BYKdb

Dataset for cluster tadcd of phylum acidobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

312 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2V7VMF7      MDVGQPAGFPGYDMDTFRTGVGYEVGPSMRASMGYERQRVPGAPDRPVIEAEADSVFLKV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A7D0PQC3      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7D0PPG7      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      TDDRGPAGSGQVEVAYRDQRSPRAAAAGQRFRGLNYAATLRRAVGVNTLVELGGGRATDV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A7D0PQC3      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7D0PPG7      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      SGFEANAFYVSSFARGGLTVALPWELSLHAGRGGLGLEPLPTGRERDRAPARRRPLWLVR
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A7D0PQC3      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7D0PPG7      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      GSEPVVRPPPLPARGLPARPARLQHPRLRSRDPRIHRPARDRPVPRQGHRGEGHAVKSLA
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A7D0PQC3      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7D0PPG7      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LLLAALVLPGARMVAQEAPRPPATPAPEYVVGPGDILQITVYGNEELSRAPTVQSNGTIG
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A7D0PQC3      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7D0PPG7      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LPLLGDVAVTGLSASEIQRKLTALLARDFLVNPQVEVKVKEYQSQFVSVVGEVNNPGRKA
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      -----MEAPNSIQATVPLTATAGPISVTTPAGTGTSSAPFKSATRFENTDPALTYTSGWD
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A7D0PQC3      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7D0PPG7      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LRGRTRLFDVLIEAGGFTPRASGEVVITRREGTFDNGGHSLRLQFSGASPAPKDLVNLEV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      RTSTLRPWSVGTAAVASTAGQQVTFTFSGTDLTWIGFRGPQAGIARVSLDGVFIQQLDMY
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A7D0PQC3      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      -----------------------------------------------------------M
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      -----------------------------------------------------------M
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7D0PPG7      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      PLQNGDLITASAKYYVTVEGEVVRPGRYPLEEETTISTAVIAAGGLTRFAKNDVRIRRVS
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      SVAEEVQAEVFKATGLASGNHTLLIEVTGTSNPASTGSYVAVDAFDIAPQVPATVNITSP
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      --------------------------------------------------------MAQE
A0A2V9R9V4      --------------------------------------------------------MSDQ
A0A321LE75      --------------------------------------------------------MSDE
A0A2V8R8U7      -----------------------------------------------------------M
A0A2V8QMP4      -----------------------------------------------------------M
A0A2V8R4S3      -----------------------------------------------------------M
A0A2V8NJ55      ----------------------------------------------------------MM
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      -----------------------------------------------------------M
A0A317I2L9      ----------------------------------------------------------MM
A0A2V8LLF9      -----------------------------------------------------------M
A0A352FRF4      -----------------------------------------------------------M
A0A2V8MKV0      -----------------------------------------------------------M
A0A2V8PYY8      -----------------------------------------------------------M
A0A1Q7YKQ8      ----------------------------------------------------------MV
A0A352F3R7      -----------------------------------------------------------M
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ----------------------------------------------------------MM
A0A2V8MHG6      -----------------------------------------------------------M
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      -----------------------------------------------------------M
A0A1Q7NJH5      -----------------------------------------------------------M
A0A2V8PJY0      -----------------------------------------------------------M
A0A1Q7Y6W9      --------------------------------------------------------MKES
A0A2V8NC68      --------------------------------------------------------MKES
A0A399WK13      -----------------------------------------------------------M
A0A352FLX4      -----------------------------------------------------------M
A0A2V8RTL7      -----------------------------------------------------------M
A0A3E0PCJ6      -----------------------------------------------------------M
A0A3M1S4R8      -----------------------------------------------------------M
A0A7C2G442      -----------------------------------------------------------M
A0A1Q7YFI6      -----------------------------------------------------------M
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      -----------------------------------------------------------M
A0A2V8SEX6      -----------------------------------------------------------M
A0A7C5ZUU4      -----------------------------------------------------------M
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      -----------------------------------------------------------M
A0A2V8MM59      -----------------------------------------------------------M
A0A2V8PFE8      -----------------------------------------------------------M
A0A2V8PWS6      -----------------------------------------------------------M
A0A2V8LCT5      -----------------------------------------------------------M
A0A352FTJ9      -----------------------------------------------------------M
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------MSVPSQ
A0A1F2T595      -------------------------------------------------MSTQIPPEFSQ
A0A2V8JQV5      -----------------------------------------------------MDMEFSE
A0A2V9AC41      --------------------------------------------------------MEQV
A0A2V9MAM9      --------------------------------------------------------MLPV
A0A348V070      --------------------------------------------------------MDKI
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      -----------------------------------------------------------M
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      -----------------------------------------------------------M
A0A2V9LPQ3      --------------------------------------------------------MADI
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      --------------------------------------------------------MAFD
A0A3E0PCN7      --------------------------------------------------------MQKN
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          -----------------------------------------------------MPQEHPN
A0A317J121      --------------------------------------------------------MRHL
A0A2V7YW66      --------------------------------------------------------MSPL
A0A2V7Z0V0      --------------------------------------------------------MSPL
A0A2V8GFD4      --------------------------------------------------------MSDN
A0A2V8HSS5      --------------------------------------------------------MSDN
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      --------------------------------------------------------MQSN
A0A2V9JSI3      --------------------------------------------------------MTND
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      --------------------------------------------------MSDIRNFDPS
A0A7C5Z4J3      ----------------------------------------------------MPQEANES
A0A1F2TPT3      --------------------------------------------------------MSDE
A0A2V8JTQ2      -------------------------------------------MSESFELMNQRARDFDP
A0A2V8UZY0      -------------------------------------------MSKYFELMNRLRRD-SP
A0A350UEK1      -------------------------------------------------------MSQQS
A0A350UIQ4      -------------------------------------------------------MPKPT
A0A1H5Z7N3      --------------------------------------------------------MIPV
A0A1G7JVV8      --------------------------------------------------------MPPL
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          --------------------------------------------------------MPPA
A0A1I6MH75      --------------------------------------------------------MDRQ
E8WVF6          --------------------------------------------------------MSSD
A0A7D0PQC3      --------------------------------------------------------MTPD
A0A428MDU2      --------------------------------------------------------MGLE
A0A5B9EBI2      --------------------------------------------------------MGPQ
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ----------------------------------------------------------MA
A0A1Q3QQB6      --------------------------------------------------------MGLQ
A0A3N1K1G7      --------------------------------------------------------MGPK
A0A4V2G466      --------------------------------------------------------MGPQ
A0A6B9YNQ8      --------------------------------------------------------MGLQ
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      --------------------------------------------------MPLQPKRNNS
A0A2V9Y2R7      --------------------------------------------------MDSPIVVRSA
A0A2V9NGH6      -------------------------------------------------MDSAPLIAANT
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      -----------------------------------MYLLFQFSIQLGRQMEPSPVMQI-G
A0A2V9QD92      -------------------------------------------------MEPSPVMQI-G
A0A2V9WPZ6      ----------------------------MACWSALLGRNRMQDCCSGVGMDSGPLVHTNG
A0A2V9ZLH4      -------------------------------------------------MEPGSLIPSNG
A0A2V9RQF1      -------------------------------------------------------MPANA
A0A2V9YDK8      -------------------------------------------------MDSGPLVQTNG
A0A2V9V8F7      CSARMRQTFITNNFLSASEHPRRRLWSLWACWSALLGRNRMQDCCSGVGMDSGPLVHTNG
A0A2V9XGR9      -------------------------------------------------MDSGPLVHTNG
A0A2V9V3Q5      -------------------------------------------------MALGPLVPHND
A0A2V9NWS3      --------------------------------------MVGLNFFLGASMASGPLIPANG
A0A2V9USA9      -------------------------------------------------MDSGPLVPANS
A0A2V9XW18      -------------------------------------------------MDLGPLAPLGT
A0A1H5SQF5      ------------------------------------------------------MPYDPL
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      --------------------------------------------------------MADE
A0A2V8XAR9      --------------------------------------------------------MADD
A0A2V8VZA0      --------------------------------------------------------MADE
A0A1Q7CB82      --------------------------------------------------------MADE
A0A2V8WIU1      --------------------------------------------------------MADE
A0A1Q6Y9F5      --------------------------------------------------------MADE
A0A2V9EVV8      --------------------------------------------------------MADE
A0A2V8YF91      --------------------------------------------------------MTDE
A0A2V8XZK2      --------------------------------------------------------MAEE
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      --------------------------------------------------------MTDE
A0A2V9YHT3      --------------------------------------------------------MDSG
A0A7C2XNI7      -------------------------------------------------------MNSNG
A0A1Q8B793      -------------------------------------------------------MEENG
A0A2V9BCA0      -------------------------------------------------------MEENG
A0A2V9BWU9      --------------------------------------------------------MDES
A0A2V9DKX2      --------------------------------------------------------MDES
A0A7C2YQY3      --------------------------------------------------------MDPK
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ---------------------------------------------------MADLAKQSR
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      --------------------------------------------MNESIDVHQRRGLVQG
A0A2V9LK56      ---------------------------------------------------------MDE
A0A2V9L7I0      ---------------------------------------------------------MDE
A0A522PPT0      ---------------------------------------------------------MDS
A0A7C5V1G5      ---------------------------------------------------------MEE
A0A2V9KCS3      WRCIPTTFSSFRAAPARRPGGARWKRCWAWARASAQAPRSIAVNRDLFRVNHSRADSTSG
A0A372IT17      --------------------------------------------------------MTSP
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ---------------------------------------------------MKMIPSSEQ
A0A1Q7N5R7      --------------------------------------------------------MPDH
A0A2V9QB26      --------------------------------------------------------MTEP
A0A2V9VYY4      --------------------------------------------------MALQPTRNNS
A0A3E0PHB0      --------------------------------------------------------MESN
A0A3M1SIV3      --------------------------------------------------------MEKD
A0A3M2D491      ------------------------------------------------------MNKERD
A0A353C9L6      ------------IDGLKYGRFGVIRSKNRENTADIWYKTRLRKFCRVGDVQGQESSMEQD
A0A2V8RQV0      --------------------------------------------------------MEQE
A0A2V8SJH5      --------------------------------------------------------MEQD
A0A357F267      --------------------------------------------------------MEQD
A0A7C5ZUA8      --------------------------------------------------------MEQE
A0A136JPP4      --------------------------------------------------------MDQD
A0A399WUJ8      --------------------------------------------------------MDQD
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ----------------------------------------------------MKEPSDLS
A0A3B9MLP9      ----------------------------------------------------MKEPSDLA
A0A3D5SQ87      ----------------------------------------------------MKEPSDLA
A0A2V8NW86      ----------------------------------------------------MDKHELPP
A0A7C2GJ20      ------------------------------------------------------MSDSTE
A0A7C4BTL5      --------------------------------------------------------MAPE
A0A2V8ZHL8      ----------------------------------------------------------MP
A0A2V9B240      ----------------------------------------------------------MP
A0A2V9CBM2      --------------------------------------------------------MGEQ
A0A2V8XN17      --------------------------------------------------------MDDQ
A0A2V8WX45      --------------------------------------------------------MEDQ
A0A1Q6YR79      --------------------------------------------------------MDDQ
A0A1Q7VA32      --------------------------------------------------------MDDQ
A0A2V9EY85      --------------------------------------------------------MDDQ
A0A2V9H8K0      --------------------------------------------------------MDDK
A0A2V9FFE5      --------------------------------------------------------MDDR
A0A2V9GM43      --------------------------------------------------------MDDR
A0A2V9CYQ5      --------------------------------------------------------MGEQ
A0A2V9BWU8      --------------------------------------------------------MSEP
A0A2V8ZG48      --------------------------------------------------------MSEQ
A0A2V8Y334      --------------------------------------------------------MGEQ
A0A2V9AY68      --------------------------------------------------------MSEQ
A0A1F2RFI7      --------------------------------------------------------MSEE
A0A1F2RZS3      --------------------------------------------------------MEEN
A0A1F2USE2      ----------------------------------------------MGEEIPDSKREVPD
A0A7C2VB08      --------------------------------------------------------MSEA
A0A2V9C238      --------------------------------------------------------MDPE
A0A1F2Q9F5      --------------------------------------------------------MSDE
A0A1F2QQH9      --------------------------------------------------------MSDE
A0A1F2QXK7      --------------------------------------------------------MSDE
A0A2V9DEM9      --------------------------------------------------------MDPE
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      --------------------------------------------------MSDT------
A0A2V8HDM7      --------------------------------------------------MSDT------
A0A2V8DRT9      --------------------------------------------------MADQFQLDPG
A0A2V7VYF3      --------------------------------------------------MSKR------
A0A1F2SVH2      --------------------------------------------------MSEE------
A0A2V8AJG9      --------------------------------------------------MSEQFSSNPG
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      -----------------------------------------------------------M
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      -------------------------------------------MTNPLMKSDPATRRELV
A0A2W0BVQ9      -------------------------------------------MTNPLMKSDPATRRELV
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------MAYSFGYRLRSSSRCPAP
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------MTRYFELTGEPAPDSAA-
A0A1Q7RBU1      ------------------------------------------MSKYFELMNQLGRDSAAV
A0A2V9JPV9      ---------------------------------MSRYFNKDEERRYFELMNQHPRNSLAV
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      -------------------------------------------------------MNTSL
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      --------------------------------------------------------MRHR
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          --------------------------------------------------------MNDH
A0A2V8ERZ5      --------------------------------------------------MLPSSPPDAP
A0A2V8GTX0      --------------------------------------------------MFTPGGLSTT
A0A2V8J0X9      --------------------------------------------------MFDTQEVRAQ
A0A523DUV7      ----------------------------------------------MDPQDSHHQEH---
A0A372IRG7      ----------------------------------------------MQGSAIAPQGQQEL
A0A1F2U158      ----------------------------------------------MSESSPAHPTPASA
A0A2V8F6S9      ----------------------------------------------MADSTPSGSRPASS
A0A7D8BEX2      ----------------------------------------------MPQSATNNTSPQGL
A0A4Q1SCH5      ----------------------------------------------MNQPAAASPLQAQP
A0A2V8K4L4      ----------------------------------------------------MRNHDDSS
A0A2V8NCZ3      ----------------------------------------------------MKDQDDSS
A0A4Q7YNP3      ---------------------------------------------------MGNTFNTNG
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      --------------------------------------MVGDKEMVENNLTPALPAPLEA
A0A2V8TTB0      ------------------------------------------MKKFENNL-PAVP-----
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ----------------------------------------------MNLRQRTVAPRESD
A0A2V8EXP2      ---------------------------------MSTQFRDSTDSLQHRLTMASADAENAG
A0A2W4RYA1      ---------------------------------------------MPDINLDDLDDASRR
