A0A2V8ERZ5      -LDT-------VPEFNGTKPAPPTASTLLQEAKDKIIGIAKP------NAPAEA---PKV
A0A2V8GTX0      -LED-------VPEFNGKGAKPPLLTQVISDLKAKIAAPFRG------QTAAPP---PRP
A0A2V8J0X9      -LQN-------SPLFNGSAPPPRDPLSLARQGRAAASAWLRGLIVKPPPAAAAP---PAP
A0A523DUV7      -LAD-------KPPFRDAKEPG--------------------------------------
A0A372IRG7      -LYH-------RKPFSDMFAKQPY---------------------------------TGH
A0A1F2U158      -LQN-------VAEFNGTAKPAETPVTKARDAGDRLLRFLARTPTPIAEV-------PKP
A0A2V8F6S9      -LQD-------RAEFNGTERPRPTPFSMLREAEQRIVRLVRPAKEEPTEA-------PKV
A0A4Q1SCH5      -PEQ-------FQNYAGFSRSQMVFRLEDDQH-------------------------RPI
A0A2W0BGU4      -LAD-------NRMFADES--------------------------------------RVT
A0A2W0BVQ9      -LAD-------NRMFADES--------------------------------------RVI
A0A3D1ASD2      -LRE-------VDGNDLME--------------------------------------NTS
A0A2N9MK30      -LRD-------LERK------------------------------------------ARA
A0A1I6MH75      -LPN-------NSDFLEIK-G--KAPH------------------------------ASL
E8WVF6          -LAN-------NPTFLSVK-G--PIPH------------------------------SSM
A0A1H5Z7N3      -LAN-------NPWFLGTQKSKQAQPH------------------------------RNI
A0A2V9YHT3      -W---------DKAFAPANAG--AIPL------------------------------DSK
A0A1G7JVV8      -LAN-------NPDFMG------SGPY------------------------------RNI
A0A1H4T6W9      -LVN-------NPDFMGGK----AARF------------------------------RDI
I3ZEU5          -LIN-------NPDFMGIR----VGKV------------------------------RDI
A0A5B9EBI2      -LNN-------EPAFLGVR-P--PVPV------------------------------TSL
A0A239HDF6      -LCN-------NPAFLGRKTA--PEPR------------------------------RDL
A0A4Q0T270      -LAN-------NPEFLGVK-G--KVPH------------------------------ASL
A0A1Q3QQB6      -LAN-------NPDFIGKD-A----PH------------------------------GNI
A0A3N1K1G7      -LSN-------NSEFLEVK-G--PLPH------------------------------TNL
A0A428MDU2      -LSN-------NPEFLEVK-G--PVSH------------------------------TTL
A0A4V2G466      -LAN-------NPDFLGGN-A--PSTR------------------------------ASI
A0A4Q7YNP3      -AEP-------HSATTPRLDLASRLIGMLHLP-------------------------ISV
A0A2V9MN96      -LDS-------NPRFTGFVPVANDASRSIGSA-------------------------NLG
E8UZE1          -LDA-------NPVFSGITSSATPKP-------------------------------LNS
A0A2V7V2Z1      -LLQ-------DPEFGGPRSAEEIEAVKA----------------------------ASP
A0A2V7X2F7      -LLQ-------DPEFGGPRSPEEVKGALA----------------------------APP
A0A2V7V2I1      -LFQ-------DPEFGGPQPAEQRAALKA----------------------------SAP
A0A2V7U3M2      -LLQ-------DPEFGGPRSPEEMEAVKA----------------------------AAP
A0A2V7UHT0      -LLQ-------DAEYGGPRSPEEIEAVKA----------------------------AAP
A0A2Z5FVL3      -LED-------TSAFKPHFTFTGWV-----------------NSLFSPPPPADPAGVALS
A0A1V6HR88      -LDQ-------DPAFNPARASLAGSDEGG----------------------------SAA
A0A2V9KBD6      -LDQ-------NPMFI-----------------------------------------GGA
A0A2W0AJ66      -LE--------NGKFD-----------------------------------------GGK
A0A1Q7RBU1      -LDK-------NPKFA-----------------------------------------GRA
A0A2V9JPV9      -LDT-------NPNFA-----------------------------------------DRA
A0A3E0P0A3      -LWN-------HRYFGGAVDRSSYVRPGEPV--------------------------TAD
A0A2V8EXP2      -LWD-------HPQFNPKGEAAFSLGALVTAPLRWLSAW--ATPPPAI-EPGG----VSA
A0A2W4RYA1      -AWN-------HPLLVPERGALAVVREGVASVMRWFRSPEGGVPDPAVGQAGG----QEP
G8P0Y7          -LDT-------RADFAGRAQTQSNGGIAVSQ--------------------------SPA
A0A5M8T4U7      -IYG-------RLRAGEHATPGSIAQYKL----------------------------PVV
A0A3P0X3W6      -LL------------------------------------------------------PRD
A0A1E3Y9R6      -REP-------AERVPAASTWSFSPSAVVGTTIAAVRHWFGPAPVLPAASDGADP--APG
A0A2W4TLP2      -GGL-------PERVPPASSLSFSLSSLLGGAVSAVADMFGPGPV---PAAGGEE--PAA
A0A3R9WF43      -LAK-------KRPFLGAIVRGEADK-------------------------------PLE
A0A317HKM4      -SSE-------AA--------------------------------------------LPP
A0A523E0N1      -LWE-------HPLFAPDPD-------------------------------------AHL
A0A523ECP2      -LWE-------HPHFGGDK--------------------------------------THT
A0A2W0C122      -LAH-------NAEFMRDANRQFAS--------------------------------LRE
A0A2W0AUU7      -LTH-------NAEFMRDANRQFAS--------------------------------LRE
A0A2W0BQL1      -LTH-------NAEFMRDANRQFAS--------------------------------LQE
A0A4Q1SDL1      -LEK-------NRDFQPHFNPIGWV-----------------MGLFAPKGIADPPGASLE
A0A3P0XH15      -LYH-------KQPFAQVFVRQPY---------------------------------NGK
A0A4R1LAZ7      -LYH-------KKPFSKIFKQTPY---------------------------------HGQ
A0A3M1WQW8      -LDR-------QPEFAGLA--------------------------------------RIR
A0A3N1JHC1      -PRV-------PP--------------------------------------------SLA
C1F294          -LYN-------KPPYSGVFKKAGY---------------------------------HGT
A0A2V9KA79      -L-------------------------------------------------------YPV
A0A522PSP1      -LWA-------PP--------------------------------------------ADS
G8P085          -DEE-------FREYAGPNAKQLAIPL------------------------------GAI
A0A4Q1SGQ1      -LET-------THDYFPQRTTGWHLP----------------AWLFFWRQPLEPLNIRLE
Q1ILD9          -LDQ-------KPPFAGDKLYTEGSG----------------TWYSHHGLRSLPNEPLSN
Q1IJZ6          -FEK-------HIGSY--------------------------WHLFPSGRVTSEQGLPLR
A0A2V8TCE6      -LPR-------HPLLPRKSPGLL-------------------QRTLAALRRALPRGEAHA
A0A522TBE8      -LQD-------NPAFRAP---------------------------------------SHP
Q1ITG0          -LDQ-------NEAFAT-------------------------KSLFGRSLQTPVGKDVSS
A0A3N5PCI5      -LWD-------LGRAPADGNAQPAGTFAFLGQWRSWLGRAVGAATGATSSQEKEP--GSV
A0A3M1Q0S9      -LMN-------TGLPGQDDSRENRFFSAI---------RKLRTTVVRTLSRTQVP--IEE
A0A2Z5G448      -LFA--------------------------------------KKPFSKVFEKQPYVLGKP
A0A3M1VZ38      -LEN-------RPTLLGEQADEEPSPFSL---------GGLRAKILSVIGRGAPE--TGE
A0A4Q1SD29      -LYH--------------------------------------KAPFDAIFKTSPY--TGT
A0A3M1PY35      -LRE--------------------------------------LLLASLRPEDEED--LAA
A0A3M1VMP2      -VRE--------------------------------------ALAPEL-TEPGED--GEE
                                                                            

A0A2V7VMF7      -------------------------------------KDNPEAGALFVTHVGVEPI----
A0A2V7YYV7      ------------------------------------------RPDDLAKRIKATPQ----
A0A2V7Z0J5      ------------------------------------------TSDELVKQVKVTPDA---
A0A2V7Z3M4      ------------------------------------------TSDDLARQIKVTPD----
A0A399Y5V2      -------------------------------------RVTAQVLGQ--------------
Q01X01          -------------------------------------PVTRTAVDEVRKNLQIISS----
A0A3M2D9H8      -------------------------------------ASERLGYYISSSQVRVQQV----
A0A2V8JK38      -------------------------------------DQLRSLIDQYLDRITVKPL----
A0A2V9IXG5      -------------------------------------QSSDGIAGELGGGISLAPV----
A0A2V9J2P4      -------------------------------------QSSDGIAGELGGGISLAPV----
A0A1Q7RLS4      -------------------------------------KKSVDSIGAFSEMIVVAPV----
A0A2V2R525      APAT-DKEDLAEI------------------------KRLNPFVGAIQSGLEVEQV----
A0A321LPW6      DTDKQ-PGPGADA------------------------NDLAALIRALDKNLSVEPI----
A0A2V9R9V4      KSKIEGNRSPEEV------------------------ERLAPYVGMLEESLRVRPI----
A0A321LE75      EGGID--RSPEES------------------------ARLAPFVAVLSGNLSPEPL----
A0A2V8R8U7      KD--R-QLTPEEL------------------------ATLEPYEDAIIANETIEPI----
A0A2V8QMP4      SA--D-QIAPEQA------------------------QALEPYEDAMRAGLNIDAV----
A0A2V8R4S3      SA--D-QIAPEQA------------------------QALEPYEDAMRAGLNIDAV----
A0A2V8NJ55      KN--E-QLSPEQL------------------------ERLEPYEDALRASLTVEPV----
A0A2V8Q7I0      RD--Q-PLSPEEL------------------------AALEPYEDTIIANEDIDGI----
A0A2V8S6K4      GD--ELKLTPEQL------------------------KQLEPYEDALAGNLTVDPV----
A0A317I2L9      RD--Q-PLSPEEL------------------------AALEPYEDAIIGNEQVDGI----
A0A2V8LLF9      RS--R-QFTAEEL------------------------TQLEPYEDAIAAGETVEAV----
A0A352FRF4      NN--Q-EFTPEQL------------------------AALEPYEDTITANEIIEPQ----
A0A2V8MKV0      IDKVN-NLTPEEV------------------------VRLEPYEDAITANEEVDTV----
A0A2V8PYY8      KNKIS-NLTPEEL------------------------VRLEPYEDAIIANEDVGIV----
A0A1Q7YKQ8      TE--Q-QLTPEQL------------------------TRLEPYEDALAGNLTVEPV----
A0A352F3R7      TG--D-SLTPEQL------------------------AELEPYEDGIIAGEAVEAV----
A0A0B6WXT1      DA--E-NLTPEQL------------------------AKLEPYEEAILAGITVEPV----
A0A3B9MEU8      TN--G-SLTPEQL------------------------AELEPYEDAIIAGETIEPV----
A0A2V8MHG6      SSAL-SNDDIAQT------------------------NHLQPYVEMLQSQLSVKQL----
A0A2V8P7N1      NSAL-SNDDIAEA------------------------NHLQPYVEMLQSQVSVKQL----
A0A2V8M3M6      NSAL-SNDDIAEA------------------------NHLQPYVEMLQSQVSVKQL----
A0A1Q7NJH5      NSAL-SNDDIAEA------------------------NHLQPYVEMLQSQVSVKPL----
A0A2V8PJY0      NSAL-SNDDIAEA------------------------NHLQPYVEMLQSQVSVKPL----
A0A1Q7Y6W9      ASAV-ASEDLAEA------------------------KRLQPYVSMLQGGLKVDPVKETR
A0A2V8NC68      APAT-AREDLKEV------------------------NQLAPYIESLQGGLSVKEV----
A0A399WK13      A----SADEIAEA------------------------VRLTPFVEVIRRNLSVDPVRESR
A0A352FLX4      SSST-AAQEQAEA------------------------ERLSDYVDDLQETLKVEPVKETR
A0A2V8RTL7      V----SADEIAEA------------------------LRLSPYVDLIKEDLIVEPVRESR
A0A3E0PCJ6      A----TVEEMNEA------------------------VRLAPFVDAVQRDLIVDPVRESR
A0A3M1S4R8      A----TAEEINEA------------------------VRLAPFVEILKKNLRVDPVRVSQ
A0A1Q7YFI6      APAT-IEGDIAEV------------------------NRLAPYVGMLQGGLSIKEI----
A0A136KC10      A----SADEIAEA------------------------VRLTPFVEVIRRSLSVDPVRESR
A0A2V8SEX6      I----SSDEIAEA------------------------VRLAPYVEIIRKNMSVEPVRESR
A0A3M2D6Y5      A----SVEEMNEA------------------------IRLAPYVEIIKKKLQVEPVRESR
A0A0B6WWQ6      APATESQDDFDVA------------------------MRLDPYVRTIASSLKVDPVKEVR
A0A3B9MK99      AAAT-SQEDLVEA------------------------KRLAPYVGAVLGGLRVEPVKESR
A0A352EX26      APTT-SQEDLVEA------------------------KRLSPYVGAILGGLRVDPVKESR
A0A2V8MM59      APAT-SSEDLVEA------------------------KRLAPFVGALQGGLKVEPVRESR
A0A2V8PFE8      AAAT-SNDDLAEA------------------------KRLAPYVGALQGGLKVEPVRESR
A0A2V8PWS6      AAMT-SNDDLAEA------------------------KRLAPFVGALQGGLKVEPVRESR
A0A2V8LCT5      APAT-SSEDLVEA------------------------KRLAPYVGMLLGGLRVDPVRENR
A0A352FTJ9      APAV-SSDDLVEA------------------------KRLAPYVSALAAGLRVEPVRENR
A0A2V8G155      DET----------------------------------ALQSRAVDAFLARLDVTPV----
A0A2V8HDM7      DET----------------------------------ALQSRAVDAFLARLDVTPV----
A0A2V8DRT9      GET----------------------------------TTQSRILNDFLSNLTISPI----
A0A2V7VYF3      AES----------------------------------AAESQAIDAFLGGLVINPV----
A0A1F2SVH2      DES----------------------------------KVQSNTIDRFLRALTVAPV----
A0A2V8AJG9      DES----------------------------------KQQSRVIDRFLKDLTVSPI----
A0A2G6PYV5      -------------------------------------KEITKIASNLIGGVEIKEV----
A0A2V8F956      RTTESANPGPDET------------------------ASQSDAIDAFENALTIAPV----
A0A1F2S1W5      -------------------------------------RVQSRVINRFLAALDVSAV----
A0A1F2T595      -------------------------------------RTQTVVINRFLANLGVSAV----
A0A2V8JQV5      -------------------------------------SAREAAISLAAATLQVEAL----
A0A2V9AC41      -------------------------------------TAGKRLAGSYLSKLHISPV----
A0A2V8K4L4      -------------------------------------LDRNNAIAAAAGGINVKAS----
A0A2V8NCZ3      -------------------------------------IDRDRAIRMAGEDIKVKGS----
A0A2V9MAM9      -------------------------------------NDDREAILRVKDRLRIEPS----
A0A2V9M454      --------------------------------------MKNAAVAAFKARLKVERP----
A0A2V9IVR7      --------------------------------------AESPLVGIFKGGLRVEIM----
A0A2V9ILE2      --------------------------------------AESPLVGIFKGGLRVEIM----
A0A2V9LGY4      --------------------------------------AESPLVGIFKGGLRVEIM----
A0A2V9J4D6      --------------------------------------VRGRLVKLFDSYLGVNLH----
A0A2V9L9C5      --------------------------------------VRGRLVKLFDSYLGVNLH----
A0A2N9M9N1      --------------------------------------TPANLIRSFKKHLHIELL----
A0A2V9JEC4      --------------------------------------LQDRLIRAFKKHLHVALM----
A0A2V9LPQ3      -------------------------------------MLRDRLVREFQRSTTVRLM----
A0A348V070      -------------------------------------VFKERLIDEFIESLNVSPL----
A0A2Z5G3A3      -------------------------------------GRMSHALKVFSKNLTVTPV----
A0A2V7UGP8      IPE----------------------------------DPDKPYIQFVLSGLDINPL----
A0A239MKT6      -------------------------------------YTRDRVLAIFHKGLQVEVL----
A0A3E0PCN7      ALQLSLDSNEQPSEP----------------------EKLAPFVNSIRGNLSVNPV----
A0A2V8IYW3      -------------------------------------VPMEDVVARMRTEVDVDPP----
G2LEI9          EDEL---------------------------------QRYAPQIGRLASGLQAYNV----
A0A317J121      M------------------------------------ALMTSGLNVALATFDARPI----
A0A2V7YW66      -------------------------------------AVLGSLAEQVRGGLSVAPV----
A0A2V7Z0V0      -------------------------------------AVLGALADQLRGGLAVDPV----
A0A2V8GFD4      -------------------------------------PLERRRVDAFLGALSIVPV----
A0A2V8HSS5      -------------------------------------PLERRRVDAFLGALSIVPV----
A0A2V8KP55      ISSVEKTEQASDDEG----------------------DQLRSLIDQYLDRITVKPL----
A0A399WNU1      TDADLDSQA----------------------------EQLAPYVGFIKRNLEVSPV----
A0A2V9CG11      -------------------------------------VPEDELVHQAERNLTVRAA----
A0A2V2R0I6      -------------------------------------QKRPPELGEFLGSLSVKRV----
A0A2V8XAR9      -------------------------------------QKRPPELGEFLGSLSVKRV----
A0A2V8VZA0      -------------------------------------QKRPPELAEFLGSLSVKRV----
A0A1Q7CB82      -------------------------------------QKRPPELAEFLGSLSVKRV----
A0A2V8WIU1      -------------------------------------QKRPPELAEFLGSLSVKRV----
A0A1Q6Y9F5      -------------------------------------QKRPPELAEFLGSLSVKRV----
A0A2V9EVV8      -------------------------------------QKRPPELAEFLGSLSVKRV----
A0A2V8YF91      -------------------------------------QIRPQELGQFLGSLSVKRV----
A0A2V8XZK2      -------------------------------------RTRPPELAEFLGSLSVRRV----
A0A2V8ZTX6      -------------------------------------QTRPPELAEFLGNLSVKRV----
A0A2V9BT79      -------------------------------------QTRPPELAAFLGNLSVRRV----
A0A1Q8B793      -------------------------------------QNRPPELAAFLGSLTVKRV----
A0A2V9BCA0      -------------------------------------QNRPPELAAFLGSLTVKRV----
A0A2V9BWU9      -------------------------------------QARPPALGGFLGSLRVKRV----
A0A2V9DKX2      -------------------------------------QARPPALGGFLGSLRVKRV----
A0A2V9JSI3      -------------------------------------IVQISLINAFRDHLRVEWV----
A0A2V9WI32      --------------------------------------AESSLLDRFRRGLKLNVV----
A0A2V8IVN9      GIPDAGET-----------------------------SSQSRAVDAFLKRLTVSPV----
A0A1F2TPT3      AEPLAGER-----------------------------PAEAPQISAFLGGLSLAPT----
A0A2V8JTQ2      -------------------------------------ANQDALLQSFHKGLEISKV----
A0A2V8UZY0      -------------------------------------DNEDRLVKSFHKSLRISKV----
A0A3N5YNR8      -------------------------------------DKNRDVLDTFRDRLEVAQV----
A0A350UEK1      AAWRQALNLPEEAAT----------------------GAKARAVEMAADTLKVRAS----
A0A350UIQ4      SAWRRALNLPDVPEN----------------------DARQHAIAMAADSLKVRAS----
A0A3N6A5T6      -------------------------------------ADLSADVDRFLGSLQVQPI----
A0A1F2Q9L4      -------------------------------------ATLAGLAYGVLGGLEVNPI----
A0A1H5SQF5      -------------------------------------TYRDSAVNLFQSRLKITLV----
A0A3E0NV31      DLIKNGFRPRRRGEA----------------------LSEAGALRRLQENLSIAPV----
A0A3N5M5V0      -------------------------------------AENRAVIEKVLSRLEVTQV----
A0A2V9AEW6      -------------------------------------SEREQMIRQVERNLTVQSS----
A0A2V8WQK6      -------------------------------------PEREELIRQIKRNLTVRTS----
A0A2V8XIF4      -------------------------------------PEKEELIRQIQRNLTVRES----
A0A3N5XQP8      -------------------------------------DPTEYMIDRLLSDLQINPV----
A0A2Z5G7H4      -------------------------------------RRRTRALKIFDANLNVKVV----
A0A2V9L5B5      -------------LT----------------------DAYRNSVTHFLASVDVNPV----
A0A2V9LK56      -------------SS----------------------EAFNNSIANFMNSMSVGPV----
A0A2V9L7I0      -------------SS----------------------DAYVNAIAHFRKSVDVSPV----
A0A522PPT0      -------------NS----------------------DAYLNSVTNFMRAVVVNPI----
A0A2V9KCS3      -------------------------------------PSREQAAGMAAASVSVRSV----
A0A2U3KC61      ----------------------------------------AGLLGAFRGGLSVQII----
A0A2V9Y2R7      -------------------------------------EETTALLAAFHSGLSVRVI----
A0A372IT17      -------------------------------------NRRYVALRIFARHLTVQPV----
A0A136JPP4      -----AAVQLSPEEA----------------------ARAGQYAGILSGGLHVEQT----
A0A399WUJ8      -----TAAQLSPEES----------------------ARANQYAAALSGGLRVDQT----
A0A2V9NGH6      -------------DS----------------------VKASAVLASFKSDLKVLLK----
A0A2V9PYE6      -------------DS----------------------VRTSEILAHFKSDLKVSLK----
A0A2V9NL07      -------------DS----------------------ARANALLGAFKGGLHVVLE----
A0A2V9QD92      -------------DS----------------------ARANALLGAFKGGLHVVLE----
A0A2V9WPZ6      -------------DS----------------------TRTSALLSAVKGSLRVSLV----
A0A2V9ZLH4      -------------NS----------------------SRVTNLLGAFKGNLKVTLQ----
A0A2V9RQF1      -------------DS----------------------EQTTALLSAFKGNLRVALQ----
A0A2V9YDK8      -------------DS----------------------ARTSALLAGFKGNLRVSLL----
A0A2V9V8F7      -------------DS----------------------TRTSALLSAVKGSLRVSLV----
A0A2V9XGR9      -------------DS----------------------TRTSALLSAVKGSLRVSLV----
A0A2V9V3Q5      -------------DS----------------------KRTTALLGGFKGNLKVSLI----
A0A2V9NWS3      -------------DS----------------------QRTTDLLSAFKGKLRVALE----
A0A2V9USA9      -------------DS----------------------AHLSSVIGGFKGSLRVALS----
A0A2V9XW18      -------------DP----------------------GRASSMIGGFKGNLRVTLS----
A0A4R1LC91      -------------------------------------HKLSHMLKAFSHNLTVKPV----
A0A3M2BZG9      -------------DA----------------------AELARQAMRLQSGLVVNPI----
A0A1Q7N5R7      LERGDVGAAIGRTDSLGFRWTPAAADLAPGAEIVFGVTTLRDASRGLSDGLRVSPD----
A0A3M1SIV3      KSLDNLEAKLSPEEK----------------------EAVEKVTASLLPGVDVVQE----
A0A3E0PHB0      -GETVDQINLTPEQS----------------------QRADKYTAALVNSLVVEKV----
A0A3M2D491      EGFSSEEIKLSPEER----------------------LRVERITASLAGSVDAIQE----
A0A357F267      SPSPSSALELTPEEE----------------------KRVQIYAAMLRGGLSVEQR----
A0A353C9L6      LGEERPRTILSPDEE----------------------KRADQYAGILFSGLTVDQV----
A0A2V8RQV0      LNSKGELAKLSPEEE----------------------ALANQHVGNLIGRLQIVPQ----
A0A2V8SJH5      GTDASDNIQLTPEER----------------------ARVENYAAMLAGRVTVQPK----
A0A2V9QB26      -------------ES----------------------GAAQAAARSLNARVS--------
A0A2V9VYY4      -------------DP----------------------VQAAGLLGAFRGGLSVQPV----
A0A2V9KIE8      -------------NS----------------------EAFTNAVKHFLDAVEISPV----
A0A352F549      AFASAGFNADDPAEV----------------------ERLTPYAESLQGLVDVEQV----
A0A3B9MLP9      -LTTSGLSLEDPAEV----------------------ERLAPYVDSLQGMLDVAQL----
A0A3D5SQ87      -LTTSGLSLEDPAEV----------------------ERLAPYVDSLQGMLDVAQL----
A0A2V8NW86      -------------ES----------------------GAVQAAAESLKARAS--------
A0A2V8ZHL8      --------------Q----------------------NSEDKLLRLFKSRLHVQRV----
A0A2V9B240      --------------Q----------------------VWEDRLLGPFKRRLHVQRV----
A0A2V9CBM2      -------------DR----------------------ELYQRVLERFRDHLTIAPI----
A0A2V8XN17      -------------DR----------------------ELSQRVLERFQDRLTIDPV----
A0A2V8WX45      -------------DR----------------------ELSQRVLERFQDQLTVDPV----
A0A1Q6YR79      -------------DR----------------------ELSQRVLERFQDRLTIDPV----
A0A1Q7VA32      -------------DR----------------------ELSQRVLERFQDRLTIDPV----
A0A2V9EY85      -------------DR----------------------ELSQRVLERFQDRLTIDPV----
A0A2V9H8K0      -------------DR----------------------ELSQRVLERFLDRLTIDPV----
A0A2V9FFE5      -------------DR----------------------ELSERVLERFLDRLTIDPV----
A0A2V9GM43      -------------DR----------------------ELSERVLERFLDRLTIDPV----
A0A1F2RFI7      -------------DP----------------------K-YYNVLDNFQDRLTVNPV----
A0A1F2RZS3      -------------DP----------------------K-YSAVIDNFLGRLQIVPI----
A0A1F2USE2      -------------DP----------------------AAYQGVLRRFQDRLAVAPV----
A0A2V9C238      -------------DP----------------------WAYQTALKRFRDRLSVDPI----
A0A1F2Q9F5      -------------DP----------------------VAYQNALETFSRRLAVAPI----
A0A1F2QQH9      -------------DP----------------------VAYQNALETFSRRLAVAPI----
A0A1F2QXK7      -------------DP----------------------VAYQNALETFSRRLAVAPI----
A0A2V9DEM9      -------------DP----------------------RAYQTALKRFRDRLSVDPI----
A0A2V9CYQ5      -------------DR----------------------ELYQHVLERFRNHLTIAPI----
A0A2V9BWU8      -------------DS----------------------AVYQRVLERFQDRLSIEPV----
A0A2V8ZG48      -------------DP----------------------EVYQRVLERFQGRLTVDPV----
A0A2V8Y334      -------------DP----------------------EVYQRVLERFQDRLTVDPV----
A0A2V9AY68      -------------DP----------------------EVYQRALGRFQDRLTVEPV----
A0A257VBK0      -------------------------------------------AAMLRGMTKVDNI----
A0A2V7XDY0      --P----------------------------------AEHRDAGGEFMSHVNVEPI----
A0A350UQT3      EGD----------------------------------QARAQDAPIVLRNLKVARP----
A0A2U3JZ71      LSR----------------------------------VPGAEDAPVLLKNLKVSRP----
A0A2V8TTB0      SER----------------------------------WQGSDEAPVILKYLKITRP----
A0A1F2TCR2      DEN----------------------------------AAEAGIISQFIGSINIIPE----
A0A2N9LQU7      MDP----------------------------------LSREKLLLKFHDAEKLEVL----
A0A2P6WFK7      MPP----------------------------------ADRQRLVSAFKQSLSVRVL----
A0A1F2V330      PDG----------------------------------KISDTDLDRMRESIKIT-V----
A0A2V8U914      AAQ----------------------------------NAAQYAADVARKHLKIEPA----
A0A662EE63      --------------------------------------------GIVLGGLTVKPV----
A0A2V7W309      EID----------------------------------QITQAMAGGLLGGVNIAPK----
A0A2V8TLH7      -------------------------------------------VGVFSSMVQVELI----
A0A1Q7ZJT1      -------------------------------------------IGEFSQMIVVAPV----
A0A2V8VC99      -------------------------------------------IGTFSSAIEVEPI----
A0A348UZU3      KNP----------------------------------VFRQKLVDKFLGRLEVKPI----
Q01XL7          EPL----------------------------------EQMKEAVRTAAFTVSARGV----
A0A2V8ERZ5      DET----------------------------------ADESGLVSAFIGRVSVDPV----
A0A2V8GTX0      AGP----------------------------------VNENQQADAFLGRVQVVPV----
A0A2V8J0X9      DEP----------------------------------AHEAGLISAFLGGLSIRPE----
A0A523DUV7      --------------------------------------------RIFMSRVQVVPI----
A0A372IRG7      LTP----------------------------------LQRYQLIRAFQSSEKVIVE----
A0A1F2U158      DET----------------------------------ADESALVSRFLGRVQVVPV----
A0A2V8F6S9      DEA----------------------------------PDESGLVSGFISRVTVAPI----
A0A4Q1SCH5      NLT----------------------------------PQQEDVLDKFQLALKAKQE----
A0A2W0BGU4      ESQ----------------------------------AHKMKLIETFKRQLSVELV----
A0A2W0BVQ9      DAQ----------------------------------AHKMKLIETFKRQLSVELV----
A0A3D1ASD2      EAR----------------------------------SAAAEDAPVRLKRLEVIRP----
A0A2N9MK30      GSD----------------------------------QGLLIDAPVLLKQLKVTRP----
A0A1I6MH75      DSP----------------------------------AVQAGTIRRLNGHLKVSLI----
E8WVF6          EDP----------------------------------RVRQTIVGILQKNLKVTLV----
A0A1H5Z7N3      DDP----------------------------------VVRQMVLYTLRADVNVSVI----
A0A2V9YHT3      LTP----------------------------------PQESALIGRLRGSLQVSSI----
A0A1G7JVV8      NDP----------------------------------IVRAAVIGKLSNAFKVASI----
A0A1H4T6W9      NDP----------------------------------VVRTEVLRRLGGAVVATVI----
I3ZEU5          NDP----------------------------------AVRTDVLQRLGNSVNASII----
A0A5B9EBI2      DTP----------------------------------MIRQATLSRLKANLTVSIV----
A0A239HDF6      NDP----------------------------------QVRQGTLLVLSSNLKIAMQ----
A0A4Q0T270      DDP----------------------------------GVRQGTIHRLQSSLRIQLV----
A0A1Q3QQB6      DDP----------------------------------AVRQATVHALQSGLRIVLV----
A0A3N1K1G7      DDA----------------------------------AVRQSTVHRLQSNLHITLV----
A0A428MDU2      DDA----------------------------------GVRQSTVHRLQSNLHITLV----
A0A4V2G466      DDP----------------------------------DVRQRTIHQLLGGLRIAQV----
A0A4Q7YNP3      GKP----------------------------------ISSDDLIEDTAKHVTVKPL----
A0A2V9MN96      PDS----------------------------------QQIASMLSIFRSGLTVQVM----
E8UZE1          LTD----------------------------------QERYSLIRRFQSGLGVQLE----
A0A2V7V2Z1      GAS----------------------------------AVMERAIDEFLGKLKVVPI----
A0A2V7X2F7      GSS----------------------------------PVMEGAIDGVLGRLRINAG----
A0A2V7V2I1      GSS----------------------------------RVMEAAIDQFLSRVKVQPV----
A0A2V7U3M2      GAS----------------------------------PVMERAIDSFLRKLRVLPV----
A0A2V7UHT0      GAS----------------------------------QLMEGAIDAFLRRLRVLPV----
A0A2Z5FVL3      AAP----------------------------------LRRDRLLKQFQENLEVKII----
A0A1V6HR88      ADQ----------------------------------SALARLAGRLLGGLEVKPV----
A0A2V9KBD6      -KA----------------------------------VNEDRLVKLFHKSLDISKV----
A0A2W0AJ66      IEP----------------------------------GNEDSLVRAFHKNLAISNV----
A0A1Q7RBU1      EQP----------------------------------VNEDRLVESFHKNLTISKV----
A0A2V9JPV9      AHS----------------------------------GNEDRLVKSFHKNLTISKV----
A0A3E0P0A3      DDA----------------------------------VVVARLASRVRSGLSVQQV----
A0A2V8EXP2      GET----------------------------------SAQARAIDRLLGGLTVTPI----
A0A2W4RYA1      PET----------------------------------PEQTAVIDAFLRRVSVSPV----
G8P0Y7          EES----------------------------------FRLESLIRKLQGNLTIQQI----
A0A5M8T4U7      LSP----------------------------------VERRALIGYIRGGLSVKLV----
A0A3P0X3W6      KKG----------------------------------KEFLPAGSVTLPGLTITHP----
A0A1E3Y9R6      AVS----------------------------------PQEAALTSRVQAGVSVVPV----
A0A2W4TLP2      VES----------------------------------AARAALTSRIQGGIVVVPI----
A0A3R9WF43      DAP----------------------------------RTRERMVKLFRKNLKVDSP----
A0A317HKM4      NER----------------------------------LSQVPTVAEIAAARSIGGV----
A0A523E0N1      DQK----------------------------------KVVSNIGRSIQAMANVSRV----
A0A523ECP2      ADE----------------------------------QTLEDLAEQVAGMLQVTQI----
A0A2W0C122      IAP----------------------------------APESIAVQALLSGLSVKTI----
A0A2W0AUU7      AAP----------------------------------DPTDIAGEAVVSGLSVKTI----
A0A2W0BQL1      AAP----------------------------------DPTDIAGEAVVSGLSVKTI----
A0A4Q1SDL1      NSP----------------------------------ARRTRLLKIFAANLKAESV----
A0A3P0XH15      LTP----------------------------------NQRIEMLSIFKGSTKIATK----
A0A4R1LAZ7      LTP----------------------------------LQRYLLLLSYHGALKIMVI----
A0A3M1WQW8      DAT----------------------------------LRDKLMVDRFLSGLRVELI----
A0A3N1JHC1      SND----------------------------------AGREGVVRNMVMDAKAKEE----
C1F294          VTP----------------------------------SQKLALLNTFKGATQVVLV----
A0A2V9KA79      TRG----------------------------------AATSRQIDEMRARIQIT-V----
A0A522PSP1      SST----------------------------------EVPRSFVAGITGGIKTSQD----
G8P085          SLS----------------------------------PAQEEMLSHFKSQINVLQV----
A0A4Q1SGQ1      DAP----------------------------------NRRYVALKIFEHHLKVKAE----
Q1ILD9          IGN----------------------------------ARRQQLLARFQLGLDVTEV----
Q1IJZ6          NAP----------------------------------RQREAMLKKFGKALTVTPI----
A0A2V8TCE6      APA----------------------------------EPMGPFIDLVLAGLSIEPV----
A0A522TBE8      NLT----------------------------------PSPDDVLRQLSNGVSVSRP----
Q1ITG0          VDE----------------------------------ARKSKLLTRFSKALRVEAV----
A0A3N5PCI5      RET----------------------------------VAESIAIDRLLANLRILPV----
A0A3M1Q0S9      DDP----------------------------------YA--PYVKTLRGGLSVEPI----
A0A2Z5G448      LTP----------------------------------AQRIPLIRLLRSNLQVVVI----
A0A3M1VZ38      VDP----------------------------------LR--PYIKQLRAGLSVDPV----
A0A4Q1SD29      LTP----------------------------------AQRHEIISLFLGSTKVQVL----
A0A3M1PY35      WEP----------------------------------PDDGDLVEMLGAGLDVAPL----
A0A3M1VMP2      PKP----------------------------------PTDDQIAAYIRDNLDTEQL----
                                                                            

A0A2V7VMF7      ----PE-------SRLVTVAVTHQDAKEAALWANTLAEVYVEQTLASRVEAAKKAYDWLQ
A0A2V7YYV7      ----PN-------TTILDIAVDDTNPALARNIANDLVDKLI-------------------
A0A2V7Z0J5      ----TT-------ALVLHINVQDTNRARSRDVANTLVSEFI-------------------
A0A2V7Z3M4      ----TL-------ALVLHINVQDTNRARARDVANTLVAEFV-------------------
A0A399Y5V2      -------------TSIIRVRARDASASLARDIANGVSATY----IDLRRKSALDSFAQQA
Q01X01          ----RG-------TSIIRIVAEAREPQLAADLANTLAQTFIEQSIEARQRSAQQTFASLS
A0A3M2D9H8      ----RG-------AQLIQIVVEDSDPQKAAEIANTLVTVFLEQNAKIQSNRFSASEESLQ
A0A2V8JK38      ----RQ-------SWLVEVTFQAKDPKLAAQVINAHGRHFVEQNIENRFQTTQQVSELLS
A0A2V9IXG5      ----ED-------TNLLWLEFVADDPRKAADWVNLYVDLYVEENDRQQGEAVKQSRDVLK
A0A2V9J2P4      ----ED-------TNLLWLEFVADDPRKAADWVNLYVDLYVEENDRQQGEAVKQSRDVLK
A0A1Q7RLS4      ----KE-------TGIVEISMEGLNPEEVASWVNTISEVYVERNLDQVVEATSKAVKALL
A0A2V2R525      ----GK-------TRLVEIRYTHRDPHVAAKVVNAIADTFVQANLEKMTETNSGAGAFLK
A0A321LPW6      ----RD-------TRVIKVVFTHTDPKLAAEVVNAVTQSFIARSFSTKAEKYNNAASWLD
A0A2V9R9V4      ----LD-------TRAMTLTFKHTDPVIAAGVANAIAQRFVETSFDKKIEKFTSASEWLD
A0A321LE75      ----ED-------TRLLVINYSHTDPKLAATISNTVAAAFINRSFSNKTEKFTKTSDWLN
A0A2V8R8U7      ----IG-------TSLVTIRYQHTDPALAQRIANTLADVFVQNNRERLDIGTSKAVESLA
A0A2V8QMP4      ----EK-------TNLVEIHFQHTDPEIAASVANTLATIFRDNDIQEETTGSQKAEDVLA
A0A2V8R4S3      ----EK-------TNLVEIHFQHTDPEIAASVANTLATIFRDNDIQEETTGSQKAEDVLA
A0A2V8NJ55      ----EK-------TNLVTIRFRHSNPVIAMKVADTFAQVFIYNDLQRTTSGTQTATEKLA
A0A2V8Q7I0      ----VH-------TNLFTIKYKHHDPEMAQKIANTLAEVFASNNIDSQTVNSKDAGDLLE
A0A2V8S6K4      ----ER-------TSLVDIHFKHTDPELARQVADTLAAVFIENDRARESKGTEDMKVATA
A0A317I2L9      ----VN-------TNLFVIKYKHHDPDIAQKVANTLAEVFANNNLERSTTNSSKQETMLA
A0A2V8LLF9      ----EK-------TSLVTIHFQHTDPELAQKIANTLADVFVQNNLDRITAGTSKAEIDLT
A0A352FRF4      ----PQ-------TNLVIIRYRHTDPALAQKIADTLAEVFVANNLNLQESGTSKQSQDLG
A0A2V8MKV0      ----EK-------TNLVSIRYHHSDPALAQKVANTLVDVFANNNKESLESGTRKSAAQLG
A0A2V8PYY8      ----EK-------TNLVTITYHHNDPALAQKVANTLVDVFANNNLERLESGTKKSAEQLA
A0A1Q7YKQ8      ----MT-------TNLVMLKFTHSDPVLAQKIVNTFADTFAYNNFERETQGTAKATELLA
A0A352F3R7      ----TN-------TNLVKIRFVHSDPELAQKIANTLAEVFVNNNLQRATAGSSKAEDVLA
A0A0B6WXT1      ----EK-------TNLVNIKFQHSDPEMAAKVANTIADVFIYNNLERETQGAQRASVLLA
A0A3B9MEU8      ----PT-------TNLVKIKFMHSDPELAQKIANTLAEVFRNNNLERSTAGSSKAEDQLA
A0A2V8MHG6      ----SD-------TRIIEIRFKHQDPEIAEKINNTIADTFVVSNLERKTETTNSAGDFLQ
A0A2V8P7N1      ----SD-------TRIIEIRFKHQDSEIAEKINNTIADTFVVSNLERKTETTNSAGDFLQ
A0A2V8M3M6      ----SD-------TRIIEIRFKHQDSEIAEKINNTIADTFVVSNLERKTETTNSAGDFLQ
A0A1Q7NJH5      ----SD-------TRIIEIRFKHQDSEIAGKINNAIADTFVVSNLERKNETTNNAGDFLQ
A0A2V8PJY0      ----SD-------TRIIEIRFKHQDSEIAGKINNAIADTFVVSNLERKNETTNNAGDFLQ
A0A1Q7Y6W9      LLI-KE-------TRLIDISFTHQDPQVAAKIINALADTFVLSNQEKRNESNNTTGGYLQ
A0A2V8NC68      ----NE-------TRIIELRYRHLDPEVATKIVNTIADTFIQSNLEKKTETSSSAGDFLQ
A0A399WK13      ATV-KD-------TRLIEISYSDTDPDLAAFVANAIAETFTNQNQEKRTGTSRKTNDFLQ
A0A352FLX4      LTV-RE-------TRLIDISYRHSDPHLAAKIVNTVAQIFIDQNREKKTETSGSTGTYLL
A0A2V8RTL7      ATV-KD-------TRLIEISYRNTNPELAAFVVNAIGETFVNANQEKRSGTSRKTSDFLQ
A0A3E0PCJ6      ATV-KD-------TRLISISYRNQDPNVAAFVVNGIAEVFTRVNDEKRTGVNSKTNEFLK
A0A3M1S4R8      ATF-KD-------TRLIEISFQHTNPELAALIVNGIAEVFVKQNQEKRTGTNKRTNDFLA
A0A1Q7YFI6      ----TD-------TRLIEIHYTHPDPQVAAKIVNSIADTYIISNLEQKTKNTNSAADFLQ
A0A136KC10      ATV-KD-------TRLIEISFNSTDPALAAFVANAIAETFVNQNQEKRTGTSRKTNDFLQ
A0A2V8SEX6      ATV-KD-------TRLIEISFRHTNPQLAAFVVNSIGETFVTANQNKRSGTNRKTSDFLQ
A0A3M2D6Y5      ATF-KD-------TRLIEVRFQHTNPELAALVVNGIAEIFAKQNQEKRTGTSKRTNDFLS
A0A0B6WWQ6      LPV-KE-------TRLIDISFRHPDPYVAATVVNTIAETYKLSNLEKRTSARATTSQFLQ
A0A3B9MK99      -GLFKE-------TRLIDLSYTHIDPEVASKVVNAIAETYVYNNLEKKSDTNMGTADFLQ
A0A352EX26      -GLYKE-------TRLIDIGYTHTDPEVASKVCNAIADTYVFNNLEKKTESNASTGDVLQ
A0A2V8MM59      AGYYKE-------TRLIDITYQHGDPEVAARVANCVAETFVHSNLEKTNQTNTSTSEFLS
A0A2V8PFE8      AGYYKE-------TRLIDIVFQHGDPEVSAKITNAVADTFVRANLEKKNETNTSTGEFLS
A0A2V8PWS6      AGYYKE-------TRLIDIAFQHGDPEIAARITNAVAETFVRANLEKKNETNTSTGEFLS
A0A2V8LCT5      AGYYKE-------TRLIDIDYQHGDPEIAAKVVNCVAETFVRSNLEKKNETNTSTSEFLS
A0A352FTJ9      AGYNKE-------TRLIDIDYQHGDPEVAARVVNAVAQTFVRSNLEKKNETNTTTSEFLS
A0A2V8G155      ----RN-------SRLVDIKYRLGDPALAQKIVNAVAHAYIEQTMEFKFTASKQAGDWLE
A0A2V8HDM7      ----RN-------SRLVDIKYRLDDPALAQKIVNAVAHAYIEQTMEFKFTASKQAGDWLE
A0A2V8DRT9      ----RN-------SRLVEIEFASPYPYVAANVANSLSKAYIELNLEYKFTASRDASDWLG
A0A2V7VYF3      ----KN-------SRLVDVVYRSPDPVFATTIVNELAHQYIQQNVELRFHASKDASDWLG
A0A1F2SVH2      ----RN-------SRLVDVRFDSPDAAFSATVANALARAYIEQHLEFKFLSSKEASDWLG
A0A2V8AJG9      ----RN-------SRLVDVKFESPSAALSAQVANGLAKAYIEQNLEFKFMSSKEASDWLG
A0A2G6PYV5      ----KD-------TNLVRISYTDTNPERAMILANTWVKAYIAHSLNMTYDKNLEAYNFLE
A0A2V8F956      ----RN-------SRLVDLKFDLPDGALAATIVNALAKNYISQSLEFKFMASKDASDWLG
A0A1F2S1W5      ----RY-------SRLVDVSFRSNDPALAARVSNALADQYIKQSVELRSNTTKEASEFLV
A0A1F2T595      ----RY-------SRLVDVSFRSADPGLAAKVANEHSKQYIEQSLEFRTTTTREASDFLT
A0A2V8JQV5      ----QQ-------AHIIQITADSTDPKIAAEFLNTLTDEFINQKLRSRLQTNERTAEWLQ
A0A2V9AC41      ----GG-------TSLVKVRFTTPDPALSARLANAHANSYVRYGVDLRSQTNEEASEFLK
A0A2V8K4L4      ----GT-------TRIIEITSDSTDPQLAADFANTLVDEFIQKNLDDRWKTTERTGEWLT
A0A2V8NCZ3      ----NT-------TRIIEITADSADPRLAADFANTLVDEFIEKNLDDRWKTTERTGEWLT
A0A2V9MAM9      ----KQ-------GRIIRILCDATDPQLAADFANALAQVFIEQSVEARWNGASQIREWLN
A0A2V9M454      ----KD-------TRMALVSFESTDPREAAAVVNGLVTNYIEHNFKSKYDATRQATGWME
A0A2V9IVR7      ----RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASGWME
A0A2V9ILE2      ----RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASGWME
A0A2V9LGY4      ----RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASGWME
A0A2V9J4D6      ----RN-------THIVEVSFESTDRDLAARVVNALINNYIEYNFHTKYDATRQASGWME
A0A2V9L9C5      ----RN-------THIVEVSFESTDRDLAARVVNALINNYIEYNFHTKYDATRQASGWME
A0A2N9M9N1      ----TE-------SRLVEVSFESVDSNLAARVANTLVKNYVEANFRSKYETTRQASAWME
A0A2V9JEC4      ----GN-------SRLITVSFESTDPELAANAANTLATNFVEANFQGAYDTTREATKWME
A0A2V9LPQ3      ----PN-------SHMMEVSFESTDPDLSAKVANTLINHYIEYNFRKRYDATRQASGFME
A0A348V070      ----TG-------TKLIQVSFNHRNPELAAEVLNTLLDSYIEMLIKRKYTASEQATEFLS
A0A2Z5G3A3      ----VG-------TRLIQISYVSSDRKLAESVVNALAQDLTNFSFETRYKATAQTSQWLT
A0A2V7UGP8      ----KN-------THLVEISFVSVDPELSSRIANAVANSYMEFNQSARYDTSAQASEFIG
A0A239MKT6      ----KS-------TRLLAVSYTDTDRNRASKIANYVVQAYLQDNTENRYQATSMASTWLT
A0A3E0PCN7      ----RDNRTAAQETRLIEVQFTHFRPEVAAKIVNTLGETYVRQNLEQKVQTNASAGEFIQ
A0A2V8IYW3      ----VK-------DDTFKISYVSGDPVVAMKVVARLASMFIDGNVRDRRVVAEGTNQFLE
G2LEI9          ----PR-------TRLVRITFQHHDPETTKAVVNTVAEVFARRNVSDRLQQGSSQKEFLS
A0A317J121      ----NG-------TRIIEITCDSTSPDIAANFVNTLANEYIEQNSQGRAQNLQQTSQWLS
A0A2V7YW66      ----RS-------TQLVQLAYTAASPEFAAKAANAFSEAFIDMGVEDRYATAGKASTFLG
A0A2V7Z0V0      ----RN-------TQLVQLSFRASSPEFAAKAANAFAESYIDMGVEDRFATAGKASTFLS
A0A2V8GFD4      ----RN-------SRLVDIVYSSPDPKFATAAANAIAKAYIEQNLEYRFTASKEASDWLA
A0A2V8HSS5      ----RN-------SRLVDIVYSSPDPKFATAAANAIAKAYIEQNLEYRFTASKEASDWLA
A0A2V8KP55      ----RQ-------SWLVEVTFQAKDPKLAAQVINVHGRQFVEQNIENRFQTTQQVSELLS
A0A399WNU1      ----KDSRTATKETRLIRIEYRHYDPVIATKLVNAIADTYVLQNLEQKVQSNASASDFLQ
A0A2V9CG11      ----GN-------TRVLEVLYESPDPKLAADFANTLASEFIEETQGMRLKAFQRTAEHLT
A0A2V2R0I6      ----PN-------SRLMDVSFESTDPQLGARIVNAHINNFIEQNFRSRFEATSQASSWLT
A0A2V8XAR9      ----PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASTWLA
A0A2V8VZA0      ----PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASSWLA
A0A1Q7CB82      ----PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASSWLA
A0A2V8WIU1      ----PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASSWLA
A0A1Q6Y9F5      ----PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASTWLA
A0A2V9EVV8      ----PN-------SRLMDVSFESTDPRLAARIVNAHIASYIEQNFRSKYEATTQASTWLA
A0A2V8YF91      ----PN-------SRLMDVSFESTDPRLAARIANAHIATYVEQNYRSKYESTTQASNWLA
A0A2V8XZK2      ----PN-------SRLMDVSFESTNPQLAARIVNAHIATYVEQNFRSKYESTTHASDWLA
A0A2V8ZTX6      ----PN-------SRLMDVSFESTDPRLAARTVNAHIATYVEQNYRSKYEATSQASDWLA
A0A2V9BT79      ----PN-------SRLMDVSFESTDPRLAARTVNAHIATYIEQNYRSKYEATSQASDWLA
A0A1Q8B793      ----PN-------STLLDVAFESTDPRLAARVVNAHIENFIEHNFRSRYEATTQASSWLA
A0A2V9BCA0      ----PN-------STLLDVAFESTDPRLAARVVNAHIENFIEHNFRSRYEATTQASSWLA
A0A2V9BWU9      ----PN-------SRLLDVTFEAGDPKLAARVVNVHLENYIEQNFRSKYLATTTASNWLK
A0A2V9DKX2      ----LN-------SRLLDVTFEAGDAKLAARVVNAHLENYIEQNFRSKYLATTTASNWLK
A0A2V9JSI3      ----RN-------SRMLEVSFEARDPRLAAAVANALVSNYAEYNFRKRYDATRQASGWME
A0A2V9WI32      ----PR-------TRIVEIHYSHPDARLAAQIANILINTFIEQNFKTKFESTMQTSAWLS
A0A2V8IVN9      ----RN-------SRIVDVKFEAKDPDVAERVVNALAKGYIDQNLEFKFMSTKEASDWLG
A0A1F2TPT3      ----AN-------G-VLDIKYRSSDPVLAARFANAHAQEYINENLEMRVAAVREVTGWLT
A0A2V8JTQ2      ----KG-------TRLIEIQFRSTDPQLAADVVNGLAKEYVDQYYRSQFQVSTQFSDFLA
A0A2V8UZY0      ----KG-------TRLIEIKFRSTDPRLSADVVNSLAKEYVDHYYRSQFQVNAQISSFLA
A0A3N5YNR8      ----PN-------SRLVEIRWVSPDPTLAAAVSDTLAEEFIEQNLQTKFEANTRATEFLK
A0A350UEK1      ----GQ-------TRIVEVLVDSTDPAVAASFANRLTAEYVEQSMEARWQSSQRTGEWLT
A0A350UIQ4      ----GQ-------TRIVEVLVDSTDPAIAAQFANLLTSEYVDQSMEARWQSSQRTGEWLT
A0A3N6A5T6      ----RG-------SRLVEVSYASHDARLAATIVNTLADQFIEMNFESRYQATTKATEFLQ
A0A1F2Q9L4      ----RN-------TRLVEVSYVATTPELAARIANGVADTYIDWGVETRFATVGKASTFLT
A0A1H5SQF5      ----KG-------TRLVNVTYTDADPKQAARVANAVVEAYLISSTQQRYDATSKTSAWLT
A0A3E0NV31      ----GN-------TQLVRVSYSSPDPDLSTDVAGAIALTFIETTLQTRYDATRRAVKFLE
A0A3N5M5V0      ----PN-------SRLVEVGWVSPDPSLASAVSDTLAEEFIEQNLQTKFEANTRATAFLK
A0A2V9AEW6      ----GS-------SRLLEVLYESPDPKQAADFANTLVSEFTELSQEAHWKSAQGTAEWLT
A0A2V8WQK6      ----GN-------SRLLEVLYESPDPQRAADFANTLVSQYVELSQEERWRSAQGTAEWLT
A0A2V8XIF4      ----GN-------SRLLEILYESPDPKLAADFTNTLVSEFVELSQEERWKSAQGTAEFLT
A0A3N5XQP8      ----LE-------SRLMDVSFSSPSPKFAAMVANAWVEEYIEQNFQSKLKTTEMATKFLA
A0A2Z5G7H4      ----SG-------TRLIEVRFLSSDPVLAAKVVNQLMDGLVEYNFQTRFTATNQASEWLT
A0A2V9L5B5      ----RR-------SNLVEVTFDSYSRTVAALAANKLADDYVEQNLEVKWDAAEKASQWLQ
A0A2V9LK56      ----RR-------SNLVEISFYSNDPKLAARIANRLADDYIEQNLQVKWDAALKASEWLS
A0A2V9L7I0      ----RR-------SNLVELTFDSYSPEVAAQAANKLARDYIEQNLEVKWDAAAEASKWLE
A0A522PPT0      ----ER-------SNLVEVAFYSQDAAVAARVANQLGEDYIDQNLQVKWNEALKASEWLS
A0A2V9KCS3      ----NE-------TRIVEILCDSTDPKFAADFANTLVSEYMEQSLESRWKNAQRTGDWLT
A0A2U3KC61      ----PN-------SRLVQISYTHPNPRLAEAIVNKLVDTFKEENTNAKYESVNETSEWLK
A0A2V9Y2R7      ----PR-------TRLLELRYIHQDPVLARDIVNKLAKTYIEENFRKRYESTTQTSEWLS
A0A372IT17      ----TG-------TRLIEIRYSDPDPALAARVVNRLVQALADYTFQSRLAQTSESSSWLA
A0A136JPP4      ----ER-------TSLFTLTINSTNPQIAANVANKVGEVFIEEDAKRELETTQSAYDELT
A0A399WUJ8      ----ER-------TSLFTVSVSSTNPQLAAAVSDKVAEVFIEEDAKRELEGTQSAYDELT
A0A2V9NGH6      ----PN-------TRIIEIRYRSTDKDSAARVVNTLINTYIEQNFKTKFESTMQASDWLS
A0A2V9PYE6      ----TN-------TRIIEIRYRSTDKGLAARVVNALINTYIEQNFKTKFESTMQASDWLS
A0A2V9NL07      ----PN-------TRIIDIHYRSPNKELAARVVNTLANTYIEQNFKTRFESTMQASDWLS
A0A2V9QD92      ----PN-------TRIIDLHYRSPNKELAARVVNTLANTYIEQNFKTRFESTMQASDWLS
A0A2V9WPZ6      ----PN-------SRIIELHYRSPNQELAATVVNTLATTYVEQNFKTKFESTMQAADWLS
A0A2V9ZLH4      ----PN-------TRIIEIHYTSPNKELAATIVNTLVNTYIEQNFKTKFESTMQASDWLS
A0A2V9RQF1      ----PD-------SRVVDIHFRSPDRQLAAHVVNALTSTYIEQNFKTRFESTMQASDWLS
A0A2V9YDK8      ----PN-------SRIIELHYRSPDKNLAANIVNTLAATYVEQNFKTKFESTMQAADWLS
A0A2V9V8F7      ----PN-------SRIIELHYRSPNKELAATVVNTLATTYVEQNFKTKFESTMQAADWLS
A0A2V9XGR9      ----PN-------SRIIELHYRSPNKELAATVVNTLATTYVEQNFKTKFESTMQAADWLS
A0A2V9V3Q5      ----PN-------TRIIEIHYRSTDPTLAASVVNTLAATYVEQNFKTKFESTMQASDWLS
A0A2V9NWS3      ----PN-------TRIVDIHFRSPDRELAAHVVNTLISTYIEQNFKTRFESTMQTSDWLS
A0A2V9USA9      ----PN-------TRIIEVHYRSGDPQMAANVVNTLMQTYVENNFKSRFESTMQASDWLN
A0A2V9XW18      ----PN-------TRIIEVHYRSADPQMAANVVNTLMQTYVENNFKARFESTMQASDWLS
A0A4R1LC91      ----SG-------SRLIQITYLSSNPHTAAAVVNALSAALIDYTFQTRFNATNQASGWLS
A0A3M2BZG9      ----RD-------TQLVELTYRSDKPELAARIANGYAQAFIDWGIETRTSTVSRASTLLT
A0A1Q7N5R7      ----LS-------GNFLRIALTGPSATGVTGVVNAVADRFVAVATDLKRAKLTELGRLLR
A0A3M1SIV3      ----ER-------TNLFSINVANSNPELAAILANTIAEVYIERTIRRETEGMQKSLEDIT
A0A3E0PHB0      ----EG-------TNLVKLTMNGSDPELIRRVADTLTEVYKDRSIMLATKTQVEAHKELQ
A0A3M2D491      ----ER-------TNLFSVKVVHTNPELAARLANAIVGVYIDRAARREVEGTRKSLEDLT
A0A357F267      ----ER-------TNLVNVSIRSTNPDLAARVADKVAEVFRDQDAERETQGAKNASEDLG
A0A353C9L6      ----ER-------TNLVNVRVKSTNQALAPKVADKIAEVFKLRDAERETQGAKNSAADLA
A0A2V8RQV0      ----ER-------TNLVNVTIQNEDPALAGKVTDEIAAIFIEEDKERETQGERKAIEDLT
A0A2V8SJH5      ----ER-------TNLVNVSVTTPKAELSARVADKVEEVFIDKDAQRETEGSRRTYEDIS
A0A2V9QB26      ----GL-------TRVVEASYDSTDPRFAAAFLNTLVQEFMDSNMEARLKSSEYTSQWLS
A0A2V9VYY4      ----PS-------TRLIQVSYTHSDPRFATEITNALVKTFIEENFRTKYNSASQTSEWLG
A0A2V9KIE8      ----RR-------SNLVEVSFGSHDPRVAAQVANRLAQDYIDSNLQVKWDETIKASDWLQ
A0A352F549      ----KK-------TYLIDLRATHTDPVVATKVVNAMADAFALWNMEVKTKTNTVAGSYLQ
A0A3B9MLP9      ----KK-------TRLIDIRASHTDPGVAAKVVNAVADAFALWNIEVKTKTNTLAGTYLQ
A0A3D5SQ87      ----KK-------TRLIDIRASHTDPGVAAKVVNAVADAFALWNIEVKTKTNTLAGTYLQ
A0A2V8NW86      ----GL-------TRVVEASYDSTDPRFAAAFLNTLVQELMESNMEARMKSSEYTSQWLS
A0A2V8ZHL8      ----RD-------SHVVNISFEGPDSSLSAKIANSLASNFIEYNFRQKYDATRQASGWME
A0A2V9B240      ----RD-------SHVVNISFESPDPGLSAKIANSLANNYIEYNFRQKYDATRQASGWLE
A0A2V9CBM2      ----NR-------SRLVAVRFDSHNPDLAARVANNLAADYVEQGLDERWAAAQRASDWLS
A0A2V8XN17      ----NR-------SRLVAVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEWLS
A0A2V8WX45      ----NR-------SRLVTVRFDSRDPELAARVVNTLAADYVDQSLEARWQATQKAAEWLT
A0A1Q6YR79      ----NR-------SRLVTVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEWLS
A0A1Q7VA32      ----NR-------SRLVTVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEWLS
A0A2V9EY85      ----NR-------SRLVAVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAEWLS
A0A2V9H8K0      ----NR-------SRLVAVRFDSHDPELAARVVNTLAADYVDQNLEARWQATQKAAEWLS
A0A2V9FFE5      ----NR-------SRLVAIRFDSHDPELAARVVNTLAADYVDQSLEARWQATQKAAEWLS
A0A2V9GM43      ----NR-------SRLVAVRFDSHDPELAARVVNTLAADYVDQSLEARWQATQKAAEWLS
A0A1F2RFI7      ----RR-------SRLVEISFDSYDPALSARTANALAANFIDQNLEAKWDATQKASDWLS
A0A1F2RZS3      ----RR-------SQLVEITYESYEPSQSARVTNTIAANYIDMNLEAKWDATQKASEWLS
A0A1F2USE2      ----KY-------SRLVEVHFESEDPALAAQATNTLAANYIEQNLEARWEASQKASEWLS
A0A2V9C238      ----KR-------SRLVEISFESRDAELAARVLNALASHYIEQSLEVRWEATQKASEWLS
A0A1F2Q9F5      ----KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLS
A0A1F2QQH9      ----KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLS
A0A1F2QXK7      ----KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASEWLS
A0A2V9DEM9      ----KR-------SRLVEISFESRDAELAARVLNALASHYIEQSLEVRWEATQKASEWLS
A0A2V9CYQ5      ----NR-------SRLVAVRFDSQNPDLAARVANALAADYVEQGLDERWAAAQRASDWLS
A0A2V9BWU8      ----SR-------SRLVTVRFDSGNAQLSARIANALAEDYIDQSLEARWLATQKATDWLS
A0A2V8ZG48      ----SR-------SRLVNVRFDSNDAQLSARIVNTLAEDYIDQNLDSRWKATQKATDWLS
A0A2V8Y334      ----SR-------SRLVTVRFDSNSAELSARIVNTLAEDYIDKNLEARWKATQKAADWLS
A0A2V9AY68      ----SR-------SRLVTVSFDSNNARLSASIVNTLAEDYIDENLEARWMATQKATDWLS
A0A257VBK0      ----RD-------SALFRITVMAPYKADVAIWANAIAEAYQDRMLKDALDFIAKANEVML
A0A2V7XDY0      ----PE-------SRLVLIHVTHRYPKEAALWANTLADVYIEDTISTRVEAARKAYEWLQ
A0A350UQT3      ----PN-------TYLLQVSYRSPDPQLAADVANQVAQSYIEHTYNIRIRSSQSLSRFME
A0A2U3JZ71      ----PN-------TYLLLISYRSTDPRLAADVANGVARSYLEHTYNIRFKSSASLSAFME
A0A2V8TTB0      ----PN-------TYLLLISYRSPNRQLAADVANAIALSYLAHTYRIRYKATAGLSEFME
A0A1F2TCR2      ----QT-------TRLVSIQYRSPDPRFAALAANTIAEEYATQNLDLHLDNVLGKLAWLD
A0A2N9LQU7      ----PK-------TRVIEIRFQNVNPKLASDVVNGIVDAYLQRNFDVKYQGAVQVSEWLS
A0A2P6WFK7      ----PN-------TQIVEVLFRCTDPKLATDVANAVVEKYMQHTLQTRYEGTVQVSNWLS
A0A1F2V330      ----EG-------SDSFHLAFEGRGRTQVMNVTNDLSERFIRRLANMREQQVNEGAGLLN
A0A2V8U914      ----RD-------SQIIRVAFDAHDPQLAADFANTLARTFIEQSVNGRRRAAQEIQEWLG
A0A662EE63      ----AE-------SNVIELSMIGRNPDRVAEWLNVYVEQYIAANIEDGIDKTRKIYKVIQ
A0A2V7W309      ----HG-------TNLIVITYTGSSPKLAQKIAEAWGDSFMRMTIAKKLDSVRQATEFLS
A0A2V8TLH7      ----KD-------TGIMQITLDGPEPKEVQTWVNSVAEAYVDRNLDLSIEATGRAVKALL
A0A1Q7ZJT1      ----KE-------TGIVEISMEGLNPEEVASWVNTISEVYVERNLDQVVEATSRAVKALL
A0A2V8VC99      ----KD-------TGIVVIGLEGLNPEEVAAWANAIAEVYVDRNRDQAVEATAKAVRALL
A0A348UZU3      ----RM-------TRLVEVAFKAHDPALASDCVNALFDSFVDMNIEARYETTEQATEFLS
Q01XL7          ----GA-------TRLIELRCQSPSPEVAANFLNTLAAEHISQNLAIRSSATQRTSQWMD
A0A2V8ERZ5      ----RG-------SHLVDVSFVSEDPKFAAEAVNALIEEYVNQNLELKLQSTQGMLDWLD
A0A2V8GTX0      ----RG-------SRLVDVYFVSADPEFAARAVNVLAEEYVNENLDFRLQNTDKTLQWLT
A0A2V8J0X9      ----PN-------SRLVKIVYSHSDPKFAALAANTVADEYTQQNIDLRLQNTEKTLQWLG
A0A523DUV7      ----PD-------TRLAQIVVEHEDPREAARWADTLAESYIEQNLASKIEATRNVYSWLQ
A0A372IRG7      ----TG-------TQIVEIHFQNPDPEVAAKVVNAIVQAYMERDLRSRFEGTTRVSNWLS
A0A1F2U158      ----AE-------SKLVDVYFTSADPQFAATAANALADEYVASNLEVKMQGTQSMLDWLE
A0A2V8F6S9      ----TG-------SKLVDVTFQSSEPKFAATAANALVDEYVDSNLEIKQAGTQNMIEWLD
A0A4Q1SCH5      ----EG-------TQLVDVSFRDQNPQMAALLLNHVVDAYLRQSFNSRYGSVAQVRDWLS
A0A2W0BGU4      ----PG-------SRVVLVGFESRDPELAARIANTQVENYSDYNFRQKYDATRQAAGKME
A0A2W0BVQ9      ----PG-------SRVVLVGFESRDPELAARIANTQVENYSDRNFRQKYDATRQAAGKME
A0A3D1ASD2      ----PN-------TYLLQITYQSANPRLAAEVANGVANSFLQHSFEIRFKSSESVSQFMT
A0A2N9MK30      ----VN-------TYLLLISYRSPDRRLAADVANAIARSFVEHTYDIRFRSSASLSTFME
A0A1I6MH75      ----PK-------TEIIAISYTSLNAKLSADIANKVVSDYIQRSFETRFQSQQRVSAWLQ
E8WVF6          ----PK-------TDIIRIAYSSLDPKLSADVVNKVIADYQQRSYETRFDSTKRVSQWLS
A0A1H5Z7N3      ----AK-------TDLIHISCQTFSADLSAEIVNKLIREYIFRSLESSAEAQKRVSDFLS
A0A2V9YHT3      ----PN-------TRMIELRFSDPAPRETARVLNVFMDDYIQENIRAKYDSTMQATDWLT
A0A1G7JVV8      ----PR-------TQMIRITVTANKAQLAADLVNHLINAYQQRSFESRFASTQRVSQWLQ
A0A1H4T6W9      ----PR-------TAMVRITCTASKPQLAADIVNQVINAYQQRSFETRFESTKRISQWLS
I3ZEU5          ----PR-------TAMIKITCTASRPQLAADIVNQVINAYQQRSFETRFESTKRVSQWLS
A0A5B9EBI2      ----AR-------TNLITINYRSLDAHLSANIINTLIKDYIQRSYQTRFNSAQHASQWLT
A0A239HDF6      ----PR-------TNILRLSYSSLDGKLSAEIVNTVISEYIQRSYETRFASTQRVSKWLS
A0A4Q0T270      ----PK-------TEIMRISYSSLSPKLSADIVNKVVSDYIQRSYETRFASTQRVSQWLS
A0A1Q3QQB6      ----PK-------TEIINISYSSLNPKLAADIVNKVISAYIQRSYETRFASTQRVSRWLS
A0A3N1K1G7      ----PK-------TDIIRISYSSRSPKLSADVVNKVISTYIQRSFETRFASTQRVSQWLQ
A0A428MDU2      ----PK-------TDIIRISYTCLSAKLSADIVNTVIATYVHRSYQTRFDSTQRVSQWLS
A0A4V2G466      ----QK-------TELIRISFQSLSPKLASDIVNKIISAYIQRSYETRFSSSQKVSTWLS
A0A4Q7YNP3      ----GI-------TRLVEITCDSWNAEFAARFCNTLTTQFKEADLETRSSESEKTSRWLA
A0A2V9MN96      ----PR-------TRVIEITYIHPDPQLAAEVTNALVKTFVEENFRTKYESTSQTADWLS
E8UZE1          ----RG-------TEIVQIRYKSTNPALAATIANTVAAKYIQRNFETKYNTTHETSAWLQ
A0A2V7V2Z1      ----KS-------SRLVMVSYESFRPEMAAAAANGLSKLYIEQTLEFRYQTSSEAAQWLG
A0A2V7X2F7      ----KG-------TRLVGVGSEAFRPDLAMNVANKLSQLYIEQTLEYRYQTSSEAGVWLG
A0A2V7V2I1      ----RN-------SRLVLVGFEAYRPELAAQAANKLSQLYIQQTMEFRYQTSADAGLWLG
A0A2V7U3M2      ----KN-------SRLVLVAYESYVPEMAAAAANWLSQLYIKQTLEFRYETSSEAAQWLG
A0A2V7UHT0      ----RN-------SRLVTVTYESYRPDMAAAAANRLSQLYIQQTLEFRYQTSSEAAQWLG
A0A2Z5FVL3      ----PG-------TRVIEVAFSSSDPNLAARVVNQLVASLVNYSFQSRRTVDTEASKFLE
A0A1V6HR88      ----GQ-------TQMVDISYRSTDPALAARIANGVAETYIDWGIESRSNLAGKTSVFLG
A0A2V9KBD6      ----KG-------TRLIQIRFRSPDPQLAADVVNGLAKDYVDHYYQSQFQVSEQISAFLT
A0A2W0AJ66      ----RG-------TRLIEIKFRATDPRLAADVVNYVTKAYVDRNYSSQLYASNQLSQFLL
A0A1Q7RBU1      ----KG-------TRLIEIQFRNTDPRLAADVVNELARAYVDQYYKSLFQVSTQISEFLA
A0A2V9JPV9      ----KG-------TRLLEIKFRNTDPRLAADVVNQLTKAYVDRYYRNQFEASTQMSEFLA
A0A3E0P0A3      ----SG-------TQLFNLTYSTGDPEIAMMLANGYAEAFIETGKASSRADAAQASSDIQ
A0A2V8EXP2      ----RN-------SRLVDVKFSSLSPMLSSQVANALARAYIDQNLEFKFLSSKEASDWLG
A0A2W4RYA1      ----RN-------SRLVDVSFESPSAAFSMRVANALAKAYVQETLDYRLSASRDANDWLM
G8P0Y7          ----PD-------TTLVQVGYSDPSPALAAEIANGITAAYIEQNVKSRYDSTMQAADWLS
A0A5M8T4U7      ----GG-------TQMVDIRYRNHDPKLATDVVNTLMDTFIHENLRSKFDQTKQTSAWLE
A0A3P0X3W6      ----AS-------SLLLKITYRSKDPRKAADVANAVAHSYIDEAMDMRLHSSMNLSGFMA
A0A1E3Y9R6      ----RN-------SRLVDLRFRSPDPEFAARVVNQHAAQYIEQSLEFRLAATTQTNAWLT
A0A2W4TLP2      ----RN-------SRLVEIKFQSPDPEFAARVVNAHAEQYIEQSLQFRLEATSQTNAWLN
A0A3R9WF43      ----PD-------TRLINVTFENPDPTVAALAANSLAKTFIDDYLERRHRSTSQASYWLQ
A0A317HKM4      ----KD-------TRLVNVGFRSTDPEIAARVANALARAYVRWNVEYRSKMTGEASAWLS
A0A523E0N1      ----KK-------TQLMEVSFVSPDPELSAQLANSLVVQYRQFNIDSESGLARDTSSFID
A0A523ECP2      ----RN-------TQLMELKFTSTEPKVAADLANALARQYMTFSMEKETTLARDTAGFIR
A0A2W0C122      ----KN-------TRVVEVSFTGRYRDLNARIVNTLVDVFIDDNIRSRYEAANRAAKFLS
A0A2W0AUU7      ----KN-------TRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNIRSRYEAANHAAKFLS
A0A2W0BQL1      ----KN-------TRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNIRSRYEAANHAAKFLS
A0A4Q1SDL1      ----SG-------TRLIEIDFTNSDPKVAAAVVNHLIQALTDYAFQTRVNSTSEAATWLT
A0A3P0XH15      ----PG-------TQLVEVRFRNQSPAVAASVSNAIVDRYMDRSRRARYEGTTRISEWLA
A0A4R1LAZ7      ----PS-------TDVVEIHFSNPDPEVATNVANAIVDAYLERDLKSRFEGTTRVSSWLA
A0A3M1WQW8      ----RD-------TRIVKVTYESPDPQLAAQIVNALMDQLIEYTLMARFESTRQAREWLN
A0A3N1JHC1      ----GM-------SNLIRITLIGPDPHLAADTANELTNQYIQQGQNARLAAASETGVFLT
C1F294          ----PE-------TDLAEIHFQNQNPKVAQEAANEIVNAYQDWTLRAHFETMTRISDWLS
A0A2V9KA79      ----EG-------NDAFYVSFEGTGAAQVRDVANRLAEEFIHEVSAADESRVEEAAGLVG
A0A522PSP1      ----PG-------TYLLNVSYRSSSPDQSAAVANALAEAFIEHEYKTRNSALVSLTQYMR
G8P085          ----PS-------TQLVTISFRNPNPQVAALLANRLIEAYLRQTFDSRYGSVTQVTKWLS
A0A4Q1SGQ1      ----PG-------TRLIDVSYADPNPYLATAVVNRLLSALTEYTYQARFQATAQASDWLA
Q1ILD9          ----PR-------TGIVQLRFRSSDPELAAAVVNELAEAYTEHNFQVAYESTIKASDWLA
Q1IJZ6          ----PD-------TRLIQIAFEDPDPNFAAQVLNTLIGQYTQDVLTRRNASTTQASEWMS
A0A2V8TCE6      ----KD-------SNLVEVVYLSPDPRFCAQLANAVADAYIEFALSSQFDTTEQASDFLS
A0A522TBE8      ----PA-------SLLLNVSYQTQSATLAAQIANAIANSFLNLEYNSRAQALNQSTAYMS
Q1ITG0          ----PK-------TQVIEIRFRSTDPALAAKVVNTLTSSYMHHNFMTRFEATMQASAWLQ
A0A3N5PCI5      ----RD-------TRIIEVRYESPDPELAARVVNTLATTYITHNLEVQSQASKEATTWLA
A0A3M1Q0S9      ----RD-------SQLVTISFVHPDRVFAARVANALAEAYIRFSLAAKLDIAAQSEAFLV
A0A2Z5G448      ----PN-------TDLVEIHYRDPDPNQASRIAQAVVDQYLELDLRSRYEGTLRISNWLS
A0A3M1VZ38      ----RD-------SHLVEISFVHPDPRIAAEVANAIAYGYLRFTLDRKTRIAKQSKDWFV
A0A4Q1SD29      ----PN-------TEMVEISFRNPDPKVAMEGANGIVDAYLDRDLRAKFQGTTRVSNWLS
A0A3M1PY35      ----EK-------SNVVRVSYRHRDPEIAARIVNAVVRAYRDFFVESGTDARRGASEFLD
A0A3M1VMP2      ----EY-------SSVVRVSFTHPSPEIAANVVNAVVDAYRDFFVRTGVDARRGAADFLE
                                                                            