G8P0Y7          --------------------------------------------MSTGRMRGEFAEPVRH
A0A5M8T4U7      --------------------------------------------MAIEPQSEHQLDRVMI
A0A7D0PPG7      --------------------------------------------MESRPSFANNALTPSQ
A0A7D8BF18      --------------------------------------------MESHGL----------
A0A1E3Y9R6      ----------------------------------------------MAHLPNA-G-----
A0A2W4TLP2      ----------------------------------------------MAHLPPAHG-----
A0A7C4BZ42      ----------------------------------------------MNRFPGNNPKHLPG
A0A3R9WF43      ----------------------------------------------MDRSPPKVSITKKE
A0A317HKM4      --------------------------------------------MSLDSHRPARSDPDSD
A0A2V9CG11      ----------------------------------------------MESPP---------
A0A523E0N1      --------------------------------------------MSTERLPPDY------
A0A523ECP2      --------------------------------------------MELKKSEQGSNANWAP
A0A2W0C122      --------------------------------------------MDARELIKSNPAELSA
A0A2W0AUU7      --------------------------------------------MDARGLMKWNSTDIST
A0A2W0BQL1      --------------------------------------------MDARGLMKWNSTDIST
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ----------------------------------------------MEGPAVQPERQVAA
A0A4R1LAZ7      ----------------------------------------------MEGPRTTTRVSPAG
A0A3M1WQW8      ----------------------------------------------MSERDERTHLPAPA
A0A3N1JHC1      ----------------------------------------------MRTPAGKLRAIAPA
C1F294          ----------------------------------------------MDTLDPQRQSGSAI
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      --------------------------------------------MNFNITERSDAVLRSA
G8P085          ----------------------------------------------MRVQTTQPDTEGKL
A0A7C6A629      ----------------------------------------------MSDPSHMLPPGSGG
A0A4Q1SGQ1      --------------------------------------------MNEKALLAGRPLEW--
Q1ILD9          --------------------------------------------MSATNLATRKDLLPQN
A0A7C5SHM3      ----------------------------------------------MQDRPSEMSPEQSA
Q1IJZ6          ----------------------------------------------MDSLFRKSELPPLG
A0A2V8TCE6      ----------------------------------------------MTSPREAE------
A0A522TBE8      ----------------------------------------------MPKAVQQPSPIPPP
Q1ITG0          ----------------------------------------------MEKFSQIENVQGAS
A0A7C2ML20      ----------------------------------------------MSGLIGGADQQPGL
A0A7C5AXS9      ----------------------------------------------MKQLPEPGKPEEAR
A0A7C2RGE3      ----------------------------------------------MAESGERPFLPPTP
A0A3N5PCI5      ----------------------------------------------MSDTQQPPSEHDAV
A0A3M1Q0S9      ----------------------------------------------MTESSEQRE-----
A0A2Z5G448      ----------------------------------------------MQGPDPASERQQGT
A0A3M1VZ38      ----------------------------------------------MIQQDPQN-QE---
A0A4Q1SD29      ----------------------------------------------MQGWSAPP-QEPQK
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ----------------------------------------------MAASEPYR-REPPT
A0A3M1VMP2      ----------------------------------------------MPAMTVPG-VGP--
                                                                            

A0A2V7VMF7      PETGKTEILEADLKAIRNGKETDLLLXXXEDGDAPMSTAPPVFDPPSERELDLRYYAGLV
A0A2V7YYV7      --------------------------------------------------MELGRYLRVA
A0A2V7Z0J5      --------------------------------------------------MELNRYLRVV
A0A2V7Z3M4      --------------------------------------------------MELNRYLRVV
A0A399Y5V2      ------------------------------------------MTESHATTLELRDYLGIL
Q01X01          -----------------------------------------------------MECARTL
A0A3M2D9H8      --------------------------------------------------MLPRDYLFLA
A0A2V8JK38      PSGSTVSGTDKAKTPGRRAGKDKLVRINHRKYPEIVENLPRNLATQEEDETHLLAYWRVI
A0A2V9IXG5      --------------------------------------MQDLNVSESLPQLDIRYILHVL
A0A2V9J2P4      --------------------------------------MQDLNVSESLPQLDIRYILHVL
A0A1Q7RLS4      --------------------------------------------MEEKREIHLLDYWRTI
A0A2V2R525      ------------MKEDQITKHSSIHDLDSPYNVFPFPPVIQTGERQDQSQASLAFYVQII
A0A321LPW6      RVELERVSTA----RVALDAAPPPR---YPALAGAAGTEYGLGYPEEYGRIHLLEVWRTI
A0A2V9R9V4      KRYPDNLPPEVTFRQLPARQAHDSGAVIYPEIDLP---RYG----EAED-FHLRMLWRIV
A0A321LE75      RTDIERIKPE----EMAFGRPGYPRAVGYPEAYATGSYGYG----EADDRINIRAIWRTV
A0A2V8R8U7      IQDERL--V---------P-AGRGLDNSLADLTQAKPFGRYDRYNSAPAETNVREYLYVI
A0A2V8QMP4      MQDNRL--L---------PLTPETLDRPLRDLAQPSP--VAV---SSNEPVNLRDYLAVV
A0A2V8R4S3      MQDNRL--L---------PLTPETLDRPLRDLAQPSP--VAV---SSNEPVNLRDYLAVV
A0A2V8NJ55      SQDNRL--L---------PLTSTSLDRPLSDLAQ-SK--KYYGV-SATSETHLRDYLAII
A0A2V8Q7I0      --------M---------PAVDRGLEKPQTD----QI--RSYGP-AANEPTQLRDYLFVV
A0A2V8S6K4      SQDNRLLPL---------PTPAGNIDRPLRDLTQPAV--QVTGSYSLPEPTHLRDYLNIV
A0A317I2L9      SQDNRLMPM---------PAVERSLDKPLTDLN--AA--RSYGP-AANEPTQLRDYLFVI
A0A2V8LLF9      THDEHLVPA---------RT-GRDFDSTLADLTQSKPYGKYARYGTTQSETNVKEYFFII
A0A352FRF4      TQDERLVPA---------RP-ARDLDRTLAELTQSKGYGGRYG-GGSPAEVNLKEYLFVV
A0A2V8MKV0      TQDERLIPA---------RA-GRELDRSLADFATAKPYERY---GAAGVETSLRDYLFVI
A0A2V8PYY8      TQDERLIPA---------RA-GRELDRSLADFATAKPYDRY---GATAVETSLRDYLFVI
A0A1Q7YKQ8      SQDNRLLPL---------PQ-ERGLDRPLSSLPHSKSYG-Y---GAAAESTHLRDYLNVV
A0A352F3R7      AQDNRLLPV---------SALDRSIDRPLADLVPAKPYG-----TSGSEPTTLRDYLFVV
A0A0B6WXT1      MQDNRLLPL---------SQTEQQLDRPLHDLTLGQP-------ATFIEQAHLREYWAIV
A0A3B9MEU8      SQDNRLLPV---------SALDRSIDRPLADIAQAKPYG-----VSGADTTTFRDYLSVV
A0A2V8MHG6      KEPTELIEK-----SNGSRDVGGVLERSLTPYTRYDSYEDES-----NGYSRLRDYWRSV
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      KEPAELIEK-----SNGSRDVGGVMERSLAPYTRYDSYADES-----NGYHRLRDYWRSV
A0A1Q7NJH5      KEPTELIEK-----SNGSRDVGGPWDRSLAPYTRYDSYADDS-----NGYSRLRDYWRSI
A0A2V8PJY0      KEPTELIEK-----SNGSRDVGGPWDRSLAPYTRYDSYADDS-----NGYSRLRDYWRSI
A0A1Q7Y6W9      RELITRVKE-----ANELEVAGETFSPSPSAYKGYDSAAEDE--------VHLLDYWRSI
A0A2V8NC68      SRPTETTAL-----VHGNGNSGEPLM-QPSFRQDYRYMGEDSFQTSGGGYARLREYWCSI
A0A399WK13      KETRNIITT---TSPEP-VELQRPPDP-AIPTTGRYPGYSATPQGEGFQ---LIDYWRAV
A0A352FLX4      NQSTNLSRTNTVPIGDEHIGLERTNGG-HVLPGVMQGAYSYEREERGSR---LLDYWRIV
A0A2V8RTL7      KEIRELVPT---KPNDTVVELERPFETHVIPGTGRYPAYRDVYGPEGFQ---IVDYWRAI
A0A3E0PCJ6      RESRDIVRN---PRTES-AEVERPFEAVAPITNYGYARYRNEDLREHSP---LFEYWRII
A0A3M1S4R8      RESRELIST---RSAGR-EELEPRWQ--SPSYYPSYKSFSEGSAK-------IFEYWNAI
A0A7C2G442      RESRELIST---RSAGR-EELEPKWQ--SPSYYPSYKSFSEGSAK-------IFEYWNVV
A0A1Q7YFI6      EKETQLVKA---SVEPR-VVELQANGN-GAGLPYGSYAYGSSEPQEESGFSRLQAYWQSV
A0A136KC10      ------------------MEMERPADP-TIAATGRYPGYPQTGQAEGFQ---LIDYWRAI
A0A3M2D6Y5      RKTNELIVR---EAQEN-TEVEFRSQP-FV-SSGNYYSAATRDSAGSLK---LREYWNAI
A0A2V8SEX6      KETREIIQK---PLNEP-VELERHFEP-QIVPAGRYPSYRE-NVAEGFQ---LLDYWKAI
A0A7C5ZUU4      KESREILKK---PVSEP-VDLEKVLET-PL-PIGRYPAYREFYEPDGFQ---FLEYWRAI
A0A0B6WWQ6      ----MMKGD---P-EKE-PQSLIRLDA-SAPYPKLYADYDHRWEREERTQQIVAGYWRAV
A0A3B9MK99      ---------------------------------------------------------MCI
A0A352EX26      NPSNELIRK---E-PAD-TAIGRPADS-NGIPHSYNYGVDPNA-ESEVH---LLDYWRAV
A0A2V8MM59      NEGTKLARV---E-TEP-QDLDRRLDD-HGP-RPYAYGYGTNGFDGEVN---LLDYWRAV
A0A2V8PFE8      NQATKLVKR---E-DEP-GEIDRRFDG-SANYRGPVYGYGPESSEGEVH---LLDYWRAI
A0A2V8PWS6      NQGTKLVKR---E-DEP-GEMDRRFDD-AANYRGGVYGYGPEGSEGEVH---LLDYWRAI
A0A2V8LCT5      NEATKLVRR---D-DQP-REIDRRTGD-TTSYRTA-YGYNMDAGENEVH---LLDYWRAI
A0A352FTJ9      NEATKLVKQ---D-E-S-RPVERRSDE-SQPYR-G-YGYGADAGDGEVH---LLDYWRAI
A0A257VBK0      --------------------------------MADSDPPQVQAEFSAAQDVDLLHWVQIL
A0A2G6PYV5      --------------------------------------MQDNQPFDQQADFNIFHYIGLL
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      FERKSPESSVLGLDAAPDAGLAPQPSAATGGSGYGYGYGYSGSMPSGDSELSFIHYLQVL
A0A1F2T595      KAPASQGSGSESPVFNAVPSNGSGGSGYGSGSYGGYSGYGYGTSVTSDSELTLVHYLQIL
A0A2V8JQV5      HDLTNKGNGEP------------SQDPVRKVSKSGKPQQSPAYSGPMTSPAGVFDYWRVF
A0A2V9AC41      NQPSPYFIKRT-------------------ARVEQGTIDLNEFAVVDDQVHPLREYWLTI
A0A2V9MAM9      SKLSKAPQRPS--------HSLSRAEFQRLARPSPEALAAGTSAEIETGSLSIIEYLRVL
A0A348V070      TPTTPTTGARQ---------------------------------TQQNLLEQILYYWHAV
A0A2V9M454      MNGDELVPLNS---------GPVTPPPNRNGSGP----HSYIDLEQVDAFGQLRATWDIL
A0A2V9IVR7      MENDPIESREL---------APVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRML
A0A2V9ILE2      MENDPIESREL---------APVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRML
A0A2V9LGY4      MENDPIESREL---------APVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRML
A0A2V9J4D6      THRSRFTPSSA---------SLRPGSSNAPPSFA--PLPSCASAGG------------KS
A0A2V9L9C5      -MREEFGKSGT---------LVGRAINDSPEPIH--PIISITSAGEFE--RPSVLRAIAV
A0A2N9M9N1      ----MAENDKL---------IPVSAVSSDRLGYSGYPVTDLDPAGSEA--YSFQSYWEIL
A0A2V9JEC4      PRNTDHEQTAS---------ARSETALSERPAIGEYVVPQLEDAEGGA--SAFRVYWHVL
A0A2V9LPQ3      QKLTTTEPAPL---------ARRRAASSESIGFG--LLPT--DFDGFS--SVLRVYWEIV
A0A2Z5G3A3      --------------------------------MKTLPSPQSIYTPIPETPLTISDMGALV
A0A2V7UGP8      ------------------------------------------MDVLSQKEINLVDYWNVL
A0A239MKT6      NNDASIASDLN-------------------------------DAEQGSSDLTLESVWEFL
A0A3E0PCN7      KQLALRPKEEG-----------QETIVYGDYEGDYFDSSYYGGAPAPSERQQLMAAIGVL
A0A2V8IYW3      --------------------------------------------MIPGHKYTPQDVLDAV
G2LEI9          NNVMLAPTAAE-----------LDLATPTVQDRMRRRGSYQYTLPQEDAGQPIRQAFLTI
A0A317J121      NHDQPEPGNNR-----------------LPALPNSYFVQPGELTIEPASSSPGIDYWHLL
A0A2V7YW66      SPVPFEEEPEG--------------------------------AAEPASELNFGEYLGIA
A0A2V7Z0V0      TPVPLDDEPEV--------------------------------APEPESELNLTEYLGML
A0A2V8GFD4      EQHQHHEIRID------MPADSAFASARDAVEKDGVERLPPGSGEMVDGTLSGFDYLRIL
A0A2V8HSS5      EQHQHHEIRID------MPADSAFASARDAVEKDGVERLPPGSGEVVDGTLSGFDYLRIL
A0A2V8KP55      ----------------------------------------------EEDETHLLAYWRVI
A0A399WNU1      FQVVKRNSRQD-----------PESLDFYDQDDLYPESYYGDSIQEPTEKQQLFNLLSIL
A0A2V9JSI3      NALAPIEHVPF------------------ERVGYRKPSVVTVEAEEFDSPLDLRHYWNNL
A0A2V9WI32      ------MGESLMDSGIVRRRSDTSTLEQLPTEIQFPADPARSYAPLPEEGFLLREYGRIL
A0A2V8IVN9      VKLRFEEAANP--------EDAVLRAPGEAAGGGYASYPDIVGGSGEGGEPHLLDYVRVL
A0A7C5Z4J3      ASETVLPERAE----------------------MYHRTVLDLQRDWTDSFVYLRSYCKIL
A0A1F2TPT3      PRSNPPAEATP-------PDDIRLSMEGTAEPALRRYENDALWQGLEGEDRHFQYYLAVL
A0A2V8JTQ2      VQLPRVALSSG--------------------PNPANHYLPRVG---APDEVFAAGMWRII
A0A2V8UZY0      LAVSACDIGPEEPENLEVHGTRAAPRFVRSLPNHPPHPVARASDERASDEMFAAGLWRII
A0A350UEK1      PPP---GDARDHDSRLPARFEIVEAGVPHRLEGPQVNYYGSPAPEEDPDSGGLLDYWRIL
A0A350UIQ4      PPSNPQGDSASANSRLPVKFEIVDA--PPANSDP---YYGGPQFDSDEEEGGLLEYWRIL
A0A1H5Z7N3      RAQTSQASESE-----------------------VVMPQAMQDRAS--GDTTLSDAWLTI
A0A1G7JVV8      TNQ---PSDRV-----------------------VPETNAGFSAIT--AESALSEALNVL
A0A1H4T6W9      MNQ---PVTH------------------------DPANPAGFTSTA--ADSALSEALAVI
I3ZEU5          TNQ---PVPT------------------------DPASPTGFTTTS--ADSALSEALAVI
A0A1I6MH75      TTE-TTSPTGV-----------------------PHTPGGGFAAATAATETTLSDALMTL
E8WVF6          NPY-SNPGPGM-----------------------SQAQQPTFVAPS--NDTTLSEALITL
A0A7D0PQC3      ASQ-DATAVGA-----------------------PRPTFSFSAPES--TDTTLSEALVVL
A0A428MDU2      NPQQPGP--GA-----------------------PETNPTGFSTTV--TDTTLSEALITL
A0A5B9EBI2      NPQ-QPL---P-----------------------PTTDYRAAASAP--TDASLSEAILVL
A0A239HDF6      --------------------------------------MPGSIPQA--ADASLADALLTL
A0A4Q0T270      DDG-PGT--GT-----------------------PHAPLGGLSTSG--SETTLAEALTTL
A0A1Q3QQB6      NTQ-PSADGDT-----------------------SELNSPRFGSAV--TDTALSDAILTL
A0A3N1K1G7      ETP-PVA--GA-----------------------PDLSPSAFSSTA--TDTTLSEAIITL
A0A4V2G466      SAQTPSHTGGA-----------------------SETTPPAFSTAT--TDTTLSETLITL
A0A6B9YNQ8      SAQTPPQAGGA-----------------------SDTSPLAFGTAA--TDTTLSETLVTL
A0A3N5YNR8      -----------------MGDLIRREYSSIPDPSIRIQRNTEYQWASDDDSLDIRRYFQVL
A0A3N6A5T6      -------------MADLMIPGTEGLPTQIRPSPSPNWAHQKPKAPSKVEVPHLRDYWNVV
A0A1F2Q9L4      -MVARRPAAPD----------------------------KIGFEVEPESEFHISQWLGVV
A0A2U3KC61      DALEALEPIDP----------------LPVKGPQSVYPHFAQPQNS------ILHYWQIL
A0A2V9Y2R7      DNLPGQRSLEI----------------LDQTPPSCQIPYSYNSYSASGHAINLLHYWHVL
A0A2V9NGH6      RVLRELPSAHP----------------VEFRRQFGFGIYNPATFQDSV----VHEYLRVL
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      NQVREM-GPAS----------------MQIGRNI-AAIHPAMAAQDSI----LREYLRVL
A0A2V9QD92      NQVREM-GPAS----------------MQIGRNI-AAIHPAMAAQDSI----LREYLRVL
A0A2V9WPZ6      QMIREVQAPYP----------------VEFSRQLLTGIYPNAPAQDSV----LREYLRVL
A0A2V9ZLH4      QPVRELQAIAP----------------VEFSQQVGPGVYPPLPTNDSV----LREYLRIL
A0A2V9RQF1      QGLRESPDPLP----------------VEVNRTTQHYAYPVLPSQDSV----LREYLRVL
A0A2V9YDK8      QTIREVQPVYP----------------VEFGRQMLTGIYPTLHPQDSA----LREYLRVL
A0A2V9V8F7      HMIREVQAPYP----------------VEFSRQLLTGIYPNAPAQDSV----LREYLRVL
A0A2V9XGR9      QMIREVQAPYP----------------VEFSRQLLTGIYPNAPAQDSV----LREYLRVL
A0A2V9V3Q5      G-FREIQPAEP----------------TELIKPIGPGLYTVLPSQESA----LREYLRVL
A0A2V9NWS3      QMLREISSLSS----------------FDLNR-QLAAYYPNAPIQDSV----VREYMRVL
A0A2V9USA9      GVVREI-PLTS----------------PEFGRAAVPQVYPVLPSQESA----AGEYIRVL
A0A2V9XW18      PTIREIQPSQN----------------VDLVRPQDPRFYPPLASHESG----AREYLRTL
A0A1H5SQF5      QDVTSRSASTH-------------------------------RRSAFRREMHLSDALVIL
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      -----MKPSEFPLDKTDRRRNELSRGAEQRPTVYKYVESPSTEVGASPGYDSLLDYWHIL
A0A2V8XIF4      -----MQASQFSIEKSKRRPNGLSANGKQRPVLYAYLDSPAAEGAATPGYDNLLEYWHLL
A0A2V2R0I6      HKLVRRESGSN------------VPVEIVP----PANRLPA--WELSPREPHLYDYLLVL
A0A2V8XAR9      NKLVPRENGSN------------GPVELVP----LPARLPS--WELSPREPHLYDYLLVL
A0A2V8VZA0      NKLVPRENGSS------------GAVEVVS----LSNRVPS--FELSPREPHLYDYLLIL
A0A1Q7CB82      NKLVPRENGSS------------GAVEVVS----LSSRVPS--FELSPREPHLYDYLLIL
A0A2V8WIU1      NKLVPRENGSS------------GAVEVVS----LSSRVPS--FELSPREPHLYDYLLIL
A0A1Q6Y9F5      NKLVPRENGSN------------GAVELVS----LQSRVPS--FELSPREPHLYDYLLIL
A0A2V9EVV8      NKLVPRENGSN------------GAVELVS----LQSRVPS--FELSPREPHLYDYLLIL
A0A2V8YF91      NKLVSRGNGSN------------GAIELAP----VTPRFVS--FDLSPREPHLYDYLLIL
A0A2V8XZK2      NKLVPRENGSN------------GAVELVP----NTPRFAS--FELSPREPHLYDYLLIL
A0A2V8ZTX6      ------------------------HVELAP----LPNRFAS--FDLSPREPHLYDYLLIL
A0A2V9BT79      NKLVPHENGSN------------GNVELVP----IPGRFAS--FDLSPREPHLYDYLLIL
A0A2V9YHT3      KLIRAEDAGNG------------KSSLDF-----PPPLLPAGYFPATLPQPALLDYWHIL
A0A7C2XNI7      KLVPREPLERA------------GTLAPAETTGGTPFVHPG--WDAERRQIHLLDYLVIL
A0A1Q8B793      SKLAAHDNGAN------------GAVEIIQ----APLRMPV--FDLSPHEPHLYDYLLIL
A0A2V9BCA0      SKLAAHDNGAN------------GAVEIIQ----APLRMPV--FDLSPHEPHLYDYLLIL
A0A2V9BWU9      TALMQRDRRAG------------SSFEVIT----AHPQFSS--WETPPREPHLLDYWRIL
A0A2V9DKX2      TALIQRDRRAG------------SSFEVIT----AHPQLSS--WETPPREPHLLDYWRIL
A0A7C2YQY3      NALERRASPVT-----------------LLAEPFSWRSVPAGSFDPVSTGLPLREYLRIL
A0A3E0NV31      -----------------MDRESYFNEDLRRHGGGGVGPGARRGDNDPSEGIKVRQLIESI
A0A3N5M5V0      -----------------MGDLIRREPSSFADPTIRMQRTGNYQWGPDEDSLDVRRYFQIL
A0A3N5XQP8      QGMQERGGGPR----------------------------LFEPSPSSRDRSTVRFYWEAI
A0A2Z5G7H4      ---------------------------------------MGPRADVRERPITLGDLRHIF
A0A2V9L5B5      DQDSSGESQHA------IEPAFSRSLQESEV-----------LDVSPEEVPHLLDYWQVV
A0A2V9LK56      IQNSNGFQGAS------LAPRTTA-LPDSRV-----------LDIGPEKVPSLFDYWQII
A0A2V9L7I0      SENLQRDPVRA------LARTATQPLEKPEI-----------LDVSPEEVPDLIDYWQLI
A0A522PPT0      NEITPINQTGN------VERLNGHYLREEDV-----------LDVLPEESPRLLDYWHVM
A0A7C5V1G5      HGITPVNQTRS------VERLDGSYLHEEKI-----------LDVSPEEAPRLLDYWNII
A0A2V9KCS3      ALMDQIVHLPKGPQRELIRRTNGGVPASGSLPYGDSPVDQ--EYGADAVSGGLLYYWHMI
A0A372IT17      THI--------------LER----------------------DAMAVYDEWTVADLLSIL
A0A4R1LC91      ---MKALTGSQ----------------------------ANFAQNSLDGELTIKGLWALL
A0A3M2BZG9      PLPRPAVRDDF------LAYDAAPATATPVPPMPG-----------DAGELDVAKYLGAL
A0A1Q7N5R7      TSLRRTPPPP-------LTAADLSRAGTAVEKFSP----------NGDEGPDWHRYLTVV
A0A2V9QB26      MDKHALPPASH---DLVLRKSEGSPGHGEAGSYLY-------GHRDELEPGGFVEDWRIL
A0A2V9VYY4      DDFEALAPIDP------LPVNGHQPLHTYFGEPHN----------------ALLHYWHVL
A0A3E0PHB0      DRLLQIPEIQERRSKKSLQTAPQDYPPAYSPF---------YDDEALGDSRSIREYFNIV
A0A3M1SIV3      ERLLPLPKELE------ANKNAITYQEEGPRYFAS----YAYGDDILEKKFNPRDYLLVI
A0A3M2D491      ERLLPLPKEIQ------EYELTSRYYPSYGG-----------STELVEQRFDPREYLIII
A0A353C9L6      QRLTPLPKSAD------LRANASEYGSSYSSF---------YDEEVIEGKRTVQQYFRIV
A0A2V8RQV0      QRLTTLPHLGE------LRHSKHEYAGSYSGA---------YSDEVIEGRRTVQQYFNIV
A0A2V8SJH5      QRLTPLPKSLD------LRASKTEYPATYAGF---------YDDEVSEGRRSIQQYFNVV
A0A357F267      QRLTHLPKAVD------LRANGGDYGSGYSSF---------YDEEIADGRRSLQQYFNIV
A0A7C5ZUA8      QRLTPISKTAE------SPLAPAGYASAYPAF---------YDEEAGESKVSIRQYVNII
A0A136JPP4      QRLTPLPKGLE------LNQPAGDLTTSYAAY---------YDHESQSGKRTLRQYVRVV
A0A399WUJ8      QRLTPLPRGLD------LNQPHGELPAAYTAY---------YDHESQSGQRTLRQYVRVI
A0A2V9KIE8      MGKSEILPGDR------LNRIAPVSMEQVRGQ-------EF-LEVGHEEAPHLMDYWHLI
A0A352F549      KALEIILKNSA------LEQSNGSSHNGHGNPPIV----AYGEEASPEGEMHLRDYWKTI
A0A3B9MLP9      KALDIILKNSS------LEPTNGSLRNGYATPPIV----AYGEEASPEGEMHLRDYWQTI
A0A3D5SQ87      KALDIILKNSS------LEPTNGSLRNGYATPPIV----AYGEEASPEGEMHLRDYWQTI
A0A2V8NW86      TSHELVPRKST------EAYPGHGEAGSYLHGRRD-----------EFEHGGFVEDWRIL
A0A7C2GJ20      KPSLPATPPER------SSLQAPGAMSGHVMKFYP--ASAF-REESGERDVHLLDYWRVI
A0A7C4BTL5      ESKDLTLRPAP------IEAPAPSVSQTRVYEQDG--------FEEGDERGGVLEYWRMV
A0A2V8ZHL8      PGVKDMPDNEA------LSLRGAKLPVLESPQSPAFPVLGI-DVQDFESFSYLQAYWNIV
A0A2V9B240      HKVKDMPDNQA------LSLRGPRLPVPESPHLPAFPVLGT-DVQEFESFSYLQTYWNII
A0A2V9CBM2      NQSEPYSHAHR------LARK-RGSLEASVVELAD----SY-EIIGPEEGIDLRACGHIV
A0A2V8XN17      NQVELYGRGHR------LDRRGPGAPDSRVIELPD----SY-EILESGEALDLRSYGRIL
A0A2V8WX45      KQVELYGRGHR------LDRRGPGALDGRVVELPD----SY-EILESDEGLDLRAYGRIL
A0A1Q6YR79      NQVELYSRGHR------LDRRGPGALDGRVLELPD----SY-EILEPGEALDLRSYGRIL
A0A1Q7VA32      NQVELYSRGHR------LDRRGPGALDGRVLELPD----SY-EILEPGEALDLRSYGRIL
A0A2V9EY85      NQVELYGRSHR------LDRRGPGALDSRIIELPD----SY-EILEPGEALDLRSYGRIL
A0A2V9H8K0      NQVELYGRDQR------LERRGPDALNTRVIEMPD----SY-EILESAEALDLRSYGRIL
A0A2V9FFE5      DQVELYGRRHQ------LERRGPDALNTRIVELPD----SY-EILESGEALDLRSYGRIL
A0A2V9GM43      DQVELYGRRHQ------LERRGPDALNTRIVELPD----SY-EILESGEALDLRSYGRIL
A0A2V9CYQ5      NQSEPYRHAHR------LVRRTGNGLEASVVELAD----SY-EILGPEEGIDLRACGHII
A0A2V9BWU8      NKLEPFAQGPR------SGHGGLRFMDNRVVDLSD----SY-EIIEAEEPVDLRAYGRIL
A0A2V8ZG48      NKVELYARDAR------FERARLGFLDHRIVDLSD----SY-EILEPDEPLDLRAYGRIL
A0A2V8Y334      QNVELYSRGPR------FERGGRAFLDHRVLDLSD----AY-EIVEPEEPLDFRAYARIL
A0A2V9AY68      NKVELYARRPR------FERGGSVLLDNRVLDLSD----SY-EILEPDEPLDLRAYGRIL
A0A1F2RFI7      MSLEKIPPLKG------E-------VPATTTVAAY----TI-SQEEEAATPSFLDYWRVL
A0A1F2RZS3      NSLERVSRGQI------D-------APASVPVSSY----PV-EVLEEQDSFPLLEYWRVL
A0A1F2USE2      GRIERYEPSPP------M-------LARPEPPVPV----AY-ETVETEEAPDLLAYWRVV
A0A7C2VB08      HPLVPHRPPGP------I-------VP--GPLPAP----RA-TDSQRETPVDLLAYWRVL
A0A2V9C238      NKIKLYEPAVR------K-------WERLRPTPAV----RA-EPLEMKESADLLAYWRVL
A0A1F2Q9F5      KSVERYEPAAR------T-------LERRRPGVPA----PL-QTLEMEPAADLLSYWRIL
A0A1F2QQH9      KSVERYEPAAR------T-------LERRRPGVPA----PL-QTLEMEPAADLLSYWRIL
A0A1F2QXK7      KSVERYEPAAR------A-------LERRRPGVPA----PL-QTLEMEPAADLLSYWRIL
A0A2V9DEM9      NKIKLYEPAVR------K-------WERLRPTAAV----RA-EPVEMKESADLLAYWRVL
A0A7C5TWV7      ------------MKQAAPMGPAGPPAGWGMPPAQWPMQEGPWFEEETEREFSLVEYTDLL
A0A2V7XDY0      ----------------MPSPVPAPA------------------GGSSESPIDFRYYGNLL
A0A2V8G155      --------------------KEGLRMMGAPAPG----DYALNDAALPPASPHVVNSLMVV
A0A2V8HDM7      --------------------KEGLRVVGAPAPG----DYALNDAALPPASPHVVNSLMVV
A0A2V8DRT9      DLDNQKKNLAP---------RPRRAVRAASGKP--------AAAEHALEEVHLSDYVKIM
A0A2V7VYF3      ----------IGHDETAEDTRPQAESYWNDDRD---------ADNAAPEEAHLLEHLRVL
A0A1F2SVH2      --------------------SPRIAMAGEDARAQTSPVYGYGSNVLGDTEVHLLDYVKVL
A0A2V8AJG9      PAAAGRLEMAPGLDSIDAGAAPPISAAAPNGRG---PAYGYGSNVIGDGEVHLLDYVKVL
A0A2N9LQU7      ------MQNIPEQQLARVTARGRISGPVPLP------------PALRNPDVSLGEIWLKI
A0A2P6WFK7      RPAACQESHMPEIEQDSLATMRESGLKRFGN------------DSVTERELSVTEISRTI
A0A2V8U914      --------------------------------------------------------MRVL
A0A2V7W309      ------------------------------------------MDLNTQQEVHLSQYWNVI
A0A2W0BGU4      DYEIAPHPTPEPITIAPRYYPDPNA------------------SPEAGSLALYWN---IL
A0A2W0BVQ9      DYEIAPHATPEPITISPRYYPAPNS------------------GPEAGSLALYWN---IL
A0A2V9MN96      -------------------------------------------PYRIGGQHPLLSYWRIL
A0A2V7V2Z1      TWPPGPSRSERRRGSPAVSPSASSG------------------YEGEPQEAHLWEYIYVI
A0A2V7X2F7      --------------MASPSQPPPSE------------------PAG---EDHLWDYLAVV
A0A2V7V2I1      -----------------MSTTAPAG------------------QAGVPEETHLWEYLHVV
A0A2V7U3M2      -----------MEGTSPVTPTPPTS------------------SESEAQETHLWEYIYIV
A0A2V7UHT0      ---MWPRRTVLSKELSSVTPIPPAG------------------SEGEPQEAHLWEYIYVV
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      MDLSRPEPRLPP-KVPSPRVQRVVG------------------APDEALASTLWR---II
A0A2W0AJ66      QTLVQTPPNLKP-GLPNRYTQKVVE------------------ALEETFLGNLWR---VV
A0A1Q7RBU1      Q-----LTRAAP-NLPNRYPQRLID------------------APEQMSTAGLWR---II
A0A2V9JPV9      QPPSRGVPRSTP-NLSNRYPQRVID------------------APEQVSAAGLWR---II
A0A3P0X3W6      --MSSVYNNKPR-ILPASAPPSQIA-------HYTGPQAAAEPDELLPMQHYMW----LL
A0A2N9MK30      QELTIVEERGPR-SLPVAAGFGPAQ-----PASW---DLEPE-EQTLPLSHYLW----VL
A0A3D1ASD2      ----MSEMRLDRSNLPALPSTYSVS--------HITAEPEAR-ETTVPLTHYVW----VL
A0A7C5AXI3      ----MAEQKLDR-NLPAVSETYSVS--IPQPVVF--PEPVQE-EPALPLSHYLW----IL
A0A7C6E4H7      ------MSDPSR-LLPSGSGPVAAPGYPPAPVGWYGPEMEFE-EPGTPLSHYLW----IL
A0A1F2TCR2      MFDTHDLQQAPAIAIEAPPQLPMPP------------------VAQSQQPLHVLDRLSAV
A0A350UQT3      --------------------------------------------------------VSRI
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      -----------------------MP------------------SDGTGKEISVLALLDIV
A0A662EE63      DIDMDRWMPADQGAMPPGGPAMGGW------------------VDDQGHEIDVMEYARLL
A0A2V8TLH7      -------------------MSENLP------------------IVEEQREVHLLDYWRTI
A0A1Q7ZJT1      -------------------MPDSLN------------------PLEEKREIHLLDYWRTI
A0A2V8VC99      -------------------MPETLA------------------PLEEKRDVHLLDYWRII
A0A348UZU3      -----------------MSENYVDP------------------QSLETAEIDLRKYIDIF
Q01XL7          YEPESNGSGPHGLPVGPDVRMLPSP------------------SDGWVPEPTKISYWKIA
A0A2V8ERZ5      APSTTAVTAGSPSHAGSSHGQGSAP------------------HYAPEQDVHLLDRLAVI
A0A2V8GTX0      GP---AAGSPPPVPVHQPQARKTAG------------------LFSPDPNIHLFDRLAII
A0A2V8J0X9      LP---AEVSPSALIALPSSTSQST---------------------------HVLDRLNAV
A0A523DUV7      ----------------------TNL------------------IAGLSGEFDLKYGLRLL
A0A372IRG7      HPP-------------------GGV------------------PPHESPAFTPADFRKII
A0A1F2U158      PTSSGAPRAP------------QPL------------------TYAVDKDVHILDRLAVV
A0A2V8F6S9      ASNSNGGVAP-------------PL------------------TYGTDGDVHILDRLAVL
A0A7D8BEX2      QEAF------------------DVQ------------------TDQAADLPSLARIWVGL
A0A4Q1SCH5      AAF-------------------SSP------------------GVGDSEGISFREIFRAI
A0A2V8K4L4      NLPVPFTPPPGNQLSTPLQARFMPE------------------PQEEASREGVVAYWRMV
A0A2V8NCZ3      NLPVPFKSARGSQLPTPVPARFTAE--------------------DDSSREGVVAYWRMV
A0A4Q7YNP3      IDRRPVGIVARDESGETFPKSWTAN------------------DRVEQRTSLFAEYLRIL
E8UZE1          --------------MKNPGIPDEVA------------------ARSSFSAVGLPEIYRLL
A0A2U3JZ71      LPGRNLPVPMEVYRTSNLMP----E------------------VEAAPSSVPLSHYLWIL
A0A2V8TTB0      ----------EVYRAAAPVPVIDAE------------------FEPQAPQVPLAHYLWIL
A0A1V6HR88      --------------------------------------------------------MKVF
A0A3E0P0A3      ----------------------EAF------------------AGSGDDLKLIAEYGSIL
A0A2V8EXP2      AARAADSGPAAAAPPPTAYGYGSNV------------------VGDDQ--VHLLDYVKVL
A0A2W4RYA1      GAAGDGQPPAGATVPSRAGAQHAHG------------------LDEDHGDVHLRDYVRIL
G8P0Y7          DSPRLASL--------------QEM------------------YRPPAREHSISDYWHIL
A0A5M8T4U7      N---------------------PAT------------------IAAPSESLSLMDVWRVV
A0A7D0PPG7      RLRERLYLPEPLDQLPS-----PLE------------------VEAPEQVLSIGHYAWLL
A0A7D8BF18      ----------------------PLT------------------AVDQASENALSDAWITI
A0A1E3Y9R6      ----------------------GRQ------------------ASAKGGGWHPTDYLRVL
A0A2W4TLP2      ----------------------GRA------------------ARRGGSSWHPTDYLRVL
A0A7C4BZ42      GGGPPMVPDRPVEVMQPAYY--QPA------------------YDDAASGGGLLEYWRLA
A0A3R9WF43      HRSFLAEMQTRA----------HLA------------------PVNASEYESLSGLLRVL
A0A317HKM4      DARGT-----------------GSP------------------DTWGTDTLQIRDYARIV
A0A2V9CG11      ----------------------NRE------------------VATAGGYDSFLDYWRIL
A0A523E0N1      ----------------------SDY------------------APEIYPRASLREIYFVL
A0A523ECP2      PPTPTSEPE-------------RVD------------------FHPPESETHLRDYWYII
A0A2W0C122      QNTPASQGI-------------HYG------------------WARLVPLNPVQRVVRLL
A0A2W0AUU7      QQSSASQNL-------------HRA------------------SSRRVPLNPMQVVFRLL
A0A2W0BQL1      QQSSASQNL-------------HRA------------------SSRRVPLNPMQVVFRLL
A0A4Q1SDL1      ----------------MNNYLLEAP------------------PTHVEPGLTLGDLSKII
A0A3P0XH15      ----------------------GPQ------------------LAPEQAIITPSDIRKIL
A0A4R1LAZ7      DMQ-------------------AEL------------------PVNERSILTPGDVRKIF
A0A3M1WQW8      DTGAMDRNVVTRLYPIGYGH--ERY------------------GTAVERDVHLLDYWRII
A0A3N1JHC1      ETPGPRLPSAGTLDP-------FRS------------------STVYGTPEEQIDYLLLL
C1F294          ASA-------------------DEK------------------TVAPQSTINLSDLRKLF
A0A2V9KA79      -----------------------MQ------------------NGTANTSASLTNLVAIF
A0A522PSP1      GPEEATRLAPDNQKGT------WGF------------------PTEPAISLALSRYWGAI
G8P085          DQR-------------------SLT------------------EADSASALSLGDIAQML
A0A7C6A629      LPAAPAYPPAPAGWY-------GPE------------------MEFEEPGTPLSHYLWIL
A0A4Q1SGQ1      ----------------------TDL------------------LTRPRREWTMLDLWQVM
Q1ILD9          GKGAR-----------------WQP------------------SESDGQKIDFDGLFRII
A0A7C5SHM3      AGD-----------------------------------------------WSLKAVQRLL
Q1IJZ6          VSEQS-----------------TTN------------------AGLEDEDLSLRQVIRIL
A0A2V8TCE6      --------------------------------------------------SEIREFWSIL
A0A522TBE8      QPVAGRAGAPAPWWQATEEAG-PQA------------------ERPAGSGTPWVYYGRLL
Q1ITG0          RT--------------------SWA------------------DVQEDREADLLHVLYVL
A0A7C2ML20      NPPGL-----------------LAG------------------LSQEKMSDVWRRYWRVV
A0A7C5AXS9      LPVRYEYVEVP-----------APE------------------TGAEPEGPTLLDYWRIL
A0A7C2RGE3      SERSSLHAPGAPSGHVMKFYPASAF------------------EEGGERDIHLLDYWRVI
A0A3N5PCI5      TSRAE-----------------PQ--------------------------WQLEDVFAVL
A0A3M1Q0S9      --------------------------------------------------FNLRDYWQIV
A0A2Z5G448      SVAGK-----------------PAG------------------SDRQDFILTPADFRKIL
A0A3M1VZ38      --------------------------------------------------FNLRSYWQIL
A0A4Q1SD29      VASSP-----------------AVG------------------SVQEHTVFTPADLRKVV
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      GGE-----------------------------------------------WDLDALRRVL
A0A3M1VMP2      GGD-----------------------------------------------WDLAAVRKVL
                                                                            

A0A2V7VMF7      WRSRV-FIVALGLVGLGLGFVVALLQTPQYRAGAM--IQIEPPAP-----TFMTVTDALA
A0A2V7YYV7      RHRLW-MIIACPILAALSAGIVSFALPPVYEAHAA--LLVLPSN-LGTSDPNVIPLTPDQ
A0A2V7Z0J5      RHRLW-MIVACPLLAAVTAGVVSFALPPVYEAKVD--LAVKPAQLLPSTDPNAPSISATT
A0A2V7Z3M4      RHRLW-MIVACPLLAAVTAGIVSFAVPPVYEAKVD--LAVRPAQLLPSTDPNAPSVSSAT
A0A399Y5V2      RRRKW-FIILPTVVILVAAITASLLTTPIYEASAD--VLIQSNKRSSV----IADVAMPA
Q01X01          YRRKA-TVLWITFFAVIAAALISVAQPRMYESQAS--IQVQGVNENFLNLRDIFPTAAPS
A0A3M2D9H8      KRWAW-LLGVGVLIGLIGGLIYSLVQEPVYQATTK--VMVLGAPQSNLSDILNQNTELL-
A0A2V8JK38      VTRRW-TVVAVFATIVLLTLIWTLKQKPMYAATIT--IQIERETP-----SLVNLRDYYQ
A0A2V9IXG5      WTGKW-VILACMLVALALAAVNNNFQKVSYRAQAQ--IQIDAPPFLPSP---------GA
A0A2V9J2P4      WTGKW-VILACMLVAMALAAVNNNFQKVSYRAQAQ--IQIDAPPFLPSP---------GA
A0A1Q7RLS4      WRGRW-TILSIFVVVFTLVAIGTFTQKPVYRASVT--VEITPQSRKVSPVAEVAETGMAQ
A0A2V2R525      RKHFL-MIIALTALCTLTTAVYMARKPDVYGAAVR--VQIDVESNPA---SGINGKPVVI
A0A321LPW6      RKRRW-LIAATVVIVTSIVTVEMFRIKTAYQASAM--IEIGKDVQA----VQGPSAAAVQ
A0A2V9R9V4      RKRRW-LIIGIASIITTLVTIDVFRTKPLYEATTT--IEIGRDNGA----RINSNGLFIQ
A0A321LE75      RKRLW-LISLIALIVTTIVTLEMFRTKSMYKASTT--IEIEKENRT----LVKSGDVVIS
A0A2V8R8U7      LKRKW-LILSLVLVVTSLVTIQAYRQPSIYEGGTT--IRIESKPAPV---LATGQV--I-
A0A2V8QMP4      LKRKW-LILSLMVVITSLVAIQMYRLPSIYEAQAT--IQIEQKKGGV---LQTAGAGNL-
A0A2V8R4S3      LKRKW-LILSLMVVITSLVAIQMYRLPSIYEAQAT--IQIEQKKGGV---LQTAGAGNL-
A0A2V8NJ55      LKRKW-LILSLVVVVTSLVTIQMYRQPPIYEAETT--IQIE-QKKNI---LQTKEL--I-
A0A2V8Q7I0      LKRKW-LILSLCLVVTSLVAVQMFRQPSIFQAETT--IRIE-RKQNV---LVSKDF--V-
A0A2V8S6K4      LKRKW-LILSLVTVVTTLVAIQMYRLPSIYEAKTT--IQIEPKRNAL---IKTKDI--V-
A0A317I2L9      LKRKW-LILSLCLVVTSLVAVQMFRQPSIYEAETT--IRIEQRKSNI---LQSDKL--V-
A0A2V8LLF9      LKRKW-LIMSLLLVVTSLATIQAYREPSIYQASTM--IRIEGRPQSV---LSTGNLIIS-
A0A352FRF4      LKRKW-LIMSLVLIITSLATIQAYREPSIYEGATT--IKIEQKTPSI---LQSGNGGGI-
A0A2V8MKV0      LKRKW-LILSVALVITSMAAIQQYRQPSIYDGIAQ--LKIEEKPPNI---LSSSQIVIT-
A0A2V8PYY8      LKRKW-LILGVVLVITSMAAVQQYRQPSIYDGIAQ--LKIEEKPPNI---LSSSQLVIV-
A0A1Q7YKQ8      LKRKW-LILTLMLVVTSLVAIQMYRLPPIYQAEAT--IQIEPKHDSI---LKAGNNVVIN
A0A352F3R7      LKRKW-LILSLVLVITSLVTIQSFRAPSIYEGETT--IRIEQRPMSV---LQTKE--IV-
A0A0B6WXT1      YKRRW-LILSLALAVTSLVAIYMYRQPNVYEAMVT--IDIEPRR-SV---LQTKGDVQV-
A0A3B9MEU8      LKRKW-LILSLVLVITSLVTIQSFRAPSIYEGETT--IRIEQKPMSV---LQTKE--IV-
A0A2V8MHG6      RKHLW-LVMGIVVLVSGVTAMYMARQRDIYESLAR--VQVDSETANNPAIGALKGNSIFL
A0A2V8P7N1      ----------------------------------K--VQVDSETANNPAIGALKGNPIFL
A0A2V8M3M6      RKHFW-LIIAILILVTGITAIYMARQPDVYESLSK--VQVDSETANNPAIGALKGNPIFL
A0A1Q7NJH5      RKHVW-LVIGIVVVVTGLTAVYMARQPDVYESASR--VQVDSETANNPAIGALKGNPIFL
A0A2V8PJY0      RKHVW-LVIGIVVLLTGLTAVYMARQPDVYESASR--VQVDSETANNPAIGALKGNPIFL
A0A1Q7Y6W9      RKRLW-LVISITVLMTTLAAIYMARKPDIYTAQAR--VQVDLEN-INPALGTNR-NGVNI
A0A2V8NC68      RKHIW-LVMGIILLITMLATIYMARQPDVFEARAR--VQVDLEI-NNPALGSIKGNSIVL
A0A399WK13      RKRLW-LVVGIAVVMTTLATIYIARKPNVYRAKAV--VQVDNEQVNPDL-VTTDRARPIS
A0A352FLX4      SKHLW-LILGISVLIPTLVAIYVVRKPDIYESQAR--IQVDLENANPLLGGMSKNSNVIL
A0A2V8RTL7      RKRLW-LVVGIAVLITTLAAIYMARKPNIYLASSV--VQVDLEQTNPDL-ITNDRQRVLS
A0A3E0PCJ6      RKRLW-LVLGITVLLTTVTAIYMARKPNVYMASAT--VQVDLEQANQDL-VTPDRRMPVM
A0A3M1S4R8      RKRLW-LIVGLVVLVTTLTAIYVARQPNVYEARAR--VQVDLEQGNPQL-QVSDRPTLLP
A0A7C2G442      RKRLW-LIVGLVVLVTTLTAIYVARQPNVYEARAR--VQVDLEQGNPQL-QVSDRPTLLP
A0A1Q7YFI6      RKHLW-LIIGIVVLITMIAAVYMARQADIYEAKSR--VQVDLEVNNPGI-GAMKNTSYIL
A0A136KC10      RKRLW-LVAGIAVVMTTLATIYIARKPNVYRAKAV--VQVDNEQVNPDL-VTNDRARPIS
A0A3M2D6Y5      RKRLW-LIVSIAILVTTLTAIYVARKPNIYEAKAR--IQVDLEQNNPQL-QVTDRPALLS
A0A2V8SEX6      RKRLW-LVAGIAVLVTTLVAIYMARKPDIFSATAR--IQVDLEQVNQDL-VTSDRQRPIS
A0A7C5ZUU4      RKRLW-LIAGICVLVTTLVAIYMARKPNIYLAKAT--IQVDLEQINPDL-VTSDRQRPVS
A0A0B6WWQ6      RRYLW-LVIGLVALAAAATAIYMARQPDLYLARAR--VEIGSEEDSALS-LSPTGGPVVI
A0A3B9MK99      RDR----VISVLVLITTISVIHVARKPDIYQASAR--VQVGLENNAD---LVGKT-PYYF
A0A352EX26      RKRLW-LVIGIVILITTLAVINAAQKPDIYSANAR--VQVDLENNGA---LVGKT-PYYM
A0A2V8MM59      RKRLW-LVIGVAALITAMAVIYAARKPDVYEAASQ--VRVDLENNPM---YEGKTTQLIY
A0A2V8PFE8      RKRLW-LVLGVAALITALSTVYVARKPDVYEAKSQ--VQVDLENNPM---YAGKSVPMIY
A0A2V8PWS6      RKRLW-LVLGVAALITALSTIYVARKADVYEASSR--AQVDLENNPM---YAGKSVPMIY
A0A2V8LCT5      RKRLW-LVIGVAALLTTLALVYVARKPDIYEAKSQ--VQVDLENNPM---YAGKTAPMIV
A0A352FTJ9      RKRLW-LVIGVAVLMTTLAIIYVARKPDIYESSSR--VQVDLENNPM---YAEKAAPMIV
A0A257VBK0      WDQRF-WIAGVTAAVVILVALYTFLATPIYSATAT--VYVQTYSR----------QPMSG
A0A2G6PYV5      RKHFF-LTLSLLILGLGLAYLAWLVKPPLYKSSVL--IKMNHLS----M-DVIGFTEKL-
A0A2V8F956      ------MAITTFLLVVGSVTVYTFTATPIFEAKTR--LLIEAEN----R-NVVSFKAVL-
A0A1F2S1W5      YRRRY-VAATAFLVVVLSVALYTFTAVRIYEGTVR--ILIERDD----P-NVVSFQEVL-
A0A1F2T595      YRRRY-AAITVFLATVVTVALFTFTATRVYEGSVR--ILIERDD----P-NVLSFQQVF-
A0A2V8JQV5      LNRKG-TVLIAAVLGTAIGLLISFPRTPIYQARTT--LEIQGLN----D-NLLNTREVNP
A0A2V9AC41      KRHRW-LIVMTALAILACAMLYLFTRIPLYTAEAT--VLIERKA----P-QILKVQDTRA
A0A2V9MAM9      RRHSL-LLAVITAATVGAAFLVSIAQPRLYQSVAS--VEVQGLN----E-NFLNLRDVNP
A0A348V070      LRWKW-TGLTVAVLIVALTLVYILISPHIYTASGT--IWIDETQ------SVLPFEELSR
A0A2V9M454      LKHQW-LILVTAFVLTLLVTVYSYKMKPVYRATAR--VDVEAEE----P-LLQSLNDLFR
A0A2V9IVR7      VRHGW-TILTVAFVVTMLVALISFRLQPVYQATAR--VEIEAAT----P-EIRTLSDLFE
A0A2V9ILE2      VRHGW-TILTVAFVVTMLVALISFRLQPVYQATAR--VEIEAAT----P-EIRTLSDLFE
A0A2V9LGY4      VRHGW-TILTVAFVVTMLVALISFRLQPVYQATAR--VEIEAAT----P-EIRTLSDLFE
A0A2V9J4D6      FRWRW--------LSWISVTIYTFKAERVYQATAR--LDIEAET----P-MNLSAESLYR
A0A2V9L9C5      LRKRWWEVLSVAMVVLISVTIYTFKAERVYQATAR--LDIEAET----P-MNLSAESLYR
A0A2N9M9N1      -RKRRSTVFAAAFLVTLLVTVVVYRMKPIYRATAR--MEVQAET----P-ALQTLNELGP
A0A2V9JEC4      -KRRWPTVITVASAVTLLATLISLKMQPVYKATAR--LEVKGEM----P-QLQTINEIDR
A0A2V9LPQ3      YRRRWQIVAITVAAVTIMA-IYSFKVNPIYRATAH--VEIEAEA----P-LTMSVSDRFR
A0A2Z5G3A3      VRRRA-IIAGVTFAFLAIASLYCLLSTRRYMATGT--IQIQKDS----S-DALRLESMMQ
A0A2V7UGP8      KRRRW-VVFTAVVVLVITVTLGSFLIPPSYQAICT--LQIEREQ----P-NVLTFQQVQP
A0A239MKT6      RRRKI-WIALGIVLGFLSGLAVYLHTPPLYTATAI--VELNKDSS-SGL-GLQELSGLSD
A0A3E0PCN7      RKYWL-MIVAITLLGSLAAVVYVAQKPDYYTATVR--IQVNNEN------NPAVGNDTSS
A0A2V8IYW3      NRRKW-LLICPVLVFGIAAFLITRSLPNLYQSETT--ILVVPQRV-PES-----------
G2LEI9          LRYKF-TVILCVVLTMTVTGLALSRMQPVYEASSH--IEVAPEK------ELYSSSGRIA
A0A317J121      RKYLI-LLSLFAVAGAAAGFFSVAFLNPVYQSRAL--LEVQAPT----------------
A0A2V7YW66      RRHWK-LAAVCCLLGLAGAAVHYAITPKAFQATAT--IQIERRN-------LTPLGNG--
A0A2V7Z0V0      RRHWR-LAAVCCALGLAGAGIHYAITPKAYQASTI--IQIERRN-------LTPLGN---
A0A2V8GFD4      YKRRW-LCLAVFVLTLGSVVMYTFTATPIYEARTQ--ILIETEN----P-NVVSFQEVV-
A0A2V8HSS5      YKRRW-LCLAVFVLTLGSVVMYTFTATPIYEARTQ--ILIETEN----P-NVVSFQEVV-
A0A2V8KP55      VTRRW-TVVAVFATIVLLTLIWTLKQKPMYAATIT--IQIERET----P-SLVNLRDYYQ
A0A399WNU1      KKHWL-LVLSITLIGTFLVIVYEAQKPDFYEASVR--VQVNNES------NPAAGEGTAS
A0A2V9JSI3      VKRRW-TVVTVAFVVSTVVAMVNFRMPPVYEARVS--VEVEGEA----P-EVQSISNFY-
A0A2V9WI32      KKRKW-VVISTWLIIAILATVYALHMTPVYDATGR--IAINREN----S-VNLGFKDSDQ
A0A2V8IVN9      YKRRW-IAGTAFTVVMLLVTVYTFTVTPIYQATTK--LLIESDS----P-NVVSFKEVI-
A0A7C5Z4J3      SKRRW-TILSVAIVVTTLAAIYSFKQKPVYRATAE--LEVDSEV----P-ELQSVDNLF-
A0A1F2TPT3      YKRRW-IAITALLVVLTFAINRNFTAVPVYEASVR--VLLDAER----L-NLVNVEDVID
A0A2V8JTQ2      RDRKW-TIAAFALVVVGIVVTASLLMEPQYKAVGR--VVVVFHRD-NDS-GVLGFRGADT
A0A2V8UZY0      QDRKW-TITAFALVVVAIVLTASYYMKPRYEAVGR--VVVVFHRE-NDS-GVLGFKGVDT
A0A350UEK1      RRRKG-TLIIGAVAGLLIGIASTLPRTPIYQAKTT--LEIQSFN----Q-NFMNMGNLQE
A0A350UIQ4      RRRKG-TLVIGATVGLLLGIAVTLPQTPIYQAKTT--LEIQSFN----Q-NFMNMGNLQE
A0A1H5Z7N3      RKRKY-WILAAALIGILLALYQSATQPRLFEAYGN--IEIRSGAS--NEYKIGAATGG--
A0A1G7JVV8      RKRKW-VLIIAAILGILYGVYQAATQPIVYVATGR--IQVAKPNG--QASLGVATGNLT-
A0A1H4T6W9      RKRRW-ILIACAIVGILYGYYLASTQPIIFTATGR--IQVHEANS--TAT------QMM-
I3ZEU5          RKRKW-ILVACAVIAILYGYYTASTQPIIYTATGR--IQIHEANS--AAT------QLM-
A0A1I6MH75      RKRKW-VLVACVLLGMVYGSYDAITQPRLYESHSR--IQVRSGAS--NEYRVSAVPGM--
E8WVF6          RKRRM-VLIIAVVLGTLFGFYKSVTQIKPYEAYGR--LEVNTGAS--NQFKLSPFSGL--
A0A7D0PQC3      RKRRW-VLIVAIILGVLGGLYRGFTEPRLYVATGR--IQVHSSSS-ASEYKMNVATAAM-
A0A428MDU2      RKRRW-ILITSVVLGIAYGVYKAETQPKLFEAFGR--IEVRSGSS--NEYRVSAVQGY--
A0A5B9EBI2      RKRRW-VLLIAIAVGLAYGMYRSVSQPRLYIATGR--IEVRSGSS--NEYRLTT---V--
A0A239HDF6      RKRRW-VLIVAFVLGAAFGLYRAFFQPRIFEAYGR--IQVRTGSA--DQYKLTSPVGL--
A0A4Q0T270      RKRKW-VLILAVLIGFAYGYWKASSQPRLFEAYAR--IQVRSGSS--NEYKVSASTGI--
A0A1Q3QQB6      KKRRK-ILILAILLGLGYGIYKAQTQPKLYEAVGR--IQVRSGSS--NEYRLSAVQAL--
A0A3N1K1G7      RKRRW-ILIVAVLLGLIYGVYKAETQPKLYEAYGR--IQVRSGSS--NEYRVTAVQGY--
A0A4V2G466      RKRKR-ILLVFVLLGLIYGIYRAETQPRIYEAFGR--IQVRSGSS--NEFRVSAVPGM--
A0A6B9YNQ8      RKRKR-VLLAFVLAGLLYGIYAAETQPRIYEAFGR--IQVRSGSS--NEYRVSSVSGA--
A0A3N5YNR8      LKRKW-LIGLVVGAVLLLVGLQSFTTTPLYRATAR--VQIDPES----A-SILPYQPLNE
A0A3N6A5T6      LKRKW-LVLTVLVTVVVGTAVQTMTTTKVYRSTAR--VRIDPES----T-NILPYEDVYQ
A0A1F2Q9L4      RRRRL-LLILVAGLVAAISIVLYFMTPRQYRATTV--LQIERRP----T-SAAAMQQPMQ
A0A2U3KC61      RKRKW-AVLATFAIVFALSVIKTLRETRLYQATSK--VAIFEEN----P-NVLGFKDV--
A0A2V9Y2R7      RKRKW-AVLVTLIVVWVLSAVATMKQTRLYEAVSQ--LAIFPEN----L-NALGLKDG--
A0A2V9NGH6      IKRKW-VVISSVVMIFVVVAIATLKATPVYDATGS--IAINKLD----P-ALISFKDS--
A0A2V9PYE6      ------------------------------------------MD----P-ALISFKDS--
A0A2V9NL07      IKRKW-IVVGTLAAIFGASLVATLRITPIYDAVGS--IAINKPD----P-MLQNLRDP--
A0A2V9QD92      IKRKW-IVVGTLAAIFGASLVATLRITPIYDAVGS--IAINKPD----P-MLQNLRDP--
A0A2V9WPZ6      IKRKW-TILFCLAGIFIMVAISSLKMTPVYEASGS--IAVNKAD----P-GLVNFKDS--
A0A2V9ZLH4      IKRKF-VALSCVVVIFLLVLIATLRMTPIYDAAGS--IAINKLD----P-SFINFKDS--
A0A2V9RQF1      IKRKW-IVISSVTVIFGVVAIATLKSIPIYDASGS--IAINKSD----P-ALLNIKDS--
A0A2V9YDK8      IKRKW-TIILCFSGIFIAVAIASLKMTPIYEASGS--IAVNKTD----P-GLVNFKDS--
A0A2V9V8F7      IKRKW-TVLFCLAGIFIMVAISSLKMTPVYEASGS--IAVNKAD----P-GLVNFKDS--
A0A2V9XGR9      IKRKW-TILFCLAGIFIMVAISSLKMTPVYEASGS--IAVNKAD----P-GLVNFKDS--
A0A2V9V3Q5      LKRKW-IIIACVVGIFAAVAIASLRQTPVFDAVGR--IAINKAD----S-NLVTFKDS--
A0A2V9NWS3      IKRKW-VIISCLAIIFGAVSVVTMRSTRIYDATGS--IAINKSD----P-ALLNFKDS--
A0A2V9USA9      AKRKW-VIFSCVAAIFAVVAIASLKMTPIYEANGS--IAINKPD----S-T-LNFQNS--
A0A2V9XW18      IKRKW-IVIICLVTIFSVVAIATLKTTPVYEAGGT--IAINKPD----T-T-LNFQNS--
A0A1H5SQF5      RKKLW-LIVGCVVVGVGLAVLLTSLMQRRFSSTVT--IEVHKEGG-TSL-SLEDLSGAGQ
A0A2V9AEW6      ----M-TLLGFAVVGLLASIMISLVQTPIYRVRTS--LEIQGTN----FQEMKGID---S
A0A2V8WQK6      IRHRM-TVLRFAVAGLLGAIVVSLVQTPIYRVRTS--LEIQGPN----FPEMKGAN--DS
A0A2V8XIF4      AQHKM-TLLAFGVCGLVAAILFSFIQTPTYRVRTS--LEIQSTN----FVEIKGGDPSGS
A0A2V2R0I6      RKHQW-LILSFMLAVVTIVAIATFRMQPVYTATAR--IEIDREN----S-NILPFQGPEA
A0A2V8XAR9      RKHQW-LILSFMLAVVTIVTISTFRMQPVYNATAR--IEIDREN----A-NILPFPGADS
A0A2V8VZA0      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTR--VEIDREN----A-NILPFQGTDS