A0A2V7VMF7      ERLGETQKGMREAQDKLAKTYQG--QDG----------FVPEGSG---------------
A0A2V7YYV7      -------------------------GEL----------------K---------------
A0A2V7Z0J5      -------------------------KEV----------------N---------------
A0A2V7Z3M4      -------------------------SEV----------------K---------------
A0A399Y5V2      NDLQQKVDEATAELQQRDAELAD-------------------------------------
Q01X01          GDLKEIRNRA---LQTESDLNAY-------------------------------------
A0A3M2D9H8      AQIQQVEAQIADLQKQLAQSSEQSSEKR-LQ-------------D---------------
A0A2V8JK38      QQIVNLKGGLEKAEERLQKYGQD--NDILFT-------------E------DG-------
A0A2V9IXG5      RQLYEIKSMLASQQTQMNQYAES--SNLPVT-------------P------EM-------
A0A2V9J2P4      RQLYEIKSMLASQQTQMNQYAES--SNLPVT-------------P------EM-------
A0A1Q7RLS4      SEIAPLKEKLEDTQRTSFEFAEK--ANLYVP-------------E------NQ-------
A0A2V2R525      KRIYELQEQIKNGEERLINYAKD--NQI-IS-------L-----E------PS-------
A0A321LPW6      RSTRELQAKVQKAEQSVADYTRD--HNI-YS-------T-----E------GK-------
A0A2V9R9V4      RSTRELKSKIERSEQALADYTKT--NNI-YS-------T-----D------GK-------
A0A321LE75      TMVRERRAEVQKAEEELANYTRE--HNL-FS-------T-----D------GK-------
A0A2V8R8U7      QEIAKYQDKVNKEQDARFAFAKA--KDLPLG-------P-----E------SG-------
A0A2V8QMP4      NEIIDLQARIQANEQKRINYRKE--NDLPLG-------T-----K------QG-------
A0A2V8R4S3      NEIIDLQARIQANEQKRINYRKE--NDLPLG-------T-----K------QG-------
A0A2V8NJ55      NQIAELQLKIKADEEKLLNYKEK--NDIPIS-------T-----A------QG-------
A0A2V8Q7I0      REISEMQGKVRTKTERLFNYARE--YSLPLT-------E-----D------VM-------
A0A2V8S6K4      RQITDLQAQIAE-----LEKKRT--DALVQS-------G-----SAVNPEAKG-------
A0A317I2L9      KEIGELQFKVKHDQEVLFNYARE--NNLNPT-------G-----N------QN-------
A0A2V8LLF9      NQIAKVQDKIKKEEQDRFSFAKA--HNLPID-------N-----T------PG-------
A0A352FRF4      QEIAKYQGQVKQKQADVFNYAKQ--YELPLT-------D-----A------PA-------
A0A2V8MKV0      SQIGTYDELVKKERDDRIAYAKQ--YGLPLT-------P-----T------EN-------
A0A2V8PYY8      NQIATYERKVKEERDARVAYAKQ--YNLPLT-------P-----T------EN-------
A0A1Q7YKQ8      QKIAELQLEIRRQDEERVNYIKL--KNLPPS-------K-----S------PG-------
A0A352F3R7      KEIASYQTKIKQEQEAQFNYAKN--HNLPLT-------I-----D------AS-------
A0A0B6WXT1      KQIAELQLKIRQGEEARINYLRS--HNLPLG-------Q-----A------KG-------
A0A3B9MEU8      KEIAKLQTQIKHDQEAQFNYAKN--HNLPLT-------A-----E------AG-------
A0A2V8MHG6      RRIADLQSEIRSDEEQLINYAKN--HQI-LS-------L-----D------AS-------
A0A2V8P7N1      RRIDDLQSEIRSDEEQLINYAKN--HQI-LS-------L-----D------AS-------
A0A2V8M3M6      RRIDDLQSEIRSDEEQLINYAKN--HQI-LS-------L-----D------AS-------
A0A1Q7NJH5      RRIADLQSEIRSDEEQLINYAKN--HQI-LS-------L-----D------AS-------
A0A2V8PJY0      RRIADLQSEIRSDEEQLINYAKN--HQI-LS-------L-----D------AS-------
A0A1Q7Y6W9      RRIADLQGEIRSDEERLINYANQ--HQI-LS-------L-----D------PG-------
A0A2V8NC68      KRIADLQSEIRSGEEQLINYAKN--HQI-LS-------L-----D------AS-------
A0A399WK13      ERIASLQSDIRRDEEKLVEMTQN--AGI-LK-------T-----S------DD-------
A0A352FLX4      KRIAELQSNIRGKEEELINYGKN--HQI-LS-------L-----D------AN-------
A0A2V8RTL7      KRINDLQTDIRGDEIKLVELKQS--EGI-LK-------T-----D------GD-------
A0A3E0PCJ6      KRIGELQSEIRQGEERLVDLKKN--AGI-LK-------T-----D------EN-------
A0A3M1S4R8      ERIATLQSEIKRDEMRLAELKNN--AGI-LK-------K-----D------EG-------
A0A1Q7YFI6      RRIAEIQSEIRNGEERLINYAKN--NQI-LS-------L-----D------GS-------
A0A136KC10      ERIASLQSDIRRDEEKLVEMTQN--AGI-LK-------T-----S------DD-------
A0A2V8SEX6      RRITDLQSEIRSDELELAELQKN--IGI-LK-------T-----D------GE-------
A0A3M2D6Y5      ERIASLQAEIKRDEMRLAELKNS--AGI-LK-------K-----D------EG-------
A0A0B6WWQ6      RRIAELQAQIRAGEAQLLAYSKS--HQI-LS-------L-----D------PS-------
A0A3B9MK99      KRIAELQQQIRSDEERLVNYARN--NKI-IS-------L-----D------AN-------
A0A352EX26      KRIAELQQAIRSDEERLVNYAKN--NQI-IS-------L-----D------AN-------
A0A2V8MM59      KRVAELQDKIRSDEEKLVSYAKS--NQI-LS-------L-----D------AN-------
A0A2V8PFE8      KRVAELQQQIRADEEKLVSYAKN--NQI-LS-------L-----D------AS-------
A0A2V8PWS6      KRVAELQQQIRADEEKLVSYAKS--NQI-LS-------L-----D------AS-------
A0A2V8LCT5      KRVTELQSQIRSDEEKLVVYAKS--NQI-LS-------L-----D------AS-------
A0A352FTJ9      KRVEELQAQIRAAEEKLMAYAKS--NQM-LS-------L-----D------AN-------
A0A2V8G155      ERLAEQRKVVEQAEARLQAYREE--HDAIVP-------A-----E------DR-------
A0A2V8HDM7      ERLAEQRKVVEQAEARLQAYREE--HDAIVP-------A-----E------DR-------
A0A2V8DRT9      ERMGEQRKTVDASERALQVYREQ--HDA-VS-------L-----E------ER-------
A0A2V7VYF3      QQLAEQRKKVEVSELAIQRFRED--NDA-VS-------L-----E------DR-------
A0A1F2SVH2      ERLAEQRKQVEASEQAVQRYREQ--TDS-VS-------L-----E------EK-------
A0A2V8AJG9      ERLSEQRKQVEASEQALQRYREQ--TDS-VS-------L-----E------DK-------
A0A2G6PYV5      EKSNEYRQRIMELYSQLGEQQKN-SEDL-IV-------G-----R------AK-------
A0A2V8F956      QQLLEQRKQVEGAEKKLQQYREQ--NDS-IS-------M-----K------DR-------
A0A1F2S1W5      QQLAEQRNKVEASEQALQAYRER--TGS-VS-------F-----E------ER-------
A0A1F2T595      QQLAEQRKKVEASERALQEYRER--TDS-VS-------L-----E------ER-------
A0A2V8JQV5      LQLQELKVNLEKSEQELQDFGRA--TGL-MF-------T-----S------EKD------
A0A2V9AC41      QRLTELKERVEQSETALNSYRKD--KGI-IS-------V-----D------EK-------
A0A2V8K4L4      KQLDDLKIKLERSEDTLQSYALAVGLQF-TA-------SSKGKDG------DQ-------
A0A2V8NCZ3      KQMDDLKIRLEKSEDTLQSYAVAVGLQF-TG-------AA-SKDG------EQ-------
A0A2V9MAM9      PQLEELKGKLVKSEGELQAYLRS--SGL-IF-------G-----A------GQ-------
A0A2V9M454      QRLDELKLKVEKSEEAMVTYERQ--NNI-AN-------I-----G------DK-------
A0A2V9IVR7      QQLDELKAKVERSQQALVDYERD--NKI-IN-------I-----S------DK-------
A0A2V9ILE2      QQLDELKAKVERSQQALVDYERD--NKI-IN-------I-----S------DK-------
A0A2V9LGY4      QQLDELKAKVERSQQALVDYERD--NKI-IN-------I-----S------DK-------
A0A2V9J4D6      QQLDELKAKVEKSQEALVNYERA--NSI-VN-------V-----N------DK-------
A0A2V9L9C5      QQLDELKAKVEKSQEALVNYERA--NSI-VN-------V-----N------DK-------
A0A2N9M9N1      QQLDELKAKVEKAQQALVDYERE--YSI-TN-------L-----G------DK-------
A0A2V9JEC4      QQLDELKTKVERSQQALVDYEKA--NDI-AS-------I-----G------DK-------
A0A2V9LPQ3      QQLEELKAKVEKSQEALVGYERQ--NSI-VN-------V-----S------DR-------
A0A348V070      TQISALRKDIEEAEKKLAELGTA--QGI-LP-------L-----S------SA-------
A0A2Z5G3A3      SQMADLRKQSEALQAKVADLQKE--AGV-YT-------VGDGGPD------GK-------
A0A2V7UGP8      TQTTELKKQVSDLEAKLNQYGKE--NEI-IG-------L-----D------DK-------
A0A239MKT6      TQLEDLKRKIEENHRQVAAFQQK--SGI-VS-------EGMSAPA------PSAGGGARG
A0A3E0PCN7      KRVAELQSKIRAGEQNLLSYSRN--NEI-LS-------L-----D------PD-------
A0A2V8IYW3      SQLEDAKLRLIDREKKLEEYRRRYIGEL-PS-------Q-----L------QSNLQV---
G2LEI9          STAARLQQEILEEERKLTEYLRT--RKI-VS-------L-----K------PE-------
A0A317J121      GQLEETRNKLQEAQQHLQEFVQS--SGN-LF-------V-----L------QD-------
A0A2V7YW66      TQIETLKKEVQDKETQLQAFSRR--TDI-VT-------L-----D------PA-------
A0A2V7Z0V0      SQIEKLKEEIQDKETQLQAFSRR--SDI-VT-------M-----D------PA-------
A0A2V8GFD4      ARMAEQRSAVEASERALQQYREQ--YDA-IS-------L-----E------DR-------
A0A2V8HSS5      ARMAEQRSAVEASERALQQYREQ--YDA-IS-------L-----E------DR-------
A0A2V8KP55      QQIVNLKGGLEKAEERLQKYGQD--NDI-LF-------T-----E------DG-------
A0A399WNU1      KRVAELQAKIRTGEESLINYAKS--NQI-LS-------L-----D------AN-------
A0A2V9CG11      VKLDEMKAKLEQSEAQLQDYART--SGL-TF-------T-----S------EK-------
A0A2V2R0I6      DQLSELKVKVQKSEDARIAYERQ--NQI-WT-------L-----D------DK-------
A0A2V8XAR9      DQLSELKIKVQKSEDARIAYERQ--NQI-WT-------L-----D------DK-------
A0A2V8VZA0      DQLGELKIRVQRSEDARIAYERQ--NQI-WT-------L-----D------DK-------
A0A1Q7CB82      DQLGELKIRVQRSEDARIAYERQ--NQI-WT-------L-----D------DK-------
A0A2V8WIU1      DQLGELKIRVQRSEDARIAYERQ--NQI-WT-------L-----D------DK-------
A0A1Q6Y9F5      DQLGELKIRVQKSEDARIAYERQ--NQI-WT-------L-----D------DK-------
A0A2V9EVV8      DQLGELKIRVQKSEDTRIAYERQ--NQI-WT-------L-----D------DK-------
A0A2V8YF91      DQLSELKVKVQKSEDARIAYERQ--NQI-WT-------L-----D------DK-------
A0A2V8XZK2      DQLNDFKIKVQRSEDARIAYERQ--NQI-WT-------L-----D------DK-------
A0A2V8ZTX6      DQLRDFKIKVQKSEDARIAYERQ--NQI-WT-------L-----D------DK-------
A0A2V9BT79      DQLRDFKIKVQKSEDARIAYERQ--NQI-WT-------L-----D------DK-------
A0A1Q8B793      GQLNELKIRVEKSEDARIAYERQ--NQI-WT-------I-----D------DK-------
A0A2V9BCA0      DQLNELKIRVEKSEDARIAYERQ--NQI-WT-------I-----D------DK-------
A0A2V9BWU9      DQLNELQFKVEKSEDARIAYERQ--NQI-WN-------I-----D------EK-------
A0A2V9DKX2      DQLRELQFKVEKSEDARIAYERQ--NQI-WN-------I-----D------EK-------
A0A2V9JSI3      QQLDELKAKVEKSQQAMVDYERQ--NAI-VN-------I-----N------DK-------
A0A2V9WI32      VQLSDLQMKVETSQEKLVRYQKE--HDI-LG-------I-----D------EK-------
A0A2V8IVN9      ERLGEERKQVEAAEARLQQYREQ--NDA-IS-------L-----K------DR-------
A0A1F2TPT3      ARLAEQKEKLDASEQALEHFREQ--NQL-IT-------A----------------EG---
A0A2V8JTQ2      NQLKELQARVEDSQRKLVDYQKE--NGL-FG-------L-----D------DK-------
A0A2V8UZY0      NQLKELQSKVEESQQRLLAYQKQ--SGL-FG-------L-----D------NK-------
A0A3N5YNR8      KQLQDMKGKVEKSEQELVQYARE--NNI-VN-------I-----G------PD---R---
A0A350UEK1      RQMDDLRIKLERSEDALQSYAQR--NKL-VF-------T-----G------KD-------
A0A350UIQ4      KQLDDMRIKLERSEDALQNYAQR--NNL-LF-------T-----G------ND-------
A0A3N6A5T6      KQMHELKVKVEKSEEQLVAYARA--HNI-LS-------L-AGSSS------KEGDRS---
A0A1F2Q9L4      SQIEALKQEIQDKEAQLQAYSRR--SDI-VA-------L-----D------PS-------
A0A1H5SQF5      NQLSDLKNKVAESQRRVDDFRQK--VGI-IG-------APTMSSA------GSPQVG---
A0A3E0NV31      DQLAELENEIEDSQDQLLAFARS--RDL-DV-------D-----------------G---
A0A3N5M5V0      KQLQDMKGNVEKSEGDLYRYARE--NNI-LN-------I-----N------DR-------
A0A2V9AEW6      NHLDEMKTQLEASEAQLQDYARI--TGL-SF-------T-----S------EK-------
A0A2V8WQK6      SHLGKMKGELEASEAQLQDYARA--SGL-SL-------T-----S------EK-------
A0A2V8XIF4      NHLDQMKAQLEASETQLQEYART--SGL-SI-------T-----A------EK-------
A0A3N5XQP8      EELKELRVKVEQSERDLNDYART--KGI-FT-------T-----E------GS-------
A0A2Z5G7H4      GQLSDLKKQAEALQARVIALQRQ--SGV-VS-------L-GVQDA------QGRDQA---
A0A2V9L5B5      GKNAEIKAKLEKAEDELQAYAQA--NSI-VY-------I-----T------EK-------
A0A2V9LK56      GRLDELKGKLEKSDNALQEYAKK--NSI-LF-------V-----D------DR-------
A0A2V9L7I0      GKIVEIKAKLEKAEDALQAYAEA--NSI-VY-------I-----T------EK-------
A0A522PPT0      GRLVELKAKLKASEDALQAYAAK--NSI-LF-------IQNAVNA------QA-------
A0A2V9KCS3      RQLEDQRINLEKSEDRLQGYARS--SGL-MF-------T-----A------EK-------
A0A2U3KC61      AKLDDLRRKVQTSEEILVRYQKD--HSI-LG-------V-----D------EK-------
A0A2V9Y2R7      GQLADLQLKVETSEGKLVRYQKE--HSI-LG-------I-----D------EK-------
A0A372IT17      GQMSGLKKQAEALQTKAIGLQSE--AGM-YG-------D-----N------GS-------
A0A136JPP4      KSIADLKVTIADQENKLTEYMRS--SNL-PL-------Q-----E------KG-------
A0A399WUJ8      KSIADLKVTIADQENKLTEYMRS--SNL-PL-------Q-----E------KG-------
A0A2V9NGH6      KQLIDLQIKVETSQEKLVRYQKQ--HQI-LG-------I-----D------EK-------
A0A2V9PYE6      KQLIDLQMKVETSQEKLVRYQKQ--HQI-LG-------I-----D------EK-------
A0A2V9NL07      RQLVDLQMKVETSQEKLVKYQKD--HQI-LG-------I-----D------EK-------
A0A2V9QD92      RQLVDLQMKVETSQEKLVKYQKD--HQI-LG-------I-----D------EK-------
A0A2V9WPZ6      KQLVDLQMKVETSQEKLVKYQKQ--HEI-LG-------I-----D------EK-------
A0A2V9ZLH4      KQLVDLQMKVETSQQKLVKYQKE--HSI-LG-------I-----D------EK-------
A0A2V9RQF1      KQLVDLQLKVETSQEKLVKYQKE--HGI-LG-------I-----D------EK-------
A0A2V9YDK8      KQLVDLQMKVETSQEKLVKYQKQ--HEI-LG-------I-----D------EK-------
A0A2V9V8F7      KQLVDLQMKVETSQEKLVKYQKQ--HEI-LG-------I-----D------EK-------
A0A2V9XGR9      KQLVDLQMKVETSQEKLVKYQKQ--HEI-LG-------I-----D------EK-------
A0A2V9V3Q5      KQLVDLQMKVETSQEKLVRYQKE--HEI-LG-------I-----D------EK-------
A0A2V9NWS3      KQLVDLQMKVETSQEKLVKYQKE--HEI-LG-------I-----D------EK-------
A0A2V9USA9      KQLVDLQMKVETSQEKLVRYQKE--HEI-LG-------M-----D------EK-------
A0A2V9XW18      KQLVDLQMKVETSQEKLVRYQKE--HEI-LG-------A-----D------EK-------
A0A4R1LC91      NQLADLRKQSEDLQARVVELQKK--AGI-VT-------L-----G------DDGTGR---
A0A3M2BZG9      SQIEELSREIEKLRTKLASSAAE--ANL-VL-------D-----P------DG-------
A0A1Q7N5R7      EQLQAAEAGMHRAESALEAFRVR--T---IT-------L-----P------GDPGVA---
A0A3M1SIV3      KSIDQLQENIAELENQRIAQMRE--SGL-PL-------A-----E-------K---G---
A0A3E0PHB0      NSIEKLKKTIEDGEQNYIGALRE--SNL-PV-------G-----D------GK---G---
A0A3M2D491      KSIEELKENIAQLEQQRIEEMKS--SGL-PL-------A-----E-------K---G---
A0A357F267      RSIDELRETIAQQEIELIEYMRS--SGL-PL-------Q-----E-------K---G---
A0A353C9L6      KSIEELQNTIAQQEIDLIAEMRS--SGL-PL-------Q-----E-------R---G---
A0A2V8RQV0      KSIEELKLTIQDQESQLMAQMRE--SDL-PL-------L-----E-------K---G---
A0A2V8SJH5      KSIEELGKTISEQEADLISYMRS--SGL-PL-------Q-----E-------K---G---
A0A2V9QB26      RQLEDMRIKLEHSEDALQSYARS--TGL-IF-------T-----S------EK-------
A0A2V9VYY4      KELADLQLKVQTSEEKLVRYQKD--HGI-LG-------V-----D------EK-------
A0A2V9KIE8      GQLVGLKAKLEKSDDQLQAYAQE--HSI-LF-------I-----T------EK-------
A0A352F549      KRIAELQSQIRSGEEQLVNYAQS--HEI-LS-------L-----D------AS-------
A0A3B9MLP9      KRIGELQSQIRNGEEQLVNYAQS--HEI-LS-------L-----D------AS-------
A0A3D5SQ87      KRIGELQSQIRNGEEQLVNYAQS--HEI-LS-------L-----D------AS-------
A0A2V8NW86      RQLEDMRIKLEHSEDALQSYARS--TGL-IF-------T-----S------EK-------
A0A2V8ZHL8      QQLDELKAKVEKSQQALVDYERQ--NAI-VN-------I-----S------DK-------
A0A2V9B240      QQLDELKAKVEKSQQALVDYERQ--NLI-VN-------I-----S------DK-------
A0A2V9CBM2      RQLLSVKAKLEKSEDQLQAYARH--NGL-VF-------L-----Q------TDNGTT---
A0A2V8XN17      QQLVGVKAKLEKSEDELQSYARR--NGL-VF-------L-----E------TDKGAS---
A0A2V8WX45      QQLVGVKAKLEKSEDELQTYARR--NGL-VF-------L-----E------TDKGAS---
A0A1Q6YR79      QQLVGVKAKLEKSEDDLQSYARR--NGL-VF-------L-----E------TDKGAS---
A0A1Q7VA32      QQLVGVKAKLEKSEDDLQSYARR--NGL-VF-------L-----E------TDKGAS---
A0A2V9EY85      QQLVGVKAKLEKSEDELQGYARR--NGL-VF-------L-----E------TDKGAS---
A0A2V9H8K0      QQLVGVKAKLEKSEDELQSYARH--NGL-VF-------L-----E------TDKGAS---
A0A2V9FFE5      QQLVGVKAKLEKSEDALQGYARH--NGL-VF-------L-----E------TDKGAS---
A0A2V9GM43      QQLVGVKAKLEKSEDALQSYARR--NGL-VF-------L-----E------TDKGAS---
A0A1F2RFI7      QQLVGLKGRLEKSEEDMQRYAKD--NAI-LF-------L-----D------EK-------
A0A1F2RZS3      QQLVGLKGKLEKSEEDLQRYAKE--NSI-LF-------L-----D------EK-------
A0A1F2USE2      QQLTGLKAKLEQSEEELQTYAHE--QGL-LF-------L-----Q------NQRGEN---
A0A2V9C238      QQLLELKARLEKSENEMQSYARE--NGL-LF-------L-----E------KEKG-A---
A0A1F2Q9F5      EQLLEIKANLEKSEEQLQAYARQ--NGL-LF-------L-----E------NEAGQP---
A0A1F2QQH9      EQLLEIKANLEKSEEQLQAYARQ--NGL-LF-------L-----E------NEAGQP---
A0A1F2QXK7      EQLLEIKANLEKSEEQLQAYARQ--NGL-LF-------L-----E------NEAGQP---
A0A2V9DEM9      QQLLELKARLEKSENELQSYARE--NGL-LF-------L-----E------REKGVP---
A0A2V9CYQ5      RQLLSEKAKLEKSEDQLQAYAHR--NGL-VF-------L-----Q------TDNGTT---
A0A2V9BWU8      QQLVGVKAKLEKSEEQLQDYARH--NGL-VF-------L-----E------NDKGAS---
A0A2V8ZG48      QQLVGVKAKLEKSEEQLQDYAQR--NGL-VF-------L-----E------TDKGTS---
A0A2V8Y334      QQLVGVKAKLEKSEEQLQDYARH--NGL-VF-------L-----E------TDKGAS---
A0A2V9AY68      QQLVGVKAKLEKSEEQLQDYARH--NGL-VF-------L-----E------SDKGVS---
A0A257VBK0      AEAKKMQDQYARQQTTMTTSLAA--SGS-YF-------P-----Q------NQKE-----
A0A2V7XDY0      ERLGATQKSMREAQDRLFKSYQS--QDL-FV-------P-----E------GSTS-----
A0A350UQT3      RQIEELRVKMEDSSGRLAQMERE--LNV-IN-------P-----E------EKTN-----
A0A2U3JZ71      KQLEELKAKMERSSGALVQFERE--LNV-IS-------P-----E------EKTS-----
A0A2V8TTB0      RQLEELRAKMEKSSAALAQFERE--LNV-IN-------P-----E------EKTS-----
A0A1F2TCR2      DELKKQQQKVTDSEAAMMQYREQ--KDA-LS-------L-----D------SSQN-----
A0A2N9LQU7      KQMEELKLNAARAEQRLAEFQKQ--NNI-LG-------T-----D------ENNN-----
A0A2P6WFK7      KQMDDLQTRATQSQQRLSEFQMK--NNM-IG-------A-----D------ENDN-----
A0A1F2V330      AELETLRSQLNEQEERLKIYKES--AVN-EL-------P-----D------RLATNLS--
A0A2V8U914      PRIQELRSKLQTSEAALDEYTRE--SGL-VL-------A-----P------GDDT-----
A0A662EE63      SRLDPLRLQVEAGQRKLMSFQEG--HDS-LG-------F-----A------DEQKS----
A0A2V7W309      QQIATVQANLEESRQDLLSYGKS--KGI-IS-------V-----D------EGSN-----
A0A2V8TLH7      SEIAPMREKLQDTQRSSFELAEK--ENL-YV-------P-----E------NQQK-----
A0A1Q7ZJT1      SEIAPLKEKLEDTQRTSFEFAEK--ANL-YV-------P-----E------NQQK-----
A0A2V8VC99      SEIAPLREKLKDSQQSTFEFAER--ANL-YV-------P-----E------NQQK-----
A0A348UZU3      EQIAELKKEISQKEQELQNYGQE--KDI-VI-------L-----S------DKET-----
Q01XL7          SQMEEAKSRLQTAGEKLRDFVRQ--SGM-DF-------F-----P------EQST-----
A0A2V8ERZ5      KELDNQQKRVEGSEKGLAEYREK--ENA-LS-------L-----D------DKQN-----
A0A2V8GTX0      EEVAKQQSVVQASERMLAEYREN--QNA-IS-------L-----E------DRQN-----
A0A2V8J0X9      EELKRQEQQLAASEGALTEYRER--NNA-LS-------L-----E------DRQN-----
A0A523DUV7      ERLAAAEGDVKSSENSLYEYTKQ--QDL-FV-------P-----S------GGQS-----
A0A372IRG7      QQLSTLKSQVQSSQQELSDYQKK--NNL-VG-------L-----G------PTGTS----
A0A1F2U158      KEVATQQSKVEQSERDLAEYRDR--ENA-MS-------L-----D------EKNN-----
A0A2V8F6S9      KELAKQLQKVQESERAMANYRER--QNA-LS-------L-----D------DKQN-----
A0A4Q1SCH5      AQMDDLQKHAADAQQKLAKFQED--NNL-VG-------T-----D------PTDN-----
A0A2W0BGU4      EQLDELKAKVEKSQRALVEYERQ--NAI-LS-------I-----G------EKQN-----
A0A2W0BVQ9      EQLDELKAKVEKSQRALVEYERQ--NAI-LS-------I-----G------EKQN-----
A0A3D1ASD2      KELEELKAKMERSSDALAKFQRD--LSV-VN-------P-----E------EKTS-----
A0A2N9MK30      KQLEELRAKMERSDTALAQFEKE--LNV-IN-------P-----E------EKTN-----
A0A1I6MH75      NQLDGLKQEVETSQEQMMDLQKR--LGT-LG--FD---P-----K------DNQ------
E8WVF6          GQLDDLKRQVETSQEQVLDLGKK--LGT-LG--FD---S-----T------HNQ------
A0A1H5Z7N3      TQLGDLKQQVETSQEQMIDLQKK--IGI-LG--FD---P-----T------HNE------
A0A2V9YHT3      RQLSELRMKVESSQEKLVKYEKD--NDI-LG--ID---E-----K------QNI------
A0A1G7JVV8      GQLDDLKQQVEASQEQLMDLQKK--IGV-LGLGADASKP-----V------TTQ------
A0A1H4T6W9      GQLDDLRQQVETSQEQLIDLQKR--LGV-LGLGFDATKP-----P------TTQ------
I3ZEU5          GQLDDLRQQVETSQEQLIDLQKR--LGV-LGLGFDATKP-----P------TTQ------
A0A5B9EBI2      GQLDDLKQQVETSQEQLLELQRR--LGS-VGVSID---P-----T------HSQS-----
A0A239HDF6      KQLEDLKADVEASQEKMINLQRR--LGI-LG--FD---P-----T------HNQ------
A0A4Q0T270      GQLDDLKAQVELSQEQMMDLQKR--LGV-LG--FD---P-----K------DNQ------
A0A1Q3QQB6      SQLDDLKQQVETSQEQMMDLQRK--LGI-VG--FD---P-----N------HNQ------
A0A3N1K1G7      GQLDDLKQSVETSQEQMMELQKR--LGI-LG--FD---P-----S------HNQ------
A0A428MDU2      GQLDDLKQQVQTSQERMMDLQRR--LGM-LG--FD---P-----S------HNQ------
A0A4V2G466      GQLDDLKQQVQASQEQMLDVQRR--LGI-LG--FD---P-----N------HSQ------
A0A4Q7YNP3      QQAADIKLLAEESQHKLEAATGG--NGL-VL-------S-----Q------ESTT-----
A0A2V9MN96      KELSDLQLKVQASEEKLVRYEKQ--KGI-VG-------I-----D------EKQN-----
E8UZE1          DQLETLRHQVDADQKNFEEFQER--TGL-LQ-------T-----G------EGHN-----
A0A2V7V2Z1      QQIEEQKGKVEQAERALQQVKEQ--EGI-VN-------I-----E------ERRT-----
A0A2V7X2F7      GQIDQQRQKVEQATQELQKLKER--EGI-VN-------I-----E------ERRT-----
A0A2V7V2I1      SQIEEQRHKVEQAELALQKLKEK--DGI-VN-------I-----E------ERRT-----
A0A2V7U3M2      QQIEEQKAKVEAADLALQKVKEQ--EGI-VN-------I-----E------ERRT-----
A0A2V7UHT0      QQIEEQKTKVEEADRALQKVKEQ--EGI-VN-------I-----E------ERRT-----
A0A2Z5FVL3      SQLAEMKADSDALEQKAVKLQKQ--TGV-VQ-------V-----A------GSGDGDGQG
A0A1V6HR88      AQIETLKQEIQDKENQALAYSKR--ADI-VT-------L-----D------TGGN-----
A0A2V9KBD6      NQLKELQARVEDSQQKLMEYQKQ--NGI-LG-------L-----D------NQQN-----
A0A2W0AJ66      NQLTDLKAKVEESQQKLVDYQNR--NGI-FG-------L-----D------DKQN-----
A0A1Q7RBU1      NQLKELQAKVEESQQKLVDYQKE--NGI-FG-------L-----D------DKQN-----
A0A2V9JPV9      SQLKELQAKVEESQQKVVDYTKE--IGI-FG-------L-----G------DKQN-----
A0A3E0P0A3      AEISSLEAEIQELEADLVSYTQS--SDI-VA-------P-----N------EETN-----
A0A2V8EXP2      ERLAEQRQKVEVSEQAVQRYREQ--TES-VA-------F-----E------DRQN-----
A0A2W4RYA1      ARLAEQRKAVEEAEAALQRYREQ--NNA-LS-------L-----Q------DSQN-----
G8P0Y7          KQLADMQIKMETAQAKLVQYQKE--HAI-VG-------T-----D------DKQN-----
A0A5M8T4U7      KQLEDLKEQAADAQIRLANFQKQ--HNI-VG-------T-----D------ENSN-----
A0A3P0X3W6      KQLDDLKANMDKSAEALTTYQRQ--LGV-ID-------P-----E------QQTS-----
A0A1E3Y9R6      SQLEEQRRLVEESERRLQDYKEQ--NNA-TS-------V-----D------DK------Q
A0A2W4TLP2      TQLEEQRRLVEESERKLQQYKEQ--HNT-VS-------V-----D------DK------Q
A0A3R9WF43      KELDDLKKQVRDSEQRLADYERT--TGL-AG-------V-----Q------VSGSTSG-D
A0A317HKM4      RQVEEQRKLLEASETALQAYRRD--HGA-DA-------L-----V------RTNQLGEER
A0A523E0N1      EEIGELRNDIQEKERLLRDYSRE--NQI-VI-------A-----E------DEN-----N
A0A523ECP2      EQVEKIQVEIQEREQRLQEYSQR--QDL-MM-------V-----D------EKEL-----
A0A2W0C122      AQLTELRATVEESQQKLVAYERE--HNI-LM-------V-----D------DK------Q
A0A2W0AUU7      TQLNELRAKVEESQQKLVAYERE--HNI-VM-------V-----D------EK------Q
A0A2W0BQL1      TQLNELRAKVEESQQKLVAYERE--HNI-VM-------V-----D------EK------Q
A0A4Q1SDL1      GQLGDLRKQSEEEQEKLAALEKQ--TGI-YS-------F-----G------TDN-----Q
A0A3P0XH15      KQLEPLKNQVTESQDALSTYQKQ--NNL-IG-------V-----D------SNGSG---Q
A0A4R1LAZ7      QQLTALKGQVEDSQKALAKFQRD--NNL-IG-------I-----D------SEG-----G
A0A3M1WQW8      KRLTELREKLEQLQEELVRYSRE--HEI-IQ-------L-----D------ENQT-----
A0A3N1JHC1      QQLEGAKKKLQESGEALQEYARA--SGI-VL-------T-----S------ETQ-----E
C1F294          QQIISLRESVNKSQNDLVQYQRE--HNL-LS-------V-----G------QQG-----S
A0A2V9KA79      ARVEQLRKQMQEQQDRITRYKQA--TLS-EL-------P-----E------NLGNNYKLL
A0A522PSP1      EQVKELSERMKESQLALNAFERE--NSI-I--------N-----P------ENT-----S
G8P085          SEMDSLRERAAEAQKKLADFQEK--NNI-LM-------L-----G------GGSSGSSKD
A0A4Q1SGQ1      GQLKGLRAQTQALEDRASRLQRD--TGI-Y--------G-----D------DAG-----H
Q1ILD9          KQLVELKTGIQSSEQQIADYQKT--HKI-I--------G-----T------DEN-----N
Q1IJZ6          AQIKDLNQQVEAAQQKLINYEKE--SGL-IA-------I-----T------ATD-----P
A0A2V8TCE6      RRVGELRDEVEDLEKRLQSYRES--RRI-L--------P-----S------AGA-----E
A0A522TBE8      GQLDNLRAQTEQAQQNLVSYESR--ANI-L--------D-----P------DSK-----D
Q1ITG0          QRLTELKNNVEESQRKLAEYQSK--ANI-I--------G-----T------DET-----D
A0A3N5PCI5      EQLAEQRRKVEVSELALQKYRER--ENS-L--------S-----L------EAG-----Q
A0A3M1Q0S9      DQVRSLKEDINRRRLELHEYAMR--HNI-V--------------T------GDA-----N
A0A2Z5G448      GQLTELKAHAADAQRKIAQFQRA--NNL-IG-------M-----D------AEG-----G
A0A3M1VZ38      ERVAELKREVSDLELALQDYAAQ--HQI-V--------------L------GQG-----E
A0A4Q1SD29      QQLTSVKKQVEDAQQDLAKFQRE--NNL-VA-------M-----D------ATG-----G
A0A3M1PY35      RRIEDAQAELLELERRLAEERRR--LGP-V--------L-----A------RGS-----D
A0A3M1VMP2      RAIQEAQAEVLELEAKLAQARRQ--APP-T--------V-----P------ERE-----D
                                                                            

A0A2V7VMF7      ---------GSAAASSIGKLNE----DYVAAQARRIGIEAALKQFAEMRKARKNLDTI-P
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------VTNIISGLQA----EINQLQADIVRLESDHETVLG-------------
A0A2V8JK38      ---------RNTVTEKLRQLQE----EYTRAQAERIQKQSYERMVRTGS----------A
A0A2V9IXG5      ---------ASVEFEMVSRYRA----DYEDAKAKREEEEQKLAKLETYIADSSKLTNI-P
A0A2V9J2P4      ---------ASVEFEMVSRYRA----DYEDAKAKREEEEQKLAKLETYIADSSKLTNI-P
A0A1Q7RLS4      ---------QKITNDRLSTLQS----ELTEAQVKKGEIEGLLKQIDANRQNGGAYENI-P
A0A2V2R525      ---------QNTVVERLNSLNR----SLLTAENDRTLAEAAYRAAL----E--------P
A0A321LPW6      ---------ETLTTDKLSRLHD----QVMRAETDRLLKGSLYEELN----M--------G
A0A2V9R9V4      ---------ATLVAEKLSRLHD----LATRAETDRILKESLYEQVR----Q--------G
A0A321LE75      ---------EAPAVNKLAQLYT----QVTTAEVQRKLKESLYQQVK----G--------G
A0A2V8R8U7      ---------PNIEAVRDATYSS----QLLAAENERRTFLAIYEAAKN---A--------P
A0A2V8QMP4      ---------QDLNALQLSTYSS----QMQTAEAA-------YTSAEQTKNT--------S
A0A2V8R4S3      ---------QDLNALQLSTYSS----QMQTAEAARKQAEADYKSAVETRNT--------S
A0A2V8NJ55      ---------VDITNVRVGSYSS----QLIEAENKRKQAQATYDAARN---S--------S
A0A2V8Q7I0      ---------LNTEAQRLADLTK----QLFESENKRKNAEAVYKSAST---A--------T
A0A2V8S6K4      ---------ANVTVERVAMLST----EWLNAQNEVTKLQSEYDAAQKAQAA--------S
A0A317I2L9      ---------LDVEGQRLNSLSG----QLLDAENQRKTAQAIYNSAKN---A--------S
A0A2V8LLF9      ---------TNLEAMRLQTYSA----QLLAAEDNRRSQEAIYDAARD---A--------N
A0A352FRF4      ---------SNLRQQRVSTYSS----QLLEAENQKRSLQSAYEAAKT---S--------P
A0A2V8MKV0      ----------NVPIQREQTYNK----QLLDAQNEYRKLKADYDEAKA---S--------T
A0A2V8PYY8      ----------NVAAQSEQAYNK----QLHDAENERRKLKADYEEAKG---A--------A
A0A1Q7YKQ8      ---------ADLAADRLAQLSK----QLLEAENNRKNLQSLYEAAAH---Q--------S
A0A352F3R7      ---------SNLEVARLSTLSS----QLLQAENDRKLIQAQLEAARR---E--------K
A0A0B6WXT1      ---------QNLTLERLATLSG----QLLEAENERKNLQSAYEAAQR---E--------T
A0A3B9MEU8      ---------GNLEAARLATLSG----QLLQAENDRKMIQAQLEAARK---E--------P
A0A2V8MHG6      ---------QNTVVDRLAGLNK----QLLEAENERKAAEAAYRATL----A--------P
A0A2V8P7N1      ---------QNTVVDRLAGLNK----QLLEAENERKAAEAAYRAVL----A--------P
A0A2V8M3M6      ---------QNTVVDRLAGLNK----QLLEAENERKAAEAAYRAVL----A--------P
A0A1Q7NJH5      ---------QNTVVDRLAGLNK----QLLEAENDRKAAEAAYRAVL----A--------P
A0A2V8PJY0      ---------QNTVVDRLAGLNK----QLLEAENDRKAAEAAYRAVL----A--------P
A0A1Q7Y6W9      ---------QNTVVERLAGLNR----QLLEAENQRKLAQAVYEASL----Q--------P
A0A2V8NC68      ---------QNTVVDRLVGLNR----QLLEAENDRKMAEASYRAAL----R--------P
A0A399WK13      ---------STIVMDRLSGLNK----AMLEAENARKNAEANYFEIAK---S--------P
A0A352FLX4      ---------QNTVVERLEGLSK----QLLIAENERKMAESAYKASL----Q--------P
A0A2V8RTL7      ---------QTIVIDRLSGLNK----QLLEAENARKLAEAKYFAIKD---S--------P
A0A3E0PCJ6      ---------TTIVTQRLMGLNE----QLLEAEEQRKNAEAQFNAVRD---S--------P
A0A3M1S4R8      ---------QTIVIDRLAGLNK----QLLEAENIRKIAEAEYMAVKD---S--------P
A0A1Q7YFI6      ---------QNTVVERLAGLNR----QLLEAENERKLAEAAYRAAQ----A--------P
A0A136KC10      ---------STIVMDRLSGLNK----SMLEAENARKNAEANYFEVAK---S--------P
A0A2V8SEX6      ---------QTIVLERLAGLNK----NLLEAENKRKNAEAQYVAIKD---S--------P
A0A3M2D6Y5      ---------QTIVIDRLAGLNR----QLLEAENARKIAEAEYNAVKD---S--------P
A0A0B6WWQ6      ---------QNTVVERLAGLNR----QLLDAENERKLAEAAYLASL----E--------P
A0A3B9MK99      ---------QNTVVERLGGLNK----QLLEAENARIEAESKFNAAK----V--------G
A0A352EX26      ---------QNTVVERLAGLNK----QLLEAENERKTAEAAFNAAK----A--------P
A0A2V8MM59      ---------QNTVVERLSGLNK----QLLEAENDRKLAEAEYNAAK----A--------P
A0A2V8PFE8      ---------QNTVVERLAGLNK----QLLEAENDRKMAEAEYNAAK----A--------P
A0A2V8PWS6      ---------QNTVVERLAGLNK----QLLEAENDRKMAEAEYNAAK----T--------P
A0A2V8LCT5      ---------QNTVVERLAGLNK----QLLEAENDRKMAEAEFNAAK----A--------P
A0A352FTJ9      ---------QNTVVERLAGLNK----QLLEAENDRKMAEAEFNAAK----A--------P
A0A2V8G155      ---------QNIVVQRLADLNT----ALTRAKTERIQKQAAYDQIRNARDVPGSVDTF-P
A0A2V8HDM7      ---------QNIVVQKLADLNT----ALTRAKTERIQKQSAYDQIRNARDVPGSVDTF-P
A0A2V8DRT9      ---------QNIVVQKLADLNA----AVTRAKTERIQKESAYEQIKAVQSDREALDTI-P
A0A2V7VYF3      ---------QNIVVQKLADLNG----AVTSAKNERITKEAGYNRLRTMADDRSALDAF-P
A0A1F2SVH2      ---------QNIVVQKLSELNA----AVTRAKTERIEKEAAYNQIRTVQNDRATLDTI-P
A0A2V8AJG9      ---------QNIVVQKLADLNA----AVTRAKTERIQKEAAHNQLRGLQHDRNALDTF-P
A0A2G6PYV5      ---------SAVEEQALVKLNE----EIAVANRSFIEKRNNLQALQAST----------P
A0A2V8F956      ---------ENIVVQKLTELTG----AVTQAKTERFQREALYRQVESLRGNPAMLDTF-P
A0A1F2S1W5      ---------QNVVVQRLADLNA----AVTKANTVRIQKEATYNQVKAVLENPAAIDTV-P
A0A1F2T595      ---------QNIVVQKLQELNA----AVTRANTARIQKEAVYNQVRTVLEDPAAMDTV-P
A0A2V8JQV5      ---------SSVAEEKLHHLEA----DLSEALADRVEKQSKYEIAKSAP-----VESL-P
A0A2V9AC41      ---------ENVVIDRLLDLNR----SLTKAEAERIGLEAQMHSIHGRN-----YDEV-P
A0A2V8K4L4      ---------ENVASASVRLVQE----ELLKARADRMIAQSKYELLASSP-----PEAL-P
A0A2V8NCZ3      ---------ENVVSTSVRLLQE----ELLKARAERMVTQSRFELIQSSP-----PEAL-P
A0A2V9MAM9      ---------ETLAENRLHLIES----ELSKAQADRIAKTPAYQLADKEH----------P
A0A2V9M454      ---------QTAEEARFEDMSK----ELSQAQSDRISKESLYKMVVSNEAQV-------G
A0A2V9IVR7      ---------ENVEEKKLGDLSK----ELTDAQAEVVRAESLYNVARNNENQM-------A
A0A2V9ILE2      ---------ENVEEKKLGDLSK----ELTDAQAEVVRAESLYNVARNNENQM-------A
A0A2V9LGY4      ---------ENVEEKKLGDLSK----ELTDAQAEVVRAESLYNVARNNENQM-------A
A0A2V9J4D6      ---------QSVAEQRLSELSS----DLTRAQSDRAEKESLHQLVKSNEAQI-------A
A0A2V9L9C5      ---------QSVAEQRLSELSS----DLTRAQSDRAEKESLHQLVKSNEAQI-------A
A0A2N9M9N1      ---------ENVVQQRLAQLST----DLTAAQVERANKQSVYDSARHNNAEA-------A
A0A2V9JEC4      ---------ENVVQLRLEDLSK----DLTTAQTDRAQKESLWESVQEDNSLA-------E
A0A2V9LPQ3      ---------QNVVEQRLSDLSR----DLTTAESDRAQKESLYQMVKSNPEQI-------A
A0A348V070      ---------EAPLIQKITEVNT----ALTAATLDRVNKFSAYNQLKALR-----PEEL-P
A0A2Z5G3A3      ---------TQAYSSDINRLEL-ATTALSGAESNRILTGAVEQIVKTGD----------P
A0A2V7UGP8      ---------ENITNQKLGQLNQ----DVLEAQVESSRKEARYRGLLTTP----------P
A0A239MKT6      NIGAMAPSVDSTAFQRLSALNE----ELTRAEVARIQREALYHIIQTND----------V
A0A3E0PCN7      ---------QNIVVQRLSDLNG----KLNQAEMERINAEAALSAAQQDP-----MRGV-T
A0A2V8IYW3      ---------IQTTQIQLQSLSE----SLNRDRDRRLVLERGLADMRADPATAAATAD--P
G2LEI9          ---------DNPEVARLTGLNQ----ALLEAEKERLRAEERYQASLTQP-----IDSL-D
A0A317J121      ---------NTLDNSKLRQLQG----ELSAIQADRIAKQAKYELVAKTS-----PEAL-P
A0A2V7YW66      ---------TNVILKRLEVLNG----SLMEAKRVRIEKEAKYHETITGP----------K
A0A2V7Z0V0      ---------ANVTLKRLEALNT----QYIEAKKMRIEREAQYHETQSGP----------R
A0A2V8GFD4      ---------QNIVVQRLEDLNG----AVTKAHTERLQKQALFEQLQAARGDAAALDRF-P
A0A2V8HSS5      ---------QNIVVQRLEDLNG----AVTKAHTERLQKQALFEQLQAARGDAAALDRF-P
A0A2V8KP55      ---------RNTVTEKLRQLQE----EYTRAQAERIQKQSYERMVRTGS-----ADAL-P
A0A399WNU1      ---------QNTVVQRLSDLNT----KLSQAENDRITAEAAYKAALNNP-----LAGTTA
A0A2V9CG11      ---------DNVSDARLVELQS----ELTKAQAERIAKQAKFEQVKSTP-----VESL-P
A0A2V2R0I6      ---------QNIATQRLGDVNR----ELTQAQSERMKREALFEFAKAGN-----LDAV-P
A0A2V8XAR9      ---------QNITTQRLSDINK----QLTDAQSERMKKESLYEFAKSGN-----LDAV-P
A0A2V8VZA0      ---------QNITTQRLSDINK----QLTDAQSERMKKESLYQFAKAGN-----LDAV-P
A0A1Q7CB82      ---------QNITTQRLSDINK----QLTDAQSERMKKESLYQFAKAGN-----LDAV-P
A0A2V8WIU1      ---------QNITTQRLSDINK----QLTDAQSERMKKESLYQFAKAGN-----LDAV-P
A0A1Q6Y9F5      ---------QNITTQRLSDINK----QLTDAQSERMKKESLYQFAKAGN-----LDAV-P
A0A2V9EVV8      ---------QNITTQRLSDINK----QLTDAQSERLKKESLYQFAKAGN-----LDAV-P
A0A2V8YF91      ---------QNITTQRLSDINR----QLTEAQSERMKKESLYQFAKSGN-----LDAV-P
A0A2V8XZK2      ---------QNMTTQRLGDINR----QFTDAQSERMKKESLYEFAKAGD-----LDAV-P
A0A2V8ZTX6      ---------QNMTTQRLSDINK----QFTDAQAERMRKESLYEFAKAGN-----LDAV-P
A0A2V9BT79      ---------QNMTTQRLSDINK----QYTDAQAERMKKESLYEFAKAGN-----LDAV-P
A0A1Q8B793      ---------QSITTQRLGEINK----ELTEAQSDRMKKEALYQLAQSGS-----LDAL-P
A0A2V9BCA0      ---------QSITTQRLGEINK----ELTEAQSDRMKKEALYQLAQSGS-----LDAL-P
A0A2V9BWU9      ---------QNITQQKLSDLNK----ELTQAQGERMRSEALYQLVGTGH-----IDAL-P
A0A2V9DKX2      ---------QNITQQKLSDLNK----ELTQAQGERMRSEALYQLVGTGH-----IDAL-P
A0A2V9JSI3      ---------QSVEEQRLAQLSN----DYTNAQNVRLDKESLFELASSNEAEA-------A
A0A2V9WI32      ---------QNIVTSKLDELNK----ELTAAEGDRIQKESAYKLASAGN----------P
A0A2V8IVN9      ---------ENIVVQKLSDLNS----AVTQAKTERLQKEALYSQLNSLRSGRGAALDTFP
A0A1F2TPT3      ---------SPIVMARLNELSA----SITRAQTGLFDKEASYNRALALRANPDKLDQL-P
A0A2V8JTQ2      ---------QNIVTTKLTDLNR----ELTAAEVDRVQKDVNYQLARSGQ----------P
A0A2V8UZY0      ---------QNLVTAKLDDLNR----GLTAAEADRIQKEVNYRLAVSGR----------P
A0A3N5YNR8      ---------GSIVLQTLEDLNR----QMTTVEGELIGKTADYQAVRDAT----------P
A0A350UEK1      ---------TNVDEEKLKQIQD----QLTAVQGDRVSKQSRWEMASSAP-----AETL-P
A0A350UIQ4      ---------TNVDEVKLKQIQD----QLTAVQGDRVSKQSRWEMASSAP-----AASL-P
A0A3N6A5T6      ---------QNIIMQKLADLNQ----EMTKVEAQMIERSAEFDAVKNAT-----VQDF-P
A0A1F2Q9L4      ---------SNVTLQRLEGLNK----DYVGAMSERIGKEAHYKELANTP----------D
A0A1H5SQF5      ---------SDLGSVELARLND-LNAQLTAAETVRIAAEAAYRMTQSRD----------A
A0A3E0NV31      ---------ESASSRRVGDLAR----LQTEAEAEAARLRSYVDTLRAGR-----TEGV-P
A0A3N5M5V0      ---------GSIVLQTLEDLNR----QMTTVEGELIGKTAEFQAVRDAT----------P
A0A2V9AEW6      ---------ESLAEARLKEIQD----ELSKAQADRIANQAKYAEAAGKS-----ADSL-P
A0A2V8WQK6      ---------ENPVVNRLKELQD----ELSKAQADRIAKQAKSEEARSKP-----ADSV-P
A0A2V8XIF4      ---------ENPAENRLKELLD----ELSKAEADRIAKQAKFEEAQSKP-----ADSL-P
A0A3N5XQP8      ---------QNEVTQKLNDLNT----EITRAQANLIAEQSQYDQARAAS-----ATRV-P
A0A2Z5G7H4      ---------YSVIVDRLQQATA----TLSQATSNRILKGAVYKIVQSGN------AELIS
A0A2V9L5B5      ---------QNMATARLEELLE----AYTKAQSERFEKQSLYSLVEAGK-----IQDL-P
A0A2V9LK56      ---------KNLANERLGQLQQ----EYTKAQADRFQTESLYNLVKPDA-----AKDV-P
A0A2V9L7I0      ---------QNMGNARLEELLQ----EYTKAQAQRFEKQSLYSLVEAGK-----VQDL-P
A0A522PPT0      ---------QSMANARLEQLEE----EYTRAQADRAQKEAQYSLVHTGK-----VQDL-P
A0A2V9KCS3      ---------DNVAEARLRQLQE----ELSKAQGDRVAKQSRYEVALSSS-----LEAL-P
A0A2U3KC61      ---------QNIVTAKLNELNN----ELTVAQTDRIQKESNYNLAMAGD----------P
A0A2V9Y2R7      ---------QNIVTAKLDELNK----ELTEAQTDRIQKEANYKSAMVGD----------P
A0A372IT17      ---------HDVVLAQLENLNQ----ALSQAELNRILKEAIDHTAQSGD----------P
A0A136JPP4      ---------SDLAASRLQTLSE----QWLSAADDRRKLEARYNGAVQASSRGEGRNI--P
A0A399WUJ8      ---------ADLAASRLQTLSE----QWLSAADDRRKLEARYNGAVTASSRGQGQNI--P
A0A2V9NGH6      ---------QNIITAKLDELNR----ELTTAESGRMEKESIYGLVQATD----------S
A0A2V9PYE6      ---------QNIITAKLDELNK----ELTAAESGRMEKESIYGLVQATD----------S
A0A2V9NL07      ---------QNITTAKLDELNK----ELTAAESARMEKESVFRLSDSVD----------T
A0A2V9QD92      ---------QNITTAKLDELNK----ELTAAESARMEKESVFRLSDSVD----------T
A0A2V9WPZ6      ---------QNITTAKLDELNK----ELTAAESERMEKESVYRLIQSGD----------P
A0A2V9ZLH4      ---------QNIITEKLDELNK----ELTAAESDRMQRESLYRLTRSGD----------P
A0A2V9RQF1      ---------QNIITSKLDELNK----ELTAAESDRMQKESVYRLVQSGD----------P
A0A2V9YDK8      ---------QNITTAKLDELNK----ELTSAESERMEKESVYRLIQSGD----------P
A0A2V9V8F7      ---------QNITTAKLDELNK----ELTAAESGRMEKESVYRLIQSGD----------P
A0A2V9XGR9      ---------QNITTAKLDELNK----ELTAAESGRMEKESVYRLIQSGD----------P
A0A2V9V3Q5      ---------QNIITQKLDELNK----ELTSAESERMEKEAIYRMTQTGD----------P
A0A2V9NWS3      ---------QNITTSKLDELNK----ELTSAESDRMAKESFYTLVQAAD----------A
A0A2V9USA9      ---------QNITTAKLDELNK----ELTSAESERMDKEAFYRLVESGD----------P
A0A2V9XW18      ---------QNITMAKLDELNK----ELTAAESERMDKEALYRLVDSGD----------P
A0A4R1LC91      ---------TPAYSSVLDRLEQ-ATTALTQAQSSRIEKGALYQAIKSGN------GELIS
A0A3M2BZG9      ----------EAIIERKKSLET----TLNRAVIDRLDKQAIWDELRNLT----------D
A0A1Q7N5R7      ---------AAGAPPRGSPLGEFFSLRIEQDQMRRDADALEHVLISMRD----------P
A0A3M1SIV3      ---------QELTAGILRSKSE----EWLKAEADRRKLEQMYEAALQAANRGEIFSIVSR
A0A3E0PHB0      ---------AELSASRLSTVSS----QYLTAIDERRKLEAEYSAAVQAKNP---YAL--S
A0A3M2D491      ---------QELAASILEQKST----EWLKAEAERRAIEQQYRTAVEVAKKGEILSV--A
A0A357F267      ---------QDLAATRLGSMSE----TWLRALEARRQLESRYNAAVSARARGEGMNL--P
A0A353C9L6      ---------QDLSASRLSSLSE----TWLKAMESRRQLEGRYNAALTANSRGEGMNI--P
A0A2V8RQV0      ---------QDLAAQRLGAMSE----AYMKAMETRRQLEATLNAAESANARGEAVNI--P
A0A2V8SJH5      ---------QDLSAARLQSMSE----TWLKAMEGRRQLEARYTAAAQAGARGEGMNI--P
A0A2V9QB26      ---------TKISEEKLQQLQG----ELSKTQTDRITAQSRWEITAASP-----PDAL-P
A0A2V9VYY4      ---------QNIVTEKLGELNK----ELTEAETDRIQKEADYKLAMNGDPEMFMKTSP-D
A0A2V9KIE8      ---------QNLVNDRLQQLEQ----EYTKAQAARFHAEASYTLVKSTK-----NMDL-P
A0A352F549      ---------QNTVVERLAGLNK----ELLEAENDRGLAEAAFRTSKLPG-----ATEA-S
A0A3B9MLP9      ---------QNTVVERLAGLNK----ELLVAENERSLAEAAYRASLAPG-----VTEA-N
A0A3D5SQ87      ---------QNTVVERLAGLNK----ELLVAENGRSLAEAAYRASLAPG-----VTEA-N
A0A2V8NW86      ---------TNISEEKLRQLQG----ELSKTQADRITAQSRWQGTTTSP-----PDAL-P
A0A2V8ZHL8      ---------ESVVEQRLADLSR----DLTNAQSDRVQKESLYELVKSNE------SQV-A
A0A2V9B240      ---------ESVVEQRLADLSR----DLTNAEGDRVQKESLYELVRSNE------SQV-A
A0A2V9CBM2      ---------QNIANERLQQLQQ----ELTKAQAELYEKESLYRLVQTSD-----YGSL-P
A0A2V8XN17      ---------QNVANERLQQLQE----QLTKAQSERYEKEALYRLVQTGE-----LGAL-P
A0A2V8WX45      ---------QNVANERLQQLQE----QLTKAQAERYEKEALYRLVQTGE-----YESL-P
A0A1Q6YR79      ---------QNVANERLQQLQE----QLTRAQSERYEKEALYRLVQTGE-----FGAL-P
A0A1Q7VA32      ---------QNVANERLQQLQE----QLTRAQSERYEKEALYRLVQTGE-----FGAL-P
A0A2V9EY85      ---------QNVANERLQQLQE----QLTKAQSERYEKEALYRLVQNGE-----FGAL-P
A0A2V9H8K0      ---------QSVANERLQQLQE----QLTKTQAERYEKEALYRLVQAGE-----SGAL-P
A0A2V9FFE5      ---------QNVANERLQQLQE----QLTKAQSERYEKEALYRLVQTGE-----SGAL-P
A0A2V9GM43      ---------QNVANERLRQLQE----QLTKAQSERYEKEALYRLVQTGE-----SGAL-P
A0A1F2RFI7      ---------QSLTTEKLKQLQE----EATRAQADLFQKESLYNQVRTGD-----LSSV-P
A0A1F2RZS3      ---------QSMNAQKLQQLQE----EATRAQSDLIQKESLYNQIRDGD-----FSSV-P
A0A1F2USE2      ---------ENIVNQRLRQLQE----QLTQAEADRYQKEALYQLLAQGD-----YASL-P
A0A2V9C238      ---------ENIVNERLRQLQE----ELTRAQAARYEKESLYRLVQAAD-----YASL-P
A0A1F2Q9F5      ---------ENIVNERLLQLQA----ELTRAQAERIAKESLYRLTQAGE-----YGAL-P
A0A1F2QQH9      ---------ENIVNERLLQLQA----ELTRAQAERIAKESLYRLTQAGE-----YGAL-P
A0A1F2QXK7      ---------ENIVNERLLQLQA----ELTRAQAERIAKESLYRLTQAGE-----YGAL-P
A0A2V9DEM9      ---------ENIVNERLRQLQE----ELTRAQAARYEKESLYRLVQAAD-----YASL-P
A0A2V9CYQ5      ---------QNIANERLQQLQQ----ELTKAQAELYEKEALHRLVQTSD-----YGSL-P
A0A2V9BWU8      ---------QNVANERLQALQE----ELTKAQADGYQKESVYRLVQSGN-----YGSL-P
A0A2V8ZG48      ---------ENVANERLQQLQE----ELTKTQAERYEKEAVYRLVQAGD-----YGSL-P
A0A2V8Y334      ---------ENVANERLQQLQE----ELTKAQTERYQKEALYRLVQAGD-----YGSL-P
A0A2V9AY68      ---------ENVANERLQQLQQ----ELTKAQAQRYEKESVYRLVQAGD-----YESL-P
A0A257VBK0      -----------ILDTKIASINE----RLTQVGVKESEVAAIASQLEAWR----------T
A0A2V7XDY0      -----------AVTSSITKLTA----DLIEAQARRIGLEAALKQIAQLK----------A
A0A350UQT3      -----------ILSARLLQLNT----EYTRAQAERVAAEAGYEQTRSGS----------L
A0A2U3JZ71      -----------ILSARLLQLNT----EYTNAQADRVRKEAAYKSVAGGS----------L
A0A2V8TTB0      -----------ILSARLLQLNT----EYTNAQGDRVKKEAAYNSIQSGS----------L
A0A1F2TCR2      -----------TVLPRLNSLND----SVTRARLARLQKGQVYEQVRAVK----------P
A0A2N9LQU7      -----------IVIDRLRHLNS----QLADAEGDRIIKEARYRLASTGN----------P
A0A2P6WFK7      -----------ITVDRLKLLNQ----QLTEAEADRIVKEARHRLAATRN----------P
A0A1F2V330      -----------LFAATQAQLRS----SSGLKANDQARLAAVQQEITELE----------K
A0A2V8U914      -----------LAADKLRGVQD----ELSKAQSDLIAKQVQFDLIAKNP----------A
A0A662EE63      -----------VITEQVDLLTK----EYAQAKAERIDVETKLNALNQLR----------A
A0A2V7W309      -----------VTLQKLGKLNT----DVTSAQGDMYDKQARYNSIQSTA----------P
A0A2V8TLH7      -----------ITNDRLSALQA----DYTETQVKAAELESVLKRVDEVR----------Q
A0A1Q7ZJT1      -----------ITNDRLSTLQS----ELTEAQVKKGEIEGLLKQIDANR----------Q
A0A2V8VC99      -----------ITNDRLSTLQA----GLTETQVKKGELEGLLKQIDSVR----------L
A0A348UZU3      -----------TMLDKISELNK----ALTEAQIERVRKESYYNGIKNAS----------P
Q01XL7          -----------LADSKMKVLQG----DLAAIQADRIAKQARWEMAKNTP----------I
A0A2V8ERZ5      -----------IVLSRLNQLND----AVTRARTERVQKESLYNQV-KAI----------A
A0A2V8GTX0      -----------IIVSRLNQVND----AASHARTNRIQKEALYNQV--------------A
A0A2V8J0X9      -----------IVVSRLNQLND----KVTTSRNERLSKEAIYNQLRRAD----------P
A0A523DUV7      -----------IAASTMTRLNE----EATEAKTRRIEIESALAQVDKLK----------Q
A0A372IRG7      -----------LVTDDLRTIND----QLAEARADRIVKEARYRMAQTRN----------P
A0A1F2U158      -----------IVLSRLNALND----AVLRARTTRIEKESVNNQIKSLG----------T
A0A2V8F6S9      -----------LVGARLNKLND----DAMMARSRKLQKELLYNQVKAMA----------A
A0A4Q1SCH5      -----------TVIDRLKLINE----QLTQAEGDRIVKEAQYRAAETGD----------P
A0A2W0BGU4      -----------VVEQRLGEIST----NFTQSQNDRIQKEALYNQVQTNP-----------
A0A2W0BVQ9      -----------VVQQRLGEIST----NFTQSQNDRIQKEALYNQIQANP-----------
A0A3D1ASD2      -----------ILSARLQQLNT----EYTNAQTDRVRKEAGFNAMQSGQ----------M
A0A2N9MK30      -----------ILSARLLQLNT----DYTNAETERVKKEAAYKSVSTGS----------L
A0A1I6MH75      ------------TTSTLEDLSK----ASGAAHIARILAESRYRMLSGMD----------P
E8WVF6          ------------IASSLEDLAK----ASGTAKLARIIAESRYRMLNGMD----------P
A0A1H5Z7N3      ------------ITTSLEDLNR----AVGQAQISRIMAEVRYHTLSGMD----------P
A0A2V9YHT3      ------------ITAKLNDLNK----AYTDATNDRIHKQATYRLTLNSS----------P
A0A1G7JVV8      ------------VTAAVEALST----AAIAAKVQRILAESRYRVLASSD----------P
A0A1H4T6W9      ------------LAVSVDALST----ASVGAKVQRILAESRYRVLANSD----------P
I3ZEU5          ------------LAVSVDALST----ASVSAKVQRILAESRYRVLASSD----------P
A0A5B9EBI2      -----------EITSLIDSLTK----AAGDARINRIIAESRYRALAQAD----------P
A0A239HDF6      ------------ISTSLDDLAK----ASGQAKLARIIAESRYRMLSGME----------P
A0A4Q0T270      ------------ISSSLEDLSK----ASGTAKIARIVAESRYRMLSGMD----------P
A0A1Q3QQB6      ------------ISSSLEDLSK----AAGEAKIARIIAESRYRVLSGMD----------P
A0A3N1K1G7      ------------ISSSLEDLSK----AAGEARIARIIAESRYRILSGMD----------P
A0A428MDU2      ------------ISTSLEDLSK----AAGDARIARIVAESRYRMLAGMD----------P
A0A4V2G466      ------------ITASLEQLST----ASNDAHIVRIMAESRYRMLSGMD----------P
A0A4Q7YNP3      -----------VGEDKLRELQA----ELVRAQADRIQKESQSEIAAVAL----------S
A0A2V9MN96      -----------IVTAKLDELNK----ELTGAQTDRMQKEANYGLAEAGD----------P
E8UZE1          -----------AIVDRLSQLNS----DLSKAQADRIMKEVTFRESMVSD----------A
A0A2V7V2Z1      -----------LLDQKLKELGT----SLTTLRTERLEREALYNQMRGAA----------N
A0A2V7X2F7      -----------LLAQKLQQLGT----ALTETRTVRLEKEALYRQMRGAD----------V
A0A2V7V2I1      -----------LVEQRLRELGT----SLTALKTQRIEKEALYRQMKEAP----------N
A0A2V7U3M2      -----------LLEQKLKELGT----ALTTLRTDRLEKEALYNQMRNAA----------N
A0A2V7UHT0      -----------LLDQKLKELGT----ALTTLRTERLEKEALYRQMRGAS----------N
A0A2Z5FVL3      QAYS-------STLDQLQKATA----AVSQAHTNVILKGAIYEVVKSGD----------P
A0A1V6HR88      -----------VVLSRLQALNA----DYTRAVSERIGKGAALKELEVAT----------P
A0A2V9KBD6      -----------IVTTKLADLNK----ELTASEADRVQKEVSYRLARSGQ----------P
A0A2W0AJ66      -----------IVTAKLDDLNK----ELTAAEADRMQKEATYRLTPSSQ----------P
A0A1Q7RBU1      -----------IVTAKLDDLNR----ELTAAEAERVQKEVNYRLASSGR----------P
A0A2V9JPV9      -----------IVTAKLDDLNK----ELTSAEADRVQKEIDYRLARSGE----------P
A0A3E0P0A3      -----------VTLQRLTAANS----AFLEAQRRRIEAQAEYNELSNRP----------A
A0A2V8EXP2      -----------IVVQKLADLNA----AVTRAKTERIQKEATYNQMKALQ----------T
A0A2W4RYA1      -----------IVAQKLTDVNT----EVTRARTERMRQESLYRQLQDAL----------A
G8P0Y7          -----------LTTEKLDELNR----ELTSAQADRIQKESLYNVAKRGD----------P
A0A5M8T4U7      -----------LTIQKLGQTSS----DLESAEADRIMRESRMREFASQD----------T
A0A3P0X3W6      -----------ILSARVAQLNS----EYTEAENDRIRKQTAYQGVKSGN----------A
A0A1E3Y9R6      N----------IIVQKLNALNE----QFVQARIARMNAEVQVNAMAERR----------A
A0A2W4TLP2      N----------IVVQKLNALNE----QLVQARIERMNREVQVNAIRELR----------A
A0A3R9WF43      GTSSVSVNSHNTVLDRLFTLNQ----EMTSAEANRISSEAVYHLVKTQN----------P
A0A317HKM4      QN---------IVVQKLGDLQA----AVTRARADTIEKDAQIKQMSALE----------A
A0A523E0N1      S----------IVMQRLETLNE----QLAQAEVQRTAAEARYANLASAD----------P
A0A523ECP2      -----------LVMRQLQDLNG----AVAVARTARAGAEANYTSLRAAD----------R
A0A2W0C122      N----------VVTSKLNELNK----QLTAAEEDRMEKEASYQAIAAGS----------L
A0A2W0AUU7      N----------VVTSKLDELNK----QLTAAEEDRMEKDASYQAIAAGS----------L
A0A2W0BQL1      N----------VVTSKLDELNK----QLTAAEEDRMEKDASYQAIAAGS----------L
A0A4Q1SDL1      GREQVYS----DVLDRLQQSTA----ALSVASQNRILKEAVYKAVESGN----------A
A0A3P0XH15      D----------LTIEDMRVANQ----QLSEAQADRVVKEARYRMAMTRN----------P
A0A4R1LAZ7      N----------LVTDSLRTVNQ----QLAQAEADRIVKEARYRLAQTRN----------P
A0A3M1WQW8      -----------IAIERLTDLNR----RLVEAEAERIRAETLYRLSQEAD----------V
A0A3N1JHC1      P----------VAAEHLREIQQ----GLAQAEVDRANRQSAVEMARNAS----------V
C1F294          S----------LVDANLETINS----QLAQAEADRIVKEARYKMALTRN----------P
A0A2V9KA79      E----------TIQARLQTVGE----RISNDAARRVAAANEMRELQRQG----------A
A0A522PSP1      G----------LLTQQLSSLQQ----ELGQEQSKQRTLEANLALANEGS----------L
G8P085          GGGESPSPSASTVTDRLTQLNN----RLTVAQGDRIVKEAQMRAAENGN----------T
A0A4Q1SGQ1      N----------IVLDRLTTLNQ----RLAAAETNRILMQAIAQAAESGD----------P
Q1ILD9          N----------LTLATLDDVSK----QYTDAQADRIMKEAKYRLAKSGN----------P
Q1IJZ6          KNPAAAPVLHIPALDRLTALNQ----DLVTAEASRVTREALYRLARSGD----------L
A0A2V8TCE6      N----------IALKGVSDIDA----IYLQARARRIATESEWTAARGTD----------P
A0A522TBE8      N----------IMVARLTELNS----DLTKAKSQRMQMQAAVRVIDSGA----------A
Q1ITG0          N----------LAVSDLTDVSK----QLTDAESDRIMKEAKYRLAQTGN----------P
A0A3N5PCI5      N----------IVVQRLNSLNA----SVTQAKTDLIAVESLYRQLAASQ----------R
A0A3M1Q0S9      E----------VSLQNLQDLRN----RRVEAEADLEDKRARYQVLTSAS----------P
A0A2Z5G448      N----------LVSDSLRLVNE----QLIQAEADRIVKEARYHLAETRN----------P
A0A3M1VZ38      D----------VTRRNLSNIQE----RYTQAKIKLAEARARLDTVRSTR----------P
A0A4Q1SD29      D----------LVTERLRTVNE----QLAEAEADRIVKEARYRMAMTRN----------P
A0A3M1PY35      E----------MGSERLVALDQ----ALTEAKRERAAAEARVEALDGAE----------P
A0A3M1VMP2      E----------PGSTRLSRLEQ----TLTEVKAERAAAEARLAAYQEAT----------P
                                                                            