A0A1Q7CB82      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTR--VEIDREN----A-NILPFQGTDS
A0A2V8WIU1      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTR--VEIDREN----A-NILPFQGTDS
A0A1Q6Y9F5      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATAR--IEIDREN----A-NILPFQGAES
A0A2V9EVV8      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVGTAR--IEIDREN----A-NILPFQGAES
A0A2V8YF91      RKHLW-LIVSFMLTVVTIVAIANFRMKPVYVATAR--IEIDREN----A-NLLPFQGADP
A0A2V8XZK2      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATAR--VEIDREN----A-NILPFQGADS
A0A2V8ZTX6      RKHQW-LILSFMLAVVTIVSIATFRMQPVYVAIAR--IEIDREN----A-NILPFPGGES
A0A2V9BT79      RKHQW-LIVSFMLSVVTIVSIATFRMQPVYVATAR--IEIDKEN----A-NILPFQGADS
A0A2V9YHT3      VKRKA-VVLITLAVVFALVAFRTYRTTPLYESTGR--VAIYHES----Q-TLTGFKDSVP
A0A7C2XNI7      RKHMW-LSLAFLLAVVTVVTIATFKMQPVYVAVAR--VAVDRED----P-NLLPFQNSMY
A0A1Q8B793      RKHQW-LILTFLLTVVTIVSIATFRMKSVYVAPAR--IEVDREN----A-NFLPFQPADP
A0A2V9BCA0      RKHQW-LILTFLLTVVTIVSIATFRMKSVYVAPAR--IEVDREN----A-NFLPFQPADP
A0A2V9BWU9      RKYQW-SILSFLLTVVTFVTIATLRMHPVYEATAR--VEIDNEN----T-NFLPFK-SDS
A0A2V9DKX2      RKYQW-SILSFLLTVVTFVTIATLRMHPVYEATAR--VEIDNEN----T-NFLPFK-SDS
A0A7C2YQY3      RKHRW-IILTVVAVMVTVVSVVSFQMQPVYQASSR--LEINGEA----P-DLTNLRELFV
A0A3E0NV31      RVRIF-TVVLVWLLTVVVMVVHVWTQTPLYRSTAT--LEIEPKQ------NLLPYQDLSA
A0A3N5M5V0      RKRKW-LIVAVVTTVLVLVAVQSFTTTPLYRATAR--IQIDPES----E-NILPYKDVYE
A0A3N5XQP8      IKYRR-FVLLVLFLVVALVALETFTATPLYRASVR--VEVDAEP----A-KVLPYQEIY-
A0A2Z5G7H4      RRRRR-VMVSCVGGCVALAVLVCVFCTRRYQAFGE--IQVQKDS----S-DALGLDSMMG
A0A2V9L5B5      LKRRW-TVLVCLLVVFTTVAIGTLKKRPVYEGKVL--LEINPEE----P-QVLNFREVSQ
A0A2V9LK56      LKHRW-LLISTLLIVFSIVAVGTLKQKPSFQGSIL--VEIDPDP----P-SVVNFKEILQ
A0A2V9L7I0      LKRRW-TVLVCLLAVFTTVAIGTLKQRPVYVGKVL--LEINPEE----P-QVLSFKEVTQ
A0A522PPT0      LKRRW-AVLTCLLIVFTTVAIGTFKQKPIYAGKIL--IEINPEE----P-QVLSFQQIAQ
A0A7C5V1G5      LKRRW-TVLTCLLVVFSTVAIATFKEKPVYAGRIL--IEINPEE----P-QVLSFQQIAQ
A0A2V9KCS3      LRRKW-TVLIIGFVGTLSGFLVSLPQTPVYRSRTS--VEIQALN----D-NLMNTRQIDP
A0A372IT17      RRRRR-IVLGMVFALLLLVTLYCLLITPLYQATGE--IEIQREP----SGAFGLDNGVLG
A0A4R1LC91      RRRRS-VVYGTTLVLFGAAILYCLLSTRRYEVTGE--VQVQKTP----ADSLGLDVSGNG
A0A3M2BZG9      QRRWP-LILIFCALAAAYSLVRYSLTTKMYQATAV--IQIERRQ----LATIAMGGATNW
A0A1Q7N5R7      WRYRW-WILAATALGTIGGAAASRFLPPRYVAQAT--IWIQTSGG-NGP-ERGPIGANQL
A0A2V9QB26      CRHTG-ILAGITLMGALAGVLLSIWQSPVYRARTA--LEIQNIN----E-DFLNIKQVTP
A0A2V9VYY4      TKRKW-VVLPTFAIVFALSAIATLSETRLYQATSK--VAIFPEVP-NVL-GFKDAENIAP
A0A3E0PHB0      YKRLP-LILAATIIVTAAVAFYMFRLSDQYAAAAT--MIVEPPK----P-KATDSQSVIL
A0A3M1SIV3      HKRLP-LIIALVLVITTLTALYMYRQPSIYQATAI--LLIEPPK----P-KIQSKDTINI
A0A3M2D491      YKRLP-MIIALVVIVTSLVAFYMYRQPSIYEARAV--LLIEPRR----P-KIQSKDTINI
A0A353C9L6      YKRLP-LIIAIVTIVTAAAAIYMYRQPTVYQATTD--MIIEPRR----P-KVTSKDAINI
A0A2V8RQV0      YKRLP-LILALTILVTAAAAFYMYRQASVYQASTQ--LVIEPRK----P-KVTSKDSINI
A0A2V8SJH5      KKRLP-IILAITLLATVAAALYMYKQPSLYQATTE--MVIEPRK----P-KVQSKESINI
A0A357F267      YKRLP-MILTLAIIVTAATAFYMYRQKSVYQATTE--MLIEPRK----P-KVTSKDSINI
A0A7C5ZUA8      TKRLP-LILVLTILTTAITAFYMYRQPSIYRARTQ--MVIEPRK----P-KMTSKDTINI
A0A136JPP4      TKRLP-MIGAIAVVVTAAAAFYSFRQPSIYSASTE--MLIEPRK----A-APTAKDAINI
A0A399WUJ8      TKRLP-LIGAIAIVVTAAAAFYSFRQPSIYSASTE--MLIEPRK----A-APT--DAINI
A0A2V9KIE8      LKRRW-TVLTALLAVFLTVAIGTFKQKPGYSGTAL--LEINPEP----P-NVLNFKEVLQ
A0A352F549      RKRLW-LIIGLALIVGSVTALRQARQPDIYQARAR--VQVGTQTY-SPALGASRGESFYP
A0A3B9MLP9      RKRLW-LIIGLALIVSTIAALKQARQPDIYQARAR--VQVDTETY-SPALGASRGGSYYV
A0A3D5SQ87      RKRLW-LIIGLALIVSTIAALKQARQPDIYQARAR--VQVDTETY-SPALGASRGGSYYV
A0A2V8NW86      CRQKD-ILAWITFLGALAGVLLTIWQSPVYRARTA--LEIQNIN----E-DFLNIKQVNP
A0A7C2GJ20      KKRRW-IVLSVLLVIVTIVTIRMYQLPVVYEATGR--IIINPQL----PLRVTREKETAA
A0A7C4BTL5      SRRKG-TVILVAALGGLAGVLVTMPQTPVYQARTT--IEIQEMN----E-NFLNMKQTTP
A0A2V8ZHL8      NKRRW-TIATVAFIATLLVAIASFKMTPIYEATAR--LDIEADT----A-QIQSFNDLY-
A0A2V9B240      NKRRW-TIVTVAFIVTLLVAIASFKMVSIYEATAH--LDIEADT----P-QIQSLNDLY-
A0A2V9CBM2      RRRLS-TILAVFFVVFVVIAIATLKQKPTYRAQVV--LEIQKEN----P-DIPTIQELY-
A0A2V8XN17      RKRLP-TILVVFFILFTGILIATLKQKPVYRAQVL--LEIQKEN----P-DIPTIKEMY-
A0A2V8WX45      HKRLP-TILIVFFILFTTILVVTLKQRSVYRAQVL--LEIQKEN----P-DIPTIKELY-
A0A1Q6YR79      RKRLP-TILVVFFILFTGILIATLKQKPVYRAQVL--LEIQKEN----P-DIPTIKEMY-
A0A1Q7VA32      RKRLP-TILVVFFILFTGILIATLKQKPVYRAQVL--LEIQKEN----P-DIPTIKEMY-
A0A2V9EY85      RKRLP-AILVVFFILFTAILIYTLKQKPVYRAQVL--LEIQKEN----P-DIPTIKELY-
A0A2V9H8K0      RKRLP-TILIVFFILFTAILIATLKQRPVYRAQVL--LEIQKEN----P-DIPTIKELY-
A0A2V9FFE5      RKRLP-SILVVFFILFTVILIATLKQRPVYRAQAL--LEIQKEN----P-DIPTIKELY-
A0A2V9GM43      RKRLP-SILVVFFILFTVILIATLKQRPVYRAQAL--LEIQKEN----P-DIPTIKELY-
A0A2V9CYQ5      RRRLS-TILTVFFVVFVGIAIATLKQKPTYRAQVM--LEIQKEN----P-DIPTIQELY-
A0A2V9BWU8      RKRFA-TVAIVFFLVFAGSLIATLKEKPVYRAQVL--LEIQKEN----A-DIPTIKDLY-
A0A2V8ZG48      RKRLP-TILIVFFLVFTVGLIATLKEKPIYRAQLL--LEIQKEN----P-DIPTIKDLY-
A0A2V8Y334      RKRFS-TVLIVFFLVFAVTLIATLKEKPLYRAQVL--LEIQKEN----P-DIPTIKDLY-
A0A2V9AY68      RKRFS-TILIVFFLVFAATLIVTLKEKPVYQAQVL--LEIQKEN----P-DIPTIKDLY-
A0A1F2RFI7      RKRRW-TVLGLLLLVVVTVMIGTLKQKPVYRAKAV--LQIDKES----S-NIFSFKDFVA
A0A1F2RZS3      QKRRW-TILSILLLVVVTVMIGTLKQRPIYEAKTV--IQIDRES----P-NILSFQGFVA
A0A1F2USE2      QKRRW-TILTIFFVFLTLVLLWTLKQKPIYGATVL--LEIEKEN----P-GLATVQELF-
A0A7C2VB08      RKRRW-TVLTLFSVVWLLVLIGTLKMRPVFEARGL--IEIEKEN----P-NFLTVKELF-
A0A2V9C238      RKRRW-TILTVFFVLFTVVLLGTLKQKPIYRAKAL--LEVAKEN----P-NILTVQELF-
A0A1F2Q9F5      RKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKAL--LEIEREG----P-NILTVQELF-
A0A1F2QQH9      RKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKAL--LEIEREG----P-NILTVQELF-
A0A1F2QXK7      RKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKAL--LEIEREG----P-NILTVQELF-
A0A2V9DEM9      RKRRW-TILTVFFVLFTVVLLGTLKQKPIYRAKAL--LEVAKEN----P-NILTVQELF-
A0A7C5TWV7      WRQRW-LIAAVVLICILAGGAWAFTTTKMYRARTR--IAFEQAPQ------------IIK
A0A2V7XDY0      WKNRI-LLATAAVLGLALGLVIAFAQTPEYRASVM--VQIDPPTP-----------TFMS
A0A2V8G155      YRRRW-TVVTAFVLATAGATVYTFSQPRLYEARTR--LLIETENP--NVVNFKAVIDEDQ
A0A2V8HDM7      YRRRW-TVVTAFVLATAGATVYTFSQPRLYEARTR--LLIETENP--NVVNFKAVIDEDQ
A0A2V8DRT9      YRRRW-PAGTAFMLVVLVVLVYTFTATPIYKARVQ--LLIEDEKS--NVVSFKEVIEQDK
A0A2V7VYF3      YKRRW-TAVTTFVLVVLAMMLRTLNGIPVYEARVQ--LLIDVEAP--KVLNFKDVFDQGH
A0A1F2SVH2      YKRRW-TALTAFLIVVLSVSVYTFTATPVFEARVQ--ILIEKEAT--NVVTFKEAYEQNQ
A0A2V8AJG9      YKRRW-TAITAFLVVFLSVTIYTFTATPIYEAKVQ--ILIEKENT--NVVTFKEAFEQNQ
A0A2N9LQU7      WKRRV-AASLFASGIFLAVILYTFLKKPVYESVAQ--IRVDSSQQ--GSLGLEDLVSQKL
A0A2P6WFK7      FKHKL-LILLTALTVFGIITLRTLTMTPVYESAVR--LQVDPSRS--SSLGLDEMISQKL
A0A2V8U914      YRRRV-TLLSVTLAGVFIAALLSMAQPRLYRSVAS--LEVQGVNE--NFLNLRDIDPAAT
A0A2V7W309      RKRWK-VAAAIVLVVMIGTFLASYFSKPLYQSWIQ--IEVEEESQNVTIEDLFGIASSDQ
A0A2W0BGU4      LRRRW-SILAVVFLATLTATLASLKMKPVYKATAR--IEVEADTPQTQMLNDRYQQLQTD
A0A2W0BVQ9      LRRRW-SILAVVFLATLTATLASLKMKPIYKATAR--IEVEADTPQTQMLNDRYQQLQTD
A0A2V9MN96      KKRKW-TIVATFAIILVLAIIATLRMPRLYEAASR--IAIYPENS--NVLGLKDLENGGM
A0A2V7V2Z1      LRRRR-LVLAVFLGVAALATFRSLLTRPVYEASAQ--ILIERDTP--SVLTFKEVAQVDA
A0A2V7X2F7      LRHRK-FALAIFLTATAVATIRTLLTRPVYMATAQ--ILIEREKS--NVLSFKDVTEVDA
A0A2V7V2I1      LRRRR-LVLAVFLTVAAAATVRTLLTRPVYEADVQ--ILIERENP--NVLTFKEVARVDS
A0A2V7U3M2      LRRRR-LVLAVFVAVTALATLRALLTRPVYEASAQ--ILIERDTP--NVLTFKEVAQVDA
A0A2V7UHT0      LRRRR-LVLAIFLGVAALATLRALLTRPVYEASAQ--ILIERDTP--NVLTFKEVAQVDA
A0A2Z5FVL3      ---------------------MCILMTRRYTAVAE--IQVQKPNSDSLTLDSNAASPAGG
A0A2V9KBD6      RPHKW-ITAGFTLAVVAIVTVASLVMKPQYDAVGRMVVVFHRDND-SGVLGFKGVDTSLL
A0A2W0AJ66      RSRKK-IIAAFAVMVVSTVMTASFLMKPRYDAVGR--VLFFREDEGAGVLGFKGPGSSLP
A0A1Q7RBU1      RNRKW-TIAVFALVVVAIVVTASLLMKPQYEAVGR--VVFHREND-SGVLGFKSVHPSLL
A0A2V9JPV9      RNRKW-VIALFALVVVAIVATASFLMKPQYEAVGR--VVFHREND-SGVLGFKGVDTSLL
A0A3P0X3W6      RRAWW-KIALFVVTCTALTAVACFLMTPVYEATVR--LAVDSKVP-ASVIGQDSATPNIS
A0A2N9MK30      RRHRW-KILSFIGVSAIATLIVSARLTPMYEATVT--VDVDRKVP-TAVVGQDSTQTGLN
A0A3D1ASD2      RRHKW-KILGFVLACCIATLLVSTRLTPIYAATAT--VDVDRQMP-TNVLGQDSGRAPVN
A0A7C5AXI3      KRHRW-RILAFVAASVAATIIVSSRLTPVYESTAT--VDIDRQTP-TGVIGQEALRTVSN
A0A7C6E4H7      KRHRW-KILAFVATCVIATLVISSRITPLYESTAT--IDIDRRMP-TGVLGPESAQSAIN
A0A1F2TCR2      FKHRR-VAGAAFVIVVMAMMVQTYSTIPLYLATAR--VMIEDERS-IA---------VAN
A0A350UQT3      DEEMW-KIGAFILVVLIATAVISLRLTPVYESTAT--LYVDRQEA-KGIVGQESQANVPS
A0A7C3HRX0      RRHAL-RIILFVAALTAATGIITLRLTPVYEATAT--LYVDRQEA-RGIVGQDSQAASIS
A0A1F2V330      MRRKL-FVLIPAAVLIVAVGIYTVYQPPLYRAQAL--LGVEPGAR-NYVQTMDGS-----
A0A662EE63      WSRRW-LVLAVLLSTVVLTTAWSVTRPKLYRAATK--LIVEPTSS-INNNQFDAF-----
A0A2V8TLH7      SRGRW-TILSVFVVIVTLVAIGTFTQKPVYRARAT--VEITSQAS-KV-APVADV----S
A0A1Q7ZJT1      WRGRW-TILSIFVVVFTLVAIGTFTQKPVYRASVT--VEITPQSR-KV-SPVAEV----A
A0A2V8VC99      WRGRW-TILTIFVVVVTLVAIGTLTQKPVYRAQAT--IEISPQSR-KV-SPVADV----A
A0A348UZU3      YRRRW-TVISLTLIAVALSLIISFVTRPVYKARGT--VMIEKEPN-I--LSFEDIFQIET
Q01XL7          WGHKF-ILLLCIFAGALGGTAYVILKTPEYAAAST--VELIGFNQ-SF-MNMSQVDPQAG
A0A2V8ERZ5      YRYRR-ICAATFVLVSAALIIQGYSTVQMYQAQAR--LLIEDERS-TA---------VPG
A0A2V8GTX0      IKHWK-ACAAIAVLVIAGMMYQTFTTVPLYRAQAR--IQIDEEQT-TA---------QVD
A0A2V8J0X9      FKHRR-LSGTAFVLVVTAMMVQTYSTIPVYEAWSR--VQIQDERT-TQ---------VGT
A0A523DUV7      WVGKS-WILVIALLGLGVGFLATFLQVPIYSARAL--VQIDPPGQ-NI-------SQLSN
A0A372IRG7      IKRKW-VILFCVLVGVGIAFYHIFTTIPQYEAISR--MSIDFSRS-TN-IGIEDIIESKL
A0A1F2U158      YRYKR-IALSVFLLTALALMIQGYSGEQVFQAKAQ--VLIEDERS-TA---------MPG
A0A2V8F6S9      YRYRR-IAITVFVLTTAALMIQGYSTTPMFEARAQ--IEIDAERA-TA---------LPG
A0A7D8BEX2      LRRRR-IVLAAFLVGLLIGTALLF-KPRNYLSVGL--LRIEPSRS-SM-FQLSASSALQG
A0A4Q1SCH5      LKGKW-FILASTVLCGAIALIYITVTKPVYEADGI--VRIDPNRS-GT-LGLTDA-----
A0A2V8K4L4      MRHKW-IVVLVAFLGTVAGILFTLPQTPIYQSSTS--LEVQGLNE-NF-LNLENLNPTSS
A0A2V8NCZ3      MRHKW-IVILVAFLGATAGILITLPQTPIYQSTTL--VEVQGLNE-NF-LNMQNLNPTSV
A0A4Q7YNP3      SRHRW-MIFASAIAGILLSFLLSFASLPYYRARTS--LDIQSLNS-DF-MNMRAVAPTGE
E8UZE1          KRRKW-LVLLIFLVFVAASALYTLRLPKRYEALCK--IDIDLSTP-KSVLALDSQSTASV
A0A2U3JZ71      RRNWW-KMLLFVSCAVAATLMVSARLIPVYESTST--IDIDRQMP-SAIIGQESTRTVAN
A0A2V8TTB0      RKHGW-TIAGFVVAAVLGTLIVSLRLTPVYESTVT--VDIDRQMP-TGVLGPESLQNATN
A0A1V6HR88      TARWR-LIALTTLLAIAGGVLAYLVTPKEYRATTT--ILIERR------LSIPVQSAVEA
A0A3E0P0A3      LRGWK-VLIAFAVLGLALGIARYLSAPVVYSATSQ--IQIERRAP-NL-LGGQMF-----
A0A2V8EXP2      HKRRV-AALTAFLLVFVSTAVYTFTAKPIYESKVQ--ILIEKENA-NV-VTFKEV--FEQ
A0A2W4RYA1      YKRRW-LMASAFLTVMVAVALYTFTATPLYEARTR--LLIDSD-P-NI-VSFEGV--VDQ
G8P0Y7          LKRKW-IVIVSVAIVLITTALISLHTTPIYEAVTK--ITISPPTS-NP-LNFKDN--NSS
A0A5M8T4U7      MKQRF-VILAVTIISFAAATVYSFRTKSVYESGGR--LQINPNVP-K--VGLQGY--GDQ
A0A7D0PPG7      RRHAW-KIAIAVTVCTTLAGVAAYTMTPVFESTAR--VAIDMKTP-ASVLGEPTVAGSAS
A0A7D8BF18      RKRLW-VILLLSVLGAGWGYYKAVTQPRIYEASGT--IEIRSGST-NE---------FRL
A0A1E3Y9R6      YKRRW-VAIPGFLLVFVSGAIGSIRTVPVYEARTQ--IIIEKDAR-RN---------TSI
A0A2W4TLP2      YKRRW-VAIPGFLLVFLSGAIGSIRTVPVYEARTQ--LIIEKDAR-RA---------TSI
A0A7C4BZ42      IRNRW-TLATAGVLGALLGFLYTVPQTPIYQASTT--VEVQGLNE-NF-LNMGNYSPTTP
A0A3R9WF43      RRRWR-SAVLVAVVIALLGTVAVLLMTPRYSATAT--IEVNREDH-EEASGPR----TDT
A0A317HKM4      YRRRW-IIFLIVVAGLIGGALYNWTAPRIFEAGAT--LQIEGDTN-ILALDRPLV-----
A0A2V9CG11      IRHKK-MLLLVTLAGLIAAILIGLVQTPVYRARTS--LEIQDFNE-NF-LDLKSVDPTVT
A0A523E0N1      LKHRW-PFVAVILATWMFAFISKYTETPYYRATAL--IQIDWGK-----INVVQDVMINP
A0A523ECP2      LKRRW-VILAVFISVLSYTAVKALMRQPVYSATTI--LQIDRGR-----INLVQDVMVQD
A0A2W0C122      HKHVW-IILGCTSLSVSVSVLYAMRQPRLYRATTN--IAIDRDSN-AT-VPLNKA--FAS
A0A2W0AUU7      HKHLW-TIAACTSLALSISLLYAVHQPRLYRATAN--IAIDRDSN-AG-VSLNKT--FAS
A0A2W0BQL1      HKHLW-TIAACTSLALSISLLYAVHQPRLYRATAN--IAIDRDSN-AG-VSLNKT--FAS
A0A4Q1SDL1      RRRRR-TVYSIFGAILLLAILYCIFATRRYMATGI--VQLQKDTD-SG-LSMSDL--QNN
A0A3P0XH15      IKRKW-LILAGIVVGLAFAAVYILTTIPQYEAIAL--IDINEGQQ-SN-IGISEL--VQQ
A0A4R1LAZ7      IRRKW-LLLAFALIGLGAGVLFLLMSVPLYEATAR--IDIDPGRS-TN-IGINDL--IEQ
A0A3M1WQW8      KKRKW-IVLGVLMMVVTVVAIRMYRARPIYQASGK--VIINQQTP-VPLANRQEALPYSS
A0A3N1JHC1      RRHRF-AVMMIFALCLLGGLLYAFFVPKSYKAQTV--LEITGINQ-DF-MNTRDA---DP
C1F294          LKRKW-IILICVLAGIGVALYHVETATPQYEAVSS--VSIDMNKS-TG-VELTSL---AS
A0A2V9KA79      KRRLW-LVLATTFVGTLCGGGASVLLPVRYRAQVL--LAAESAPT-RDYLRLGGY-----
A0A522PSP1      RRHAL-RIAIFVAATFLFTGIILLRLPRKYESTCV--IRLDPSVP-VS-VVNNQPGTVSL
G8P085          GRHKW-FILACIVIGTVVAVVYVKSVTPIYEATAS--IRIDPGRI-GS-LGLADL--TGT
A0A7C6A629      KRHRW-KILAFVATSVIATLIVSSRVTPVYESTAT--IDIDRRMP-TGILGPEAA-----
A0A4Q1SGQ1      RRRRR-WVLWPTGAALLLATLYWLLATPRFQANGE--IEVQRESA-AA-FGLDNS--VNG
Q1ILD9          VRRRK-LLAAGVLLGILLATAYCILKTRRYEGEAT--VYVHPEGS-DVLGSMPDL----G
A0A7C5SHM3      MQRRW-LVVAIAAQVFIVTGLVTFLRTPLYDASAR--ILIERSTP-KV-LESDDV--MPM
Q1IJZ6          RKRKN-LILGAAGACLACALLLSFVMRSYYNSSAT--IEIQKDQD-AS-LGSALDTLAST
A0A2V8TCE6      VRRQW-AIYTVAGLVLGLTALRLLMVQSTYKAKAL--VEIQRSSP-DV-LAFRDI--IRT
A0A522TBE8      QRNLW-RLVTFVCVVTAVATLIALTRPKQYAAVTT--LQVDALGA-QV-VGDEHL----Q
Q1ITG0          RRHLQ-MIIGVTAFGVLVAILFCLFMKPRYEGMAD--LNVHPEES-AA-LDMGALGDLAT
A0A7C2ML20      WRRRW-EVLGVFVTILIISGVMAYRTKPVYTATGT--ISIEPARQ-QVIIGVQDF--STT
A0A7C5AXS9      KRHKG-TLALFALSGVAAAILFSLPQTPVYQAKMT--LEILNLNE-NV-LNRRQL--EPT
A0A7C2RGE3      KKRRW-IVLSVMLVVVTIVTIRMSQLPVVYESTGR--IIINPQMP-LR-VTREKE--TGA
A0A3N5PCI5      YKRRW-IALFTFLIAAAGVVTYTMSVTPIYEAHTQ--LLLQ-QRA-SI-VTFEGA--ADP
A0A3M1Q0S9      VRRRW-LIVTCVLVATVAALVSSLLATPVYRATCT--LAIERTGV-RV-LR-ETL--SSA
A0A2Z5G448      IKRQF-IILACLATGLILGAVITFFTTPVFESTAR--IDINPDRS-TN-LGISDL--LNS
A0A3M1VZ38      VRRRW-LIGTCVLVTTVAAAVSSFLATPIYKATTT--ISIERRGV-RL-LNT-SL--TAT
A0A4Q1SD29      FKRKW-IILACLLLGLGIGLYFALATIPQYEATAR--VHIDFSRS-AN-IGIEDL--IQQ
A0A6N9FGE2      -----------------MALVHAYTATPVYRATAR--LLIEPQGP-NV-VTFQEV--I-V
A0A3M1PY35      WQRRW-LVAAIALEVLLVGAVVTFLRTPLYEASAR--LIIEKTMP-RV-LDSEDV--VSA
A0A3M1VMP2      WQRRW-LVAAIAAEVFLLTALVTFLRTPVYTASAR--LLIERTTP-RV-LDTEDV--VPM
                                                                            

A0A2V7VMF7      GM----GNYWQNADF-----YNTQFRVLKS----KTLGSRVVERLKLD--------D---
A0A2V7YYV7      I-------------------LRTYALLLTQ----RKLLDEVIADLRL-------------
A0A2V7Z0J5      I-------------------LATYALFMTE----PPLLNKVIADLGL-------------
A0A2V7Z3M4      I-------------------LATYALFMTE----PPLLNKVISDLRL-------------
A0A399Y5V2      EDPARE--------------LQTQIQVITS----RPVAEETAKRLQLN--------V---
Q01X01          ADSAVY--------------VQTQAEMLQQ----DALLERVVKKLRLE--------D---
A0A3M2D9H8      --------------------SQTFTELLVT----RPVLEAASERLGYY------------
A0A2V8JK38      ADSDTYVDYM----------LQSYFRILKS----RSLARRVVTELHEE--------L---
A0A2V9IXG5      DFNAQSSYYLNIDRY-----FKTEKQKLTS----RRMHLLFAGRLKQQ------------
A0A2V9J2P4      DFNAQSSYYLNIDRY-----FKTEKQKLTS----RRMHLLFAGRLKQQ------------
A0A1Q7RLS4      YGWYAEERY-----------FNTQYEIIKS----RDVARRVFDRLDLY--------N---
A0A2V2R525      NNSASAPDY-----------FETQLEILKG----SGLLRRVVKTLDLE--------H---
A0A321LPW6      DDS--DNFYPLVR-------IKTYMIELKS----RPLLSDVAARLRLD--------Q---
A0A2V9R9V4      EED-----YLNVT-------MNTSEVILKS----LPLLEDVVVQLRLD--------Q---
A0A321LE75      TDESDDAYYTSLV-------MKTKIRTLMS----RPLLEDVVIHLGLD--------H---
A0A2V8R8U7      INAPADANF-----------WGTQLKLLQN----PQLARQVVLSLELQ--------K---
A0A2V8QMP4      IIRGSDPNY-----------WNTQLQKLKT----QKLARQVILRLDLQ--------N---
A0A2V8R4S3      IIRGSDPNY-----------WNTQLQKLKT----QKLARQVILRLDLQ--------N---
A0A2V8NJ55      LNTGTDPYY-----------WNTQLKLLEN----PELARQVAITLDLQ--------N---
A0A2V8Q7I0      LNSQPDANF-----------WGTQITLLQS----PALARQVALTLDLQ--------H---
A0A2V8S6K4      VNAGADPAY-----------WGTQLKLLEN----PSLLRQVIMRLGLQ--------N---
A0A317I2L9      IGGQLDPNF-----------WGTQLKLLES----PALARQVALTLDLQ--------H---
A0A2V8LLF9      --GQPDPNF-----------WGTQLRLLQN----PLLARQVIVSLDLQ--------H---
A0A352FRF4      VIGQSDPNF-----------WGTQLNLLHN----EALARQVIVRLDLP--------H---
A0A2V8MKV0      ---QRDPNF-----------WGTQIKMLQN----PSLARQVILTLDLP--------H---
A0A2V8PYY8      ---QRDPNF-----------WGTQIKMLQN----AQLARQVILTLDLQ--------H---
A0A1Q7YKQ8      TGGGDDAQY-----------WNTQIKLLES----QQLARQVALTLDLQ--------N---
A0A352F3R7      ITGQNDPNF-----------WGTQLKLLEN----PALARQVVLTLDLQ--------H---
A0A0B6WXT1      VSVPNDPNY-----------WSTQIKLLQN----PQLARQVALTLDLP--------N---
A0A3B9MEU8      INAQSDPSF-----------WGTQLKLLEN----PALARQVVLTLDLQ--------H---
A0A2V8MHG6      NNPSQDPTY-----------FNTQIQILTS----AGLLGRVAKTLDLE--------H---
A0A2V8P7N1      NNSSQDPTY-----------FNTQIQILTS----AGLLGRVARTLDLE--------H---
A0A2V8M3M6      NNPSQDPTY-----------FNTQIQILTS----AGLLGRVARTLDLE--------H---
A0A1Q7NJH5      NYPSQDPTY-----------FNTQIQILTS----AGLLGRVAKTLDLE--------H---
A0A2V8PJY0      NNPSQDPTY-----------FNTQIQILTS----AGLLGRVAKTLDLE--------H---
A0A1Q7Y6W9      NYRISDPAY-----------FNTQLQILNS----PGLLRRVVKTLDLE--------H---
A0A2V8NC68      NTPYQDPTY-----------FNTQLQILSS----AGLLSRVVKTLDLE--------H---
A0A399WK13      NA---DPSY-----------FNTQLQLLWS----ESLLRRVVKEHNLD--------A---
A0A352FLX4      NSETNDPAY-----------FNTQLQILTG----PGLLRSVAKTLDLE--------H---
A0A2V8RTL7      NP---DPSY-----------FNTQLQLLNS----DTLLRRVVKEHNLD--------A---
A0A3E0PCJ6      TS---DPAY-----------FNTQLQLLNS----EVLLRRVVKELNLD--------T---
A0A3M1S4R8      NP---DPAY-----------FNTQLQLLTS----DSLLRRVVKEMNLE--------T---
A0A7C2G442      NP---DPAY-----------FNTQLQLLTS----DSLLRRVVKEMNLE--------T---
A0A1Q7YFI6      EQQYQDPTY-----------FNTQIQILSS----PGLLSRVVKTLDLE--------H---
A0A136KC10      NA---DPSY-----------FNTQLQLLWS----ESLLRRVVKEHNLD--------A---
A0A3M2D6Y5      NP---DPAY-----------FNTQLQLLTS----DSLLRRVIKEMNLD--------T---
A0A2V8SEX6      NP---DPSY-----------FNTQLQLLDS----ENLLRQVVKEHSLD--------T---
A0A7C5ZUU4      NP---DPSY-----------FNTQLQLLGS----DALLRRVIKEHNLD--------T---
A0A0B6WWQ6      NRS-SDPTY-----------FSTQLQILTG----SQLLRRVVRTLDLE--------H---
A0A3B9MK99      GPT-NDPVY-----------FNTQLQILGS----PGLMRRVVKTLDLE--------H---
A0A352EX26      GSM-NDPVY-----------FNTQLQILGS----QALARRVVKTLDLE--------H---
A0A2V8MM59      SPV-NDPAY-----------FNTQLQILTS----QGLLRRVVKTLDLE--------H---
A0A2V8PFE8      SPV-NDPAY-----------FNTQLQILTS----PGLLRRVVKTLDLE--------H---
A0A2V8PWS6      SPV-NDPAY-----------FNTQLQILTS----PGLLRRVVKTLELE--------H---
A0A2V8LCT5      SPV-NDPAY-----------FNTQLQILTS----QGLLRRVVKTLDLE--------H---
A0A352FTJ9      NPI-NDPAY-----------FNTQLQILTS----PGLLRRVVKTLDLE--------H---
A0A257VBK0      FNPTGASSWMEEQKF-----YNSQQQIMTS----SVVMQDVVDKLKLQ--------S---
A0A2G6PYV5      ------QWNPYREEY-----FKTEFRIIKS----LPVAEEVARTLGVK------------
A0A2V8F956      ------DEDQTRADY-----YQTQYNLLQS----RALALRTIDQLKLW--------E---
A0A1F2S1W5      ------EQNEVTDDY-----YETQYRLLQG----RGLARRTIDALNLW--------S---
A0A1F2T595      ------EQSDGADDY-----YETQYRILQG----RGLARRTIDALDLW--------R---
A0A2V8JQV5      SAPSVISTAFEE--------IQTQIKILKS----DSLIGQAMKRFGLT--------HSAD
A0A2V9AC41      DSI---DSGDYNNEF-----YKTQYEILRS----PALAERVIREEGLQ--------N---
A0A2V9MAM9      TAT---APTHSEDSY-----IETQAEILRQ----DSLIGRAFNRLPAE--------R---
A0A348V070      LSGGIN--------------SQSHAMLLKS----RSLAADVIEKMKLH--------S---
A0A2V9M454      -------TEQADDSF-----LASQISILQS----DNLAWETIQQLGLA--------R---
A0A2V9IVR7      -------AMPADDMF-----LQTQVNVLQS----DNLAWQTIEQLRLG--------E---