A0A2V7VMF7      -----QVATDPV----------------------------------------VAGLNAQI
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ----------------------------------------------------VNALGQPA
A0A2V8JK38      -----DALPQITG------------------------------------SSLISQFVGRL
A0A2V9IXG5      -----ELVSSPS----------------------------------------FRSYYIQW
A0A2V9J2P4      -----ELVSSPS----------------------------------------FRSYYIQW
A0A1Q7RLS4      -----QISGDTV----------------------------------------VRDLYREK
A0A2V2R525      -----GAAEALAA----------------------SNQ---------------STAAAKL
A0A321LPW6      -----RLDRLSEA----------------------FSDPKI------------SELTKIR
A0A2V9R9V4      -----RVAQIPEA----------------------FADTKT------------VELQRKL
A0A321LE75      -----NIDVATEA----------------------FTDSKL------------TGLQARL
A0A2V8R8U7      -----DPFANPEV----------------------QKDERI------------LRLRGKI
A0A2V8QMP4      -----GIWAIPQV----------------------QSNPTV------------VKLRDKI
A0A2V8R4S3      -----GIWAVPQV----------------------QSNPSV------------LKLREKM
A0A2V8NJ55      -----DPWSIPEI----------------------QDDKSV------------QRLRDRI
A0A2V8Q7I0      -----DKFSIPEV----------------------QKSGRV------------TALRDRI
A0A2V8S6K4      -----DIFSIPKV----------------------QDNKQI------------QDLQIKL
A0A317I2L9      -----DPFTVPEV----------------------IKSTRI------------VALRERI
A0A2V8LLF9      -----DPFNAPEI----------------------QSDQRI------------QKLRDKI
A0A352FRF4      -----DPFANPEV----------------------QKDERI------------MKLREKI
A0A2V8MKV0      -----ELLSNPEV----------------------QKNESV------------LKLRDKL
A0A2V8PYY8      -----DLISNPEV----------------------QKNESV------------MKIRDKL
A0A1Q7YKQ8      -----NPMAVPDV----------------------ADSKRI------------QQLREKL
A0A352F3R7      -----DPFSIPDV----------------------NASARV------------DKLRDRI
A0A0B6WXT1      -----DIWSVPEV----------------------QSDQRI------------QKLRDRI
A0A3B9MEU8      -----DPFSVPDV----------------------NSSARV------------EKLRDRI
A0A2V8MHG6      -----GALEAQAE----------------------ATNN-SS-----------ATTEAKL
A0A2V8P7N1      -----GALEAQAE----------------------ATSNKSS-----------ATPEAKL
A0A2V8M3M6      -----GALEAQAE----------------------ATSNKSS-----------ATPEAKL
A0A1Q7NJH5      -----GALEAQAE----------------------ATSNKSS-----------AATEAKL
A0A2V8PJY0      -----GALEAQAE----------------------ATSNKSS-----------AATEAKL
A0A1Q7Y6W9      -----GASEARAE----------------------DANK-QI-----------QQYEANL
A0A2V8NC68      -----DAASAMVE------------------------AK-SS-----------SDADAKL
A0A399WK13      -----ERLSAMAE----------------------AEMARFITEQQNNIRQFQSDTLKKI
A0A352FLX4      -----GAAEALAE----------------------GGINEKDVPSATRIT---TDSELKL
A0A2V8RTL7      -----ESLNALAE----------------------QDSQRYITERENSVLQLRTDVRKKI
A0A3E0PCJ6      -----SRLSALAE----------------------EQMARYITERENDIRRFVNDTQKEI
A0A3M1S4R8      -----EKLRALAE----------------------EKLQRFITERENDMRSLNNETAKKI
A0A1Q7YFI6      -----GAAEALAR----------------------ENRN--------------KQAEEQL
A0A136KC10      -----ERLAAMAE----------------------AEMARFITEQQNNIRAFQSDTLKKI
A0A2V8SEX6      -----EAINALAE----------------------QDNQRIIQDRKLAIIAYRNDTQKKI
A0A3M2D6Y5      -----DRLKALVE----------------------EKLQRYITERENDMRALNNEATKRI
A0A0B6WWQ6      -----GAAEAMVE----------------------KEDGIS------------VAALNKL
A0A3B9MK99      -----GAATALAE----------------------VDAKQV------------NETEGKL
A0A352EX26      -----GAASALAE----------------------GDNKQA------------GDGENKL
A0A2V8MM59      -----GAANALAE----------------------AGAKDI------------ADSESKL
A0A2V8PFE8      -----GAATALAE-----------------------GAKDI------------NESESKL
A0A2V8PWS6      -----GAATALAE----------------------AGAKDI------------NESESKL
A0A2V8LCT5      -----GAASALAE----------------------AG-KDI------------ELSESKL
A0A352FTJ9      -----GAASALAE----------------------AGAKEI------------EATDSEL
A0A2V8G155      -----LILTNGF----------------------------------------IQQQKSQL
A0A2V8HDM7      -----LILTNSF----------------------------------------IQQQKSQL
A0A2V8DRT9      -----AILSNVF----------------------------------------IQQQKTEL
A0A2V7VYF3      -----AILSNSF----------------------------------------VQQLKSEL
A0A1F2SVH2      -----AILSNGF----------------------------------------IQQQKNVL
A0A2V8AJG9      -----AILSNTF----------------------------------------IQQQKGEI
A0A2G6PYV5      -----SQAIEVN------------------------------------QNVAIKDLSSQI
A0A2V8F956      -----AILANTF----------------------------------------IQQQKTEL
A0A1F2S1W5      -----AILSNAF----------------------------------------VQQQKTEL
A0A1F2T595      -----AILSNTF----------------------------------------VQQQKAAL
A0A2V8JQV5      -----QILDDGT----------------------------------------LRDLQSKL
A0A2V9AC41      -----LVRDSLV----------------------------------------IGGLKGEL
A0A2V8K4L4      -----QVLDDSS----------------------------------------LREYESKL
A0A2V8NCZ3      -----QVLDDPS----------------------------------------LREYESKL
A0A2V9MAM9      -----ELLVDNA---------------------------------------VIRDYQVKL
A0A2V9M454      -----FIQTNSL----------------------------------------LPGLEAKE
A0A2V9IVR7      -----SLVGNDL----------------------------------------LSRLEERY
A0A2V9ILE2      -----SLVGNDL----------------------------------------LSRLEEKY
A0A2V9LGY4      -----SLVGNDL----------------------------------------LSRLEERY
A0A2V9J4D6      -----LLAQDHL----------------------------------------LETLEQKV
A0A2V9L9C5      -----LLAQDHL----------------------------------------LETLEQKV
A0A2N9M9N1      -----VLAEDAL----------------------------------------LGQLESKN
A0A2V9JEC4      -----VASNDAL----------------------------------------LQHLEQNY
A0A2V9LPQ3      -----MLAQNDL----------------------------------------LQKLQEKS
A0A348V070      -----ESPSNPA----------------------------------------IARLREQY
A0A2Z5G3A3      -----ELISGLAG----------------------SPMLGAASSGVASSLSLIQGLRSQE
A0A2V7UGP8      -----GSIKEVT------------------------------------QSNLIQQLRQKT
A0A239MKT6      -----DLVLNSA-------------------------SSLGAGLAGGNEMRVLGTLREQA
A0A3E0PCN7      -----VASKDAR----------------------------------------TTSLEQEL
A0A2V8IYW3      -----SDRTPDP----------------------------------------LDAARTEL
G2LEI9          -----EMQSDPE----------------------------------------LQKLRGKI
A0A317J121      -----GVLEDIN----------------------------------------VRGYQTRI
A0A2V7YW66      -----ENVADSL------------------------------------SGGMVTELRKEV
A0A2V7Z0V0      -----ESMSDSL------------------------------------TTGVVSDQRGQI
A0A2V8GFD4      -----TVLSNGF----------------------------------------IQQLKGEI
A0A2V8HSS5      -----TVLSNGF----------------------------------------IQQLKGEI
A0A2V8KP55      -----QITGSSL----------------------------------------ISQFVGRL
A0A399WNU1      -----QAKDART-----------------------------------------AGLESQL
A0A2V9CG11      -----EMLDDPT----------------------------------------LREYRLRL
A0A2V2R0I6      -----QMQNNSF----------------------------------------LNELIRKR
A0A2V8XAR9      -----QVQSDAG----------------------------------------LAELLRKR
A0A2V8VZA0      -----EVQNNSA----------------------------------------LGDLLKKR
A0A1Q7CB82      -----EVQNNSA----------------------------------------LGDLLKKR
A0A2V8WIU1      -----EVQNNSA----------------------------------------LGDLLKKR
A0A1Q6Y9F5      -----EVQNNSA----------------------------------------LGDLFKKR
A0A2V9EVV8      -----EVQNNSA----------------------------------------LGDLFKKR
A0A2V8YF91      -----QVQTNTA----------------------------------------LTELLKKR
A0A2V8XZK2      -----QVQSNAA----------------------------------------LTDLLKKQ
A0A2V8ZTX6      -----QVESNTA----------------------------------------LADLLKKK
A0A2V9BT79      -----QLDSNSA----------------------------------------LTELLKKR
A0A1Q8B793      -----AVRDSEL----------------------------------------LQDIYKKR
A0A2V9BCA0      -----AVRDSEL----------------------------------------LQDIYKKR
A0A2V9BWU9      -----PVRDSLL----------------------------------------LQDLQKKQ
A0A2V9DKX2      -----PVRDSLL----------------------------------------LQDLQKKQ
A0A2V9JSI3      -----VLMQSEV----------------------------------------LGRLEEKY
A0A2V9WI32      -----EIFAKAE------------------------------------PSSLINQLRTQE
A0A2V8IVN9      -----AILSNTF----------------------------------------IQQQKSEL
A0A1F2TPT3      -----QMLNNAA----------------------------------------LQQLRLEL
A0A2V8JTQ2      -----DLVARLE------------------------------------PDNLLTRLRAQQ
A0A2V8UZY0      -----ELIAKLE------------------------------------PDNLITRLRAQL
A0A3N5YNR8      -----ENFPQSL------------------------------------RTPSISLLEERL
A0A350UEK1      -----DVLNDTL----------------------------------------MRGYQEKI
A0A350UIQ4      -----DVLNDSS----------------------------------------MRGYQEKL
A0A3N6A5T6      -----DALVTDN----------------------------------------IRQLETTL
A0A1F2Q9L4      -----DMVADTV------------------------------------SGGLVTQLRGEQ
A0A1H5SQF5      -----DVVLGIDS----------------------SQLNGAPGALASLDTVRLHQLRTQT
A0A3E0NV31      -----DTAKTQE----------------------------------------LRALEAQI
A0A3N5M5V0      -----EDFPQSL------------------------------------RTPSISLLEERL
A0A2V9AEW6      -----EILEDPT----------------------------------------MRDYRQKL
A0A2V8WQK6      -----EMLEDPT----------------------------------------MREYRQKL
A0A2V8XIF4      -----EMLEDPT----------------------------------------MREYRQKL
A0A3N5XQP8      -----TNLRSSV----------------------------------------TEQIEARL
A0A2Z5G7H4      -----GLSANGI---------------------------VSGSPTLSTSLGLIQSLRMQE
A0A2V9L5B5      -----GVLSNRL----------------------------------------VQDLEIRL
A0A2V9LK56      -----GTLSNKL----------------------------------------IQDLEFKI
A0A2V9L7I0      -----AVLSNRL----------------------------------------IQDLEERL
A0A522PPT0      -----GVLDNRL----------------------------------------IQTLEQNL
A0A2V9KCS3      -----EVLDDAS----------------------------------------LQDYRQKL
A0A2U3KC61      -----AEFAKPS---------------------------------REGTSSMLEKLREKE
A0A2V9Y2R7      -----TAFAKIQ---------------------------------AGGTSSLVDKLREKE
A0A372IT17      -----ELISGLT-----------------------ASAGAEETGGLQHSLELIETLRSRE
A0A136JPP4      -----DLYENKVY----------------------QDTVRLNTERKAKLQDQIREIEKQI
A0A399WUJ8      -----DLYENKVY----------------------QDTVRLNTERKAKLQDQIRDIEKQI
A0A2V9NGH6      -----DAAAAAA-----------------------ISADHSTRNASLS-SSLLEKLREQQ
A0A2V9PYE6      -----DAAAAAA-----------------------TSADHSTRIASLS-SSLLEKLREQQ
A0A2V9NL07      -----ESAAAVA-----------------------NSGSAKG---SGSTSGLLDKLQAAK
A0A2V9QD92      -----ESAAAVA-----------------------NSGSAKG---SGSTSGLLDKLQAAK
A0A2V9WPZ6      -----DVVASVP-----------------------VGGDSNSGNNPNSGSPLLDSLRGKQ
A0A2V9ZLH4      -----DVIATAT-----------------------ATGGTEG--NASSGSTLLDKLRSQE
A0A2V9RQF1      -----DTAASAA-----------------------LSAAGTAGTNSST-SGLLEKLREQQ
A0A2V9YDK8      -----DVIASTT-----------------------SVAGSNGGTGANSGSSLLDNLRSKQ
A0A2V9V8F7      -----DVVASAP-----------------------VGGDSNSGNNPNSGSPLLDSLRGKQ
A0A2V9XGR9      -----DVVASAP-----------------------VGGDSNSGNNPNSGSPLLDSLRGKQ
A0A2V9V3Q5      -----DAVASAV-----------------------TSAPVATLAGTGS-SPLLDKLHQQQ
A0A2V9NWS3      -----DTAAAAA-----------------------LSSATGSGLSSAS-SNLLEKLREQQ
A0A2V9USA9      -----DAIASSA-----------------------GGIETGSA--QSA-SALLESLRAKQ
A0A2V9XW18      -----DAILSSA-----------------------NALEEAGAGGQSS-SALLGGLRSKE
A0A4R1LC91      -----GLVGNSI--------------------------TAGASPGVNSSLNLIQNLRLQE
A0A3M2BZG9      -----AEVANSL------------------------------------ISSQITQLRSEV
A0A1Q7N5R7      -----GALADAL--------------------------------APIGAVQRSADLTQAL
A0A3M1SIV3      -----ETPNSEFI----------------------STLRANIIAKKNSLDARLSEIDNKI
A0A3E0PHB0      -----DASGGVLA----------------------SQLRQTKTERKAKFDEQVRALDEKV
A0A3M2D491      -----S--DNKFI----------------------ITAREQQLKLKKDSEARLEDIEGQI
A0A357F267      -----DLYENKIF----------------------QDTMRLNTERKAKLQDQIRDIDKQI
A0A353C9L6      -----DLYENKIF----------------------QDTIRLNTERKAKLQDQIRDIEKQI
A0A2V8RQV0      -----SIGENKIF----------------------QDTMRLNTERKAKLQDQIRDIEKQI
A0A2V8SJH5      -----DLSESKIF----------------------QDTIRLNTERKAKLQDQIRDIEKKI
A0A2V9QB26      -----DFLNDSA----------------------------------------LRSLQEKL
A0A2V9VYY4      -----GRGGSGL----------------------------------------LDKLREKE
A0A2V9KIE8      -----SVLSDKF----------------------------------------IQELEGRL
A0A352F549      -----AEVSDKQ----------------------------------------IAELKTRL
A0A3B9MLP9      -----AETSDKQ----------------------------------------VAEFKTRL
A0A3D5SQ87      -----AETSDKQ----------------------------------------VAEFKTRL
A0A2V8NW86      -----DVLNDSS----------------------------------------LRSLQEKL
A0A2V8ZHL8      -----FVAQNDL----------------------------------------LQRLEEKF
A0A2V9B240      -----FVAQNEI----------------------------------------LQRLEEKF
A0A2V9CBM2      -----GVFENRM----------------------------------------LQDLTVRL
A0A2V8XN17      -----GVFENKL----------------------------------------IQDLSERL
A0A2V8WX45      -----GVFENKL----------------------------------------IQDLSERL
A0A1Q6YR79      -----GVFENKL----------------------------------------IQDLSERL
A0A1Q7VA32      -----GVFENKL----------------------------------------IQDLSERL
A0A2V9EY85      -----GVFENKL----------------------------------------IQDLSERL
A0A2V9H8K0      -----GVFENKL----------------------------------------IQDLSARL
A0A2V9FFE5      -----GVFENKL----------------------------------------IQDLSERL
A0A2V9GM43      -----GVFENKL----------------------------------------IQDLSERL
A0A1F2RFI7      -----GILENKL----------------------------------------YQDLSIKL
A0A1F2RZS3      -----GILENKL----------------------------------------YQDLSLKL
A0A1F2USE2      -----GIHDNTV----------------------------------------METLTVKL
A0A2V9C238      -----GMAENKL----------------------------------------VADLAVRL
A0A1F2Q9F5      -----GIFENKL----------------------------------------MQDLTVQL
A0A1F2QQH9      -----GIFENKL----------------------------------------MQDLTVQL
A0A1F2QXK7      -----GIFENKL----------------------------------------MQDLTVQL
A0A2V9DEM9      -----GMAENKL----------------------------------------VADLAVRL
A0A2V9CYQ5      -----GVFENRM----------------------------------------LQDLTVRL
A0A2V9BWU8      -----GVVENKL----------------------------------------IQDLSERL
A0A2V8ZG48      -----GVVENKL----------------------------------------IQDLSERL
A0A2V8Y334      -----GVVENKL----------------------------------------IQDLSERL
A0A2V9AY68      -----GVVENKL----------------------------------------VQDLSERL
A0A257VBK0      SGGDPLSIPAVAQ----------------------DPS--------------VQDLAKQY
A0A2V7XDY0      ANQPLDAVPQFAA----------------------DPT--------------IMILNTQV
A0A350UQT3      -----ESAQVSGQ----------------------GEA--------------IRRLLERQ
A0A2U3JZ71      -----EAAQVSTQ----------------------GEA--------------LKRLSERL
A0A2V8TTB0      -----AAAQVSSQ----------------------GEA--------------LKKLTENL
A0A1F2TCR2      DSDEADNLSIIAT----------------------SPG--------------VVTAKSRL
A0A2N9LQU7      -----ELVAAVVP----------------------STT--------------LQALRMQE
A0A2P6WFK7      -----ELLGTVDP----------------------N----------------LQTLRTQE
A0A1F2V330      -----EGVLDAAP----------------------PKE--------------KTPAETNL
A0A2V8U914      -----EITTENPG---------------------------------------IRDYETKL
A0A662EE63      RHVSEVAFPEVLE----------------------DAT--------------ISNLMQRR
A0A2V7W309      -----ETVAQQ------------------------DAT--------------VIHLNEEL
A0A2V8TLH7      NGGSYEVIPQISG----------------------DAV--------------VQDVYREK
A0A1Q7ZJT1      NGGAYENIPQISG----------------------DTV--------------VRDLYREK
A0A2V8VC99      SHGSYENIQQISG----------------------DPV--------------VQELYREK
A0A348UZU3      -----DFIPEAMN----------------------NPL--------------IQRLREEY
Q01XL7          -----DSLPDVLS----------------------DPT--------------LLGLKSRI
A0A2V8ERZ5      NGTAPDAIPAIAT----------------------NAG--------------VASAKAKL
A0A2V8GTX0      ATKDREGLSQIAS----------------------NPF--------------VQQLKTRI
A0A2V8J0X9      SSDAIDNFPIVGT----------------------NSA--------------VVDAKNAL
A0A523DUV7      SGGALDAMPQIAA----------------------DPL--------------VQRLNLSK
A0A372IRG7      -----DLLVSVS-----------------------GGV--------------LGSLRSQE
A0A1F2U158      -TPV-DSIPAIAQ----------------------NAQ--------------VQLHKAQL
A0A2V8F6S9      GQPL-DSVPAIAQ----------------------NPT--------------VVGAKNKV
A0A4Q1SCH5      -----AVLAALMP----------------------DQN--------------LQSLQTTE
A0A2W0BGU4      -----DQVPAIAN----------------------NEV--------------MQKLEENY
A0A2W0BVQ9      -----DQVPAIAN----------------------NEV--------------MQKLEENY
A0A3D1ASD2      -----EAALISSQ----------------------GQS--------------LKKLTEAY
A0A2N9MK30      -----ESAQASTQ----------------------GDA--------------LKTIAERL
A0A1I6MH75      -----GTIDGTID----MN------------PGTMPVQ--------------FAQLRSQI
E8WVF6          -----NAIEGSIDAGTTAT------------TGGATNG--------------LANLRSNL
A0A1H5Z7N3      -----NQIDDSVA----STQVGSSGNLTSGAPGAGDQQ--------------LATLRTQM
A0A2V9YHT3      -----ELL----------S------------QADPNTL--------------IEQLRTRE
A0A1G7JVV8      -----ALMESNLQ----AS------------GAGQESE--------------LSKLRDDA
A0A1H4T6W9      -----DLLESNLD----VA------------GG--QSE--------------LSKLRSDA
I3ZEU5          -----DLLESNLD----VA------------GG--QSE--------------LSKLRSDA
A0A5B9EBI2      -----ASMEGLID----AT------------PSIQPAP--------------LNALRSQL
A0A239HDF6      -----DAIEGSID----AG------------PGLPPSG--------------LNALRTQL
A0A4Q0T270      -----DSIDNSIE----TT------------PGTAPGE--------------FSALRGQV
A0A1Q3QQB6      -----DSVESSID----AA------------PGAAPQE--------------LTQLRTQL
A0A3N1K1G7      -----NTIEGSIE----TT------------PGTAPGE--------------LNTLRAQI
A0A428MDU2      -----NTMEGSIE----TT------------PGTAPGE--------------LNLLRGQV
A0A4V2G466      -----NTIEGSLE----AS-------------GAAPSQ--------------LNALRAQL
A0A4Q7YNP3      -----TTLPSVMD----------------------SPE--------------YRRYQEKL
A0A2V9MN96      -----SGFAKLSA----------------------DNL--------------LEKLRVQQ
E8UZE1          -----DQIVPTTT----------------------FPG--------------LTSLRAQK
A0A2V7V2Z1      P----EELPEVMR----------------------SPL--------------VQSLRIEL
A0A2V7X2F7      P----EDLPEVRK----------------------DSV--------------VQQLRMDL
A0A2V7V2I1      S----EELPEVMR----------------------NPL--------------IGSLRVEL
A0A2V7U3M2      P----EELPDVMR----------------------SPL--------------VQALRIEL
A0A2V7UHT0      P----EELPEVMR----------------------NPL--------------VQSVRIEL
A0A2Z5FVL3      -----ETIMGLPS----------------------NTALAGAASGMSNDLAVISSLRTRE
A0A1V6HR88      -----QIAAEILP----------------------DPV--------------VAQLRGEV
A0A2V9KBD6      -----ELLAKLEP----------------------GSL--------------LTTLRAQQ
A0A2W0AJ66      -----ELIAKSEP----------------------DNL--------------VTKLRAQE
A0A1Q7RBU1      -----ELIAKLEP----------------------DNL--------------ITKLRAQQ
A0A2V9JPV9      -----ELIAKLGP----------------------DNL--------------ITKLRAQQ
A0A3E0P0A3      -----DDLAETLS----------------------GGL--------------VSSQRAEL
A0A2V8EXP2      ERAGLDTFPAILS----------------------NQF--------------IQQQKGEL
A0A2W4RYA1      RSADLDGFPAVLN----------------------NQL--------------VQQQKLEL
G8P0Y7          -----STLSVILQ----------------------DPI--------------LSALRQRQ
A0A5M8T4U7      -----DMAALTGD----------------------NPQ--------------VAALRTQL
A0A3P0X3W6      -----SAIDISTQ----------------------AEQ--------------LTRLQQQM
A0A1E3Y9R6      RGESLESFPPVLA----------------------SPV--------------VQKLRADI
A0A2W4TLP2      SGESLETYPAIMN----------------------SPV--------------VQALRADI
A0A3R9WF43      EVVLGLGSMSIAS----------------------GNGSSSGALTADGGVDLLRSLRTQE
A0A317HKM4      DHKPLDTLPAIAA----------------------NPF--------------IQTLKGEL
A0A523E0N1      -----FSLSEVRT----------------------SGP--------------VRDLERRY
A0A523ECP2      -----QTLPAVLA----------------------NPT--------------VQGLVQQR
A0A2W0C122      -----DRIGENKS----------------------GEA--------------LQSLRLRE
A0A2W0AUU7      -----DRLSESKS----------------------GDA--------------LQSLYLRE
A0A2W0BQL1      -----DRLSESKS----------------------GDA--------------LQSLYLRE
A0A4Q1SDL1      -----ELISELGG----------------------TST-ADTAPAVTNALSLIQNLRLQQ
A0A3P0XH15      -----ELLLSVAP----------------------SAT--------------LSQLQQQA
A0A4R1LAZ7      -----ELLVSVAP----------------------TTV--------------LASLREQQ
A0A3M1WQW8      -----DTLPPVMS----------------------NPI--------------VQTLRQRL
A0A3N1JHC1      -----DSLPQVAD----------------------DPT--------------MRDDRAKL
C1F294          -----DLLVSVAP----------------------NTV--------------LTSLRSQE
A0A2V9KA79      -----TENRAVVE----------------------EAS----------------AVQKKL
A0A522PSP1      -----DALLVSDR----------------------GDS--------------LATLVQAQ
G8P085          -----AVLAAMFP----------------------SAN--------------LAALQSQQ
A0A4Q1SGQ1      -----ELLPALSG----------------------GGGSGMPGYGPQLAV--IQELRMRE
Q1ILD9          -----ELIGMLVP----------------------DSV--------------LPVLRTQE
Q1IJZ6          -----DRLTSLGA----------------------ESLTSPTDQAQAAMFTNLQALRQRQ
A0A2V8TCE6      -----SSLPAVVE----------------------NPT--------------VQRLQHEV
A0A522TBE8      -----AGWTNPTL----------------------TQE--------------VQTLRGRL
Q1ITG0          -----ELIGTILP----------------------DSV--------------LPVLRSQE
A0A3N5PCI5      DQGALDTFPLIRS----------------------NGV--------------VQEIRGRL
A0A3M1Q0S9      -----DSIDEVRQ----------------------HPT--------------IAQLSAEV
A0A2Z5G448      -----ELLVSVAP----------------------TTT--------------LVSLRTQQ
A0A3M1VZ38      -----ESLQEVLE----------------------NPV--------------VRELRSRV
A0A4Q1SD29      -----DLLVSVAP----------------------GTV--------------LGSLRTQQ
A0A3M1PY35      -----LSIEAVRS----------------------DPL--------------VVRLREEL
A0A3M1VMP2      -----SGIPEVNA----------------------NPQ--------------VQRYRQDL
                                                                            

A0A2V7VMF7      ATFTVELSR---LKEK-YKEGHPEVQKVNKQVVQIQK---------------AKEERAAQ
A0A2V7YYV7      ----------------------------------------------------DIQTSHLQ
A0A2V7Z0J5      ----------------------------------------------------QIQQAETQ
A0A2V7Z3M4      ----------------------------------------------------QIQQAETQ
A0A399Y5V2      ----------------------------------------------------AISKTRGE
Q01X01          ----------------------------------------------------GRGKRAAG
A0A3M2D9H8      RVTPTLTVD---QQIE-LTQKRSRLDELKSLLNIYQQ-----------------------
A0A2V8JK38      SDLKRQDAE---LTVT-FAPDYPSRRRIRSQIEEIQK---------------QIEGERGR
A0A2V9IXG5      VEANNALEK---LRLDGKGEEHPTLVAKRTELDNLRK---------------QLRNELVK
A0A2V9J2P4      VEANNALEK---LRLDGKGEEHPTLVAKRTELDNLRK---------------QLRNELVK
A0A1Q7RLS4      AGLEREYER---LLVT-YKDKHVRVLEKQKEIEETTQ---------------KIASEVDR
A0A2V2R525      SDLRQRLAQ---LKAE-YTDKWPEIKVVQEQIAEIEK-----------QDVENKTNSKSL
A0A321LPW6      GELAATYAQ---LSVR-YGPENPRVAESKKQMAEIDN---------------QIRASRAS
A0A2V9R9V4      GELATTAAE---LSVT-YGPKYPKMAEINQQMAAIRD---------------QIAAGRVQ
A0A321LE75      NELEVKARE---LDVK-FGADHPRVVEIRNQMVTIQE---------------QINRSRGD
A0A2V8R8U7      SDLKDKLTF---LRQK-YTDEWPDVKQASAQIDELEK---------------ELKKAPQE
A0A2V8QMP4      GELEEQKAA---LLVN-YTPEWPAVQKIEKQLKSLHE---------------QLDKMPDE
A0A2V8R4S3      GELEEQKAA---LLVN-YTPEWPAVQKIEKQLKSLHE---------------QLDKMPDE
A0A2V8NJ55      SDLEEKRAS---LLRT-YTEEWPAVQATNDEIKQVKS---------------ELDKKPAE
A0A2V8Q7I0      SALREKRET---LKVT-YTDKWPEVLKLDAAIKPLEA---------------ELDRAADE
A0A2V8S6K4      AALNEQRVA---LLKQ-YTENWPAVQKVEAQIKQTED---------------AQQKIAKA
A0A317I2L9      SAIKERRDA---LLVT-YTPEWPEVRKLEASLKPLEA---------------ELQAAAAE
A0A2V8LLF9      GDLEDKRNS---LLEI-YTPEWPEVKKIEAQLEPLKK---------------QLIAAPKE
A0A352FRF4      SELKDKETG---LLQK-YTKEWPEVQQVEAQIAQLEV---------------ELKKAPTE
A0A2V8MKV0      SELQAQRAA---LRQT-YTDEWPDIKKLDAQIKPLEQ---------------ALEAAKRQ
A0A2V8PYY8      TELQSQRAA---LLQT-YTTEWPDVKKLDAQIKPLEQ---------------ALEAAKRQ
A0A1Q7YKQ8      DQLKQKRSE---LLVI-YTVEWPEVKRVDEQIKTIEE---------------ALTKAPGE
A0A352F3R7      SALKEKRDA---LLIV-YTSEWPEVKKIDAQLKGLEA---------------ELAKAPPE
A0A0B6WXT1      GELEEKRAA---LLVQ-YTPEWPEVKKVDEQIKRLKQ---------------DLDKAPYE
A0A3B9MEU8      SALKEKRDA---LLIV-YTPEWPEVKKIDAQLKGLEA---------------ELAKAPPE
A0A2V8MHG6      AELKQHRAQ---LLQE-YTEKYPEVRDLDQQIAMLEK-----------QAEQSRAHTESV
A0A2V8P7N1      AELKQHRAQ---LLLE-YTEKYPEVKDVDQQIAMLEK-----------QVDQSRRHTESM
A0A2V8M3M6      AELKQHRAQ---LLLE-YTEKYPEVKDVDQQIAMLEK-----------QVDQSRRHTESV
A0A1Q7NJH5      AELKQRRAQ---LLLE-YTEKYPEVKDVEQQIAMLEK-----------QVDQVRTHTESV
A0A2V8PJY0      AELKQRRAQ---LLLE-YTEKYPEVKDVEQQIAMLEK-----------QVDQVRTHTESV
A0A1Q7Y6W9      VELRRKRAE---LLVE-NTEEHPDVQQVEQQIAEIER-----------QLKEAKSHAANI
A0A2V8NC68      NELKRKRAQ---LLLE-YTEKYPEVKDLDEEIALLEK-----------QTKEGKTHATSV
A0A399WK13      SDLRQARAL---KLQE-YQEGAPEIKEIDAQITSYQNSIDNAVQKFQNDLDKYRDSTKKT
A0A352FLX4      AELKQKRAE---LLVE-NTEKWPAVREIDKQIAAIEK-----------VMGDARRRATGV
A0A2V8RTL7      NDLNAEKAR---KLED-YKETAPEIIEIDKQIASLEDSLEKLLEKNNKDIQAYKERSATI
A0A3E0PCJ6      TALRAKRQK---MLVE-YVERAPEIQEIDREIATLMNEIADFRDKNDKALQQYRKTVGET
A0A3M1S4R8      AELEAEKAK---LLIE-YQESAIEVQEINRKMEALKSTVEKAQEKNREELEKYRARTAKE
A0A1Q7YFI6      LELRKKRAE---LLVE-NTEDWPEVKEIDRQIAILEA-----------QVNQSHSEDVST
A0A136KC10      SDLRQARAL---KLQE-YQEGAPEIKEIDAQITSYQNSIDNAVQKFQGDLEKYREATKKT
A0A2V8SEX6      SDFRSQRAK---LLQE-YKESAPEIVEIDTQIRSLEDSLTKLVDENTTEVQKLQERASKL
A0A3M2D6Y5      AELEAEKAR---LLVE-YQESALEVQEINRKIDALKRTVEVAQEKNRKDLEEYRSRTAKE
A0A0B6WWQ6      TELRQRRAQ---LLVE-ATEEMPEVKEVNEQIAELER-----------QINEARARAKDV
A0A3B9MK99      ADLRQKRAL---LMVD-ATEEAPEVKEVDQQIAELER-----------QVKDVRSRKSVT
A0A352EX26      ADLRQKRAL---LMVD-ATEEAPEVKEVDQQIAELER-----------QVNDSRNRKTNT
A0A2V8MM59      SDLKQKRAQ---LLVD-ATEEAPEVKEIQQQIAELQK-----------HLGETRSRSTSV
A0A2V8PFE8      ADLKQKRAQ---LLVD-ATEEAPEVKEVDQQIAELQK-----------HLHESRARNTNT
A0A2V8PWS6      ADLKQKRAQ---LLVD-ATEEAPEVKEVDQQIVELQK-----------HLNESRARNTNT
A0A2V8LCT5      AELKQKRAE---LLVT-ATEEAPEVKEVDQQIDVIQK-----------HLVETRSRSTAT
A0A352FTJ9      TKLRQKRAQ---LLIE-ATEEAPEVKEIDQQIDVLQK-----------HLADTRARGTAT
A0A2V8G155      SELQREYAQ---LSEK-LGDKHPEIIKVKSAIQISQA---------------KLSGEISK
A0A2V8HDM7      SELQREYAQ---LSEK-LGDKHPEIIKVKSAVQISQA---------------KLSGEISK
A0A2V8DRT9      AELQRQESQ---LSEK-LGQRHPDMLKAKLNVQNAEA---------------RIQAEINK
A0A2V7VYF3      ADAQHKQAQ---FSET-LGDKHPDMIKARSAVDTALA---------------KLNTEIDK
A0A1F2SVH2      ADLQRQQAQ---LSDK-LGPNHPDMVRLSSAVREAES---------------KIQGEIAK
A0A2V8AJG9      AELQRQQAQ---LSEK-LGPRHPDMLKVSNAIQLAES---------------KLQGEIAK
A0A2G6PYV5      SRKKLEYEA---NLSK-YKPQLPKMVALNAEIKSMEK---------------RLANEQKK
A0A2V8F956      AQLQSQSAQ---LGDK-LGPNHPDMVKIRSAIRLTQA---------------KLDGEIGK
A0A1F2S1W5      AQLLRQRAQ---LSEK-LGPNHPDMIKVNTAIQLAET---------------RLQAEVAQ
A0A1F2T595      ADLQRQRAQ---MSEK-LGPNHPEMVKINVALRGAET---------------RLQNEIAQ
A0A2V8JQV5      TELRSQTAE---LRVS-LTPAHYRVQRLEAQMGELET---------------AFERERAN
A0A2V9AC41      AKSEADYAS---LAKE-FKAGYPPLDNLKVRMEETRR---------------RLQAEIQN
A0A2V8K4L4      VDLKRQRAE---LSPS-FTPDHPRMQKLEAQITELET---------------ALEAARQK
A0A2V8NCZ3      VDLRRQGAE---LGSS-FTPAHPRMQKLEAQIAEMET---------------ALEDARQK
A0A2V9MAM9      TELRKQLAD---LDSV-LTPENYKVVRLKAQITALES---------------ALAKEREE
A0A2V9M454      LDLKEQYSE---ALAH-YGPTYPKVLSLQDQIKDLQA---------------LVVRERKR
A0A2V9IVR7      AELKSQYVE---AREQ-YGPNFPKVVRLRDQAEEIRS---------------SLEAERKR
A0A2V9ILE2      AELKSQYVE---AREQ-YGPNFPKVVRLRDQAEEIRS---------------SLEAERKR
A0A2V9LGY4      AELKSQYVE---AREQ-YGPNFPKVVRLRDQAEEIRS---------------SLEAERKR
A0A2V9J4D6      ADVKTEYID---ARTT-YGPNFPKVVRLQQQIDEVQL---------------LIQQERHR
A0A2V9L9C5      ADVKTEYID---ARTT-YGPNFPKVVRLQQQIDEVQL---------------LIQQERHR
A0A2N9M9N1      AELHTEYAA---ATSQ-YGPNFYKVKQLGNQINEVEE---------------LIDRERKR
A0A2V9JEC4      ADLKTQYAA---SLAQ-AGPNFYKAVQIRKQLAEVES---------------LINRQRMR
A0A2V9LPQ3      ADLKAQYVD---ALGQ-FGPNFPKVVRLRGQVAQMQS---------------LIEQEQKR
A0A348V070      ALLSREYAR---RLAT-LKPEYPEMQKLKSEIEATYD---------------SLTREKEN
A0A2Z5G3A3      AVLQGQMAE---YSSK-FSPDYPKLVDMKSNLQVIQA---------------AIASEVAR
A0A2V7UGP8      AELEREYTQ---KSKQ-FKPDWPDMVRLQAEWDSARK---------------TMAEESQK
A0A239MKT6      SAIKIRMAS---ESVK-FGSQYPAVLELQNQLNSIDA---------------QVHEQMVR
A0A3E0PCN7      STLRLQLEQ---LKVE-FTEEWPAVKEVRRKIAAVEN---------------ELKGTRKL
A0A2V8IYW3      ATLGRRLLP---THPD-VIAAKRRVAQLEAERVAMPK---------------ASDAPASA
G2LEI9          SELKQRRLE---LLGT-YTELHPDVVQIDQVLAQAEN---------------ELKEAKAN
A0A317J121      ADLRREAAV---LKTT-LTPDNPKVKKIEVQINELQI---------------TLNKEVTA
A0A2V7YW66      LNLQRDYDT---KLKT-YKPDFPEMVTLKAEIEKSQQ---------------HINDVVKE
A0A2V7Z0V0      LKLEREYET---KLKT-YKPDFPDMVTLKADIEKARQ---------------HLNEVLGE
A0A2V8GFD4      AALQRQHAE---MADN-LGERHPTMIKLKASLQSADA---------------KLQAEIAK
A0A2V8HSS5      AALQRQQAE---MADN-LGERHPTMIKLKASLQSADA---------------KLQAEIAK
A0A2V8KP55      SDLKRQDAE---LTVT-FAPDYPSRRRIRSQIEEIQK---------------QIEGERGR
A0A399WNU1      TTLRQQLAQ---LKVD-YTDEWPEVQKVEKQIAGIEK---------------ELQSNRKR
A0A2V9CG11      TDLQRQFVE---LTAT-LTPAHYKVQRVQAQIAELQS---------------AVKNQRTL
A0A2V2R0I6      NELNAEYND---AVSQ-YGPNFPRVQRLQAQLKDLDA---------------TIEKEKQN
A0A2V8XAR9      NDLSSQHSD---ALSQ-YGPNFPKVQRLQAQLKDLDA---------------NIEKEKKK
A0A2V8VZA0      SDAASQYND---ALAQ-YGPNFPKVQRLQAQLKEFDQ---------------TIEKEKQK
A0A1Q7CB82      SDAASQYND---ALAQ-YGPNFPKVQRLQAQLKEFDQ---------------TIEKEKQK
A0A2V8WIU1      SDAASQYND---ALAQ-YGPNFPKVQRLQAQLKEFDQ---------------TIEKEKQK
A0A1Q6Y9F5      SDAASQYTD---ALAQ-YGPNFPKVQRLQAQIKEFDQ---------------TIEKEKQN
A0A2V9EVV8      SDAASQYTD---ALAQ-YGPNFPKVQRLQAQIKEFDQ---------------TIEKEKQK
A0A2V8YF91      SDTSAEYAN---ALTQ-YGPNFPKVLRLQAQLKEIDE---------------NIQGEKRG
A0A2V8XZK2      RDSSAEYTD---ALAQ-YGPNFPKVQRLKTELKDIED---------------SIEKEKRK
A0A2V8ZTX6      GETSADYAD---ALTQ-YGPNFPKVLRLKAQLKDIDD---------------NIEKEKQK
A0A2V9BT79      GETSADYAD---ALQQ-YGPNFPKVLRLKAQLKDIDD---------------NIEKEKRK
A0A1Q8B793      NDAYTQYTS---ALNQ-FGPNFPRVQRLQEQLKEFDG---------------LIDAEKKN
A0A2V9BCA0      NDAYTQYTS---ALNQ-FGPNFPRVQRLQEQLKEFDG---------------LIDAEKKN
A0A2V9BWU9      SELNTQYVE---ALNQ-YGPSFPKVVRLQAQLKEIEH---------------LIAREKAN
A0A2V9DKX2      SELNTQYIE---ALNQ-YGPSFPKVMRLQAQLKEIEH---------------LIAREKAN
A0A2V9JSI3      AELKAQLVD---ASGQ-YGPNYPKVVRLQDQVNEIQG---------------FIERERKR
A0A2V9WI32      SDLRMKYAE---ATTQ-FGSSYPKVMQLGNQLKQVEA---------------SIQAEDER
A0A2V8IVN9      LQLQSQYTQ---LSEK-FGDKHPDIIKVKSAIQLAQA---------------RLDGEIGK
A0A1F2TPT3      ERLRRDRAT---AART-LRAQHPSMLKLEETIQATQA---------------KLDVERSR
A0A2V8JTQ2      ADLENQIAQ---ASVQ-LGPAHPKMAELSKQLAQVRR---------------SVDAEVKG
A0A2V8UZY0      ADLENQIAQ---ASVQ-LGPAHPKMVELSKQLDQARR---------------SVDAEVNR
A0A3N5YNR8      FGLQQNLAS---LSAQ-FGSEWPAVIQVRQQIQEVEK---------------QLQREKKE
A0A350UEK1      SDLRRQQQE---LLET-FTPENQRVKRVAAQVASLEK---------------SLEVERAQ
A0A350UIQ4      SDLRRQQED---LLEV-FTPETSRVKRVNAQISSLEK---------------SLANERDQ
A0A3N6A5T6      ADLEQKLAN---MTSH-YGPVWPEVVQLKREVNEVNT---------------QLVREKKR
A0A1F2Q9L4      LKLERDYAT---KLNT-YKPEWPAMQELKAQIDKGRQ---------------HLGNVTKE
A0A1H5SQF5      GQLEVQISA---ETQK-YGPRNPAILSLKSELAELQR---------------QTNEEISR
A0A3E0NV31      ARQEQELAA---LSAR-YGPEWPSVRQTRSELAELRR---------------DLSAAGGR
A0A3N5M5V0      FGLQQNLAS---LSAQ-FGNEWPAVVQVRQQIREVEQ---------------QLVREKRE
A0A2V9AEW6      TELQRQYAE---LSAT-LTPEHYKVLRVQAQIDELKA---------------QIEKERGN
A0A2V8WQK6      TELQRQYAE---LSAT-LTPEHYKVKRVQAQITELRS---------------EMQKERAN
A0A2V8XIF4      TELQRQYAE---LSAT-LTPEHYKVQRVQAQINDLKA---------------EMQRERNN
A0A3N5XQP8      SALRQDYAR---LTSQ-FGPEWPEVIQAQRQITQGEQ---------------ELKQERER
A0A2Z5G7H4      AALQGQIAQ---DTSK-FGPSYPRLMDSRANLSGMES---------------AIEDEVHR
A0A2V9L5B5      ADTKKEYAQ---VTTW-VKPDYPKAQQVEKQIDALQA---------------ELDKQKKA
A0A2V9LK56      ADLEREYAQ---LTAV-VKPDYPSAVRLKKQIDLLQS---------------ILGKDKRT
A0A2V9L7I0      ADVQKEYAL---VTTW-VKPEYPKALQVKKQIDALQA---------------EIDRQKKA
A0A522PPT0      SDLRRQYSE---LTAT-VKPGYPKAMALKKQIETLQA---------------NLDHQKQA
A0A2V9KCS3      TELRRQLAE---LGAT-YTSTHPKVERVDAQIASVQS---------------ALERERVN
A0A2U3KC61      ADLNTQYAQ---ATTQ-FGSGYPKVVELKNQLKQVRT---------------EIVAEETR
A0A2V9Y2R7      ADLNVQHAQ---ATTQ-FGSAYPKVVELRNQLQEVRS---------------GISVEQTR
A0A372IT17      STAKAELAQ---DETR-YGAAWPGMQERQAQLTEIQK---------------SIHDEVRR
A0A136JPP4      KDAETEKAE---LLVK-YTPEYVKVKQVEEKIASLKT---------------TKQQTETE
A0A399WUJ8      KDAETEKAE---LLVK-YTPEYVKVKQVEEKIVSLKN---------------TKQQTESE
A0A2V9NGH6      ADFRIQVSQ---LSTQ-FGPAYPKVAQLNSQLQEVES---------------QIQLEMKK
A0A2V9PYE6      ADLRIQVSQ---LSTQ-FGPAYPKVAQLNSQLQEVES---------------QIQLEMKK
A0A2V9NL07      ADLKIQIAQ---VSTQ-FGPAYPKLAELNNQLQEIDS---------------QIQGETKK
A0A2V9QD92      ADLKIQIAQ---VSTQ-FGPAYPKLAELNNQLQEIDS---------------QIQGETKK
A0A2V9WPZ6      ADLKILVAE---LSTQ-FGASYPKVAQLNNQLKEIDI---------------QIQGEMKK
A0A2V9ZLH4      ADVKIQVAE---LSTQ-FGPSYPKVAQLNNQLKEIDV---------------QIQSEIRK
A0A2V9RQF1      ADIRIQTAQ---LSTQ-FGPSYPRLAQLNNQLKEVEA---------------QTQVEMKK
A0A2V9YDK8      ADLKIQVAE---LSTQ-FGSSYPKVAQLSNQLKEIVA---------------QIQAETKK
A0A2V9V8F7      ADLKILVAE---LSTQ-FGASYPKVAQLNNQLKEIDI---------------QIQGEMKK
A0A2V9XGR9      ADLKILVAE---LSTQ-FGASYPKVAQLNNQLKEIDI---------------QIQGEMKK
A0A2V9V3Q5      ADLKIQVAE---LSTQ-FGPAYPKVAQLNSQLKEIEN---------------QIQVETRK
A0A2V9NWS3      ADLKIQVAQ---LATQ-FGPAYPKLTQLNGQLKEVDA---------------QLQAEMKK
A0A2V9USA9      AELHIQTAD---LNTQ-FGPSYPKLAQLNNQLKEIDT---------------QIQGEMKK
A0A2V9XW18      ADLKIQAAD---LSTQ-FGPSYPRLNQLNNQLKEIDS---------------QIQGEMKK
A0A4R1LC91      ATLQGQIGE---LSAK-FGSAYPKIEELQGNLHSIQK---------------AIQAETHR
A0A3M2BZG9      DKLERQYRK---ALQT-FRDDWPSVTKLKEELEGKRA---------------KLTALVSA
A0A1Q7N5R7      HELTTKRAEQRALAYR-YTPDHPTLQRVTSEIETLER---------------TTIPALAK
A0A3M1SIV3      KAAESERAA---LLAR-YTPENPKVKQIEATIQKLQE---------------GKEKIRQE
A0A3E0PHB0      KTAESELAK---LRVK-YTEQHWKVKEAISLIASLKE---------------QKNQLEDE
A0A3M2D491      EKAEKEKAA---LLAR-YTEEHPSVKQIEAQIQQLRE---------------TKEKVKNE
A0A357F267      QQAETEKAE---LLVK-YTPEYFEVKKKVERIAALQE---------------TRAKTETE
A0A353C9L6      QETEAEKAE---LLVK-YTPEYPEVGKKEAKIASLKE---------------TKDKTERE
A0A2V8RQV0      QQTEVEKSE---LLVK-YTEAYPEVGKKDAKIASLRE---------------TKEKTEKE
A0A2V8SJH5      QDSEVEKAE---LLVK-YTPEYSKVKVVEERIASLKA---------------TKDRTESE
A0A2V9QB26      TELRRQHAE---LITI-YTEKHNKVKQVEAQIALLEA---------------ALQKEQAA
A0A2V9VYY4      ADLETQYAM---ATTQ-FGSGYPRVTELNNQLKQVRA---------------AIEAEKTK
A0A2V9KIE8      AELERQYAE---MTSM-VKPEYPKAVQLKKQIDVLEA---------------RITAQKQA
A0A352F549      GELRQKRAQ---LLLT-DTEESPEVKDATQQIATLEK---------------QLADTRGS
A0A3B9MLP9      AELKQKRAQ---LALT-DTEESPEVKDVNQQIAILEK---------------QLDETRGS
A0A3D5SQ87      AELKQKRAQ---LALT-DTEESPEVKDVNQQIAILEK---------------QLDETRGS
A0A2V8NW86      TELRRQKAE---LITI-YTEKHNKVKQVEAQIASLEA---------------ALQKERTA
A0A2V8ZHL8      ADLKAQYVD---ALEQ-YGPKHPKVERFRSQVDEVQS---------------LIDTERKR
A0A2V9B240      ADLKAQYVD---ALEQ-YGPKHPKVERLRSQVDEIQS---------------LIDTERKR
A0A2V9CBM2      TDLKREYAQ---LSTT-FGSDYPRVKEIQSQITDVEA---------------SLQQERKR
A0A2V8XN17      AELKREHAQ---LSTT-FSPDYPRVKEIQSQIDEIEA---------------SLRDERQR
A0A2V8WX45      AELKREHAQ---LSTT-FNADYPRVKEIQSQIDEIEG---------------SLQVERKR
A0A1Q6YR79      AELKREHAQ---LSTT-FSPDYPRVKEIQSQVDEIES---------------SLREERQR
A0A1Q7VA32      AELKREHAQ---LSTT-FSPDYPRVKEIQSQVDEIES---------------SLREERQR
A0A2V9EY85      AELKREHAQ---LSTT-FSPDYPRVKEIQSQIDEIES---------------SLREERQR
A0A2V9H8K0      AELKREHAQ---LSTT-FNPDYPRVKEIQSQIDEIAA---------------SLREERQR
A0A2V9FFE5      AELKREHAQ---LSTT-FNPDYPRVKEIQSQIDEIAA---------------SLREERQR
A0A2V9GM43      AELKREHAQ---LSTT-FNPDYPRVKEIQSQIDEIAA---------------SLREERQR
A0A1F2RFI7      ADLRREYSE---LTAT-FTPEYPRVKRLKNQIEEIER---------------TVQRERGA
A0A1F2RZS3      NDLRREYSD---LSAT-FTEEYPRVQRLKSQIDQTAA---------------ALDRERQA
A0A1F2USE2      AELQREHAQ---LTTT-FTAKYPRVEQLENQIQEVQG---------------LLGQEQDK
A0A2V9C238      ADLQREQAQ---LATT-FTADYPKVRQIQSQINELDA---------------ALARERGR
A0A1F2Q9F5      AELRRQHAQ---AATT-FSPDYPTVKQLQNQIDEIER---------------LLAQERAR
A0A1F2QQH9      AELRRQHAQ---AATT-FSPDYPTVKQLQNQIDEIER---------------LLAQERAR
A0A1F2QXK7      AELRRQHAQ---AATT-FSPDYPTVKQLQNQIDEIER---------------LLAQERAR
A0A2V9DEM9      ADLQREQAQ---LATT-FTADYPKVRQIQSQINELDA---------------TLARERGR
A0A2V9CYQ5      TDLKREYAQ---LSTT-FGSDYPRVKEIQSQITDVEA---------------SLQQERKR
A0A2V9BWU8      AELKRELAQ---LSTK-FNAEYPRVKEIQSQIDEIEA---------------TLREERQR
A0A2V8ZG48      AELKRQFAD---LSTK-FNPEYPRVKEIQSQINEIEA---------------TLKEERQR
A0A2V8Y334      ADLKRELAQ---LSTK-FNAEYPRVKEIQSQIDEIEG---------------TLKEERQR
A0A2V9AY68      AELKRELAQ---LSTK-FNPEYPRVKEIQSQIDEIEA---------------ALKDERKR
A0A257VBK0      NELNRDLGK---LQAK-FTPKHPEVLKKQEEIRGLKE---------------RISQQAET
A0A2V7XDY0      SAANNELTR---LRQQ-YKEGHPEIQKLLLQLDQAQK---------------TKERQGTQ
A0A350UQT3      NEAAERFAE---VKAH-FGVNHPEFRKAQAQLREIQS---------------QVDATRDN
A0A2U3JZ71      DEEQQKFAE---IKAH-YGPNHPEYRKASLQLAELER---------------QLQSGKEN
A0A2V8TTB0      NEAKERFAE---VRNH-YGINHPEYRKAQTKVQELET---------------QIADTGAS
A0A1F2TCR2      ADLNSQRLT---LSSR-YMDTHPDIQKLDAQIAIAKK---------------DLIAQRQR
A0A2N9LQU7      ADLKSQYAQ---LDAK-FGSGFPRVQELQAQLARLDQ---------------NIADELTN
A0A2P6WFK7      ADLKAQLAQ---VSAK-YGNGYPKLRELQTQLSKLNA---------------AIADEVAN
A0A1F2V330      EERRLHLKQ---LRSV-FTEQYPEVVSTEREIKELEK---------------AVAAAPPK
A0A2V8U914      TDLRRQLAD---LESI-LQPESYKVVRVKAQIVQLEA---------------AIARESRR
A0A662EE63      GEVEVELLD---KLGT-YKEGHPAIKELRVRLEGIDQ---------------AIERQIQT
A0A2V7W309      SRLQRDFNA---KRAQ-YTEAHPVMQDLAQQIEKTKL---------------ARAAAVRE
A0A2V8TLH7      AILERDLEK---LSVT-YKDKHVRVLEKQSEIDKTNQ---------------KLASEVDR
A0A1Q7ZJT1      AGLEREYER---LLVT-YKDKHVRVLEKQKEIEETTQ---------------KIASEVDR
A0A2V8VC99      VGLEREYER---LLVT-YKDKHIRVQEKQKEIDEISR---------------KIASEVDR
A0A348UZU3      LKLSREYAK---MEEK-FQPEYPEMQRLKAELDTARE---------------LLKNETQR
Q01XL7          VDLRREMAQ---LTAT-LTPEHYKVQKIQAQISELQQ---------------TLDKEKTG
A0A2V8ERZ5      SDLQREKAK---LLER-YQDKHPQVINAVAALQDAQR---------------QLDLEIAR
A0A2V8GTX0      VELQRDRVR---LEER-YGEKHPDVQRVNGQIQDAQR---------------QLDAEIER
A0A2V8J0X9      ATLTAQKAN---YAGR-YGPEHPRMMEVKDQIENAKR---------------RLVAERTK
A0A523DUV7      AELEVERVQ---LKNR-YKEGHPKVKKVVTQIEQLQD---------------AVRTQAEK
A0A372IRG7      ADLMVQKAQ---LQSK-FGPEYPKLREIDRQLGSVRS---------------DIQTEITN
A0A1F2U158      SELQRQKAQ---LSER-YGEKHPDIINVNARLGDEQR---------------QLDLETAK
A0A2V8F6S9      QELQRTLTE---LSAR-YGEKHPSIQKARTDLAEGQK---------------QYEFEVAR
A0A4Q1SCH5      ASLYAQEAQ---LATK-FGSSYPPLVETREQLASVRD---------------QIRKNVGN
A0A2W0BGU4      ANLRGQYVE---ALNQ-YGPNYPKVLRLDKQVKEASA---------------LIAAERGR
A0A2W0BVQ9      ANLRGQYVE---ALNQ-YGPNYPKVLRLDKQVKEASA---------------LIAAERGR
A0A3D1ASD2      DEAQSRLAD---VKLH-YGINHPEYRKAQGQVAELDR---------------QLQTAKTS
A0A2N9MK30      EQAQEKFAE---VKTH-YGPNHPEFHKAQTQLDQVQA---------------QFDATRGS
A0A1I6MH75      ALAKANYAQ---LMTT-LGPNNPKALELSNEIKELDA---------------QLAAEQKR
E8WVF6          ATARATYAE---LTAT-LGPNHPQVKAARAQIDEFQH---------------AVEAEQNR
A0A1H5Z7N3      ETTKADLAK---LNVA-MGDRNPQIRALRAQVDTLNQ---------------EIRAEQDR
A0A2V9YHT3      ADLKTQYAQ---VSTQ-FGPAYPKVVEVGNQLKQVQE---------------TIQGETRR
A0A1G7JVV8      AQTKAQIAQ---SSVS-LGPKNPQILALQAHLREVDR---------------EIKTEETR
A0A1H4T6W9      AETQASIAE---LSIT-LGPKNPKIVALQAHQREIQR---------------ELRSEENR
I3ZEU5          AETQASIAE---LSIT-LGAKNPKIIALRAHQREVQR---------------EVQAEENR
A0A5B9EBI2      ATARAHYAE---LTSQ-LGPNHPQVKAAKAQMDELAT---------------EINTEQGR
A0A239HDF6      STARSTYAE---QEAT-LGPNHPQAKSTKAQIDELAR---------------QVAAEQNR
A0A4Q0T270      AFARSNLAQ---LLTT-YGANHPLVKAQSNELAELEK---------------QLKAEQER
A0A1Q3QQB6      ATARASYAQ---MQAT-LGPNHPQAKALRAQIDELSK---------------EVTKEQNR
A0A3N1K1G7      AVARASYAQ---LEAT-MGPNHPQAKAQKAQIDELAK---------------EIDAEQSR
A0A428MDU2      ASAKANYAQ---MEST-LGPNHPQAQALKAQIDELEK---------------EIDAEQKR
A0A4V2G466      ATARATLAQ---MESD-LGPNHPQAKAQKAQIAALST---------------EINTEQQR
A0A4Q7YNP3      ADLKGKVAQ---LVPP-LTEENPKVIHLRSEIREVEA---------------GMEAARNA
A0A2V9MN96      AELETQYAQ---ATTQ-FGPSYPEVIQLRSQLNQVRN---------------SIATEQKN
E8UZE1          ITLESQYAS---LSSK-YGDSYPRVAQIKSELAEVNR---------------TITTELRR
A0A2V7V2Z1      AGLERQQAQ---LLER-YMDQHPEVVKVRNQIQETRK---------------KIAAESQR
A0A2V7X2F7      STLEQKQTQ---LLEQ-YLDQHPEVIKVRRQIEDTRK---------------RLSAEGQR
A0A2V7V2I1      ASLQRQSVQ---LQER-YLDQHPEVVKNRNQITETRE---------------KIASEAQR
A0A2V7U3M2      ATLERSQAQ---LLER-YMDQHPEVVKVRNQIQETRK---------------KIAAESQR
A0A2V7UHT0      ASLERAQAQ---LLER-YMDQHPEVVKVRNQIQETRK---------------KIAAESQR
A0A2Z5FVL3      ATLNGQINE---LLAK-FGPAYPKVDELKADLTAIQN---------------SIKEEIQR
A0A1V6HR88      VEMEREYAS---RLAT-FKPEWPAMVELKGRIDQARG---------------NLIPAARE
A0A2V9KBD6      DDLERQNAQ---ASVQ-LGPTNPKMAELSSQLSQVRS---------------SIDAEVKR
A0A2W0AJ66      ADLQMQLAQ---ASVQ-LGPTHPKIRELSNQLAQTRR---------------SIRSEVKR
A0A1Q7RBU1      ADLENQMAQ---ASVQ-LGPAHPKMGELSNQLAQAQR---------------SVDAEVRR
A0A2V9JPV9      ADLENQMAQ---ASVQ-LGPANPKISELSKQLAQARQ---------------SVDVEVRR
A0A3E0P0A3      IRLQREYDT---KLET-YRPDFPTMVELKTQIDEARR---------------QLNQLIEE
A0A2V8EXP2      AELQRQQAQ---LSEK-LGPRHPDMVKIGLAINAAEE---------------RIQGEIAK
A0A2W4RYA1      AALNQKKAQ---LSET-FGDRHPEIVAINRAIELAQQ---------------KLDTEIQK
G8P0Y7          SELQTRYAQ---LDTW-AGQSYPQMREITSQLDQLNK---------------SINEQVKN
A0A5M8T4U7      ADLQTQRDQ---LALE-VGPRHPKMQAMNAQIAKVKV---------------DLDHEVSL
A0A3P0X3W6      QDAEQAMAI---VQTH-YGPNNANYKVAANTLAEVTR---------------EYQAARDN
A0A1E3Y9R6      VAKESERAR---LGTQ-YGPAYPAMRDLASQIEAANR---------------DLDLEIDK
A0A2W4TLP2      AAKEAERAR---LGTQ-YGPAYPAMRELATQIERARR---------------DLETEVSK
A0A3R9WF43      ASLRREYAS---YATK-YGEKNPRLLQLQEQINAVDA---------------QMQTEMAR
A0A317HKM4      TTSERELGQ---ASKE-LGEHHPTIIKLREAVQNADR---------------KLQAEIAA
A0A523E0N1      LDLSERYSE---LRTT-FGPDWPEIKRVKGALDETKR---------------DLDVVATE
A0A523ECP2      GVLEGQVAE---LTAK-FKDDWPDLRRAREGLTDIKS---------------RIEIERNV
A0A2W0C122      AELKNEYAQ---ATTT-YGPNHPKVIELTNRINAINL---------------SIQTELKR
A0A2W0AUU7      AELKNEYAQ---ATTT-YGPNHPKVLELTNRIKAMDT---------------SIQTELKR
A0A2W0BQL1      AELKNEYAQ---ATTT-YGPNHPKVLELTNRIKAMDT---------------SIQTELKR
A0A4Q1SDL1      ANIETEIAS---GEKH-YGSAYPHMVELRASLDKVNQ---------------AISDEVSR
A0A3P0XH15      AALTVQQAQ---LQSK-FGPEWPRVKEVQGSLVQVRK---------------AIDVEINN
A0A4R1LAZ7      AALLVQAAQ---LESK-YGPDWPRVREIRSQLSQVQR---------------DIDSEINS
A0A3M1WQW8      ADDRRRLVK---LQQQ-YTDEWPEIQSLKGEIAETEQ---------------QLAE----
A0A3N1JHC1      TELHRQLAE---MSTT-MTPSNYKVQKVESQIKELEE---------------EMQRHRFT
C1F294          ANLLVQQAD---LQSR-FGPRYPKLEEVRQQLKQVRS---------------DINKEITN
A0A2V9KA79      EDLRLELKG---LQARGYTENHPEVIRLRRQIQEFEA---------------SASAQAPV
A0A522PSP1      QQTQLQLDA---LSSK-YGPGNYLFQQKQRELTQIDN---------------SIRKGQQH
G8P085          ATLYGQYVQ---LSTK-FGQNYPPLAQVKDQMQKTDA---------------ELERQSSI
A0A4Q1SGQ1      AALEAEIAE---NDAR-YGPAHPHTAELQAELTGVQR---------------SIRAEAER
Q1ILD9          ADIQNQLSQ---ATAI-YGPNYPRVVELKKQLAQVNA---------------SLAKETRD
Q1IJZ6          SQLKQQMAS---AVQI-YGARNPHLVDVDKQLSDVDS---------------QIKGELKL
A0A2V8TCE6      NDLEIQRAE---LLRT-FKPGWPQVEVLTRKLEGARQ---------------QLSSETEA
A0A522TBE8      QTDQNQLQV---LGQI-YGTSHPRYRQQSTVVRRDEE---------------AVQQAQAR
Q1ITG0          ADLRNQLAQ---YSTK-FGSNYPKVIQLNNQLAQTDA---------------SLKKEIRD
A0A3N5PCI5      ANLQRERMQ---LASN-LGAKHPEMVRVNSAIEAAER---------------ELDSEVAK
A0A3M1Q0S9      ARLERDYAN---KRVL-LGERHPDVQQIATELAAGRE---------------RLASETER
A0A2Z5G448      AELLVQSAE---LKSK-YGFDYPRVREVEKQLTAVQT---------------DIDAEISN
A0A3M1VZ38      SALESEYRE---KLVQ-LGEKHPEVQTVKAKLDSSRE---------------HLQEQIAA
A0A4Q1SD29      AALLVQAAQ---LKAK-FGPNYPKVVEVNNQLEKVQS---------------DIDQEINS
A0A3M1PY35      ASREQRLEE---LRTR-FGPDWPEVRELSRAIAEARV---------------RLAERAAA
A0A3M1VMP2      AELRRELAE---LEGK-VGPNWPRLVELRAAVKETER---------------NLENEMEA
                                                                            