A0A2V9ILE2      -------AMPADDMF-----LQTQVNVLQS----DNLAWQTIEQLRLG--------E---
A0A2V9LGY4      -------AMPADDMF-----LQTQVNVLQS----DNLAWQTIEQLRLG--------E---
A0A2V9J4D6      N-----ESTPADETF-----LLTQTQVLRS----DNLAWETIQQLKLA--------D---
A0A2V9L9C5      N-----ESTPADETF-----LLTQTQVLRS----DNLAWETIQQLKLA--------D---
A0A2N9M9N1      -------SGATDAAF-----LQTQVDLLQN----NNLSWQTMQELGLA--------NGNT
A0A2V9JEC4      -------HAPVDSTF-----LQTQVDLLQN----DSLMWQTIHRLDLE--------S---
A0A2V9LPQ3      -------SMPADEAF-----LKTQALVIGS----DHLAWETIGQLGLA--------E---
A0A2Z5G3A3      ------GGAADEDALDENITLQTQTNILQS----DSLALRVIEDLHLD--------K---
A0A2V7UGP8      VG----YDYMSYNDF-----YQTQYRLLAS----HNVARKAMLKLDLR--------N---
A0A239MKT6      SLSGGMELNTD---------MLTHQRILQN----DNTALSVISSLNLM--------Q---
A0A3E0PCN7      SVI---LNSGSDPAY-----FATQLQILEG----PGLLRRVVRTLGLE--------K---
A0A2V8IYW3      ------YIRSTVTNR-----IEDRLRSIRE----QVLSRSMLEPIILEFDLYPEQRK---
G2LEI9          F-----VPYSVDPDY-----LNTQIRKISS----PSLLVEVVKTLKLD--------R---
A0A317J121      -VTLFKNSGVSGNDEVSQVNIQTQIQLLRS----SSFLRRVMERLQLE--------T---
A0A2V7YW66      ------GQNPWLENYWNMEFYPTQYELLQS----RGLAERVVKSLDLM--------E---
A0A2V7Z0V0      ------TQNPWLENYWNMEFYPTQYELLQS----RGLAERVVKSLDLM--------E---
A0A2V8GFD4      ------DQNKTTLDY-----YQTQYRILQS----RAIARRSIADPFLA--------T---
A0A2V8HSS5      ------DQNKTTLDY-----YQTQYRILQS----RAIARRSIADPFLA--------T---
A0A2V8KP55      A---------DSDTYVDYM-LQSYFRILKS----RSLARRVVTELHEE--------L---
A0A399WNU1      SII---LNPGSDPTY-----FATQLQIIEG----PGLIRRVVKNLDLE--------H---
A0A2V9JSI3      ------RGTPSDEAF-----LRTQVKVLES----DSLAWQTIQQLGID--------Q---
A0A2V9WI32      G-----TIGADYEDYNIA--LETQIRILQS----DALAFQVIKNLKLD--------N---
A0A2V8IVN9      ------NEEQTKADY-----YQTQYNILQS----RSLARRTLETLKLW--------E---
A0A7C5Z4J3      ------RTVSTDPTF-----LQTQVDVLKS----GNLAWQTIQQLKLD--------L---
A0A1F2TPT3      QRRP----------------LDTELAILRS----RWLAAKTVASLGLI--------Q---
A0A2V8JTQ2      SLLDDPEDRTA---------IDTQIRILQT----DALAMQVIKNLQLD--------K---
A0A2V8UZY0      SLLEDPEDRAA---------IDTQIGILQT----DALAMQVIKDLHLN--------K---
A0A350UEK1      VTEGSGPAGNMVD-------LQTQIKILQS----DTLVDRVTAQLSNG------------
A0A350UIQ4      VTEGAGPSGSTID-------IQTQIKILQS----DTLLERVHSLMNPG--------E---
A0A1H5Z7N3      ------SGIESSSAH-----LPTQVSILKS----DTLLLTVARDLDLA--------N---
A0A1G7JVV8      ------GSLQSED-------LETEVLIISS----ESLMLSVAQEMNLA--------N---
A0A1H4T6W9      ------GSSLSQETN-----LENELGIIMS----DSLLLNVARNMNLV--------N---
I3ZEU5          ------GSVGSQETN-----LENELGIITS----DSLLLNVARNMNLI--------N---
A0A1I6MH75      --------GQDTQTK-----MNTEIAIMQS----DTLLLTVARELNLP--------N---
E8WVF6          --------GDDPQQK-----MMSEIAIITS----DTLLTTVAKEMNLA--------N---
A0A7D0PQC3      ------GGDEDSQTK-----LQSEVSILQS----DSLMASLARELNLV--------N---
A0A428MDU2      -------ASDTAASK-----MLTEVAILQS----DSLMLTVAREMDLS--------N---
A0A5B9EBI2      -------GAPDTSNH-----LTTQSSILTS----ETLLLTVARELNLN--------N---
A0A239HDF6      --------GQDTMTQ-----MMTETAILQS----DTLLLTVAKDLDLC--------N---
A0A4Q0T270      ---------SDPQTK-----MMTEIAILQS----DTLMLTVAREMNLA--------N---
A0A1Q3QQB6      -------GGTDTASK-----MLTEIAILRS----DSLMLTVARDMNLA--------N---
A0A3N1K1G7      -------AGDAQSSR-----MLTEIAILQS----DSLMLTVARELNLS--------N---
A0A4V2G466      --------ASDSGQR-----MLTEVAILQS----DSLMLSVAREMDLA--------N---
A0A6B9YNQ8      --------STDSSQR-----LLTEVAILQS----DSLMLTVAREMDLA--------N---
A0A3N5YNR8      SA----ERYLSSEIY-----LQTQLEILQS----RALARRVVDRLNLA--------N---
A0A3N6A5T6      AA----DQGIAMETY-----LQTQFKILQG----RTLAERIVKQLQLH--------E---
A0A1F2Q9L4      I-----DDWFDAQSF-----YPTQYRLLQS----RGLAERVVKNLRLA--------D---
A0A2U3KC61      ------ENNLP--DFDYQATLETQAAILRS----DVLALKVIKAMHLD--------P---
A0A2V9Y2R7      ------DGGSPGEDWDYNVTLETQTAILRS----DALALKVIETMHLD--------K---
A0A2V9NGH6      ------ANAGP--DYYDPSDLDTEVGILKS----DLLAFQVIKQLNLD--------K---
A0A2V9PYE6      ------PSVGP--DYYDPSDLDTEVGILKS----DLLTFQVIKQLNLD--------K---
A0A2V9NL07      ------GNSGM--DYYDPTDLDTEVRILHS----DLLALQVIKQLNLD--------Q---
A0A2V9QD92      ------GNSGM--DYYDPTDLDTEVRILHS----DLLALQVIKQLNLD--------Q---
A0A2V9WPZ6      ------GSMSI--DYYDPADLDTEVKILQS----DLLALQVIKQLNLD--------K---
A0A2V9ZLH4      ------ASAS---DYYDPADLDTEVKILKS----DLLALQVIKQLNLD--------R---
A0A2V9RQF1      ------ANAPI--EYYDPADLDTEVRILKS----DLLALQVIRQLNLD--------K---
A0A2V9YDK8      ------GSVSV--DYFDPADLDTEVKILQS----DLLALQVIKQLNLD--------K---
A0A2V9V8F7      ------GSMSI--DYYDPADLDTEVKILQS----DLLALQVIKQLNLD--------K---
A0A2V9XGR9      ------GSMSI--DYYDPADLDTEVKILQS----DLLALQVIKQLNLD--------K---
A0A2V9V3Q5      ------MPV-M--DYYDPTDLDTETRILQS----DILALQVIRQLNLD--------K---
A0A2V9NWS3      ------PSAAV--DYSDPTELDTEVRILKS----DLLALQVIRQLDLD--------K---
A0A2V9USA9      ------ATFSL--DYYDPTELDTEVKILQS----DLLALQVIKELNLD--------H---
A0A2V9XW18      ------ATFSL--DYFDPTELDTEVKILQS----DLLAMQVIRELNLD--------R---
A0A1H5SQF5      QLIGGDQLSVD---------LLTQQAVIGN----ENIAMKVLEDLGLT--------N---
A0A2V9AEW6      N-----GNYVSQESY-----VETQVKLLQS----ESLIEHVIDKMKLH--------K---
A0A2V8WQK6      N-----GSYASPESY-----VETQVKILQS----ESVIEHVIDKLKLQ--------K---
A0A2V8XIF4      T-----ASIASPESY-----VETQVRRLQS----ESLLERVIDKLKLR--------K---
A0A2V2R0I6      Y-----DFYSDSESY-----IETQSKILTS----ETLALQTIRNSGLS--------A---
A0A2V8XAR9      Y-----DYMMDLENY-----IETQSKILTS----ETLALQTIRNTGLS--------A---
A0A2V8VZA0      Y-----DYMMDLENY-----IETQSKILTS----ETLALQTIRNNALS--------T---
A0A1Q7CB82      Y-----DYMMDLENY-----IETQSKILTS----ETLALQTIRNNALS--------T---
A0A2V8WIU1      Y-----DYMMDLENY-----IETQSKILTS----ETLALQTIRNNALS--------T---
A0A1Q6Y9F5      Y-----EYMMDLENY-----IETQSKILTS----ETLALLTIRNNALS--------T---
A0A2V9EVV8      Y-----EYMMDLENY-----IETQSKILTS----ETLALLTIRNNALS--------T---
A0A2V8YF91      Y-----DYTVDFDNY-----IETQAKILTS----ETLALQTIRNGGLS--------D---
A0A2V8XZK2      Y-----DYMVDSENY-----IETQAKILTS----ETLVLQTIRDSGLT--------A---
A0A2V8ZTX6      F-----DYMVDSENY-----IETQAKILTS----ETLALQTIRNNGLA--------L---
A0A2V9BT79      Y-----DYMMDSDNY-----IETQSKILTS----ETLALQTIRNNGLA--------L---
A0A2V9YHT3      ---------IDADDWDYTVAMETQVRIMQS----DSLALKVAHDLG--------------
A0A7C2XNI7      Y-----EMYWDVENY-----IETQAKILQS----ETLALQTIESLQLY--------K---
A0A1Q8B793      Y-----AYLLDQENY-----IETQSKILTS----ETLALQTIRSVGLA--------G---
A0A2V9BCA0      Y-----AYLLDQENY-----IETQSKILTS----ETLALQTIRSVGLA--------G---
A0A2V9BWU9      Y-----EMYMDMENY-----IETQSKILQS----ETLALQTIQSAGLV--------E---
A0A2V9DKX2      Y-----EMYMDMENY-----IETQSKILQS----ETLALQTIQSAGLV--------E---
A0A7C2YQY3      RLP-------TDEEF-----LQTQVRILQS----DDLAMQTIRALRLY--------D---
A0A3E0NV31      RGG--------DQSN-----IETQITLLRS----GNLLAKVVERLELT--------T---
A0A3N5M5V0      GPE----RYLSSEVY-----LQTQLEILQS----RALARRVVDRLNLA--------N---
A0A3N5XQP8      QVA---MDPRSMESD-----LRTQYSILQS----RTMARGVIKRLNLT--------N---
A0A2Z5G7H4      GAEDA-SDALDANIT-----LQTQADLLES----DTLALQVIEALELE--------T---
A0A2V9L5B5      E-----APTVDVDSY-----RETQYKILRS----RTLAEKVVNDLHLY--------Q---
A0A2V9LK56      V-----ASA-DVESY-----RETQYRVLES----RSLAESVVKDLELY--------R---
A0A2V9L7I0      A-----APTVDVDSY-----RETQYKVLQS----RTLAEKVVNDLRLY--------L---
A0A522PPT0      A-----GPSWDLQSY-----RETQYQILKS----RSLAERVVRDLRLY--------R---
A0A7C5V1G5      A-----GASWDIQSY-----RETQYRILRS----RSLAERVVRDLRLY--------Q---
A0A2V9KCS3      TPG---TNDMYVQTD-----ILTQIKILQS----DSLMERVVTKLKLD--------K---
A0A372IT17      DTSHEASDALENSMS-----IETQAGILES----DTLALHVIRALDLE--------S---
A0A4R1LC91      GAG---GDALDANIT-----METEANILQS----DTLALKVIKELHLE--------S---
A0A3M2BZG9      LEE---W---WNLEY-----YPTQYRLLRS----RGMAERVIQNLHLL--------Q---
A0A1Q7N5R7      LVA---S---AWTDL-----LKS-YVVLDA----VARERRLYLQARPR--------D---
A0A2V9QB26      VSE---GNSSTALTE-----IATQVRLLQS----ESLIKRVLTKLK--------------
A0A2V9VYY4      DYE---Y-----EAT-----LETQVAILRS----DALALKVIEGMRLY--------Q---
A0A3E0PHB0      NFG---Y---D-QNY-----YNTQLQLMRS----EDVMRDVVVKMKLY--------E---
A0A3M1SIV3      NFG---Y---D-LNY-----YNTQEKLLES----PELMKEVVVKLGLY--------R---
A0A3M2D491      NFG---Y---D-MNY-----YNTQEKLLES----PELIKEAVIKLGLY--------R---
A0A353C9L6      NFG---Q---D-ANY-----YQTQLMLLRN----RDLVKQVVIDLGLY--------R---
A0A2V8RQV0      NFG---N---D-ANY-----YNTQLELLKN----PELMKKVVISLGLY--------R---
A0A2V8SJH5      NFG---N---D-ANY-----YNTQLELLQS----HDLMKEVVIRLGLY--------K---
A0A357F267      NFG---N---D-ANY-----YATQLQLLQN----ADLMRRVVVDLGLY--------R---
A0A7C5ZUA8      NFG---Q---D-INY-----YNTQLQLLRS----PELMKDVVISMGLY--------R---
A0A136JPP4      NFG---L---DETTY-----YNTQLQLLQN----PDLMKKAVVALGLQ--------R---
A0A399WUJ8      NLG---G---DETTY-----YNTQLQLLQN----PDLMKKVVLALGLQ--------R---
A0A2V9KIE8      ISN---Q---DVDSY-----RETQFRVLES----RTLAERVVRDLALY--------R---
A0A352F549      ENG---Y---MEPEY-----FNTQVQILTS----PTLLRRVAKNLDLE--------H---
A0A3B9MLP9      DNT---Y---MDPEY-----FNTQVQIISS----PTLLRRVAKTLDLE--------H---
A0A3D5SQ87      DNT---Y---MDPEY-----FNTQVQIISS----PTLLRRVAKTLDLE--------H---
A0A2V8NW86      VSE---GDSSTVLTE-----IATQVRLLQS----ESLIKRVLTKLRDR--------F---
A0A7C2GJ20      DLS---S---NDAQY-----LETQQNVLRS----RELARRVIEALHLE--------R---
A0A7C4BTL5      VYE---SGIYATLAD-----IQTQIKILQS----STLLERVVEKLKLK--------A---
A0A2V8ZHL8      RQV---P---TDEAF-----IGTQIQVLES----DNLAQRTIEQLGLA--------R---
A0A2V9B240      RQV---P---TDDAF-----IGTQIQVLES----DNLAQRTIEQLGLA--------R---
A0A2V9CBM2      QLE---T---VSDDY-----LRTQYDILAS----DSLARRVIDQLRLD--------T---
A0A2V8XN17      ELD---A---VSDAY-----LRTQYSILAS----ESLARQVIDQLQLE--------A---
A0A2V8WX45      ELE---A---VSDAY-----LRTQYNILAS----ESLSRRVIEQLRLD--------T---
A0A1Q6YR79      ELD---A---VSDAY-----LRTQYSILAS----ESLARRVIDQLQLE--------T---
A0A1Q7VA32      ELD---A---VSDAY-----LRTQYSILAS----ESLARRVIDQLQLE--------T---
A0A2V9EY85      ELD---A---VSDAY-----LRTQYSILAS----ESLARRVIDQLQLE--------T---
A0A2V9H8K0      ELD---A---VSDAY-----LRTQYSILAS----DSLARHAIGQLGLE--------T---
A0A2V9FFE5      ELD---A---VSDAY-----LRTQYSILAS----ESLARRAIDQLRLE--------T---
A0A2V9GM43      ELD---A---VSDAY-----LRTQYSILAS----ESLARRAIDQLHLE--------T---
A0A2V9CYQ5      QLE---T---VSDDY-----LRTQYDILAS----DSLARRVIDQLRLD--------T---
A0A2V9BWU8      ELE---S---VSDSY-----LKTQYTILAS----DSIARRVIDQLHLD--------S---
A0A2V8ZG48      ELE---S---VSDSY-----LKTQYSILAS----ESVARQVIDQLHLD--------T---
A0A2V8Y334      ELE---S---VSDSY-----LKTQYSILAS----ESVVRRVIDQLHID--------A---
A0A2V9AY68      ELE---S---VSDSY-----LKTQYSILAS----ESVARRVIDQLHLD--------S---
A0A1F2RFI7      DID---P---FDESY-----LETAYKVLQS----RTLARRVIDKLQLD--------K---
A0A1F2RZS3      EMN---P---YDDSY-----LETAYKVLQS----RSLAYRVINKLNLA--------H---
A0A1F2USE2      ELD---A---VSDTY-----LETQYKILGS----ESLARRVINQLRLD--------Q---
A0A7C2VB08      ELE---T---VSDAY-----LETQYKVLRS----DALARRVIQQLRLD--------R---
A0A2V9C238      ALD---T---VSDTY-----LETQFKILQS----DTLARRVIEGLRLD--------K---
A0A1F2Q9F5      QIE---S---ASDTY-----LETQYRILES----ESLARRVVDQLRLD--------Q---
A0A1F2QQH9      QIE---S---ASDTY-----LETQYRILES----ESLARRVVDQLRLD--------Q---
A0A1F2QXK7      QIE---S---ASDTY-----LETQYRILES----ESLARRVVDQLRLD--------Q---
A0A2V9DEM9      ALD---T---VSDTY-----LETQFKILQS----DTLARRVIEGLRLD--------M---
A0A7C5TWV7      SQIYGGPSWWELQQY-----TKDQMLVLQT----HRLAERVAEKLGLN--------A---
A0A2V7XDY0      VQEALGGGYWQNADF-----YNTQFRVLRS----SALGEKVLDRLKL-------------
A0A2V8G155      TKAE--------Y-------YQTQYNIIQS----RAIARRALDELKLW--------N---
A0A2V8HDM7      TKAE--------Y-------YQTQYNIIQS----RAIGRRALDELKLW--------N---
A0A2V8DRT9      ATND--------Y-------YQTQYRILQS----RSLARRTLDRMGAW------------
A0A2V7VYF3      SPYD--------YEF-----TETQQKLLTS----RSLARKTLDALRMW--------Q---
A0A1F2SVH2      VTDD--------Y-------YQTQYKILQS----RALARRTLDALKLW--------D---
A0A2V8AJG9      IADD--------Y-------YQTQYKILQS----RALARRTIDGLKLW--------E---
A0A2N9LQU7      ADSDSE-----GG-R-----LQTELTILQC----PPVSMQVIKNLDLG--------H---
A0A2P6WFK7      GGSDDI-----NS-V-----LQTEVKVIQS----DTVAMRVIDSLELA--------K---
A0A2V8U914      PNASSN-----DV-Y-----VKTQSEILQQ----DALIEQASDKLNLA--------E---
A0A2V7W309      E-----------F-------LQTQYELLKS----RGLAMRVIEDHKLL--------N---
A0A2W0BGU4      QD----------F-------LRTQIQVLQS----DNLAWRTIEELRLA--------D---
A0A2W0BVQ9      QD----------F-------LRTQVQVLQS----DNLAWRTIEQLGLA--------D---
A0A2V9MN96      SEDWDY-----NV-S-----LETQLSILRS----DALALKVVEALHLD--------S---
A0A2V7V2Z1      ARDD--------Y-------YQTQYKLLQS----RALVRRVIESMSLL--------Q---
A0A2V7X2F7      AKDD--------Y-------YQTQYRLLQS----RSLARRVVESLNLL--------Q---
A0A2V7V2I1      ERDD--------Y-------YQTQYKLLQS----RALVRKVIEEMDLF--------Q---
A0A2V7U3M2      ARDD--------Y-------YQTQYKLLQS----RLLARRVIETMNLL--------Q---
A0A2V7UHT0      ARDD--------Y-------YQTQYKLLQS----RALARRVIESMNLL--------Q---
A0A2Z5FVL3      DTDPNS-----ASMN-----LETQATVLES----PALAMKVIEDLHLE--------D---
A0A2V9KBD6      EDPEDR-----AA-------IDTQISILQT----DALALKVIQDLRLD--------Q---
A0A2W0AJ66      EDADER-----AA-------INTQIGILES----DGLASQVIHDLHLE------------
A0A1Q7RBU1      EDPEDR-----AA-------IDTQIGILQT----DALAMQVINDLHLD--------K---
A0A2V9JPV9      EDPEDR-----AA-------IDTQIGILET----DTLAMQVINDLHLD--------T---
A0A3P0X3W6      DVEE--------F-------LTTEIDLLQS----DAVLRPVAKAYHL-------------
A0A2N9MK30      DADQ--------F-------LATQIKLIQS----DAVLRPVADQYHLR--------D---
A0A3D1ASD2      DADE--------Y-------LATQINLIKA----DSVVRPVVQKLRLR--------E---
A0A7C5AXI3      DADQ--------F-------LATQVKLIQS----DSVLRPVVEKFGLR--------D---
A0A7C6E4H7      DADQ--------F-------LATQVKLIQS----DSVLRPVVERYKLR--------V---
A0A1F2TCR2      LNANDPMFWQDSTQY-----YNTQYSILKS----RVLGQRVVRRLHLQ--------D---
A0A350UQT3      ALDAES--------F-----LASQIRLLQS----DSVVRPVAQRFRL-------------
A0A7C3HRX0      TPESEQ--------F-----LASQIRLIQS----DSVVRPVAERFNL-------------
A0A1F2V330      ------------VAR-----VQDQLLTIREVLFSRPVLEPVMRNFHLL--------P---
A0A662EE63      ------VSYWQLDRY-----ISDQVQVLET----DRLAKRVVDQLGLA--------S---
A0A2V8TLH7      QLGTSNFGWSAEERY-----FNTQNEIIKS----RDVAQRVFDKLDLY--------H---
A0A1Q7ZJT1      ETGMAQYGWYAEERY-----FNTQYEIIKS----RDVARRVFDRLDLY--------N---
A0A2V8VC99      EMGASQYGWFAEERY-----FNTQYEIIKS----RDVARRVFDRLDLY--------N---
A0A348UZU3      F----------RDDY-----FQTQYKLLQS----RSLAERTIERLKLW--------E---
Q01XL7          TDMTTA-----SASN-----IQTQTRILTS----RSMLARVAERMSLE--------M---
A0A2V8ERZ5      LQNDANQYYEDPEPY-----YQTQYKILKG----RDLTRRVVRKLRLD--------T---
A0A2V8GTX0      FKQPELVY-SDPEPY-----YQTQYKILQG----RDLALRAVKRVKLE--------D---
A0A2V8J0X9      LNASDPAFWQESGPY-----YQTQYSILQS----RGLGRRVVRKLDLQ--------N---
A0A523DUV7      PYPTSAFNYFDYRNY-----YNTQYRIIRS----KSLGERSIEKLDLA--------D---
A0A372IRG7      SGGEES------DQK-----LQTELRIMQS----DSVVMDVINSLDLY--------H---
A0A1F2U158      IAAAD--YYQDPIPY-----YNTQYRILRG----RDLARRVVKRIDLQ--------N---
A0A2V8F6S9      ITTPDNTYYEDPEPY-----YKTQYRIIKG----RELTRRVVKKLNLQ--------D---
A0A7D8BEX2      SSSLDD--------K-----LNTEVLVLTS----DSLLLHVAKDLDLA--------N---
A0A4Q1SCH5      -------LLGANSDE-----VPTEIGILGS----AQVALSALEMLTPE--------Q---
A0A2V8K4L4      PSGYLD-----PSYE-----ILTQVKVFQS----RSLLQQTTERLLKE--------K---
A0A2V8NCZ3      TGGW--------GYE-----IMTQVRVLQS----RSLMEKVTERLLND--------K---
A0A4Q7YNP3      GNGSSA------ETN-----VQTQIKLLQS----DTLLQRTKARLAAE--------P---
E8UZE1          A----------TEQK-----MATQLSILES----QSIAWKVIEELKLD--------A---
A0A2U3JZ71      D----------SDQF-----LATQAKLIQS----DSVLRPVAQQYRLL--------D---
A0A2V8TTB0      D----------ADQF-----LATQMKLIQS----DSVLRPVVDKFRLR--------E---
A0A1V6HR88      AWENYY-----SMEF-----YPTQYRLLQS----RGLAERTVQNLRLD--------Q---
A0A3E0P0A3      ------AQPWWNPEF-----FPTQEQLLKG----RGLAEAVTRDLALW--------N---
A0A2V8EXP2      NQVADD--------Y-----YQTQYKILQG----RALARRTLDALRLW--------D---
A0A2W4RYA1      EQAQPD--------Y-----YTTQINLLRS----RLLARRTIEALDAW--------N---
G8P0Y7          SSALED-----PQAG-----INTQVKILQS----DTMAELVIHRMNLD--------T---
A0A5M8T4U7      ERSSAD------TSA-----IQTELLILQS----DSVLLQTAEKLDIY--------G---
A0A7D0PPG7      D----------AEQV-----FNTELQLIQS----DAVLRPVAERFHL-------------
A0A7D8BF18      SSGTGS----DNTFP-----IPTQVALLKS----DTLLLNVARDLNLA--------N---
A0A1E3Y9R6      NTVLEERESWYQDDF-----YPTQYRVLQS----RTLAQRTARVLARE--------P---
A0A2W4TLP2      NTVLEDRDSWYQDDF-----YPTQYRILQS----RTLASRTAAAIEGG--------L---
A0A7C4BZ42      GYSYDP------SYD-----ITTQIKLMES----GAVKKRAMDRLLKQ--------G---
A0A3R9WF43      PSDSAD----DLKAE-----VQTDTSILQS----DGLVLRVIKDLDLA--------K---
A0A317HKM4      ------DQRDWMSTF-----LPTQVGILMS----ADLARTAHDEL---------------
A0A2V9CG11      ADDYTT-----GASY-----FETQVKLLQS----ESLLERVIEKLNL-------------
A0A523E0N1      SRTYAD--------I-----YGTQEKIVNS----RQLAEHVVEDLELW--------E---
A0A523ECP2      YWSGYD-------EF-----YPTQQRVLMS----RNLSRRIVKHLRLW--------E---
A0A2W0C122      ALGDAD----DYSVS-----LETQIRVLAS----RSLAEVVVRKLDLA--------H---
A0A2W0AUU7      PLGDAD----DYSVS-----LETQIHVIAS----RSLALAVVRKLDLT--------H---
A0A2W0BQL1      PLGDAD----DYSVS-----LETQIHVIAS----RSLALAVVRKLDLT--------H---
A0A4Q1SDL1      AAAGGGDDALAANIN-----LETQSQILQS----DTLALRVIEDLNLE--------K---
A0A3P0XH15      EQGGIE----ADLTR-----TATEIAIMQS----DTVSLDVINSLDLY--------H---
A0A4R1LAZ7      KLTGGE----GSSDR-----MQTEIRIMQS----DSVSMAVINSQDLY--------H---
A0A3M1WQW8      N----------DTQY-----LRTQINVLQS----RTLARRVIEELSLD--------R---
A0A3N1JHC1      YANGVT-----QDSY-----LETQIMLLKN----EVVADRVAMVM---------------
C1F294          SSGGLQ-----SQDR-----VETQLHIMQS----NTIAWNVIKTLKLY--------N---
A0A2V9KA79      ----------GDAIH-----IQDQLRIIKEHLYKPALLERIIREFGLY------------
A0A522PSP1      DS---------MDVL-----FATATKEIIT----PAVVTPAILKLGLW------------
G8P085          QADSAE--------L-----IATEMAIIKS----DAVAIDTMHSLSDE--------E---
A0A7C6A629      QSAIND-----ADQF-----LATQVKLIQS----DSVLRPVVERFKL-------------
A0A4Q1SGQ1      EPSQAEGDSLDYSMT-----LETESKILES----PTLALRVMHDLELE--------T---
Q1ILD9          LSSGMD-----WNSQ-----LATQIKILQS----DALAWDVVKRLRLD--------Q---
A0A7C5SHM3      VWNEFE-----IQRF-----YQTQYLLIKD----AKVLMRALHREDYP------------
Q1IJZ6          VGGGSG----DTKTE-----VQTQVAILQS----DDLAIETIERTGFE--------K---
A0A2V8TCE6      DPSYQG-----YSAF-----YETQYRILQS----RAVARRAAERLDLP--------R---
A0A522TBE8      RASTAD-----SDAL-----VLTDQTVMTS----PAVLLQVVEQLHLQ--------D---
Q1ITG0          GAGGLD-----WSSK-----LETQARILKS----DTLAWDVISQLRLD--------Q---
A0A7C2ML20      DQGSYE------GTI-----IKTHLDILQS----RALAERVIERLSRS--------G---
A0A7C5AXS9      EAPAGS-----PELD-----IRTQVRILQS----EALVERVLSKVGNE--------Q---
A0A7C2RGE3      DLSSND------AQY-----LETQQNVLRS----RELARRVIEALGLE--------K---
A0A3N5PCI5      QAN--------ERGY-----LETQHRLLRS----RSLARRVIDALNLW--------D---
A0A3M1Q0S9      EPSWLD-----YQNW-----YNTQYQIMQS----DEVLRRAVDLLDLM--------N---
A0A2Z5G448      KAGGND-----ESTR-----LLTEARILQS----DSVIFAVIESENLF--------A---
A0A3M1VZ38      EPSWLD-----YQNW-----YNTQYRIISS----DAVLRYAVKQLDLE--------N---
A0A4Q1SD29      QLGGGG----NAEDK-----LQTEVEIMQS----ETVAMEVINSLDLY--------H---
A0A6N9FGE2      ERGFFG-----MDA------QTTQRDMLRS----RSLARAAIDRLDLW--------D---
A0A3M1PY35      PVGFFD-----TERF-----YQTQYLLMRD----PAVLERALDNDGL-------------
A0A3M1VMP2      VWNEYE-----IQRF-----YQTQYLLLRD----PAVLRDALDRYGV-------------
                                           .                                

A0A2V7VMF7      ----RPPFKDN-------------------------------------------------
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ----PPE--------------AIQARVT--------------------------------
Q01X01          ----RPEYQRSSSLWDRLRPGTSQAPVT--------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ----EKEFAAPQRGFLAAQAGNLKKISSVEKTEQASDDEGDQL-----------------
A0A2V9IXG5      ----NPRFQNQSS-----------------------------------------------
A0A2V9J2P4      ----NPRFQNQSS-----------------------------------------------
A0A1Q7RLS4      ----HPLFKKS-------------------------------------------------
A0A2V2R525      ----NKAFFRPQMGQ-RTTWQRLLDMVGMGRDSGDSSQPVDDGVLMTSSVAPATD----K
A0A321LPW6      ----RPEFLAAEDRR--GVWSAIKSIGGRSALREAGESPP-----EQASDAADTDKQ--P
A0A2V9R9V4      ----NPAFL-ASQKK--SVWESLHEIAGKIQRDDASAPPA-----VFTATAMKSKIEG-N
A0A321LE75      ----NPQFMEVTRKK--SLVEAVQTIGSKFKQEVTSELPV-----LEPGVQIEGGID---
A0A2V8R8U7      ----NPSFLGGQAQS--SVFASLKRIFSGERIATPPAQNPA--AEQTVTMDEMKD--R-Q
A0A2V8QMP4      ----SPAFFGTNRGT--GVIAGLRHIIARGKPTPTPQPAAG--GVPVLSDAELSA--D-Q
A0A2V8R4S3      ----SPAFFGTNRGT--GVIAGLRHIIARGKPTPTPQPAAG--GVPVLSDAELSA--D-Q
A0A2V8NJ55      ----NPTFFEGQASS--GFFASIRRIFFGDKPAPAHVD-----KVPVVVNPTIKN--E-Q
A0A2V8Q7I0      ----NPTFFGGQSQG--GIFASIKRMFAGDKAKPKISAPGPT-GLDVVRAAQLRD--Q-P
A0A2V8S6K4      ----NPSFLGGQSRP--SIFTTLRRAFSRNKAQTNEQPQPADGGLTVANEAAPGD--ELK
A0A317I2L9      ----NPNFFGGGSQG--GFFASLRRILSGDQRRTKAKPAEPT-KLELVGESQLRD--Q-P
A0A2V8LLF9      ----NSRFLSGQAQT--SIVASLKRIFSRENAPAS-SPSTNA-TVEPISEEDLRS--R-Q
A0A352FRF4      ----NPTFFGPQGQS--TIFASLKRIFSRDSVPKT-SPTPAA-GSVPLNEEALNN--Q-E
A0A2V8MKV0      ----NPNFLGGRANS--GLFNSLKYLFSRTKIAPAPAPAASS-GEQTITQDELIDKVN-N
A0A2V8PYY8      ----NPNFLGGRANG--GLFNSLKYLFSRTKNAPSPAPATGS-SETTMSEDELKNKIS-N
A0A1Q7YKQ8      ----NSAFLGNQSQH--GLFTALRRIFSSERTTNA-SPATRT-NLPVISPERVTE--Q-Q
A0A352F3R7      ----NPAFFGGQTQG--GVFSSLRRIFSKPKKATV-APAAPA-GLVVVGESEVTG--D-S
A0A0B6WXT1      ----NPAFLSGQAGP--SLTSSLRRILSRRKKEEN-E---QG-KLQVVTDSEVDA--E-N
A0A3B9MEU8      ----NPAFFGGQSQG--GVFASLRRIFAKPKKASE-SPAVSS-GLTVVGESEVTN--G-S
A0A2V8MHG6      ----NEGFLHPQSATRPSVWESLKGLVGLSKSQSKPREPE-G-----YVLRPSSAL-S-N
A0A2V8P7N1      ----NQAFLHPQSAQDLSFGESLKGLIGLRKSQSKTKEQE-G-----YVLRPNSAL-S-N
A0A2V8M3M6      ----NQAFLHPQSAQDLSFGESLKGLIGLRKSQSKTKEQE-G-----YVLRPNSAL-S-N
A0A1Q7NJH5      ----NQAFLHPQSAQNLSFWESLKGLIGFKKSQSKTKEQE-E-----YVLRPNSAL-S-N
A0A2V8PJY0      ----NQAFLHPQSAQNLSFWESLKGLIGFKKSQSKTKEQE-E-----YVLRPNSAL-S-N
A0A1Q7Y6W9      ----NQAFVHPQSQSNRSTWQSILQMIGLSRSSTQEQNQQ-ASQDIPLTTNVASAV-A-S
A0A2V8NC68      ----NQAFLNPQSFNKRSTWDSIKRMFGLSDKKEREQEQK-L-DDAPLVDRIAPAT-A-R
A0A399WK13      ----NKEFQAAAKASSGSMLGRLLRSVGLASGDKQKQEES-------VPIDPNSTLAS-A
A0A352FLX4      ----NPDFLRETSSKNKSTWLDIRGMLGLKAKTPPQSSTP----DVLPQSSSSSSSTA-A
A0A2V8RTL7      ----NKDFQAAKNAHGTSAWRSMMKAVGLASDKSSNSPDA----NTQKSEETNSSLVS-A
A0A3E0PCJ6      ----NEAFRKDSAEGSGSALRGMLTALGLASDDSKKEDVV----E-EVPLASNTELAT-V
A0A3M1S4R8      ----NKEFQEERNRQQASTWRAILRSIGLAREETKKTRDL----E-EV--LAGMNLAT-A
A0A7C2G442      ----NKEFQEERNRQQASTWRAILRSIGLAREETKKTKDL----E-EV--LAGMNLAT-A
A0A1Q7YFI6      ----NQAFLNPQAAQSRSTWENLKRMFGFGRPANNQQSV--PQNMMPLVDSSLAPATI-E
A0A136KC10      ----NPEFQALARTDSTSTFGRILRSVGLASGETQKSEQL-----A--AIDPNSTLAS-A
A0A3M2D6Y5      ----NKEFQEEKNQQRASAWRAFLRSIGLVREERRKEDTK-----ID-EITPGMNLAS-V
A0A2V8SEX6      ----NKEFLTARSEG-TGILRAMLRAVGLASDPKKDTAPN-----DEFAASANSSLIS-S
A0A7C5ZUU4      ----SKE-LQAEKNN-AGYWQTLMRTLGLAGDGTKKDDSK-----DN-ADQIDASLLA-N
A0A0B6WWQ6      ----NPEFLRPRAVRDLSPWLNLRRMLMLGTGQEKSAGQRGTRGQMPLPSEIAPATES-Q
A0A3B9MK99      ----NPDFFK-GTIQKRSTWQTIKRMAGFASADPPDVTAK-PKDELQLRPAVAAAT-S-Q
A0A352EX26      ----NPDFFK--GTQKRTTWQTVKMMAGFDNNVPKPDQSK-PNDVLQLRTTVAPTT-S-Q
A0A2V8MM59      ----NKGFLSPQSSQPHSTWQTIMQMSGFANPDPK-AGKQ-SKE-LPLTTSFAPAT-S-S
A0A2V8PFE8      ----NQAFLRPQSLRQPSTWKTILQMWGVSGPEKKDPSTQ-PKE-LPLTSTVAAAT-S-N
A0A2V8PWS6      ----DQAFLRPQTLRQRSTWKTILQMWGVSGPEKKDPSTQ-PKE-LPLTSTVAAMT-S-N
A0A2V8LCT5      ----NQAFLRPQTAQPHSTWKTILQMLGVGGREKKETKQQ-NNV-LPLTTSVAPAT-S-S
A0A352FTJ9      ----NQAFLRPTAAQPHSTWKTIVKMLGAGA-EKKDTVPA-PNV-LPLTSAMAPAV-S-S
A0A257VBK0      ----HEAFKDV-------------------------------------------------
A0A2G6PYV5      --------------------------YFREQEQEDAQPKNLLDLGTVNEPREKTQKTKED
A0A2V8F956      ----TPPFRNDKRFSLKRMMLGAPALVGQYAVSGISRTGDAASDFSGTGGSAARTTESAN
A0A1F2S1W5      ----HPQF--TQPARPTVRSVIMMPVNAVARWFEPPRPVEPPDAAETRVQ----------
A0A1F2T595      ----HPSL--NQPPRLTIRGILFWPVGKLASWFEPARPPQAADAAETRTQ----------
A0A2V8JQV5      PLTRLTRW---------------------------RIALGIAKTSAASAR----------
A0A2V9AC41      ----LPLFGGKADKADSQKGLVANLKDGLKERVKGFVPDKPKVNAPPPDPATAG------
A0A2V9MAM9      ----RGGL-----------------VLPGWSERLLPVFAPRSPGGNDD------------
A0A348V070      ----HPEF--------------------IAPKLPVKLQKEGVQPDNPVFK----------
A0A2V9M454      ----LPNS----------------------GQTSPADGRVLGTPPA--MK----------
A0A2V9IVR7      ----NPAF----------------------APPLKGASPQRGESAE--AE----------
A0A2V9ILE2      ----NPAF----------------------APPLKGASPQRGESAE--AE----------
A0A2V9LGY4      ----NPAF----------------------APPLKGASPQRGESAE--AE----------
A0A2V9J4D6      ----DPSF----------------------TKGPQKQRKESIDSAD--VR----------
A0A2V9L9C5      ----DPSF----------------------TKGPQKQRKESIDSAD--VR----------
A0A2N9M9N1      ELGVGGDL----------------------WPVSTSRSTVA-------TP----------
A0A2V9JEC4      ----RPEF----------------------NPRRTASSKSQLESLPP-LQ----------
A0A2V9LPQ3      ----NGAF----------------------IPQTPKDASGQRAPEPRMLR----------
A0A2Z5G3A3      ----TPDF----ESKFNPIDMVLGIFSPGGASDPPGASLQQSPGRM--------------
A0A2V7UGP8      ----DPVV----------NRLVNRVRHKGPFTRLAEIVRHSPLDEIPEDPD---------
A0A239MKT6      ----EPPY---------------NEIPKGKLHDVYERERSLPLKDAPYTR----------
A0A3E0PCN7      ----NPEFLQPNQGEQSTVWQNVLKMFGFYQTKSMTPVEFADKETEDALQLSLDSNEQPS
A0A2V8IYW3      ----QVPM----------------------------------------------------
G2LEI9          ----DPKFLATGPTTLSAALLDLIRSPRGPRKPPQSETKSAELPEASPTPATTEDEL---
A0A317J121      ----VPPP-----------------PVQNDIFSRLRRRLTTNTQDPMALM----------
A0A2V7YW66      ----DPAF-------------------NPGAAARKDGGRGPTAEDDDAVL----------
A0A2V7Z0V0      ----DPAF-------------------NPGAA--REGAKGGTAEADEAVL----------
A0A2V8GFD4      ----NAQLSGGGRQMFDLQSLFNSVVAYVNGKMTGEAYSKSTAVDETPLE----------
A0A2V8HSS5      ----NAQLSGGGRQMFDLQSLFNSVVAYVNGKMTGEAYSKSTAVDETPLE----------
A0A2V8KP55      ----EKEF----------AAPQRGFLAAQAGNLKKISSVEKTEQASDDEG----------
A0A399WNU1      ----NPTFFRPGKDQDTTVWQNVARMFGLYSQPVRNQAESAPPAKNTLDLKTDTDADLDS
A0A2V9JSI3      ----SAEF--------------------SPPRGGKPVSPAIVQ-----------------
A0A2V9WI32      ----NPAF----------------------------------------------------
A0A2V8IVN9      ----SGEF----------------VTNKRGIVQTLAGGVASLFGKKAPEPGIPDAGET--
A0A7C5Z4J3      ----EPSF--------------------------TSVLPGGGAGDEGLSP----------
A0A1F2TPT3      ----NEPVAGRGAGNGVGKRDGQAGKSGPDGWWSAASLFVSRAFGGFPPPPRAAEPLAGE
A0A2V8JTQ2      ----NPKF-----------------------------------TARGGRA----------
A0A2V8UZY0      ----NPKF-----------------------------------TGRVEQP----------
A0A350UEK1      ------TT-------------PAEPAA-PGRLAAWRQALNLPEEAATGAK----------
A0A350UIQ4      ----EVAA-------------PAEPASTPSRISAWRRALNLPDVPENDAR----------
A0A1H5Z7N3      ----NPWF------------------------LGTQKSKQAQPHRNIDDP----------
A0A1G7JVV8      ----NPDF------------------------MG------SGPYRNINDP----------
A0A1H4T6W9      ----NPDF------------------------MGGK----AARFRDINDP----------
I3ZEU5          ----NPDF------------------------MGIR----VGKVRDINDP----------
A0A1I6MH75      ----NSDF------------------------LEIK-G--KAPHASLDSP----------
E8WVF6          ----NPTF------------------------LSVK-G--PIPHSSMEDP----------
A0A7D0PQC3      ----NPDF------------------------LETR-D--PIQHKSMDDL----------
A0A428MDU2      ----NPEF------------------------LEVK-G--PVSHTTLDDA----------
A0A5B9EBI2      ----EPAF------------------------LGVR-P--PVPVTSLDTP----------
A0A239HDF6      ----NPAF------------------------LGRKTA--PEPRRDLNDP----------
A0A4Q0T270      ----NPEF------------------------LGVK-G--KVPHASLDDP----------
A0A1Q3QQB6      ----NPDF------------------------IGKD-A----PHGNIDDP----------
A0A3N1K1G7      ----NSEF------------------------LEVK-G--PLPHTNLDDA----------
A0A4V2G466      ----NPDF------------------------LGGN-A--PSTRASIDDP----------
A0A6B9YNQ8      ----NPDF------------------------LNGP-A--PKPRASLDDP----------
A0A3N5YNR8      ----DPRFSVPVREGVVTSQLSWLKRTVSNLRPGRSDAPKTGADESGAGR----------
A0A3N6A5T6      ----NPSF--------------NAETSGGLLTDSLAGLIGGTIALLKGRQPETPDSAENR
A0A1F2Q9L4      ----DPVF------------------NPGRSRLPGGSGGAVTASDDAATL----------
A0A2U3KC61      ----NPQ----------------------AED------------AMQPDP----------
A0A2V9Y2R7      ----DPRF-------------------VGSTA------------ASQPNP----------
A0A2V9NGH6      ----RPEF-------------------GGSGQ-AQSTSLELTTDILQPDS----------
A0A2V9PYE6      ----RPDF-------------------GGSGP-AQSTSLGLTTDILQPDS----------
A0A2V9NL07      ----MPEF-------------------GGHGA-PPASSLALTTDAFEADS----------
A0A2V9QD92      ----MPEF-------------------GGHGA-PPASSLALTTDAFEADS----------
A0A2V9WPZ6      ----RTEF-------------------GGKPD--SASSLNLAPDPLQTDS----------
A0A2V9ZLH4      ----RVEF-------------------GGKGDMPSPNALGITTDELQINS----------
A0A2V9RQF1      ----RPEF-------------------GGKGE-SSGNSLALTTDALQPDS----------
A0A2V9YDK8      ----RSEL-------------------GRKPD--DASSLNLAPDPLPTDS----------
A0A2V9V8F7      ----RTEF-------------------GGKPD--SASSLNLAPDPLQTDS----------
A0A2V9XGR9      ----RTEF-------------------GGKPD--SASSLNLAPDPLQTDS----------
A0A2V9V3Q5      ----RPEY-------------------GGQSA----PQPNLVADPLQNDS----------
A0A2V9NWS3      ----RAEF-------------------GGNGQVPSPNSVQLTTDSLQVDS----------
A0A2V9USA9      ----SGGP-------------------NGRAP----SSLELTPDPLQVDS----------
A0A2V9XW18      ----RPEI-------------------AGQAPPIPSPSLDLT-DPLQIDP----------
A0A1H5SQF5      ----SQPF-----------------LALRPANATASGQSLLETDP---------------
A0A2V9AEW6      ----EQPT--------------------TAWGIFASRVHRLFAFSRTGRL----------
A0A2V8WQK6      ----ERPR--------------------TGWRGLASRVQRIFAFSKASNL----------
A0A2V8XIF4      ----ERPA--------------------TGWRAFESRVQRFFDLSKTPHL----------
A0A2V2R0I6      ----RPEF-----------------STPTGPSEAVAIGTL----ANQKRP----------
A0A2V8XAR9      ----RPEF-----------------SSPNGPSEAMASGSL----ANQKRP----------
A0A2V8VZA0      ----RPEF-----------------SSPNGPSEAVASGSL----ANQKRP----------
A0A1Q7CB82      ----RPEF-----------------SSPNGPSEAVASGSL----ANQKRP----------
A0A2V8WIU1      ----RPEF-----------------SSPNGPSEAVASGSL----ANQKRP----------
A0A1Q6Y9F5      ----RPEF-----------------SSPNGPSEAVASGSL----ANQKRP----------
A0A2V9EVV8      ----RPEF-----------------SSPNGPSEAVASGSL----ANQKRP----------
A0A2V8YF91      ----RPEF-----------------SGPGGPSEAVASGSL----TNQIRP----------
A0A2V8XZK2      ----RPEF-----------------SVGGGPSEAVASGSL----ANRTRP----------
A0A2V8ZTX6      ----RPEF-----------------AASGGPSEAVASGNL----ANQTRP----------
A0A2V9BT79      ----RPEF-----------------AESGGISEAVANGNL----ANQTRP----------
A0A2V9YHT3      ---------------------------WDKAFAPANAGAIPL--DSKLTP----------
A0A7C2XNI7      ----HPEF-------------------AGDEAAAPAVTVPTTTGEPQPRP----------
A0A1Q8B793      ----HPDF-----------------SEGGKPSEAVTTGSL----ANQNRP----------
A0A2V9BCA0      ----HPDF-----------------SEGGKPSEAVTTGSL----ANQNRP----------
A0A2V9BWU9      ----LPEF-------------------GGQPGKASKPASVPVNAANQARP----------
A0A2V9DKX2      ----LPEF-------------------GGQPGKASKPASVPVNAANQARP----------
A0A7C2YQY3      ----KPEF------------------------------AVRPLGANGTAPFSP-------
A0A3E0NV31      ----RPEF-------------------------VRSVDRGFFLDAAEAGLDLIKNGFRPR
A0A3N5M5V0      ----DPRFEVPVREGLVTSQLGSVKKAMSGLFSKSDSGAAAANRESMPGM----------
A0A3N5XQP8      ----ERLL--------------------QLREKSGVISETLRQVMRAVRGVIDRLIDEGG
A0A2Z5G7H4      ----TRDY--------------------------QPRYDALGSIFRLLSPSGPADPLNAS
A0A2V9L5B5      ----SPEF-----------------YRNRGLFGLYESDPEKIPS-SDPGP----------
A0A2V9LK56      ----LPEF-----------------YRSRRLFGLFESDPARIPSPTED------------
A0A2V9L7I0      ----SPEF-----------------YRNQMFFGLFESDPEKIPSISQPGL----------
A0A522PPT0      ----YPEF-----------------YQSRSFLGLVAKDPEKIPSASDPNP----------
A0A7C5V1G5      ----YPEF-----------------YQSRSYFGLVTKDPKHIPSPSDPNP----------
A0A2V9KCS3      ----KPAA------------------------------------LEQPTKLSAWRKALGL
A0A372IT17      ----TQNF--FPAKKRGLTIPGWIFFWRSPLEPRSVPLEEAP------------------
A0A4R1LC91      ----SPDFKPMFNPIGW--------ALGLVSPKGPADPPNAPLE---DSP----------
A0A3M2BZG9      ----DPTF--------------------------TGRSADLLPGAADATT----------
A0A1Q7N5R7      ----MAVMATFAVADQY--------RPGRYHLKVDRTGQHFSLQDEDGTELERGDVGAAI
A0A2V9QB26      --------------------------------------DRFPEDPKVRTSRFSLWRKASL
A0A2V9VYY4      ----DPRF--------------------------TAVKQSSPESAMGEPS----------
A0A3E0PHB0      ----KDSL--YGGKSRGIFETLGAMFTGGPKNSEEA--GALPVVDSVD---GETVDQINL
A0A3M1SIV3      ----TPDL--IIRRNSGITALFKSIFESEKDKQEQI---VLPVINESDFQKSLDNLEAKL
A0A3M2D491      ----NPEL--FKGQGRGVIASIKSLFSGGSDEPSKT--QSLPVLSENN-DEGFSSEEIKL
A0A353C9L6      ----EPNL--FGASERGILASLRSIFTGSGQNAEVP--SALPVVSEPE-LLGEERPRTIL
A0A2V8RQV0      ----NKTL--FGGQNAGILAGIKSLFSRSKAQTEEA--NALPVISDTE-QLNSKGELAKL
A0A2V8SJH5      ----EADV--FGEEDRGLLSGVRSMFSSRKANSGPD--NSLPVVSELP-AGTDASDNIQL
A0A357F267      ----EPDL--FGDGDRGFFAAVTSIFSSTKEEEKEKEADSLPIVSDTA-ESPSPSSALEL
A0A7C5ZUA8      ----DPNL--FGSQDRGFLSAIKSLFSSEQQTSQTE--KSLPVVTDID-E--ST-SPSSL
A0A136JPP4      ----EPDL--FGSSNRGFFASIKSLFVSPKSPETPK--GALPVLTGTE-N--ADPAAVQL
A0A399WUJ8      ----DPDL--LGQSDRGFFATIKSLFSGPAKAQAPQ--GTLPVLTGTE-N--ADPTAAQL
A0A2V9KIE8      ----SPEF-----------------YRKSILFGLMETTPANVPSPTDNAP----------
A0A352F549      ----NRTFLDGRVENRSTWRSLLTMFGFSQKQAEAPKNQN-VLPDVNSSPAFASAGFNAD
A0A3B9MLP9      ----NRTFLDSHVDNRSTWQSLMRMFGLGSNPKNSAVAENGALPDRGNQP-LTTSGLSLE
A0A3D5SQ87      ----NRTFLDSHVDNRSTWQSLMRMFGLGSNPKNSAVAENGALPDRGNQP-LTTSGLSLE
A0A2V8NW86      ----AEDPKVKTSRFSL--------WRK-------------------AVL----------
A0A7C2GJ20      ----HPEF------------------------------------ADITTR----------
A0A7C4BTL5      ----PADLKMETGRISA--------WRRAL-----------------NLP----------
A0A2V8ZHL8      ----EPGW-------------------------------VLAAGSGNDGL----------
A0A2V9B240      ----DPAW-------------------------------ALAVGLGNDVP----------
A0A2V9CBM2      ----VSEF----NAPQL--------FS-WKWKKKAPTSQTFTVG---PIP----------
A0A2V8XN17      ----LPEF----NSPRW--------WQFWPSKKKSPPPQTFTIG---PVS----------
A0A2V8WX45      ----LPEF----NSPRW--------WQIWPKTKKPSTAQTFAIG---PVP----------
A0A1Q6YR79      ----LPEF----NSPKW--------WQFWPRNKKSPAPQTFAIG---PVP----------
A0A1Q7VA32      ----LPEF----NSPKW--------WQFWPRNKKSPAPQTFAIG---PVP----------
A0A2V9EY85      ----LPEF----NSAKW--------WQLWPRKKKSPAPQTLAIG---PVP----------
A0A2V9H8K0      ----LPEF----NSPRW--------WRFWQERRKPSTTQTLATG---PVP----------
A0A2V9FFE5      ----LREF----NSRKW--------WQLWPETRKPSTTQTFTVG---PLP----------
A0A2V9GM43      ----LREF----NTRKW--------WQLWPETRKPSTTQTFAVG---PVP----------
A0A2V9CYQ5      ----VSEF-----NAPP--------LLSWKWKKKAPRSQTFTVA---PIP----------
A0A2V9BWU8      ----LPEF-----NAPK--------WWSLKRFARAPQKQAFALG---PAP----------
A0A2V8ZG48      ----LPEF-----NRPK--------WWQFGKRLSLPRKQTFALD---PVR----------
A0A2V8Y334      ----LPEF-----NSPK--------WWQFRKKAFKPRNQTFALD---QES----------
A0A2V9AY68      ----LPEF-----NKPK--------WWQLQERFFTPHKQTLALD---PAG----------
A0A1F2RFI7      ----LPEY----DEKPS--------WFAKLLSKSRSESQQLPAE---DL-----------
A0A1F2RZS3      ----SPEFAKEQESSPS--------WLGTLWPGGAEQPEGPLSP---EE-----------
A0A1F2USE2      ----RAEF----NPPQP--------WWSWGGKETAAAAPTLVVG---TSE----------
A0A7C2VB08      ----VPEF----NPNAS----------SAGTVSAASVPDS--------------------
A0A2V9C238      ----LEEF----NPRAS--------QLGDAKPQNAAAAQSFTAG---DT-----------
A0A1F2Q9F5      ----LAEF----SRPGF--------RLRGGKRETPASPQTFAVG---AAG----------
A0A1F2QQH9      ----LAEF----SRPGF--------RLRGGKRETPASPQTFAVG---AAG----------
A0A1F2QXK7      ----LAEF----SRPGF--------RLRGGKRETPASPQTFAVG---AAG----------
A0A2V9DEM9      ----LEEF----NPRAS--------QLGDAKPQNAAAPQSFTAG---DT-----------
A0A7C5TWV7      ----NPAFG---------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------KDPAEH
A0A2V8G155      ----TPPFGGTAP--------------ADSPFSLR-RVIALVHTTNAGPPPPPPDETALQ
A0A2V8HDM7      ----TPPFGGTAP--------------ADSPFSLR-RVIALVHTTNAGPPPPPPDETALQ
A0A2V8DRT9      -------------DTFDSAKAPKKMSIRTAVASVV-APVFHLFVARKAIEPEQTGETTTQ
A0A2V7VYF3      ----HPYFGGPTPNTTSSSSTRGAIGFTNGILALV-RGAFQSKAETIGREKRAPAESAAE
A0A1F2SVH2      ----HPQFNPKPDDSLTMRK------IALAPVVLV-AGWFKPAQPL---EPPLPDESKVQ
A0A2V8AJG9      ----HPLLKPN-DDNLTVGK------IAAAPAAFV-SSWFRTAAPV---GMPGSDESKQQ
A0A2N9LQU7      ----REEFAGKTL-----------------MASVT-AI------------DPVKMDPLSR
A0A2P6WFK7      ----RPAFAGK-Y-----------------AASAK-LT------------NPSAMPPADR
A0A2V8U914      ----RPEFQPHSG-----------------FWERL-RE------------ASPRAAQNAA
A0A2V7W309      ----DRDFYGPGV-----------------EG------------------KTKAEIDQIT
A0A2W0BGU4      ----NRMFADE---------------------------------------SRVTESQAHK
A0A2W0BVQ9      ----NRMFADE---------------------------------------SRVIDAQAHK
A0A2V9MN96      ----NPRFTGFVP-----------------VANDA-SRSIGS--------ANLGPDSQQI
A0A2V7V2Z1      ----DPEFGGPRS-----------------AEEIE-AVK-----------AASPGASAVM
A0A2V7X2F7      ----DPEFGGPRS-----------------PEEVK-GAL-----------AAPPGSSPVM
A0A2V7V2I1      ----DPEFGGPQP-----------------AEQRA-ALK-----------ASAPGSSRVM
A0A2V7U3M2      ----DPEFGGPRS-----------------PEEME-AVK-----------AAAPGASPVM
A0A2V7UHT0      ----DAEYGGPRS-----------------PEEIE-AVK-----------AAAPGASQLM
A0A2Z5FVL3      ----TSAFKPHFT-----------------FTGWV-NSLFSPPPPADPAGVALSAAPLRR
A0A2V9KBD6      ----NPMF------------------------------------------IGGA-KAVNE
A0A2W0AJ66      ----NGKF------------------------------------------DGGKIEPGNE
A0A1Q7RBU1      ----NPKF------------------------------------------AGRAEQPVNE
A0A2V9JPV9      ----NPNF------------------------------------------ADRAAHSGNE
A0A3P0X3W6      --------------------------------------------------LPRDKKGKEF
A0A2N9MK30      ----LER-------------------------------------------KARAGSDQGL
A0A3D1ASD2      ----VDGNDLM---------------------------------------ENTSEARSAA
A0A7C5AXI3      ----RPGE------------------------------------------LAGAEPGKPY
A0A7C6E4H7      ----EDVD------------------------------------------KTKLPPAE--
A0A1F2TCR2      ----NPAFNGQAPPRRGPLIAVRNARASLGKAI---RRLITRPIQTPAVEPAAPDENAAE
A0A350UQT3      ---------------------------------------------LESEQQLAKEGDQAR
A0A7C3HRX0      ---------------------------------------------LEREKQLAVPADKAR
A0A1F2V330      ----MP-------------------------------------------------DGKIS
A0A662EE63      ----LPEFEG-------------------------------------------------R
A0A2V8TLH7      ----HPMF-------------------------------------------------RKS
A0A1Q7ZJT1      ----HPLF-------------------------------------------------KKS
A0A2V8VC99      ----HPLF-------------------------------------------------KET
A0A348UZU3      ----KKEFSG-----------------------------------GKNVTGEDLKNPVFR
Q01XL7          ----TP------------------------------IASTPTTFFTKLRAHIPFAQKEPL
A0A2V8ERZ5      ----VPEFNGTKPAPPTASTLLQEAKDKIIGI----AKP------NAPAEAPKVDETADE
A0A2V8GTX0      ----VPEFNGKGAKPPLLTQVISDLKAKIAAP----FRG------QTAAPPPRPAGPVNE
A0A2V8J0X9      ----SPLFNGSAPPPRDPLSLARQGRAAASAW----LRGLIVKPPPAAAAPPAPDEPAHE
A0A523DUV7      ----KPPF-------------------------------------------------RDA
A0A372IRG7      ----RKPFSDM----------------------------------FAKQPYTGHLTPLQR
A0A1F2U158      ----VAEFNGTAKPAETPVTKARDAGDR--------LLRFLARTPTPIAEVPKPDETADE
A0A2V8F6S9      ----RAEFNGTERPRPTPFSMLREAEQR--------IVRLVRPAKEEPTEAPKVDEAPDE
A0A7D8BEX2      ----KPEFFE-----------------------------------PARTRHQVLDAPETR
A0A4Q1SCH5      ----FQNYAG--------------------------FSRSQMVFRLEDDQHRPINLTPQQ
A0A2V8K4L4      ----KTGY----------------------------GTSTDRLAAWRKVLHIAPKQALDR
A0A2V8NCZ3      ----KTPY----------------------------GTSSDRLAAWRKVFHLSSKPAIDR
A0A4Q7YNP3      ----HSATTP--------------------------RLDLASRLIGMLHLPISVGKPISS
E8UZE1          ----NPVFSGITS--------------------------------SATPKPLNSLTDQER
A0A2U3JZ71      ---------------------------------------------TEAEGSDATLSRVPG
A0A2V8TTB0      ---------------------------------------------VEKDALEQPSERWQG
A0A1V6HR88      ----DPAFNPA-----------------------------RASLAGSDEGGSAAADQSAL