A0A2V7VMF7      ---------------------IADGLQ----AE-------------------FAQLQKRE
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ---------------------IYVNLS-------------------------FSPASQSS
A0A2V8JK38      ---------------------IVKTFE----VE-------------------YSAATERE
A0A2V9IXG5      ---------------------YADGMR----VS-------------------VSVLRNRE
A0A2V9J2P4      ---------------------YADGMR----VS-------------------VSVLRNRE
A0A1Q7RLS4      ---------------------IINGLR----SQ-------------------YDLLKDRE
A0A2V2R525      ---------------------AVKGLE----TK-------------------FREAQRRE
A0A321LPW6      ---------------------LEARLR----AD-------------------YERSARDE
A0A2V9R9V4      ---------------------LEEKLK----AD-------------------YERVVRDE
A0A321LE75      ---------------------LEARLK----AE-------------------YERAIRDE
A0A2V8R8U7      ---------------------VLASMK----SR-------------------ADAAEAHE
A0A2V8QMP4      ---------------------IIAGLE----NR-------------------YEAAVKNE
A0A2V8R4S3      ---------------------IIAGLE----NR-------------------YEAAIKNE
A0A2V8NJ55      ---------------------IINSLK----LR-------------------YETALATE
A0A2V8Q7I0      ---------------------IIARLK----SE-------------------YQESYAHE
A0A2V8S6K4      ---------------------IVIGMG----AS-------------------LDGAKKRA
A0A317I2L9      ---------------------AIQGLK----AQ-------------------YEAALAHE
A0A2V8LLF9      ---------------------VLAGLK----SR-------------------RDSAIAHE
A0A352FRF4      ---------------------VLASMK----AK-------------------SDAATTQL
A0A2V8MKV0      ---------------------ILVSME----SR-------------------YKAAEATE
A0A2V8PYY8      ---------------------ILASME----SR-------------------YKAAEATE
A0A1Q7YKQ8      ---------------------VLATMK----SK-------------------YDAAVTTE
A0A352F3R7      ---------------------IVTSIQ----RR-------------------YEAAVSRE
A0A0B6WXT1      ---------------------VIKAMR----SR-------------------YEAALARE
A0A3B9MEU8      ---------------------IVTSIQ----RR-------------------YEAAVSRE
A0A2V8MHG6      ---------------------VKTNLE----TR-------------------YRQALQKE
A0A2V8P7N1      ---------------------VKTNLE----TS-------------------YRQALQKE
A0A2V8M3M6      ---------------------VKTNLE----TS-------------------YRQALQKE
A0A1Q7NJH5      ---------------------VKTNLE----TS-------------------YRQALQKE
A0A2V8PJY0      ---------------------VKTNLE----TS-------------------YRQALQKE
A0A1Q7Y6W9      ---------------------LTTNLK----TN-------------------YLQAKAQE
A0A2V8NC68      ---------------------AITNLE----TS-------------------YRQAMARE
A0A399WK13      ---------------------LLYNLQ----TK-------------------YLQAKANE
A0A352FLX4      ---------------------VTTNLA----TR-------------------YRQALATE
A0A2V8RTL7      ---------------------LLENYK----TQ-------------------YQQAKDQE
A0A3E0PCJ6      ---------------------ILENLK----TR-------------------YLQTKERE
A0A3M1S4R8      ---------------------ILTNLQ----TR-------------------YEQAKAQE
A0A1Q7YFI6      ---------------------LKTNLE----TR-------------------YHQALARE
A0A136KC10      ---------------------LLYNLQ----TK-------------------YLQAKANE
A0A2V8SEX6      ---------------------LVDNLR----TK-------------------YLQTKNEE
A0A3M2D6Y5      ---------------------ILTNLQ----TK-------------------YEQAKAQE
A0A0B6WWQ6      ---------------------MLTNLR----TR-------------------YRQALARE
A0A3B9MK99      ---------------------LLTNLE----TD-------------------YRQTLARE
A0A352EX26      ---------------------LLTNLE----TQ-------------------YRQTLGRE
A0A2V8MM59      ---------------------LLTNLE----TR-------------------YRQTLARE
A0A2V8PFE8      ---------------------LLTNLE----TK-------------------YRQSLARE
A0A2V8PWS6      ---------------------LLTNLE----TK-------------------YRQALARE
A0A2V8LCT5      ---------------------LLTNLE----TK-------------------YRQAAERE
A0A352FTJ9      ---------------------LLKNLE----TK-------------------YRQAADRE
A0A2V8G155      ---------------------VVDSVK----TD-------------------YLAAVAQE
A0A2V8HDM7      ---------------------VVDSVK----TD-------------------YLAAVAQE
A0A2V8DRT9      ---------------------VVHALS----ND-------------------YQAALAQE
A0A2V7VYF3      ---------------------VVESVH----NE-------------------YLTALARE
A0A1F2SVH2      ---------------------VVQAMR----ND-------------------YRQTVAQE
A0A2V8AJG9      ---------------------VVQSVK----NE-------------------YQAALIQE
A0A2G6PYV5      ---------------------LYNRLIQSISKDVQDRKNELA----------YLEAQRKK
A0A2V8F956      ---------------------VVQGVK----NE-------------------YLAALAKE
A0A1F2S1W5      ---------------------VLQAMR----ND-------------------YEAALTEE
A0A1F2T595      ---------------------IAQAIR----SE-------------------YEAALAEE
A0A2V8JQV5      ---------------------ILRGIA----NQ-------------------YEDAKRRE
A0A2V9AC41      ---------------------EVKRIE----VT-------------------YTAAKNNE
A0A2V8K4L4      ---------------------VVTRLR----ND-------------------YAAAESHE
A0A2V8NCZ3      ---------------------VVTRLN----ND-------------------YAAAQSHE
A0A2V9MAM9      ---------------------TRQRLR----ND-------------------YLTARRRE
A0A2V9M454      ---------------------VVDNLH----ND-------------------YLAAVERE
A0A2V9IVR7      ---------------------IVERYH----GE-------------------YVAAQQRE
A0A2V9ILE2      ---------------------IVERYH----GE-------------------YVAAQQRE
A0A2V9LGY4      ---------------------IVERYH----GE-------------------YVAAQQRE
A0A2V9J4D6      ---------------------VVERIQ----RD-------------------YEAAVERE
A0A2V9L9C5      ---------------------VVERIQ----RD-------------------YEAAVERE
A0A2N9M9N1      ---------------------IMERIE----SD-------------------YRTAVRRE
A0A2V9JEC4      ---------------------LVKQTK----DA-------------------YDTAVRRE
A0A2V9LPQ3      ---------------------TVERIQ----ND-------------------YRAASTRV
A0A348V070      ---------------------LIKTAY----AE-------------------YQGALAKE
A0A2Z5G3A3      ---------------------MGARAE----ND-------------------FKVAKTAE
A0A2V7UGP8      ---------------------IFDDTLKTAKME-------------------YEEASAHE
A0A239MKT6      ---------------------LNSETR----SS-------------------YLLAKADE
A0A3E0PCN7      ---------------------SADVQLSDLQRQ-------------------FREASSRE
A0A2V8IYW3      ---------------------AAPQVA----DNVVVRRMRETQTEIDKLDRQIAGKEADS
G2LEI9          ---------------------TLVRIK----TA-------------------YENAKRRE
A0A317J121      ---------------------EIQRIK----ND-------------------YDVALRRE
A0A2V7YW66      ---------------------LTEKARNAAAAS-------------------YQTALRQE
A0A2V7Z0V0      ---------------------QVDKAKSNSLAA-------------------YQTAQRQE
A0A2V8GFD4      ---------------------IAESVR----TE-------------------YLAAAAQE
A0A2V8HSS5      ---------------------IAESVR----TE-------------------YLAAAAQE
A0A2V8KP55      ---------------------IVKTFE----VE-------------------YSAATERE
A0A399WNU1      ---------------------SADTQIASLLQT-------------------YREAASRE
A0A2V9CG11      ---------------------ILRRIG----SE-------------------YSAARQRE
A0A2V2R0I6      ---------------------ILNGLE----AD-------------------YREARQHE
A0A2V8XAR9      ---------------------IVDVLE----SD-------------------YREARQRE
A0A2V8VZA0      ---------------------ILDVLE----SD-------------------YHEAQQRE
A0A1Q7CB82      ---------------------ILDVLE----SD-------------------YHEAQQRE
A0A2V8WIU1      ---------------------ILDVLE----SD-------------------YHEAQQRE
A0A1Q6Y9F5      ---------------------ILNVLE----SD-------------------YHEAQQRE
A0A2V9EVV8      ---------------------ILDVLE----SD-------------------YHEAQQRE
A0A2V8YF91      ---------------------ILDALE----SD-------------------YREARQRE
A0A2V8XZK2      ---------------------VLEVLE----SD-------------------YREARQRE
A0A2V8ZTX6      ---------------------ILDVLE----SE-------------------YREARQRE
A0A2V9BT79      ---------------------ILEVLE----SD-------------------YREARQRE
A0A1Q8B793      ---------------------IVTSIE----NE-------------------YRAARQRE
A0A2V9BCA0      ---------------------IVTSIE----NE-------------------YRAARQRE
A0A2V9BWU9      ---------------------IINRIE----AE-------------------YHTARQRE
A0A2V9DKX2      ---------------------IVNRIE----AE-------------------YHTARQRE
A0A2V9JSI3      ---------------------IAGRVR----ND-------------------YRAAMGRE
A0A2V9WI32      ---------------------IASRVQ----NE-------------------YLSALQRE
A0A2V8IVN9      ---------------------VVQSVK----NE-------------------YLGSLAKE
A0A1F2TPT3      ---------------------VLEAMR----ED-------------------LGVSRAAE
A0A2V8JTQ2      ---------------------IGERIT----YE-------------------YQTAAERE
A0A2V8UZY0      ---------------------IGKRIT----YE-------------------YQSAVGRE
A0A3N5YNR8      ---------------------TINRVQ----SE-------------------YRVAVNRR
A0A350UEK1      ---------------------ILRRIR----NE-------------------YEEAMRKE
A0A350UIQ4      ---------------------ILRRIR----NE-------------------YEEAMRKE
A0A3N6A5T6      ---------------------AIQRAR----AQ-------------------YQVAVDRR
A0A1F2Q9L4      ---------------------MVGKARDSARAE-------------------YQGALRRE
A0A1H5SQF5      ---------------------VGNQAA----RN-------------------LDLARKTE
A0A3E0NV31      ---------------------AADAVL----QQ-------------------YRAAQRRA
A0A3N5M5V0      ---------------------TIRRAQ----SE-------------------YKVAVNRQ
A0A2V9AEW6      ---------------------VLGRMR----NE-------------------YEAALRRE
A0A2V8WQK6      ---------------------VLRGLG----NE-------------------YAAAVRRE
A0A2V8XIF4      ---------------------VLRRIG----NE-------------------YTAAVRRE
A0A3N5XQP8      ---------------------ALEEAQ----GR-------------------YRASLQQY
A0A2Z5G7H4      ---------------------VAERSK----ND-------------------YEIARREE
A0A2V9L5B5      ---------------------VVDNIV----DE-------------------YRSATAKE
A0A2V9LK56      ---------------------LVQNLV----DA-------------------YSSAVNRE
A0A2V9L7I0      ---------------------VTENIV----DE-------------------YRSAAAKE
A0A522PPT0      ---------------------LTQNIA----QQ-------------------YDAAVVRE
A0A2V9KCS3      ---------------------ILKRIR----NE-------------------QEAAVRRE
A0A2U3KC61      ---------------------MQHGVR----DE-------------------YLAAVQRE
A0A2V9Y2R7      ---------------------MQHRIR----DE-------------------YLAAAQRE
A0A372IT17      ---------------------VGERAH----AD-------------------YEIAQRAE
A0A136JPP4      ---------------------VSQIID----RDQKKIEKDAVSGALVSLRSQVDAARRRE
A0A399WUJ8      ---------------------VSQIID----RDQKKIEKDAVSGALVSLRSQLDAAKRRE
A0A2V9NGH6      ---------------------VIARVR----SD-------------------YLASVHRE
A0A2V9PYE6      ---------------------VIARVR----SD-------------------YLASVHRE
A0A2V9NL07      ---------------------VGGRLR----GD-------------------YLAALQRE
A0A2V9QD92      ---------------------VGGRLR----GD-------------------YLAALQRE
A0A2V9WPZ6      ---------------------MGGRVR----GQ-------------------YMASLHRE
A0A2V9ZLH4      ---------------------IAGKVR----NQ-------------------YLAAVQRE
A0A2V9RQF1      ---------------------ITSRVR----SD-------------------YLASLQRE
A0A2V9YDK8      ---------------------IAGHVR----SQ-------------------YMASLQRE
A0A2V9V8F7      ---------------------MGGRVR----GQ-------------------YMASLHRE
A0A2V9XGR9      ---------------------MSGRVR----GQ-------------------YMASLHRE
A0A2V9V3Q5      ---------------------AVDHLR----GQ-------------------YQTALQRE
A0A2V9NWS3      ---------------------VVARVR----SD-------------------YLAALQRE
A0A2V9USA9      ---------------------IASKVR----GQ-------------------YMTALQRE
A0A2V9XW18      ---------------------IVAKVR----GQ-------------------YNAALQRE
A0A4R1LC91      ---------------------VAERAQ----ND-------------------YLVAQGVE
A0A3M2BZG9      ---------------------EVNQRRDLARTA-------------------YQEALRKE
A0A1Q7N5R7      ---------------------AL-----------------------------ATELESRE
A0A3M1SIV3      ---------------------ESAQIE----QESKQAEERAKKEILTGLAAQLNSARKRE
A0A3E0PHB0      ---------------------SKQIIE----DESKTLEKAVQKEITSALAAKLNTARRRE
A0A3M2D491      ---------------------VEKKLE----LESKLLEQRAQKELLTALSAQLNAAKQKE
A0A357F267      ---------------------VTQIID----RDQKKIEVDAINGALVSLKAQLDAKRKEE
A0A353C9L6      ---------------------VSGIID----RDQKKIEKDAVTGALVSLRAQLDSKRREE
A0A2V8RQV0      ---------------------VSKIID----TDQKKIEKEAVSGALVSLRAQLNAARTQE
A0A2V8SJH5      ---------------------VSTIID----KDQKKIEKDAVNGALVTLRSQLSAAQKQE
A0A2V9QB26      ---------------------IVDRIR----ND-------------------YKTALRRE
A0A2V9VYY4      ---------------------LQQKMR----DD-------------------YLAALQRE
A0A2V9KIE8      ---------------------LVENIV----EE-------------------YHAAESNE
A0A352F549      ---------------------AKQIITTNLEVN-------------------YRKAVERE
A0A3B9MLP9      ---------------------ARKIITVSLDSN-------------------YRQALDRE
A0A3D5SQ87      ---------------------ARKIITVSLDSN-------------------YRQALDRE
A0A2V8NW86      ---------------------IVDRIR----ND-------------------YETALRRE
A0A2V8ZHL8      ---------------------IVERLR----ND-------------------YMAALGRE
A0A2V9B240      ---------------------VVERLR----ND-------------------YEAALGRE
A0A2V9CBM2      ---------------------AADQIT----NE-------------------YFAASSRE
A0A2V8XN17      ---------------------AADRIA----ND-------------------YSAAVRRE
A0A2V8WX45      ---------------------AADRIA----ND-------------------YSAAVRRE
A0A1Q6YR79      ---------------------AADRIA----ND-------------------YSAAVRRE
A0A1Q7VA32      ---------------------AADRIA----ND-------------------YSAAVRRE
A0A2V9EY85      ---------------------AADRIA----ND-------------------YSAAVRRE
A0A2V9H8K0      ---------------------ATDRIV----ND-------------------YSAAVRRE
A0A2V9FFE5      ---------------------AADRMV----ND-------------------YSAAVRRE
A0A2V9GM43      ---------------------AADRMV----ND-------------------YSAAVRRE
A0A1F2RFI7      ---------------------FAKRVT----DD-------------------YRAALNRK
A0A1F2RZS3      ---------------------FAQRVA----ND-------------------YKAAANRK
A0A1F2USE2      ---------------------AAERIR----KE-------------------YGAAQQRQ
A0A2V9C238      ---------------------VAGRIT----ND-------------------YLAAVRRE
A0A1F2Q9F5      ---------------------AAERLA----ND-------------------YQAAMRRE
A0A1F2QQH9      ---------------------AAERLA----ND-------------------YQAAMRRE
A0A1F2QXK7      ---------------------AAERLA----ND-------------------YQAAMRRE
A0A2V9DEM9      ---------------------VAGRII----ND-------------------YLAAVRRE
A0A2V9CYQ5      ---------------------AADQIT----NQ-------------------YLAASSRE
A0A2V9BWU8      ---------------------AADKIT----NE-------------------YSAAVRRE
A0A2V8ZG48      ---------------------VADKIV----NE-------------------YLAAVRRE
A0A2V8Y334      ---------------------AADKIT----NE-------------------YFAALRRE
A0A2V9AY68      ---------------------AADKIT----NE-------------------YFAALRRE
A0A257VBK0      ---------------------VLGSYR----NQ-------------------LSALRGER
A0A2V7XDY0      ---------------------IIAALR----AD-------------------YEQLQKRE
A0A350UQT3      ---------------------AIRRMQ----VE-------------------YEQAQARE
A0A2U3JZ71      ---------------------IGQRVE----VE-------------------YREALNRE
A0A2V8TTB0      ---------------------IAQRVE----IE-------------------YREAVNRE
A0A1F2TCR2      ---------------------VIETAK----TD-------------------YEAAVAEE
A0A2N9LQU7      ---------------------VGQRLH----DE-------------------FLAAQNSE
A0A2P6WFK7      ---------------------VGRRME----TE-------------------YQSAAKTE
A0A1F2V330      -------PTVAEPSAARMHYVQIRAEK----ES-------------------LEQRLTSY
A0A2V8U914      ---------------------VRQSVQ----ND-------------------YVAAQRRQ
A0A662EE63      ---------------------LRLGME----TR-------------------FDMVKRRE
A0A2V7W309      AYSR-----------------ALEEAR----AQ-------------------VSAASSRE
A0A2V8TLH7      ---------------------IISNLR----TQ-------------------YALLKDRE
A0A1Q7ZJT1      ---------------------IINGLR----SQ-------------------YDLLKDRE
A0A2V8VC99      ---------------------IINGLR----AQ-------------------YELLKDRE
A0A348UZU3      ---------------------LIRAAY----AD-------------------YQAALKKE
Q01XL7          ---------------------LLKRLD----ND-------------------YQEALRRE
A0A2V8ERZ5      ---------------------AVQSVK----NE-------------------YETAVLQE
A0A2V8GTX0      ---------------------SVAAIK----AD-------------------YQAALDEE
A0A2V8J0X9      ---------------------VLESLK----ND-------------------YNAAFAQE
A0A523DUV7      ---------------------LVAGMR----AD-------------------YQQLRRRE
A0A372IRG7      ---------------------LTQRFQ----TE-------------------YDAAVKTE
A0A1F2U158      ---------------------ALQTVR----NE-------------------YERAVLEE
A0A2V8F6S9      ---------------------AATTIK----ND-------------------YESAVLEE
A0A4Q1SCH5      ---------------------ITAHLK----QD-------------------LDASRQAE
A0A2W0BGU4      ---------------------IAQRIR----ND-------------------YFAAARRE
A0A2W0BVQ9      ---------------------IAQRIR----NE-------------------YFAAARRE
A0A3D1ASD2      ---------------------ITEQVA----IE-------------------YRTATQRE
A0A2N9MK30      ---------------------VMRRVE----VE-------------------FREGVNRE
A0A1I6MH75      ---------------------LLIQTR----EA-------------------YLATKANE
E8WVF6          ---------------------LLTQAK----ET-------------------YLIAKANE
A0A1H5Z7N3      ---------------------ILAQAR----QN-------------------YIASRTNE
A0A2V9YHT3      ---------------------IGGRLQ----SE-------------------YQAATQRE
A0A1G7JVV8      ---------------------MVTEAK----QA-------------------LVAAQANE
A0A1H4T6W9      ---------------------LLTEAK----QA-------------------LVAAKANE
I3ZEU5          ---------------------LLTEAK----QA-------------------LVAARANE
A0A5B9EBI2      ---------------------LLNQAK----QT-------------------YLAAKATE
A0A239HDF6      ---------------------LLLQSK----EN-------------------YLIAQANE
A0A4Q0T270      ---------------------LLTQAR----EN-------------------FNAAKANE
A0A1Q3QQB6      ---------------------LLLQAK----EN-------------------FVVARANE
A0A3N1K1G7      ---------------------LLLQAK----QN-------------------YVIARANE
A0A428MDU2      ---------------------LLLQAK----QN-------------------YVVARTNE
A0A4V2G466      ---------------------LVLQAK----EN-------------------FLAARTNQ
A0A4Q7YNP3      ---------------------NSNRLK----NE-------------------LETARHRE
A0A2V9MN96      ---------------------LLSKVR----DE-------------------YMAAIQRE
E8UZE1          ---------------------GRNQLE----LE-------------------YKLASENE
A0A2V7V2Z1      ---------------------VIRAAE----ND-------------------YKAYAAQE
A0A2V7X2F7      ---------------------VIRSAE----ND-------------------YKAAAAQE
A0A2V7V2I1      ---------------------VIRAAE----ND-------------------YRAAVAQE
A0A2V7U3M2      ---------------------VIRAAE----ND-------------------YKAAAAQE
A0A2V7UHT0      ---------------------VIRAAE----ND-------------------YKAAAAQE
A0A2Z5FVL3      ---------------------MRDRAR----NE-------------------YVVAQQVE
A0A1V6HR88      ---------------------ALAKAR----EA-------------------ARAEYQGA
A0A2V9KBD6      ---------------------IGDRLT----YE-------------------YHSAAERE
A0A2W0AJ66      ---------------------TRERMT----NE-------------------YRMALERE
A0A1Q7RBU1      ---------------------IGEHIT----YE-------------------YKSAVGRE
A0A2V9JPV9      ---------------------IGERIT----YE-------------------YKSAVGRE
A0A3E0P0A3      ---------------------NSRQAV----TA-------------------ARARYQQA
A0A2V8EXP2      ---------------------VVQAVR----NE-------------------YLSAQTQE
A0A2W4RYA1      ---------------------VVASIT----AQ-------------------YEAAVAHE
G8P0Y7          ---------------------SVSRIH----ND-------------------YQTAVNRE
A0A5M8T4U7      ---------------------AHRQIQ----DE-------------------YQGALRTE
A0A3P0X3W6      ---------------------TGRRIQ----TD-------------------FAQADTRE
A0A1E3Y9R6      ---------------------VAAALQ----AE-------------------FQTARARE
A0A2W4TLP2      ---------------------VAAAIE----AD-------------------FETALARE
A0A3R9WF43      ---------------------ITKRAE----NA-------------------YQYAKDNE
A0A317HKM4      ---------------------AAHTIR----ND-------------------FEAAQSRE
A0A523E0N1      ---------------------QAAKVV----GT-------------------AKGEFQEA
A0A523ECP2      ---------------------LAVEVV----AK-------------------ARVEYRAA
A0A2W0C122      ---------------------LQARAE----LE-------------------YQVASRRE
A0A2W0AUU7      ---------------------LQGRAE----LE-------------------YQVAARRE
A0A2W0BQL1      ---------------------LQGRAE----LE-------------------YQVAARRE
A0A4Q1SDL1      ---------------------VQARAK----SD-------------------YEIAQKTE
A0A3P0XH15      ---------------------MQQRFQ----VE-------------------YETALSTE
A0A4R1LAZ7      ---------------------LTQRFQ----EE-------------------YNAASNTE
A0A3M1WQW8      ---------------------IEKQIL----AK-------------------IEADYKAA
A0A3N1JHC1      ---------------------IVKRLS----VE-------------------DDTAARRQ
C1F294          ---------------------LTQRFK----AE-------------------YDAAVQTQ
A0A2V9KA79      EGPVSARRPAGEPSPFFLRYLQLKSEV----EA-------------------IDQRLNSS
A0A522PSP1      ---------------------ILAQIK----AQ-------------------ARAQAVQV
G8P085          ---------------------VKNRLK----QE-------------------YDTAVAI-
A0A4Q1SGQ1      ---------------------MGHR---------------------------ARVDLDIA
Q1ILD9          ---------------------IEARFS----SE-------------------YEASLNTE
Q1IJZ6          ---------------------IVDR---------------------------TELDLELA
A0A2V8TCE6      ---------------------IARRIV----SA-------------------EQAKYRAA
A0A522TBE8      ---------------------LA--------GA-------------------ARAQFVAA
Q1ITG0          ---------------------IEERFR----TE-------------------YESAKRTE
A0A3N5PCI5      ---------------------TVESVR----QE-------------------YLAALSRE
A0A3M1Q0S9      ---------------------IARQVR----EA-------------------AKIDYEQA
A0A2Z5G448      ---------------------LLKRFE----EE-------------------YNAAVNTE
A0A3M1VZ38      ---------------------IAASAI----DS-------------------AQAAFEQA
A0A4Q1SD29      ---------------------LTKRFT----EE-------------------YDASVNTE
A0A3M1PY35      ---------------------VFEEAV----GA-------------------ARADLELA
A0A3M1VMP2      ---------------------IYRQAL----ES-------------------ARAELALR
                                                                            

A0A2V7VMF7      SELRDAIDAQKADAARQS-QK----KTEVEVLKKEAQSAASLYDVLLQKLNESDIAA---
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      --------------------------------KTSDTGSQALVATLTNRREQAAAVQSFW
Q01X01          --------------------------------RAEGDGNREFYDAMARRANEAS------
A0A3M2D9H8      Q------------------------NGTNNQLQAALVLYQQIYANLLSNYEAIRLAR---
A0A2V8JK38      RLLSVALEQQRDAVNKMN-RE----IIQYNILKREADSSKDIYNGLLTRLKEAGISG---
A0A2V9IXG5      QASQKSYSEKMAERRVTS-RH----MAEMSSFIKSKENWASAFAAVEQKLRDLSLQE---
A0A2V9J2P4      QASQKSYSEKMAERRVTS-RH----MAEMSSFIKSKENWASAFAAVEQKLRDLSLQE---
A0A1Q7RLS4      AKLIKATDETRTESLQVN-RK----ASGYEMVRGEATETKRIYDLISARVKEIDLSS---
A0A2V2R525      QEIRDAFEKARSETITQN-SA----AVNYRILQQEIQTNQELLNGLWQRYKENDVIL---
A0A321LPW6      VSLKGALDRAKTEAARQN-QD----AIQYGILKQDVDTAKSLYTEFLQKTNQANLEL---
A0A2V9R9V4      NALKAALEEAKAGAAQEN-QR----AIQYSLLKQDVDTAKSLYTEFLQKTNQAYLEV---
A0A321LE75      TALKESLERAKIDAAQQN-QD----AITFNILRQNVETAKTLYTDFLQKQSQARVQV---
A0A2V8R8U7      RSLEKAYSVQHGKTVSQT-RN----VIDLAIKTQELTTDAQYLNTLMQKRRELAAGG---
A0A2V8QMP4      RSATGSYFAARAKANDQS-VA----DTKLADLDQQIATDRQNLNLYMQRANELKVTA---
A0A2V8R4S3      RSATGSYFAARAKANDQS-VA----DTKLADLDQQIATDRQNLNLYMQRANELKVTA---
A0A2V8NJ55      QKIKTDYEHERGAAQAQG-KA----ALDIGGLTQELETYRQLFQTLSQKQNEIDLAG---
A0A2V8Q7I0      NSVRAMYNSQHGTATQQT-RN----QIEMAQYKQELETDKQYLNTLMARKRDVQTSN---
A0A2V8S6K4      ASLQAAYYKERSAAQAQG-IQ----VIGLSNVEQQLTTSKQMLSTLLQRRQELETAD---
A0A317I2L9      QSIKSMYNAQRGVTSQQT-RA----QIDMVSYTQTLETNKQYLNTLQQRLREIQASS---
A0A2V8LLF9      KSLVGAYSRQHGTTIQQT-KD----QIDMAIITQALTTDQQYLNTLTQRLRELTATS---
A0A352FRF4      ADLKTAYTKESGLTAQQT-KN----IIELASMRADLASDQQYLNTLFQKRRELNAVS---
A0A2V8MKV0      RSLAQAYSQAHGVTAAQL-DH----ELELAAMTQKLTSDEQYLNTLNQKERELKATG---
A0A2V8PYY8      KSLAQAYSQAHGVSTAQI-QH----ELELAAMTQNLTSDEQYLNTLNQKERELKATG---
A0A1Q7YKQ8      NSLRASYNQQHSEFSQQT-QD----QIQLTMIEQEIETNRQYLTTLLQRQRELENEQ---
A0A352F3R7      NLLRRSYEQQKGTTTQQT-RD----QIDLIALTQGLETDKQYLNTLLQRQRELQVTS---
A0A0B6WXT1      NKLKQAYYQEAAAANEQN-QA----EIELSRITQELETNKQFYNTLFQRQKELEITS---
A0A3B9MEU8      NLLKRSYEQQKGTTTQQT-RD----QIDLMAITQELETNKQYLNTLLQRERELTVAS---
A0A2V8MHG6      EALRQAFEKQRAETLTQN-EA----AVNYRIIQQQIETNKSLLDGLLQRSKENEVIL---
A0A2V8P7N1      EALRQAFDKQRAETLTQN-EA----AVNYRIIQQQIETNKSLLDGLLQRSKENEVIL---
A0A2V8M3M6      EALRQAFDKQRAETLTQN-EA----AVNYRIIQQQIETNKSLLDGLLQRSKENEVIL---
A0A1Q7NJH5      EALRQAFAKQRAETLTQN-EA----AVNYRIIQQQVETNKSLLDGLLQRSKENEVIL---
A0A2V8PJY0      EALRQAFAKQRAETLTQN-EA----AVNYRIIQQQVETNKSLLDGLLQRSKENEVIL---
A0A1Q7Y6W9      DSLRDAFNKQRSETLVQN-EA----AVNYNIIKQGIETNKQLLDGLLQQERTNDVVG---
A0A2V8NC68      QALRADFEKQRGETLTQN-EA----AVNYRILQQEIDTNKSLLDGLLQRAKENDVVL---
A0A399WK13      DKIRADFNKQFGEATGQN-QS----AVSLALLKQTIDTNKGFLENLRKQVSSNDVAA---
A0A352FLX4      ELLRKAYDQQRAETLTQN-EA----AVSYRIIQQEIETNKTLLDGLLQRTKENDVVM---
A0A2V8RTL7      TKIRSAYDVQYNEAQGQN-SG----AVMIKLLEQTIETNRGFLDNLRKQQSGNDVAS---
A0A3E0PCJ6      DKVRSAFNAQYNEAQGQN-QS----EVTIKLLEQDIETKKGFYANLENQQKGNDLAG---
A0A3M1S4R8      DKIRRAFEEQYRKAEGEN-RA----AIDIKLLEQNIETNRGFLKNLIEQQSSNDVVA---
A0A1Q7YFI6      ESLRQAFDQQRAQTLTQN-EA----AVNYRIIQQEVETNKQLLDGLLQTAKGNDVVM---
A0A136KC10      DKIRADFNKQFGEATGQN-QS----AVSLALLKQTIDTNKGFLENLQKQVSSNDVAA---
A0A2V8SEX6      DKIRAAYDEQYNAAQVQN-GG----AVRLKLLEQTIETNRGFLDNIRKQQSSNDVAS---
A0A3M2D6Y5      DKIRKAFDEQYRRAEGEN-RA----AIDIRLLEQNLETNRGFLKNLIEQQSSNDVIA---
A0A0B6WWQ6      EALRQAFDEQRGETLTQN-EA----AINYRIIQQEIETNKSLLDNLLQRAKENGMAM---
A0A3B9MK99      QALRKAFEQQRGETLSQN-EA----AINYRIIQQEIDTNKTLLDSLLQRSKENDVIM---
A0A352EX26      QALRAAFQQSRSETVTQN-EA----AINYRIIQQEIDTNKTLLDSLLQRSKENDVIM---
A0A2V8MM59      QALRKSFDQQRAETLTQN-EA----AINYRITQQEIDTNKGLLDSLLQRSKENDVVL---
A0A2V8PFE8      ESLRKSFNQQKGETVTQN-EA----AINYRILQQEIETNKGLLDNLLQRSKENDVVL---
A0A2V8PWS6      DSLRKSFNQQKGETVTQN-EA----AINYRILQQEIETNKGLLDNLLQRSKENDVVL---
A0A2V8LCT5      DSLRKSFNQQKGETLSQN-EA----AINYRILQQQIETNRGLLDNLLQRSKENDVVL---
A0A352FTJ9      EALRKSFNQQKGETVTQN-EA----AINYRILQQEIETNKGLLDNLLQRSKENDVVL---
A0A2V8G155      RSLTAALEQQKTEALVMN-RK----AIEYGVLERDAKSSRQIYESLMQRAKETGVS----
A0A2V8HDM7      RSLTAALEQQKTEALVMN-RK----AIEYGVLERDAKSSRQIYESLMQRAKETGVS----
A0A2V8DRT9      QSLMHALDQQKNDALALN-RK----GIEYGALQRDAASNRQIFESLLQRTKETGIS----
A0A2V7VYF3      QDLVAALNAQKNEALGQN-RK----AIAYGALQRDAASNRQMFEALLQRTKETGLS----
A0A1F2SVH2      QSLMSALEQQKSEALSLN-RK----GIEYGVLARNAASNRQIFESLMQRTKETGIS----
A0A2V8AJG9      QTLTGALDQQKRDALALS-RK----GIDYGALQRDNATNRQVFESLLQRAKETGVS----
A0A2G6PYV5      QNQKIVLADLKTKEQNASLDS----KIQVLEQNSLVIDKRKEYLELALGLKEIGRTD---
A0A2V8F956      NSLTGALNAQKGDA---------------------VQSSRQIFDSLMQRAKETGVS----
A0A1F2S1W5      RTLANELNRQKIEAQQLN-RT----SIDYSALQRDAAANRQMFEALLKRTQETGVS----
A0A1F2T595      RSLSASLNQQKIEAQSLN-RA----GIEYGALERDATANRQMFEALLKRTQETGVT----
A0A2V8JQV5      ELLAQEYDAQTRVVSDQA-DK----VAHYARLKREADSNRQLYEAMLQKVKEYNIA----
A0A2V9AC41      TGLRATMEDQKKTTLNLK-DA----AVQYAMLAREVDMNKQLYDGVLQRLKEIGVA----
A0A2V8K4L4      KLLNDEFAKQLDTVSSQA-AN----EVHYNILKREVDTNRQLYESMLSKVKESSIA----
A0A2V8NCZ3      KLLNDEFAKQLNTMSSQT-AK----EIHYNILKREVETNRQLYESMLARVKESSIA----
A0A2V9MAM9      ALLSSAYQQQTHLASDLR-KK----MIHYDTLNREVATTRQFYEAMLQKVNDAGVA----
A0A2V9M454      KFLATAVAQQKVQVDRVN-QL----LIQHNLLKREFESNQQLYDNLLQHLKDGNVS----
A0A2V9IVR7      AMISEALARQKVELEKLN-QL----LIQQNILKHEFETNQQLYEGLLQRLKDATLS----
A0A2V9ILE2      AMISEALARQKVELEKLN-QL----LIQQNILKHEFQTNQQLYEGLLQRLKDATLS----
A0A2V9LGY4      AMISEALARQKVELEKLN-QL----LIQQNILKHEFQTNQQLYEGLLQRLKDATLS----
A0A2V9J4D6      KLLEATVAQQKFEVGKLN-QL----LIQHNILKRDSDTNQQLYDNLLQRLKDATVT----
A0A2V9L9C5      KLLEATVAQQKFEVGKLN-QL----LIQHNILKRDSDTNQQLYDNLLQRLKDATVT----
A0A2N9M9N1      QLLSQDVSAQRTEVEKLN-QL----LIKYTILKGDFETNQQLYDELLKRLKDATVS----
A0A2V9JEC4      TLLSRTVAEQRKDVERLN-QL----LIQHNILKGEFETNQQLYNDLLRRLKDATLS----
A0A2V9LPQ3      SLVSTSVVQQKAEVGRLN-QL----LIQHNILQREFQTNQQLYDDLLQRLKDATVS----
A0A348V070      QNLQKLLDDLKAQAYKAN-ST----AILYNSLKIETDNKKALLEALSKRQSETDLAS---
A0A2Z5G3A3      AQSQMSYKALKKRADALN-DK----TIEYELTRQEATDSRTLYVSLLGRLKEAGLL----
A0A2V7UGP8      KTVRGALEGQKSEAIKQK-QY----GVEYSNLKAAVDSKREILNKLMQRETETGSLS---
A0A239MKT6      DGIRKRATDQRQQVLELG-NS----LTALTFLQQEENTSRGLYQDLYTRLQEASIS----
A0A3E0PCN7      NELRRNFEAQRNAVLNQN-EA----AINYNIIRQEIATNKTLLDSLLQRARETEVI----
A0A2V8IYW3      VRLRGTIAEYQRRVETAP-TR----ESEMAELTRDYETLKKGYESLLAKKEDSNIA----
G2LEI9          EELRARVEKQRNEVVTQN-GD----GVMQRMMQDNIDNKKKMLQALQATTKDTEIN----
A0A317J121      KLLSADYTKQASQVSAEA-TK----ASQYSGLKREVETLQQTYSAMLLQANESNIN----
A0A2V7YW66      QSLDGELTTLKGQAIDQN-SA----AVGFTNLKVEIQTRRDLLNELMHKQSETEVAV---
A0A2V7Z0V0      QELEGELNALKRDVINQS-SA----AVEYTNLKVEIQTRRDLLDELMRKQSETEVAV---
A0A2V8GFD4      RSLQAALDQQKHEAQELN-RR----AIDYGVLQRDAATNRQIFDALLQRSKETGIS----
A0A2V8HSS5      RSLQAALDQQKHEAQELN-RR----AIDYGVLQRDAATNRQIFDALLQRSKETGIS----
A0A2V8KP55      RLLSVALEQQRDAVNKMN-RE----IIQYNILKREADSSKDIYNGLLTRLKEAGIS----
A0A399WNU1      NELRSNFDAQRSAVLNQN-EA----AINYRIIQQEIDTNKSLLNSLLQKARETEVV----
A0A2V9CG11      EFLAKAYADQEMIAADQS-SK----AIRYRTLKGEVDSSRQLYEAMLERVKQAELA----
A0A2V2R0I6      NLLMRELEDQKAQANAMA-EK----LVEYNILKREAEANKTLYDGLMNKLKEVGIA----
A0A2V8XAR9      SMLTQALDQQKAAANQMA-EK----LVEYNILKREAEANKALYEGLMTKLKETAIS----
A0A2V8VZA0      TLLTQALDQQKAETNQMA-GR----LVEYNILKREAEANKTLYEGLMTKLKETAIS----
A0A1Q7CB82      TLLTQALDQQKAETNQMA-GR----LVEYNILKREAEANKTLYEGLMTKLKETAIS----
A0A2V8WIU1      TLLTQALDQQKAETNQMA-GR----LVEYNILKREAEANKTLYEGLMTKLKETAIS----
A0A1Q6Y9F5      ALLTRALDQQKADTNQMA-GK----LVEYNILKREAEANKTLYEGLMTKLKETAIS----
A0A2V9EVV8      ALLTRALDQQKADTNQMA-GK----LVEYNILKREAEANKTLYEGLMTKLKETAIS----
A0A2V8YF91      TLLTDALDQAKAEANQMA-ER----LVEYNILKREAEANKALYEGLTTKMKETAIS----
A0A2V8XZK2      TLLSEALDQAKVEANQMS-EK----LVEYNILKREAEANKALYEGLMTKMKETAIS----
A0A2V8ZTX6      TLMGQALDQAKAETNQMA-EK----MVEYNILKREAEANKALYEGLMTKMKETAIS----
A0A2V9BT79      TLLADALNEAKAETNQMA-EK----MVEYNILKREAEANKALYEGLMTKMKETAIS----
A0A1Q8B793      LLLLKALDQQKAEANQMA-ER----LVQYNILKREAEANKALYEGLLTKLKEAGIS----
A0A2V9BCA0      LLLLKALDQQKAEANQMA-ER----LVQYNILKREAEANKALYEGLLTKLKEAGIS----
A0A2V9BWU9      NLLSQALDKQKGESNAMA-EK----LVQFNILKREAEANKQLYEGLLQKMKEASIS----
A0A2V9DKX2      TLLSQALDKQKGESNAMA-EK----LVQFNILKHEAEANKQLYDGLLQKMKEASIS----
A0A2V9JSI3      KLLAAALAREKEAVGRLN-QV----LIQHNLLKREFETTQQLYENLLQHLKDATVS----
A0A2V9WI32      KLLGAALDVQKQEANHLN-ES----AIEYNLLKRDAESNRQLYEGLLQKLKEAGVS----
A0A2V8IVN9      NSFIAALNQQKGEALTMN-RK----AIDYGVLDRDVQSSKQIYESLLQRAKETGVS----
A0A1F2TPT3      ANLGKELESLKIEATAQN-RK----NVELSILTREVASNRQIYDMFMQRARETGVA----
A0A2V8JTQ2      RMLRDALEAQKQVVDHLN-AS----AVQSDILKREFETNRKLYEDLLQKQKEVGIS----
A0A2V8UZY0      RILQDALEAQKQTADKLY-AN----AVQSEILKHEFETNRKLYEDLLQKQKEVGIS----
A0A3N5YNR8      QMLLGALNRQKSEANQLN-QD----SIQYNILQREVDTNRQLYEGLLQRLKETGIS----
A0A350UEK1      RLLQTDYDRQTRLVTALG-EK----AIQYNILKREVETNRQLYESMLQRVKEAGLA----
A0A350UIQ4      RLLQADYDKQTRLVTVQG-EK----AIQYNILKREVETNRQLYESMLQRVKEAGLA----
A0A3N6A5T6      NRLQTALVAQKEMADQLN-EN----SIQYNILQREVETNKQLYEGLLQRLKEAGVA----
A0A1F2Q9L4      EALVAELTRQKSDAMQLN-SA----AVEYNNLKVEVSTRRTLLDELVRKQSETEVAS---
A0A1H5SQF5      DGLLQSVDREKLRLGHMT-TS----ADQLLLLEQEETSNRTLYQDLYGKLEAANIL----
A0A3E0NV31      DSFAAQIRAERRSSDRES-EA----AVQLEILERKTQTNKQLYDGILQRLRETDIV----
A0A3N5M5V0      QMLRRALQKQKAEANQLN-QD----SIQYNILQREVDTNRQLYEGLLQRLKETGIS----
A0A2V9AEW6      KLLTEAHDAQQKVVADQS-SK----AIHYDTLKRDVDSNRRLYETMLQRVKEASLA----
A0A2V8WQK6      RLLSKAQAEQEKIAADQS-DK----VIHYDTLKRDVDSNRRLYEVMLQRVKEASLA----
A0A2V8XIF4      RLLVEVHANQEKVVADQS-SK----AIHYDTLRRDVDSNRRLYEVMLQRVKEASLA----
A0A3N5XQP8      SQLSRVMDRQRQLAYRLN-SD----LVQFNTLKREADTNRQLYEGLLARLKQAGVE----
A0A2Z5G7H4      DESRTEFATEKHQADSLN-DK----AIEYAIVRQEADDSRGLYEDLLKRLKEAGVL----
A0A2V9L5B5      QYFAQAVDDQKREVNEIA-AR----SIQYNILKREVDSNRQLYEGLLQRMKEAQAS----
A0A2V9LK56      KYLEQALKGQEKQVNDIA-EK----TIQYNILKREADSNKDLYNGLLQRMKEAQVS----
A0A2V9L7I0      KYFAQAVEDQKREVNRIA-DK----SIQFNILKREVDTNKQLYEGLLQRMKEAQVS----
A0A522PPT0      KYLNSLVSQQESLVDVVS-QK----TIQYNILKREVDTNRSLYDGVLQRMKEAQVA----
A0A2V9KCS3      SLLAAEYGSQAKLVSEQS-GK----TIHYNILRREVDTNRQLYDSMLQRVKEYGIA----
A0A2U3KC61      NLLTTAFNQQTQQANQLN-ES----AIEYSVLKRDAEANRQLYQDLLQRFSEASVS----
A0A2V9Y2R7      RLLTSAFEQQKQRANLLN-ES----AIEYSVLKRDAESNRQLYLSLLQKLKEAGVT----
A0A372IT17      DTAREEFEKQKTLAAQMN-DR----RIAWTLARQEADESRRLYDQLFGKLKQAGVL----
A0A136JPP4      DQLLNAYEVEAERANVQG-QA----ATTLTTLKRALETNRGLLDTYTQRQKEQELAL---
A0A399WUJ8      DQLLNAYEVEAERANVQG-QA----TTTLTTLKRALETNRGLLDTYTQRQKEQELSL---
A0A2V9NGH6      EMLRAAMEKQKQEANQLN-ES----AIEYTLLKRDVDTNRTLYEGLLEKLKEAGVT----
A0A2V9PYE6      EMLHAAMEKQKQEANQLN-ES----AIDYTLLKRDVDTNRTLYEGLLEKLKEAGVT----
A0A2V9NL07      NMLRSALEEQKQQENKLN-ES----AIEFSLLKRDFETNRTLYEGLLQKLKEAGVT----
A0A2V9QD92      NMLRSALEEQKQQENKLN-ES----AIEFSLLKRDFETNRTLYEGLLQKLKEAGVT----
A0A2V9WPZ6      GLLRDALEKQKQQANKLN-ES----AIEYSLLKRDVETNRQLYEGLLEKLKEAGVT----
A0A2V9ZLH4      SMLHDAMEKQKQEANKLN-ES----AIEYSLLKRDVETNRQLYEGLLEKLKEAGVT----
A0A2V9RQF1      NMLRDALDRQKQQANRLN-ES----AIDYSLLKRDVETNRTLYEGLLEKLKEAGVT----
A0A2V9YDK8      NMLRAALEKQKQEANKLN-QS----AIEYSFLKRDVETSRQLYEGLLEKLKEAGVT----
A0A2V9V8F7      GLLRDALEKQKQQANKLN-ES----AIEYSLLKRDVETNRQLYEGLLEKLKEAGVT----
A0A2V9XGR9      GLLRDALEKQKQQANKLN-ES----AIEYSLLKRDVETNRQLYEGLLEKLKEAGVT----
A0A2V9V3Q5      TMLRAALEKQKQEANRLN-EN----AIDYTLLKRDVDSNRQLYEGLLEKLKQAGVT----
A0A2V9NWS3      TMLRGALTKQKQEANKLN-ES----AIEFTLLKRDVETNRALYEGLLEKLKEAGVS----
A0A2V9USA9      NMLRDALEKQKQEANKLN-ES----AIQYNILKRDSESYRQLYEGLLQRMKEAGVS----
A0A2V9XW18      NMLHTALDKQKQEANKLN-ES----AIEYTLLKRDVDTNRQLYEGLLQKLKEAGVS----
A0A4R1LC91      NSTQKVFDEEKKQADAMN-DK----SIEYAIARQEADQSRTLYETLLNHLKEAGVL----
A0A3M2BZG9      QNVEEELRKLTDEISAYS-SS----ALDYTTAKLELETKQRLFNDLLKKQSEAEVAS---
A0A1Q7N5R7      AVLGTQITAGGRELRGIP-QR----AIEEARLRRDATIAENLFTSVQQRYSEARLA----
A0A3M1SIV3      AKAKESYLREVEKANQQG-QA----AMSLTDLTQKIETSRSLLNTYVQRQKELESAI---
A0A3E0PHB0      AQLAAAYEQESAKANQQG-QK----ETMLTTARREIENNRGILDRLLQREREMELSI---
A0A3M2D491      EQARASYLAEVERSNQQG-QA----GMRLKTLTQAIDTNRELLNTYIQRQKELELAI---
A0A357F267      AQAQAAYDAEAARANIQG-QA----ETKLTTLKRGIETNRNLLDTYTQRQKEAELAI---
A0A353C9L6      AQALDAYEKEAALANVQG-QA----QTKLTTLKREIETKRNLLDTYTQRLKEKELEV---
A0A2V8RQV0      AQAQAAYEQESGTANVQG-QA----QTKMITLKREIETNRNLLDTYTQRLKEQELSR---
A0A2V8SJH5      AQSLAAYEQEASQANVQG-QA----QTELITKKRAIETNRNLLDTYTQRQKEQELAI---
A0A2V9QB26      KLLSAAYRNQSRLVTDQD-EK----SIQYGILKREVDSNRETYQAMLQRVKEANIA----
A0A2V9VYY4      NLLDSAFNKQKQEANKLN-ES----AIEYTVLKRDAETNRQLYQDLLQRLKEAGVS----
A0A2V9KIE8      KLLAQAVVQQKAEVNDIA-QK----TIQYNILKREADTNKQLYESLLQRLKEAQVS----
A0A352F549      KTLRDSFNKQRGETVAQN-QA----AINYNILKQEIETNKGLLAGLMQRSKENDVT----
A0A3B9MLP9      KTLRDSFNKQRAETVAQN-QA----AINYNILKQEIETNKGLLEGLMQRSKENDVT----
A0A3D5SQ87      KTLRDSFNKQRAETVAQN-QA----AINYNILKQEIETNKGLLEGLMQRSKENDVT----
A0A2V8NW86      KLLSAEYRNQSRLVTDQD-EK----SIQYGILKREVDSNRGIYEAMLQRVKEANIA----
A0A2V8ZHL8      KLLAAAVAKEKADVGALS-QL----LIQHNLLKREFDSNQQLYDSLLQRLKDATVS----
A0A2V9B240      KLLAAAVAKEKVGVGALS-QL----LIQHNLLKREFDTNQQLYDSLLQRLKDATVS----
A0A2V9CBM2      SLLRHELAEQQKQIDRIA-EK----SVQYNILKREVDTNKQVYDGLLQQLKSAGLA----
A0A2V8XN17      NLVQQALDNQQKQVSLIA-EK----SVQYNILKREVDTNKQLYEGLLQQLKEAGVS----
A0A2V8WX45      NLVQQALGEQQEQVSLIA-EK----SVQYNILKREVDTNKQLYEGLLQRLKEAGVS----
A0A1Q6YR79      DLVHQAVDGQQKQVSLIA-EK----SVQYNILKREVDTNKQLYEGLLQQLKEAGVS----
A0A1Q7VA32      DLVHQAVDGQQKQVSLIA-EK----SVQYNILKREVDTNKQLYEGLLQQLKEAGVS----
A0A2V9EY85      DLVHQAVDGQLKQVNLIA-EK----SVQYNILKREVDTNKQLYEGLLQQLKEAGVS----
A0A2V9H8K0      NLVQQALNDQQKQINLIA-EK----SVQYNILKREADTNKQLYEGLLLQLKEAGVS----
A0A2V9FFE5      NLVQQALDDQQKQVNLIA-EK----SVQYNILKREVDTNKQLYEGLLLQLKEAGVS----
A0A2V9GM43      NLVQQALDDQQKQVNLIA-EK----SVQYNILKREVDTNKQLYEGLLLQLKEAGVS----
A0A1F2RFI7      RLLDQAVEQQTKEINQIA-EK----SIPYNILKREADTNKQLYEGLLQRLKEASVS----
A0A1F2RZS3      RLLDQAVAQQTSDFNAMA-EK----SIQYNILKREADTNKQLYDGLLQRLKEASVS----
A0A1F2USE2      EFLRQAFQKQEEQANLIA-EK----SVQYSILQREVETNQQLYEGLLQRLKEAGVS----
A0A2V9C238      NLVAQAFAEQQKQANLIA-GR----SVQYNILKREVETNQQLYEGLLQRLKEAGVS----
A0A1F2Q9F5      TLLRRAFADQQAQAGRVA-EK----SVQYNILKREVDTNKQLYEGLLQRLKEAGMS----
A0A1F2QQH9      TLLRRAFADQQAQAGRVA-EK----SVQYNILKREVDTNKQLYEGLLQRLKEAGMS----
A0A1F2QXK7      TLLRRAFADQQAQAGRVA-EK----SVQYNILKREVDTNKQLYEGLLQRLKEAGMS----
A0A2V9DEM9      NLVAQAFAEQQKQANLIA-GR----SVQYNILKREVETNQQLYEGLLQRLKEAGVS----
A0A2V9CYQ5      SLLRHELAEQQKQIDLIA-EK----SVQYNIRKREVDANKQVYEGLLQQLKSAGLA----
A0A2V9BWU8      ELVKQALDDQQKQVNVIA-EK----AVQYNILKREVETNRQLYEGLLQRLKEAGVS----
A0A2V8ZG48      SLVKQALDEQQKQVNLIA-EK----AVQYNILKREVDTNRQLYEGLLQRLKEAGVS----
A0A2V8Y334      SLVKEALDGQQKQVNLIA-EK----AVQYNILKREVETNKQLYEGLLQRLKEAGVS----
A0A2V9AY68      GLVKGALDTQQNQVNVIA-EK----AVQYNILKREVETNKQLYEGLLQRLKEAGVS----
A0A257VBK0      ANLAQEVDGARREGLQFV-EG----LSRGEGLNTSSAAIKKYMDLLYDKMSELNVSS---
A0A2V7XDY0      SELRGAIDTEKAQAASQS-RK----AAELDAIKKEAESAKGLYDVLLQKLNETDIAA---
A0A350UQT3      KMLERSVNETKAEYDTLN-FR----SFEYQRAKREAEADKNLYDELVRKIREAGINA---
A0A2U3JZ71      SMLRKTVSETKAEFDALN-AR----SFEYQSLKREAEADKTLYEELVRKIREASINS---
A0A2V8TTB0      AMLEKAVAETKAEFDRLN-AR----SFEYQTLKREAESDKKLYEELVRKIKEAGINA---
A0A1F2TCR2      RSFASSLEDQKRVAMDLD-RK----STDYSMLQRQADGDRKMYDTLLQEQKSLQVIS---
A0A2N9LQU7      SLLRDQFEHQRQEAFNLN-AS----AVQFATLKHEVESSQELSDTLQLKLKEAGLMA---
A0A2P6WFK7      AALRNQFNKQKEEAFKLN-EH----AVQYLVLKHDVENSRDLYDTLQLKLKMAGVTA---
A0A1F2V330      GQEERALESEMGRLQRRV-QSTPQHEIAITELTRGYEATKTRYNALLAKQQEAGLAS---
A0A2V8U914      TGLASVYARQSALVSKMT-AK----MTHYNTLKHEVDTNRQFYEAMLQKVNEAGLAS---
A0A662EE63      QSLFENIQGLRNQTIELS-KT----SLEYDRLEETYLQNRRFLDDMLARSNEADLSA---
A0A2V7W309      GSVRSAYEQQRTEAQRLN-VD----AAKYFDLRMAVDSKQTLLAALQKQLNETQVTA---
A0A2V8TLH7      SKLAVAINETRSESLRVN-QK----ASNYELMRTEALDTKRIYDLISARVKEIDLSA---
A0A1Q7ZJT1      AKLIKATDETRTESLQVN-RK----ASGYEMVRGEATETKRIYDLISARVKEIDLSS---
A0A2V8VC99      AKLIKVSDDTRAESLQVN-RK----ASSYEMVRGEEAETKRIYDLISIRVKEIDLSS---
A0A348UZU3      ASLKELFEQQKEEAFRLN-SN----AILYNSLKIELENKKNLLESLLKRQSETGVSA---
Q01XL7          KLLSGAYNAQTHAVGAQA-DK----ASQYAMLKRDAEMAQQVYNGLLQQANQAALIA---
A0A2V8ERZ5      QTLARNLDGAKSEAQDLN-RK----GIGYGVMEREAKSNREVYQSLLTREKELRVSA---
A0A2V8GTX0      KQLSADLEGQKAQATDLN-RK----SIDYSVLQREAESNRQVYESLLQREKELRVVS---
A0A2V8J0X9      RSFSSQLEEQKGASMDLD-RK----SGDYKLLQRKADSDRQVYQSLLSQQKELAVVA---
A0A523DUV7      RELLASINSQRKESIEDS-RK----TVQLEMLQREALSNKSLYEAILQKIKETDVAS---
A0A372IRG7      GLLQQRLDDTKQQAFHEN-ES----AAQFEILQHGAESASELYDALQMKLKEAGITA---
A0A1F2U158      RTFAANLEEAKKDVQDLG-RK----SVSYNVLEREARSNRTVYESLLQRENELRVSS---
A0A2V8F6S9      QTIARGLESAKADAQNLS-RL----GVDYNVMQRDAQTNRTIYDTLLARQKELTVSS---
A0A4Q1SCH5      SLMHQEYQDAVSQAYALN-RK----QADYAVLAAEGAASRDLYDTLQYKIQQASVNA---
A0A2W0BGU4      QLLGATLAEQKKESGNFN-RL----LIEHDLLKGDFEANQQLYQRLLQRVKDATVIA---
A0A2W0BVQ9      QLLGATLAEQKKESGNFN-RL----LIEHDLLKGDFEANQQLYQRLLQRVKDATVIA---
A0A3D1ASD2      QMLKQELARTKSESDALN-AR----SFGYEELKREAEADKKLYDELIRKIKEASINA---
A0A2N9MK30      EMLKKAVTETKAEFDRLN-AR----SFEYESLKHEAEADKKLYEELITKIREAEINA---
A0A1I6MH75      QQTSAALEQQKTDAYKLR-DD----LVEYTLKAREYETTRTLYDGLVSRLRTASVQA---
E8WVF6          TQTTAALEAEKQDAYSLR-DA----QVEYTLRLREFESNRTLYEGLLQKLRTAGVEA---
A0A1H5Z7N3      QQTRGALEAEKSTAYQLR-DQ----MVQYTLRQREYETNRQLYDGLLQRLRSAAVEA---
A0A2V9YHT3      TLLQEALNQQKREANRLN-ER----AIQYTLLKRDLDTNQQLYDGLLQRLKEAGISA---
A0A1G7JVV8      AQTEGALEDQKNQSYRLR-DD----LVEYTLRQRDYETNRALYEALLAKLRSASVQA---
A0A1H4T6W9      DQTSSALEEQKQESYRLR-DD----LVEYTLRQRDYEANRTLYESLLSKLRAASVQA---
I3ZEU5          DQTTSALEQQKQESYRLR-DD----LVEYTLRQRDYEANRTLYESLLSKLRAASIQA---
A0A5B9EBI2      EQTQAALEAQKADAYKLR-DE----LVEYTLRQREFESGRQLYDSLLQRLRAAGIQA---
A0A239HDF6      EKTNAALDAQKADAYKLR-DD----LVEYTLRQREFESNRTLYEGLLQRLRTAGIQA---
A0A4Q0T270      EQTTAALEKQKADAYKMR-DD----LIEYTIKQREFESSRTLYEGLLERLRTAGVQA---
A0A1Q3QQB6      VQTKAALEQQKTDAYKLR-DD----LIEYTLRQREFESNRTLYEGLLQRLRTAGVEA---
A0A3N1K1G7      DQTAAVLEAQKTDAYKLR-DD----LVEYTLRQREFESNRTLYEGLLQRLRTAGVQA---
A0A428MDU2      DQTSAALEKQKSDAYKLR-DD----LVEYTVRQRDFESNRTLYEGLLQRLRTAGVQA---
A0A4V2G466      EETAAALEKEKSDAYKLR-DD----LVEYTIRQREFESSRHLYESLLERLRTAGIEA---
A0A4Q7YNP3      MLLMTAYHMQEANVSSDL-GK----AAQVSLLRREVESEQQLYQTLLQRAKEAGFAS---
A0A2V9MN96      TLLTSAFDHQKQEANQLN-ES----GIEYTALRRDADSNRQLYQSLLQRLKEASVTA---
E8UZE1          NKLRAATEAQKQQIFSMN-ED----ALHYSILQGQVASGRALYQDLTRKLQEAQITS---
A0A2V7V2Z1      ASVASALEAAKAEALDLS-RR----SVQYDTAKREAEAGKEVLNSLLSRHKQTDVAQ---
A0A2V7X2F7      ASLAAALESTKEEIQELG-AR----SGHYDSVKREVEASRAVLNSLTERHKETDVAQ---
A0A2V7V2I1      HGVADALEMAKREALELS-RR----GVQYDSLKRELDASKEVLNSLMARHKQTDVAQ---
A0A2V7U3M2      ASVSSALEAAKAEALDLS-RR----SVQYDNAKREADAGKEVLNSLLSRHKQTDVAQ---
A0A2V7UHT0      ASVSSALEAAKEEALDLS-RR----SVQYDNAKREADAGKEVLNSLLSRHKQTDVAQ---
A0A2Z5FVL3      SGAKQLYDAEKQRADEMN-DK----AVQYSMARQQADQSRSLYEKLQSRMKEAGVLE---
A0A1V6HR88      QRREAALAAEINSLKVEN-REVNSASIEYNNLRLEIDTRRQLLDEMLRKQSETDVSS---
A0A2V9KBD6      RMLRAALEKQKQVADDLD-AH----AVQSEILKHEFETNRKLYEDLLQKQKELGITA---
A0A2W0AJ66      RMLRNALETQKQAADTLN-AN----AIQYNILKRDVDTNRKLYEDLLEKQKELGISA---
A0A1Q7RBU1      RMLRSALEAQKQAADKLN-AN----AIQNNILKHEFETNRKLYEDLLQKQKEMAISA---
A0A2V9JPV9      RMLRYALEAQKQAADELN-AN----AIQYDILKHEFETNRKLYEDLLQKQKEVGISA---
A0A3E0P0A3      LQTERSLEREYEAMKEET-RRYQSASTALQNLTGDIAAKRETLDRLRRSQSQANISA---
A0A2V8EXP2      QSLINVLDQQKREALALN-RK----GIDYSALQRDALSNRQIFESLLQRTKETGISG---
A0A2W4RYA1      NNLLAALAQQEREAQQLN-AK----AVEYRVLERNAQSARQLYDSLLQRAQETGVSG---
G8P0Y7          QMLQEALGEQMGIADQLN-QN----AIEYKILKQEADSNRQIYDGLLQQLKEASLAA---
A0A5M8T4U7      QLLRQRLDAQKEEAFRLN-ED----VGQYAILRHEAELNRDLYDTLQMRLKEASVTA---
A0A3P0X3W6      KMLAATLAAAKAQSDALS-LK----SLEYQQLKRDADANKTLYNELFQKIKEAGINS---
A0A1E3Y9R6      AALQQSLAGQQRESLGLD-RQ----MLDYSALEREAQSNRQLYENLLARAKETGAAG---
A0A2W4TLP2      RALQQSLDQQQRESLGLD-RR----MLEYAALEREALSNRQLYENLMARAKETGAAA---
A0A3R9WF43      NSIKGQFEKQQHEAIQLA-DN----TVQLQVLAQEAYSNRALYQNLFSKLQEASLSS---
A0A317HKM4      QALEAALDRSKREVQALN-AK----AVEYSALEREAASNREVLDKLLQRSTEARLAR---
A0A523E0N1      RDRENSLRKSLNAQKSQV-RKLAHAASDYGHIKAELANQRQILKRLLRRRSETAITA---
A0A523ECP2      VEREHLLLAEVESQKKEA-QELSKLTTNYTQIKAGIDNQRSMLRQLLRRQSETGLSA---
A0A2W0C122      QKLRAAFEAQKVEANRLN-VS----AIQYGLLRRESEANRQLYDNLEERMKEAGVAA---
A0A2W0AUU7      QKLRAAFEAQKIEANKLN-ES----AIQYGLLKRESEANRQLYDTLEERMKEAGVTA---
A0A2W0BQL1      QKLRAAFEAQKIEANKLN-ES----AIQYGLLKRESEANRQLYDTLEERMKEAGVTA---
A0A4Q1SDL1      NDSRAQYEANRQAADALK-DK----AIDYSILREEATQSRGLYEDLLRKLKEAGVLE---
A0A3P0XH15      NLMRKRLEDAKQQAYQQN-RS----SAEYQILRHGADSASDLYDALQTRLKEAGITA---
A0A4R1LAZ7      ALMRKRLDATKQEAFREN-ES----SAEFEILKHGAESASDLYDALQIKLKEAGIMA---
A0A3M1WQW8      RTREENLRAELMAQRAET-LRQNERAINLSIKQQQVEASAELYRSLLQKMNDVDLLS---
A0A3N1JHC1      QLLKQQYDRQLAVVTDQG-SK----QVRFNMLKHEVDVNEQVYQSMLQKAKEAGVIA---
C1F294          NLLEARLENTKQQAFKQN-ES----SAQFEILKHKAQTSSELYDALQLRLEEAGITA---
A0A2V9KA79      KQEQRDLTAQLETYRSRV-QSTPTHAGALADMTRDLESTRTQYQSLLDKQQQATLAS---
A0A522PSP1      KLTERQL----ADVKAQL-EEFNRKGVEFQILKHQADTDKLVYDDLLERLDAADVSA---
G8P085          ---QSSLQQQYDEQTDKA-YALNRKAAEFAVLYAEGSSSRELYNTLQYKLQQAGVDA---
A0A4Q1SGQ1      QNTENAARDAFEKQRSTA-DAMSNRTVAYQLARQEADSSRNVYEGLLAKLKQAGVLE---
Q1ILD9          NKIKGNFDQHQQEALSKS-QN----FSEYSRLRREVDTSRDIYDDLLRKLREAGVMA---
Q1IJZ6          RQSEDALRQAYEKQEQEA-NKINDSQIRLAVLQQEADSTRQLYETLYGRLEVSKLDE---
A0A2V8TCE6      LDEEERLGKLLEEQKSEA-QRTGRDSIEYATLQAEVERKRAVLNALLQRQNETAVSS---
A0A522TBE8      RLQEMLLEQAVAQQKQAM-DQFERRAITYRSLQAAAQNYTKLYYDLLQRIAESKLAA---
Q1ITG0          DQLRASVENRKKEAFSQS-AK----FSQYDILKNEVASGRSLYEDLLRKLNEAGIAA---
A0A3N5PCI5      KELTAELDAQKSRALALN-RQ----GIEYGVLLREVESNRQIYQNLLQRSNETAVSK---
A0A3M1Q0S9      RRRAEGLRRLYEETEQRV-SELQQAFVEYEARKAEIDRKQATLRELLDRKNQMTLSA---
A0A2Z5G448      ALLKGRLEQVKQEAFRVS-DS----SADFEILKHEAQSTTDLYDALQMKLKEASVTA---
A0A3M1VZ38      RREEQQLAQLLADATREA-SEADRAMIEYEARSLELERKKATLNELIAKENEMEQSA---
A0A4Q1SD29      SLMRARLEATKQEAYREN-ES----AAQFDILKHGAESASELYDALQMRLKEAGITA---
A0A3M1PY35      RTREARLQALFQQELAAT-DALQRRAQDYDRLYREYEQKRQVLDRLLARREEIGIAK---
A0A3M1VMP2      RESEARLQRLIEEEQARA-AQLQLATGELEALRSLYKQKREALDRLLARREEVAVTR---
                                                                            

A0A2V7VMF7      -----------SIRTNNA----SVVERASPP--LAPVWPNKRKMAGVGILVGVALGLGLV
A0A2V7YYV7      --------VPNSRLSDVL----VPVSPAVVP--DRPVSPTKALNISIAFGAGLLLAVGLA
A0A2V7Z0J5      --------STNARSGDTF----VVLSPAVLP--KNPVSPNKALNVAVAFVAGLLLALGLA
A0A2V7Z3M4      --------SPNTRTADDF----VVLSPAVLP--SKPVSPNKVLNVAIALMAGLLLALGVA
A0A399Y5V2      KTALDKLQIQSNLQTSSA----ETVAPATLP--TAPVEPKLSRKVIFALTIGILLGAGIA
Q01X01          --------VASTLRQSNV----RLVDPAQPA--THHHKPNVPLNLLFGLFGGLALATGYV
A0A3M2D9H8      --------LQSTPEVVQV-------EEARVP--SRPVRPQTATNVLLGGILGLILAGGIV
A0A2V8JK38      -----------GLRASNI----RVVDQAEVP--KGAVTPNHKLNLAWGIFFGLIFGVGSA
A0A2V9IXG5      -----------GFVTSNI----KVVEHAGA---GYRVATRGANFVILATLGGMILGMALV
A0A2V9J2P4      -----------GFVTSNI----KVVEHAGA---GYRVATRGANFVILATLGGMILGMALV
A0A1Q7RLS4      -----------SLLSNNL----RILDKAPVP--KVPVRPRTVLNLAIGMLLGILLGVGAI
A0A2V2R525      ---------AGT--PNNI----RVADYANTP--ERPIGPQRTRGVGLAFAFSLAFGIGLA
A0A321LPW6      ---------AQQ--SSAL----HVIEPAEVP--TFPVDAKRLQGVLIALFVSLCAGLIFA
A0A2V9R9V4      ---------AQQ--QSNI----RIISPARVP--KEPVSPNRQRTILIGLLLSLSGGIGLA
A0A321LE75      ---------AEQ--HNNM----RVIEPAQPP--GGPIGPNRMRGILIGLFLSLVAGIGLA
A0A2V8R8U7      ---------ADR--GTDV----SVSNYSRTP--QL-VGPQRMRNIMIAFVLALVAGIGLA
A0A2V8QMP4      --------PDRA--SGNV----TMVEEARTP--REPIGPPRVRNIIIALLLSIAVGIGLA
A0A2V8R4S3      --------PDRA--SGNV----TMVEEARTP--REPIGPPRVRNIIIALLLSIAVGIGLA
A0A2V8NJ55      ---------NDQ--GNNV----TVATPARLP--RGPVGPARSRNIIVAFLLSLGVGIGLA
A0A2V8Q7I0      ---------TDR--ANEV----SIENYSRIP--RSPIGPARLRNVMIAFVLSLVAGIGLA
A0A2V8S6K4      --------IEGQ--SNNV----IIQTPARTP--QL-VGPPRVRNIIIALLLALGAGIGLA
A0A317I2L9      ---------GDR--GNEV----SVENYSRVP--KAPIGPARIRNVMIAFLLSLVAGIGLA
A0A2V8LLF9      ---------GSG-TASEV----SIANYSRLP--HEPVGPARLRTIILALVMSLLVGIGLA
A0A352FRF4      ---------GET--GTNV----SVSNPSRLP--RAPVGPARLKTILIALILSLVAGIGLA
A0A2V8MKV0      ---------SDK--GTNV----SVVSYSRLP--HEPTGPPRTRNILLALALALLAGIGLA
A0A2V8PYY8      ---------TDK--GTNV----SVVSYSRLP--HEPVGPQRTRNILVALALAFLAGIGLA
A0A1Q7YKQ8      ---------TGRMQTNNV----SVSQYSREP--RAPVGPPRLRNILIAFLLSLGAGIGLA
A0A352F3R7      ---------GDR--SNEV----NIATYSRLP--KEPIGPQRLRNIFIAFLLSLGAGIGLA
A0A0B6WXT1      ---------NDR--ANNI----TVATPARVP--REPVGPKRLRNILIALLVALGAGIGLA
A0A3B9MEU8      ---------GDR--SNEV----SIPTPSRLP--KTPVGPQRLRNIFVALLLSLGAGIGLA
A0A2V8MHG6      ---------AGT--PNNV----HVVDHAAIP--KTPIGPKRMQAIALAALFALILGIALA
A0A2V8P7N1      ---------AGT--PNNV----HVVDHAAIP--KNPIGPKRMQAIVLAALFALIVGIALA
A0A2V8M3M6      ---------AGT--PNNV----HVVDHAAIP--KNPIGPKRMQAIVLAALFALIVGIALA
A0A1Q7NJH5      ---------AGT--PNNV----HVVDHAAIP--KTPIGPKRMQAIVLAALFALIAGIALA
A0A2V8PJY0      ---------AGT--PNNV----HVVDHAAIP--KTPIGPKRMQAIVLAALFALIAGIALA
A0A1Q7Y6W9      ---------EGT--PNNI----HIVDYALVP--DGPVGPNRTRVVMLALVLSFGFGIGFA
A0A2V8NC68      ---------AGT--PNNI----HVLDYSPQP--KVPVGPHRMQGILLASLFSLVFGVALA
A0A399WK13      ---------QGS--DNNI----TVTEPAVPS--NIPVSPRRLTTVLGALFLSTLFGVGLA
A0A352FLX4      ---------AGT--PNNI----RVVDYAIAG--KKPVAPRRVLTVALAFLFSIGCGIGLA
A0A2V8RTL7      ---------QGS--DNNI----SVASFGIPP--EAPVAPRRLMTVVAALLLSSLFGMGLA
A0A3E0PCJ6      ---------AGT--ENNI----SVAEIAIPP--ERPVSPRRLTTVAVVMMLSLLFGAGLA
A0A3M1S4R8      ---------QGT--TNNI----SVVDLAIPP--DTPVSPRRLLTVMMALFLSTCFGVGLA
A0A1Q7YFI6      ---------SGT--PNNV----HVLDYAPIP--KSPVGPRRMQGVALGFLFSLVIGIALA
A0A136KC10      ---------QGS--DNNI----SVTEPAVPS--NIPVSPRRLATVLGALFLSTLFGMGLA
A0A2V8SEX6      ---------QGS--DNNI----SVAGFAIPP--EHAVSPSRLMTVFAALFLSTLFGMGLA
A0A3M2D6Y5      ---------RGT--ENNI----SVVDPAIPP--DTPVSPRRLLTVMMAFFLSIVFGVGLS
A0A0B6WWQ6      ---------AGV--ANNI----HIVEYAFPP--NRPIGPARLQAVGLAIVLGLAVGIGLA
A0A3B9MK99      ---------ASK--PNNI----SIVDYAVTP--DGPIGPNRSSTVSMALFLSLGLGVGLA
A0A352EX26      ---------ASK--PNNI----SVVDYAITP--AGPVGPNRMRTVALALFLSLGLGVGLA
A0A2V8MM59      ---------AGR--PNNI----SIVDYAIQP--DGPVGPARMRSVMLALVLSLALGVGLA
A0A2V8PFE8      ---------AGR--PNNI----SIVDYAITP--DFPVGPARMRSVMLAFVLALALGVGLA
A0A2V8PWS6      ---------AGR--PNNI----SVVDYAITP--DFPVGPARMRSVMLAFVLALALGVGLA
A0A2V8LCT5      ---------AGR--PNNI----SVVDYAIVP--DFPVGPGRMRTVMLAFVLSLGLGIALA
A0A352FTJ9      ---------AGR--PNNI----SVVDYAIVP--DFPVGPARLRTVMLAFLLALGFGAALA
A0A2V8G155      --------A--ELKTSNI----SVIDRAETP--RTPVEPRVQYMLTLGGCGAFLFALCLA
A0A2V8HDM7      --------A--ELKTSNI----SVIDRAETP--RTPVEPRVQYMLTLGGCGAFLFALCLA
A0A2V8DRT9      --------G--ELKVSNI----RIVDAAELP--QVPASPDKPLNVLLAILGGSIMAVGLA
A0A2V7VYF3      --------E--ELRATNV----RIVDAAEVP--RSPAGPNTRTDFLLAVLVGGVVAVGFV
A0A1F2SVH2      --------G--ELKTSNI----RVVDAAETP--RGPVRPNTRNNLLLALFGGATLAVGLA
A0A2V8AJG9      --------T--ELKTSNI----RVVDAAEVP--RRPASPNVPTNLLLAFFGGGTLALGLA
A0A2G6PYV5      --------K-------------VIVEHARLP--HSPYAPSLKRHLFSGFIIAAGLAGLLI
A0A2V8F956      --------A--ELKTSNI----RVVDRAQTP--TEPVSPQKGLNLLLALFGGSLLACGLV
A0A1F2S1W5      --------E--ELKTGNI----RVVDLAENP--TGPISPNIFNSLLMALLGGLTLAVGLA
A0A1F2T595      --------E--ELRTGNI----RVVDPAEMP--TGPVSPNIINNLLLALFGGMVLAVGLA
A0A2V8JQV5      --------S--AVTANNV----NIVDPARPP--GGAYKPDVYMYAMLGLATGVFLGLMLI
A0A2V9AC41      --------A--EIRSSNI----YLMGKAEPP--GGPSYPDKNGILLRGLFLGLLMGVGLA
A0A2V8K4L4      --------S--AMRASNF----RIVDLAKPA--GAPYKPNLMNNAMLGSMAGIFLGVVLV
A0A2V8NCZ3      --------S--AMRASNF----RIVDLAKPA--NLPYKPSPVNNAILGLMAGIFVGVVLV
A0A2V9MAM9      --------T--AIRPSNI----RVVGPAQPA--LQPYKPNFLLNVAIGLFGGLVLAIGCV
A0A2V9M454      --------A--GLRATNI----RIIDEATIP--SFPVRPNRPRNIEFALAAGLILGIALA
A0A2V9IVR7      --------S------------------------GAPVRPRKLFNVTIGLLVGLILGVALA
A0A2V9ILE2      --------S--GLRATNI----HIVDQARVP--GAPVRPRKLFNVTIGLLVGLILGVALA
A0A2V9LGY4      --------S--GLRATNI----HIVDQARVP--GAPVRPRKLFNVTIGLLVGLILGVALA
A0A2V9J4D6      --------A--GLRATNI----HVVDKAVPP--ATPVRPKKALNVALGLLAGIILGTAFA
A0A2V9L9C5      --------A--GLRATNI----HVVDKAVPP--ATPVRPKKALNVALGLLAGIILGTAFA
A0A2N9M9N1      --------V--SLRATSV----RLADAALVP--ATPIRPDKRVDIAVGLLVGLILGVTLA
A0A2V9JEC4      --------V--SLRAASV----RVADRARVP--AVPVRPDTRRNFPLFAFAGLVIGVTLA
A0A2V9LPQ3      --------A--GLRATNI----HIVDTASPP--AVPVRPNKLLNLMLGLVAGGLLGLVLA
A0A348V070      --------RLKDLQALNV----WIVDRASPP--VNPSFPNRRKTFIIGVLLALIGGAGTS
A0A2Z5G3A3      --------E--GLRSTNV----SVVDPGRSP--AKPTKPNIPLFLGGGLASGLFLGFCAA
A0A2V7UGP8      --------QLKNAGTGNV----WVVDAAEIP--DRIFRPNKKMNILLSLFVGLALGVGMA
A0A239MKT6      --------A--GVRSTDM----VIVDPARPP--SLNSSPNASRLLATGTAAGLLLGLLIG
A0A3E0PCN7      --------L--NGTPNNV----NLVDRAQPP--SAPQGPNRSRAVLMAFVASLIGGIGLA
A0A2V8IYW3      --------A--NLEKQQVGEQFKVLDPARVP--ERPFSPKRLQLNLTAIGIGLMLGMAVS
G2LEI9          --------L--RMDLNNI----TVVDRAGTP--GAPISPRVSYTLSVAFFLSLFGGVGLA
A0A317J121      --------SSVPLGMGTI----RLVDPSTPP--AKPYKPRPALNIAFGTMAGLFLSVGIA
A0A2V7YW66      --------RLQDTRQSNI----RIIDKALVP--GGPFRPSLRQDVTYGLLLGLLAGLGLA
A0A2V7Z0V0      --------RLQDTRQSNI----RIIDKATVP--GGPFQPSLRKDGSYGLLLGLLFGVGCA
A0A2V8GFD4      --------G--ELRTSNV----RVVDAAEEP--PWPAYPRKRTNVTYGLLAAVLLAGMFG
A0A2V8HSS5      --------G--ELRTSNV----RVVDAAEEP--PWPAYPRKRTNVTYGLLAAVLLAGMFG
A0A2V8KP55      --------G--GLRASNI----RVVDQAEVP--KGAVTPNHKLNLAWGIFFGLIFGVGSA
A0A399WNU1      --------L--NGTPNNV----HVVDRALVP--GAPSGPQRTKNVVIAFFASLFGGIAIA
A0A2V9CG11      --------T--AMRASNV----LVIDHAEVP--RLPYKPNLPMNAALGMFGGFFLALGLV
A0A2V2R0I6      --------E--SLKSSNI----RVVDPAMIP--SYPSRPAKARNLALAFLVGLVGGVGLA
A0A2V8XAR9      --------L--GLRSSNI----RIVDPAMIP--STPSRPAKARNITLAFLVGLVGGIGLA
A0A2V8VZA0      --------Q--GLRSSNI----RVVDPAMIP--STPARPAKTRNVALAFLVGLVGGMGLA
A0A1Q7CB82      --------Q--GLRSSNI----RVVDPAMIP--STPARPAKTRNVALAFLVGLVGGMGLA
A0A2V8WIU1      --------Q--GLRSSNI----RVVDPAMIP--STPARPAKTRNVALAFLVGLVGGMGLA
A0A1Q6Y9F5      --------Q--GLRSSNI----RVVDPAMIP--STPARPAKTRNIALAFLVGLVGGIGLA
A0A2V9EVV8      --------Q--GLRSSNI----RVVDPAMIP--STPARPAKTRNIALAFLVGLVGGIGLA
A0A2V8YF91      --------A--GLRSSNI----RIIDPAMVP--TSPARPAKTKNITLAFLVGLVGGIGLA
A0A2V8XZK2      --------A--GLRSSNI----RIVDPAMVP--TSPARPAKARNIMLAFLVGLIGGIGLA
A0A2V8ZTX6      --------G--ALRSSNT------------------------KNIILSFLVGLVGGIGLA
A0A2V9BT79      --------G--ALRSSNI----RVVDPAMVP--ATPARPAKGKNIMLSFLAGLVGGIGLA
A0A1Q8B793      --------A--GLRSSNI----RVVDPAMIP--SSPARPAKMRNISLAFLVGLVGGIGLA
A0A2V9BCA0      --------A--GLRSSNI----RVVDPAMIP--SSPARPAKMRNISLAFLVGLVGGIGLA
A0A2V9BWU9      --------A--GLRSSNI----RVVDPAMVP--SAPSRPQKTRNILLAFLIGLVGGVGLA
A0A2V9DKX2      --------A--GLRSSNI----RVVDPAMVP--SAPSRPQKTRNILLAFLIGLVGGVGLA
A0A2V9JSI3      --------A--GLRATNI----HVVDPALPP--AAPIRPKKTQNIAMGLLGGLALGVMLA
A0A2V9WI32      --------A--GLRSSNI----RIVDVARVP--TSPSAPNIPRDIVLGLALGLFGGIGLA
A0A2V8IVN9      --------T--ELKTSNI----RVVDPAERP--RKPSSPQYALNLLLGLLGGTMLGVGLA
A0A1F2TPT3      --------K--DINPSRI----RILDAATVP--SSPVGPDKGRSILGAVFAGLGLALVLA
A0A2V8JTQ2      --------A--SLKSSNI----WIVDPARPP--KLPAEPNILRNLALSLLFGICGGVWLS
A0A2V8UZY0      --------A--SLKSSNI----WIVDPARPP--KLPVEPDIRRNFALSLLFGIFGGVLLA
A0A3N5YNR8      --------A--GMRASNI----HVVDHAEVP--ETPYSPQRAGDLALGLGVGLFLAIGLA
A0A350UEK1      --------S--ALRASNV----RVVDEAQPP--ERPYKPSLPLNAVLGLLAGGFLAVGFV
A0A350UIQ4      --------S--ALKASNV----RIVDPAKAP--ERPYKPRLPLNALLGLLAGGFLAVAFV
A0A3N6A5T6      --------A--GLKSSNI----NVVDRGETP--RRVYRPRTAINLALGLILGLMLGVSMA
A0A1F2Q9L4      --------RLQGTHDSNI----VVVDRALVP--GGPYRPSLRRNLGLGLVLGLALGLGFV
A0A1H5SQF5      --------A--GAKSSNV----TIVNPARVP--SGPSRPQPVQNIALGFLAGLATGLFLA
A0A3E0NV31      --------A--ELQKEGI----RISIPATRP--NSQYAPNKTRSTLFALGIGLALGIAAA
A0A3N5M5V0      --------A--GMRTSNI----HIVDHAQVP--TAPYSPQRAADLALGFGVGLLIAVGLA
A0A2V9AEW6      --------A--AMRDSNV----MVIDRARPP--KLPYRPSLPMNSAIGLLGGMFLGLGFV
A0A2V8WQK6      --------T--AMRDSNV----LVVDRAKPP--LLPYRPSLPVNSAIGLFSGVFLGFGFV
A0A2V8XIF4      --------T--AMRDSNV----LVVDRAKPP--LLPYRPSFPMNSAIGLFSGLFLGFGFV
A0A3N5XQP8      --------A--GFRSNNI----QIVDRARTP--LNTWWPRRTMNLALAFLGGLFLGLGLA
A0A2Z5G7H4      --------E--GLRSSNI----TVVDPGRIP--STPKQPNIPVYLAIAAGVGLFLGVCGA
A0A2V9L5B5      --------A--GLRASNI----RVVDAAEAP--KYPAKPRVLLNLVLGLILGLGLGVGMA
A0A2V9LK56      --------A--GLRASNI----RIVDAAEVP--RRPVRPRVILNLALGIIFGLGLGVAGV
A0A2V9L7I0      --------S--GLNASNV----RIVDAAEIP--KGPAKPRVLLNLILGLVVGLALGVGVA
A0A522PPT0      --------A--GLNASNI----MVVDPAQVP--KGPAKPRVILNLAVGFILGLSLGVGLA
A0A2V9KCS3      --------S--AMHASNM----RVVDPAKAP--RLPYKPNLLQHAGVGFIAGLLLGTVFV
A0A2U3KC61      --------E--TLKSSNI----RVVDFARTP--TSPITPNVPRNIELGLLLGLACGIGLA
A0A2V9Y2R7      --------A--GLRSSNI----RVVDVARTP--MFPVKPDVPRNIKLGFILGLCLGVGLA
A0A372IT17      --------E--GLHTSSF----SIVNPARIPPGNHPKSPNLPLYYAAALGAGLFLGCAGA
A0A136JPP4      --------A--SGKPNNI----KISERAEAP--TYPVGPNRARNIFIALLASLGAGIGLA
A0A399WUJ8      --------A--AGKPNNI----KISNRAVVP--TSPDGPKRARNIFIALLASLGAGIGLA
A0A2V9NGH6      --------A--GLRSNNI----RPVDLARVP--IEPAEPDVPRNLSFALVLGLTTGVSLA
A0A2V9PYE6      --------A--GLRSNNI----RPVDLARVP--IEPAEPDVPRNLSFALVLGLTTGVSLA
A0A2V9NL07      --------A--GLRSNNI----RQVDIARTP--AGPAEPNIPRNLGFALALGLTSGIGLA
A0A2V9QD92      --------A--GLRSNNI----RQVDIARTP--AGPAEPNIPRNLGFALAFGLTSGIGLA
A0A2V9WPZ6      --------A--GLHSSNV----KIVNAARVP--MAPSEPNIPRNLAFGLLLGLTSGIGLA
A0A2V9ZLH4      --------A--GLRSNNV----KIVDAARVP--QAPSEPNIPRNLAFALLLGLTSGVGLA
A0A2V9RQF1      --------A--GLRSNNI----RNVDIARAP--RSPAEPNVPRNLSFALALGITTGIGLA
A0A2V9YDK8      --------A--GLRSSNV----KIVNAARVP--MAPSEPNIPRNLAFALVLGLTSGVGLA
A0A2V9V8F7      --------A--GLHSSNV----KIVNAARVP--MAPSEPNIPRNLAFGLLLGLTSGIGLA
A0A2V9XGR9      --------A--GLHSSNV----KIVNAARVP--MAPSEPNIPRNLAFGLLLGLTSGIGLA
A0A2V9V3Q5      --------A--GLKSNNF----RIVDPARSP--NAPVEPNIPRNLLFALVLGVSSGVGLA
A0A2V9NWS3      --------A--GLRSNNI----RNVDAARVP--SEPVEPNVPRNLAFALALGLSTGIGLA
A0A2V9USA9      --------A--GLKSNNF----RIVDTARVP--NGPIEPNIPRNLGFALVLGLMSGVGLA
A0A2V9XW18      --------A--GLKSNNF----RIVDSARPP--TGPIEPNVPRNLLFAAVLGLASGMGLA
A0A4R1LC91      --------E--GLRSTNI----TVVDPGRVP--AKPAKPNVPLVLAGSLLGGLFLGCCGA
A0A3M2BZG9      --------SFHDAKESNV----RVVDYAIVP--SAPFRPVLRKDLTTALLLGLLAGVGLI
A0A1Q7N5R7      --------E--ASSTADV----RVLDAAVAP--RRPVKDSASRLIALGFLAGLGFGVVGA
A0A3M1SIV3      --------S--SSRPDNV----AVSTKASKP--DSPIGPPRNRNILISLIVSLFLGIGLA
A0A3E0PHB0      --------N--TSAPDNI----KVSGKA--Q--VNRTGPQRTRNILIALFISLAGGIGLT
A0A3M2D491      --------S--SSRPDNI----SIATEATKP--DAPIGPQRNRNILLAFLASLFVGIGLA
A0A357F267      --------A--SGRPDNI----KIAARAITP--KSPIGPQRNRNIFVAFMLSLAAGIGLA
A0A353C9L6      --------E--SGAPDNI----KIAANA-GG--AYPVGPQRSRNILVAFLLSLAAGLGLA
A0A2V8RQV0      --------A--NDAPENI----KIAANA-GP--AILVGPPRGRNIFVAFLFSLAAGIGLA
A0A2V8SJH5      --------A--SGRPENI----KIAANAVTP--GGPIGPARTRNILVAFLVSFGVGIGLA
A0A2V9QB26      --------S--AVRPSNV----RIIDAAEPP--EHPYKPNLPMNAAVGLLSGLCIGVAFV
A0A2V9VYY4      --------A--GLRSSNI----RIVDIARVP--TQPISPNVHRSLVLGFLLALGLGVGLA
A0A2V9KIE8      --------E--GLKASNI----RIVDQAETP--KLPVKPRVILNLALGFAFGLALGIGLA
A0A352F549      --------M--AGTPNNI----HVVDYAAIP--KGPVGPRRMQAVTLAMMLATAFGIALA
A0A3B9MLP9      --------M--AGTPNNI----HVVDYAAVP--KGPIGPRRMEAVFLALVLALVFGVALA
A0A3D5SQ87      --------M--AGTPNNI----HVVDYAAVP--KGPIGPRRMEAVFLALVLALVFGVALA
A0A2V8NW86      --------S--AVRATNV----RIIDAAEPP--KRPYKPSLPVNAAVGLLSGLCIGVAFL
A0A2V8ZHL8      --------A--GLRATNI----HVVDPARPP--RVPVRPQKLLNIAIGLVVGLILGVTLA
A0A2V9B240      --------A--GLRATNI----HVVDLARPP--KVPVRPQKLFNIAVSLVVGLILGVTLA
A0A2V9CBM2      --------A--SLKASNI----LIVDPAEPP--AKPAKPKILLNLVLASILGLALGVGEA
A0A2V8XN17      --------A--GLKASNI----RLVDSAEPP--AKPVKPRTLLNLSVALFLGLALGICAA
A0A2V8WX45      --------A--SLKASNI----RIVDSAEPP--ARPVKPRIALNLMVAAFLGLGLGVCAA
A0A1Q6YR79      --------A--GLKASNI----RLVDSAEPP--AKPFKPRTLLNLSVAVFLGLALGICAA
A0A1Q7VA32      --------A--GLKASNI----RLVDSAEPP--AKPFKPRTLLNLSVAVFLGLALGICAA
A0A2V9EY85      --------A--GLKASNI----RLVDSAEPP--AKPFKPRTLLNLSVAVFLGLALGICAA
A0A2V9H8K0      --------A--SLKASNI----RLVDSAQPP--AKPVTPRTLLNLAVAMFLGLGLGICTA
A0A2V9FFE5      --------A--SLKASNI----RLVDSAQPP--AKPVKPKILLNLAVAMFLGLGLGIGTA
A0A2V9GM43      --------A--SLKASNI----RLVDSAQPP--AKPVKPKILLNLAVAMFLGLGLGIGTA
A0A1F2RFI7      --------A--GLRASNI----RVVDQAEVP--EMPAKPQKLVNLALALIFGLGLGVGMA
A0A1F2RZS3      --------A--GLRASNV----RVVDPAEVP--TLPSKPRKLMNLALALMVGLSLGIGMA
A0A1F2USE2      --------A--GLKASNI----RIVDSARPP--EKPAKPKVLLHLAMGFLLGLGLGVGAA
A0A2V9C238      --------A--GLKASNI----RIVDAAEPP--KKPARPNLPLNLALAVLLGTGLGV---
A0A1F2Q9F5      --------A--GMKASHV----RVVDPAQPP--DKPAKPSLALNLLLALVLGLGLGLAAV
A0A1F2QQH9      --------A--GMKASHV----RVVDPAQPP--DKPAKPSLALNLLLALVLGLGLGLAAV
A0A1F2QXK7      --------A--GMKASHV----RVVDPAQPP--DKPAKPSLALNLLLALVLGLGLGLAAV
A0A2V9DEM9      --------A--GLKASNI----RIVDAAEPP--KKPARPNLPLNLVLAVLLGTGLGVGAA
A0A2V9CYQ5      --------A--SLKASNI----LIVDPAEPP--TKPAKPKILLNLLVASILGLALGVGEA
A0A2V9BWU8      --------A--SLKASNI----RVVDSAEPP--ARPAKPRIPLNLAVAALLGLGLGISTA
A0A2V8ZG48      --------A--SLKASNI----RIVDSAVPP--AKPAKPKIPLNLAVATLLGLGLGISAA
A0A2V8Y334      --------A--SLKASNI----RIVDPADPP--AKPAKPRIPLNLAVGVLLGLGLGISTA
A0A2V9AY68      --------A--SLKASNI----RIVDSAEAP--AKPAKPKIPLNLAVASLLGLGLGISAA
A0A257VBK0      --------SLMSS---NV----RMVEPAQPP--MAPVKPNKRMNLLMGLLFGLMLSVGSI
A0A2V7XDY0      --------SIRSN---NV----SVVERASAP--TSPIRPNKKRIAAVAGFLGLLLGVGLV
A0A350UQT3      --------GFQNN---MV----RIADAARPA--WKPVFPKLTLNLLLAFLFSSLLAVGAA
A0A2U3JZ71      --------GFQNS---AI----RIADLARPA--FKAVFPNIKLNVLLAFLLSTLLAIGTA
A0A2V8TTB0      --------SFQNS---SI----RVADPARPG--LKPVFPLTWLNVLLAFLFATFLGVGAA
A0A1F2TCR2      --------NSRSN---NV----QLMDRAEVP--AAPFTPNPRKDWFTAIMAGLLVGVGLA
A0A2N9LQU7      --------GLASA---DI----SIVSRGMVA--ARPAFPKKSLMLPLGFLISVFGGLVFV
A0A2P6WFK7      --------GLSSG---YI----SIIDRAEIP--ATPVEPRIKRNLALGLFGGVIAGLLLA
A0A1F2V330      --------RPERMNKTVAF---RIVEPASLP--KGPSTPRRSRLLLVGLFVGLALGLAVA
A0A2V8U914      --------AVRQS---NI----RLVAPAEPA--FRPYKPNLPLNLSIGLFAGLVLAVGSV
A0A662EE63      --------TAWMN---NI----RVIEKATPP--SGPFSPNLRRAVALGGVLGLFLGIGLV
A0A2V7W309      --------RLRGSASSNV----HWVDHAETP--GSRINLSMKKNLQTAFPLGLFLGFAAI
A0A2V8TLH7      --------SLLSN---NL----RVLDRAPLP--QMPIRPRPILNLLIGVMLGLLLGVGTV
A0A1Q7ZJT1      --------SLLSN---NL----RILDKAPVP--KVPVRPRTVLNLAIGMLLGILLGVGAI
A0A2V8VC99      --------SLMSN---NL----SILDKAPVP--KVPVRPRTVLNMAIGVLFGLLLGVGTV
A0A348UZU3      --------RLKGLRTSNI----RIVDRADIP--LRPDSPRKFRNLLLALFLGLFGGLGLA
Q01XL7          --------LVPAS---NI----RVVDAAVAD--NIPSSPTPMRDIPTWSLFGGALCYGLL
A0A2V8ERZ5      --------NSRTN---NV----RLVDRAETP--RGPITAGGRRTVLMSLMIGLVLAVAVA
A0A2V8GTX0      --------NSRAN---NV----RLLDRSEVP--ESPFTPNTRRAWLMAILFGLGFGIAAA
A0A2V8J0X9      --------NSRAN---NV----QVLDRADVP--PFPVSPNPRRDWMTAILAGLSIALGLA
A0A523DUV7      --------SLREN---NV----SIVERASIS--AVPIRPQPTKNLAIALVLGVLSGCGLI
A0A372IRG7      --------GLNSN---NI----DVIDTAMIP--PYPVLPQKRQDATFGFLGGLIVGLILA
A0A1F2U158      --------NSRAN---NV----RVVERAEVP--AGPLTPTGRRTWLLSFAVGLVAAISVA
A0A2V8F6S9      --------NSRQN---NV----RVIDHAELP--RGPMAPTGRRTWLLSLAVGLAIAVAVA
A0A4Q1SCH5      --------GLDSI---NT----MIVDRARLQ--RFPVEPKKALILASGLILGCVAGIGAA
A0A2W0BGU4      --------GLSST---NI----HIVDPALAP--IIPVRPRTRLNIVLGLLVGMIFGSMLA
A0A2W0BVQ9      --------GLSST---NI----HIVDPALAP--IIPVRPRTRLNIVLGLLVGMIFGSMLA
A0A3D1ASD2      --------NFQTS---NV----RIADSARPP--LKPVFPRTRLNVLIAFLFSTILAIGAA
A0A2N9MK30      --------GFQSN---TV----RIADNARPG--LSPVFPNVPLNVGLALLFAAILAVGAA
A0A1I6MH75      --------GLEST---EI----DVVDLAMIP--ASPRLQPYSSVVLTACIFALLVGIILA
E8WVF6          --------GLESS---EI----DIIDQAVPP--SDPQSTPQSTIILTYFAVSLVLGTLLA
A0A1H5Z7N3      --------GLEST---EI----EIVDNAVPP--VYPTLKPRSTILMIDLVVALIVGLIVA
A0A2V9YHT3      --------ALKSS---NI----RIVDSARPP--VLPSQPDVPRNLLLGLAAGLIAGVVLA
A0A1G7JVV8      --------GLDAL---EI----DVVDPAFKP--IGPTMTPRSSILSRDLILSLVFGIMLA
A0A1H4T6W9      --------GLDSL---EI----DIVDQALKP--AAPSITPRSTILLRTLLISLVAGLMIA
I3ZEU5          --------GLDSL---EI----DIVDQALKP--AGPSMTPRSTILLRTVLIGLVAGLMIA
A0A5B9EBI2      --------GLESL---EI----DVVDQALIP--AAPTLQSATTIIIVTLLFSLFGGIVIA
A0A239HDF6      --------GLESL---EI----DIVDQAVPP--ASPMLRPKSTLVLTTLAVAMILGVLIA
A0A4Q0T270      --------GLESL---EI----DVVDQALLP--AYPTLQPYSSIITTNVLFALIVGIVVA
A0A1Q3QQB6      --------GLESL---EI----DVVDQALPP--AKPTLKRRSTVVLTGMVFGLLGGIIIA
A0A3N1K1G7      --------GLESL---EI----DVVDQALPP--ANPVLRPQSTIILTMLFVGLIAGIIIA
A0A428MDU2      --------GLESL---EI----DVVDQALPP--ASPMLRPQSTIIMTSFVFGLLGGIVLA
A0A4V2G466      --------GLESL---EI----DVVDPALLP--ATPTLKPKSTVVLTYLFMGLVAGVMLS
A0A4Q7YNP3      --------AMQAS---TV----RLVDAAHKP--KMPFSPRRGTSTMAGLLLGSLFGIGFA
A0A2V9MN96      --------GLRSS---NI----RVIDVARLP--TGPAKPDVRRNIFLGFLLGLAGGVALA
E8UZE1          --------GLSSD---TI----SVIDPALTP--NIPSEPRRALNMEAGALLGLVVAFAVV
A0A2V7V2Z1      --------ELKNS---NI----RIVDPASVP--RGPVRPRTTRDILYGVFLGLALGIGLA
A0A2V7X2F7      --------ELKAS---NI----RIVDPAVMP--NGPVRPNRQRDILTGALLGLVLAFGAA
A0A2V7V2I1      --------ELKAS---NI----RIVDAAAVP--GSPVRPNRPSDIAMGLFLGLALGVMAA
A0A2V7U3M2      --------ELKNS---NI----RIVDAASVP--RSPVRPQKTRDIAMGVALGLFLGIGLA
A0A2V7UHT0      --------ELKNS---NI----RIVDGASVP--RGPVRPQKTRDIAMGLALGLFLGIGLA
A0A2Z5FVL3      --------GFHSS---NI----TVVSPALAP--SAPSRPNIPLYLAGSLATGLLFGCIMA
A0A1V6HR88      --------RLQATRESNV----RIVDRALVP--GGPFRPSLRRNVTFAGGAGLVLGFGLV
A0A2V9KBD6      --------SLKSS---NI----WIVDPARAP--KLPSEPNLVRNVALSLAFGLFGGMCLA
A0A2W0AJ66      --------TLKLS---GL----RVIDPAQPP--KRPSEPNVPRNFGLSVGFGLVGGVLLA
A0A1Q7RBU1      --------SLKSS---NI----WIVDPARPP--KLPAEPKILRNLALSLLFGIFGGVLLA
A0A2V9JPV9      --------SLKSS---NI----WIVDPARPP--KRPAEPNILRNFALSLLFGIFGGVLLA
A0A3E0P0A3      --------SSGNQ---AIV---TQTERAVLP--TSPVSPSLRRHLPFGVALGLLCGVALV
A0A2V8EXP2      --------ELKTS---NI----RVIDVAETP--RRPASPNVVANLLLALFGGLTLAVGIA
A0A2W4RYA1      --------ELRTS---GI----RIVDPAVLP--RTPSSPRKVLNLSLGFVVAVLGALGLA
G8P0Y7          --------GLTSS---NT----RVVDRARLP--RYPTKPNIPRNLEFALLVGLVVGIALA
A0A5M8T4U7      --------GLSAT---NI----SVVDPAQVP--IIPIAPRKTMSMLFGLIGGFVGGLVMA
A0A3P0X3W6      --------GFQNS---SI----RIADEARPQ--NAPVFPKKGIFIFIGFFLSGVIAVAAT
A0A1E3Y9R6      --------EYRGT---AI----QVLDPATVP--SAPVLPRTPRDLLLAALAGGLLALGLA
A0A2W4TLP2      --------DYRGT---SI----QVLDRAEVP--RVPVLPRTQRDLMLAALAGLVLAFGLA
A0A3R9WF43      --------GVRAT---RI----DVVNEARPA--GTPSSPDYPKYLTLVAGIGIFLGISSA
A0A317HKM4      --------ELEST---NI----RIVDSAEIP--TVPSLPRQTHNLMLAFAGSSSLALVLV
A0A523E0N1      --------ELGEKQPVRV----KFIERAEAP--TVPFAPGSNRRFALLLALGVILGAGTA
A0A523ECP2      --------ELFEREPVNV----RIVEAALVP--KVPTGPRLSRSLLLGSVVGIALALGLA
A0A2W0C122      --------GLRST---NV----RLIDPAEAT--ELPVSPYLPRSSYLGLFLGFLLSAAVI
A0A2W0AUU7      --------GLRST---NI----RLIDPAGAT--GLPVSPNLRRTSCIGLFLGFLLSAAAI
A0A2W0BQL1      --------GLRST---NI----RLIDPAGAT--GLPVSPNLRRTSYIGLFLGFLLSAAAI
A0A4Q1SDL1      --------GLKAS---DI----TVVDPGRVP--AKPKKPNVPLYLLIAAFGGLVLGLAGA
A0A3P0XH15      --------GLNAT---QI----DIVDRAVTP--ALPVFPVKRNDAAIGLAAGLVLGLALA
A0A4R1LAZ7      --------GLNSN---NI----DVIDRASIP--ALPISPVKRVDLGVGLAAGLLVGISLS
A0A3M1WQW8      --------TLTTT---NI----QILDRAQVP--TTPARPRKLFTTGVSGLVGLLLGIVLA
A0A3N1JHC1      --------ALRAA---NA----RVVSPAKAS--LIPTSPKLSICIFLAVLLGGVFSLLYI
C1F294          --------GLNSN---SL----EVVDHANLP--VIPVTPQKKRTVVFGFLGGLIAGIAIS
A0A2V9KA79      --------KRGKVETNVLW---RIADPARLP--SAPVTPGRVRILLLGLAAGLCLGLGLA
A0A522PSP1      --------GYHST---AL----RIIDPARPN--SAPVYPRTKQTLMLALILSGMLGVLGA
G8P085          --------GLQSV---NT----MRVDTARAP--LIPVEPKKLVILSFGLVLGLFAGVGSA
A0A4Q1SGQ1      --------GLRST---NL----TVVAPAQVPPTHRPSSPRMLLVYACALIGGLFLGCTGG
Q1ILD9          --------SLKAA---NI----DVVDAAPVP--IKPVEPAMKLAMALGLIGGLFMGFAGV
Q1IJZ6          --------GIKST---NV----AVISAGLPP--AKPSHPDPLVNGIVGLGGGLFVGLILA
A0A2V8TCE6      --------QLRDMNAGNA----RIVDRAIPP--TAPCKPRPGVELPLGLFVGLLLGMGAA
A0A522TBE8      --------GFHTT---NA----RVVSPARPD--FRPVAPRPKLTAAVALLLSLLAGVGFV
Q1ITG0          --------GLKST---NV----DVIDPSAVP--QLPVLPNVPLFIALGLFGGAFLGVCSA
A0A3N5PCI5      --------DIQGP---DI----QVVDAAEVP--RRPVRPDTRSTLMIGLLLSGILAVAIA
A0A3M1Q0S9      --------SLAEDRALNI----RVIEKATPP--RMIFKPKKKLNVALGFLFGLFLGIGAA
A0A2Z5G448      --------GLNSN---NV----NLVDKAEVP--AFAVAPKKRTNYGFGALIGLFIGIAAA
A0A3M1VZ38      --------NLGDT-AHNV----QIIDEAVPP--EIIYRPKKKLNILLGFLLGLCLGIGGA
A0A4Q1SD29      --------GLSAT---NI----DVIDRANIP--PFPVLPAKRSDVMFGLLGGLIVGMALA
A0A3M1PY35      --------DLRSILERQV----SVVAPATPP--ERPAVPRYRLDLALSALLGLFLGIGAA
A0A3M1VMP2      --------DLQSILERQV----HVVDRAKPP--KSPSAPRVKLNLALGLLLGLLLGVGGA
                                                                   .        

A0A2V7VMF7      L-LRDFLS-NT-V----RDPEEIERYLHLDLLSAVPRYEA--------------------
A0A2V7YYV7      Y-LLERLD-QS-I----KTNEDLTERLGLLPVGHIGYVLAG-------------------
A0A2V7Z0J5      L-LFDYLD-QS-I----KSDAELTDRVGLISLGHVPFLVAG-------------------
A0A2V7Z3M4      F-LLDYLD-QS-I----KSDQELTERLGLVPHGHIAFVPAG-------------------
A0A399Y5V2      F-LVEYLD-DS-L----RSKQDAEKAFGAPILGMIPRA-----------QSWND------
Q01X01          M-LQEQTN-SA-L----RSPGDAGAYLTLPELGAIPRAAKRKFAVLGFLSESNG------
A0A3M2D9H8      F-LIEYLD-DS-I----RNGETVTKNLDLPVLGYISEMNGKLP-----------------
A0A2V8JK38      V-FQEYID-RS-I----KSPDDVTRHLGLLALGTVPRLHNLSLWRGYKYKYGYGYGFRFG
A0A2V9IXG5      V-LGEVIN-PR-V----KTVEEIQTSLSVPALGFLPRTKD--------------------
A0A2V9J2P4      V-LGEVIN-PR-V----KTVEEIQTSLSVPALGFLPRTKD--------------------
A0A1Q7RLS4      F-FLDYMD-NT-V----RTSDDVEQYLRLNLLAIVPKEAD--------------------
A0A2V2R525      L-LRELSN-NT-V----RTMSDVTRSIRLPTIAVVPTVKSWP------------------
A0A321LPW6      F-LLEYLD-NT-I----KTVDDVARFVRLPALGVIPMMTA--------------------
A0A2V9R9V4      W-LLERFD-DS-I----RSVDDVNRYTQLPALAVIPVIGA--------------------
A0A321LE75      F-VLEYFD-NT-I----KSVEDVNRYAQLPALGIIPAITS--------------------
A0A2V8R8U7      F-LIDYLD-DT-V----KSLDDIDRYIHLPALALIPSVRS--------------------
A0A2V8QMP4      F-LLDYLD-DT-L----KSIEDVDRHLHLPTLALIPAPRE--------------------
A0A2V8R4S3      F-LLDYLD-DT-L----KSIEDVDRHLHLPTLALIPAPRE--------------------
A0A2V8NJ55      F-LLDYLD-DT-V----KSIEDVDRYIHLPALALIPGQRS--------------------
A0A2V8Q7I0      F-LLDFLD-DT-V----KSVDDIDRYVHLPALALIPASRG--------------------
A0A2V8S6K4      F-LLDYLD-DT-L----KSIEDVDRHVHLPTLALIPAPRE--------------------
A0A317I2L9      F-LLDFLD-DT-V----KSIEDIDRYVHLPALALIPASRS--------------------
A0A2V8LLF9      F-LLDFLD-DT-L----KSVDDVDRYLHLPALALIPTARN--------------------
A0A352FRF4      F-LLDFLD-DT-I----KSVDDVDRYINLPALALIPAVRN--------------------
A0A2V8MKV0      F-LLDFLD-DT-V----KSLDDVDRYIHLPTLALIPAARS--------------------
A0A2V8PYY8      F-LLDFLD-DT-V----KSLDDVDRYIHLPTLALIPAARS--------------------
A0A1Q7YKQ8      F-LLDYLD-DT-L----KSVEDVDRYLHLPALALIPSTRS--------------------
A0A352F3R7      F-LLDFLD-DT-V----KTVDDIDRYLHLPALALIPASRE--------------------
A0A0B6WXT1      F-LLDYLD-DT-L----KSAEDVERYLHLPTLALIPAPRT--------------------
A0A3B9MEU8      F-LLDFLD-DT-L----KSVDDVDRYLHLPALALIPSNRD--------------------
A0A2V8MHG6      R-YLDYMD-DS-V----RTSEDVENFLRLPALTVIPTIGNSA------------------
A0A2V8P7N1      R-YLDYMD-DS-V----RTSDDVENFLRLPALTVIPTVGNSA------------------
A0A2V8M3M6      R-YLDYMD-DS-V----RTSDDVENFLRLPALTVIPTVGNSA------------------
A0A1Q7NJH5      H-YLDYMD-DS-V----RTSEDVENFLRLPALTVIPTIGNSA------------------
A0A2V8PJY0      H-YLDYMD-DS-V----RTSEDVENFLRLPALTVIPTIGNSA------------------
A0A1Q7Y6W9      L-FLDYLD-DT-V----RTADDVEKVLRLPALGVIPSIEGKT------------------
A0A2V8NC68      R-YLDYLD-DS-V----RTVEDIERTLRLPSLAVIPAIGSLS------------------
A0A399WK13      L-FLEYLD-DT-V----RSTEEVESLLQLPALAAIPTIDSM-------------------
A0A352FLX4      F-IIEYLD-DS-V----RSMEDVENLLRLPAIALIPQVGTVK------------------
A0A2V8RTL7      L-FLEYLD-DT-I----NTTEEVENLLQLPALTAIPTIDSI-------------------
A0A3E0PCJ6      L-FLEYLD-DS-I----KTTEEAETYLQLPALAAIPTVEAS-------------------
A0A3M1S4R8      F-FLEYLD-DT-I----KTAEDVENYLGLPVLVVIPSMNAA-------------------
A0A1Q7YFI6      R-YLDYLD-DT-L----HSAAEVDEMLRLPTLAVIPAVGNA-------------------
A0A136KC10      L-FLEYLD-DT-V----HSTEEVESLLHLPALAAIPTIQSM-------------------
A0A2V8SEX6      L-FLEYLD-DT-I----RSTEEIETYLQLPALAAIPTIDSI-------------------
A0A3M2D6Y5      L-FLEYLD-DS-V----KTVEDVETYLGLPALAVIPTIGVS-------------------
A0A0B6WWQ6      I-FLDYLD-DS-L----QSAEEVERELHLPALAAIPTVS---------------------
A0A3B9MK99      L-LLEYFD-DT-L----RSSEEVERLLQLPALGVIPSANASA------------------
A0A352EX26      L-FLEYLD-DT-V----HSTDEVERLLHLPALAVIPSANGMG------------------
A0A2V8MM59      L-FLEYLD-DS-V----HSTDDVERLLGLPALAVIPSMSGGST-----------------
A0A2V8PFE8      L-FLEYLD-DS-I----HSTDDVEKFLRLPALAVIPSMSGGVA-----------------
A0A2V8PWS6      L-FLEYLD-DS-I----HSTDDVEKFLRLPALAVIPSMSGGVA-----------------
A0A2V8LCT5      L-FLEYLD-DT-V----HSTEDVEKFLRLPALAVIPAMGAASA-----------------
A0A352FTJ9      L-FLEYLD-DT-V----HSTDDVERFLRLPALAVIPAMSSASA-----------------
A0A2V8G155      F-FFEHFD-NR-I----KTPEEIQTHLRLASLGLVPAVRLKGS-----------------
A0A2V8HDM7      F-FFEHFD-NR-I----KTPEEIQTHLRLASLGLVPAVRLKGS-----------------
A0A2V8DRT9      F-FFEYCD-NR-I----KSPAEIKAHLGLPFIGMIPKMAVADG-----------------
A0A2V7VYF3      F-GLEYLD-NR-I----KSPDEITAHLRMPCLGLVPAAPDKYA-----------------
A0A1F2SVH2      F-FFEYLD-NR-I----KSPDEIKQHLGLPFLGMVPALFDKAL-----------------
A0A2V8AJG9      F-FFEYLD-NR-I----KTPDEVKAHLGLPFLGMVPALFGDDV-----------------
A0A2G6PYV5      F-LIEITD-RK-I----HNTEVLEMVTVLPTLATIPKVSGFNK-----------------
A0A2V8F956      F-FFEHID-SR-I----KTPDEVTAHLQLPHLGLLPALNEKQF-----------------
A0A1F2S1W5      F-GLEYAD-DR-I----KNPDEMKKHLGLPFLGMVPALFDKGA-----------------
A0A1F2T595      F-TLEYAD-DR-I----KNPDELKKLLGLPFLGMIPALSGNRA-----------------
A0A2V8JQV5      V-RQEQAD-RS-I----HAPAEAPVYLNVPELGVVLSAEADSS---------------LG
A0A2V9AC41      F-LFDQLD-NT-I----KSPEEAERFIQLPTLGVVPDFALLTG-----------------
A0A2V8K4L4      L-LKEQAD-RS-I----QQPGDSSLYLGISELGVIPSDRPTML-----------------
A0A2V8NCZ3      L-LREQAD-RS-I----QQPGDSALYLGVSELGVIPSDRQG-------------------
A0A2V9MAM9      T-VVNQAEAGR-S----REPGDVEARLNLVELGAIPSARSVVG-----------------
A0A2V9M454      F-TREALD-NS-I----KNAQEIEKLTSLPTLSIVPLSHSSVL-----------------
A0A2V9IVR7      F-VQEALD-DS-I----KSIGQVERYLSTNALAVIPLARTVRS-----------------
A0A2V9ILE2      F-VQEALD-DS-I----KSIGQVERYLSTNALAVIPLARTVRS-----------------
A0A2V9LGY4      F-VQEALD-DS-I----KSIGQVERYLSTNALAVIPLARTVRS-----------------
A0A2V9J4D6      F-LEEQLEQKT-V----KTMEDVQRLVGLPSLGLIPLWAPNHN-----------------
A0A2V9L9C5      F-LEEQLEQKT-V----KTMEDVQRLVGLPSLGLIPLWAPNHN-----------------
A0A2N9M9N1      F-IREGLD-RT-V----KTAEDIENQIAIPTLAVIPLGTRSRG-----------------
A0A2V9JEC4      F-AQEALN-NS-I----RTPDDLEGSFSIRALTIVP--AVFSS-----------------
A0A2V9LPQ3      F-AEEGLERRS-I----RTPDDVERLLGIPALAIIPSASLLIR-----------------
A0A348V070      L-FINYLV-AT-V----KSSRDIAQATGWPTIGTIPAFEKEFKPRGPRAEFRTLSGLLKG
A0A2Z5G3A3      L-LFDTTD-TK-I----QDLDELELMLGGVPIGILPAFDRPAT-----------------
A0A2V7UGP8      F-FLEYLD-NS-I----KSTSDVEKYVQLPTLGTIPMVVSSAL-----------------
A0A239MKT6      I-ALHLRD-RF-L----YTIEDFQAAWSAPVIGVVPHFVENGQ-----------------
A0A3E0PCN7      F-VLNWLD-DT-V----RADDNFELHEGVSVLGMVPGADRRLG-----------------
A0A2V8IYW3      A-LLEYRD-TS-L----RTESQLLEALKIPVLAVLPVMESIDEKRRRMLRLAFTFTGGFL
G2LEI9          F-AREYLN-TR-I----KSVEDVDRLLNLPTLGLIPQVSPKEL-----------------
A0A317J121      F-LWERMD-KS-V----RTPGHSRTLLNVPELGVIPSIEPRGS-----------------
A0A2V7YW66      V-LIELMD-RT-V----KSPEEVERRLGLPPLAVIHDVTEMGKAYGYAGGYGYGYGYGEP
A0A2V7Z0V0      V-LIEVLD-RT-V----KAPEEIERKLGLPTLAVIQDLSESGKAYGYS-----AYGYGET
A0A2V8GFD4      F-VIEALD-TC-L----KTPDDIKVQLGLPFLGLVPQLRRREF-----------------
A0A2V8HSS5      F-VIEALD-TC-L----KTPDDIKVQLGLPFLGLVPQLRRREF-----------------
A0A2V8KP55      V-FQEYID-RS-I----KSPDDVTRHLGLLALGTVPRLHNLSLWRGYKYKYGYGYGFRFG
A0A399WNU1      F-GLNWLD-DT-I----RVPVASQAQLGAPIVGMIPQSNGHRR-----------------
A0A2V9CG11      L-FRERLD-RR-I----QSPGDAHVYLNISELGVITSAEIKHS-----------------
A0A2V2R0I6      L-LREYLD-NT-V----KSPDDVENLARLPSLAVVPHFTGSNG-----------------
A0A2V8XAR9      L-MREYLD-NT-V----KSPDDVETLARLPSLAVVPQFASSNG-----------------
A0A2V8VZA0      L-MREYLD-NT-V----KSPDDVETLSGLPSLAVVPQFAGSNG-----------------
A0A1Q7CB82      L-MREYLD-NT-V----KSPDDVETLSGLPSLAVVPQFAGSNG-----------------
A0A2V8WIU1      L-MREYLD-NT-V----KSPDDVETLSGLPSLAVVPQFAGSNG-----------------
A0A1Q6Y9F5      L-MREYLD-NT-V----KSPDDVETLSRLPSLAVVPQFASSNG-----------------
A0A2V9EVV8      L-MREYLD-NT-V----KSPDDVETLSRLPSLAVVPQFASSNG-----------------
A0A2V8YF91      L-LREYLD-NT-V----KSPDDIEALARLPSLAVVPQFSGSSG-----------------
A0A2V8XZK2      L-MREYLD-NT-V----KTPDDIESLARLPSLAVVPQFTGLNG-----------------
A0A2V8ZTX6      L-LREYLD-NT-V----KTPDDIETLARLPSLAVVPQFAGTNG-----------------
A0A2V9BT79      L-LREYLD-NT-V----KTPDDIETLARLPSLAVVPQFAGSNG-----------------
A0A1Q8B793      L-LREYMD-NT-V----KTPDDVEMLARLPSLAVVPAFIDTNG-----------------
A0A2V9BCA0      L-LREYMD-NT-V----KTPDDVEMLARLPSLAVVPAFIDTNG-----------------
A0A2V9BWU9      L-LREYLD-NT-V----KTPGDIEMLTRLPSLAVVPAFVTLNG-----------------
A0A2V9DKX2      L-LREYLD-NT-V----KTPGDIEMLTRLPSLAVVPAFVTLNG-----------------
A0A2V9JSI3      L-FADVLD-NS-V----KSVEDIERLTGMPTLAVIPLAASDRA-----------------
A0A2V9WI32      F-VLESLD-NT-V----RTPEEAQIISALPSLGIIPLSTKQIA-----------------
A0A2V8IVN9      F-FFEYLD-SH-I----KTPDEIRAHLGMPALGMLPAVQEKEF-----------------
A0A1F2TPT3      F-GFEYLD-NR-I----KLPEEIGQRLGLPVLGFLPEIKLKSG-----------------
A0A2V8JTQ2      FGLAKIEE-KT-I----NTVEQAQSLSSLPALGVLPLLEAKSQ-----------------
A0A2V8UZY0      FGLAKVNE-KT-I----ITLEQARLLSPLPALGVLPLLKTMSR-----------------
A0A3N5YNR8      F-LMEYLD-NT-L----KTPEDMEQSLGLPSLGVIPAMADLPA-----------------
A0A350UEK1      V-TTEKAD-RA-L----REPSDIPFYLGARELGVVPSAGRVED-----------------
A0A350UIQ4      V-TTEKAD-RA-L----REPSDVPFYLGVRELGVVPSASLLEE-----------------
A0A3N6A5T6      F-FIDYLD-NT-I----KTPDDIEKTLDLPSLGVIPAFKMFET-----------------
A0A1F2Q9L4      F-FLEYLD-RS-V----KTAEDVDRILSLPVLAVIPDVARSRN-----------------
A0A1H5SQF5      F-ATAYHN-DV-L----STPEEVASLTSLPLLGLVPQAGKRRR-----------------
A0A3E0NV31      L-GLEFLD-QT-V----KSSDHITESIGLPVLGTVPSIGKQEG-----------------
A0A3N5M5V0      F-LMEYLD-NT-L----KTPEDMEQSLGLPSLGVIPAISDLPA-----------------
A0A2V9AEW6      L-LRERLD-RR-I----SAPGEAQIYLDLPELGVIPLDDTAVS-----------------
A0A2V8WQK6      L-LRERID-RR-I----SAPGDAQVYLDLPELGVLPLDQAAVS-----------------
A0A2V8XIF4      I-LRDRLD-RR-I----TAPGDAQAYLDLPELGVIPFDQGGLA-----------------
A0A3N5XQP8      V-TLHLLD-NR-V----HSPEDV-LALHIPALGIVPKSQELTN-----------------
A0A2Z5G7H4      F-ISDSID-DK-I----QTIEEIERDLELVPLGILPHLGEPNW-----------------
A0A2V9L5B5      F-FQEYLD-KT-L----KTPDEVERLLRLPSLGVLPRFTPNGA-----------------
A0A2V9LK56      I-LLEYLD-NT-L----KSPSQVESLLRLPSLGVILEFDLFSA-----------------
A0A2V9L7I0      F-LQEHLD-KT-L----KTPDEVERLLHLPSLGVLPRFTLNGN-----------------
A0A522PPT0      F-LQEYLD-NT-L----KTPDEVEFLLRLPSLGLIPSVHLNGS-----------------
A0A2V9KCS3      V-IQEQAD-RS-L----QSPGDGPTYLNLPELGVIPSAKADRG-----------------
A0A2U3KC61      F-VLESLD-TS-I----RNMEELSAISTLPALGTIPLQLSSNG-----------------
A0A2V9Y2R7      F-VLESCD-NT-V----RNMEQVSAISTLPALGMIPLQVSGNG-----------------
A0A372IT17      I-TCEFTD-RS-I----TSLTEVERLTGAPLFSVIPLLEPSFH-----------------
A0A136JPP4      F-LLDYLD-DS-I----RTSDDISRALGLPTLAMIPHHGINEK-----------------
A0A399WUJ8      F-LLDYLD-DS-V----RTSDDVSRALGLPTLAMIPHHGINEK-----------------
A0A2V9NGH6      F-LLEGID-NT-V----RTPEQAQAISGLPSLGIIPDGSKLSI-----------------
A0A2V9PYE6      F-LLEGID-NT-V----RTPEQAQAISGLPSLGIIPDGSKLSI-----------------
A0A2V9NL07      F-LLEGID-NT-V----RTPEQAQLISGLPSLGMIPLGSRTAA-----------------
A0A2V9QD92      F-LLEGID-NT-V----RTPEQAQLISGLPSLGMIPLGSRTAA-----------------
A0A2V9WPZ6      F-LLENLD-NT-V----RTPEQAQIISSLPSLGS-RTGVEGKN-----------------
A0A2V9ZLH4      F-LLENLD-NT-V----RTPEQAQMISALPALGMIPLGSKRPN-----------------
A0A2V9RQF1      F-LLEGID-NT-V----RTPEQAEAISGLPSLGMIPLGSKSSS-----------------
A0A2V9YDK8      F-LLENLD-NT-V----RTPEQAQIISGLPSLGMIPQGSKS-I-----------------
A0A2V9V8F7      F-LLENLD-NT-V----RTPEQAQLISSLPSLGMIPQGSRTGV-----------------
A0A2V9XGR9      F-LLENLD-NT-V----RTPEQAQIISSLPSLGMIPQGSRTGV-----------------
A0A2V9V3Q5      F-LLEGMD-NT-V----RTTEQAQMISALPSLGMIPLGSKSRN-----------------
A0A2V9NWS3      F-LLEGVD-NT-V----RTPEQAQAISALPSLGIIPMGSKAPT-----------------
A0A2V9USA9      F-LLEGLD-NT-V----RTTEQAQTISGLAPLGMIPLGSKGIR-----------------
A0A2V9XW18      F-LIEALD-NT-V----RTTEQAQMIAGVASLGMIPLGSKSAR-----------------
A0A4R1LC91      L-LADVMD-NK-I----QDVSELEGYIGGLPIGILPKYTQDDR-----------------
A0A3M2BZG9      L-LIEFFD-RT-I----KSPEELEKITGLPTLTVIPDVAERNRSYAARLRYGLGNGYGYG
A0A1Q7N5R7      V-LVDRLD-RR-V----RYPDQVTNGMGLRILGALPHVKNRKAGPDD-------------
A0A3M1SIV3      F-LLDYLD-DS-V----RDVDDITRHLNLPTLALIPEAQEKKK-----------------
A0A3E0PHB0      F-LLDYLD-DS-I----KSSDDIGRSLGLPTLGLIPHQKMMDR----------GKKQK--
A0A3M2D491      F-LFDYLD-DS-V----RTVDDVTKHLGLPTLAIIPEATASKK----------TKL----
A0A357F267      F-LLDYLD-DS-V----KESEDIGRHLGLPTLALIPHYFGSEK----------RKHR---
A0A353C9L6      F-LLDYLD-DS-V----KTSEDIGRHVGLPTLALIPHYFGSEK----------RRLRLL-
A0A2V8RQV0      F-LMDYLD-DS-V----RTSEDIGRHLGLPTLGLIPHHGIAER----------RRL----
A0A2V8SJH5      F-LLDYLD-DS-V----KTSDDIGRHLGLPTLALIPHHFGSEK----------RRLKLIA
A0A2V9QB26      V-TRGRAD-RT-F----RAPGEAQLWLNVPELQVIPTAVEESRRCLYTERCNKTTTLSLS
A0A2V9VYY4      L-VRETFD-ST-V----RSMEEVRAVSTLPALGTIPLQLVTDE-------------RFRK
A0A2V9KIE8      F-FQEYLD-NT-V----KSPDEVEELVRLPSLAVLPSFALNDG--------------KGD
A0A352F549      L-FLEYLD-DT-V----KDSRDIESGLRLPSLAVIPIAGKSTQ-----------------
A0A3B9MLP9      L-FLEYLD-DT-I----KSPGDIESGLRLPSLAIIPIAGRSAQ-----------------
A0A3D5SQ87      L-FLEYLD-DT-I----KSPGDIESGLRLPSLAIIPIAGRSAQ-----------------
A0A2V8NW86      V-TRGRAD-RT-L----RAPGEAQLWLNVPELQVIPTAVEESGRCLDTERCDKTTTLLPS
A0A2V8ZHL8      F-VKEALD-TS-I----KSIEEAERVVNAPALAVVPLEREIPH---RPAL----------
A0A2V9B240      F-VKEALD-SS-I----KSIEEAERVVNAPALAVVPLERELPH---RPAR----------
A0A2V9CBM2      F-LQERLD-DT-V----TGADDVERLCGLSVLALIPAVQPSNG---DQHGGVHYKLLEHA
A0A2V8XN17      L-FQERMD-DT-L----KGDDDVERLLGLPSLALIPVVASANG---NHLG--IHRFLPRD
A0A2V8WX45      F-FQERMD-NT-L----KGDDDVERLFGLPSLALIPVVPPSNG---DQHG--IHRFLQQD
A0A1Q6YR79      L-FQERMD-DT-L----KGDDDVERLLGLPSLALIPVVPASNG---DHLG--IHRFLPRD
A0A1Q7VA32      L-FQERMD-DT-L----KGDDDVERLLGLPSLALIPVVPASNG---DHLG--IHRFLPRD
A0A2V9EY85      L-FQERMD-DT-L----KGDDDVERLLGLPSLALIPVVPASNG---DHLG--IHRFLPRD
A0A2V9H8K0      L-FQERMD-DT-L----KGDDDVERLFGLPSLALIPAVPPSNG---DLQG--IHRFLPRD
A0A2V9FFE5      L-FQERMD-NT-L----KGDDDVERLFGLPSLALIPVVPPSDS---DQHG--IHRFLPRD
A0A2V9GM43      L-FQERMD-NT-L----KGDDDVERLFGLPSLALIPVVPPSDS---DQHG--IHRFLPRD
A0A1F2RFI7      F-FQEYLD-NT-L----KTPEDVQRFLHLPTLGIIPAASANGR---AGLSYGYGYGYGYG
A0A1F2RZS3      F-FQEYLD-NT-L----KTPEDVQRYLRLPTLGVIPAANAASR---KKLA----YGYGYS
A0A1F2USE2      F-LQEYLD-NT-L----KTPEDVERFLHIPALALIPSVESLSG---RRGRAYGYGYGLYG
A0A2V9C238      --VQEHVD-NS-L----KTSEDVERFLGLPALALIPAVESLNG---RRKGA----YRLYG
A0A1F2Q9F5      F-LQEHFD-NS-L----KTSEDVERFLHLPVLALIPSLESLNG---RRRA--------YG
A0A1F2QQH9      F-LQEHFD-NS-L----KTSEDVERFLHLPVLALIPSLESLNG---RRRA--------YG
A0A1F2QXK7      F-LQEHFD-NS-L----KTSEDVERFLHLPVLALIPSLESLNG---RRRA--------YG
A0A2V9DEM9      F-LQEHVD-NS-L----KTSEDVERFLGLPALALIPAVESLNG---RRRGV----YRLYG
A0A2V9CYQ5      F-LQEHLD-DT-V----RGADDVERLFGLSVLGLIPAVQPSNG---DQHSI----HKLVE
A0A2V9BWU8      F-LQERLD-DT-L----KGADDVERLFGLSALALIPSVHCLNG---DRPSV----RKLLD
A0A2V8ZG48      F-LQERLD-DT-L----KGADDVERLFGLPALALIPAVHHLNG---NGPSV----RRLLD
A0A2V8Y334      F-LQERLD-DT-L----KGADDVERLFGLPALALIPSVHHLDG---DRHGV----RKLLD
A0A2V9AY68      F-LQERLD-DT-L----KGADDVERLFGLSALALIPSVHQLGG---NRNGV----RKLLR
A0A257VBK0      V-AWQYLD-TS-V----KSVEDLETRMGVALLTMVPKFEPE-------------------
A0A2V7XDY0      I-ARDYLD-NT-I----KDPEEIERYLHIDLLAAVPQYDEA-------------------
A0A350UQT3      I-LVDTLD-NT-I----RDPEQVSRTLKTHIIGTLPSVKNT-------------------
A0A2U3JZ71      I-CADLLN-NA-V----RDPEQVARTLSTEVIGTLPSVKEWHGRITAASEPGT-------
A0A2V8TTB0      V-LTDVLD-NT-I----RDPDQVARLMNTNVVGSLPTVKDWRRRLSPISSSGSANGHRNG
A0A1F2TCR2      F-GIEYLD-DT-V----KTPEDITKVLGLPLLGLVPAIRGE-------------------
A0A2N9LQU7      F-VLESFD-DS-L----RTSEEVEAASSIPALATIPLITRR-------------------
A0A2P6WFK7      F-GVEALD-DT-L----SNSEELETCLALPVLCTIP--THQ-------------------
A0A1F2V330      F-VAEQMD-TT-F----GNIVEFQTFTNLPAIAVLPSMSADLDPGVKPLTGT--------
A0A2V8U914      M-LTEQTN-SR-L----RAPGEASFYLNLPELGTIPSAESL-------------------
A0A662EE63      L-GLDFLD-HT-L----RTPDQVERYLGLEVLAALPKLTDD-------------------
A0A2V7W309      F-FLEYMD-RS-I----KTPEELERVTKFASLGVIPAAGTI-------SRQY----GYNY
A0A2V8TLH7      F-FLDYMD-NT-V----RTSEDVERYLKLNILAVVPRDNDA-------------------
A0A1Q7ZJT1      F-FLDYMD-NT-V----RTSDDVEQYLRLNLLAIVPKEADG-------------------
A0A2V8VC99      F-FMDYMD-NT-V----RTSEDVEQYLRLNLLAIIPKQSDE-------------------
A0A348UZU3      L-GMEYLD-NT-V----KSAEDVERYSGWPTLGVVPIFDQD--------ATLNGHYYAYR
Q01XL7          W-FREVLR-RKRLTQLFESPGHTRTILGVPELGVIPSATIDRPKKLAAAQRA--------
A0A2V8ERZ5      L-GLDYMN-DT-I----KTPEDVTRRLKLPFLGLVPVVRGD-------------------
A0A2V8GTX0      F-AIDYLD-DT-V----KTPEDVTWRLHLNFLGLVPKVHGE-------------------
A0A2V8J0X9      F-GMEYLD-DS-V----KTPEDITKRLRLPLLGLVPAVRGE-------------------
A0A523DUV7      L-LRDYLD-NT-L----KEQEDIERHLRVDCLAIVPEHDAA-------------------
A0A372IRG7      V-FLESMD-DT-L----RTSDDAEAVSLLPALAVIPHFQPF-------SKKA--------
A0A1F2U158      Y-GLDYMN-DT-I----KTPEDVTRMLKMTFLGLIPSVRGD-------------------
A0A2V8F6S9      Y-GLDYMN-DT-I----KTPEDVTRRLKLPFLGLVPSVRGD-------------------
A0A4Q1SCH5      L-LRESMG-GE-I----QSISQVESNVGLANLATVPHMDWE-------------------
A0A2W0BGU4      F-IQDSLD-NS-L----KSPEEVEMLIATRALALIPMKRLT-------RAER--------
A0A2W0BVQ9      F-IQDSLD-NS-L----KSPEEVEMLIATRALALIPMKRLT-------RAER--------
A0A3D1ASD2      V-MSDVLD-NT-L----KDPEQIARTLKTQVIGTLPSMKSW-------------------
A0A2N9MK30      V-LSDTLD-NT-I----RNTEQVARIVKAEVIGGLPQVKSW-------------------
A0A1I6MH75      F-TLESLD-TG-L----RSIAEIESVIELPSLAIIPKARRT-------AAEQ--------
E8WVF6          F-LLESLD-TG-L----RSVAEIEAITELPSLSIIPRARRA-------TPEQ--------
A0A1H5Z7N3      F-VLDSLD-TG-L----RDVMEIERITGLPSLAVIPKTRRT-------SAEQ--------
A0A2V9YHT3      F-GAEVMD-ST-I----RTPEQVQIVSALPSLGIVPMSISL-------SSQA--------
A0A1G7JVV8      F-ALESLD-TG-I----RSVSEVEHITQLPSLSIIPRVRRM-------QSDG--------
A0A1H4T6W9      F-TMESLD-TG-I----RSVAEVEQITQLPSLSVIPRVRRL-------SSD---------
I3ZEU5          F-TMESLD-TG-I----RSVAEVEQITQLPSLAVIPKVRRL-------SSD---------
A0A5B9EBI2      F-LLESLD-TG-L----RTIAEVEGITELPALAIIPRSRRT-------VSEL--------
A0A239HDF6      F-LLDTLD-TG-I----RSVTELEAITEMPSLAVIPRLRKP-------AGAA--------
A0A4Q0T270      F-VLDSLD-TG-L----RSIAEIESVIELPSLAVIPKARRT-------AADQ--------
A0A1Q3QQB6      F-IVESLD-TG-L----SSVAEIESLIELPSLAVIPKARRL-------SVEQ--------
A0A3N1K1G7      F-LMESLD-TG-L----RSIAEIESITELPSLAIIPRARRS-------SAEQ--------
A0A428MDU2      F-LMESLD-TG-L----RSVAEIESITELPSLAVIPRSRRA-------GVSE--------
A0A4V2G466      F-LLESLD-TG-L----RSVAEVESIIELPSLAIIPRFRRS-------TAEV--------
A0A4Q7YNP3      F-YKDRNS-DI-L----RVPGEVERYLNLNELGVIPSSRYE-------DKAF--------
A0A2V9MN96      F-LQESMD-TT-V----GSLEELSAITALPMLGVIPLQLAE-------NGRR--------
E8UZE1          F-LIENAN-AT-I----RTGEDIYRYSGLPLLSIVPHLSPA-------QRNM--------
A0A2V7V2Z1      F-FLDYLD-NT-I----KTPEDVRKQLAAPLLAVIPEIAN--------PAE---------
A0A2V7X2F7      F-FLEYLD-NT-L----KTPDDVRNHLGAPLLGVVPETGQS-------PADL--------
A0A2V7V2I1      F-FLEYLD-NS-I----KTPEEVRLHLGVPLLGVIPEHGQD-------SGSP--------
A0A2V7U3M2      F-FLDYLD-NT-I----KTPEDVRKQLGAPLLAVIPEISV--------PGDI--------
A0A2V7UHT0      F-FLDYLD-NT-I----KTPEDVRKQLGAPLLAVIPEIGS--------PTD---------
A0A2Z5FVL3      V-VVDLMD-SK-I----ADIHGLESLMGEAPFGILPSFAAK-------KKGL--------
A0A1V6HR88      L-LLHYMD-RT-L----KSSEEVERLFGVPVLAVIPDVGAGGKGYGLRGRYGYGYGYGYG
A0A2V9KBD6      F-GLEKIN-EKTI----RTVEQVQLLSPLPVLGALPLLEAN-------SKNG--------
A0A2W0AJ66      F-GLAKMH-EP-I----STLEQAQILSPLPALGVVPLLEG--------SANQ--------
A0A1Q7RBU1      F-GLTKMN-EK-I----STLEQALALSPLPSLGVVPLLEAK-------SKSR--------
A0A2V9JPV9      F-GLTKMN-ET-I----STLEQAIALSPLPSLGVVPLLEAK-------GKSR--------
A0A3E0P0A3      L-LIDFLD-RS-I----KSPEELERRLGLPVLGVVPDLNRR-------GSSR--------
A0A2V8EXP2      F-FFEYLD-NR-I----KTPDEIKAHLGLPFLGLVPALFAK-------DLH---------
A0A2W4RYA1      F-FFEYFD-NR-L----RTPEEMQAVLGLTSLAMLPSVPAS-------SLRS--------
G8P0Y7          F-GLEALD-AT-V----RTPEQAETTSGLPVLGVIPMQPVF-------DKAG--------
A0A5M8T4U7      F-IIESID-DR-M----QTSEEVESVSTLASLATIPHMEDG-------PLRR--------
A0A3P0X3W6      L-LSDMMD-KS-V----RDPEQARRSLQVEVLGILPDVLQL-------KPAGRQLLLKSG
A0A1E3Y9R6      F-GFEYFD-SR-I----KLPEEIKTHLNLPFLGMIPVFPDA-------GRDG--------
A0A2W4TLP2      F-GVEHFD-SR-I----KLPEEIKTHLGLPFLGMIPTFPGG-------DESG--------
A0A3R9WF43      F-VRESLD-ES-I----RTPLDIEAASHLSILAYIPTKSRA-------ETVT--------
A0A317HKM4      F-VLEVFN-TR-V----TSVEDVKRHLRIPVLGLMPQVPSK-------NGRV--------
A0A523E0N1      Y-LLDHWD-DA-I----HTVDDVKQHVPLPYLGMIPRYGTD-------SALKSIKSRLAP
A0A523ECP2      L-FLDYWE-TS-I----YTIEDLRRHVPLPYMGMVPRLDSD-------TASRWDALAASS
A0A2W0C122      G-FRESMD-RA-L----RDPADVESFTAMPSLAIIPQHRGS-------PRLL--------
A0A2W0AUU7      G-IREGMD-RA-L----RDPAEVESFTAMPSLAIIPQHHPS-------PRLL--------
A0A2W0BQL1      G-IREGMD-RA-L----RDPAEVESFTAMPSLAIIPQHHPS-------PRLL--------
A0A4Q1SDL1      L-IAEAMD-RR-I----QTVEQLDRL-GVPLVAILPRYSKE-------KRAL--------
A0A3P0XH15      L-FAETID-DT-I----RTSDDAESVVGLPSLAVIPHFEPA-------QKKG--------
A0A4R1LAZ7      L-LLESLD-DT-I----QTSEDAETVSGLTTLAVIPHFRGA-------SKKS--------
A0A3M1WQW8      L-FVEYLD-NT-V----KSTEDVDRLLGLPSLGVVPALESL-------ERKK--------
A0A3N1JHC1      L-ISERRD-NS-V----RNPGESEQYVERPELAVIPRDRLI-------AKKS--------
C1F294          L-LLESLD-DT-L----RTSEEVESIGHLPALAIVPRFVSG-------AKRK----TAYG
A0A2V9KA79      V-LAENLD-TT-F----ENAEQFQSFFDFPVLCIIPSMNLH-------NLRRKVRSEEIS
A0A522PSP1      V-AADGMD-RT-L----RDPRAVPSELGAGLLGSLPELQND-------IEIK--------
G8P085          F-LREALS-DK-L----QSVDQIERALGYQLLAIIPHISIA-------QRTD--------
A0A4Q1SGQ1      W-TAERFD-HS-V----RSLEQLEEEVGSPLLGILPEFSRR-------LKTR--------
Q1ILD9          V-VAEAVD-QS-L----KTPDDVELITSLPVIGVIPNTAVG-------RSSN--------
Q1IJZ6          F-VVETLD-DS-V----ATTTDAEELTGIAVLGVIPIVNEN-------PRVL--------
A0A2V8TCE6      F-GMESWD-NT-L----RTQEEIERFLGTPTLARIPSASLD-------PQRR--------
A0A522TBE8      L-ARDALD-QS-V----ASAEQVELLFRVPVLGLLPLLESE-------NELQ--------
Q1ITG0          F-VKESID-QT-I----SSPEDAEEMAGISTIGLIPHFSME-------GLNA--------
A0A3N5PCI5      F-IREAFD-SR-L----QTPSAVRAL-GIPFLGMLPYVGKR-------ALKG--------
A0A3M1Q0S9      F-VMEYVD-NT-I----KTPDDVRDVLQLPVLGMIPAQEPA-------TRRE--------
A0A2Z5G448      L-FLETLD-DT-I----RTSEDAEAISSLPSLAVVPRFTTA-------AKEA--------
A0A3M1VZ38      V-LAEYID-NT-I----KSPDDVRDILDLPLLGMVP-APRP-------VKKA--------
A0A4Q1SD29      F-FMEGLD-DT-V----RTSDDAEQIAHLPTLAVIPRFPIA-------ARKG--------
A0A3M1PY35      F-AAEARD-NK-V----RSVEQLGELGGLPVLGSVPHVEGP-------PRPR--------
A0A3M1VMP2      F-GAEALD-VK-L----RTASQMREITGLPLLGSIPRASAP-------PRPR--------
                                                                            