A0A3E0P0A3      ----HRYFG---------------------------GAVDRSSYVRPGEPVTADDDAVVV
A0A2V8EXP2      ----HPQFNPKGEAAFSLGALVTAPLRWLSA-----W--ATPPPAI-EPGGVSAGETSAQ
A0A2W4RYA1      ----HPLLVPERGALAVVREGVASVMRWFRS-----PEGGVPDPAVGQAGGQEPPETPEQ
G8P0Y7          ----RADFA---------------------------GRAQTQSNGGIAVSQSPAEESFRL
A0A5M8T4U7      ----RLR-----------------------------AGEHATPGSIAQYKLPVVLSPVER
A0A7D0PPG7      ----------------------------------------------VSNTPTKKMPAGMT
A0A7D8BF18      ----DPRFMG------------------------------------PSPKPRNLDDPIVR
A0A1E3Y9R6      ----AERVPAASTWSFSPSAVVGTTIAAVRHWF---GPAPVLPAASDGADPAPGAVSPQE
A0A2W4TLP2      ----PERVPPASSLSFSLSSLLGGAVSAVADMF---GPGPV---PAAGGEEPAAVESAAR
A0A7C4BZ42      ----GAPY----------------------------AYPVGRFEAWKQALGLGQAEAVTK
A0A3R9WF43      ----KRPFLGAIV--------------------------------RGEADKPLEDAPRTR
A0A317HKM4      ---------------------------------------------TSSEAALPPNERLSQ
A0A2V9CG11      ------------------------------------REARKSHSIVRRMLRLSNSQHVPE
A0A523E0N1      ----HPLF--------------------------------------APDPDAHLDQKKVV
A0A523ECP2      ----HPHFGGD---------------------------------------KTHTADEQTL
A0A2W0C122      ----NAEFMRDA---------------------------------NRQFASLREIAPAPE
A0A2W0AUU7      ----NAEFMRDA---------------------------------NRQFASLREAAPDPT
A0A2W0BQL1      ----NAEFMRDA---------------------------------NRQFASLQEAAPDPT
A0A4Q1SDL1      ----NRDFQPHFNPIGWV------------------MGLFAPKGIADPPGASLENSPARR
A0A3P0XH15      ----KQPFAQV----------------------------------FVRQPYNGKLTPNQR
A0A4R1LAZ7      ----KKPFSKI----------------------------------FKQTPYHGQLTPLQR
A0A3M1WQW8      ----QPEFAGL---------------------------------------ARIRDATLRD
A0A3N1JHC1      ---------------------------------------------APRVPPSLASNDAGR
C1F294          ----KPPYSGV----------------------------------FKKAGYHGTVTPSQK
A0A2V9KA79      ----------------------------------------------------PVTRGAAT
A0A522PSP1      ------------------------------------------------APPADSSSTEVP
G8P085          ----F-------------------------------REYAGPNAKQLAIPLGAISLSPAQ
A0A7C6A629      ----------------------------------------------PVEDVDKETLPSTD
A0A4Q1SGQ1      ----THDYFPQRTTGWHLP-----------------AWLFFWRQPLEPLNIRLEDAPNRR
Q1ILD9          ----KPPFAGDKLYTEGSG-----------------TWYSHHGLRSLPNEPLSNIGNARR
A0A7C5SHM3      ------------------------------------IRERILELLSADEQPEEDATPPDD
Q1IJZ6          ----HIGSY---------------------------WHLFPSGRVTSEQGLPLRNAPRQR
A0A2V8TCE6      ----HPLLPRKSPGLL--------------------QRTLAALRRALPRGEAHAAPAEPM
A0A522TBE8      ----NPAF----------------------------------------RAPSHPNLTPSP
Q1ITG0          ----NEAFAT--------------------------KSLFGRSLQTPVGKDVSSVDEARK
A0A7C2ML20      ----SSEF-------------------------------------TLPSAATEEERETQR
A0A7C5AXS9      ----AAEE----------------------------AGGRGRVSAWREALGLKPPAEPGP
A0A7C2RGE3      ----HPEF--------------------------------------ADITARVADPDRRR
A0A3N5PCI5      ----LGRAPADGNAQPAGTFAFLGQWRSWLGRA---VGAATGATSSQEKEPGSVRETVAE
A0A3M1Q0S9      ----TGLPGQDDSRENRFFSAI--------------RKLRTTVVRTLSRTQVPIEEDDPY
A0A2Z5G448      ------------------------------------KKPFSKVFEKQPYVLGKPLTPAQR
A0A3M1VZ38      ----RPTLLGEQADEEPSPFSLGGLR----------AKILSVIGRGAPETGEVDPLRP--
A0A4Q1SD29      ------------------------------------KAPFDAIFKTSPYTG--TLTPAQR
A0A6N9FGE2      ----HPEFGGAGGARRSSVLRALNPVRLVRRAFSWVRSAVLGPPPPVETEGLVDAESRAE
A0A3M1PY35      ------------------------------------RELLLASLRPEDEEDLAAWEPPDD
A0A3M1VMP2      ------------------------------------REALAPEL-TEPGEDGEEPKPPTD
                                                                            

A0A2V7VMF7      -------------------------------------------PEAGALFVTHVGVEPI-
A0A2V7YYV7      -------------------------------------------KTRPDDLAKRIKATPQ-
A0A2V7Z0J5      -------------------------------------------KTTSDELVKQVKVTPDA
A0A2V7Z3M4      -------------------------------------------NTTSDDLARQIKVTPD-
A0A399Y5V2      -------------------------------------------AQVLGQ-----------
Q01X01          -------------------------------------------RTAVDEVRKNLQIISS-
A0A3M2D9H8      ------------------------------------------------ISSSQVRVQQV-
A0A2V8JK38      -------------------------------------------RSLIDQYLDRITVKPL-
A0A2V9IXG5      -------------------------------------------DGIAGELGGGISLAPV-
A0A2V9J2P4      -------------------------------------------DGIAGELGGGISLAPV-
A0A1Q7RLS4      -------------------------------------------VDSIGAFSEMIVVAPV-
A0A2V2R525      EDLAEIKRL----------------------------------NPFVGAIQSGLEVEQV-
A0A321LPW6      GPGADANDL----------------------------------AALIRALDKNLSVEPI-
A0A2V9R9V4      RSPEEVERL----------------------------------APYVGMLEESLRVRPI-
A0A321LE75      RSPEESARL----------------------------------APFVAVLSGNLSPEPL-
A0A2V8R8U7      LTPEELATL----------------------------------EPYEDAIIANETIEPI-
A0A2V8QMP4      IAPEQAQAL----------------------------------EPYEDAMRAGLNIDAV-
A0A2V8R4S3      IAPEQAQAL----------------------------------EPYEDAMRAGLNIDAV-
A0A2V8NJ55      LSPEQLERL----------------------------------EPYEDALRASLTVEPV-
A0A2V8Q7I0      LSPEELAAL----------------------------------EPYEDTIIANEDIDGI-
A0A2V8S6K4      LTPEQLKQL----------------------------------EPYEDALAGNLTVDPV-
A0A317I2L9      LSPEELAAL----------------------------------EPYEDAIIGNEQVDGI-
A0A2V8LLF9      FTAEELTQL----------------------------------EPYEDAIAAGETVEAV-
A0A352FRF4      FTPEQLAAL----------------------------------EPYEDTITANEIIEPQ-
A0A2V8MKV0      LTPEEVVRL----------------------------------EPYEDAITANEEVDTV-
A0A2V8PYY8      LTPEELVRL----------------------------------EPYEDAIIANEDVGIV-
A0A1Q7YKQ8      LTPEQLTRL----------------------------------EPYEDALAGNLTVEPV-
A0A352F3R7      LTPEQLAEL----------------------------------EPYEDGIIAGEAVEAV-
A0A0B6WXT1      LTPEQLAKL----------------------------------EPYEEAILAGITVEPV-
A0A3B9MEU8      LTPEQLAEL----------------------------------EPYEDAIIAGETIEPV-
A0A2V8MHG6      DDIAQTNHL----------------------------------QPYVEMLQSQLSVKQL-
A0A2V8P7N1      DDIAEANHL----------------------------------QPYVEMLQSQVSVKQL-
A0A2V8M3M6      DDIAEANHL----------------------------------QPYVEMLQSQVSVKQL-
A0A1Q7NJH5      DDIAEANHL----------------------------------QPYVEMLQSQVSVKPL-
A0A2V8PJY0      DDIAEANHL----------------------------------QPYVEMLQSQVSVKPL-
A0A1Q7Y6W9      EDLAEAKRL----------------------------------QPYVSMLQGGLKVDPVK
A0A2V8NC68      EDLKEVNQL----------------------------------APYIESLQGGLSVKEV-
A0A399WK13      DEIAEAVRL----------------------------------TPFVEVIRRNLSVDPVR
A0A352FLX4      QEQAEAERL----------------------------------SDYVDDLQETLKVEPVK
A0A2V8RTL7      DEIAEALRL----------------------------------SPYVDLIKEDLIVEPVR
A0A3E0PCJ6      EEMNEAVRL----------------------------------APFVDAVQRDLIVDPVR
A0A3M1S4R8      EEINEAVRL----------------------------------APFVEILKKNLRVDPVR
A0A7C2G442      EEINEAVRL----------------------------------APFVEILKKNLRVDPVR
A0A1Q7YFI6      GDIAEVNRL----------------------------------APYVGMLQGGLSIKEI-
A0A136KC10      DEIAEAVRL----------------------------------TPFVEVIRRSLSVDPVR
A0A3M2D6Y5      EEMNEAIRL----------------------------------APYVEIIKKKLQVEPVR
A0A2V8SEX6      DEIAEAVRL----------------------------------APYVEIIRKNMSVEPVR
A0A7C5ZUU4      DEVADAMRL----------------------------------APYVELIKPNLSIEPIR
A0A0B6WWQ6      DDFDVAMRL----------------------------------DPYVRTIASSLKVDPVK
A0A3B9MK99      EDLVEAKRL----------------------------------APYVGAVLGGLRVEPVK
A0A352EX26      EDLVEAKRL----------------------------------SPYVGAILGGLRVDPVK
A0A2V8MM59      EDLVEAKRL----------------------------------APFVGALQGGLKVEPVR
A0A2V8PFE8      DDLAEAKRL----------------------------------APYVGALQGGLKVEPVR
A0A2V8PWS6      DDLAEAKRL----------------------------------APFVGALQGGLKVEPVR
A0A2V8LCT5      EDLVEAKRL----------------------------------APYVGMLLGGLRVDPVR
A0A352FTJ9      DDLVEAKRL----------------------------------APYVSALAAGLRVEPVR
A0A257VBK0      -------------------------------------------KDPAAMLRGMTKVDNI-
A0A2G6PYV5      QAKEI--------------------------------------TKIASNLIGGVEIKEV-
A0A2V8F956      PGPDETASQ----------------------------------SDAIDAFENALTIAPV-
A0A1F2S1W5      -------------------------------------------SRVINRFLAALDVSAV-
A0A1F2T595      -------------------------------------------TVVINRFLANLGVSAV-
A0A2V8JQV5      -------------------------------------------EAAISLAAATLQVEAL-
A0A2V9AC41      -------------------------------------------KRLAGSYLSKLHISPV-
A0A2V9MAM9      -------------------------------------------REAILRVKDRLRIEPS-
A0A348V070      -------------------------------------------ERLIDEFIESLNVSPL-
A0A2V9M454      -------------------------------------------NAAVAAFKARLKVERP-
A0A2V9IVR7      -------------------------------------------SPLVGIFKGGLRVEIM-
A0A2V9ILE2      -------------------------------------------SPLVGIFKGGLRVEIM-
A0A2V9LGY4      -------------------------------------------SPLVGIFKGGLRVEIM-
A0A2V9J4D6      -------------------------------------------GRLVKLFDSYLGVNLH-
A0A2V9L9C5      -------------------------------------------GRLVKLFDSYLGVNLH-
A0A2N9M9N1      -------------------------------------------ANLIRSFKKHLHIELL-
A0A2V9JEC4      -------------------------------------------DRLIRAFKKHLHVALM-
A0A2V9LPQ3      -------------------------------------------DRLVREFQRSTTVRLM-
A0A2Z5G3A3      -------------------------------------------SHALKVFSKNLTVTPV-
A0A2V7UGP8      -------------------------------------------KPYIQFVLSGLDINPL-
A0A239MKT6      -------------------------------------------DRVLAIFHKGLQVEVL-
A0A3E0PCN7      EPEKL--------------------------------------APFVNSIRGNLSVNPV-
A0A2V8IYW3      -------------------------------------------EDVVARMRTEVDVDPP-
G2LEI9          ---------------------------QRY-------------APQIGRLASGLQAYNV-
A0A317J121      -------------------------------------------TSGLNVALATFDARPI-
A0A2V7YW66      -------------------------------------------GSLAEQVRGGLSVAPV-
A0A2V7Z0V0      -------------------------------------------GALADQLRGGLAVDPV-
A0A2V8GFD4      -------------------------------------------RRRVDAFLGALSIVPV-
A0A2V8HSS5      -------------------------------------------RRRVDAFLGALSIVPV-
A0A2V8KP55      ---------------------------DQL-------------RSLIDQYLDRITVKPL-
A0A399WNU1      QAEQL--------------------------------------APYVGFIKRNLEVSPV-
A0A2V9JSI3      -------------------------------------------ISLINAFRDHLRVEWV-
A0A2V9WI32      ---------------------------AE--------------SSLLDRFRRGLKLNVV-
A0A2V8IVN9      ---------------------------SSQ-------------SRAVDAFLKRLTVSPV-
A0A7C5Z4J3      ---------------------------ARR-------------ARLIAAFKKSLHIDLV-
A0A1F2TPT3      RPAE---------------------------------------APQISAFLGGLSLAPT-
A0A2V8JTQ2      ---------------------------ANQ-------------DALLQSFHKGLEISKV-
A0A2V8UZY0      ---------------------------DNE-------------DRLVKSFHKSLRISKV-
A0A350UEK1      -------------------------------------------ARAVEMAADTLKVRAS-
A0A350UIQ4      -------------------------------------------QHAIAMAADSLKVRAS-
A0A1H5Z7N3      ---------------------------VVR-------------QMVLYTLRADVNVSVI-
A0A1G7JVV8      ---------------------------IVR-------------AAVIGKLSNAFKVASI-
A0A1H4T6W9      ---------------------------VVR-------------TEVLRRLGGAVVATVI-
I3ZEU5          ---------------------------AVR-------------TDVLQRLGNSVNASII-
A0A1I6MH75      ---------------------------AVQ-------------AGTIRRLNGHLKVSLI-
E8WVF6          ---------------------------RVR-------------QTIVGILQKNLKVTLV-
A0A7D0PQC3      ---------------------------AVR-------------EGVIKTLKGNLTVALV-
A0A428MDU2      ---------------------------GVR-------------QSTVHRLQSNLHITLV-
A0A5B9EBI2      ---------------------------MIR-------------QATLSRLKANLTVSIV-
A0A239HDF6      ---------------------------QVR-------------QGTLLVLSSNLKIAMQ-
A0A4Q0T270      ---------------------------GVR-------------QGTIHRLQSSLRIQLV-
A0A1Q3QQB6      ---------------------------AVR-------------QATVHALQSGLRIVLV-
A0A3N1K1G7      ---------------------------AVR-------------QSTVHRLQSNLHITLV-
A0A4V2G466      ---------------------------DVR-------------QRTIHQLLGGLRIAQV-
A0A6B9YNQ8      ---------------------------AVR-------------QATIHGLLANLVISQV-
A0A3N5YNR8      ---------------------------DKN-------------RDVLDTFRDRLEVAQV-
A0A3N6A5T6      LDKDE----------------------ADL-------------SADVDRFLGSLQVQPI-
A0A1F2Q9L4      -------------------------------------------AGLAYGVLGGLEVNPI-
A0A2U3KC61      ---------------------------ARE-------------AGLLGAFRGGLSVQII-
A0A2V9Y2R7      ---------------------------GAQGLSELKPNNDEETTALLAAFHSGLSVRVI-
A0A2V9NGH6      ---------------------------VKA-------------SAVLASFKSDLKVLLK-
A0A2V9PYE6      ---------------------------VRT-------------SEILAHFKSDLKVSLK-
A0A2V9NL07      ---------------------------ARA-------------NALLGAFKGGLHVVLE-
A0A2V9QD92      ---------------------------ARA-------------NALLGAFKGGLHVVLE-
A0A2V9WPZ6      ---------------------------TRT-------------SALLSAVKGSLRVSLV-
A0A2V9ZLH4      ---------------------------SRV-------------TNLLGAFKGNLKVTLQ-
A0A2V9RQF1      ---------------------------EQT-------------TALLSAFKGNLRVALQ-
A0A2V9YDK8      ---------------------------ART-------------SALLAGFKGNLRVSLL-
A0A2V9V8F7      ---------------------------TRT-------------SALLSAVKGSLRVSLV-
A0A2V9XGR9      ---------------------------TRT-------------SALLSAVKGSLRVSLV-
A0A2V9V3Q5      ---------------------------KRT-------------TALLGGFKGNLKVSLI-
A0A2V9NWS3      ---------------------------QRT-------------TDLLSAFKGKLRVALE-
A0A2V9USA9      ---------------------------AHL-------------SSVIGGFKGSLRVALS-
A0A2V9XW18      ---------------------------GRA-------------SSMIGGFKGNLRVTLS-
A0A1H5SQF5      ---------------------------TYR-------------DSAVNLFQSRLKITLV-
A0A2V9AEW6      ---------------------------SER-------------EQMIRQVERNLTVQSS-
A0A2V8WQK6      ---------------------------PER-------------EELIRQIKRNLTVRTS-
A0A2V8XIF4      ---------------------------PEK-------------EELIRQIQRNLTVRES-
A0A2V2R0I6      ---------------------------PE-----------------LGEFLGSLSVKRV-
A0A2V8XAR9      ---------------------------PE-----------------LGEFLGSLSVKRV-
A0A2V8VZA0      ---------------------------PE-----------------LAEFLGSLSVKRV-
A0A1Q7CB82      ---------------------------PE-----------------LAEFLGSLSVKRV-
A0A2V8WIU1      ---------------------------PE-----------------LAEFLGSLSVKRV-
A0A1Q6Y9F5      ---------------------------PE-----------------LAEFLGSLSVKRV-
A0A2V9EVV8      ---------------------------PE-----------------LAEFLGSLSVKRV-
A0A2V8YF91      ---------------------------QE-----------------LGQFLGSLSVKRV-
A0A2V8XZK2      ---------------------------PE-----------------LAEFLGSLSVRRV-
A0A2V8ZTX6      ---------------------------PE-----------------LAEFLGNLSVKRV-
A0A2V9BT79      ---------------------------PE-----------------LAAFLGNLSVRRV-
A0A2V9YHT3      ---------------------------PQE-------------SALIGRLRGSLQVSSI-
A0A7C2XNI7      ---------------------------PI-----------------LGAFLARLEIKRV-
A0A1Q8B793      ---------------------------PE-----------------LAAFLGSLTVKRV-
A0A2V9BCA0      ---------------------------PE-----------------LAAFLGSLTVKRV-
A0A2V9BWU9      ---------------------------PA-----------------LGGFLGSLRVKRV-
A0A2V9DKX2      ---------------------------PA-----------------LGGFLGSLRVKRV-
A0A7C2YQY3      ---------------------------AEE-------------VMLIGRFKGGLNVQLI-
A0A3E0NV31      RRGEA----------------------LSE-------------AGALRRLQENLSIAPV-
A0A3N5M5V0      ---------------------------AEN-------------RAVIEKVLSRLEVTQV-
A0A3N5XQP8      PGGQN----------------------DPT-------------EYMIDRLLSDLQINPV-
A0A2Z5G7H4      LENSP----------------------RRR-------------TRALKIFDANLNVKVV-
A0A2V9L5B5      PDTLT----------------------DAY-------------RNSVTHFLASVDVNPV-
A0A2V9LK56      LDPSS----------------------EAF-------------NNSIANFMNSMSVGPV-
A0A2V9L7I0      PDTSS----------------------DAY-------------VNAIAHFRKSVDVSPV-
A0A522PPT0      PDPNS----------------------DAY-------------LNSVTNFMRAVVVNPI-
A0A7C5V1G5      PDPNS----------------------SAY-------------RNSVANFMGLLNVNPI-
A0A2V9KCS3      PQPAA----------------------PSR-------------EQAAGMAAASVSVRSV-
A0A372IT17      ---------------------------NRR-------------YVALRIFARHLTVQPV-
A0A4R1LC91      ---------------------------HKL-------------SHMLKAFSHNLTVKPV-
A0A3M2BZG9      VDDDA----------------------AEL-------------ARQAMRLQSGLVVNPI-
A0A1Q7N5R7      GRTDSLGFRWTPAAADLAPGAEIVFGVTTL-------------RDASRGLSDGLRVSPD-
A0A2V9QB26      PETKP----------------------SDE-------------SGAAQAAARSLNARVS-
A0A2V9VYY4      MQPDP----------------------VQA-------------AGLLGAFRGGLSVQPV-
A0A3E0PHB0      TPEQS----------------------QRA-------------DKYTAALVNSLVVEKV-
A0A3M1SIV3      SPEEK----------------------EAV-------------EKVTASLLPGVDVVQE-
A0A3M2D491      SPEER----------------------LRV-------------ERITASLAGSVDAIQE-
A0A353C9L6      SPDEE----------------------KRA-------------DQYAGILFSGLTVDQV-
A0A2V8RQV0      SPEEE----------------------ALA-------------NQHVGNLIGRLQIVPQ-
A0A2V8SJH5      TPEER----------------------ARV-------------ENYAAMLAGRVTVQPK-
A0A357F267      TPEEE----------------------KRV-------------QIYAAMLRGGLSVEQR-
A0A7C5ZUA8      TPEEQ----------------------ARA-------------ARYAAILLGGLSVEQV-
A0A136JPP4      SPEEA----------------------ARA-------------GQYAGILSGGLHVEQT-
A0A399WUJ8      SPEES----------------------ARA-------------NQYAAALSGGLRVDQT-
A0A2V9KIE8      PDVNS----------------------EAF-------------TNAVKHFLDAVEISPV-
A0A352F549      DPAEV----------------------ERL-------------TPYAESLQGLVDVEQV-
A0A3B9MLP9      DPAEV----------------------ERL-------------APYVDSLQGMLDVAQL-
A0A3D5SQ87      DPAEV----------------------ERL-------------APYVDSLQGMLDVAQL-
A0A2V8NW86      PELKL----------------------SDE-------------SGAVQAAAESLKARAS-
A0A7C2GJ20      VADPD----------------------RQR-------------VLLIDRFLANLKVELV-
A0A7C4BTL5      ESPEK----------------------DAR-------------EAALTMAAGGVKVKAA-
A0A2V8ZHL8      PAQPQ----------------------NSE-------------DKLLRLFKSRLHVQRV-
A0A2V9B240      PVQLQ----------------------VWE-------------DRLLGPFKRRLHVQRV-
A0A2V9CBM2      A--DR----------------------ELY-------------QRVLERFRDHLTIAPI-
A0A2V8XN17      EARDR----------------------ELS-------------QRVLERFQDRLTIDPV-
A0A2V8WX45      AGGDR----------------------ELS-------------QRVLERFQDQLTVDPV-
A0A1Q6YR79      ETRDR----------------------ELS-------------QRVLERFQDRLTIDPV-
A0A1Q7VA32      ETRDR----------------------ELS-------------QRVLERFQDRLTIDPV-
A0A2V9EY85      EAPDR----------------------ELS-------------QRVLERFQDRLTIDPV-
A0A2V9H8K0      EVRDR----------------------ELS-------------QRVLERFLDRLTIDPV-
A0A2V9FFE5      QVRDR----------------------ELS-------------ERVLERFLDRLTIDPV-
A0A2V9GM43      QVRDR----------------------ELS-------------ERVLERFLDRLTIDPV-
A0A2V9CYQ5      A--DR----------------------ELY-------------QHVLERFRNHLTIAPI-
A0A2V9BWU8      VAHDS----------------------AVY-------------QRVLERFQDRLSIEPV-
A0A2V8ZG48      PGQDP----------------------EVY-------------QRVLERFQGRLTVDPV-
A0A2V8Y334      SARDP----------------------EVY-------------QRVLERFQDRLTVDPV-
A0A2V9AY68      RARDP----------------------EVY-------------QRALGRFQDRLTVEPV-
A0A1F2RFI7      -ALDP-----------------------KY-------------YNVLDNFQDRLTVNPV-
A0A1F2RZS3      -QLDP-----------------------KY-------------SAVIDNFLGRLQIVPI-
A0A1F2USE2      PEQDP----------------------AAY-------------QGVLRRFQDRLAVAPV-
A0A7C2VB08      -APGP----------------------EAL-------------EATLASYHRRLTIAPV-
A0A2V9C238      -ERDP----------------------WAY-------------QTALKRFRDRLSVDPI-
A0A1F2Q9F5      VARDP----------------------VAY-------------QNALETFSRRLAVAPI-
A0A1F2QQH9      VARDP----------------------VAY-------------QNALETFSRRLAVAPI-
A0A1F2QXK7      VARDP----------------------VAY-------------QNALETFSRRLAVAPI-
A0A2V9DEM9      -ERDP----------------------RAY-------------QTALKRFRDRLSVDPI-
A0A7C5TWV7      -------------------------------------------KDPAAMLLGRLKIENV-
A0A2V7XDY0      -------------------------------------------RDAGGEFMSHVNVEPI-
A0A2V8G155      -------------------------------------------SRAVDAFLARLDVTPV-
A0A2V8HDM7      -------------------------------------------SRAVDAFLARLDVTPV-
A0A2V8DRT9      -------------------------------------------SRILNDFLSNLTISPI-