A0A2V7VMF7      ------------------------------------------------------------
A0A2V7YYV7      ------------------------------------KGNRGELITL--------------
A0A2V7Z0J5      ------------------------------------KGKRGELVTL--------------
A0A2V7Z3M4      ------------------------------------KGKRGELVAL--------------
A0A399Y5V2      ------------------------------------RRSAMLLSVK--------------
Q01X01          ------------------------------------KSQVERASLE--------------
A0A3M2D9H8      ------------------------------------REDYPPHVVA--------------
A0A2V8JK38      RKKEQN------------------------------EPANAEKSDNRSIELAPHD-----
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      -------------------ASKLLPS----------RKLFLQPRNG---NKNGRPLIMY-
A0A321LPW6      -------------------GKRGLGPKRRA------YALAAAGPAARALLASQ--AEIVE
A0A2V9R9V4      -------------------NKSLLNGRRRKDNTPELLALGSGDKASAIMQRA----RLME
A0A321LE75      -------------------SRPKLLTAKGQGA----LGANGSAPAAAGLQRAA--STLAT
A0A2V8R8U7      -------------------EKRLRGA----------EPL----KPS---DTTA--LAMV-
A0A2V8QMP4      -------------------SRRLLAR----------SGHEA--EPA---TTTA--LALI-
A0A2V8R4S3      -------------------SRRLLAR----------GSHEP--EAG---TTTA--LALI-
A0A2V8NJ55      -------------------ERSLLKS----------KNPPPN-TGK---ESTA--LALI-
A0A2V8Q7I0      -------------------DRGRLKG----------VVPATAGGPS---ETTA--LAMI-
A0A2V8S6K4      -------------------ARRLAFG----------RTAHVH-DHT---ESTA--LALI-
A0A317I2L9      -------------------IGGRLKG----------MTSANV-GPS---ESTA--LAMV-
A0A2V8LLF9      -------------------EKTKL------------IAGDAA-APA---ATTA--LTMV-
A0A352FRF4      -------------------DRTRLRG----------GEAALA-GPN---DTTA--LAMV-
A0A2V8MKV0      -------------------EKRL-------------REGEAP-TAG---ASTA--LAMV-
A0A2V8PYY8      -------------------EKRL-------------REGDAP-AAG---ASTA--LAMV-
A0A1Q7YKQ8      -------------------EQRL-RL----------KGGAQA-EHG---ESTA--LALV-
A0A352F3R7      -------------------RGRLIG-----------TGPSPE-GPS---DTTA--LALV-
A0A0B6WXT1      -------------------ERLLLKG----------KASEPE-GVA---EKTA--LALI-
A0A3B9MEU8      -------------------RGRLIGI----------SGGPPS-APS---DTTA--LAMI-
A0A2V8MHG6      -------------------RRRLLSA----------MPGSKRNGHQ---GGPE--LLLY-
A0A2V8P7N1      -------------------RRRLLSA----------MPGSKRNGHQ---GGPE--LLLN-
A0A2V8M3M6      -------------------RRRLLSA----------MPGSKRNGHQ---GGPE--LLLN-
A0A1Q7NJH5      -------------------RRRLLSA----------MPGSKRNGHQ---VGPE--LLLN-
A0A2V8PJY0      -------------------RRRLLSA----------MPGSKRNGHQ---VGPE--LLLN-
A0A1Q7Y6W9      -------------------RRKLLPS----------VGSLQIRNGKGGINQPE--LIFS-
A0A2V8NC68      -------------------KRRLLRN----------VSALQKRNGN---HPAE--LLLSH
A0A399WK13      -------------------PKRRLQL----------VAENGEPADD-N-LGSE--LLIH-
A0A352FLX4      -------------------PKRNLAA----------SGKKGALVSSNG-SGSGEVLLTN-
A0A2V8RTL7      -------------------PKRKLLL----------VGGKGEEVEEDR-LNSE--LLIF-
A0A3E0PCJ6      -------------------SKRRLLL----------VGVNESE-EP-E-PGNA--LLIS-
A0A3M1S4R8      -------------------QKRRLLL----------VGSSDNE-PAFK-NRSE--LLIY-
A0A1Q7YFI6      -------------------SRRFLPK----------MTALQKSD---N-GDHG--SLLE-
A0A136KC10      -------------------PKRRLQL----------VGEGGETPED-R-PGSE--LLIH-
A0A2V8SEX6      -------------------PKRRLLL----------VGASNEEVEDPG-NNSE--LLIS-
A0A3M2D6Y5      -------------------QRRKLLP----------VGTGEENGSQGK-AGSE--ILIY-
A0A0B6WWQ6      -------------------SRRSLSK----------AVALQT---DGT-AHPE--LLVG-
A0A3B9MK99      -------------------RRRLIGA----------SGALQKRNGH-S-DSPE--LLMN-
A0A352EX26      -------------------RRKLLGG----------PGALQKRNGH-S-GNHE--LLMN-
A0A2V8MM59      -------------------RRRLLSP----------GTSLQKRNGNGT-GSPE--LLLH-
A0A2V8PFE8      ------------------RRRRLLSS----------ATALQKRNGNTS-GTPE--LLLN-
A0A2V8PWS6      -------------------RRRLLSS----------ATALQKRNGNPG-GNPE--LLLN-
A0A2V8LCT5      -------------------PRRLLSS----------ATALQKRNGNNG-GNPE--LLLN-
A0A352FTJ9      -------------------PRRLLSS----------AASLQKRNGSNG-SNPE--LLLN-
A0A2V8G155      -------------------------------------MS--PSLYK--------------
A0A2V8HDM7      -------------------------------------IS--PSLYK--------------
A0A2V8DRT9      -------------------------------------ES-APLLDK--------------
A0A2V7VYF3      -------------------------------------TGGAPLINN--------------
A0A1F2SVH2      -------------------------------------EN--PLISD--------------
A0A2V8AJG9      -------------------------------------KD--PLMNN--------------
A0A2G6PYV5      ------------------GKITKNKV----------KQKAMATKLRQEIGLLTHL-----
A0A2V8F956      -----------------------------------------------ANTYPLISK----
A0A1F2S1W5      -----------------------------------------------HTPLIGR------
A0A1F2T595      -----------------------------------------------SPPLISE------
A0A2V8JQV5      VPPESSPVRSLRNAIEFGKRIAGSDR----------STPYGKDRPKPKIELMAWE-----
A0A2V9AC41      -------------------TRTGYVS----------KLVNSAKAELPAPTRDEDRPSVLD
A0A2V8K4L4      ---------------RRGQRPSALIP----------SVSGNNSNAGNPVELVTWQ-----
A0A2V8NCZ3      ----------------RGQGTAAVIP----------IGNGNTK---NPVELVTWQ-----
A0A2V9MAM9      ------------------------AS----------PGRSLRSDSHNATELTGWE-----
A0A2V9M454      -----------------RRPGLFHSK----------AANGANGDGGYAVELAVLK-----
A0A2V9IVR7      -----------------R----SLDR----------GGNGSADRRE-AVELTLLK-----
A0A2V9ILE2      -----------------R----SLDR----------GGNGSADRRE-AVELTLLK-----
A0A2V9LGY4      -----------------R----SLDR----------GGNGSADRRE-AVELTLLK-----
A0A2V9J4D6      -----------------GRQYGLRRK----------KNSELPASNG-QTGLAALE-----
A0A2V9L9C5      -----------------GRQYGLRRK----------KNSELPASNG-QTGLAALE-----
A0A2N9M9N1      -----------------RYG--RYFA----------RGALKPPGNG-SPGLAIMN-----
A0A2V9JEC4      -----------------RLPYSRLPR----------LRSKHPLPPS-RIELAVLE-----
A0A2V9LPQ3      -----------------RYGSSKRGG----------AQGEAQKRSE-SVAVMMLT-----
A0A348V070      RPGILDKKKKKKHDTPRPKSVSLKTE----------EGAPENDKNN-HQIELIIQR----
A0A2Z5G3A3      ----------------------FLRL----------TSSSGLDRID-AVDPVTRNVIALQ
A0A2V7UGP8      ------------------------------------AGESAGGRRL-RREPVSPAVDLVT
A0A239MKT6      ------------------------SK----------NVPASPDKQE-DAAWLIR------
A0A3E0PCN7      -------------------------N----------GFVGSLIRKT-QTKLVGENFYSLD
A0A2V8IYW3      LVAARITETGVLMPETAEIGVFVPLK----------NPIGVSEELF-DPALTGKVAAP--
G2LEI9          -------SKSSGYYSYGGETRALAKL----------ADGRPLPADF-NVGLSAFA-----
A0A317J121      -------------------RPAWRLL----------LGRESRNAGE-MVGSEVSLDTRVG
A0A2V7YW66      GAGDKPRPVRPARSAAEKRGDRKERK----------ERKRAAAAAG-APQIELVPHE---
A0A2V7Z0V0      AADDKPR-ARPGKAPAGGW-----RE----------KKKAPAAALP-PSQIELVPHE---
A0A2V8GFD4      ---------------------------------------------A-KPSPMINH-----
A0A2V8HSS5      ---------------------------------------------A-KPSPMINH-----
A0A2V8KP55      -------------------RKKEQNE----------PANAEKSDNR-SIELAPHD-----
A0A399WNU1      --------------SNHFLAKFNRHR----------NGDGDPDPAE-SRSAYADS-----
A0A2V9CG11      -------------------RQIANHK----------QANPALAMEA-GSSELVLESHLDD
A0A2V2R0I6      ----------------NGKRRALLQ------------TVAANGHEK-RIELVAQH-----
A0A2V8XAR9      ----------------SSKRQGLLQ------------GFAANGQDK-RIELVAQH-----
A0A2V8VZA0      ----------------NGKRHGLLQ------------GLSSNGHDK-RIELVAQH-----
A0A1Q7CB82      ----------------NGKRHGLLQ------------GLSSNGHDK-RIELVAQH-----
A0A2V8WIU1      ----------------NGKRHGLLQ------------GLSSNGHDK-RIELVAQH-----
A0A1Q6Y9F5      ----------------RSKRHGFFQ------------GLSSNGHDA-RIELVAQH-----
A0A2V9EVV8      ----------------SSKRHGFFQ------------GLSSNGHDA-RIELVAQH-----
A0A2V8YF91      -----------------GNRRGFLP------------SFSGNGHEK-RMELVAQH-----
A0A2V8XZK2      -----------------SKGRGVLP------------GLSSNGHER-RIELVAQH-----
A0A2V8ZTX6      -----------------SKRRSMLQ------------GFSENGHNK-RIELVAQH-----
A0A2V9BT79      -----------------HKRRGMLP------------DFSQNGHDK-RIELVAQH-----
A0A1Q8B793      ----------------RNGRRRFLRG----------LAAATNGREA-RVELVSHH-----
A0A2V9BCA0      ----------------RNGRRRFLRG----------LAAATNGREA-RVELVSHH-----
A0A2V9BWU9      ----------------RNRVPKMLK------------SGSGNGTES-RVELVSHT-----
A0A2V9DKX2      ----------------RNRVPKMLK------------SGSGNGTES-RVELVSHT-----
A0A2V9JSI3      -------------------RRAWRKG----------AGEKAASSTT-PVGLAVLK-----
A0A2V9WI32      ---------------RDRKNGHPRLS----------LGSRSSESAD-SLQLITFA-----
A0A2V8IVN9      ---------------------------------------GGSYPMV-GA-----------
A0A1F2TPT3      -------------------VTGPLAT----------N-----------------------
A0A2V8JTQ2      -------------------NGAHREL----------AGGSGHVDHA-LVSLL--------
A0A2V8UZY0      -------------------NGAARQL----------TGVGGDVKPE-LVSLL--------
A0A3N5YNR8      -------------------GSSRLLA----------SRNESGDSKT-GLPAPIS------
A0A350UEK1      -------------------GKKHRLL----------TGRSKKADAE-TQSLTLATNGLSE
A0A350UIQ4      -------------------KKGRKLL-----------------GEE-SQSLVLTNVGLGE
A0A3N6A5T6      -------------------PVGTRLL----------TAASTQSTDA-SVDAVLQGSQ---
A0A1F2Q9L4      -----GYGYGGSYGYGYGQRRGKGQP----------GRPTLAGQRP-GGDSGAGQIELVS
A0A1H5SQF5      ----------------------WAYA----------YPYAPTKKAD-AAAESEGKFAWVL
A0A3E0NV31      -------------------NWLAAKL----------KLPRRKPSRT-PPKLLEPKGD---
A0A3N5M5V0      -------------------GGSRLLA----------EKSTSGADKT-ELPARIA------
A0A2V9AEW6      ----------RHGANLLNMRRLTPSV----------PSGVESDSS--DKSPELATWK---
A0A2V8WQK6      ----------WQIPNRLPPHRAASSR----------PPESALRSSL-GDCPELATWK---
A0A2V8XIF4      ----------GQIAGRLHSHRPTRTL----------TSDTAPDSS--ANWPELATWK---
A0A3N5XQP8      ----------GANPLVLALPEQVQAD----------HRSASDQDRM-GSALARSA-----
A0A2Z5G7H4      -----------------------YRR----------PGGPSLSRAR-SPSSGVNSLAIFA
A0A2V9L5B5      -------------------GE--VRQ----------DSLEAVEPGV-ATALAPAI-----
A0A2V9LK56      -------------------RK--SGE----------ARLTKGSEAG-GKS-DIVI-----
A0A2V9L7I0      -------------------GKVPEEE----------DSLAAVPEVE-MAV-APAI-----
A0A522PPT0      -------------------SK--SLE----------HGITAIGKGS-NGLYGLAL-----
A0A2V9KCS3      LNSYFKRLPALKGPKDSEQTLGSALV----------KKNGRRNGNG-NHEIELVTWY---
A0A2U3KC61      -------------------YLRKRLK----------TVSAETEKPE-SPALVAYA-----
A0A2V9Y2R7      -------------------NLRKRLK----------TVPAADGELQ-SPTLVTYA-----
A0A372IT17      ---------------------LPRLL----------RGGGSSGVTA-AASWELQGTGS--
A0A136JPP4      -------------------KRRSRRG----------LGSETNAKA--ASNTALITLE---
A0A399WUJ8      -------------------KRLSLRG----------IAGESNGKST-AASTALITLE---
A0A2V9NGH6      --------------------------------------ESSARRRL-SLTSSREAIELVT
A0A2V9PYE6      --------------------------------------ESSARRRL-SLTSSREAIELVT
A0A2V9NL07      --------------------------------------EANP-TGL-SVAASKEAVELIT
A0A2V9QD92      --------------------------------------EANP-TGL-SVAASKEAVELIT
A0A2V9WPZ6      --------------------------------------EN----RL-IVASSKESVELVT
A0A2V9ZLH4      --------------------------------------EDGS-RRL-AVAASKESVELVT
A0A2V9RQF1      --------------------------------------DSKS-KRL-SLASSREVVELVT
A0A2V9YDK8      --------------------------------------EASNQKRL-TVASSKEAVELVT
A0A2V9V8F7      --------------------------------------EGKNENRL-IVASSKESVELVT
A0A2V9XGR9      --------------------------------------EGKNENRL-IVASSKESVELVT
A0A2V9V3Q5      --------------------------------------NGTGIGRL-TLTSSREVVELVT
A0A2V9NWS3      --------------------------------------ESNGRQRL-SLASSKEPVELVT
A0A2V9USA9      --------------------------------------EGSTGKRL-ALAASNEAVELIT
A0A2V9XW18      --------------------------------------EGPNPKRL-VIASSKEAVELVT
A0A4R1LC91      -------------------KQLPSSL----------SKGLTGPGSN-FMALQ--------
A0A3M2BZG9      YGYGYGYGYGYGYYGAEGRKRRKLKG----------ASSDEPEPDR-QIELLPHR-----
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------VK----------SLGSEINGNT-SAALITLR-----
A0A3E0PHB0      ------------------------LL----------TGGSNGRGP--STEFVALE-----
A0A3M2D491      ------------------------LP----------AGEKEQSS---SVALVTLS-----
A0A357F267      ------------------------LA----------AANGSEAVA--STALVTLD-----
A0A353C9L6      ------------------------AA----------NGNGNGGAP--STGLVTLE-----
A0A2V8RQV0      ------------------------MA----------AGNGAALSPH-AAALITLE-----
A0A2V8SJH5      -------------------ANGNGLA----------NGNGNGNSAT-ATGLITLA-----
A0A2V9QB26      -------------------RQQRDSG----------LPKRTSKQVD-SPSVELVTWY---
A0A2V9VYY4      -------------------RRLTISP----------DGERSGMLAL-VT-----------
A0A2V9KIE8      -------------------ASKQLAK----------AAPGDRVVAP-AI-----------
A0A352F549      -------------------RFFPISR----------ALQRTNGNGA-SP------ELLIN
A0A3B9MLP9      -------------------RLLPITR----------ALQRTNGNGS-GP------ELLIN
A0A3D5SQ87      -------------------RLLPITR----------ALQRTNGNGS-GP------ELLIN
A0A2V8NW86      -------------------RQQRDPG----------LPKRTSEHAD-SLSVELVTWYRKA
A0A2V8ZHL8      -----------------------SRA----------RNNGNSKPSE-TA------LALLK
A0A2V9B240      -----------------------SLT----------RNNGNSKSSG-AE------LALLK
A0A2V9CBM2      -------------------GALSL------------RENGGARKLV-PS------WYRID
A0A2V8XN17      -------------------KSLVL------------AGNGSGKNSR-S-------WHLID
A0A2V8WX45      -------------------KALVL------------KGNGTGKDAR-SS------WHRID
A0A1Q6YR79      -------------------KSLSLAG----------NGNGSGKDRR-PS------WHLID
A0A1Q7VA32      -------------------KSLSLAG----------NGNGSGKDRR-PS------WHLID
A0A2V9EY85      -------------------RFLSLAG----------NGNGPGKDPR-PS------WHLID
A0A2V9H8K0      -------------------KALIL------------EGNAAGKNSR-SF------WHRID
A0A2V9FFE5      -------------------KAFEF------------KGNGAGKNSR-SC------WHRID
A0A2V9GM43      -------------------KAFEF------------KGNVAGKNSH-SY------WHRID
A0A1F2RFI7      -------------------SRKSLPE----------DTSAPDGEKK-LH------PELI-
A0A1F2RZS3      -------------------SRQTLAE----------VTSEAANGKP-LS------LELI-
A0A1F2USE2      -------------------QTRQLES----------GAEGTTEKGL-ARGGTPHGWYRID
A0A2V9C238      -------------------GSKPL-------------ANGKPQTSA-LPSTTPR-WYRID
A0A1F2Q9F5      ---------------------LPT-------------PKRLASRSV-VPAAAPL-WHLVS
A0A1F2QQH9      ---------------------LPT-------------PKRLASRSV-LPAAAPL-WHLVS
A0A1F2QXK7      ---------------------LPT-------------PKRLASRSV-VPAAAPL-WHLVS
A0A2V9DEM9      -------------------GSKPL-------------ANGKPRTLA-LPSTTPR-WYRID
A0A2V9CYQ5      -------------------HPGSLSL----------RENGCARKLV-AS------WYRID
A0A2V9BWU8      -------------------RTLPLKS----------AHNGTASNPA-AR------WHRID
A0A2V8ZG48      -------------------HSNLLRS----------RQNGTASNPC-AC------WHRID
A0A2V8Y334      -------------------RTNHPGN----------GHNGTASNPG-AR------WHRID
A0A2V9AY68      -------------------RTNGLRH----------GHNGTASNPG-VR------WHRID
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ----------RELMLPAKLLTAGETH----------VEDPSARPKD--------------
A0A2U3JZ71      ---------DLIPHDPSR---------------------------G--------------
A0A2V8TTB0      NGAIPAPPNGAVPAADNT---------------------------D--------------
A0A1F2TCR2      ------------------------RV----------PLLS-----E--------------
A0A2N9LQU7      ------------SLRKDMRGRNHQPG----------LGGLGTMAVQ--------------
A0A2P6WFK7      ------------QQPPATSNSREAPK----------AVPLAPILLG--------------
A0A1F2V330      -IPLIPPCGGDLSPTLLAFADLHRNH----------IVMV-----T--------------
A0A2V8U914      --------EPALQKLIGTENGKQPVE----------RITW-----D--------------
A0A662EE63      ------------------------------------------------------------
A0A2V7W309      SYGRASGPQLRAVDAPPEEKPSPGIE----------LLPH-----L--------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      SAEDEDGKKKRKEEKGETENEPRSIE----------LISH-----F--------------
Q01XL7          ----LNGATSIHPLGTLVEDGQKTLE----------FATW-----Q--------------
A0A2V8ERZ5      -----------------------KHP----------LLAS-----S--------------
A0A2V8GTX0      -----------------------RHP----------LLSG-----P--------------
A0A2V8J0X9      -----------------------RVP----------VLTE-----T--------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------INAKDEAADRNGSLAKVSPD----------LLAY-----N--------------
A0A1F2U158      -----------------------KHP----------VLAS-----S--------------
A0A2V8F6S9      -----------------------KHP----------LLAS-----S--------------
A0A4Q1SCH5      ----------NKAADGTATKMGHGVR----------LITL-----R--------------
A0A2W0BGU4      ---------LLATNRSINARENGTAI----------LNVA-----A--------------
A0A2W0BVQ9      ---------LLATNRSINARENGTAL----------LNVA-----A--------------
A0A3D1ASD2      -----------RARLGPIAKGGAKAE----------LVPLGELG-D--------------
A0A2N9MK30      -----------KSRPALVAAGGAAST----------PVLLRHPDDD--------------
A0A1I6MH75      -------VGSLTTA---------QRN----------INVL-----T--------------
E8WVF6          -------LAAMSTV---------ERN----------INVL-----T--------------
A0A1H5Z7N3      -------NATGLVA----------RN----------IGVL-----A--------------
A0A2V9YHT3      -------QGRNGKGIVLRPGKRERVE----------MIAH-----S--------------
A0A1G7JVV8      -------SGSATVA---------QTN----------IGVL-----A--------------
A0A1H4T6W9      -------TGTMSVA---------QNN----------IGVL-----A--------------
I3ZEU5          -------TGSMSVA---------QSN----------IGVL-----A--------------
A0A5B9EBI2      -------PAGMSVT---------QLN----------MGVL-----T--------------
A0A239HDF6      -------VPDTSP-----------------------LPVI-----S--------------
A0A4Q0T270      -------AANLSVA---------QRN----------ISVL-----T--------------
A0A1Q3QQB6      -------SSTLTPT---------QKN----------LSVL-----S--------------
A0A3N1K1G7      -------AGNLTTA---------QRN----------ISVL-----T--------------
A0A428MDU2      -------AA-MSTA---------QRN----------ISVL-----T--------------
A0A4V2G466      -------PG-QSTT---------ARN----------IISL-----A--------------
A0A4Q7YNP3      PASRSDSIITLQSGSSTIVRNADVLD----------MAGW-----S--------------
A0A2V9MN96      ---------HLHPAGGSLITASTVDG----------PVAH-----V--------------
E8UZE1          --------------KLGKKEVAGTAD----------SLGLEPRVLQ--------------
A0A2V7V2Z1      -------------------------V----------IIKS-----G--------------
A0A2V7X2F7      -------------------------L----------IQKG-----G--------------
A0A2V7V2I1      -------------------------V----------LSNS-----H--------------
A0A2V7U3M2      -------------------------V----------IIQG-----G--------------
A0A2V7UHT0      -------------------------V----------VIKS-----G--------------
A0A2Z5FVL3      ------------RLSGHSFALPGREA----------IAAL-----K--------------
A0A1V6HR88      YGEKPAKARARKPGKGGGNGEPTQIE----------LLPH-----L--------------
A0A2V9KBD6      -----------APANLPALSIYRNRA----------LVSL-----L--------------
A0A2W0AJ66      -----------SLVEGNVPQTASKPE----------LVSF-----L--------------
A0A1Q7RBU1      -----------ARAQLNGVNGDLKPE----------MVSF-----L--------------
A0A2V9JPV9      -----------APAQLNGVNGDLKPE----------LVSV-----L--------------
A0A3E0P0A3      -----RVYGARAPAKRVDRGADLAID----------LLPH-----S--------------
A0A2V8EXP2      -------------------------D----------PLIS-----K--------------
A0A2W4RYA1      ------------------------GD----------PLMT-----G--------------
G8P0Y7          -----TNAARSRLLNKMPGTGTGPQP----------LISY-----L--------------
A0A5M8T4U7      ----------KRPELEDGGSSAQVRQ----------LTAL-----H--------------
A0A3P0X3W6      SDVPAPVAGKQPLDW------------------------------S--------------
A0A1E3Y9R6      ------------------------EA----------PLLQ-----P--------------
A0A2W4TLP2      ------------------------EA----------PLLS-----A--------------
A0A3R9WF43      --------------------AGTVGE----------CALI-----T--------------
A0A317HKM4      ------------------------------------PLLV-----Q--------------
A0A523E0N1      RSGNSRGPLASGRDAKRSTYLPTIYD----------KRPAL----A--------------
A0A523ECP2      MARDTDKHGKNMSQTRSALALSQSTK----------IASRA----K--------------
A0A2W0C122      -----------------TSKVGEAPQ----------VLSL-----T--------------
A0A2W0AUU7      -----------------TPRVGEAPQ----------IMCL-----T--------------
A0A2W0BQL1      -----------------TPRVGEVPQ----------IMCL-----T--------------
A0A4Q1SDL1      ---------------------DGIQH----------VRTL-----N--------------
A0A3P0XH15      ----VSAAGTAAAEAERERMARVSPD----------LISY-----T--------------
A0A4R1LAZ7      -----------SAERDDGRPESLSPD----------LVAY-----L--------------
A0A3M1WQW8      -RLALPRWSRERRTTKPILILD-----------------------D--------------
A0A3N1JHC1      -----------KAHPQMRLNGAGSKD----------VHPILEHWKE--------------
C1F294          SYGAEKR----PKEPVAEKEDQISRD----------LLTL-----L--------------
A0A2V9KA79      PRAPARRHTGEQRVSIASVPDRPGKH----------SLTS-----Q--------------
A0A522PSP1      -SLLTPASVRGNDEV---------------------------------------------
G8P085          -NKGDAP----AFDASQ--------M----------LVAY-----N--------------
A0A4Q1SGQ1      -RRASWREILMRRESVSTSPLFMSRT----------GIAD-----Q--------------
Q1ILD9          -GRPGRT----AVKQEAM-------G----------IDVL-----T--------------
Q1IJZ6          -RAAGRA----KANGSNGSKPG---R----------PTAM-----V--------------
A0A2V8TCE6      -GGPAWG----TGEI----------D----------LMSH-----H--------------
A0A522TBE8      -LAGGGS----EEDR---------------------------------------------
Q1ITG0          -LATENQ----SVLAR---------V----------PLAA-----D--------------
A0A3N5PCI5      -R-----------------------S----------LLLT-----H--------------
A0A3M1Q0S9      -RRRSAS----RGEQAAEIEDP---S----------LISA-----R--------------
A0A2Z5G448      -RSTYGQ----QAKPITPADSQFPSD----------LVSY-----L--------------
A0A3M1VZ38      -HGEEPV----RCDP----------A----------VITA-----E--------------
A0A4Q1SD29      -TDPQPQ----KVSP----------D----------LVSL-----L--------------
A0A3M1PY35      -LVFSRK----RREG----------A----------SPVV-----A--------------
A0A3M1VMP2      -LVFSRK----GRSR----------S----------RPVI-----P--------------
                                                                            

A0A2V7VMF7      -----------------------------------------DAEHLV-TEAYQNLRTALL
A0A2V7YYV7      -----------------------------------------DAHSHA-SEAYRALRTSLL
A0A2V7Z0J5      -----------------------------------------DAQSHA-AEAYRALRTGIL
A0A2V7Z3M4      -----------------------------------------DAQSHA-SEAYKALRTGIL
A0A399Y5V2      -----------------------------------------DPASTT-AEAYRSVRTNLQ
Q01X01          -----------------------------------------QPASHV-SESFRATLASIL
A0A3M2D9H8      -----------------------------------------QPRSPV-TEAFRSVRTNLE
A0A2V8JK38      -----------------------------------------EPSSVI-AESYRSVRTSFF
A0A2V9IXG5      -----------------------------------------FGLHQI-RESYNVLRTELL
A0A2V9J2P4      -----------------------------------------FGLHQI-RESYNVLRTELL
A0A1Q7RLS4      -----------------------------------------GTHSAF-KEAYQTLRTSLL
A0A2V2R525      D----------------------------------------DAHSRL-AEVYRKLRTTVL
A0A321LPW6      C----------------------------------------DSASSA-AEAYRVLRTSVL
A0A2V9R9V4      F----------------------------------------DGRSPA-SEAYRALRTALL
A0A321LE75      L----------------------------------------DTRSSA-AEAYRVLRTSVL
A0A2V8R8U7      T----------------------------------------DVRSPI-AESYRHLRTSLL
A0A2V8QMP4      E----------------------------------------DVRSPV-AEAYRHLRTSLL
A0A2V8R4S3      E----------------------------------------DVRSPV-AEAYRHLRTSLL
A0A2V8NJ55      E----------------------------------------DVRSPI-AEAYRHLRTSLL
A0A2V8Q7I0      D----------------------------------------DVRSPI-AESYRHLRTSLL
A0A2V8S6K4      E----------------------------------------EVRSPV-AEAYRHLRTSLL
A0A317I2L9      D----------------------------------------DVRSPV-AESYRHLRTSLL
A0A2V8LLF9      N----------------------------------------DVRSPI-AESYRHLRTSLL
A0A352FRF4      K----------------------------------------DIRSPI-AESYRHLRTSLL
A0A2V8MKV0      E----------------------------------------DVRSHV-AESYRHLRTSLL
A0A2V8PYY8      E----------------------------------------DVRSHV-AESYRHLRTSLL
A0A1Q7YKQ8      A----------------------------------------DARSSI-AEAYRHLRTSIL
A0A352F3R7      H----------------------------------------DARSPI-AESYRHLRTSLL
A0A0B6WXT1      S----------------------------------------DVRSPI-TEAYRHLRTQLL
A0A3B9MEU8      T----------------------------------------DVRSPI-AEAYRHLRTSLL
A0A2V8MHG6      G----------------------------------------SQRSAL-AESYRQLRTLVL
A0A2V8P7N1      G----------------------------------------SQRSAL-AESYRQLRTLVL
A0A2V8M3M6      G----------------------------------------SQRSAL-AESYRQLRTLVL
A0A1Q7NJH5      S----------------------------------------SQRSAL-AESYRQLRTLVL
A0A2V8PJY0      S----------------------------------------SQRSAL-AESYRQLRTLVL
A0A1Q7Y6W9      T----------------------------------------DGRSSL-AEAYRQLRTSVL
A0A2V8NC68      T----------------------------------------DGQSPL-AEAYRQLRTSVL
A0A399WK13      A----------------------------------------DPRSSL-AEAYRQLRTSIL
A0A352FLX4      I----------------------------------------EKRSPV-AEAYRHLRTSIL
A0A2V8RTL7      A----------------------------------------DPRSSL-SESYRQLRTSIL
A0A3E0PCJ6      N----------------------------------------DSRSST-AEAYRQLRTSIL
A0A3M1S4R8      D----------------------------------------NSRSSSLSEAYRQLRTSIL
A0A1Q7YFI6      P----------------------------------------DTRSPM-AEAYRQLRTSVL
A0A136KC10      A----------------------------------------DPRSSL-AEAYRQLRTSIL
A0A2V8SEX6      A----------------------------------------DSRSAL-AEAYRQLRTSIL
A0A3M2D6Y5      N----------------------------------------SSNSSL-SEAYRQLRTSIL
A0A0B6WWQ6      D----------------------------------------GGESGL-AETYRQLRTSVL
A0A3B9MK99      V----------------------------------------DGHSPL-AEAYRHLRTSVL
A0A352EX26      V----------------------------------------DSRSPL-AESYRHLRTSLL
A0A2V8MM59      V----------------------------------------TGRSPL-AESYRQLRTSVL
A0A2V8PFE8      V----------------------------------------NGRSAL-AESYRQLRTSVL
A0A2V8PWS6      V----------------------------------------NGRSAL-AESYRQLRTSVL
A0A2V8LCT5      I----------------------------------------TGRSAL-AEAYRQLRTSVL
A0A352FTJ9      I----------------------------------------NGRSAL-AEAYRQLRTSVL
A0A2V8G155      -----------------------------------------RAPGNF-AEALRTIRTNVL
A0A2V8HDM7      -----------------------------------------RAPGNF-AEALRTIRTNVL
A0A2V8DRT9      -----------------------------------------GATPNF-AEAMRTVRTNVL
A0A2V7VYF3      -----------------------------------------GVPAHF-SEAFRTIRTNVL
A0A1F2SVH2      -----------------------------------------GVPSNF-SESFRNIRTNLL
A0A2V8AJG9      -----------------------------------------GVPANF-AEAFRAIRTNVL
A0A2G6PYV5      -----------------------------------------KPNDAF-SESYRHLRTNIQ
A0A2V8F956      -----------------------------------------TAPPNF-SEAIRDLRTNVL
A0A1F2S1W5      -----------------------------------------GVSALF-TESFRSIRTNVL
A0A1F2T595      -----------------------------------------GVPGVF-SECFRSIRTNVL
A0A2V8JQV5      -----------------------------------------KPFSLF-AECFRTTAASVL
A0A2V9AC41      H----------------------------------------HPLSLV-AEAYRSLRSSLL
A0A2V8K4L4      -----------------------------------------RQGSLI-AESFRAVLTSIM
A0A2V8NCZ3      -----------------------------------------RQGSLI-AESFRTVLTSIM
A0A2V9MAM9      -----------------------------------------NKFNAL-SESFRCLVTSIL
A0A2V9M454      -----------------------------------------KPGAAI-SEAFRTLRTSVL
A0A2V9IVR7      -----------------------------------------RPASEL-AEAYRSMRTAIL
A0A2V9ILE2      -----------------------------------------RPASEL-AEAYRSMRTAIL
A0A2V9LGY4      -----------------------------------------RPASEL-AEAYRSMRTAIL
A0A2V9J4D6      -----------------------------------------HPASSV-AESYRALRTSIM
A0A2V9L9C5      -----------------------------------------HPASSV-AESYRALRTSIM
A0A2N9M9N1      -----------------------------------------APGSEM-AESFRVLRTSIL
A0A2V9JEC4      -----------------------------------------NSSLDV-AEAFRILRTSIL
A0A2V9LPQ3      -----------------------------------------EPASAV-AESYRALRSAIL
A0A348V070      -----------------------------------------EPRCIQ-SEAFRSIRTSLL
A0A2Z5G3A3      -----------------------------------------QPNSGY-VEALRAIRTSLY
A0A2V7UGP8      LR---------------------------------------DPASPA-SEAYKTLRTSLL
A0A239MKT6      -----------------------------------------APKSKS-AESYRQIRTAIL
A0A3E0PCN7      R----------------------------------------FARPVM-VEAFNQIRTSLM
A0A2V8IYW3      -----------------------------------------GMLPVA-TEQYRRLAAILH
G2LEI9          -----------------------------------------LSASPI-GEAYRQLRTSIL
A0A317J121      FWDSA------------------------------------PASQLL-ADSFRVTLASLM
A0A2V7YW66      -----------------------------------------RPRTLI-SEAYRSLRTGLL
A0A2V7Z0V0      -----------------------------------------RPRTLI-SESYRSLRTALM
A0A2V8GFD4      -----------------------------------------HVPGMF-PEALRAIRTNVL
A0A2V8HSS5      -----------------------------------------HVPGMF-PEALRAIRTNVL
A0A2V8KP55      -----------------------------------------EPSSVI-AESYRSVRTSFF
A0A399WNU1      -----------------------------------------FNNPLI-AEAFHQLRTSLL
A0A2V9CG11      RPELAAWN---------------------------------RKSSLS-ADCYRATVTSIL
A0A2V2R0I6      -----------------------------------------LPKSQM-SEAFRALRTSIL
A0A2V8XAR9      -----------------------------------------LPKSQI-SEAFRALRTSIL
A0A2V8VZA0      -----------------------------------------LPKSQM-SEAFRALRTSIL
A0A1Q7CB82      -----------------------------------------LPKSQM-SEAFRALRTSIL
A0A2V8WIU1      -----------------------------------------LPKSQM-SEAFRALRTSIL
A0A1Q6Y9F5      -----------------------------------------LPKSQM-SEAFRALRTSIL
A0A2V9EVV8      -----------------------------------------LPKSQM-SEAFRALRTSIL
A0A2V8YF91      -----------------------------------------LPKSQI-SEAFRALRTSIL
A0A2V8XZK2      -----------------------------------------LPKSQM-SEAFRALRTSIL
A0A2V8ZTX6      -----------------------------------------LPKSQV-SEAFRALRTSIL
A0A2V9BT79      -----------------------------------------LPKSQM-SEAFRVLRTSIL
A0A1Q8B793      -----------------------------------------LPKSQM-SEAFRALRTALL
A0A2V9BCA0      -----------------------------------------LPKSQM-SEAFRALRTALL
A0A2V9BWU9      -----------------------------------------LPQSQI-SEAFRALRTSLL
A0A2V9DKX2      -----------------------------------------LPQSQI-SEAFRALRTSLL
A0A2V9JSI3      -----------------------------------------HPASPL-AESYRALRTSVL
A0A2V9WI32      -----------------------------------------RPRSEL-AESYRALRTSIM
A0A2V8IVN9      -----------------------------------------HVTTNF-NEAFRAVRTNII
A0A1F2TPT3      -----------------------------------------GVPPEF-SEELRRIRTNLV
A0A2V8JTQ2      -----------------------------------------QPMSLA-AESYKTVLTSLL
A0A2V8UZY0      -----------------------------------------QPLSLA-AESYRAMLTPLM
A0A3N5YNR8      -----------------------------------------PARFRV-WEAYRSLRTSIL
A0A350UEK1      KLELVTLQ---------------------------------RRLSAT-AESFRAVLTSIL
A0A350UIQ4      KLELVTVQ---------------------------------RRLSAV-AESFRAALTSIM
A0A3N6A5T6      -----------------------------------------DMRSRV-WEAYRSLRTSLL
A0A1F2Q9L4      HF---------------------------------------KPRLAV-SEAYRSLRTALL
A0A1H5SQF5      K----------------------------------------APRSVV-AEACRQIRTAIL
A0A3E0NV31      -----------------------------------------RRSNIV-RESYRSVRTSLL
A0A3N5M5V0      -----------------------------------------PTRFRV-WEAYRSLRTSIL
A0A2V9AEW6      -----------------------------------------RKPSLI-AECVRTTLTSIL
A0A2V8WQK6      -----------------------------------------RKPSLL-AECTRTTLISIL
A0A2V8XIF4      -----------------------------------------RKPSFL-AECARTTLTSIL
A0A3N5XQP8      -----------------------------------------ALDSPM-WEAYRRLRTCLL
A0A2Z5G7H4      -----------------------------------------HPNSPY-TEALRGLRTALL
A0A2V9L5B5      -----------------------------------------QTHAEV-LEAFRSLRTSIL
A0A2V9LK56      -----------------------------------------RRDPAA-VEAFRSLRTSIL
A0A2V9L7I0      -----------------------------------------QSHADA-VEAFRSLRTSIL
A0A522PPT0      -----------------------------------------QKDPTA-VEAFRSLRTSIL
A0A2V9KCS3      -----------------------------------------RKPSLL-AESFRTTLASIL
A0A2U3KC61      -----------------------------------------RPKSEA-AEAYRALRTSIL
A0A2V9Y2R7      -----------------------------------------RPKSQA-AESYRALRTSIL
A0A372IT17      -----------------------------------------ASGSPF-SESLRTLRASLM
A0A136JPP4      -----------------------------------------ERHSPM-AEAYRHLRTSLL
A0A399WUJ8      -----------------------------------------DRHSPM-AEAYRHLRTSLL
A0A2V9NGH6      QS---------------------------------------RPQSQM-AEAYRALRTALL
A0A2V9PYE6      QS---------------------------------------RPQSQM-AEAYRALRTALL
A0A2V9NL07      IS---------------------------------------RPQSQM-SESYRALRTSLL
A0A2V9QD92      IS---------------------------------------RPQSQM-SESYRALRTSLL
A0A2V9WPZ6      KS---------------------------------------RPQSQM-AESYRALRTSLL
A0A2V9ZLH4      QS---------------------------------------RPQSQM-AESYRALRTSLL
A0A2V9RQF1      QS---------------------------------------RPQSQM-AESYRALRTSLL
A0A2V9YDK8      QA---------------------------------------RPQSQM-AESYRALRTSLL
A0A2V9V8F7      KS---------------------------------------RPQSQM-AESYRALRTSLL
A0A2V9XGR9      KS---------------------------------------RPQSQM-AESYRALRTSLL
A0A2V9V3Q5      QV---------------------------------------RPQSQM-AESYRALRTSLL
A0A2V9NWS3      QS---------------------------------------RPQSQM-AESYRALRTSLL
A0A2V9USA9      QV---------------------------------------RPQSQM-AESYRALRTSLL
A0A2V9XW18      QV---------------------------------------RPQSQM-AESYRALRTSLL
A0A4R1LC91      -----------------------------------------EPRSAY-TEAVRALRTSLL
A0A3M2BZG9      -----------------------------------------KPRLAV-CEAYRSLRTALL
A0A1Q7N5R7      -----------------------------------------EQVLQV-IETMRSVRLSLL
A0A3M1SIV3      -----------------------------------------ETSSAT-AEAFRHLRTSLL
A0A3E0PHB0      -----------------------------------------DNRSGM-AEAYRHLRTSLL
A0A3M2D491      -----------------------------------------SKQSPL-AEAFRHLRTSLL
A0A357F267      -----------------------------------------ERNSPM-AEAYRHLRTSLL
A0A353C9L6      -----------------------------------------ERHSPM-AEAYRHLRTSLL
A0A2V8RQV0      -----------------------------------------ERNSPM-AEAYRHLRTSLL
A0A2V8SJH5      -----------------------------------------ERRSPM-AEAYRHLRTSLL
A0A2V9QB26      -----------------------------------------RKASLI-AESFRSLLTSIL
A0A2V9VYY4      ----YE-----------------------------------RPKSEA-AEAYRALRTSIL
A0A2V9KIE8      -----------------------------------------QTTAVG-KESFRTLRTSIL
A0A352F549      G----------------------------------------TGSSVQ-AEAYKHLRTSIL
A0A3B9MLP9      S----------------------------------------RGPTLQ-AEAYKHLRTSIL
A0A3D5SQ87      S----------------------------------------RGPTLQ-AEAYKHLRTSIL
A0A2V8NW86      SLIAESYRSLLTSILFSGSNGLPERTSKQADSLSVELVTWYRKASLI-AESYRSLLTSIL
A0A2V8ZHL8      Q-----------------------------------------PSSAL-AESFRTLLTSVV
A0A2V9B240      E-----------------------------------------PSSAL-AESFRTLLTSVV
A0A2V9CBM2      V---HA-----------------------------------TRHAPL-VEAFRSLRASIL
A0A2V8XN17      R---DG-----------------------------------AQHAAL-GEAFRSLRTSVL
A0A2V8WX45      L---DG-----------------------------------TQHGAL-VEAFRSLRTSVL
A0A1Q6YR79      R---DG-----------------------------------TQHAAL-GEAFRSLRTSVL
A0A1Q7VA32      R---DG-----------------------------------TQHAAL-GEAFRSLRTSVL
A0A2V9EY85      R---DG-----------------------------------TQHAAL-GEAFRSLRTSVL
A0A2V9H8K0      R---DG-----------------------------------TQHAAL-VEAFRSLRTSVL
A0A2V9FFE5      R---DE-----------------------------------TQHASL-VEAFRNLRTSVL
A0A2V9GM43      R---DE-----------------------------------TQHASL-VEAFRNLRTSVL
A0A1F2RFI7      ----AG-----------------------------------DGTNPL-SEAYRSLRTSVL
A0A1F2RZS3      ----GA-----------------------------------NGNAAL-SEVYRSLRTSVL
A0A1F2USE2      E---LD-----------------------------------PQRSTL-AEAFRSLRTSVL
A0A2V9C238      V---EA-----------------------------------TQQSAL-AEAFRSLRTSVL
A0A1F2Q9F5      G---NG-----------------------------------EGSTKL-GEAFRSLRTSVL
A0A1F2QQH9      G---NG-----------------------------------EGSTKL-GEAFRSLRTSVL
A0A1F2QXK7      G---NG-----------------------------------EGSTKL-GEAFRSLRTSVL
A0A2V9DEM9      A---EA-----------------------------------TQQSAL-AESFRSLRTSVL
A0A2V9CYQ5      V---HA-----------------------------------TRHAPL-VEAFRSLRASIL
A0A2V9BWU8      QVDRGE-----------------------------------KPQAAL-VEAFRSLRASVL
A0A2V8ZG48      Q---GG-----------------------------------KRHAAL-VEAFRSLRASVL
A0A2V8Y334      Q---SG-----------------------------------KPQPAL-VEAFRSLRASVL
A0A2V9AY68      Q---GG-----------------------------------KPQAAL-VEAFRSLRASVL
A0A257VBK0      ------------------------------------------TQKVS-AEAFQTLRTAMV
A0A2V7XDY0      ------------------------------------------NVHFV-TEAYQNLRTALI
A0A350UQT3      -----------------------------------------RQFSTY-EEAVRTIRSSVL
A0A2U3JZ71      -----------------------------------------TSLNSF-QEAIRTLRNSIL
A0A2V8TTB0      -----------------------------------------QALSNY-EEAIRTLRTSIL
A0A1F2TCR2      -----------------------------------------QVPHDF-GEAFRSLRTSLV
A0A2N9LQU7      -----------------------------------------RPASLL-AESYRVLCNSLL
A0A2P6WFK7      -----------------------------------------SPRSQA-AEAFRGLRTSLL
A0A1F2V330      -----------------------------------------DPHSVA-SEQCRMLALKTR
A0A2V8U914      -----------------------------------------KRFSKM-SEAFRATVASIL
A0A662EE63      ------------------------------------------NSRAL-REAFQTLRTALM
A0A2V7W309      -----------------------------------------DARSPV-SEAYRAFRTSLL
A0A2V8TLH7      ------------------------------------------TRRAV-REAYQTLRTSLL
A0A1Q7ZJT1      ------------------------------------------THSAF-KEAYQTLRTSLL
A0A2V8VC99      ------------------------------------------TLSAV-KEAYQTLRTSLL
A0A348UZU3      -----------------------------------------APDSTF-AESYRSLRTALL
Q01XL7          -----------------------------------------NKSSIL-AESFRQTLTSIL
A0A2V8ERZ5      -----------------------------------------HVPHDF-GESFRSLRTSLL
A0A2V8GTX0      ------------------------------------------VPHDF-GEAFRALRTALV
A0A2V8J0X9      ------------------------------------------VPHDF-GEAFRSLRTSLV
A0A523DUV7      ------------------------------------------NPSVI-TESYRTLRASLL
A0A372IRG7      -----------------------------------------EPQSIV-AEGFRSLRSSIL
A0A1F2U158      -----------------------------------------HAPHDF-SEAFRSLRTSIA
A0A2V8F6S9      -----------------------------------------RVPHDF-GESFRALRTSLV
A0A4Q1SCH5      -----------------------------------------EPRSRA-AESYRTLRNSVL
A0A2W0BGU4      -----------------------------------------QATSEQ-SEAYRALRTSVL
A0A2W0BVQ9      -----------------------------------------QTTSEQ-SEAYRALRTSVL
A0A3D1ASD2      -----------------------------------------RYASGY-DEAVRTLRNSIL
A0A2N9MK30      -----------------------------------------RLLAGF-GEAVRTLRNSIL
A0A1I6MH75      -----------------------------------------QPKSQF-SESFRALRTSLL
E8WVF6          -----------------------------------------QPKSQF-TEAFRSLRTALL
A0A1H5Z7N3      -----------------------------------------APKSQF-AESFRGLRTSLL
A0A2V9YHT3      -----------------------------------------HPKSEI-AESYRALRTSIL
A0A1G7JVV8      -----------------------------------------TSKSQF-SEAFRSLRTALL
A0A1H4T6W9      -----------------------------------------TSKSQF-SEAFRSLRTSLL
I3ZEU5          -----------------------------------------TSKSQF-SEAFRSLRTSLL
A0A5B9EBI2      -----------------------------------------MPKSQF-AEAFRSLRTSIL
A0A239HDF6      -----------------------------------------QPKSQF-TESFRALRTALL
A0A4Q0T270      -----------------------------------------QPKSQF-AESFRSLRTSLL
A0A1Q3QQB6      -----------------------------------------QPKSQF-TESFRALRTSLL
A0A3N1K1G7      -----------------------------------------QPKSQF-AESFRALRTSLL
A0A428MDU2      -----------------------------------------QPKSQF-AEAFRSLRTALL
A0A4V2G466      -----------------------------------------QPKSQF-AEAFRSLRTALL
A0A4Q7YNP3      -----------------------------------------SHFSVV-AEAYRSTTFSIL
A0A2V9MN96      -----------------------------------------RPKSEA-AESYRALRTSIL
E8UZE1          -----------------------------------------FPQSHF-AESFRVLRSALL
A0A2V7V2Z1      ------------------------------------------VESPL-ADGYRLLRTSLS
A0A2V7X2F7      -----------------------------------------STQSTF-AEAYRVIRTSLN
A0A2V7V2I1      ------------------------------------------QQGPF-MEGYRVLRMALS
A0A2V7U3M2      ------------------------------------------VESPL-ADGYRLLRTSLT
A0A2V7UHT0      ------------------------------------------AETPL-ADGYRLLRTSLT
A0A2Z5FVL3      -----------------------------------------DPHSAY-VEALRALRTTLL
A0A1V6HR88      -----------------------------------------RPRMPV-AEAYRALRTALL
A0A2V9KBD6      -----------------------------------------EPMSLA-AESYRSVLTSLL
A0A2W0AJ66      -----------------------------------------QPLSPA-AESYRALLTSIL
A0A1Q7RBU1      -----------------------------------------QPLSLA-AESYRALLTSIL
A0A2V9JPV9      -----------------------------------------QPLSLA-AESYRAILTSIL
A0A3E0P0A3      -----------------------------------------QPRLPA-SEAYRALRTATL
A0A2V8EXP2      -----------------------------------------GVPANF-SEAFRAVRTNVL
A0A2W4RYA1      -----------------------------------------PVPAGF-AEALRMLRTNLL
G8P0Y7          -----------------------------------------EPRSEI-AEAYRALRTSIL
A0A5M8T4U7      -----------------------------------------SPKSLA-GEAYRGLRSSLL
A0A3P0X3W6      -----------------------------------------RTQDAY-TEAIRTMRSLVL
A0A1E3Y9R6      -----------------------------------------DAPAAF-SEAIRAVRTAVL
A0A2W4TLP2      -----------------------------------------DAPPAF-AEAIRAVRTAVL
A0A3R9WF43      -----------------------------------------NPYSPF-SESFRTLRTSIL
A0A317HKM4      -----------------------------------------GAPARL-TELFQAARTNLI
A0A523E0N1      -----------------------------------------ENRDAL-SERFRFLRGSML
A0A523ECP2      -----------------------------------------EDMSLI-AERFKFLRGSLL
A0A2W0C122      -----------------------------------------EPRTAI-AEAYRSLGTSIL
A0A2W0AUU7      -----------------------------------------EPRTAA-AEACRALGTSVL
A0A2W0BQL1      -----------------------------------------EPRTAA-AEACRALGTSVL
A0A4Q1SDL1      -----------------------------------------APRSAY-SEAMRGLRASLT
A0A3P0XH15      -----------------------------------------EPQSYV-SEGFRTLRSSIL
A0A4R1LAZ7      -----------------------------------------EPHSVI-AESFRNLRSTIL
A0A3M1WQW8      -----------------------------------------QRRSSF-AEAFRSLRTSVL
A0A3N1JHC1      -----------------------------------------ADKTFL-TETYRSAGASIL
C1F294          -----------------------------------------EPQSIV-AEGFRTLRSSIL
A0A2V9KA79      -----------------------------------------PPPSIA-TDQYNILAMKIR
A0A522PSP1      ------------------------------------------DGTPF-AESLLGIRSTLL
G8P085          -----------------------------------------SPLSVN-AEAFRNLRNALL
A0A4Q1SGQ1      -----------------------------------------ARQEIF-VEALCSLRTSLL
Q1ILD9          -----------------------------------------RPNSQF-SESFRTLRTSIM
Q1IJZ6          -----------------------------------------YEQAMA-TEAFRSLRTTLL
A0A2V8TCE6      -----------------------------------------HPSSPL-AESFRDLRTALS
A0A522TBE8      -----------------------------------------EARHPY-HEAIVSLQSAIL
Q1ITG0          -----------------------------------------RPQSKL-AEAFRALRTSLL
A0A3N5PCI5      -----------------------------------------GVPAPY-AEACRALRTNVL
A0A3M1Q0S9      -----------------------------------------APLSPV-AEAYRELRTAVL
A0A2Z5G448      -----------------------------------------TPQTVG-AEAFRTLRSSIL
A0A3M1VZ38      -----------------------------------------MPLSPA-AEAYRELRTAVL
A0A4Q1SD29      -----------------------------------------EPQSIA-AESFRTLRSSIL
A0A3M1PY35      -----------------------------------------PGAHSV-EEAFRTLRSSLL
A0A3M1VMP2      -----------------------------------------EEQMDV-EEAFRALRSSIL
                                                                 :          

A0A2V7VMF7      F--ARKDDA-GQVVLITGTAPQEGKTTTLVNLAKLLAG-S-GERTIVIDCDLRRAQIHQR
A0A2V7YYV7      F--SAIDRE-LKEIVVTSAEVGEGKSRTAANLAIVLAQ-A-GHWTLLIDADFRRPAQHRM
A0A2V7Z0J5      F--SGVERS-VKQLIVTSAEMGEGKSRTAANLAVVLAQ-A-GYKTLLMDADFRRPAQHRI
A0A2V7Z3M4      F--SGINHR------LXXXGSGEGKSRTAANLSVVLAQ-A-GHQTLLIDADFRRPSQHRM
A0A399Y5V2      F--SLLDSG-SRVVLVTSPSASEGKSTTAANIAVVLAQ-S-GKSVIIVDCDLRRPRVHKF
Q01X01          S--SSHNGDHPHVLVVTSSRPMEGKTTVVSNLGIALAE-I-GNRVLLIDGDLRRPRLHKV
A0A3M2D9H8      F--VEIDRP-LKTLLIGSPGPDEGKTTVAVNLAIVMAQ-G-GNRVLLMDTDLRQPQVHER
A0A2V8JK38      L--SSGSAP-TRSVVITSAVPGEGKTVTAVNTAVIVAQ-T-GARVILIDADMRRPRMHKI
A0A2V9IXG5      F--NKNLRQ-HKVIMVTSSLPEEGKTTVTMNLAKTLAA-A-GDRTMVVDFDLRKARLRSI
A0A2V9J2P4      F--NKNLRQ-HKVIMVTSSLPEEGKTTVTMNLAKTLAA-A-GDRTMVVDFDLRKARLRSI
A0A1Q7RLS4      F--SRKSRG-ANTVLITSAGPQEGKSCTTVNVARTLAT-A-GEKVIIVDCDLRRPAIHTR
A0A2V2R525      L--SRPGKT-PKTLLVTSSMPAEGKTTTAVNMATILAQ-T-GASVLIIDADMRQPTLHEI
A0A321LPW6      L--CAAGSP-PRTILVTSGQQGEGKTTTVINTAVSLAQ-L-GAKVLIIDCDLRRPSAHKL
A0A2V9R9V4      L--SAAGNP-PKTILVTSVRMEEGKTTTATNTAIALAQ-L-GASVLLIDCDMRNPSVHDV
A0A321LE75      L--STAGNP-PKTILITSGQPGEGKTFTAINTAISLAQ-L-GASVLIVDCDLRKPSTHKA
A0A2V8R8U7      L--SSAGTP-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GADVLIIDCDLRRPRLHSH
A0A2V8QMP4      L--SSAGQP-PKTVLVTSSQPSEGKTTTVVNIATMLAQ-T-GADVLILDCDLRRPRVHAH
A0A2V8R4S3      L--SSAGQP-PKTVLVTSSQPSEGKTTTVVNIATMLAQ-T-GADVLILDCDLRRPRVHAH
A0A2V8NJ55      L--SSAGQP-PKTILVTSSQPSEGKTTTAVNTAVMLAQ-T-GAEVLIIDCDLRRPRIHTH
A0A2V8Q7I0      L--SSAGQP-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GVDVLIIDCDLRRPRLHAQ
A0A2V8S6K4      L--SSAGQP-PKTMLVTSSQPSEGKTTTAVNTAMMLAQ-T-GAEVLILDCDLRRPRVHMH
A0A317I2L9      L--SSAGQP-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GADVLIIDCDLRRPRLHAQ
A0A2V8LLF9      L--SSAGMQ-PRTILVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHSQ
A0A352FRF4      L--SSAGTA-PRTILVTSSQPSEGKTTTAINTAFILAQ-T-GAEVLIIDCDLRRPRLHAH
A0A2V8MKV0      L--SSAGQA-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHSN
A0A2V8PYY8      L--SSAGQA-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHSN
A0A1Q7YKQ8      L--SSAGQP-PKTILVTSSQPSEGKTTTAVNTAVMMAQ-T-GADVLIVDCDLRRPRLHAQ
A0A352F3R7      L--SSAGQP-PKTILVTSSQPSEGKTTTTINTAFMLAQ-T-GAEVLVVDCDLRRPRLHAH
A0A0B6WXT1      L--STAGQP-PRTVLLTSSQPSEGKTTTAVNMAMMLAQ-M-GAEVLLLDCDLRRPRVHVH
A0A3B9MEU8      L--SSAGQP-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHAH
A0A2V8MHG6      L--SSAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSI
A0A2V8P7N1      L--SSAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVIIVDGDMRRPRLHSI
A0A2V8M3M6      L--SSAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSI
A0A1Q7NJH5      L--SSAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSI
A0A2V8PJY0      L--SSAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSI
A0A1Q7Y6W9      L--STAGRA-PKSLLVTSSQPAEGKTTTATNIAISLAQ-T-GASVLIIDADMRRPRLHTI
A0A2V8NC68      L--SSAGGA-PQTLLVTSSQPAEGKTTTVVNTATILAQ-T-GATVVVIDADMRRPRLHSI
A0A399WK13      L--STAGHA-PKSLLITSSLPSEGKTTTATNTAISLAQ-T-GASVVIIDADMRRPRLHSV
A0A352FLX4      L--STAGRP-PRTLLITSSVPSEGKTTTAVNTAISLAQ-T-GAKVLIIDADMRRPRLHSI
A0A2V8RTL7      L--STAGHA-PKSLLITSSLPSEGKTTTATNTAISLGQ-T-GAKVLIIDADMRRPRLHSV
A0A3E0PCJ6      L--STAGHA-PKSLLITSSLPAEGKTTTAVNTAISLAQ-T-GAKVLVIDADMRRPRVHSF
A0A3M1S4R8      L--SVAGHA-PKSLLVTSSLPAEGKTTTAVNTAITLAQ-T-GAKVLVIDADMRRPRIHSI
A0A1Q7YFI6      L--SSAGGA-PQALLVTSGVPSEGKTTTALNMAQIMAQ-T-GATVLLIDADMRRPMLHTL
A0A136KC10      L--STAGHA-PKSLLITSSLPSEGKTTTATNTAISLAQ-T-GAQVLIIDADMRRPRLHSV
A0A2V8SEX6      L--STAGHA-PKSLLITSSLPSEGKTTTATNTAISLAQ-T-GAKVLIIDADMRRPRLHSV
A0A3M2D6Y5      L--SVAGHA-PRSLLVTSSLPSEGKTTTAVNTAISLAQ-T-GAKVLIVDADMRRPRVHSI
A0A0B6WWQ6      L--STPGHA-PKTLLVASSAEAEGKSTVAVNVALILAQ-T-GAQVLLIDADMRRPKLHEL
A0A3B9MK99      L--STAGRA-PRSLLVTSSLPGEGKTTTAVNTAVSLAQ-T-GASVVIIDADMRRPRLRSI
A0A352EX26      L--STAGRA-PRSLLVTSSLPGEGKTTTAVNTAVSLTQ-T-GASVVLIDADMRRPRMRSI
A0A2V8MM59      L--STAGRA-PKTLLVTSSLPGEGKTTTAVNTAISLAQ-T-GASVVIIDADMRRPRLRSI
A0A2V8PFE8      L--STAGRA-PKTLLITSSLPGEGKTTTAVNTAITLAQ-T-GASVVIIDADMRRPRLRSI
A0A2V8PWS6      L--STAGRA-PKTLLITSSLPGEGKTTTAVNTAITLAQ-T-GASVVIIDADMRRPRLRSI
A0A2V8LCT5      L--STAGRA-PKTLLVTSSLPGEGKTTTAVNTAISLAQ-T-GANVLIIDADMRRPRLRSI
A0A352FTJ9      L--STAGRA-PKTLLVTSSLPGEGKTTTAVNTAISLAQ-T-GASVVIIDGDMRRPRLRSI
A0A2V8G155      F--ALPEEA-ARCILVTSTAPGEGKSVIASNLAMSLAH-S-GARVLLVDGDMRKPRGHEL
A0A2V8HDM7      F--ALPEEA-ARCILVTSTAPGEGKSVIASNLAMSLAH-S-GARVLLVDGDMRKPRGHEL
A0A2V8DRT9      F--SSTADG-GQSIVVTSSGPGEGKTVVSSNLALALAQ-T-GQRVLLIDADMRRPRVHQV
A0A2V7VYF3      F--SSVEEG-SRTIVVTSTGPGEGKTVVSSNLALALAQ-A-NQRVLLVDADMRRPQIHSY
A0A1F2SVH2      F--SSADEG-GRSVLITSTGPSEGKTVVATNLAVALAQ-A-GQRVLLMDADMRKSRVHIV
A0A2V8AJG9      F--SSAEEG-SKTIVITSTAPGEGKTTVASNIGIALAQ-A-SQRVLIVDADMRKPRVHSV
A0A2G6PYV5      L--SKTTD--NKVLLLSSALSGEGKTVSSLNLAISFAQ-L-EKKTLIIDCDLRRPKLHKI
A0A2V8F956      F--SSAEKG-SRSVVVTSTGPGEGKSLVAANLAISLAH-A-TQRVLVLDADLRKPQVHDI
A0A1F2S1W5      F--SSTEEG-GRLVVITSSAPGEGKTMVVTNLAVALAQ-A-GHRVLLMDADMRKPRVHEV
A0A1F2T595      F--SSTDEG-GRMIAVTSSAPGEGKTVVSTNLSIALAE-A-GHRVLLLDADMRKPRVHEI
A0A2V8JQV5      F--SEHGGTVPQILVVTSANPQDGKSTMASNLAVALAE-T-QRRVLVIDSDLRRPDLHRI
A0A2V9AC41      L--SQAGGP-PHTMLMTSATRGEGKTTTLVNTAIVFSQ-L-GIRVLVIDADLRRPRCHML
A0A2V8K4L4      F--SEQR---PRVVVISSANPSEGKTTVSTNLSIALSE-I-SQRVLLIDADMRRPRLHRL
A0A2V8NCZ3      F--SEQR---PRVLVISSANPSEGKTTVSTNLSIALSE-I-SQRVLLIDADMRRPRLHRL
A0A2V9MAM9      RLGGDEGQSPPRVLVITSTLPAEGKTTVATNLGITLAS-I-QRRVLLIDGDMRQPRIHHI
A0A2V9M454      L--STAERP-PKVLLITSAQPSEGKTATTLNLAVTLAQ-K-GSRVLLIDSDLRRPGLAKA
A0A2V9IVR7      L--ATSPRP-PQVIVMTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADFRKPGIAAA
A0A2V9ILE2      L--ATSPRP-PQVIVMTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADFRKPGIAAA
A0A2V9LGY4      L--ATSPRP-PQVIVMTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADFRKPGIAAA
A0A2V9J4D6      F--STSPKP-PQVVLVTSGHPKEGKTATAVNLASLMAQ-T-GSRVLLVDCDLRIPGASKL
A0A2V9L9C5      F--STSPKP-PQVVLVTSGHPKEGKTATAVNLASLMAQ-T-GSRVLLVDCDLRIPGASKL
A0A2N9M9N1      L--SSSPQP-PQVLLVTSAHPSEGKTFASVNLALALAQ-R-GGRVLLVDGDLRKPTVLRA
A0A2V9JEC4      L--SMTPRP-PQLLLITSPLPCEGKTSCSINLAASLAQ-R-GGRVLLLDADLRRPGVARA
A0A2V9LPQ3      F--SSTPEP-PKVLLVASSQPKEGKTCTSINLALSLAQ-N-SVPVLIIDADLRKPGVTRE
A0A348V070      L--SFDSPT-RKALIFSSPLSKDGKSSVISNLGLALAQ-A-HKRVVIVDSDLRKPRQQEI
A0A2Z5G3A3      L--SKGGSP-PQVVLITSSIEGEGKSTLAANFAVLLAR-Q-GKKVLLVDGDLRRPKLHTT
A0A2V7UGP8      L--STADAP-PKIIVVTSSEPQEGKTVTTLNTAISLTQ-S-GKKVLLVDGDMRRPRLHKA
A0A239MKT6      F--SRIDDP-PKVILFTSGISGEGKSTTAYNMAVAFAL-Q-TKRVLLIDADMRRPTIRER
A0A3E0PCN7      L--STAGGP-PKSVLVTSGQPFEGKTINSLCLAKSMAE-L-GKKVLLIDADMRCPKMHLI
A0A2V8IYW3      H--AQADTG-MRVVMVTSAISGEGKSLTITNLALTLTR-SYERRVLLIDADLRRPTLHTI
G2LEI9          L--SSSEDVRNRIILITSSQPGEGKTTTSFNTAISLAQ-T-GASVLLIDCDLRRPQLQKL
A0A317J121      L--GNGTRRPPRVILVTSPGAGEGKTTIVSNLGTALAE-T-GRSVLILDGDFRRPRLHKV
A0A2V7YW66      L--SSARE--LKTVAVTSAMAGEGKTATAVNLAIVLAQ-L-GRQVLIVDCDLRKPRLHQV
A0A2V7Z0V0      L--SSARE--LKAIAVTSAVAGEGKTATASNLAVVLAQ-L-GRQVLLVDCDLRKPRLHQV
A0A2V8GFD4      F--SFAEGS-AKTLVITSTAPEEGKTMVAANLAIALAM-T-SQRVLLVDADMRRPKIHQL
A0A2V8HSS5      F--SFAEGS-AKTLVITSTAPEEGKTMVAANLAIALAM-T-SQRVLLVDADMRRPKIHQL
A0A2V8KP55      L--SSGSAP-TRSVVITSAVPGEGKTVTAVNTAVIVAQ-T-GARVILIDADMRRPRMHKI
A0A399WNU1      L--STAGGS-PKTVLVTSGEPSEGKTITSLNLAKSLAQ-L-GGKVLLVDADLRCPKMHLI
A0A2V9CG11      L--ANQNGDLPQVIVVTSPCQGEGKTTVASNLSIAIVE-L-GRRVLLIDGDLRRPRLHKV
A0A2V2R0I6      L--SQADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVVVDADLRKPGVGRL
A0A2V8XAR9      L--SQADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRL
A0A2V8VZA0      L--SQAGHP-PQVILVTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADLRKPGIGRL
A0A1Q7CB82      L--SQAGHP-PQVILVTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADLRKPGIGRL
A0A2V8WIU1      L--SQAGHP-PQVILVTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADLRKPGIGRL
A0A1Q6Y9F5      L--SQADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRL
A0A2V9EVV8      L--SQADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRL
A0A2V8YF91      L--SQADHP-PQVILVTSALPREGKTTVAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRL
A0A2V8XZK2      L--SQADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRL
A0A2V8ZTX6      L--SQAEHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIARL
A0A2V9BT79      L--SQAEHS-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDRTVLVDADLRKPGIGRL
A0A1Q8B793      L--SQADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDKTLLIDADLRKPGVGRA
A0A2V9BCA0      L--SQADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDKTLLIDADLRKPGVGRA
A0A2V9BWU9      L--SQAEHP-PQVILVTSALPREGKTTAAVNLAVTLAQ-L-GDRTLLVDADLRKPGISRA
A0A2V9DKX2      L--SQAEHP-PQVILVTSALPREGKTTAAVNLAVTLAQ-L-GDRTLLVDADLRKPGISRA
A0A2V9JSI3      L--STPGHP-PQVILITSSQPNEGKSCTCLNLALTLAQ-R-GGRVVIIDGDLRKPGVASV
A0A2V9WI32      L--SSLGSP-PKVILVTSALPQEGKTTTSINSAIVLAQ-R-GGRVLLVDADLRRPGVHKA
A0A2V8IVN9      F--SSAEEG-SRILVVTSTGPGEGKTTFASNLAVSLAQ-T-GQRVLLIDGDMRKPKLQEA
A0A1F2TPT3      F--SFAGDA-TRSVVITSASPTEGKTVVGSNLAVALAQ-A-GERVLLMDADLRRPMIHTH
A0A2V8JTQ2      L--SQPTP--PRVIQVTSALPGGGKTTVSTNLAILLAR-L-RRRVLLVDADLRRSQIHLA
A0A2V8UZY0      L--SAATP--PGIILVTSAVPGEGKTTVCTNTAILLAR-L-HRRVLLVDADLRRPSIHRA
A0A3N5YNR8      L--SHSGKP-PKVIMVTSSVPGEGKTTTVANTGIVLAQ-T-GARTLLIDLDMRKPALAST
A0A350UEK1      F--SGNGHGPPRMIVVTSASPSEGKTTVATNLALAMAE-T-GQRVLLVDGDTRRPRQHGI
A0A350UIQ4      F--SGNGSGPPRMIVVTSPNPSEGKTTVATNLAVAMAE-T-GQKVLLIDGDTRRPRIHGI
A0A3N6A5T6      L--SNSGKP-PQIILVTSALPAEGKTTTALNAAIVLAQ-T-SARTLLIDLDMRRPKIGSH
A0A1F2Q9L4      L--STTNR--LKSVVVTSAIPGEGKTSTAVNLAVVLAQ-L-GRQVLLVDADLRKPRLHEI
A0A1H5SQF5      L--SRAEQ--PRTLLFTSSFSGEGKSTLTSNMAFAFGL-Q-GSRVLLMDADMRRPTLHTK
A0A3E0NV31      L--SSASEP-PRTILVTSALPAEGKSTTVANMAISFAN-N-NARTLIIDLDLRKPALAPL
A0A3N5M5V0      L--SHSGKP-PKVIMVTSSIPGEGKTTTVANTGIVLAQ-T-GARTLLIDLDMRKPALAGT
A0A2V9AEW6      L--PNQDGDPPQVVLLTSPCLGDGKTTVACNLSIAMAE-I-GRKVLLIDGDLRRPRIHQV
A0A2V8WQK6      S--PNQNGEGPRIIVLTSACPGDGKTTVACNLSIAMAE-I-GRKVLLIDGDLRRPRLHKI
A0A2V8XIF4      L--PSQNGDCPGVVVLTSPSSGDGKTTVACNLAIAMAE-I-GRKVLLIDGDLRRPRLHKV
A0A3N5XQP8      L--SHPDQP-PVRILIASAMPGEGKTTTAAYTGVVLAE-T-GAPTVLIDLDLRRAGLTGL
A0A2Z5G7H4      L--AKSSAP-PQLLLITSSVAGEGKSILSANLAAVLAQ-S-GRRVLLVDADLRKPSLGDR
A0A2V9L5B5      L--SA--SPVPRVILITSALPGEGKTTTAVNLGAALAS-L-GSKVVVIDCDMRRPSCHRS
A0A2V9LK56      L--SA--NPSPKIVLVTSALPSEGKTTITVNMGATLAS-L-GSKVLVLDCDMRRPTCHRA
A0A2V9L7I0      L--SA--SPVPRLILITSALPGEGKTTTTVNLGAALAS-L-GSRVVIVDCDMRRPACHRS
A0A522PPT0      L--SA--HPVPKVLLVTSALPGEGKTTTTVNLGATLAS-L-GSKVLILDCDMRRPACHRA
A0A2V9KCS3      F--FEADGNRPRILVMTSSAPGEGKTTVTSNLAIALAE-I-SRRVLVIDADMRRPRIHDI
A0A2U3KC61      L--SSFGAP-PKVILVTSAMPQEGKTTVSANSALVLAQ-R-GSRVLLVDADLRRPSIAKL
A0A2V9Y2R7      L--SSFGAP-PKVILVTSALPQEGKTTISANSAVVLAQ-R-GSRVLLVDADLRRPGIGKM
A0A372IT17      L--SRSSAP-PQVLLVTGTRDAEGKSTIALNLAAILAH-Q-GAQVLLVDGDLRRPALHRY
A0A136JPP4      F--SSAGKP-PQSILVTSSQPSEGKTMTAINTAITLAQ-A-DADVVLIDCDLRRPRMHSH
A0A399WUJ8      F--SSAGKP-PQSILVTSSQPSEGKTTTAINTAVTLAQ-A-DADVVLIDCDLRRPRMHSH
A0A2V9NGH6      L--SSVGAA-PKVVVVTSALPSEGKTTTSINTAIVLAQ-K-GNRVLLVDADLRRPSIHKT
A0A2V9PYE6      L--SSVGAP-PKVVVVTSALPSEGKTTTSINTAIVLAQ-K-GNRVLLVDADLRRPSIHKT
A0A2V9NL07      L--TSLGAP-PKTILITSALPQEGKTTTSINTATVLAQ-K-GTRVLLIDADLRRPSIHKT
A0A2V9QD92      L--TSLGAP-PKTILITSALPQEGKTTTSINTATVLAQ-K-GTRVLLIDADLRRPSIHKT
A0A2V9WPZ6      L--SSLGAP-PKIILITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADLRRPGVHKA
A0A2V9ZLH4      L--SSSGAP-PKVILVTSAMPQEGKTTTSINCAIVLAQ-K-GTRVLLVDADLRRPGVHKA
A0A2V9RQF1      L--TSLGAP-PKIILITSALPQEGKTTTSINTAVVLAQ-K-GTRVLLIDADLRRPSIHKT
A0A2V9YDK8      L--SSSGAP-PKIILVTSALPQEGKTTTSINCAIVLAQ-K-GVRVLLIDADLRRPGVHKT
A0A2V9V8F7      L--SSLGAP-PKIILITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADLRRPGVHKA
A0A2V9XGR9      L--SSLGAP-PKIILITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADLRRPGVHKA
A0A2V9V3Q5      L--SSLGGP-PKVIMVTSARPQEGKTTTAINSAIVLAQ-K-GVRVLLVDADLRRPSVHKT
A0A2V9NWS3      L--TSIGAP-PKVILVTSALPQEGKTTTSINTAIVLAQ-K-GTRVLLIDADLRRPSIHKA
A0A2V9USA9      L--TNLGAP-PKVIMVTSALPQEGKSTTSINCAIVLAQ-K-GVRVLLIDADLRRPSIHKT
A0A2V9XW18      L--SNLGAP-PKVIIVTSALPQEGKTTTSINTAVVLAQ-K-GVRVLLIDADLRRPSIHKT
A0A4R1LC91      L--SRGGSP-PQSILLTSSIEGEGKTTLSINLAILLAQ-Q-GKRVLLVDADLRRPSLHKS
A0A3M2BZG9      L--SSAEE--LRSVAVTSAEPGEGKTATTTNLGVVMAQ-L-GRSVLIVDCDLRRPRMHQV
A0A1Q7N5R7      H--AYGTAG-PMVITITSPAVGDGKSFVSTNLALACAQ-A-GQRTMLVDGDTRRGALHRV
A0A3M1SIV3      F--SSAGRP-PQTILITSSQPSEGKTTIAVNTAVALAQ-A-GADVVLIDCDLRRPRIHQH
A0A3E0PHB0      F--SSAGKP-PETILVTSSQPSEGKTTTAINTAITLAQ-S-GAEIVIIDCDLRRPRLHSL
A0A3M2D491      F--SSAGKP-PQTILITSSQPAEGKTTTAINTAIALAQ-S-GADVVLIDCDLRRPRIHEH
A0A357F267      F--SSAGKP-PQSILVTSSQPSEGKTTTAINTAVTLAQ-S-DVDVILVDCDLRRPRLHSY
A0A353C9L6      F--SSAGKP-PQTILITSSQPSEGKTTTAINTAITLAQ-S-DVDVVIVDCDLRRPRLHSH
A0A2V8RQV0      F--SSAGKP-PQSILVTSSQPSEGKTTTAINTAITLAQ-S-DVDVVIVDCDLRRPRVHSY
A0A2V8SJH5      F--SSAGKP-PQSILVTSSQPSEGKTTTAINTAVTLAQ-A-DADVVIVDCDLRRPRLHTY
A0A2V9QB26      F--SGSNGACPRVLVLTSAGPKEGKTMVASNLGIALAE-T-KRKVLIIDGDLRKPRMHEL
A0A2V9VYY4      L--SSFGAP-PKVILVTSAMPREGKTTISANSALVLAQ-R-GSRVLLVDADLRRPGVEKL
A0A2V9KIE8      L--SA--HPVPRTILITSALPGEGKTTTTVNLGVALAG-L-GSKVLIIDCDMRRPACHRA
A0A352F549      L--STAGRP-PKTLLVTSSVPAEGKTTTVVNTATVLAQ-T-GAQVLIIDADMRRPRLHQV
A0A3B9MLP9      L--STPGRS-PKTLLVTSSVPAEGKTTTAVNTATVLAQ-T-GAKVLLIDADMRRPRLHHV
A0A3D5SQ87      L--STPGRS-PKTLLVTSSVPAEGKTTTAVNTATVLAQ-T-GAKVLLIDADMRRPRLHHV
A0A2V8NW86      F--SGSNGDCPRVLVLTSAGPKEGKTTVATNLGIALAE-T-KRKVLIIDGDLRKPRMHEL
A0A2V8ZHL8      L--STAPRP-PQALLITSATAREGKSTTALNLAIALAQ-R-GDSTLIIDADLRRPGIAES
A0A2V9B240      L--STAPRP-PQALLITSATAREGKSTTALNLAIALAQ-R-GDSTLIIDADLRRPGIAES
A0A2V9CBM2      L--SAAEGP-RNSFLVTSTQPSEGKTTVASNLAIALAQ-L-GRRVLLVDADLRSPSLHRL
A0A2V8XN17      L--STPDRP-PSSLLVTSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKL
A0A2V8WX45      L--STPDRP-PGSLLVTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLVDADLRFPSLHKL
A0A1Q6YR79      L--STPDRP-PSSLLITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKL
A0A1Q7VA32      L--STPDRP-PSSLLITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKL
A0A2V9EY85      L--STPDRP-PSSLLITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKL
A0A2V9H8K0      L--ATPDRP-PGSLLVTSTQPAEGKTTVACNLAISLGQ-L-GHRVLLLDADLRFPSLHKL
A0A2V9FFE5      L--STPDRP-PSSLLVTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLLDADLRYPSLHKL
A0A2V9GM43      L--STPDRP-PSSLLVTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLLDADLRYPSLHKL
A0A1F2RFI7      L--STSGRP-PRVILVTSGQPGEGKTTTVVNLAIALVQ-L-GGRVLVVDSDMRRPRVGNL
A0A1F2RZS3      L--STSGRP-PRVMLITSGQPGEGKTTTTVNLAIALVQ-L-GGRVLVVDSDMRRPRIGTL
A0A1F2USE2      L--STAERP-PRILLVTSAQPGEGKTTITLNLAISLAQ-L-GQRVLLIDGDMRRPCLHKV
A0A2V9C238      L--STADRP-PRTLLVSSSQPSEGKTTVSINLAISLAQ-L-GQRVLLIDGDMRRPSVRKA
A0A1F2Q9F5      L--STPEQA-PRLLLTSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADLRRPCIHKA
A0A1F2QQH9      L--STPEQA-PRLLLTSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADLRRPCIHKA
A0A1F2QXK7      L--STPEQA-PRLLLTSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADLRRPCIHKA
A0A2V9DEM9      L--STADRP-PRTLLVSSSQPSEGKTTVSINLAISLAQ-L-GQRVLLIDGDMRRPSVRKA
A0A2V9CYQ5      L--SAAGGP-PNSFLVTSTQPSEGKSTVATNLAIALAQ-I-GRRVLLVDADLRSPSLHRL
A0A2V9BWU8      L--STADHP-PGSLLITSTQAGEGKTTIATNLAISLAQ-L-GQRVLLVDADLRFPSLQRL
A0A2V8ZG48      L--STADHP-PGSLLITSTQPGEGKTTVATNLAISLAQ-L-GQRVLLVDADLRFPSLEKL
A0A2V8Y334      L--STADHP-PGSLLVTSTQPGEGKTTIATNLAISLAQ-L-GQRVLLVDADLRFPSLQKL
A0A2V9AY68      L--STADHP-PGSLLVTSTQSGEGKTTIATNLAISLAQ-L-GQRVLLVDADLRFPSLQKL
A0A257VBK0      F--ATDNHQN-NAILVTSASPKEGKTSVSANLAKTLAA-G-GDRVLLMDCDLRRPSIHRI
A0A2V7XDY0      F--GRKDERG-QIVLVTGTVPQEGKTTTIVNLGKLLAS-S-GEKAVLVDFDLRRGQLHSR
A0A350UQT3      L--TDFDRRL-RTLLMTSATASEGKSTTAGHLAFAHAE-Q-RKRTLLIDCDLRRPSQHKL
A0A2U3JZ71      L--TDFDRRI-RSLMITSSGPAEGKSTTAAHLALAHAQ-Q-GRKTLLIDGDLRRPSIHRR
A0A2V8TTB0      L--TDFDRSL-RSVLLTSASPSEGKSTVAAHLAATHAG-Q-HKRTLLIDGDLRRPSVHRL
A0A1F2TCR2      F--TGKSEGP-RVIAVTSSQPLEGKTTTACNLAMVLAL-G-GSRVLLIDADMRRPGLHKI
A0A2N9LQU7      L--TAADRPP-QLLVVTSAFPSEGKSVSSCNLAITLAQ-R-GSRVLLVDADLRRSTLLRQ
A0A2P6WFK7      L--SSPDHEP-KIITVVSSVPAEGKTTVSVNLASAFAQ-R-GESVLLIDADLRRSTTHTH
A0A1F2V330      Q--QLSGVRS-PLLAISSVVGGEGKTVTSLNLSLALAGTV-SGRVLLIDSDLRKPRVHEY
A0A2V8U914      S--AEQNGDHHDVLVITSPLAGEGKTTVSSNLGIALAE-V-RGRVLLIDGDMRRPRLHKI
A0A662EE63      L--AARDEGC-QILLVTSSVPSEGKTTASFNLAKVLAA-G-GARVLLIDGDLRKPRLHHM
A0A2V7W309      L--ASANSP--KIIVITSSFAREGKTTTSVNLATVLAQ-M-GKPVLLIDADLRRPRLQKV
A0A2V8TLH7      F--SRKARTA-NAVLVTSAGPQEGKSCTSVNVARTLAN-A-GEKVVIIDCDLRRPTVHQW
A0A1Q7ZJT1      F--SRKSRGA-NTVLITSAGPQEGKSCTTVNVARTLAT-A-GEKVIIVDCDLRRPAIHTR
A0A2V8VC99      F--SRKNRSA-NTVLITSAGPQEGKSCTTVNVARTLAT-A-GERVMILDCDLRRPAIHTR
A0A348UZU3      L--SGPLSSL-KSLIITSPLPNEGKSVTISNLAVSLAQ-T-EKKVLLMDADLRRPKQHRI
Q01XL7          R--AQPKGEC-PVYVITSGGPGEGKTTLSANLAIAMAM-I-GQRVLLIDADLRRARLHSV
A0A2V8ERZ5      S--KYQGDAT-KIITVTSAQPLEGKTTTAANIAMALAY-G-GARVLLIDADMRRPGLHRP
A0A2V8GTX0      A--SSGTDAT-RLVAITSTQPLEGKTTTAVNVALALAI-G-GARVLLIDADMRRPSLHKA
A0A2V8J0X9      F--TSGAQST-RIIAVTSSQPLEGKTTTACNLAMALAF-G-GSRVLLIDADMRRPGLHKT
A0A523DUV7      F--TREREHG-NMILVTSSIPQEGKSTTAVNLAKALAE-S-GDPTLVVDFDLRRSSIHTH
A0A372IRG7      L--SAVDREP-KLLLLTSGFAAEGKSTCSSNLAVSFAQ-R-NARVLLVDTDLRKGTLHMK
A0A1F2U158      S--RYPGEGA-KTMIVTSAQPLEGKTTTAANIAMALAY-G-GARVLLIDADMRRPGLHRS
A0A2V8F6S9      S--KYPGAGT-KVLLVTSAQPLEGKTTTAANVAMALAY-G-GSRVLLIDADMRRPGLHRP
A0A4Q1SCH5      L--SSIDMPP-RLMLVTSSLPGEGKSSTSANYAVVLAQ-N-GAKVLIIDADLRRPTLHKI
A0A2W0BGU4      L--SVASRAP-QTVLITSAKIGEGKSSTALNLAMALAQ-C-GSSVVLLDCDLRKPVLARL
A0A2W0BVQ9      L--SVASRAP-QTVLITSAKIGEGKSSTALNLAMALAQ-C-GSSVVLLDCDLRKPILARL
A0A3D1ASD2      L--TDFDRRL-RSVLLTSASPSEGKSTVAAHLAVAHAE-Q-KHRTLLIDGDLRRPSLHKF
A0A2N9MK30      L--SSFDRQI-KSLMVTSATPGEGKSTVCVHLAMAHAQ-Q-NHRTLLIDCDLRRPSVHRR
A0A1I6MH75      L--SSTGHPP-KFVLFTSATPSEGKTTTACNLACILAQ-R-DTRVLLIDADLRRPNVHHR
E8WVF6          L--ASTGKEP-RLLLFTSATPSEGKTTAASNLAVILAQ-G-GTRTLLIDADLRRPNVHHR
A0A1H5Z7N3      L--ATAGKEP-KVVLVTSSTPSEGKTTVSTNLATVLAQ-R-DVKTLLIDADLRRPTVHHR
A0A2V9YHT3      L--SSLGAPP-QVILVTSALPQEGKTTTAVNCGIVLAQ-Q-GSRVLLVDADLRRPAVHHS
A0A1G7JVV8      L--ATTGHPP-KFILITSSTPSEGKTTVSTNLAAILAQ-R-ETRVLLIDADLRRPNVHHR
A0A1H4T6W9      L--ATTGHPP-KVILISSSTPGEGKTTVATNLAAILAQ-R-DTKVILIDGDLRRPNVHHR
I3ZEU5          L--ATTGHPP-KIILISSSTPGEGKTTVATNLAAILAQ-R-ETRVLLIDADLRRPNVHHR
A0A5B9EBI2      L--ADTAHPP-RTILFTSATPSEGKTTCSTNLSCILAQ-R-ETRVLLIDADLRRPSVHHR
A0A239HDF6      L--STAGREP-KLLMFTSAAPGEGKTTTSINLAAILAQ-R-GARVLLIDADLRRPAVHVR
A0A4Q0T270      L--STTGQPP-KFILFTSSTPSEGKTTTACNLACILAQ-G-DVRVLLIDADLRRPNVHHR
A0A1Q3QQB6      L--ATTGHPP-KFILLTSATPSEGKTTLSTNLACILAQ-G-DARVLLIDADLRRPSVHHR
A0A3N1K1G7      L--STTGHPP-KFILFTSATPSEGKTTTASNLACILAQ-A-DTRVLLIDADLRRPNVHHR
A0A428MDU2      L--SSAGHPP-KFILFTSATPSEGKTTTASNLACILAQ-R-DARVLLIDADLRRPNVHHR
A0A4V2G466      L--SSAGHPP-KYILLTSATPSEGKTTASTNLATILAQ-G-DARVLLIDADLRRPTVHQR
A0A4Q7YNP3      L--TGNSSNRARVYVVTSPNAGDGKTTVTSNLGVALSK-S-NLRVVILDGDLRKPGMHNA
A0A2V9MN96      L--SSFGAPP-KVVLVTSALPQEGKTTVSANSAVVLAQ-K-GGRVLLVDADLRRPGVARA
E8UZE1          L--SHAGNPP-QLIVICSAWTKEGKSTITINLATVLAQ-M-NRKVLLVDADLRRPSLHHK
A0A2V7V2Z1      Y--SWPEAAS-RILLVTSTSAGEGKTVTSVNLALILAS-L-GGRVLLVDCDLRRPQSHVL
A0A2V7X2F7      Y--SWPNTVP-RIIVVTSTAPGEGKTLTSVNLSLTLAS-S-EGKVLLIDADLRRPQAHTL
A0A2V7V2I1      Y--SWPGQDS-RVLVLTSTAPGEGKTLTSVNLALTLAT-M-DGQVLLLDADLRKPQAHEL
A0A2V7U3M2      Y--SWPESSP-RILLVTSTSAGEGKTVTSVNLALILAS-L-GGKVLLIDCDLRRPQSNTL
A0A2V7UHT0      Y--SWPDSSS-RILLVTSTSPGEGKTVTSVNLALILAS-M-GGKVLLIDCDLRRPQSHTL
A0A2Z5FVL3      S--TRGGAPP-QVLLVTSSTEGEGKSTLSSNLAVVLAQ-Q-GKRVLLVDADLRRPNLHVL
A0A1V6HR88      L--STASEL--KVIVITSSIPGEGKTSTASNLAIVLAQ-L-GKNVLLIDGDLRKSRLHEL
A0A2V9KBD6      L--SQPTPP--VVIQVTSALAAEGKTTVSANLAILLAR-L-RRRVLLIDADLRRPRIHLA
A0A2W0AJ66      L--SRPTPP--AVIMMTSALPSEGKTTVAMNTAIALAR-L-GRRVLLVDGDLRRPSVHRA
A0A1Q7RBU1      L--SQSTPP--AVILVTSALPREGKTTVSTNLAIAIAR-L-RKRVLLVDADLRRPSIHRA
A0A2V9JPV9      L--SQPTPP--AVILVTSALPREGKTTVSTNLAITLAR-L-RRRVLLVDADLRRPSIHRA
A0A3E0P0A3      L--SKADEP--RLLVVTSTEAQEGKTATALNLAIVMAQ-L-ARRTLLIDGDLRKPRIHEA
A0A2V8EXP2      F--SSADEGP-KVIVVTSAGPGEGKTLVASNLAVAMAQ-A-AQRVLLMDADMRRPRVHSL
A0A2W4RYA1      F--ARADPDM-RSVMVTSTGVGEGKSVVAGNLAVAIAQ-T-GQRVLLVDADLRRPRAHGL
G8P0Y7          L--SSVSHPP-RSILVTSSVPEDGKTMTSINIAIVMAQ-Q-EKRILLVDADMRRPSVHTA
A0A5M8T4U7      L--SSIDKPP-RVIAITSAFPGEGKTTTAVNCALALAQ-R-GERVLLVDADLRRGTLHQV
A0A3P0X3W6      L--ERTREKL-RSVQVTSAVAGEGKSTCTAHLAIAHAM-Q-GRKTLLIDADLRRPSQHNH
A0A1E3Y9R6      F--SSAEDGA-RSVVVTSTGPHEGKTVVSSSLAITLAQ-A-GQRTIVVDADMRRPRMHEA
A0A2W4TLP2      F--SSAEEGA-RSVVITSTGPHEGKTVVSSSLAIALAQ-A-GQRTVVVDGDMRRPRMHEA
A0A3R9WF43      H--SHSVTRL-QTLLVTSPHGGDGKTTVAYNLAVAFAQ-Q-GSRVVLLDADLRNPDLHRL
A0A317HKM4      M--APELARP-HILLVTSSEPGEGKTVTAANLAASLAG-L-HQRVLLIDADLRKPGLHQL
A0A523E0N1      L--STPNAVP-KIVLVTSPDKNCGKTFISSNLSCALGQ-L-DKKVLLIDSDLRNPRLHRV
A0A523ECP2      L--STPGRPP-RTVLVTGPDKNAGKTFVACNLATSLAD-L-DKKVLLIDADLRNPQLHKV
A0A2W0C122      L--ASRDL---KSLLVSSPLPAEGKTMTAANVAVVLAQ-Q-GKAVLLVDADLRKPGLDRE
A0A2W0AUU7      L--ASADL---KSLLVSSPLPGEGKTMTAANLAVVLAQ-Q-GKRVLLVDADLRKPGLDRE
A0A2W0BQL1      L--ASADL---KSLLVSSPLPGEGKTMTAANLAVVLAQ-Q-GKRVLLVDADLRKPGLDRE
A0A4Q1SDL1      P--TRTTMEPPRVVVVTSASPGEGKSLTAKNLAVSTAQ-Q-GKRVLLIDADLRKPSDKKG
A0A3P0XH15      L--SAVDREP-KLILLTSSFATEGKSTCAANLAISFAR-R-SARVLLVDTDLRKGTLHMK
A0A4R1LAZ7      L--SAVDTQP-KVLLLTSSFAAEGKSTCASNLAISFAQ-R-NARVLLVDTDLRKGTLHIK
A0A3M1WQW8      L--SHAERPP-RTILFTSSSPGEGKTTTAVNTAISLTQ-T-GARVMLIDGDLRKPGLHKM
A0A3N1JHC1      F--SRNGGMAPKVLLVTSPHPRCGKTVTIANLAISLAE-G-GRRVLLIDGDLRRPALPQL
C1F294          L--SSVDREP-KAILLTSGLAAEGKSTCAANLAISFAQ-R-PARVLLVDTDLRKGTQHLK
A0A2V9KA79      S--QLGDENG-RVLTITSAAGGEGKTLTSVNLSLALASTF-EGQVLLVDADLRKPRIHHY
A0A522PSP1      L--GASGNSM-RALAVISSRPEEGKTTIAMALAMSMAA-L-GRRTVLVDGDLRRPQVHRI
G8P085          L--SSIDRPA-KMLLVSSTIPGEGKSSTTANYGVVLAQ-K-GARVLLVDADLRRPALHSK
A0A4Q1SGQ1      R--LRDGDSS-QVVLITSAVAGEGKSTIAANLAGVLAQ-S-GERVLLVDADLRRPGIYHE
Q1ILD9          L--SFPSRPP-KSLVVTSALPGEGKSTISMNVAGTLVQ-R-GARVLLVDADMRRGRLASR
Q1IJZ6          L--SQAGSAP-KSLLLTSSLPGEGKSTTTYGLGRCFGS-L-GTRVLLIDADLRRPTLHKH
A0A2V8TCE6      L--SSAGSTP-RSLTVASTRPEEGKSTIAINLATVLAQ-S-GKKVLLVDSDLRRPRLHRA
A0A522TBE8      L--GAAEA---RVVAITSALPAEGKSTAAGHLAASMAQ-M-GQSTLLVDGDLRKPRVHRL
Q1ITG0          L--ANAGAPP-KVIMITSAQPGDGKSTVSVNISAVLAQ-S-GARVLLVDADLRRGVLARN
A0A3N5PCI5      A--SAGGGTTGRSLLVTSAAPGDGKSIVAVNLAVALGR-S-GGRVLVIDADLRRPVLHQV
A0A3M1Q0S9      L--AMPDHPP-RTLAVTSCQPGEGKTTTAINLATTLAQ-L-GRRVLVVDTDLRRPRCHQI
A0A2Z5G448      L--SSADNEA-RLILITSSLEAEGKSTIAANLAISFAR-R-DARVLLVDTDLRRGTLHLK
A0A3M1VZ38      L--ATPGHPP-RDLTVTSCQPGEGKTTTAVNLAIALAQ-L-GRQVLLVDSDLRRPRCHDV
A0A4Q1SD29      L--SAVDNEM-KLLLITSSFAAEGKSTCAANIAISFAQ-R-SARVLVVDTDLRKGTLHMK
A0A3M1PY35      L--SHPGGPP-RVLMVTSALPGEGKSTFSANLARTLAA-F-GDRVVLLDADLRHPRLHRA
A0A3M1VMP2      L--AQPQHPP-RSLLVTSALPGEGKSTIAANLARTLGA-F-GRKVVLIDADLRHPRLHRV
                                       **:      .            :::* * *       

A0A2V7VMF7      L---------EISRAPGFTDYFVRHE----DLDSLIQS--TRVPNLFALTAGPLPP-NPP
A0A2V7YYV7      F---------ARIRNVGLSNLILQDA----AESEAIAT-VESVPNLCVLTSGPTPP-NPS
A0A2V7Z0J5      F---------ARVRNIGLSNVIIQDA----AEEETITA-VDAVPNLWLLTSGSIPP-NPS
A0A2V7Z3M4      F---------GRVRNVGLSNVILGAT----TEEATVIA-VDSVPNLWLLTSGPTPP-NPS
A0A399Y5V2      F---------ELRNTEGVTTAILAERPLVDL-LQRPRI-AGAPPSLLALTSGPIPP-NPA
Q01X01          F---------DQANSWGLSDLLREKNAIEDLPLDVLVK-KTAVPRLSLLPSGTGTD-NIF
A0A3M2D9H8      L---RL----PN-R-LGLSDILREHSTLDESLHHLTTE------GIDVLTSGTLPP-NPA
A0A2V8JK38      F---------KCANANGLSSVLEGHC----SLENAVSE--TNIKNLFLLPSGPVRP-NPG
A0A2V9IXG5      L---ST----GKQNGNSIFSPVEGLK---------LRVEQTQLPSLHLTVAESLPQ-NPP
A0A2V9J2P4      L---ST----GKQNGNSIFSPVEGLK---------LRVEQTQLPSLHLTVAESLPQ-NPP
A0A1Q7RLS4      L---------NLGRDGGVTNYILSSEGD--DWRSYIKN--TDMPNLYAMTCGPIPP-NPA
A0A2V2R525      F---QL----DN-S-HGLSTLLAGKN-NQAEMLSLIHQ--HEETGLYVLPAGPPPI-KPA
A0A321LPW6      F---KL----PN-T-AGLSTYLSREI-DVEALIHTQ-----ELKNLSLLPCGPIPP-NPA
A0A2V9R9V4      F---GT----SR-T-LGLSTYLVRNV-EIDELTQDL-----PGENLRMISSGPIPP-NPA
A0A321LE75      L---GI----DH-S-HGLSNYLSRDV-AIDGLIQKL-----PIPNLSILTCGPIPP-NPA
A0A2V8R8U7      F---NL----SN-T-RGLTNCLSGES-EVADLLQTY----DKLPKLKLLTSGPIPP-NPA
A0A2V8QMP4      F---GL----PN-S-RGVTNYLSGEA-QVSELVQTY----DKLPNLKVITSGPVPP-NAA
A0A2V8R4S3      F---GL----PN-S-RGVTNYLSGEA-QVSELVQTY----DKLPNLKVITSGPVPP-NAA
A0A2V8NJ55      F---NI----SN-V-KGLTNCLSGDL-NTDELIQAY----EKLPNLKIMTSGPVPP-NPA
A0A2V8Q7I0      F---EI----SN-A-RGLTTWLSGEK-DLDGIIQTC----PRVPHLKILTSGPVPP-NPA
A0A2V8S6K4      F---NL----PN-T-RGVTNYLSGEI-NVSELIQTY----DKQPNLKVITSGPVPP-NAA
A0A317I2L9      F---EV----SN-A-RGLTTWLSGEK-DLDGLLQSL----PRNPNLKILTSGPVPP-NPA
A0A2V8LLF9      F---NL----PN-S-RGLTNCLSGDGKDLDALLHVY----DKQPNLKLLTSGPIPP-NPA
A0A352FRF4      F---NI----SN-A-RGLTNCLSGEASEIDSVIQSY----AALPNLKLLPSGPMPP-NPA
A0A2V8MKV0      F---NI----SN-V-RGLTNFLSGEL-PLDEVIQPF----EKLPNLKLLPSGPIPP-NPA
A0A2V8PYY8      F---NI----SN-V-RGLTNHLSGEL-PLDEVIQPF----DKQPNLKLLPSGPIPP-NPA
A0A1Q7YKQ8      F---NI----PN-A-RGVTNYLSGEA-GLDELIRSY----DKLPNLKLMTSGPVPP-NPA
A0A352F3R7      F---NA----PN-N-KGLTNWLSGET-DIDNLMQTL----PAQPNLKFLTSGPVPP-NPA
A0A0B6WXT1      F---NL----AN-A-KGVANYLAGER-NLDALMQTY----APLPNLKIMTSGPVPP-SPA
A0A3B9MEU8      F---GA----PN-S-KGLTNWLSGET-DIDALIQTY----EQHANLKFLTSGPVPP-NPA
A0A2V8MHG6      F---DV----DN-D-KGLSGILASKM-TEGEMLGCVQQ--HEESSLYLLPSGRLPP-NPA
A0A2V8P7N1      F---DV----DN-D-KGLSGILASKM-SEAEMLNCVQQ--HEESSLYLLPSGRLPP-NPA
A0A2V8M3M6      F---DV----DN-D-KGLSGILASKM-SEAEMLNCVQQ--HEESSLYLLPSGRLPP-NPA
A0A1Q7NJH5      F---NV----DN-D-KGLSGILASKM-SEREMLGWVQQ--HEESSLYLLPSGRLPP-NPA
A0A2V8PJY0      F---NV----DN-D-KGLSGILASKM-SEREMLGWVQQ--HEESSLYLLPSGRLPP-NPA
A0A1Q7Y6W9      F---ET----EN-R-KGLSTYLSSDM-SDAELLDMIEQ--HGASGLHYLTSGPVPP-NPA
A0A2V8NC68      F---GL----KN-E-SGLSTILANKM-SEAEMLSLVEQ--HEESGLYMLSSGPIPP-NPA
A0A399WK13      F---GI----SN-A-DGLSTILSNDL-SEAEILNIITQ--DESSKLHLLTSGPVPP-NPA
A0A352FLX4      F---NL----SN-D-SGLSALLSREA-SEAEIISAIQH--DEASGLSVLTAGPVPP-NPA
A0A2V8RTL7      F---NV----SN-N-QGISTVLSSEL-STKEILDVINY--DERTKVSVMTSGPIPP-NPA
A0A3E0PCJ6      F---NL----GN-A-EGLSTVLSSDL-AEKEILNLVKK--DEASGLYLMPSGPLPP-NPA
A0A3M1S4R8      F---NI----SN-R-EGLSNLLSSEI-KRDKVLDSVYF--DMSSRLYLLPSGPVPP-NPA
A0A1Q7YFI6      M---NL----DN-A-RGLSTILSTDM-SAAEMLSLIEQ--QAGSGLYLLSSGPVPP-NPS
A0A136KC10      F---GI----GN-A-DGLSTILANEL-SEAEILNLITQ--DPSSKLHLLPSGPIPP-NPA
A0A2V8SEX6      F---NI----EN-G-DGLSTILSTEM-TEKEILKVVKQ--DEGTKLNLLTSGPIPP-NPA
A0A3M2D6Y5      F---NV----QN-R-EGLSNLLSSEI-KADKVLDKVQF--DSAAKLYILPSGPVPP-NPA
A0A0B6WWQ6      F---GL----KN-E-RGLSTLLSSEI-RNGDAFKCIH---DSARGVQVLTSGPLAP-HPA
A0A3B9MK99      F---GL----SD-R-AGLSSILSSDV-SEADMLEMVST--DEATGLRVLTSGPIPP-NPA
A0A352EX26      F---GF----SE-R-PGLSSILSSDV-SREDTLAMISK--DEVTGLHVLTSGPIPP-NPA
A0A2V8MM59      F---DL----AE-Q-TGLSSILSSAM-TEAEMLGSVHQ--DEASGLHVLSSGPIPP-NPA
A0A2V8PFE8      F---DL----PE-R-EGLSSILSSEI-KPEDMLHAIHR--DEATGLNVLASGPIPP-NPA
A0A2V8PWS6      F---DL----PE-R-EGLSSILSSET-KPEDMLHAIHR--DEATGLNVLASGPIPP-NPA
A0A2V8LCT5      F---DL----SE-R-EGLSSILSSEM-KPDQMLGAIVK--DPTTGLNVLTSGPVPP-NPA
A0A352FTJ9      F---DL----PE-R-DGLSSILTSEA-TPEDMLRSVAR--DESSGLFVMSSGPVPP-NPA
A0A2V8G155      L---------GGPQEPGLSNVIVGET----KLADAVRR--TPIPSLWLLAAGKTPP-NPA
A0A2V8HDM7      L---------GGPQEPGLSNVIVGET----KLADAVRR--TPIPSLWLLAAGKTPP-NPA
A0A2V8DRT9      F---------AERQEPGLSNILVGDT----KTGDAVRP--TSCSTLWILPAGHLPP-NPA
A0A2V7VYF3      F---------SHPQEPGLSNFIVGNS----EVGDVVRP--SGVPELWLLPSGLIPP-NPA
A0A1F2SVH2      F---------DRSQGPGLSNVLVGNA----KASEAVHK--TAVPGLWVMPAGPHPP-NPA
A0A2V8AJG9      F---------GQTQEPGLSNVLVGNA----KASEAIRG--TAVSGLWTMTAGMLPP-NPS
A0A2G6PYV5      F---NL----PN-A-KGLVTSLVKGK----SPIDFIQS--TKIPHLFLLSSGPLPP-NPA
A0A2V8F956      F---EV----AQ-E-PGLSNLLAGQA----KASESVRK--TAIPGLWVLTSGRIPP-NPA
A0A1F2S1W5      F---GV----PS-S-PGLSNLMVANA----TASEVIQE--SSTPGLWVLSAGTHPP-NPS
A0A1F2T595      F---------SRRVDPGLSNLLVGNA----TASESIFE--SEIPGLWLMPAGTHPP-NPA
A0A2V8JQV5      F---HA----EN-R-WGLIDILQGDIEIRDYPLDMLAR-QTEVPNVHLLTSGTASR-SVV
A0A2V9AC41      L---KM----EN-T-AGLADVLAGQI----GMEEAIRP--TQAENLFLISAGTIPP-NPA
A0A2V8K4L4      F---DL----KN-D-KGLSELLLSKHALKTSEVVGAVR-ESWIPGLHILTSGPWAA-NAS
A0A2V8NCZ3      F---DM----KN-D-KGLSELLREKHSTKTSEVLEAAR-ETWIPGLHVLTSGPWAA-NAS
A0A2V9MAM9      F---DL----PN-T-WGFSNLLRGAD----ELPMDTIVKRTTVPNLYVLSSGPGTE-DIF
A0A2V9M454      L---KL----RN-Q-NGLAEILTGAC----EFDETLLEKVEGLDRLSLLPAGPYPP-NPA
A0A2V9IVR7      M---GM----SN-E-RGLSNILRGEQ----SVDEVLLQ-AHTLPNLWVLPAGPVPS-NPT
A0A2V9ILE2      M---GM----SN-E-RGLSNILRGEQ----SVDEVLLQ-AHTLPNLWVLPAGPVPS-NPT
A0A2V9LGY4      M---GM----SN-E-RGLSNILRGEQ----SVDEVLLQ-AHTLPNLWVLPAGPVPS-NPT
A0A2V9J4D6      M---GI----SN-S-KGLSGILTGAY----SVDEALQE-VKGQPGLWALPSGPPPP-NPA
A0A2V9L9C5      M---GI----SN-S-KGLSGILTGAY----SVDEALQE-VKGQPGLWALPSGPPPP-NPA
A0A2N9M9N1      L---GMGNGESE-A-NGLSSYLAGGQ----GIDSALMS-FTALPNLSVLPSGPVPA-NPA
A0A2V9JEC4      L---SL----DG-K-KGLSTVLTGGH----QIEVALET-FQNLSTLSILCAGPVPP-NPS
A0A2V9LPQ3      L---NL----PS-T-KGLSGVLTGRY----SLDEALRE-VEN-TSLSVLPAGPTPP-NPA
A0A348V070      F---NV----DY-T-WGLTHFLSSIV----DASEIIRP--TAYTNLFVVPSGVTPS-DPL
A0A2Z5G3A3      F---DV----AM-E-GGLSSILSGSS-SEKDSSQYSAP-VTSLPNLKLLVAGAPPT-EPT
A0A2V7UGP8      L---GS----GN-G-HGLSSYLSGNA----ELDPIIQE--TEIPNLFLVSSGPVPP-NPS
A0A239MKT6      V---NL----QQ-G-RGLSDLLSLNL----ELDEVLQQ-HPNQDNLFIIEAGTIPP-MPA
A0A3E0PCN7      N---DL----SN-T-TGLSTLITADYLSDERIDNAIRK--EVDYCLDVLPSGPRVP-NPA
A0A2V8IYW3      F---KL----ES-P-CGVNEYVHSHG------AKPLEL-LPVAPRLFLLPAGRPDS-DPI
G2LEI9          FDSYGQ----ERTFQPGLSRYLSGQC----KIGEIFTP--SPIPYLTLITCGQMPP-NPA
A0A317J121      F---DL----AD-T-WGLTNILEEGS----AAPERFGL-LTTVPGLFVMPNGPKSG-SIS
A0A2V7YW66      L---RV----SN-R-HGLVNQLTATG----EE--AIFP--TEVPNLWITPSGPIPP-NPS
A0A2V7Z0V0      F---RV----SN-R-FGLVNQLTATA----ESETVFLP--TEVPNLWLTPSGPIPP-NPS
A0A2V8GFD4      F---AL----DQ-E-AGLSNVLIGSA----KANDAVKK--TTVPKLWVLPAGRVPP-NPP
A0A2V8HSS5      F---AL----DQ-E-AGLSNVLIGSA----KANDAVKK--TTVPKLWVLPAGRVPP-NPP
A0A2V8KP55      F---KC----AN-A-NGLSSVLEGHC----SLENAVSE--TNIKNLFLLPSGPVRP-NPG
A0A399WNU1      N---NI----DN-S-CGLSTLLTAEEVDQDLVDRAVTK--SSEPDLDILPSGPRVP-NPA
A0A2V9CG11      F---GL----CN-N-RGLSSILSVND--IVHIKQLLCE--TAISGLYVLPAGSSTT-NTT
A0A2V2R0I6      L---NL----SNNKYAGLSSYLAGAS----SLDLVTVP-HPAIPNLAAIPTGPLPP-NPA
A0A2V8XAR9      L---NL----GSGKYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTGPLPP-NPA
A0A2V8VZA0      L---NL----AGGKYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTGPLPP-NPA
A0A1Q7CB82      L---NL----AGGKYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTGPLPP-NPA
A0A2V8WIU1      L---NL----AGGKYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTGPLPP-NPA
A0A1Q6Y9F5      L---NL----AAGKYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTGPLPP-NPA
A0A2V9EVV8      L---NL----AAGKYAGLSSYLAGVS----SLDFVSVP-HPAIPNLVAIPTGPLPP-NPA
A0A2V8YF91      L---NL----GPGKYAGLSSYLAGAS----SLDLVSVP-HPSIPNLVAIPTGPLPP-NPA
A0A2V8XZK2      L---NL----GTGKYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTGPLPP-NPA
A0A2V8ZTX6      L---NL----GGGKYAGLSSYLAGVS----SLDLVSIP-HPAIPNLVAIPTGPLPP-NPA
A0A2V9BT79      L---NL----GAGKYAGLSSYLAGVS----SLDLVSIP-HPAIPNLVAIPTGPLPP-NPA
A0A1Q8B793      L---SL----GEGKYAGLSSYLAGVS----SLDLVTVP-HPAIENLAAIPTGPLPP-NPA
A0A2V9BCA0      L---SL----GEGKYAGLSSYLAGVS----SLDLVTVP-HPAIENLAAIPTGPLPP-NPA
A0A2V9BWU9      L---SM----SDGKYAGLSSYLAGVS----SLELVTVP-HPAITNLAAIPTGPVPP-NPA
A0A2V9DKX2      L---SM----SDGKYAGLSSYLAGVS----SLELVTVP-HPAITNLAAIPTGPVPP-NPA
A0A2V9JSI3      L---GL----AN-G-KGLSSILTGAH----GLEEALQQ-LDALPGLWVLPGGPRPP-NPA
A0A2V9WI32      L---GL----RN-T-SGLSTLLTGGD----GSQNAILS--TEIPNLFVLTAGPPPP-QPA
A0A2V8IVN9      F---GM----TQ-E-PGLSNLLVGTA----KASESVRR--SKTAGLWLLPAGKIPP-NPA
A0A1F2TPT3      F---AF----PQ-E-PGLSNVLVSGA----KAGEVVRR--SAVANLWVLPAGRCPP-NPS
A0A2V8JTQ2      M---RL----SG-N-TGLGPLLRNTV----TFEEAVVS-WANVPNLFILPAGPVFL-PGD
A0A2V8UZY0      M---RL----SC-N-TGLGALLRKSV----TFDEAVIQ-RAEVPNLYILPAGPVML-PDD
A0A3N5YNR8      F---GY----NG-N-QGISAYLSGNG----DLSSQIRQ--TNYPNLFLLPAGFRPP-NPA
A0A350UEK1      F---EV----PN-D-AGLTDLLKPGD---GDWKKLIHE--SGAPGLWVLPAGPGVA-APS
A0A350UIQ4      F---EI----EN-E-AGLSDLLKPDC---GEWKKLIHQ--TPVPNLSVMTAGPGVA-AAS
A0A3N6A5T6      F---GL----NG-H-QGMSYFLTGNS----DLTSQVRK--TSVPNLFVVSAGYVPP-NPA
A0A1F2Q9L4      F---GV----SN-R-LGLVNFLTGSA----DETGIFLR--TSVPNLYLTPTGPVPP-NPS
A0A1H5SQF5      L---GL----TN-G-SGLSQCLTSDI----DPASVIQV-HPDMDKVHVMTSGPVPP-APS
A0A3E0NV31      F---EV----DS-E-NGMSKFLAGRA----EFADLLQQ--TKHKNLALVSAGPCPP-NPT
A0A3N5M5V0      F---GF----TG-N-QGISSYLSGNA----DLSSQIRQ--TSYPNLFLLPSGFRPP-NPA
A0A2V9AEW6      F---GM----TN-R-WGLNDVLLSDTPFEEFPMSHLAR-KTEVAGLSVLPSGNCGV-TPT
A0A2V8WQK6      F---GV----AN-T-WGLSDLLWADNPLETVPISHLVR-ETEVSSLSLLPGGSCGI-TPS
A0A2V8XIF4      F---GA----PN-N-WGLSDVLWGDTPLETLPISHLVR-ETEVAGLSLLPGGSCGI-TPT
A0A3N5XQP8      F---EI----EN-K-WGMSVYLSGHS----DLEQEIQP--TGVPNLSILPAGLRPP-NPA
A0A2Z5G7H4      L---GM----ES-R-TGLSQYLTDER----SPEDILEV--GRLPKLHLLTSGPVPP-YPA
A0A2V9L5B5      V---GV----KN-S-PGFVQCLTGHV----ELAEAVLP-APGVPNLSVIPCGPIPP-NPA
A0A2V9LK56      T---GV----PN-R-PGFVQCLAGRV----ELKQAIFP-VPGTENLFVIPCGPIPP-NPA
A0A2V9L7I0      T---GV----RN-A-PGLVQCLTGKG----DLAQAVLP-VPGVANLNVIPCGPIPP-NPA
A0A522PPT0      T---GV----RN-S-PGFVQCLTRRV----QLSEAILP-VNGIPNLSIIPCGPVPP-NPA
A0A2V9KCS3      F---DV----AN-T-WGLSDLLREKDAVDDYPFEALSR-KTLIPGLYVLPSGPGTV-SIS
A0A2U3KC61      F---GF----QS-R-GGLSTLISGSD----KVEDVVIP-CPEVPNLWVLPAGPIPP-QPA
A0A2V9Y2R7      F---GI----RS-G-GGVSTVISGVE----KFEDVVVP-FTQVPKLWILPAGPIPP-QPA
A0A372IT17      L---NM----PE-S-PGLSEALAGSA-----APPEPQP-LTALPSLALLHAGRKPP-FPS
A0A136JPP4      F---GL----SN-S-QGLTNYLSGEK----STENLIKA-APGLPHLKIITSGPIPP-NPA
A0A399WUJ8      F---GL----SN-T-QGLTNYLSGEK----STENLIKA-APGLPHLKIITSGPIPP-NPA
A0A2V9NGH6      L---GM----GP-R-TGLSSVLTGSA----NVQQTIVR-SALLPSLFILPAGPPPP-NPA
A0A2V9PYE6      L---GM----GP-R-TGLSSVLTGSA----NVQQTIVR-SALLPSLFILPAGPPPP-NPA
A0A2V9NL07      L---GM----GP-R-AGLSNVLTGGT----TLQQATVR-STLLPNLFILPAGTPPP-NPA
A0A2V9QD92      L---GM----GP-R-AGLSNVLTGGT----TLQQATVR-STLLPNLFILPAGTPPP-NPA
A0A2V9WPZ6      L---GM----GP-R-SGLSNILTGSA----TLQQAITR-SPLLPNLFVLPAGTPPP-NPA
A0A2V9ZLH4      L---GM----GP-R-SGLSNVLTGSA----DVQQTITR-SQVVPSLFVLPAGTPPP-NPA
A0A2V9RQF1      L---GM----GP-K-IGLSNVLTGNA----PLQQAIVR-SNVLPSLFVLPAGPPPP-NPA
A0A2V9YDK8      L---GM----GP-R-SGLSNVLTGSA----TLQQTITR-SPLVPSLFVLPSGTPPP-NPA
A0A2V9V8F7      L---GM----GP-R-SGLSNILTGSA----TLQQAITR-SPLLPNLFVLPAGTPPP-NPA
A0A2V9XGR9      L---GM----GP-R-SGLSNILTGSA----TLQQAITR-SPLLPNLFVLPAGTPPP-NPA
A0A2V9V3Q5      L---GM----GP-R-SGLSNVLTGNA----TLEQAISP-SPILPNLFILTAGSPPP-NPA
A0A2V9NWS3      L---NI----AT-K-IGLSNVLTGNA----TMSQATVR-STILPTLFVLPAGPPPP-NPA
A0A2V9USA9      L---GM----GP-R-SGLSNVLTGST----TLQQAITR-TPILPNLHVLPAGTPPP-NPA
A0A2V9XW18      L---GM----GP-H-SGLSNVLTGST----TLEQAISD-TTILPNLFVLPAGTPPP-NPA
A0A4R1LC91      F---NV----SD-T-LGLSSVLAGQIDSYLDAGTTAPL--KQVPTLHVLPAGPIPP-YPT
A0A3M2BZG9      F---KT----SN-R-LGVVNHLTGTE----RAEDLVLP--TAVPNLYLCPSGPIPP-NPS
A0A1Q7N5R7      L---GG----VR-K-PGLTDFLAGRV----PLEAVKQA--LPYPLLHFIGAGSRLR-ESP
A0A3M1SIV3      F---SL----KN-S-VGLTNYLSGDQ----ELQDLLKS-PEGLPKLKIITSGPLPP-NPA
A0A3E0PHB0      F---DL----EN-T-HGLTNYLSGER----NTDNLLKP-YPKLPNLKVITSGPIPP-NPA
A0A3M2D491      L---SL----SN-K-TGLTNYLSGDQ----SLEGLLKP-IPELPNLKVITSGPIPP-NPA
A0A357F267      F---DL----DN-T-HGLTNYLSGER----NTDNLIKS-CRDLPRLKVITSGPIPP-NPA
A0A353C9L6      F---DL----EN-T-QGLTNYLSGER----NTQNLIKT-CRDLPRLKVITSGPIPP-NPA
A0A2V8RQV0      F---DL----DN-T-QGLTNYLSGER----NTENLIKS-SRELPRLKVITSGPIPP-NPT
A0A2V8SJH5      F---DL----EN-T-QGLTNYLSGER----NTEHLIKT-CRELPRLKVITSGPIPP-NPA
A0A2V9QB26      F---GL----PN-G-RGLSSLLRDPQRALAKLSRIVQE--TNIPGLFVLTSGPLTE-SAA
A0A2V9VYY4      F---GV----RA-H-GGLSTLISGSS----NVEEVILP-SSEVPNLWILPAGPIPP-QPT
A0A2V9KIE8      T---GV----EN-K-PGFVQCLTGRV----QISEAILP-VPGVANLWVIPCGPIPP-NPA
A0A352F549      L---DM----SN-D-DGLSAILSSEV-SEADVLSKIRK--YQDSNVYLLSSGAIPP-NPA
A0A3B9MLP9      F---GL----SN-N-EGLSAILSSET-SEAEILAKINR--YLETDIYLLSSGAIPP-NPA
A0A3D5SQ87      F---GL----SN-N-EGLSAILSSET-SEAEILAKINR--YLETDIYLLSSGAIPP-NPA
A0A2V8NW86      F---DL----PN-G-HGLSSLLRDPQRAVAKLSRIVQE--TKIPGLFVLTSGPLTK-NAA
A0A2V8ZHL8      L---DL----ID-G-EGLAGFLTGAH----SIEAALIQ-FSPVPALRVLPAGPKPP-NPA
A0A2V9B240      L---DL----VD-G-EGLAGYLTGAH----SIEAALRQ-FSPVPTLWVLPAGPKPP-NPA
A0A2V9CBM2      F---GA----RE-S-SGLVSYLTDPQ----DWRTLVRH--SGSSGLDLLFCGPVPP-NPS
A0A2V8XN17      F---GI----DR-S-LGLVSYLTGQQ----DWRAVVHP--SGSRGLDLLLCGPVPP-NPS
A0A2V8WX45      F---GT----SG-S-LGLVSYLTGQQ----DWHAAVRP--CGSHGLDVLVCGPVPP-NPS
A0A1Q6YR79      F---GI----DR-T-LGLVSYLTGQQ----DWRAAVHP--SGSRGLDLLVSGPVPP-NPS
A0A1Q7VA32      F---GI----DR-T-LGLVSYLTGQQ----DWRAAVHP--SGSRGLDLLVSGPVPP-NPS
A0A2V9EY85      F---GI----DR-T-LGLVSYLTGQQ----DWRAAVHP--SGSRGLDLLVSGPVPP-NPS
A0A2V9H8K0      F---GT----SG-S-LGLVSYLTGQE----DWRAVVRP--SGSRGLDLLVCGPVPP-NPS
A0A2V9FFE5      F---GT----SG-S-LGLVSYLTGQQ----DWRAVVRP--SGSRGLDLLVCGPVPP-NPS
A0A2V9GM43      F---GT----SG-S-LGLVSYLTGQQ----DWRAVVRP--SGSRGLDLLVCGPVPP-NPS
A0A1F2RFI7      L---EL----PA-TPAGLSTYLTGQF----GLDDVVTP--TQIPNLFAIPCGPIPP-NPA
A0A1F2RZS3      L---KL----PT-TPAGLSTYLTGQF----PLEDVLVG--THVPNLYAVSCGPVPP-NPA
A0A1F2USE2      F---QL----YE-S-GGLSSYLTGQA----EWRRYALS--TGVPHLDLMACGPIPP-NPA
A0A2V9C238      F---DI----DN-S-LGLVSYLTGQQ----DWRAAVRP--TGLESLDALVCGPVPP-NPA
A0A1F2Q9F5      F---KM----AG-G-RGLVSYLTGQQ----EWEAVVHP--SPVENLDLVICGPIPP-NPA
A0A1F2QQH9      F---KM----AG-G-RGLVSYLTGQQ----EWEAVVHP--SPVENLDLVICGPIPP-NPA
A0A1F2QXK7      F---KM----AG-G-RGLVSYLTGQQ----EWEAVVHP--SPVENLDLVICGPIPP-NPA
A0A2V9DEM9      F---DI----DN-S-LGLVSYLTGQQ----DWRAAVRP--TGLESLDALVCGPVPP-NPA
A0A2V9CYQ5      F---GA----RE-S-SGLVSYLADHQ----DWRTLVRH--SGLSGLDLLFCGPVPP-NPS
A0A2V9BWU8      F---CI----RE-S-LGLVSYLTGQQ----DWRTAVCP--SASPGLDLLLCGPVPP-NPA
A0A2V8ZG48      F---CI----RE-N-LGLVSYLTGQE----DWRTAVCP--SGSPGLDLLPCGPVPP-NPA
A0A2V8Y334      F---CI----RE-T-LGLVSYLTGQQ----DWRAAVCP--SGSPGLDVLLCGPVPP-NPA
A0A2V9AY68      F---CI----RE-C-PGLVSCLTGQQ----DWHAAVCP--SGSPGLDLLLCGPVPP-NPA
A0A257VBK0      L---KA----PA-GVRGLTNYLAERTAQI-E---DFVV-PGPQPNLFVLYSGPTPP-NPP
A0A2V7XDY0      L---GL----TR-EP-GVTNFFVNHEDLD-----ALVR-PTRVPNLFALTTGPLPP-NPP
A0A350UQT3      F---GI----PL-GA-GLSNVLNGETGWR-D---VLVR-PANNEYLEIITAGPPSR-RAA
A0A2U3JZ71      F---EV----PS-TR-GLSNVLTSGIPWR-T---VLVR-PDGHPNLDILPAGPPSR-RAA
A0A2V8TTB0      Y---QV----PN-SV-GLSNVLLQQISWR-D---VVIR-MDDPKGLDVLPAGPPTR-RAS
A0A1F2TCR2      V---GI----PN-SV-GLSHLLVGQVRVR-----EAVQ-RTSEANLFVMTAGRTPP-NPS
A0A2N9LQU7      L---GL----EAGTSAGLSSMISGNDASE-A---VRKP-FPQLPTLEVIAAGPQTP-WPA
A0A2P6WFK7      F---GL----PY-SRYGTSTVLTRGMDER-A---IVTP-LKSLPSLKLMPAGPHPP-NPA
A0A1F2V330      L---GL----KP-GK-GFSDLLRAPEDEIGK------Y-VSKLGDLYIMPGGSSLA-NPV
A0A2V8U914      F---GL----AN-SW-GLSDILRERNATEDLPLDALVK-KTGVPRLYLLPSGPCTD-SIF
A0A662EE63      M---KV----KN-MR-GLTSLVLGESQLK-D---VIHG-LADVPNLDMVTSGPLPS-NPP
A0A2V7W309      F---PG----KL-NL-GIVNYLAANIPFE-----DTVQ-PTQVPNLSVVLSGPIPP-NPS
A0A2V8TLH7      L---KL----SK-DQ-GITNYILSTEGDDWR---TYLK-TTDQSNLYALTSGPIPP-NPA
A0A1Q7ZJT1      L---NL----GR-DG-GVTNYILSSEGDDWR---SYIK-NTDMPNLYAMTCGPIPP-NPA
A0A2V8VC99      L---NL----SR-DH-GVTNYILSSDGDDWR---NYIK-ASDLPNLYALTCGPIPP-NPA
A0A348UZU3      F---NL----KN-HD-GLSNYLTMGLELK-----KLVK-TTMVPSLYFINSGPIPP-NPA
Q01XL7          F---GL----DN-CP-GLSDLLTSTESLEEADLAPYLS-PTKVDNLRVMTHGLAQVGTPA
A0A2V8ERZ5      L---RL----TN-DR-GLSQVLTGQARVR-----DVIQ-RTVDPNLLAITAGRSPL-NPS
A0A2V8GTX0      M---RL----PN-DR-GLAELLSGKARMR-----EVVQ-RCGDPNLLVIPAGHTPS-NPS
A0A2V8J0X9      V---GL----RN-ET-GLSHLLVGQARVR-----EAVQ-RTSEPNLVVITAGRTPP-NPS
A0A523DUV7      L---RL----YR-EP-GLADYCTRDLKLD-----VIIQ-STREPHLSAVTSGKLPP-NPP
A0A372IRG7      F---RL----SN-RT-GLSTYLSRESKEE-S---FEYP-IPGLPNLAVMTRGPIAP-NPG
A0A1F2U158      L---RL----TN-DR-GLSQILTGQARVR-----DVIQ-RTVDPNLLAITAGRTPA-NPS
A0A2V8F6S9      L---RS----TN-ER-GLSQVLIGQARVR-----DVIQ-RTVDPNLLAITAGKTPP-NPS
A0A4Q1SCH5      F---GV----SN-TI-GISDLLIDRGTSK-D---IAQP-IEELPNLHFLPAGKSVA-FPS
A0A2W0BGU4      L---GI----QN-ER-GMSTHLTGHDSIN-D---VIQP-YKEQPNLWLIPSGPIPP-NPA
A0A2W0BVQ9      L---GI----QN-ER-GMSTHLTGHDSID-D---VIQQ-YGEQPNLWLIPSGPIPP-NPA
A0A3D1ASD2      F---DM----PM-NA-GLSSVVLQSANWR-E---VVVP-AENVAGLDVLPAGPPSR-RAA
A0A2N9MK30      L---GL----TS-ET-GLSAVLLHGLAWR-D---CVMQ-APGVPNLDVLPAGPTSR-RAS
A0A1I6MH75      F---GL----SG-K-VGLSTLLTGTTGLE-E---SLQR-VPEVPNLDIMASGPVPP-FPT
E8WVF6          F---GL----NG-K-LGLSTILSGQTTLE-N---SVQT-LKEVPTLDILASGPVPP-FPT
A0A1H5Z7N3      F---GL----NG-K-IGLSSVLTGSATLE-Q---ALQR-VPELPNLDVLVSGPVPP-FPT
A0A2V9YHT3      L---GI----RS-NGGGLSTLLAGQHSAE-E---VLVR-SNQLSNLYVLPAGPPPP-QPA
A0A1G7JVV8      F---GL----NG-R-VGLSTVLSGGATLE-E---AVKN-VPEVPNLDVLCSGPVPP-FPT
A0A1H4T6W9      F---GL----NG-R-VGLSTVLSGGSTLE-D---AVKN-VPEVPNLDVLCSGPVPP-FPT
I3ZEU5          F---GL----NG-R-VGLSTVLSGGSTLE-E---ATKN-VAEIPNLDVLCSGPVPP-FPT
A0A5B9EBI2      F---GL----NG-K-VGLSTVLSGSTSLE-E---AVQQ-VADVPNLDILASGPVPP-FPT
A0A239HDF6      L---GL----EG-R-LGLSTYLSGSSTLE-E---SLQH-LDELPSLDILTSGPVPP-FPT
A0A4Q0T270      F---GL----SG-K-VGLSTVLSGGSTLE-D---SLQH-VTEVPNLDILASGPVPP-FPT
A0A1Q3QQB6      F---GM----SG-K-TGVTTVLTGAAPLE-E---AVQT-VPEVPNLDILPAGPMPP-FPT
A0A3N1K1G7      F---GL----NG-K-VGLTTVLTGATTLE-D---TVQH-IPDAPNLDILPSGPVPP-FPT
A0A428MDU2      F---GL----NG-K-VGLTTLLTGASKLK-D---TVQN-IPNVPNLDILPSGPVPP-FPS
A0A4V2G466      F---GL----TS-K-IGLSTLLAGATTLE-A---AIQK-IPEVPNLDVLVSGPMPP-FPT
A0A4Q7YNP3      L---HV----PN-DV-GLRNLLRGEIDLARATIGTFCK-ATRIPNLSVIPSGSGSE-EVV
A0A2V9MN96      L---GL----KT-SG-GLSTLLSGVDTME-N---VMVP-FPGLPFLQVLPAGPIPP-NPV
E8UZE1          L---GL----PK-TEKGLSNLLAVSQSPP-L-VEYLHP-AAVFPGLDFLPAGPLPP-SSS
A0A2V7V2Z1      L---RG----RK-SP-GVSDLLVGQARPS-E----AIQ-RPAGTTLSLLASGTRAP-SPA
A0A2V7X2F7      L---RG----RR-TP-GLSDVLVGKAKPS-E----AIQ-VFAGGH-SLLPAGTTVP-SPA
A0A2V7V2I1      L---GL----KK-SP-GLSDILVGLADTA-E----CVE-RVKGTNLSLLPSGSHAP-SPA
A0A2V7U3M2      L---HA----KR-SP-GLSDLLVGRARPS-E----AIQ-RPAGTTLSLLAAGTRAP-SPA
A0A2V7UHT0      L---RG----KK-SP-GLSDLLVGKARPS-E----AIQ-RPSGTTLSLLAAGTRAP-SPA
A0A2Z5FVL3      F---NS----SL-EV-GLSTILAGQLSVD-AMGQAFLQ-VEAVPGLDILLSGPIPA-YSA
A0A1V6HR88      F---GM----SN-RA-GLVSYLTGQVPPE-Q----IVL-RTDIPNLYAIPAGPSPP-NPS
A0A2V9KBD6      M---QL-----N-ATAGLGALLKKSVAFE-E---AVCS-FPNLPDLFILPAGPVTQ-PED
A0A2W0AJ66      M---QL-----T-STIGLTALLSNSAPFE-D---AVIR-CAELPNLFILTAGKVSL-PED
A0A1Q7RBU1      M---GL----KT-TNAGLGALLRKSTAFE-E---AVMG-CTDVPNLFILPAGPVNL-PDD
A0A2V9JPV9      M---GL-----S-TNTGLGALLRKSTVFE-K---AVSD-CAKIPNLFILPAGPITL-PDD
A0A3E0P0A3      L---GI----SN-RV-GLVNCLVHQTELE-N----VVQ-ATPVPNLWVLPSGPLPP-NPS
A0A2V8EXP2      F---GI----AQ-EP-GLSNVLVGNAKPS-D----AVR-ITSVPGLWAMPAGMIPP-NPA
A0A2W4RYA1      F---GL----AQ-EP-GLSNLLVGTAESR-E----CVH-ETPVEGLYVLPAGHIPP-NPA
G8P0Y7          F---KI----KG-HV-GLSNVLTGGAKVR-D----AIQ-STVQPNLFVLPAGLVPP-HPS
A0A5M8T4U7      F---RI----ND-RSFGLSSVLSHPEERR-M---APNP-VPELPQFHILPTGMRPP-NPA
A0A3P0X3W6      F---SL----PN-EE-GLADVIMDGRSLA-D---VLHT-IEGIENLHVVTAGASAM-RAA
A0A1E3Y9R6      L---DR----SQ-EP-GLSNVLVGEASLA-D----AAR-TTAVPNLTLLAAGHIPP-NPA
A0A2W4TLP2      L---DR----SQ-EP-GLSNVLVGEAALA-D----ALR-PTSVPNLTLLAAGHIPP-NPV
A0A3R9WF43      F---GC----EN-SP-GLGDVSAADTHIE-V--SNLIQ-HSSIKTLYILPAGNRPD-LPS
A0A317HKM4      F---GE----EQ-QP-GLADVLAGKTTSR-D-----FR-QTKISRLWLLPAGTASR-HPA
A0A523E0N1      F---RY----RN-RV-GLSNVLTGQKSLK-D---GCIM-RTEIPNLYLMMSGPKSP-NPG
A0A523ECP2      F---RF----KN-RV-GLSSVLSGQTSIE-K---GCVF-STLIPNLYVLLAGPASP-TPA
A0A2W0C122      F---GI----AG-TP-GLSDLLSGGAGEE-C---VIHK-IEGVANLSIVAAGSSPA-MTA
A0A2W0AUU7      F---RI----AS-TP-GLSDLLSGSAGEE-P---VIQQ-IERVSGLSIVSAGSSQA-RTA
A0A2W0BQL1      F---RI----AS-TP-GLSDLLSGSAGEE-P---VIQQ-IERVSGLSIVSAGSSQA-RTA
A0A4Q1SDL1      L---EF----SG-KD-GLSLLLTEEEQVP-H----ILT-VDGVPNLSLLPSGPVPV-NPS
A0A3P0XH15      F---RT----SN-RF-GLSTLLVRENEES-S---YENP-LPDLPNLTLVTRGPVTV-NPG
A0A4R1LAZ7      F---RR----SN-RV-GLSTLLSRESGAE-A---YEQP-LADLPNLTVVSRGPVAP-NPG
A0A3M1WQW8      L---SI----NH-QP-GLSTYLTRGITID-S---VIVP-N-RIDNLWIIPSGPVPP-NPS
A0A3N1JHC1      F---GV----QN-IE-GLSNTLDEAECAD-P--NSLIQ-TTAFPGVSILTSGTTKG-NIV
C1F294          F---RV----SN-RV-GLSTYLSRESGEE-S---IVFP-LPELPNLGVLPRGPVAP-NPG
A0A2V9KA79      L---DI----RP-GT-CFDDLLVQPRLAI-E---DCLT-TVRTLHV-MLGRRSLAN-NPV
A0A522PSP1      L---DI----PN-RL-GLSSILQDQAKVQ-E---AVVP-G-QIDRLSILPAGPLSA-NAR
G8P085          F---GV----EN-KR-GLSNLILGDDTAE-P---FTNP-LPDLDNLFLLTAGKKVA-LPS
A0A4Q1SGQ1      L---GM----PA-GL-GLRHALRSKS--E-P---AIQK-FPGLPSLSVLCGSTAAS-MPA
Q1ILD9          A---GA----QE-GD-GLTECLSGLRRWT-D---VVQD-ASGIAGLRILSAGVRPP-NPA
Q1IJZ6          A---MK----EN-DR-GLSNLLTSVAEPS-D---FIQK-DSSAPNLDILCAGPIPP-NPA
A0A2V8TCE6      F---GL----RN-GS-GLSTFLCGKASLE-E---AVQM-T-LVARLWLLASGPVPP-NPA
A0A522TBE8      F---GV----AN-QR-GLSPVLRGTMDLE-A---ALQP-S-RRDNLTLLTAGPTVT-NSA
Q1ITG0          L---KV----MP-EG-GLSECLAGRKSWR-D---LIIP-VNGVANMWVLPAGHRPP-SPA
A0A3N5PCI5      L---EC----EQ-RP-GLAEVLTGKRKPS-E---AIVA-T-RSPGVWLLPSGAGIA-SPS
A0A3M1Q0S9      L---KA----ST-GR-GVSTYLTGMSDLP-A---LVQT-S-DLERVAVIPAGPIPP-NPA
A0A2Z5G448      F---RL----PN-RE-GLSTLLVRESGSS-A---YQSP-IDDLPNLFVLTRGPIAP-NPG
A0A3M1VZ38      L---GV----EK-DR-GVSTFLTGLNDLD-P---LIQQ-T-RIDRLSLIAAGPVPP-NPA
A0A4Q1SD29      F---RM----SN-RV-GLSTLLSRESGNE-S---FEHP-IPELPNLTVLSRGPIAP-NPG
A0A3M1PY35      F---KA----PR-DR-GLANVLAGATGLD-D---VLFE-T-RYDNLALVPGGPCPP-DPA
A0A3M1VMP2      F---RV----PS-ER-GLTNLLASHDPAD-G---FVVP-T-RYANLHLLPGGPCPP-DPA
                                                                            

A0A2V7VMF7      AMLARKNVADLFSH--LRR--QFEWILVDSPPLASVTDALLLARHADLAVMVVQHNNVDK
A0A2V7YYV7      ELLGSGRMRELMAR--LRT--SFSYVIVDTPPVNAVTDASILSASANGTILVVEHGQTSF
A0A2V7Z0J5      ELLGSGRMRELIGH--LLA--NFNYVIIDTPPVNAVTDAAILAAYANGTILVVEQGRTTF
A0A2V7Z3M4      ELLGSGRMKDLMSR--LSD--AFVYVIIDTPPVNVVTDAAILSAQASGTVLVVEQGRTTF
A0A399Y5V2      DLLGSARVSELIET--LGT--LADYVVIDSPPIVPLSDAAVLAPKTDGAIIVAKAGQSSR
Q01X01          GLLCSGRMARLLPR--FRQ--EFDYVIVDAPPCLEFADARIISRYTERLLLVVRADYTDR
A0A3M2D9H8      EVLSSERMATLLSE--VAT--RYDKVILDGPPFL-ISDAIVLASRVDGVLLTLRARSTSQ
A0A2V8JK38      ELILSPRFKEVLKS--LKK--DFDLVILDSPPLSNVSDGRILASVSDTAILVVKAFSTSR
A0A2V9IXG5      YLLSQPSLRDFISY--LSD--RYDWVLIDTPPVTSVTDPVIIAALVDTILFVIKYNFVDK
A0A2V9J2P4      YLLSQPSLRDFISY--LSD--RYDWVLIDTPPVTSVTDPVIIAALVDTILFVIKYNFVDK
A0A1Q7RLS4      DVFGHERFLSLLKE--LRA--EFDWVFIDSPPVVSLADSMILASLADMVAFVIRHNENDK
A0A2V2R525      ELLSSGQMRRLLEI--TSP--SFTHVVIDSTPVVSFTDSVLIANLVDGVILVVQGGKSPK
A0A321LPW6      ELLSSQKMKDLLSA--MSE--RFDHVLIDSPPLINVTDPIILSTIVDGVILVVHGGRSTR
A0A2V9R9V4      ELLSSERMKRLLAQ--LSE--RYDHIVLDSPPLASVTDAVILSTMVNGVILVVHGGRNSR
A0A321LE75      ELISSEKMKNMLAM--LCE--RYDHIVIDSPPLMHVTDPVILSTLVDGVILVVHGGKSTR
A0A2V8R8U7      ELLGSEEMRKLLVS--LSE--KFTHIIVDSPPAISFTDSSILSTFVDGVILVVHGGRSSR
A0A2V8QMP4      ELLGSEEMRRLLYV--LSE--NFTHIVIDSPPAISFTDASILSTMVDGVMLVVHGGRSSR
A0A2V8R4S3      ELLGSEEMRRLLYV--LSE--NFTHIVIDSPPAISFTDASILSTMVDGVMLVVHGGRSSR
A0A2V8NJ55      ELLGSDEMRKLLNS--VSE--RFTHVIIDSPPSISFTDASILSTMVDGVMLVVHGGKSSR
A0A2V8Q7I0      ELLGSEEMRRLLGQ--LGE--RYAHIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSSR
A0A2V8S6K4      ELLGSEQMRRLLQL--LGE--QFTHIIIDSPPAISFTDASILSTMVDGVVLVVHGGRSSR
A0A317I2L9      ELLGSEEMRRLLGT--LSE--RFAHIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSSR
A0A2V8LLF9      ELLGSDEMRKLLIL--LSE--RFTHIIVDSPPAISFTDASILSTFVDGVILVVHGGRSSR
A0A352FRF4      ELLGSEEMRNLLLS--LRE--KFTHVIVDSPPAISFTDASILSTFVDGVILVVHGGRSSR
A0A2V8MKV0      ELLGSEQMRRLLTL--LGE--KFAHIIVDSPPAVSFTDASILSTFVDGVILVIHSGRSSR
A0A2V8PYY8      ELLGSEQMRQLLTS--LGE--RFAHIIVDSPPAVSFTDASILSTFVDGVILVIHSGRSSR
A0A1Q7YKQ8      ELLGSDEMRKLLSE--LSE--RFTHVIIDSPPAISFTDASILSTLVDGVILVVHGGKSSR
A0A352F3R7      ELLGSDEMRKLLGI--LSE--RFSHIVLDSPPAISFTDASILSTMVDGVVLVVHGGKSSR
A0A0B6WXT1      ELLSSEEMRRLIDE--ASA--RFAHVIIDSPPAVSFTDAAILSTMVDGVVLVVHGGHSSR
A0A3B9MEU8      ELLGSDEMRKLLGI--LSE--RFTHIVIDSPPAISFTDASILSTMVDGVVLVVHGGRSSR
A0A2V8MHG6      ELLGSDQIRSLMSV--LEN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASR
A0A2V8P7N1      ELLGSDQIRSLMSV--LEN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASR
A0A2V8M3M6      ELLGSDQIRSLMSV--LEN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASR
A0A1Q7NJH5      ELLGSDQIRTLMSV--LGN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASR
A0A2V8PJY0      ELLGSDQIRTLMSV--LEN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASR
A0A1Q7Y6W9      ELLGSEQMRKLLSC--IEK--TFTHVIIDSPPIASFTDGVLISTIVDGVLLVVHGGKSSR
A0A2V8NC68      ELLGSDQMRRLIAA--LEN--TFTHVIIDSPPVASFTDGVLLSSIADGVLLVVHGGRASR
A0A399WK13      ELIGSDQMAKLLKM--LQG--HFTHVVVDSPPIASFTDGVLIASMVDGVVLVVNSGKSSR
A0A352FLX4      ELVGSEQMLKLLSV--VAD--NFAHIVVDSPPIAAFTDGVLIAAIVDAVLLVVHSGKSSR
A0A2V8RTL7      ELIGSEQMVGLLKT--LQS--EFTHVVIDSPPITSFTDGVLLASLVDGVILVVHSGKSSR
A0A3E0PCJ6      ELVGSEQMKRLLVT--LEK--NFTHLVIDSPPIASFTDGVLMASLVDGVIMVVHSGKSSR
A0A3M1S4R8      ELIGSTQMSTLMEI--FQK--EFTHVIIDSPPIASFTDGVLIAAMVDGVIMVVHSAKTSR
A0A1Q7YFI6      ELIGSEQMQRLLAT--MRT--SFTHIVIDSPPIASFTDGVLMSTMVDGVLLVVQGGKSSR
A0A136KC10      ELIGSEQMAKLLKT--LEG--HFTHVVVDSPPIASFTDGVLIASMVDGVILVVHSGKSSR
A0A2V8SEX6      ELIGSEQMANLLKL--LSQ--NFTHVVVDSPPITSFTDGVLIASMVDGVILVVHSGKSSR
A0A3M2D6Y5      ELIGSKSMLNLMEI--LHN--EFTHVVIDSPPIASFTDGVLIASMVDGVIMVVHSGKSSR
A0A0B6WWQ6      ELLGSDQMRALLEE--LRA--RFDYIIVDSPPIAYFTDGVVVATLVDGVMLVVRRGKSSR
A0A3B9MK99      ELLGSDQMRRLMAT--LQS--QFSHVVVDSPPVNSFTDGVLLSSMVDGVLLVVHGGKSSR
A0A352EX26      ELLGSEQMRRLMTL--LQA--EFTHVVVDSPPINSFTDGVLISSLVDGVLLVVHGGKSSR
A0A2V8MM59      ELLGSDQMRKLIAV--LSA--QFTHIVIDSPPVSSFTDGVLIASMVDGVLLVVYGGKSSR
A0A2V8PFE8      ELLGSEQMRKLIAV--LSG--AFTHIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSR
A0A2V8PWS6      ELLGSEQMRKLIAV--LSG--SFTHIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSR
A0A2V8LCT5      ELLGSEQMRKLIAV--LSI--PFTHIVIDSPPVSSFTDGVLIASIVDGVLLVVHGGKSSR
A0A352FTJ9      ELLGSDQMRKLLAT--LSE--KFTHVVIDSPPVNSFTDGVLLGSMVDGVLLVVHGGKSSR
A0A2V8G155      ELLGSERFRDLLLS--LQT--RFDWIIIDSAPIMAVADASVMAHRATGVLFVVGSEMTSR
A0A2V8HDM7      ELLGSERFRDLLLS--LQT--RFDWIIIDSAPIMAVADASVMAHRATGVLFVVGSEMTSR
A0A2V8DRT9      ELLGSKRFEDFIET--LKD--HFAFVIIDSPPIMAVSDSAIVAHMADGVLFVIGSEMTSR
A0A2V7VYF3      ELLGSMKFKEFLAT--LKE--RFDWVIIDSPPVMAVTDACILAH---------GAEMTNR
A0A1F2SVH2      ELLGSKRFKDFMAS--LVE--HFDWVMIDSPPVMAVTDSSVIAHLATGVLFVVGAEMTSR
A0A2V8AJG9      ELLGSKRFKDFIST--LGQ--HFDWVIIDTPPVMAVTDSCIAAHRTHGTIFVVGAEMTSR
A0A2G6PYV5      ELVASQKMREVLTE--LKA--NFDFIIIDTAPLLAVTDASILGNIVDSLIFVTKASATSR
A0A2V8F956      ELLGSQRFKDFLVS--VKE--HFDWVIVDTPPVMAVTDARLVAHHATGVLFVVGAEMTSW
A0A1F2S1W5      ELLGSKRFKEFAAF--LMQ--YFDWVLLDTPPVMAVTDASIVANLSHGVLFVVGSEMTSR
A0A1F2T595      ELIGSRRFRDFTAF--LLQ--HFDWIIVDTPPVMVVTDATIAANFAHGVLFVVGAEMVSR
A0A2V8JQV5      HLLHSTRLPELLQR--LRK--DYDLILIDAPPVLQMADARVLGRLADGVVFVIRSGRTTR
A0A2V9AC41      ELLGSRKMHELLQQ--LRE--QFEFIFIDSSPVMAVSDAVFLSTMVEGTLMVVNR-RTPK
A0A2V8K4L4      TLLYSARLPEIIEI--TRQ--SFDTVIIDSPPMLHIADARLLAKHSDSVLLVLRAGKTTR
A0A2V8NCZ3      TLLYSARLPEIIEI--ARQ--NFDTVIIDSPPMLHIADARLLAKHCDSVLLAVRAGKTTR
A0A2V9MAM9      SLLFSPRLRRLIER--FRE--EFDHVIIDAPPSLEFADARLLGLTADGVLMVVRANHTDN
A0A2V9M454      ELLCSTKMENLIKH--LRD--QYDHLVLDSPPVLPITDATILSSLVDGVIMVVECEATTR
A0A2V9IVR7      DLLSSPDMARLVEE--LKQ--RFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPL
A0A2V9ILE2      DLLSSPDMARLVEE--LKQ--RFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPL
A0A2V9LGY4      DLLSSPDMARLVEE--LKQ--RFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPL
A0A2V9J4D6      ELLSSPEMQSVMQN--LRQ--RFDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSSGSTPP
A0A2V9L9C5      ELLSSPEMQSVMQN--LRQ--RFDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSSGSTPP
A0A2N9M9N1      ELVSSPAMGRLVSE--LRQ--RFEHIVLDSPPLLLVTDGVLLSTLADGVVLVVESGSTSR
A0A2V9JEC4      ELVSSATMEQVIGE--LRR--RFDHIVIDSPPALVFTDATILSALVDAVVLVVESDVTTR
A0A2V9LPQ3      EMLSSPAMRQLITE--LVE--RFKHVVIDSPPLLMVTDATILSTMVDGTVLVAESGVTSP
A0A348V070      EVMFSEKMRAFITF--LKQ--QFDFVLFDSPPVLAVSDALVLGKQVDGLILVVRAGQTPV
A0A2Z5G3A3      DLLSSTRMLEALAA--WRR--EYSFVIIDAAPVLSATDSVILSGLVDTTLLLGRYKYTDR
A0A2V7UGP8      ELLASEHFDFLLAA--LKSSARFDHVLIDSPPLLSVADPVIMASKAGATILVVQCGRTSR
A0A239MKT6      ELLGSKRFLAILEK--ARK--EFDYVLIDGPPVLLVTDPLLIAPHADAIVAVFRSGRSTK
A0A3E0PCN7      NLLGSIEMRSLLDR--LGA--RYSHIIIDSPPILYFADSVILAANVEAVVIVSRANFSSY
A0A2V8IYW3      GALTSETMQRIVKE--GRE--QFDWVLIDTPPIGLLPDAGLLGGIADGALLVVRAGHSPF
G2LEI9          ELLGSQRMRSLLAY--AVE--KFDYVILDTPPMLSFADATILAAMADSVILVVNCQRSKR
A0A317J121      KMLYGSEIRRFFQM--VRE--KYDIVLIDAPPILEVADGRLLAEFADGVLLVLRSGVTDR
A0A2V7YW66      ELLSSDRMRDWLRT--MRS--RFDFVVLDTPPALAVTDATIVGLLVDGVVLTLRSGKVTR
A0A2V7Z0V0      ELLSSDRMRDWLKA--VRA--RFDFVVLDTPPALAVTDATIVGMLADGVVLTLRSGKVTR
A0A2V8GFD4      ELLGSPRFAELMAA--FRE--NFDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGADLVTR
A0A2V8HSS5      ELLGSPRFAELMAA--FRE--NFDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGADLVTR
A0A2V8KP55      ELILSPRFKEVLKS--LKK--DFDLVILDSPPLSNVSDGRILASVSDTAILVVKAFSTSR
A0A399WNU1      SLFASTHMKGLIER--LSA--TYSYIVIDSPPILYFADSVILSTQVDAVVAVARVNFSSR
A0A2V9CG11      RLLHSRRMSELLAL--LRR--EFDMVIVDAPPVTQLADARVLGHLADGVILVVRAGQTTL
A0A2V2R0I6      DLLSSHKLSDAIAE--LRT--KYKFVVIDSPPVMAATDAVIVSVQTDGVLLVVRSGETPK
A0A2V8XAR9      DLLSSHKLADAIAE--LRT--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPK
A0A2V8VZA0      DLLSSHKLVDAIAE--LRT--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPK
A0A1Q7CB82      DLLSSHKLVDAIAE--LRT--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPK
A0A2V8WIU1      DLLSSHKLVDAIAE--LRT--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPK
A0A1Q6Y9F5      DLLSSHKLADAIAE--LRA--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPK
A0A2V9EVV8      DLLSSHKLADAIAE--LRA--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPK
A0A2V8YF91      DLLSSHRLAEGIAE--LRT--KFKFVVMDSPPIMAATDAVIVSVHSDGVLLVVRSGETPK
A0A2V8XZK2      DLLSSHRLADAIAE--LRT--KFKFIVIDSPPIMAATDAVILSVLADGVLLIVRSGETPK
A0A2V8ZTX6      DLLSSHRLADAIVE--LRS--KFKFIVLDSPPIMVATDAVILSVQADGVLLVVRSGETPK
A0A2V9BT79      DLLSSHKLADAIVE--LRT--KFKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGETPK
A0A1Q8B793      DLLSSHRITDAIAE--LRA--KYKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGQTPK
A0A2V9BCA0      DLLSSHRITDAIAE--LRA--KYKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGQTPK
A0A2V9BWU9      DLLSSRRLSEAVSI--LRQ--EYKFIVIDSPPLMAATDGVILSVLVDGVLMVVRSGETPK
A0A2V9DKX2      DLLSSRRLSEAVSI--LRQ--EYKFIVIDSPPLMAATDGVILSVLVDGVLMVVRSGETPK
A0A2V9JSI3      DLLSSVSMKEVLAE--LRG--RFDHVVIDSPPVLLVTDATILTPLVDGIMLVVESGMTVR
A0A2V9WI32      ELLGSILMKDYLCR--LRK--EFDHIVIDTPPALSVTDAVLLSVEADSVLVVVRSGQTTK
A0A2V8IVN9      ELLGSQRFRELLAS--LKD--HFDWVIVDSPPVMAVIDAAVVAHRATGVVFIIGAEMTSR
A0A1F2TPT3      ELLGSYQFRKFLAA--LGQ--HFDWIVIDTPPVMAVTDACVVGHAVTGTLFVVGADMVSR
A0A2V8JTQ2      TELLMWSFQDWVKR--WRE--QFDHIIIDTPPVLSVADAVRISVEADSVILVIRSGQTAR
A0A2V8UZY0      TELLVSGFKDLVDH--WRD--QFDHIIIDTPPVLAMTDAVRMSVEADSVILVIRSGQIAR
A0A3N5YNR8      ELIGSERMESALRL--LGD--YFKYILIDTPPILSVTDGLLLSPHVDGVVMVIKGGSTPK
A0A350UEK1      HLLYSKKLRAALEW--FRE--EFDMVVIDTPPMLQIPDARLFGKLVDGVVLVVRANSTTR
A0A350UIQ4      NMLFSKRLLSALEW--CRS--EFDMVVIDTPPVLQIPDARLFAKVADGVVLVVRANSTTR
A0A3N6A5T6      ELIGSDRMDKALKL--LRD--YFQYVVIDSPPILSVTDALVLSPKVDGVVMVVRGGETPR
A0A1F2Q9L4      ELLSSERMMDLVAV--AYQ--RFENVVFDSPPILPVTDATLLGAMSDGVVLCVGSGMVLR
A0A1H5SQF5      ELLGSPRFVKLLEQ--MKK--EYDYVFIDSPPVLLVTDAVLTSTLVDGVILVVRSGVTRR
A0A3E0NV31      ELLGSKRMRWCLGV--ASE--HFDVVLIDSPPSLELSDALTVSPYVDGVVIVARAGQTPR
A0A3N5M5V0      ELIGSERMEAGLRL--LGD--YFKYILIDTPPLLSVTDGLLLSPHVDGVVLVIKGGSTPK
A0A2V9AEW6      NLFYSPRMSKLLAR--LRR--EFDMVLIDAPPMIQLADARVLGRLADGVILVVRAGQTTT
A0A2V8WQK6      NLFYSPRMSRLLRR--LRS--EFDMVMIDAPPVIHLADARVLGRLADGVILVVRAGQTTT
A0A2V8XIF4      NLFYSPRMARFLKR--MRK--EFEMVMIDAPPMIHLADARVLGRHADGVILVMRAGQTTT
A0A3N5XQP8      ALLSSKRLPNALER--LTK--QFRFIVIDTGPLLCYTDALIISTVVDGVVLVGRADQTPI
A0A2Z5G7H4      DLLGSLRMMEALDR--WRG--YYDFIVLDSPPVLLVTDPVVLASLADATLLVARYGMTNR
A0A2V9L5B5      EVLSSSLAAESLRK--LRA--DFDYVLVDSPPLLSVADGRILATMVDGAVLVARAFETPY
A0A2V9LK56      ELLSSQLSMDLLNA--LRS--QFDYVLLDSPPLLSVSDGRILATLTDAVVLTIRAGHTPI
A0A2V9L7I0      EVLSSPLAAELLRK--LRT--EFDYVLVDSPPLLSVADSRILATMTDAAVLVTRAFETPY
A0A522PPT0      EVLSSPLTVELLKR--LHT--EFEYVLVDSPPILSVADSRILATITDAVVLVTRACETPY
A0A2V9KCS3      NLLYSPRLAELLNR--FRK--EFDTVLFDTPPMLQISDARVVGRLADGVILVLKAGQTTR
A0A2U3KC61      ELLGSAVMKDHIAH--WRN--VFDHVIIDTPPCLSVTDAVLLSPEADRVILVARSGQTTK
A0A2V9Y2R7      ELLSSTVMKDYIAR--WRN--EFDHIIIDTPPCLSVTDAVVLSPEADRVILVARSGQTTK
A0A372IT17      ELIASRRMEELLGG--WRH--QYDFIVLDSPPVLPFADALVLSQMSDATLLVARPGVTAK
A0A136JPP4      ELLSSNEMRNLLQF--LRG--RFKHIIIDSPPAISFTDAAILSTQVDGVVLIAMAGKSSM
A0A399WUJ8      ELLSSNEMRNLLQF--LRG--RFKHIIIDSPPAISFTDAAILSTQVDGVVLIAMAGKSSM
A0A2V9NGH6      ELLSSGNMKKVLDE--LRE--QYDHIVVDTPPTLSVTDPVILSTRADAVVLVIRSGQTTR
A0A2V9PYE6      ELLSSGNMKKVLDE--LRE--QYDHIVVDTPPTLSVTDPVILSTRADAVVLVIRSGQTTR
A0A2V9NL07      ELLASSQMLDLLAE--LRE--QYDHIIVDTPPTLSVTDAVVLSTRSDAVVLVIRSGQTTK
A0A2V9QD92      ELLASSQMLDLLAE--LRE--QYDHIIVDTPPTLSVTDAVVLSTRSDAVVLVIRSGQTTK
A0A2V9WPZ6      ELLASSDMRDLLAQ--LRD--QYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTK
A0A2V9ZLH4      ELLASANMRDLIES--LKR--DYDHIVIDTPPTLSVTDAVVLSTRSDAVVLVIRSGKTTK
A0A2V9RQF1      ELVASSNMRDVLAE--LRD--QYDHIIVDTPPTLSVTDAVVMSTRADTVVLVIRSGQTTK
A0A2V9YDK8      ELLASSNMKDALAE--LRD--QYDHIVIDTPPTLSVTDAVVLSTKADAVVLVIRSGVTTK
A0A2V9V8F7      ELLASSDMRDLLAQ--LRD--QYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTK
A0A2V9XGR9      ELLASSDMRDLLAQ--LRD--QYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTK
A0A2V9V3Q5      ELLASSNMKDVLDE--LRE--QFDHVVIDTPPTLSVTDAVVLSPRVDAIVLVIRSGQTTK
A0A2V9NWS3      ELLASAQMKDSLAE--LRE--QYDHIVIDTPPILSVTDAVVMSIRADTVLLVIRSGQTTK
A0A2V9USA9      ELLASTNMKDVLAQ--LRE--EYDHIVLDTPPTLSVTDAVVLSPRADAVVLVIRSGQTTK
A0A2V9XW18      ELLASSNMRDVLNQ--LRE--QFDHIVIDTPPSLSVTDAVVLSPRADAVILVIRSGQTTK
A0A4R1LC91      DLLASTQMQDLLAQ--WRT--EYDFILFDGAPVLPVTDSVFLSGLVDTTLLIARYDYTQR
A0A3M2BZG9      ELLASERMRELLAT--LRS--RFDFILLDTPPALPVVDAAIIGQLVDGIVICARAGVLVR
A0A1Q7N5R7      ELLGSPAMVDLLVR--LRA--DYQVILVDSPPLGAGVDPYTLGTLTGAMMLVLRTGTTNL
A0A3M1SIV3      ELLGSTEMKALLTY--LKT--NFKHVIIDSPPAISFADAAILSTLVDGVVIVAMAGKSSM
A0A3E0PHB0      ELLSSNEMKNLLQF--LKG--KFAHVVIDSPPAISFTDAAIIATLVDGVVLVAMAGKSSV
A0A3M2D491      ELLGSDEMKALLNF--LKT--NFKHVILDSPPAISFADAAILSTIVDGVVIVAMSGKSSM
A0A357F267      ELLSSNEMRNLLQF--LRG--RYKHVIIDSPPAISFTDAAILSTQADGVILVAMAGKSSI
A0A353C9L6      ELLSSNEMRNLLQF--LRG--KYKHIIIDSPPAISFTDAAILSTQVDGVVLVAMAGRSSI
A0A2V8RQV0      ELLSSNEMKNLMQF--LRG--KFKHIIVDSPPAISFTDAAILSTVVDGTILVAMANRSSM
A0A2V8SJH5      ELLSSNEMKNLLQF--LRG--RYKHVIIDSPPAISFTDAAILATLVDGVVLVAMAGKSSI
A0A2V9QB26      DLLHSANLSGLLAK--IKI--EFDLVIIDTPPMLQMADARVLGRVADAIILVTRAGQTTR
A0A2V9VYY4      ELLGSTVMKDYISR--WRN--EFDHIIIDTPPCLSVTDAVLLSPEADRVILVARSGQTTR
A0A2V9KIE8      EVLSSPVAGALLNS--LRS--EYEYVIMDSPPLLSVSDSRILATMTDAVVLIARANSTPY
A0A352F549      ELLGSTQMKRLLEI--VGE--SFNYVVIDSPPIASFTDGVLISSLVDGVLLVVHGGKTSR
A0A3B9MLP9      ELLGSAQMKRLLDV--AGE--TFAYIVIDSPPIASFTDGVLISLLVDGVILVVHGGKTSR
A0A3D5SQ87      ELLGSAQMKRLLDV--AGE--TFAYIVIDSPPIASFTDGVLISLLVDGVILVVHGGKTSR
A0A2V8NW86      DLLHSADLSGLVAK--IKL--EFDFVIIDTPPMLQMADARVLGRMADAIILVTRAGQTTR
A0A2V8ZHL8      QLLSSSAMESLLKE--LRQ--RFKFLVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTAR
A0A2V9B240      QLLSSSAMESLLKE--LRQ--RFKFLVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTAR
A0A2V9CBM2      ELLSSQSMETLIQS--AGE--QYEFVILDSAPMLALADSRILAPLVSGVLLVVKSRTIPR
A0A2V8XN17      ELLSSQSMGALIRS--ASA--EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGTTPR
A0A2V8WX45      ELLSSQSMGALVRS--AKT--EYGFIILDSSPMLALADSRILAPLVDGVLLVVKSGTTPR
A0A1Q6YR79      ELLSSQSMGALIRS--ASA--EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGATPR
A0A1Q7VA32      ELLSSQSMGALIRS--ASA--EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGATPR
A0A2V9EY85      ELLSSQSMGTLIRS--ASA--EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGATPR
A0A2V9H8K0      ELLSSQSMGALIRS--ASA--EYSFIILDSSPMLALADSRILAPLVNGVLLVVKSGTTPR
A0A2V9FFE5      EMLSSQSMSALIRS--ASA--EYGFIILDSSPMLALADSRILAPLVNGVLLVVKSGTTPR
A0A2V9GM43      EMLSSQSMSALIRS--ASA--EYGFIILDSSPMLALADSRILAPLVNGVLLVVKSGTTPR
A0A1F2RFI7      ELLSSELMRQFLEQ--ARQ--KFDYVILDSPPVLHVSDARILAARVEAVILVAHGAATPR
A0A1F2RZS3      ELLSSKLMRQFLEQ--AAQ--KFDYVLLDSPPVLHVSDARILASQVEAVVLVAHGAVTPR
A0A1F2USE2      ELLSSERMRTFLQE--ALG--EYSFLVIDSPPVLHVTDARILARLAEGTVLVVKGAATPR
A0A2V9C238      ELLSSERMRTLLRE--AKV--EYHFVVVDSPPLLNVADSRILATLVEGIVLVVKGGETPR
A0A1F2Q9F5      ELLSSERLRAFLRQ--ALQ--RYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTPR
A0A1F2QQH9      ELLSSERLRAFLRQ--ALQ--RYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTPR
A0A1F2QXK7      ELLSSERLRAFLRQ--ALQ--RYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTPR
A0A2V9DEM9      ELLSSERMRTLLRE--AKV--EYHFVVVDSPPLLNVADSRILATLVEGIVLVVKGGETPR
A0A2V9CYQ5      ELLSSQSMETLIKS--AGK--QYEFVILDSAPMLALADSRILAPLVSGVLLVVKSRTIPR
A0A2V9BWU8      ELLSSKSMGAFLGA--AKS--EYGFVILDSSPLLTLADSRILAALVDGVLLVVKSGATPR
A0A2V8ZG48      ELLSSKSMGAFLGS--AKS--EYAFVILDSSPLLMLADSRILASLVDGVLLVAKSGATPR
A0A2V8Y334      ELLSSKSMGAFIAS--AKS--EYGFVILDSSPLLTLADSRILASLVDGVLLVVKSEATPR
A0A2V9AY68      ELLSSKSMGAFLTS--AKS--EYGFVILDSSPLLTLADSRIIASLVDGVLLVVKSGATPR
A0A257VBK0      ELFSMKRFRDLIER--FKG--EYSWVIMDSPPCLSISDAFILGGMADRTILVARYKKTRK
A0A2V7XDY0      AILTRPNMQDFLDR--LRG--HFSWILIDSPPLASVTDAQLLARYADLTTFVVQYNTADK
A0A350UQT3      DMIG-QLLGPVMEE--MAR--GYDLVILDAPPLLGFAESLQMASSADGVIVVTRAGETSR
A0A2U3JZ71      DLVGAE-LTTLLED--ACG--DYDLVVLDSPPLLGFPEPLQMAASVDGVLMVALAGQTNR
A0A2V8TTB0      DLIGSG-VAELIEE--ATR--EYDLVVLDAPPLLGFAEPLQMATAVDGVIVVARAGDTSR
A0A1F2TCR2      ELLASERMKGFLTNL-AGG--PFDWVIIDTPPVLAVTDAVIVSRLVSNVVFVVGSEMTRR
A0A2N9LQU7      ELLASKKMGDLLEQ--WRT--EYDHVVVDTTPLLFFADTMPLAAKADGVLLVVLAGRSRR
A0A2P6WFK7      ELLGSKRMIELLES--LSG--EYERIIIDTPPVLSVADSLALSNIADAVVLVVRSRIARK
A0A1F2V330      SLLASQSVRSVFER--LRG--EFDFIVVDTPPVLPIVDTHILAGLVDGVILVVRARYTRR
A0A2V8U914      SLLYSERMARLMQR--FRQ--EFDYVIVDAPPCLEFADARILARYAEGVLLVLRANYGDK
A0A662EE63      ELFGKKSFKDLLAT--ARE--NYDWVILDSPPTASVTDPVVAAQLVDMVLAVVKYGGPRR
A0A2V7W309      ELLASDRMKHLIQE--LRE--KYAFVIFDSPPVLAVTDAIVLAASADGVVLTVHGGYTPR
A0A2V8TLH7      DVFGHERFKRLLKE--LRQ--EFDWVFVDSPPAVSLADAMILASLCDMVAFVVKHNENDK
A0A1Q7ZJT1      DVFGHERFLSLLKE--LRA--EFDWVFIDSPPVVSLADSMILASLADMVAFVIRHNENDK
A0A2V8VC99      DVFGHERFLALLKE--LRS--QFDWVFIDSPPVVSLADSMILASLADMVAFVVRHNENDK
A0A348UZU3      ELLGSERMKELLGR--LKG--SFDFILIDTPPVLSVTDSQVLGKMVDGLILVVQADRTPK
Q01XL7          TLFFSPRVKELVKK--LRG--QFDYILLDTAPVLLFPDARLWGRHSDGVVLVVRAGVTTR
A0A2V8ERZ5      ELLSSERMKTLLTNL-AHG--PFNWIIIDTPPVLAVTDAVILAPMVTGVTFVVGAEMTRR
A0A2V8GTX0      ELLASDRMRAFLHQL-TTG--PFDWVIIDTPPVLAVTDAVVLAPLVHSVSFVVGAEMTRW
A0A2V8J0X9      ELLSSERMSNFLANL-ATG--PFDWVIIDTPPVLAVTDAVIIAPKVSGVVFVIGSEMTRR
A0A523DUV7      ALIGSLAVKRFLEE--CRE--RFTWIIVDAPPIVSVTDPLLLAKVSDLVLMVVQANRVDR
A0A372IRG7      EMLASRMMEDTLAR--WRQ--EFDHVILDSSPILAVSDTLSLAPQADAVLIVLRSGITRK
A0A1F2U158      ELLSSERMKTLITNL-RHG--PFDWIVIDTPPVLAVTDAVILAPMVAGVTFVIGAEMTRR
A0A2V8F6S9      ELLSSERMKTLLTNL-SHG--PFDWIIIDTPPVLAVTDAVILAPWVSGVTFVIGAEMTRR
A0A4Q1SCH5      ETLASSKLRMQLEE--WKK--EYDIVLLDSAPLLTVSDSLPLATWADTTVLVARAGVTPL
A0A2W0BGU4      ELLCSEAMESLFGE--LRR--RFKHIIIDSPPLLAVTDATVLASAVDGVILVVESGVTPK
A0A2W0BVQ9      ELLCSEAMESLFAE--LRQ--RFKHIIIDSPPLLAVTDATVLASAVDGVILVVESGVTPK
A0A3D1ASD2      DMVG-NRLPQILEE--AAL--EYDLIVLDAPPLLGFPEPLQMAVNVDGVIVVSVAGQTSR
A0A2N9MK30      DLIG-RALPQILEE--AAG--DYDLVMVDSPPALGFPEPLQMATAVDGVALIALAGQTDR
A0A1I6MH75      EMLSSAAMTSLLER--CAT--LYTHVVIDSPPILSVTDGVILARQADAVVLVVRHGKSSK
E8WVF6          EMLSSASMAELIRH--ASE--IYTHIVIDSPPILSVTDGIILSRQVDVCVLVVRHGKSSK
A0A1H5Z7N3      EMLSSQVMRNLVEQ--CRG--IYTHIVIDSPPLLSVTDSIVLAPEVDTVVLVVRHGKSGK
A0A2V9YHT3      ELLSSALMKQWIST--WRK--HFDHVVIDTPPCLSVTDAVALSVVADSVVLVIRSGVTRK
A0A1G7JVV8      EMLSSESMKNLLQE--CGE--LYTHVVIDSPPILSVTDAVILAHYADAIVMVVRHGKSSR
A0A1H4T6W9      EMLSSEAMHDLLLY--CCS--IYTHIVIDTPPILSVTDGVILARQADAIVLVVRHGKSSR
I3ZEU5          EMLSSEAMHDLLLH--CCT--LYTHVVVDSPPILSVTDGVILARQADAIVLVVRHGKSSR
A0A5B9EBI2      EMLSSEGMQHLIES--AKT--KYTHVVIDSPPILSVTDGVILGRQTDAAVLVIRHGKSSK
A0A239HDF6      ELVSSTAMRELLRY--AGE--IYTHVVIDSPPILSVTDGVELGGMVDAVILVLRHGKSNK
A0A4Q0T270      EMLSSGAMTQLLER--CGN--LYTHVVVDSPPVLSVTDGVILARLADAVVLVVRHGKSSR
A0A1Q3QQB6      EMLGSEAMDQLLRQ--CGD--LYAYVVIDTPPILSVTDGVILARHADAVVMVVRHGKSSK
A0A3N1K1G7      EMLSSEAMNTLLRH--CGE--VYTHVVIDSPPILSVTDGVILAREADAVVLVVRHGKSSK
A0A428MDU2      EMLSSEAMDAFLNH--CGD--LYTHIVIDSPPILSVTDGVILARRADAVVLVIRHGKSSK
A0A4V2G466      EMLSSEAMRQLLDH--AGE--IYTHIVIDSPPVLSVTDAVLLARQADAVVLVIRHGKSNK
A0A4Q7YNP3      QLLHSPRLAELIDR--LHR--EFDVVLIDTPPMLHMADARIFACYSQGAILVIRSGSTSR
A0A2V9MN96      ELLGSSVMKDCIAR--WRN--EFDHIIFDTPPCLSVTDSVVLSVEADRAILVARSGQTPK
E8UZE1          ELLMSPRMSELFEE--WRK--AYDFIVVDTAPLLAVSDTTALVATADTTVVVVRDDATRK
A0A2V7V2Z1      DLMTLQTMRDFLDG--LRG--FYDWIVLDTPPVGPVAEALILAPLTDGVVVVVGAEMVPR
A0A2V7X2F7      DLVTGQAMRGFLEG--LRG--VYNWIVIDTPPVGAVSEPLILGPLADGVIVVVGAEMVPR
A0A2V7V2I1      ELMSPQLLRGFLHG--LRA--AYSWVLIDTPPVGAVADALILSSACDGVLIVAQAERVPR
A0A2V7U3M2      DLMTLQTMRDFLEG--LRG--FYDWIVLDTPPVGPVAEALILAPLTDGVVVVVGAEMVPR
A0A2V7UHT0      DLMTLQTMRDFLEG--LRG--FYDWIVLDTPPVGPVAEALILGPLTDGVVVVVGAEMVPR
A0A2Z5FVL3      ELLGSSKMRQLLDL--WRG--YYDFIILDGAPVLPVTDSVVLSSQVDATLLVARYQSTQQ
A0A1V6HR88      ELLSSERMRDLVRQ--LRL--RFDYVVIDSAPTLAVTDATILGSIADGVVLTACAGRVQR
A0A2V9KBD6      TELLLSTFKELVES--WRQ--RFDHIIIDSPPLLPVADALRLSVVADSVILVIRAGEVGK
A0A2W0AJ66      TELLVARFKDLLEG--WRG--QFDHIIVDTPPVLPLTDAVRMSVEADSVILVVRSGHIVK
A0A1Q7RBU1      TELLVSGFKDLVER--WRD--QFDHIIIDTPPVLPMTDAVHMSVEADSVILVIRSGQIAR
A0A2V9JPV9      TELLVSGFKDLVER--WRE--QFDHIIIDTPPVLPMTDAVHMSVEADSVILVMRSGQIAR
A0A3E0P0A3      ELLSSGHARELFAQ--LRQ--QYDTILIDTPPVLAVTDAVTVAVRSDGLLLCVRSQRAPR
A0A2V8EXP2      ELLGSKRFKEFLGT--LGQ--HFDCVIVDTPPVMAVTDSSIAAHVATGLIFVIGAEMTTR
A0A2W4RYA1      ELLGSARFRRVLDS--ATR--QFDWVVVDSPPVMPVADAAIVGHMVSGVLFVVHSEKTSR
G8P0Y7          ELLSSSLMRDLLKK--WCE--EYDHVIIDSPPVITVTDAVLLSVETDAVLLIIRSGQTTA
A0A5M8T4U7      EMLSSQRMEEQLHQ--WTR--DYDRIVLDTAPILAVSDTQALAVMADAVVLVVRAGVTRK
A0A3P0X3W6      HLVG-NKMAALLTD--AEQ--DYDLVLIDTPPMLGLAEPIQIACSVDGVLLITQAGETNQ
A0A1E3Y9R6      ELLSSPRYAELIAE--LKR--RYDWVVIDAPPVMPVTDAAVVAHGSSGVLFVVGAEMTPR
A0A2W4TLP2      ELLCSPKYADLIAE--LKK--RFDWVVIDAPPVMPVTDAAVVANSASGVLFVVGAEMTPR
A0A3R9WF43      EFFSSATFDAVLEM--CTN--RFDYVVIDSPPILRVTDATIIAKKVDGIITVLRSQATTR
A0A317HKM4      DLLGSERFSRLIDY--LQK--QFDWIVIDSSPVLAVTDPCVIARVASGALLVVRSGRTSR
A0A523E0N1      ELLASPAMERTLKE--CAE--HFDFIVLDSAPLLPVFDSHILSTRCDGVILVARAGVTSR
A0A523ECP2      ELLGSTKMEETLEQ--CIQ--LFDYVLLDSAPLLPVFDSHILTVRADANLLVVRSGHTSR
A0A2W0C122      EMLGSDRMRAIMES--WRE--RYDYVILDTPPIIAATDAVRLSKEVDSVLLVIRSGQTPT
A0A2W0AUU7      ETLGSARMRSLMES--WRE--RYDYVILDTPPILAATDAVRLSKEVDSVLLVIRSGQTSR
A0A2W0BQL1      ETLGSARMRSLMES--WRE--RYDYVILDTPPILAATDAVRLSKEVDSVLLVIRSGQTSR
A0A4Q1SDL1      ELLSSANMGKLISD--LRT--RFDLILIDTPPLLPVVDALILAELADSTLLVARQASTTQ
A0A3P0XH15      EALASRSMEELLQR--WRS--EYDHIILDSSPVLAVADTLSIAPQVDACFILVRSGVTRK
A0A4R1LAZ7      EMLGSRSMEELLLQ--WRE--QYDHVILDTSPVLAVSDALSLAPQTDAALILVRSGVTRK
A0A3M1WQW8      ELLSSRKMREAVKV--LSE--RYDFVILDSPPV-STPDALILSTMVDGVILVIQCGETPR
A0A3N1JHC1      RLLHSSRLASVIGT--VRN--GFDFVLIDAPPLLGLADARILSKFTDGVIFICRAGQTNT
C1F294          EMLASRMMADTIQK--WRS--EWDFIIFDTSPVLAVSDTLNLVRHMDGTLVVVRSGITRK
A0A2V9KA79      QALAAKRMHEILAH--ARQ--RYRLIVLDAPPILPMADSHILAGLSDGVLLVVRARQTRR
A0A522PSP1      EHIA-ARIGEVIED--LKS--QFDIVVIDTPPMLGFADGLNVASVADASLLVVRAGRTSR
G8P085          EALGSNKFYSLLQQ--WEQ--EFDYIIVDSAPLLIVSDSLPLASWADALILVTRYNMTPL
A0A4Q1SGQ1      ELLASAKMQELLRE--WRR--NYDVVLLDSPPILPATDPALLAQASDVTILVARHGVTTC
Q1ILD9          ELLSSDKLKEMLEE--WQK--NFDHVIFDAPPALVVTDAVVLALLCDAVLLVARSGVTHR
Q1IJZ6          ELLASNVFSDLLKRVVL----EYDLVLIDSPPAMLVSDAAIISSRVDGVVLVARAGIITR
A0A2V8TCE6      ELLDSACFDELLKMVLD----SYEMVVLDSAPLLTVADGAILASRTEGTLLVVESDRTTR
A0A522TBE8      ELLQ-QHWPAVLDRLRER----FDRVIIDCGPTLGFADSGAIARDTDALVLLVRAGKTAR
Q1ITG0          DLFTSNKMEEILNE--WRG--AFDHVVIDTPPVVAVTDGVVLSQKTDAVLLIARASRTGR
A0A3N5PCI5      EQLGSRRFSEFLARVGE----SFDWVIIDSPPVMAVTDPSVMAHLASGVLFVVNARHTKQ
A0A3M1Q0S9      ELLDSERFRTMVRELEGFE--DFDHVIFDSPPVLSVVDPLLIGRQMDGTILVLRSAYTSR
A0A2Z5G448      EILASRHMESLMEG--WKT--EYDHVILDSAPVLPVADSLSLAPGADSTIIVVRAAITRK
A0A3M1VZ38      DLLDSPRFAELVETLRERG--EFDHVIFDSPPLLSVVDPVLIGRQTEGVVLVIRSGYTSR
A0A4Q1SD29      EILASRMMSELL--MKWRS--EYDHIILDSSPILAVSDTLGLAQQADATFILVRSGVTRK
A0A3M1PY35      TLLDPERVRAVVRALRERH--GAEFVIVDTPPTLVFADAYSIVPAIEGVILVARALRTPK
A0A3M1VMP2      TLLDPDRFREIVGELDERL--GFDFVVIDSPPVLVFADALNLVPVVEGTLLVARALSTPK
                  .                      :..*  *     :                      

A0A2V7VMF7      KLVKRSVVA--LR-KATP-NLLGAILNAVDLKTRS-----YHYYYY--------------
A0A2V7YYV7      PALERAKQM--LD-RVGA-HTIGVVMNKVRASSGSYAYDYGYYAAS--------------
A0A2V7Z0J5      PAVGRAKQL--LD-RVGA-HTLGAVMNKVRASGSSYAYEYGYYATP--------------
A0A2V7Z3M4      PVVNRAKQI--LD-RVGA-HTLGVVMNKVRASADAYAYDYGYYSPA--------------
A0A399Y5V2      RASAQAAEK--LD-AVGA-ELLGVVLNEVTPNFGEPGYYYDYYY-----YYQSYRPIPEK
Q01X01          KTAQAAVQR--LL-LDGI-SVMGVIFNYWDPTVN------DLYS-----YAQYHQDIA--
A0A3M2D9H8      SVTLEVLEQ--LD-RVKA-RVVGAVLNRVQDSVSNHYYHNLKSYAY---IAKESDELTLL
A0A2V8JK38      YIAYRAVQH--LA-EAQV-RIAGVVLNDLDLRHLAGYSARYRDGYV---YDRYYGHITHD
A0A2V9IXG5      RIVRNSLSA--LA-KTHA-NIMGAVLNDLDVKKTRYYAYQSYYRYY---SDSDAK-----
A0A2V9J2P4      RIVRNSLSA--LA-KTHA-NIMGAVLNDLDVKKTRYYAYQSYYRYY---SDSDAK-----
A0A1Q7RLS4      ELIRRCVTN--VR-RINP-NVIGAVLNSVDLERSHYKDYYYVGYYY---YGESSSSKKGR
A0A2V2R525      EIVQLSRKE--LM-DVGA-NIFGVVLNNVDVTAQDGY---YYYRPT---A----------
A0A321LPW6      DVARRARQE--LV-NAGA-KIFGVVLNNVDMRQHKYD-DYYCYYSK---QYDSYGH----
A0A2V9R9V4      QAVQRACHE--LS-AVGA-RIFGIVLNNVDLRREGHD-DYY-YYSY---QYSYSAD----
A0A321LE75      EVLKRGRQE--LA-TVGA-KIFGVVLNNLDLRREGYD-SYY-YYRY---YGDYSER----
A0A2V8R8U7      AVVRRAKQQ--LL-DVGA-HIFGVVLNNVKLESTDY----YYN-TY---YSSYYRT----
A0A2V8QMP4      AVVRRAKQQ--LQ-DVGA-HIFGIVLNNVKLEGTDY----YYYSGY---YSGYYSD----
A0A2V8R4S3      AVVRRAKQQ--LQ-DVGA-HIFGIVLNNVKLEGTDY----YYYSGY---YSGYYSD----
A0A2V8NJ55      AVVRRAKQQ--LL-DVGA-HIYGVVLNNVKPEGSNS----YYYYGY---YSSYYES----
A0A2V8Q7I0      AVVRRAKQQ--LL-DVGA-HIFGVVLNNVRLETQDY----YYS-GY---YSSYYSD----
A0A2V8S6K4      AVVRRAKQQ--LL-DVGA-HIFGIVLNNVKLEGNDY----YYGYGY---YSNYYAH----
A0A317I2L9      AVVRRAKQQ--LL-DVGA-HIFGVVLNNVRQESHDY----YYS-GY---YSNYYSS----
A0A2V8LLF9      AVVRRAKQK--LM-DVGA-HIFGVVLNNVKIETKSD----YYYAGY---YGGYYDAGYY-
A0A352FRF4      AVVRRAKQQ--LL-DIGA-NIFGVVLNNVKIEKTQD----YYYGGY---YGHYKSSY---
A0A2V8MKV0      AVVRRAKQQ--LL-DVGA-HIFGIVLNNVKLDTHGY-----YYGGY---YGRYYYKYGYY
A0A2V8PYY8      AVVRRAKQQ--LL-DVGA-HIFGIVLNNVKLDTHGY-----YYGGY---YGRYYYKYGYY
A0A1Q7YKQ8      AVIRRAKQQ--LL-DVGA-HIFGVVLNNVKLESTDY----YYYAGY---YSSYY------
A0A352F3R7      AVVRRAKQQ--LL-DVGA-HIFGVVLNNVKLETQDY-----YYSGY---YSSYY------
A0A0B6WXT1      AIVRRAKKL--LQ-DVGA-HIIGVVLNNVKLDAHDY----QYYANY---YAAYY------
A0A3B9MEU8      AVVRRAKQQ--LL-DVGA-HIFGIVLNNVKLETQDY-----YYSGY---YSSYY------
A0A2V8MHG6      HIVRRSKQL--LS-DVGA-KIFGVVLNNVTVSKHD-----YCYNQY---RAYYQS-----
A0A2V8P7N1      HIVRRSKQL--LS-DVGA-KIFGVVLNNVTVSKHDY----YYYNQY---REYYHST----
A0A2V8M3M6      HIVRRSKQL--LS-DVGA-KIFGVVLNNVTVSKHDY----YYYNQY---REYYHS-----
A0A1Q7NJH5      HIVRRSKQL--LS-DVGA-KIFGVVLNNVTVSKHDY----YYYNQY---RDYYHSA----
A0A2V8PJY0      HIVRRSRQL--LS-DVGA-KIFGVVLNNVTVSKHDY----YYYNQY---RDYYHSA----
A0A1Q7Y6W9      HVVRRARQV--LQ-DVGA-KIFGIVLNNVNISSHDH----YYYQRY---YQQSYYD----
A0A2V8NC68      AVVRRARQL--LQ-DVGA-KIFGVVLNNVNVRSSDY----YYYHHY---YSHYYSK----
A0A399WK13      QVVRRSRQL--LL-DIGA-KIIGVVLNNVNLRSQDNY---YYYQSY---YTRDNYR----
A0A352FLX4      KIVGRARKL--LQ-DVGA-RIIGVVLNKVPSTGSNS----YYYSGY---YQHYHYG----
A0A2V8RTL7      QVVRRARQL--LI-DVRA-KVLGVVLNNVNLNSQDNY---YYYQSY---YYRNNYR----
A0A3E0PCJ6      SVVRRSTQF--LH-DIGA-KVFGVVLNNVDARSNDNY---YYYQSY---YHRDDDP----
A0A3M1S4R8      QIVRRSCQL--IQ-DVGA-KIFGVLLNNVNLSSQDNY---YYYQSY---YYNSYYK----
A0A1Q7YFI6      IVVQRAKQY--LQ-DVGA-KIFGVVLNNVKLERQDYY-HRYYYKNH---YYSKHRD----
A0A136KC10      QVVRRSRQL--LN-DIGA-KILGVVLNNVNLRAQDNY---YYYQSY---YTRDNYR----
A0A2V8SEX6      QVVRRARQL--LQ-DVGA-KIFGVVLNNVNLRSQDNY---YYYQSY---YHRNNYR----
A0A3M2D6Y5      HVVRRSKQL--LQ-DVGA-KIFGVILNKVDVNSQENY---YYYQSY---YYSSYYK----
A0A0B6WWQ6      RIVRRTQKI--LH-DVGA-RIFGVVFNHAGMPSDAAY---YRYNR---------------
A0A3B9MK99      HVVRRSRQL--LH-DVGA-KIFGVVLNNVALQSHD-Y---YYYQRY---YGARNYK----
A0A352EX26      HVVKRARQL--LH-DVGA-KVFGVVLNNVTLQSND-Y---YYYQRY---YASGNYT----
A0A2V8MM59      GVVRRSRQL--LI-DVGA-KIFGVVLNNVNVRSHDYY---YYYQRY---YH---------
A0A2V8PFE8      GVVRRSRQL--LT-DVGA-KIFGVVLNNVSARSHDYY---YYYQRY---YHQSYYS----
A0A2V8PWS6      GVVRRSRQL--LT-DVGA-KIFGVVLNNVSARSHDYY---YYYQRY---YHQNYYS----
A0A2V8LCT5      GVVRRSRQM--LL-DVGA-KIVGVVLNNVSVRSHDYY---YYYQRY---YHQSYYH----
A0A352FTJ9      DVVRRSRQL--LL-DVGA-KLVGVVLNNVSVRSHEYY---YYYQRY---YHQSYYT----
A0A2V8G155      HAAQKAVEQ--LT-HCRA-RIIGAVLNRVALDRNR-----YYYSHY---YSREYQAYYRS
A0A2V8HDM7      HAAQKAVEQ--LT-HCRA-RIIGAVLNRVALDRNR-----YYYSHY---YSREYQAYYRS
A0A2V8DRT9      GVARTAVEQ--LI-NANG-HMIGAVLNRVDLTHNA-----YYYSQY---YRREYGHYYIK
A0A2V7VYF3      KAARRALKQ--LA-LAQA-GLMGAVLNRVDVEHHG-----HYYSGY---YRAAYARYYGA
A0A1F2SVH2      HAAQRALEQ--LE-QARA-KSIGAVLNRVDLQHNS-----YYYSQY---YRREYSDYYQN
A0A2V8AJG9      FATRRAVEQ--LR-QAKC-DVIGAILNRVDLKHHG-----YYYSQY---YRKQYGEYYSR
A0A2G6PYV5      DEVARALHM--LS-QNKI-KPLGTLFNDYDFTKGKKY-Y-GYKYGYRYKYGYGYG-YVPY
A0A2V8F956      HAAKRALDH--LD-HVQA-RFVGAVLNRVDLDRNA-----YYYSND---YRREYTQYYAK
A0A1F2S1W5      RVAQRAVEQ--LE-LGQA-KFLGTVLNRVDLEHNS-----YYYSRY---YRPEYGGYYGP
A0A1F2T595      RVAQRAVEQ--LE-LGQA-KFVGAVLNRVDLEHNA-----YYYSRY---YRPDYGGYYGP
A0A2V8JQV5      DMALSACRR--FR-EDRT-RVIGTVLNMWDPRDASQK-R-YYYSNT---YYEHYV-----
A0A2V9AC41      PLVRKTRTR--LS-TPHT-KILGVLLNRVDVRAGE-------YGSY---YAHYYEYYPHD
A0A2V8K4L4      TAGSMAIQK--FV-ADGS-TILGTILTDWNPDQNG---Y-GYDYKY---YSSHAAYYTDS
A0A2V8NCZ3      TAAVMAIQK--FV-ADGS-TLLGTILTDWNPDQNG---Y-GYDYKY---YSSHAAYYTDA
A0A2V9MAM9      KTVQLAIQR--LL-TDGV-PVLGTVLNDWNPNIAT--------YGY---YR-----YGKS
A0A2V9M454      AALSRACRV--IE-HSGG-KILGTVLNKVDVRRDG-Y-Y-G--YRY---YHGYYS-YKYK
A0A2V9IVR7      GAVLRAHRI--IE-NAGG-KILGVVLNKVDVRRGT-Y-Y-GSYYGY---GRGYYN-Y---
A0A2V9ILE2      GAVLRAHRI--IE-NAGG-KILGVVLNKVDVRRGT-Y-Y-GSYYGY---GRGYYN-Y---
A0A2V9LGY4      GAVLRAHRI--IE-NAGG-KILGVVLNKVDVRRGT-Y-Y-GSYYGY---GRGYYN-Y---
A0A2V9J4D6      AVLIRAQQI--LH-STGA-RILGVLVNKADLRRGG-G-Y-GYGYNY---YNGYYY-S---
A0A2V9L9C5      AVLIRAQQI--LH-STGA-RILGVLVNKADLRRGG-G-Y-GYGYNY---YNGYYY-S---
A0A2N9M9N1      GALHRVRQI--LD-RAGA-KTLGAVLNKLDDRVDG-Y-Y-TSRYKY---YGYYYS-QEPS
A0A2V9JEC4      AALRRARQT--IE-QAGA-HIVGAILNKATRRATDGY-Y-GSRYSY---YGSYYH-K-PP
A0A2V9LPQ3      GALARCHRI--LD-VAGG-KVLGVVINKVDFQQEGYY-Y-GSLYRY---YGSYYG-K-P-
A0A348V070      NALKQARNK--IE-DHKI-NCLGVIINGVSLLEQE---G-YYARQY---YHYSKP-L---
A0A2Z5G3A3      QLLARSYRL--LQ-MHGG-SPTGIVLNGIEREAEK-------RYSC---YGYSGSDLVTQ
A0A2V7UGP8      PAVIRGRQK--LT-QAKA-NILGVVLNDVDVRHGE------YYSYH---YGYRYRAYRYE
A0A239MKT6      QVVRATASM--LR-QYSG-RLLGYVVNDVESNQTA--------------YGYGYG-YDAY
A0A3E0PCN7      EVHSQAKKK--IE-EVGG-NVVGVILNDVPISEYK------YHNSY---YYRQLEEFEDE
A0A2V8IYW3      DLIKRAVDT-----LGRE-RILGVVFNGADTSRRY-G-D-DYYGYY---AKSGYG-----
G2LEI9          EIVKRTCRK--LD-ETNT-RVLGVVLNGMTQEQSS-Y-Y-GYDYYG---YSSYYR-YSQA
A0A317J121      VAALQAYQQ--LS-EDQT-PLLGTVLNDFKATRRS-------RQGY---YNYAGR-----
A0A2V7YW66      EEARLCRDR--LR-QAGV-KILGAVLNRYRSLQTG-L-G-KRYKYY---EAYGAE-----
A0A2V7Z0V0      EEARLCRDR--LR-QSGI-KILGAVLNRYRSLQTG-L-G-KRYRYY---EAYGAE-----
A0A2V8GFD4      GAAKTALEQ--LD-AAGA-RYIGAVMNRAEIRRHP-----HYYSRY---YRTK---YTTS
A0A2V8HSS5      GAAKTALEQ--LD-AAGA-RYIGAVMNRAEIRRHP-----HYYSRY---YRTK---YTTS
A0A2V8KP55      YIAYRAVQH--LA-EAQV-RIAGVVLNDLDLRHLA------GYSAR---YRDGYV-YDRY
A0A399WNU1      DVLTRARQK--IQ-DVHG-NVVGIVLNDIQLNNFK----------Y---YNHTYY-----
A0A2V9CG11      ESALFATEC--FA-KDRT-RVLGTILNGWDPKTGG-------RYGY---GGYYAG-YGGV
A0A2V2R0I6      EAFTRTRDL--LS-SVKC-RLLGVVLNAVDSSAPD---Y-YYSYRY---YPYSYG-YGPQ
A0A2V8XAR9      EAFTRTRDL--LA-SVKC-HILGVVLNAVDSSAPD---Y-YYSYRY---YPYSEG-YGPQ
A0A2V8VZA0      EAFTRTRDL--LN-SVKC-RILGVVLNAVD--------------RY---YPYSYG-YGPQ
A0A1Q7CB82      EAFTRTRDL--LN-SVKC-RILGVVLNAVDSGAPD---Y-YYSYRY---YPYSYG-YGPQ
A0A2V8WIU1      EAFTRTRDL--LN-SVKC-RILGVVLNAVDSGAPD---Y-YYSYRY---YPYSYG-YGPQ
A0A1Q6Y9F5      EAFTRTRDL--LS-SVKC-RILGVVLNAVDASAPD---Y-YYSYRY---YPYSYG-YGPQ
A0A2V9EVV8      EAFTRTRDL--LS-SVKC-HILGVVLNAVDASAPD---Y-YYSYRY---YPYSYG-YGPQ
A0A2V8YF91      AAFARTRDL--LN-NVKC-RVLGVVLNAVDPGAPD---Y-YYSYRY---YPYSYG-YGPQ
A0A2V8XZK2      AAFTRTRDL--LN-SVKS-RILGVVLNAVDSSAPD---Y-YYSYRY---YPYSYG-YGPQ
A0A2V8ZTX6      VAFTRTRDL--LT-SVKS-RILGVVLNAVDSSAPD---Y-YYSYRY---YPYSYG-YGPQ
A0A2V9BT79      VAFTRTRDL--LT-SVKS-RILGVVLNAVDSSAPD---Y-YYSYRY---YPYSYG-YGPQ
A0A1Q8B793      EAFTRSRDL--LT-SVKC-RLIGVVLNAVDSTAPD---Y-YYSYRC---YPYSYG-YGEP
A0A2V9BCA0      EAFTRSRDL--LT-SVKC-RLIGVVLNAVDSTAPD---Y-YYSYRC---YPYSYG-YGEP
A0A2V9BWU9      EAFMRARDQ--LV-AVKC-RLLGVVLNAVDSSSPD---Y-YYSYRY---YTYSYGAYGKE
A0A2V9DKX2      EAFIRARDQ--LV-AVKC-RLLGVVLNAVDSSSPD---Y-YYSYRY---YTYSYGAYGKE
A0A2V9JSI3      GAIQRTHKI--LE-NAGG-KVLGVVLNKLDARRNG------YYGSY---YP--SA-YGKY
A0A2V9WI32      AALRRVRDL--LS-HVNA-RITGVIVNAFDLHSGS--------SYY---YQYDSK-YYGR
A0A2V8IVN9      HTAKAAIRQ--LE-NAHA-KFVGAVLNRVELEKHH-----YYYSQY---YR--KE-YARY
A0A1F2TPT3      RTARRAVEQ--LM-MANA-KVIGGVLSRVDPGRFG-----QYYSSY---YRGNSR-KYRD
A0A2V8JTQ2      DAFLRAQDL--LS-KVNA-RLTGFVLNGANLDSSD-------FRYY---HNYSQD-QTKL
A0A2V8UZY0      DTFLRAQDL--LR-RVNA-HVAGFVLNGAQVDSSD-------FRYY---YSYHSQ-HQTK
A0A3N5YNR8      EAARKAGNH--LS-SVGA-RILGALINNVDMNAPE-Y-S-YYYRHY---FDERYN-TDLS
A0A350UEK1      DAALAARMR--LR-EDGV-TLIGTVMNDWDPQDSP-----GGYYGS---YGKYST-YRQY
A0A350UIQ4      DAAMACRMR--LR-EDGT-HLIGTVMNDWDPKDSP-----GGYYGY---YGKYSS-YHQY
A0A3N6A5T6      EAVRRASEH--LN-QVGA-KILGVMINDVDIRKSE-Y-R-YYYKYY---YDSKYY-SGYG
A0A1F2Q9L4      EDARTCRQR--LQ-LSEV-RILGAALNRFREHHGR-Y-G-KRYRAY---QK---------
A0A1H5SQF5      TPLRRALEQ--LA-PSRN-RLLGLILNAADIESSE---F-GGGYKY---YGDSTY-YEDS
A0A3E0NV31      EAVRRTSLR--FQ-RAGA-RILGALINGADLRNPD-Y-G-YYYSGY---LS--RT-YDYH
A0A3N5M5V0      ETVKKASNH--LM-SVGA-RVLGAMINNVDMDTPE-Y-T-YYYRDY---YD--DR-YNSD
A0A2V9AEW6      ESARFAIQR--FT-EDGT-RVLGTVLNSWDPRTMR--------YGY---GG--YG-VYKD
A0A2V8WQK6      ESALFASQR--FA-EDGT-RVLGTVLNSWDPKNSR-------GYGY---GN--YR-EYEK
A0A2V8XIF4      ESALYASQR--FA-EDGT-RVLGTVLNSWDPKNSH-------RYGY---GS--YA-DYEE
A0A3N5XQP8      RNLKLASEQ--LT-GVGA-NLLGVLVNGLDVTEFG---Y-GAYGGY---YPYGDQ-HRTH
A0A2Z5G7H4      LSLARSHRTL-MD-QSTQ-DRVGIVLNGVSQGSPF-------HYEY---YGHSGS-LGYP
A0A2V9L5B5      DLVRRARAL--LY-NAGA-RILGVALNDVDLRREG-Y-G----------HNGSYG-YSYT
A0A2V9LK56      EAVRQACAS--LK-SVGA-RILGVTLNGLDLRRDG-Y-G-YGYGSR---YGYHYG-YGYG
A0A2V9L7I0      DLVQRARSL--LY-GAGA-RVLGVALNDVDLTRDG-F-G------Y---QHYHYG-YIAG
A0A522PPT0      DIVRRARAL--LY-GAGA-RILGVALNEVQIHRSN-Y-G-GKYGYY---QQYGYG-Y---
A0A2V9KCS3      DMALAATQR--FA-EDGT-PVLGTILNQWNPNSTA-G-Y-GYYSDY---HQ---------
A0A2U3KC61      AALRRACDL--LL-QVNA-RVMGIVLNALNRHSIE------E---Y---YQYGGR-YANH
A0A2V9Y2R7      PALRRACDL--LL-QVNA-RVMGIVLNALDLHSAD------GYHYY---YSYGGR-YAGH
A0A372IT17      PAIARSYRALSLQ-MAQN-AVLGVVLNGVRETSAE-------YYEY---YGYKGS-R---
A0A136JPP4      HLMRQTRTR--IS-ALGA-RIYGVVLNGITSESVE--------YDY---YG--TG-YYTY
A0A399WUJ8      HLMRQFRTR--IS-ALGA-RIYGVVLNGITSESVE--------YDY---YG--TG-YYHY
A0A2V9NGH6      QALRRARDI--LL-QVNA-HATGVLLNAVDLNSGD-------Y-YY---YEYQGK-HGQR
A0A2V9PYE6      QALRRARDI--LL-QVNA-HATGVLLNAVDLNSGD-------Y-YY---YEYQGK-HGQR
A0A2V9NL07      PALRRSRDI--LA-QVNA-RVAGVLLNAVDLDSPD-------YYYY---YEYQGK-YGQR
A0A2V9QD92      PALRRSRDI--LA-QVNA-RVAGVLLNAVDLDSPD-------YYYY---YEYQGK-YGQR
A0A2V9WPZ6      GALRRSRDI--LM-QVNA-KVAGVLLNAVDLSSPD-------YYYY---YEYQGK-YGSK
A0A2V9ZLH4      QALRRAREL--LV-RVNA-KITGVLLNAVDLSSPD-------YYYY---YEYQGK-YGGR
A0A2V9RQF1      QALRRSRDI--LM-QVNS-RISGVLLNAVDLNSPD-------YYYY---YEYQGK-YGQR
A0A2V9YDK8      GALRRSRDI--LM-QVNA-KVTGVLLNAVDLNSPD-------YYYY---YEYQGK-YGSR
A0A2V9V8F7      GALRRSRDI--LM-QVNA-KVAGVLLNAVDLSSPD-------YYYY---YEYQGK-YGSK
A0A2V9XGR9      GALRRSRDI--LM-QVNA-KVAGVLLNAVDLSSPD-------YYYY---YEYQGK-YGSK
A0A2V9V3Q5      QALRRARDI--LM-QVNA-HVTGVLLNAVDLTSPD-------YYYY---YEYQGK-YS-Q
A0A2V9NWS3      QALRRSRDI--LM-QVNA-RVAGILMNAVDLRSPD-------YQYC---YEYQGK-YGHR
A0A2V9USA9      QALRRSRDV--LM-QVNA-KVSGVLLNAVDLSSPD-------YYYY---YEYQGK-YA-R
A0A2V9XW18      QALRRARDI--LM-QVNA-KVVGVLLNAVDLSSPD-------YYYY---YEYRGK-YA-S
A0A4R1LC91      QSLNRSQTL--LQ-TQGG-STIGIVLNSLTRRTGA-------YYDY---YG--YK-NSAY
A0A3M2BZG9      EHARACRER--LR-YQRI-RLLGTVVNRFNPSGAS-R-Y-ARQYYY---AD---------
A0A1Q7N5R7      ELARTRLAM--LE-HLPI-RLLGVLLNDVQPGEM---------YGY---YS--YT-YAGG
A0A3M1SIV3      HLLKRFKQR--LN-SIGA-RIYGVVLNGISSTSPE--------YGY---YGYYYG-Y-ES
A0A3E0PHB0      HLMRRFKHR--LL-NMGA-RIYGVVLNGLKPNSVE--------YGY---YG--YG-YGYD
A0A3M2D491      NLMKRFKQR--LI-SIGA-RIYGVVLNGVKPSSLE--------YSY---YGYYYG-Y-YG
A0A357F267      HLMRRFKQR--LG-NLGA-RIYGVVLNGIKAGSME--------YDY---YG--SG-Y-YD
A0A353C9L6      HLMRRFKQR--LG-NLGA-RIYGVVLNGIKSGSVE--------YEY---YG--AG-Y-YD
A0A2V8RQV0      HLMRRFKQR--AN-AIGA-RIYGVVLNGIKSGSIE--------YEY---YG--TG-Y-YD
A0A2V8SJH5      HLMRRFKHR--LG-TIGA-RIYGVVLNGIKAGSME--------YDY---YG--TG-Y-YE
A0A2V9QB26      DAAEAATQR--FT-EDNT-RVLGTVLNGWDPKETS-H-Y-DYRYQF---YR--YH-H---
A0A2V9VYY4      PALRRACDL--LL-QVNA-RVMGIVLNALNLHSVE-G-Y-YYYGTQ---YS--NN-Y---
A0A2V9KIE8      QVIQRAKNL--LY-GAGA-RILGVALNGVDFRHGG-Y-G-YGYYRR---YG--YG-YGYG
A0A352F549      QVVKRARQM--LQ-EIGA-KIIGVVLNKAELNAGN-D-Y------Y---YH--YG-Y-KG
A0A3B9MLP9      QVVRRTRQI--LQ-EIGA-KIIGVVLNKAEVRSSD-Y-Y------Y---YH--YD-Y-KG
A0A3D5SQ87      QVVRRTRQI--LQ-EIGA-KIIGVVLNKAEVRSSD-Y-Y------Y---YH--YD-Y-KG
A0A2V8NW86      DAAEAATWR--FT-EDNT-RVLGTVLNGWDPKETS-Y-Y-GYRYPF---CR--YH-Y---
A0A2V8ZHL8      GAVARARKV--LE-NAGA-RILGLVFNKVDVRHNG-Y-Y-GYYGHY---YY---S-G---
A0A2V9B240      GAVARARRV--LE-NAGA-RILGLVLNKVDVRHNG-Y-Y-GYYGHY---YY--SS-G---
A0A2V9CBM2      EQVLHAQSS--IS-SVRA-NLIGVILNGVDVRTNG----------Y---YD--YG-R---
A0A2V8XN17      EQLLHAQSG--IR-SVGG-NLIGVVLNSVDIRTNG----------Y---YN--YG-S---
A0A2V8WX45      EQILHAQSG--IR-SVGG-NLIGVVLNSVDIRTNG----------Y---YN--YG-P---
A0A1Q6YR79      EQLLHAQAG--IR-GVGG-NLIGVVLNSVDIRTNG----------Y---YS--YG-P---
A0A1Q7VA32      EQLLHAQAG--IR-GVGG-NLIGVVLNSVDIRTNG----------Y---YS--YG-P---
A0A2V9EY85      EQLLHAQAG--IR-GVGG-NLIGVVLNSVDIRTNG----------Y---YN--YG-P---
A0A2V9H8K0      EQLMHAQSG--IR-SVGG-NIIGVVLNSVDIRTNG----------Y---YN--YG-Q---
A0A2V9FFE5      EQFMHAQSG--IR-GVGG-NLIGVVLNNVDICTNG----------Y---YN--YG-P---
A0A2V9GM43      EQFMHAQSG--IR-GVGG-NLIGVVLNNVDICTNG----------Y---YN--YG-P---
A0A1F2RFI7      EAVNHAKQH--LH-QVNG-NLIGVVLNNVDFSAVG---Y-DYYYRY---YR--KG-YGYG
A0A1F2RZS3      EAVKHAKEQ--LQ-QAGA-NLIGVTLNNVDFSAVG---Y-DYYYRY---SR---G-YGYG
A0A1F2USE2      ELARRAQLH--CR-DVGA-TVVGVVLNNLDVRSGD-Y-Y-YYYYRY---YR--YG-YGYG
A0A2V9C238      ELAQRAGAY--AR-DVGA-NLIGVVLNNLDLRGGD-----DYYYRY---YH--YN-Y---
A0A1F2Q9F5      ELVQRAYVY--AR-DVGA-NVIGAVLNNLDIRSDD-----YYYGRY---YR--YD-Y---
A0A1F2QQH9      ELVQRAYVY--AR-DVGA-NVIGAVLNNLDIRSDD-----YYYGRY---YR--YD-Y---
A0A1F2QXK7      ELVQRAYVY--AR-DVGA-NVIGAVLNNLDIRSDD-----YYYGRY---YR--YD-Y---
A0A2V9DEM9      ELAQRAGAY--AR-GVGA-NLIGVVLNNLDLRGGD-----DYYYRY---YH--YN-Y---
A0A2V9CYQ5      EQVLHAQSS--IS-SVRA-NLIGVILNGVDVRTNG----------Y---YD--YG-R---
A0A2V9BWU8      EQVIQSQTS--IR-SAGA-NLTGVVLNNVSLHTNG----------Y---YG--LG-I---
A0A2V8ZG48      EQIRQSQSG--IR-SAGA-NLIGVVLNNVTLHTNG----------Y---YG--LG-I---
A0A2V8Y334      EQVLQSQSS--IR-SAGA-SLIGAVLNGVSLHTNG----------Y---YG--LG-I---
A0A2V9AY68      QQVMQSQSS--IR-SAGA-NLIGVVLNNVTLHTNG----------Y---YG--LG-M---
A0A257VBK0      PLLERILVT--LA-RAHV-QVAGVVLNEVETHSSYYYDYYYYNHYY---YATGTEPKRLP
A0A2V7XDY0      KLIRRNLSA--LR-KVTD-TVLGVVLNAVNVKAKGYY-YYYYPHDV---ETSKAPNKPSE
A0A350UQT3      KAVAAALTT--LS-HLRA-NVLGLVLNQVKKHHADSYYYYGYYGKY---YKRYQSAAQNA
A0A2U3JZ71      KALGSAVNT--LK-RLRA-NTVGVVLNDVRADSSDNYYYYHYHPKY---YKHYSVEAENE
A0A2V8TTB0      KALSSVIGT--LA-RLRA-NLVGVVLNEVHRKVSAGYYYYYGH--Y---SKYYGRTEDK-
A0A1F2TCR2      GHAERALQT--LL-SGRP-QSIGAVLNRVDFDRNKYY-YARYYGYQ---YKSYYGQTNTT
A0A2N9LQU7      KAMIRTLDL--LA-RAKA-HVLGMIVNGVALEPEYVNSYVTYGYSK---GYGDIDAKRSA
A0A2P6WFK7      RAVLRVRNL--LR-RSNA-NLVGIVFNGVDMLLEQYYYAKGSYYGK---SMGNYYLSEDE
A0A1F2V330      EVLERGLES--FQ----ATKLLGAVVNDVDYQRSRYA-YAYQYQAG---LPV--------
A0A2V8U914      KTALAAANR--LF-LDGV-PVLGTILNHWNPVVWGDAYGYPSYRGV---YDQTAS-----
A0A662EE63      QVVADAMRT--LK-RSGV-RVAGVLLNNVDIERDHYYSTYYYSYYH---YGYDEDGKRDK
A0A2V7W309      ELVQRSAER--LR-LSNI-PVLGALLNNLDLQQYGYT-YRKSYYDY---YDSNQDNAERR
A0A2V8TLH7      DLIRRCVGD--LR-KINA-NVIGAVLNNIDLERSDYKDYYYVGYYY---YGESSSSKKDR
A0A1Q7ZJT1      ELIRRCVTN--VR-RINP-NVIGAVLNSVDLERSHYKDYYYVGYYY---YGESSSSKKGR
A0A2V8VC99      ELIRKCVTN--VR-KINS-NVIGAILNNVDLERSHYKDYYYVGYYY---YGTSGGKRGRR
A0A348UZU3      EALRQTREI--ID-LLQL-KTFGVVINALNLDNRSYY-HRHYYRHY---YKH--------
Q01XL7          EGATSACQR--FA-EDGI-AVLGTILNDWTPKEGSPSHYYYHSYEA---YGQK-------
A0A2V8ERZ5      RLAERAIET--VM-QAHP-RFAAVVLNKVNFAKNKYY-YSRYYGHQ---YKNYYAEATP-
A0A2V8GTX0      RLAERAIET--LQ-AGHP-RSIAAILNRVDFDRNRYY-YSRYYGHQ---YKSYYAEAPAA
A0A2V8J0X9      VHAERALET--LQ-SGRP-RSIGVVLNRVDFDRNKYY-YSRYYGYQ---YKSYYGQNQGA
A0A523DUV7      KLAKRSLNA--LK-RTGA-RVAGVVLNSVDPKQDSYH-YYYSYYAE---PESKVTRMRRP
A0A372IRG7      KALSRVREQ--LR-RSGA-RVLGTIINDVDLRLENYY-TYSRRYDY---GYKGYKGYGSA
A0A1F2U158      RLAERALET--IL-ASHP-KMVGVVLNKVDFARNKYY-YSRYYGHQ---YKSYYARVG--
A0A2V8F6S9      RLAERAVET--VM-QTRP-KYAAVVLNKVDFARNKYY-YSRYYGHQ---YKNYYAEAAV-
A0A4Q1SCH5      KALARTKAI--LL-RAHA-RISGVLLNDISHANEDSGYYGKDGYAY---YN---------
A0A2W0BGU4      KFVSRARNI--LD-GANA-RLLGVALNKVHMRHDGYYGSYYSGYHA--------------
A0A2W0BVQ9      KFVSRARNI--LD-GANA-RLLGVALNKVHMHHDGYYGSYYSGYHA--------------
A0A3D1ASD2      KAVASVLST--LH-RLRA-NVVGLVLNEVRKEMSDSYHYYGNYGKY---YRAENEKRAS-
A0A2N9MK30      KALASVVSM--LQ-RLRA-NVVGVALNEVTKDIGDSY-YYHGYYGK---YARYYNHKTET
A0A1I6MH75      QIVRRARDL--LI-RSGA-PITGLVLNAVDLNSPEYY-GYY---GY---SGYSYTSIDSD
E8WVF6          HVVRRARDL--LV-RSGA-PIAGIVLNAVDLNSPEYY-GYY---GY---SGYSYSSLDTA
A0A1H5Z7N3      QAVRRARDL--LI-RSGA-PLAGIALNAVDLNSPEYY-SYYGYYGY---SGYGSQGVEHD
A0A2V9YHT3      EALRRAREL--LA-RVNA-KVAGVVVNAVDLRSPDLH-HYYYSGGG---RGYKYYDDSTT
A0A1G7JVV8      NVVRRARDL--MV-RSGA-PVTGVVLNSVDINAPEYH-GYY---GY---SGYSYSNIDSE
A0A1H4T6W9      NAVRRSRDL--LV-RSGA-NITGVLLNSVDINAPEYH-GYY---GY---SGYSYSNIDSE
I3ZEU5          NAVRRSRDL--LS-RSGA-NVTGVLLNSVDITAPEYH-GYY---GY---SGYSYSNIDSE
A0A5B9EBI2      QVVRRARDL--LV-RSGI-RVTGFVLNAVDINSPEYY-GYY---GY---SGYSYANLDSD
A0A239HDF6      HVVRRARDL--LV-RSNC-PLKGIVLNAVDLSAPEYE-SYY---GY---SGDGYANLDNG
A0A4Q0T270      QIVRRARDL--LI-RSGA-PIAGLVLNAVDLNSPEYY-GYY---GY---QGYSYSGVDSD
A0A1Q3QQB6      HVVRRARDL--LL-RSGA-PITGIVLNAVDTNSPEYY-GYY---GY---SGYSYSSGDSG
A0A3N1K1G7      HVVRRARDL--LL-RSGA-PITGIVLNAVDLNSPEYY-GYY---GY---SGYSYSSVDSE
A0A428MDU2      HVVRRARDM--LL-RSGA-PITGIVLNAVDLSSPEYY-GYY---GY---SGYSYSSVDSE
A0A4V2G466      HVVRRARDL--LL-RSGA-PVTGILLNAVDVSSPDYY-GYY---GY---SGYSSAGADAE
A0A4Q7YNP3      EQATKARDF--FD-KDRV-RLIGTILNAFDPGRERLSKYYDSYYRY---KQEAETFQKAA
A0A2V9MN96      GAVRRASEL--LL-QVNA-RVMGVVLNAFNFRSTDDN-YYYYGSKY---SGSYYQQPEEN
E8UZE1          QSLQAVRDT--IV-SVRG-RVAGVVLNDVKTSSEAYY-AYYGNQDG---GAAYYAEAENA
A0A2V7V2Z1      NGLRQTLER--VR-ETGT-RLLGVVLNRAQVEKHSYY-YGRYYGHY---YGHYYSSAPSR
A0A2V7X2F7      KAVATTIER--IK-ESGA-RLLGVVLNRARVQQHGYY-YGRYYGHY---YGHYYGHYGQQ
A0A2V7V2I1      KAVLHTLER--VK-DTGA-RILGVVLNRVPMEQNAYY-YSHYYSHY---YGHYYDDQHPK
A0A2V7U3M2      NGVRHTLER--VH-ETGA-RLLGVVLNRAQVEKHSYY-YGRYYGHY---YGRYYGAPAPR
A0A2V7UHT0      NGVRHTLER--VK-ETGA-RLLGVVLNRAQVEKHSYY-YGRYYGHY---YGRYYGSPPAQ
A0A2Z5FVL3      QSLDLSLRT--LRAQLGTNRHIGVVLNGVERTADAYYKYYGFSNST---YYTNTKRLGGG
A0A1V6HR88      QEAKACRDR--LQ-VAEV-KVLGAVFNRFRVGGGPYR-KGYAAYQT---YAGYGEERSGG
A0A2V9KBD6      DTFQRAQDA--LF-KVNA-PLTGFVLNGAQLDSADFR-YYHSYYSP---DQSKRLGNAA-
A0A2W0AJ66      DAFLRAQDL--LL-RVNA-HLTGFVLNAAELSSSDFR-HYYGYYSQ---HETNRPDAVA-
A0A1Q7RBU1      DEFLCAQDL--LL-KVNA-HLLGFVLNGAGLSSSDFQ-YYYGYYGQ---DQSKRLGKGT-
A0A2V9JPV9      DEFLCAQDL--LL-KVNA-RLLGFVLNGAGLSSSDFQ-YYYGYYGQ---DQSKRLGKGA-
A0A3E0P0A3      EAIQRCVEQ--LT-RAGA-PMLGTVFNAYKARPGRYG-GRYQSYGY---GYGYGAY----
A0A2V8EXP2      HTAQRAVEQ--LS-HARP-KFLGAILNRVDLQHQGYY-YSHYYRRE---YAGYYTQ----
A0A2W4RYA1      HAANQALGQ--LA-RAGA-RVIGGVLNRVDLDRNPYY-YSAYYSRE---YTRYYVP----
G8P0Y7          AHVRHTCGL--LH-SVNA-DVLGVVVNAADLGSPDYY-HYGGRSGY---YAANKMKSQEM
A0A5M8T4U7      RAILRARDL--LW-RINA-KIAGVVVNDVDMRLENFYTYRYGMYGY---RYGYGYS----
A0A3P0X3W6      DAVAAAIGT--LN-RLDV-RILGLVLNKVRREMSSTY-QHFGVYGQ---YDERVLNAS--
A0A1E3Y9R6      QTAIAAVEQ--LR-SANA-RFIGAVLNRVNIQRHAYY-YSPYYRKE---YGKYYQR----
A0A2W4TLP2      QNAAAAVEQ--LR-GANA-KFIGAVLNRVNVQRHSYY-YSPYYRKE---YGKYYQR----
A0A3R9WF43      SMASSVAQI--LI-RTHA-PALGFVLNGVHNPSLDGF-HDYSYLRE---KGSETHADA--
A0A317HKM4      DVASAAVER--LD-AVGA-NVVGAMLNGVVLDQPGRS-YLPYYHRE---YPAYYCEQTGS
A0A523E0N1      HAAKQSIEL--IE-RVNG-KITGLVLNDVDLKDYAQY-YYHSHYAY---ESGAYME----
A0A523ECP2      NAVRQSLEL--ID-RVGG-KVTGVILNDVNLADYAQN-YYYSYHSY---EYGTYGE----
A0A2W0C122      DALARSCDV--LN-QANI-PVLGIVVNGVSPRSSGSY-YYGYYPQL---AKGYYTN----
A0A2W0AUU7      DALARSCDL--LN-QANA-PVLGIVVNGVSSRSAGSY-YYGYYPQL---AKGYYGD----
A0A2W0BQL1      DALARSCDL--LN-QANA-PVLGIVVNGVSSRSAGSY-YYGYYPQL---AKGYYGD----
A0A4Q1SDL1      DSLKRAFHL--LASRTPR-SSIGVVLNGVTMNSDAYH-SYFGEKTS---HYYMENV----
A0A3P0XH15      KALLRTREQ--MR-RVNS-RVQGIIVNDVDLRLENYY-TYSKRYNY---SYNSTYG----
A0A4R1LAZ7      KALQRVRDQ--LL-RVNA-RVLGTIVNDVDLRIENYY-TYSKSYDY---GYKSYGS----
A0A3M1WQW8      ELVQRAKQS--LE-DVNA-KIFGVVLNRMDVGQDGYY-YYYYRYYY---ADEDPRD----
A0A3N1JHC1      DDLAEARRL--LA-EDGT-YIVGTILNDYDLRNEKSS-HYSSYLTY---VGNSSA-----
C1F294          KALQRTREL--LR-RANA-RILGSVVNGVDMRLENYY-TYSRG--Y---SYGYRSG----
A0A2V9KA79      ELFQHAVES--FH----ATNILGVVLNDVDVDHTRYA-YAYRY--Y---QKNYATK----
A0A522PSP1      DYVQQVIDQ--LR-QVRA-QLAGIVLNGVTPEMGHHY-Y------Y---YHDGYHS----
G8P085          GALKRIRDV--LR-HTNA-QVAGVVINDMAVTQTGYY-GGYGSGYY---N----------
A0A4Q1SGQ1      QAVHRSMAL--LREQIPETGTLRVVLNGISKDSQDFH-D------Y---YGDNKTY----
Q1ILD9          SALRRSYEM--LL-HDGI-RVAGVILNMYNPAGDYGY-YGSNYYSY---YHEGEGV----
Q1IJZ6          AALGKAVEV--LR-RNKA-PLRGLVLNAVNTKGTDYY-YSHGYYGY---DSYGSNG----
A0A2V8TCE6      EEALRAREK--LR-QVSA-RLLGVVLNNAAESGRSYG-RYRYR--Y---EPSADSG----
A0A522TBE8      NLVRGALRQ--LR-TTGV-DVTGIVLNCVSARLDPYY-Y------Y---QSAYHNY----
Q1ITG0          HPLRHARML--LA-KVRA-NVVGLVVNDFDAKAKYYG-YSYSYDKY---YVEDKTE----
A0A3N5PCI5      RVAQAALDQ--LE-TAGA-TFAGAVLNAVTLDRDHYY-NSRYYLPF---YGDYLTD----
A0A3M1Q0S9      DAGRLGVEK--LR-SGRVPHVLGVVLNAVHVEHVPYQ-YRYYRSGY---KQAGTDS----
A0A2Z5G448      KALLRVRSL--LR-RARA-RVTGIVVN-DVDLRLENY-YTYSKQ-Y---GYDY-------
A0A3M1VZ38      EAGRLGKDK--LE-KGRA-TILGAVLNAVETEHVPYQ-YRYYRY-A---ADDESRP----
A0A4Q1SD29      KALQRVREQ--LR-RANA-HILGIIVN-GVDLRLENY-YTYAKR-Y---DYGY-------
A0A3M1PY35      DAVREVCEA--LR-KIKA-PLLGAVLNDEAGDDASGS-YYRYRH-Y---KRGYYAK----
A0A3M1VMP2      DALRQAVDQ--LA-KVNA-RILGTILNCEVTEDVTGS-YYRSYR-Y---RKGYY------
                                         ..                                 

A0A2V7VMF7      ----------------------QDGEAGKAEARPEAAVKG--------------------
A0A2V7YYV7      ----------------------PDGHARPGRRPSSKSEAPTSSSGT--------------
A0A2V7Z0J5      ----------------------QADPSAPDVEPLARVKPSRSARNA--------------
A0A2V7Z3M4      ----------------------ASGAPNPLVDKTSNADHRAASN----------------
A0A399Y5V2      QGSKRGGGRRSKDSGGARAAQTAGSR----------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ED----------------------------------------------------------
A0A2V8JK38      ENVENRS-----------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      KR--------------------RSSSIAAVTTPDTEDQDRVTRIVG--------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      -----------------------AQ-----------------------------------
A0A2V9R9V4      -----------------------AKRTKT-------------------------------
A0A321LE75      -----------------------SVK----------------------------------
A0A2V8R8U7      -----------------------DESDVQGGADAGQNSRAASS-----------------
A0A2V8QMP4      -----------------------EEAAPEGAAAAAEAGGGRGV-----------------
A0A2V8R4S3      -----------------------EEAAPEGAAAAAEAGGGRGV-----------------
A0A2V8NJ55      -----------------------SEEDEEMAAEGARAE----------------------
A0A2V8Q7I0      -----------------------AESGGDSARESA-------------------------
A0A2V8S6K4      -----------------------DADEEETSGPAQARAGGQP------------------
A0A317I2L9      -----------------------DADAGASTGETA-------------------------
A0A2V8LLF9      -----------------------NSDEETAKDGDARAASV--------------------
A0A352FRF4      -----------------------YAAEEQPATDQGDATNT--------------------
A0A2V8MKV0      YS--------------------DYSDDD------GKKAQTASG-----------------
A0A2V8PYY8      YS--------------------DYSDDD------SKKTQAASG-----------------
A0A1Q7YKQ8      -----------------------NSDDE-PDVEAASAGESRTS-----------------
A0A352F3R7      -----------------------AEGEDKPEAVPGETAQS--------------------
A0A0B6WXT1      -----------------------DEEED-ERDLPEGAAERGAH-----------------
A0A3B9MEU8      -----------------------ADGDK-PEEVPGEPAETR-------------------
A0A2V8MHG6      -----------------------AETEPHKISTS--------------------------
A0A2V8P7N1      -----------------------ADIQPTEISPSTADS----------------------
A0A2V8M3M6      ------------------------DIQPTEISPSTADS----------------------
A0A1Q7NJH5      -----------------------ADTQPAEISPSTVDS----------------------
A0A2V8PJY0      -----------------------ADTQPAEISPSMVDS----------------------
A0A1Q7Y6W9      -----------------------SENKVAPEAQG--------------------------
A0A2V8NC68      -----------------------VEADVDTAA----------------------------
A0A399WK13      -----------------------SDDEA--------------------------------
A0A352FLX4      -----------------------AETTADQQ-----------------------------
A0A2V8RTL7      -----------------------HTDEGE-------------------------------
A0A3E0PCJ6      -----------------------DDPEAADEA----------------------------
A0A3M1S4R8      -----------------------KEEEEE-------------------------------
A0A1Q7YFI6      -----------------------EEEISSDVSTINQ------------------------
A0A136KC10      -----------------------SGDDA--------------------------------
A0A2V8SEX6      -----------------------PSDEQ--------------------------------
A0A3M2D6Y5      -----------------------KEEEK--------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      -----------------------SDGDDDIEPTSHARRNGSHNTLDLN------------
A0A352EX26      -----------------------SDLEADMPAPPPPASASSTLDLR--------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      -----------------------HDVESDGADERASA-----------------------
A0A2V8PWS6      -----------------------HDVESEPGERAASA-----------------------
A0A2V8LCT5      -----------------------ADEAEEAKSVAAS------------------------
A0A352FTJ9      -----------------------QETAEEVAATRS-------------------------
A0A2V8G155      ER--------------------TAS-----------------------------------
A0A2V8HDM7      ER--------------------TAS-----------------------------------
A0A2V8DRT9      GA--------------------NTKSADAKSA----------------------------
A0A2V7VYF3      PA--------------------HD------------------------------------
A0A1F2SVH2      EG--------------------SART----------------------------------
A0A2V8AJG9      TA----------------------------------------------------------
A0A2G6PYV5      SY--------------------NTPDDPTG------------------------------
A0A2V8F956      SS----------------------------------------------------------
A0A1F2S1W5      GAPGGTQTGTGAGPPAANSGGVGTRAARVAAATAAKAASVAATVGSRLVRRTAESASGTL
A0A1F2T595      PG--------------------GGGGGGTVAEPVVARPAAASILGGAGAGARAARVAASA
A0A2V8JQV5      ----------------------HKETEEVKS-----------------------------
A0A2V9AC41      LDLSDGPPAAFGNGNGALSHRVNRHSPATPEPAARKQRSNGLPAGFIDSVGSKLAEAMGP
A0A2V8K4L4      GV--------------------TNDLEAVVGDSKESSGKQAVGSRDL-------------
A0A2V8NCZ3      AI--------------------ANDLEA-VSNSKDASG----------------------
A0A2V9MAM9      YS--------------------WKNAET--------------------------------
A0A2V9M454      AY--------------------YREEDRSSGRS---------------------------
A0A2V9IVR7      -------------------------YYGARSGR---------------------------
A0A2V9ILE2      -------------------------YYGARSGR---------------------------
A0A2V9LGY4      -------------------------YYGARSGR---------------------------
A0A2V9J4D6      -------------------------DYNSYSLRPPE------------------------
A0A2V9L9C5      -------------------------DYNSYSLRPPE------------------------
A0A2N9M9N1      AS--------------------KTPDLYSAGDR---------------------------
A0A2V9JEC4      TS--------------------DVLDSGNGSSG---------------------------
A0A2V9LPQ3      -------------------------DNGESASP---------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      RK--------------------GGEH