A0A2V7VYF3      -------------------------------------------SQAIDAFLGGLVINPV-
A0A1F2SVH2      -------------------------------------------SNTIDRFLRALTVAPV-
A0A2V8AJG9      -------------------------------------------SRVIDRFLKDLTVSPI-
A0A2N9LQU7      -------------------------------------------EKLLLKFHDAEKLEVL-
A0A2P6WFK7      -------------------------------------------QRLVSAFKQSLSVRVL-
A0A2V8U914      -------------------------------------------QYAADVARKHLKIEPA-
A0A2V7W309      -------------------------------------------QAMAGGLLGGVNIAPK-
A0A2W0BGU4      -------------------------------------------MKLIETFKRQLSVELV-
A0A2W0BVQ9      -------------------------------------------MKLIETFKRQLSVELV-
A0A2V9MN96      -------------------------------------------ASMLSIFRSGLTVQVM-
A0A2V7V2Z1      -------------------------------------------ERAIDEFLGKLKVVPI-
A0A2V7X2F7      -------------------------------------------EGAIDGVLGRLRINAG-
A0A2V7V2I1      -------------------------------------------EAAIDQFLSRVKVQPV-
A0A2V7U3M2      -------------------------------------------ERAIDSFLRKLRVLPV-
A0A2V7UHT0      -------------------------------------------EGAIDAFLRRLRVLPV-
A0A2Z5FVL3      -------------------------------------------DRLLKQFQENLEVKII-
A0A2V9KBD6      -------------------------------------------DRLVKLFHKSLDISKV-
A0A2W0AJ66      -------------------------------------------DSLVRAFHKNLAISNV-
A0A1Q7RBU1      -------------------------------------------DRLVESFHKNLTISKV-
A0A2V9JPV9      -------------------------------------------DRLVKSFHKNLTISKV-
A0A3P0X3W6      -------------------------------------------LPAGSVTLPGLTITHP-
A0A2N9MK30      -------------------------------------------LIDAPVLLKQLKVTRP-
A0A3D1ASD2      -------------------------------------------AEDAPVRLKRLEVIRP-
A0A7C5AXI3      -------------------------------------------SPDAPMVLKRLKVSRP-
A0A7C6E4H7      -------------------------------------------VANAPVKLPNLKVTRP-
A0A1F2TCR2      -------------------------------------------AGIISQFIGSINIIPE-
A0A350UQT3      -------------------------------------------AQDAPIVLRNLKVARP-
A0A7C3HRX0      -------------------------------------------ASNAPILLKNLRVSRP-
A0A1F2V330      -------------------------------------------DTDLDRMRESIKITVE-
A0A662EE63      -------------------------------------------KPGPGIVLGGLTVKPV-
A0A2V8TLH7      -------------------------------------------SDPVGVFSSMVQVELI-
A0A1Q7ZJT1      -------------------------------------------VDSIGEFSQMIVVAPV-
A0A2V8VC99      -------------------------------------------TDPIGTFSSAIEVEPI-
A0A348UZU3      -------------------------------------------QKLVDKFLGRLEVKPI-
Q01XL7          -------------------------------------------EQMKEAVRTAAFTVSA-
A0A2V8ERZ5      -------------------------------------------SGLVSAFIGRVSVDPV-
A0A2V8GTX0      -------------------------------------------NQQADAFLGRVQVVPV-
A0A2V8J0X9      -------------------------------------------AGLISAFLGGLSIRPE-
A0A523DUV7      -------------------------------------------KEPGRIFMSRVQVVPI-
A0A372IRG7      -------------------------------------------YQLIRAFQSSEKVIVE-
A0A1F2U158      -------------------------------------------SALVSRFLGRVQVVPV-
A0A2V8F6S9      -------------------------------------------SGLVSGFISRVTVAPI-
A0A7D8BEX2      -------------------------------------------DAIIAQMKKSLDIAHV-
A0A4Q1SCH5      -------------------------------------------EDVLDKFQLALKAKQE-
A0A2V8K4L4      -------------------------------------------NNAIAAAAGGINVKAS-
A0A2V8NCZ3      -------------------------------------------DRAIRMAGEDIKVKGS-
A0A4Q7YNP3      -------------------------------------------DDLIEDTAKHVTVKPL-
E8UZE1          -------------------------------------------YSLIRRFQSGLGVQLE-
A0A2U3JZ71      -------------------------------------------AEDAPVLLKNLKVSRP-
A0A2V8TTB0      -------------------------------------------SDEAPVILKYLKITRP-
A0A1V6HR88      -------------------------------------------ARLAGRLLGGLEVKPV-
A0A3E0P0A3      -------------------------------------------ARLASRVRSGLSVQQV-
A0A2V8EXP2      -------------------------------------------ARAIDRLLGGLTVTPI-
A0A2W4RYA1      -------------------------------------------TAVIDAFLRRVSVSPV-
G8P0Y7          -------------------------------------------ESLIRKLQGNLTIQQI-
A0A5M8T4U7      -------------------------------------------RALIGYIRGGLSVKLV-
A0A7D0PPG7      -------------------------------------------PADASISLSKMSVVHP-
A0A7D8BF18      -------------------------------------------QSVLGSMQGIVSISPL-
A0A1E3Y9R6      -------------------------------------------AALTSRVQAGVSVVPV-
A0A2W4TLP2      -------------------------------------------AALTSRIQGGIVVVPI-
A0A7C4BZ42      -------------------------------------------ETAVAAAAGSLTIKAS-
A0A3R9WF43      -------------------------------------------ERMVKLFRKNLKVDSP-
A0A317HKM4      -------------------------------------------VPTVAEIAAARSIGGV-
A0A2V9CG11      -------------------------------------------DELVHQAERNLTVRAA-
A0A523E0N1      -------------------------------------------SNIGRSIQAMANVSRV-
A0A523ECP2      -------------------------------------------EDLAEQVAGMLQVTQI-
A0A2W0C122      -------------------------------------------SIAVQALLSGLSVKTI-
A0A2W0AUU7      -------------------------------------------DIAGEAVVSGLSVKTI-
A0A2W0BQL1      -------------------------------------------DIAGEAVVSGLSVKTI-
A0A4Q1SDL1      -------------------------------------------TRLLKIFAANLKAESV-
A0A3P0XH15      -------------------------------------------IEMLSIFKGSTKIATK-
A0A4R1LAZ7      -------------------------------------------YLLLLSYHGALKIMVI-
A0A3M1WQW8      -------------------------------------------KLMVDRFLSGLRVELI-
A0A3N1JHC1      -------------------------------------------EGVVRNMVMDAKAKEE-
C1F294          -------------------------------------------LALLNTFKGATQVVLV-
A0A2V9KA79      -------------------------------------------SRQIDEMRARIQITVE-
A0A522PSP1      -------------------------------------------RSFVAGITGGIKTSQD-
G8P085          -------------------------------------------EEMLSHFKSQINVLQV-
A0A7C6A629      -------------------------------------------VANAPVKLKNLKVTRP-
A0A4Q1SGQ1      -------------------------------------------YVALKIFEHHLKVKAE-
Q1ILD9          -------------------------------------------QQLLARFQLGLDVTEV-
A0A7C5SHM3      -------------------------------------------KQMARWIRERLKVEQL-
Q1IJZ6          -------------------------------------------EAMLKKFGKALTVTPI-
A0A2V8TCE6      -------------------------------------------GPFIDLVLAGLSIEPV-
A0A522TBE8      -------------------------------------------DDVLRQLSNGVSVSRP-
Q1ITG0          -------------------------------------------SKLLTRFSKALRVEAV-
A0A7C2ML20      -------------------------------------------TLVINRFLAGLQVKKP-
A0A7C5AXS9      -------------------------------------------QARVSRALGNLKAQVL-
A0A7C2RGE3      -------------------------------------------VLLIDRFLENLKVELV-
A0A3N5PCI5      -------------------------------------------SIAIDRLLANLRILPV-
A0A3M1Q0S9      -------------------------------------------APYVKTLRGGLSVEPI-
A0A2Z5G448      -------------------------------------------IPLIRLLRSNLQVVVI-
A0A3M1VZ38      ---------------------------------------------YIKQLRAGLSVDPV-
A0A4Q1SD29      -------------------------------------------HEIISLFLGSTKVQVL-
A0A6N9FGE2      -------------------------------------------SRAISALLARFEVVAG-
A0A3M1PY35      -------------------------------------------GDLVEMLGAGLDVAPL-
A0A3M1VMP2      -------------------------------------------DQIAAYIRDNLDTEQL-
                                                                            

A0A2V7VMF7      -------PE-------SRLVTVAVTHQDAKEAALWANTLAEVYVEQTL-ASRVEAAKKAY
A0A2V7YYV7      -------PN-------TTILDIAVDDTNPALARNIANDLVDKLI----------------
A0A2V7Z0J5      -------TT-------ALVLHINVQDTNRARSRDVANTLVSEFI----------------
A0A2V7Z3M4      -------TL-------ALVLHINVQDTNRARARDVANTLVAEFV----------------
A0A399Y5V2      ----------------TSIIRVRARDASASLARDIANGVSATY----I-DLRRKSALDSF
Q01X01          -------RG-------TSIIRIVAEAREPQLAADLANTLAQTFIEQSI-EARQRSAQQTF
A0A3M2D9H8      -------RG-------AQLIQIVVEDSDPQKAAEIANTLVTVFLEQNA-KIQSNRFSASE
A0A2V8JK38      -------RQ-------SWLVEVTFQAKDPKLAAQVINAHGRHFVEQNI-ENRFQTTQQVS
A0A2V9IXG5      -------ED-------TNLLWLEFVADDPRKAADWVNLYVDLYVEEND-RQQGEAVKQSR
A0A2V9J2P4      -------ED-------TNLLWLEFVADDPRKAADWVNLYVDLYVEEND-RQQGEAVKQSR
A0A1Q7RLS4      -------KE-------TGIVEISMEGLNPEEVASWVNTISEVYVERNL-DQVVEATSKAV
A0A2V2R525      -------GK-------TRLVEIRYTHRDPHVAAKVVNAIADTFVQANL-EKMTETNSGAG
A0A321LPW6      -------RD-------TRVIKVVFTHTDPKLAAEVVNAVTQSFIARSF-STKAEKYNNAA
A0A2V9R9V4      -------LD-------TRAMTLTFKHTDPVIAAGVANAIAQRFVETSF-DKKIEKFTSAS
A0A321LE75      -------ED-------TRLLVINYSHTDPKLAATISNTVAAAFINRSF-SNKTEKFTKTS
A0A2V8R8U7      -------IG-------TSLVTIRYQHTDPALAQRIANTLADVFVQNNR-ERLDIGTSKAV
A0A2V8QMP4      -------EK-------TNLVEIHFQHTDPEIAASVANTLATIFRDNDI-QEETTGSQKAE
A0A2V8R4S3      -------EK-------TNLVEIHFQHTDPEIAASVANTLATIFRDNDI-QEETTGSQKAE
A0A2V8NJ55      -------EK-------TNLVTIRFRHSNPVIAMKVADTFAQVFIYNDL-QRTTSGTQTAT
A0A2V8Q7I0      -------VH-------TNLFTIKYKHHDPEMAQKIANTLAEVFASNNI-DSQTVNSKDAG
A0A2V8S6K4      -------ER-------TSLVDIHFKHTDPELARQVADTLAAVFIENDR-ARESKGTEDMK
A0A317I2L9      -------VN-------TNLFVIKYKHHDPDIAQKVANTLAEVFANNNL-ERSTTNSSKQE
A0A2V8LLF9      -------EK-------TSLVTIHFQHTDPELAQKIANTLADVFVQNNL-DRITAGTSKAE
A0A352FRF4      -------PQ-------TNLVIIRYRHTDPALAQKIADTLAEVFVANNL-NLQESGTSKQS
A0A2V8MKV0      -------EK-------TNLVSIRYHHSDPALAQKVANTLVDVFANNNK-ESLESGTRKSA
A0A2V8PYY8      -------EK-------TNLVTITYHHNDPALAQKVANTLVDVFANNNL-ERLESGTKKSA
A0A1Q7YKQ8      -------MT-------TNLVMLKFTHSDPVLAQKIVNTFADTFAYNNF-ERETQGTAKAT
A0A352F3R7      -------TN-------TNLVKIRFVHSDPELAQKIANTLAEVFVNNNL-QRATAGSSKAE
A0A0B6WXT1      -------EK-------TNLVNIKFQHSDPEMAAKVANTIADVFIYNNL-ERETQGAQRAS
A0A3B9MEU8      -------PT-------TNLVKIKFMHSDPELAQKIANTLAEVFRNNNL-ERSTAGSSKAE
A0A2V8MHG6      -------SD-------TRIIEIRFKHQDPEIAEKINNTIADTFVVSNL-ERKTETTNSAG
A0A2V8P7N1      -------SD-------TRIIEIRFKHQDSEIAEKINNTIADTFVVSNL-ERKTETTNSAG
A0A2V8M3M6      -------SD-------TRIIEIRFKHQDSEIAEKINNTIADTFVVSNL-ERKTETTNSAG
A0A1Q7NJH5      -------SD-------TRIIEIRFKHQDSEIAGKINNAIADTFVVSNL-ERKNETTNNAG
A0A2V8PJY0      -------SD-------TRIIEIRFKHQDSEIAGKINNAIADTFVVSNL-ERKNETTNNAG
A0A1Q7Y6W9      ETRLLI-KE-------TRLIDISFTHQDPQVAAKIINALADTFVLSNQ-EKRNESNNTTG
A0A2V8NC68      -------NE-------TRIIELRYRHLDPEVATKIVNTIADTFIQSNL-EKKTETSSSAG
A0A399WK13      ESRATV-KD-------TRLIEISYSDTDPDLAAFVANAIAETFTNQNQ-EKRTGTSRKTN
A0A352FLX4      ETRLTV-RE-------TRLIDISYRHSDPHLAAKIVNTVAQIFIDQNR-EKKTETSGSTG
A0A2V8RTL7      ESRATV-KD-------TRLIEISYRNTNPELAAFVVNAIGETFVNANQ-EKRSGTSRKTS
A0A3E0PCJ6      ESRATV-KD-------TRLISISYRNQDPNVAAFVVNGIAEVFTRVND-EKRTGVNSKTN
A0A3M1S4R8      VSQATF-KD-------TRLIEISFQHTNPELAALIVNGIAEVFVKQNQ-EKRTGTNKRTN
A0A7C2G442      VSQATF-KD-------TRLIEISFQHTNPELAALIVNGIAEVFVRQNQ-EKRTGTNKRTN
A0A1Q7YFI6      -------TD-------TRLIEIHYTHPDPQVAAKIVNSIADTYIISNL-EQKTKNTNSAA
A0A136KC10      ESRATV-KD-------TRLIEISFNSTDPALAAFVANAIAETFVNQNQ-EKRTGTSRKTN
A0A3M2D6Y5      ESRATF-KD-------TRLIEVRFQHTNPELAALVVNGIAEIFAKQNQ-EKRTGTSKRTN
A0A2V8SEX6      ESRATV-KD-------TRLIEISFRHTNPQLAAFVVNSIGETFVTANQ-NKRSGTNRKTS
A0A7C5ZUU4      ESRATF-KD-------TRLIELSFRHTDPKFAAFLVNAIGETFVKANW-EKRSGVSRKTN
A0A0B6WWQ6      EVRLPV-KE-------TRLIDISFRHPDPYVAATVVNTIAETYKLSNL-EKRTSARATTS
A0A3B9MK99      ESR-GLFKE-------TRLIDLSYTHIDPEVASKVVNAIAETYVYNNL-EKKSDTNMGTA
A0A352EX26      ESR-GLYKE-------TRLIDIGYTHTDPEVASKVCNAIADTYVFNNL-EKKTESNASTG
A0A2V8MM59      ESRAGYYKE-------TRLIDITYQHGDPEVAARVANCVAETFVHSNL-EKTNQTNTSTS
A0A2V8PFE8      ESRAGYYKE-------TRLIDIVFQHGDPEVSAKITNAVADTFVRANL-EKKNETNTSTG
A0A2V8PWS6      ESRAGYYKE-------TRLIDIAFQHGDPEIAARITNAVAETFVRANL-EKKNETNTSTG
A0A2V8LCT5      ENRAGYYKE-------TRLIDIDYQHGDPEIAAKVVNCVAETFVRSNL-EKKNETNTSTS
A0A352FTJ9      ENRAGYNKE-------TRLIDIDYQHGDPEVAARVVNAVAQTFVRSNL-EKKNETNTTTS
A0A257VBK0      -------RD-------SALFRITVMAPYKADVAIWANAIAEAYQDRML-KDALDFIAKAN
A0A2G6PYV5      -------KD-------TNLVRISYTDTNPERAMILANTWVKAYIAHSL-NMTYDKNLEAY
A0A2V8F956      -------RN-------SRLVDLKFDLPDGALAATIVNALAKNYISQSL-EFKFMASKDAS
A0A1F2S1W5      -------RY-------SRLVDVSFRSNDPALAARVSNALADQYIKQSV-ELRSNTTKEAS
A0A1F2T595      -------RY-------SRLVDVSFRSADPGLAAKVANEHSKQYIEQSL-EFRTTTTREAS
A0A2V8JQV5      -------QQ-------AHIIQITADSTDPKIAAEFLNTLTDEFINQKL-RSRLQTNERTA
A0A2V9AC41      -------GG-------TSLVKVRFTTPDPALSARLANAHANSYVRYGV-DLRSQTNEEAS
A0A2V9MAM9      -------KQ-------GRIIRILCDATDPQLAADFANALAQVFIEQSV-EARWNGASQIR
A0A348V070      -------TG-------TKLIQVSFNHRNPELAAEVLNTLLDSYIEMLI-KRKYTASEQAT
A0A2V9M454      -------KD-------TRMALVSFESTDPREAAAVVNGLVTNYIEHNF-KSKYDATRQAT
A0A2V9IVR7      -------RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNY-HKNYEATRKAS
A0A2V9ILE2      -------RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNY-HKNYEATRKAS
A0A2V9LGY4      -------RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNY-HKNYEATRKAS
A0A2V9J4D6      -------RN-------THIVEVSFESTDRDLAARVVNALINNYIEYNF-HTKYDATRQAS
A0A2V9L9C5      -------RN-------THIVEVSFESTDRDLAARVVNALINNYIEYNF-HTKYDATRQAS
A0A2N9M9N1      -------TE-------SRLVEVSFESVDSNLAARVANTLVKNYVEANF-RSKYETTRQAS
A0A2V9JEC4      -------GN-------SRLITVSFESTDPELAANAANTLATNFVEANF-QGAYDTTREAT
A0A2V9LPQ3      -------PN-------SHMMEVSFESTDPDLSAKVANTLINHYIEYNF-RKRYDATRQAS
A0A2Z5G3A3      -------VG-------TRLIQISYVSSDRKLAESVVNALAQDLTNFSF-ETRYKATAQTS
A0A2V7UGP8      -------KN-------THLVEISFVSVDPELSSRIANAVANSYMEFNQ-SARYDTSAQAS
A0A239MKT6      -------KS-------TRLLAVSYTDTDRNRASKIANYVVQAYLQDNT-ENRYQATSMAS
A0A3E0PCN7      -------RDNRTAAQETRLIEVQFTHFRPEVAAKIVNTLGETYVRQNL-EQKVQTNASAG
A0A2V8IYW3      -------VK-------DDTFKISYVSGDPVVAMKVVARLASMFIDGNV-RDRRVVAEGTN
G2LEI9          -------PR-------TRLVRITFQHHDPETTKAVVNTVAEVFARRNV-SDRLQQGSSQK
A0A317J121      -------NG-------TRIIEITCDSTSPDIAANFVNTLANEYIEQNS-QGRAQNLQQTS
A0A2V7YW66      -------RS-------TQLVQLAYTAASPEFAAKAANAFSEAFIDMGV-EDRYATAGKAS
A0A2V7Z0V0      -------RN-------TQLVQLSFRASSPEFAAKAANAFAESYIDMGV-EDRFATAGKAS
A0A2V8GFD4      -------RN-------SRLVDIVYSSPDPKFATAAANAIAKAYIEQNL-EYRFTASKEAS
A0A2V8HSS5      -------RN-------SRLVDIVYSSPDPKFATAAANAIAKAYIEQNL-EYRFTASKEAS
A0A2V8KP55      -------RQ-------SWLVEVTFQAKDPKLAAQVINVHGRQFVEQNI-ENRFQTTQQVS
A0A399WNU1      -------KDSRTATKETRLIRIEYRHYDPVIATKLVNAIADTYVLQNL-EQKVQSNASAS
A0A2V9JSI3      -------RN-------SRMLEVSFEARDPRLAAAVANALVSNYAEYNF-RKRYDATRQAS
A0A2V9WI32      -------PR-------TRIVEIHYSHPDARLAAQIANILINTFIEQNF-KTKFESTMQTS
A0A2V8IVN9      -------RN-------SRIVDVKFEAKDPDVAERVVNALAKGYIDQNL-EFKFMSTKEAS
A0A7C5Z4J3      -------PG-------SRMIQVSFESTDPNLAAEAANALVSNYREYNF-HSRYDATREAS
A0A1F2TPT3      -------AN-------G-VLDIKYRSSDPVLAARFANAHAQEYINENL-EMRVAAVREVT
A0A2V8JTQ2      -------KG-------TRLIEIQFRSTDPQLAADVVNGLAKEYVDQYY-RSQFQVSTQFS
A0A2V8UZY0      -------KG-------TRLIEIKFRSTDPRLSADVVNSLAKEYVDHYY-RSQFQVNAQIS
A0A350UEK1      -------GQ-------TRIVEVLVDSTDPAVAASFANRLTAEYVEQSM-EARWQSSQRTG
A0A350UIQ4      -------GQ-------TRIVEVLVDSTDPAIAAQFANLLTSEYVDQSM-EARWQSSQRTG
A0A1H5Z7N3      -------AK-------TDLIHISCQTFSADLSAEIVNKLIREYIFRSL-ESSAEAQKRVS
A0A1G7JVV8      -------PR-------TQMIRITVTANKAQLAADLVNHLINAYQQRSF-ESRFASTQRVS
A0A1H4T6W9      -------PR-------TAMVRITCTASKPQLAADIVNQVINAYQQRSF-ETRFESTKRIS
I3ZEU5          -------PR-------TAMIKITCTASRPQLAADIVNQVINAYQQRSF-ETRFESTKRVS
A0A1I6MH75      -------PK-------TEIIAISYTSLNAKLSADIANKVVSDYIQRSF-ETRFQSQQRVS
E8WVF6          -------PK-------TDIIRIAYSSLDPKLSADVVNKVIADYQQRSY-ETRFDSTKRVS
A0A7D0PQC3      -------PK-------TDIIKISYSSLNAKLSADIVNKLIADYIQRSY-ESRFASTQRVS
A0A428MDU2      -------PK-------TDIIRISYTCLSAKLSADIVNTVIATYVHRSY-QTRFDSTQRVS
A0A5B9EBI2      -------AR-------TNLITINYRSLDAHLSANIINTLIKDYIQRSY-QTRFNSAQHAS
A0A239HDF6      -------PR-------TNILRLSYSSLDGKLSAEIVNTVISEYIQRSY-ETRFASTQRVS
A0A4Q0T270      -------PK-------TEIMRISYSSLSPKLSADIVNKVVSDYIQRSY-ETRFASTQRVS
A0A1Q3QQB6      -------PK-------TEIINISYSSLNPKLAADIVNKVISAYIQRSY-ETRFASTQRVS
A0A3N1K1G7      -------PK-------TDIIRISYSSRSPKLSADVVNKVISTYIQRSF-ETRFASTQRVS
A0A4V2G466      -------QK-------TELIRISFQSLSPKLASDIVNKIISAYIQRSY-ETRFSSSQKVS
A0A6B9YNQ8      -------QK-------TEIIRISYRSLSPKLAADIVNKIISAYIQRSY-ETRFASSQRVS
A0A3N5YNR8      -------PN-------SRLVEIRWVSPDPTLAAAVSDTLAEEFIEQNL-QTKFEANTRAT
A0A3N6A5T6      -------RG-------SRLVEVSYASHDARLAATIVNTLADQFIEMNF-ESRYQATTKAT
A0A1F2Q9L4      -------RN-------TRLVEVSYVATTPELAARIANGVADTYIDWGV-ETRFATVGKAS
A0A2U3KC61      -------PN-------SRLVQISYTHPNPRLAEAIVNKLVDTFKEENT-NAKYESVNETS
A0A2V9Y2R7      -------PR-------TRLLELRYIHQDPVLARDIVNKLAKTYIEENF-RKRYESTTQTS
A0A2V9NGH6      -------PN-------TRIIEIRYRSTDKDSAARVVNTLINTYIEQNF-KTKFESTMQAS
A0A2V9PYE6      -------TN-------TRIIEIRYRSTDKGLAARVVNALINTYIEQNF-KTKFESTMQAS
A0A2V9NL07      -------PN-------TRIIDIHYRSPNKELAARVVNTLANTYIEQNF-KTRFESTMQAS
A0A2V9QD92      -------PN-------TRIIDLHYRSPNKELAARVVNTLANTYIEQNF-KTRFESTMQAS
A0A2V9WPZ6      -------PN-------SRIIELHYRSPNQELAATVVNTLATTYVEQNF-KTKFESTMQAA
A0A2V9ZLH4      -------PN-------TRIIEIHYTSPNKELAATIVNTLVNTYIEQNF-KTKFESTMQAS
A0A2V9RQF1      -------PD-------SRVVDIHFRSPDRQLAAHVVNALTSTYIEQNF-KTRFESTMQAS
A0A2V9YDK8      -------PN-------SRIIELHYRSPDKNLAANIVNTLAATYVEQNF-KTKFESTMQAA
A0A2V9V8F7      -------PN-------SRIIELHYRSPNKELAATVVNTLATTYVEQNF-KTKFESTMQAA
A0A2V9XGR9      -------PN-------SRIIELHYRSPNKELAATVVNTLATTYVEQNF-KTKFESTMQAA
A0A2V9V3Q5      -------PN-------TRIIEIHYRSTDPTLAASVVNTLAATYVEQNF-KTKFESTMQAS
A0A2V9NWS3      -------PN-------TRIVDIHFRSPDRELAAHVVNTLISTYIEQNF-KTRFESTMQTS
A0A2V9USA9      -------PN-------TRIIEVHYRSGDPQMAANVVNTLMQTYVENNF-KSRFESTMQAS
A0A2V9XW18      -------PN-------TRIIEVHYRSADPQMAANVVNTLMQTYVENNF-KARFESTMQAS
A0A1H5SQF5      -------KG-------TRLVNVTYTDADPKQAARVANAVVEAYLISST-QQRYDATSKTS
A0A2V9AEW6      -------GS-------SRLLEVLYESPDPKQAADFANTLVSEFTELSQ-EAHWKSAQGTA
A0A2V8WQK6      -------GN-------SRLLEVLYESPDPQRAADFANTLVSQYVELSQ-EERWRSAQGTA
A0A2V8XIF4      -------GN-------SRLLEILYESPDPKLAADFTNTLVSEFVELSQ-EERWKSAQGTA
A0A2V2R0I6      -------PN-------SRLMDVSFESTDPQLGARIVNAHINNFIEQNF-RSRFEATSQAS
A0A2V8XAR9      -------PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNF-RSKYEATTQAS
A0A2V8VZA0      -------PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNF-RSKYEATTQAS
A0A1Q7CB82      -------PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNF-RSKYEATTQAS
A0A2V8WIU1      -------PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNF-RSKYEATTQAS
A0A1Q6Y9F5      -------PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNF-RSKYEATTQAS
A0A2V9EVV8      -------PN-------SRLMDVSFESTDPRLAARIVNAHIASYIEQNF-RSKYEATTQAS
A0A2V8YF91      -------PN-------SRLMDVSFESTDPRLAARIANAHIATYVEQNY-RSKYESTTQAS
A0A2V8XZK2      -------PN-------SRLMDVSFESTNPQLAARIVNAHIATYVEQNF-RSKYESTTHAS
A0A2V8ZTX6      -------PN-------SRLMDVSFESTDPRLAARTVNAHIATYVEQNY-RSKYEATSQAS
A0A2V9BT79      -------PN-------SRLMDVSFESTDPRLAARTVNAHIATYIEQNY-RSKYEATSQAS
A0A2V9YHT3      -------PN-------TRMIELRFSDPAPRETARVLNVFMDDYIQENI-RAKYDSTMQAT
A0A7C2XNI7      -------PN-------SRLLEVQFESTDPQLAARVVNTHLHNYVEHNF-RARYESTTKAS
A0A1Q8B793      -------PN-------STLLDVAFESTDPRLAARVVNAHIENFIEHNF-RSRYEATTQAS
A0A2V9BCA0      -------PN-------STLLDVAFESTDPRLAARVVNAHIENFIEHNF-RSRYEATTQAS
A0A2V9BWU9      -------PN-------SRLLDVTFEAGDPKLAARVVNVHLENYIEQNF-RSKYLATTTAS
A0A2V9DKX2      -------LN-------SRLLDVTFEAGDAKLAARVVNAHLENYIEQNF-RSKYLATTTAS
A0A7C2YQY3      -------RT-------SRLVEVRFESADPKVCSDVPNTLAQLYIENNF-RKKYESTMQAQ
A0A3E0NV31      -------GN-------TQLVRVSYSSPDPDLSTDVAGAIALTFIETTL-QTRYDATRRAV
A0A3N5M5V0      -------PN-------SRLVEVGWVSPDPSLASAVSDTLAEEFIEQNL-QTKFEANTRAT
A0A3N5XQP8      -------LE-------SRLMDVSFSSPSPKFAAMVANAWVEEYIEQNF-QSKLKTTEMAT
A0A2Z5G7H4      -------SG-------TRLIEVRFLSSDPVLAAKVVNQLMDGLVEYNF-QTRFTATNQAS
A0A2V9L5B5      -------RR-------SNLVEVTFDSYSRTVAALAANKLADDYVEQNL-EVKWDAAEKAS
A0A2V9LK56      -------RR-------SNLVEISFYSNDPKLAARIANRLADDYIEQNL-QVKWDAALKAS
A0A2V9L7I0      -------RR-------SNLVELTFDSYSPEVAAQAANKLARDYIEQNL-EVKWDAAAEAS
A0A522PPT0      -------ER-------SNLVEVAFYSQDAAVAARVANQLGEDYIDQNL-QVKWNEALKAS
A0A7C5V1G5      -------ER-------SNLVEVTFYSRDPALAARIANQLGEDYIDENL-QVKWNEALKAS
A0A2V9KCS3      -------NE-------TRIVEILCDSTDPKFAADFANTLVSEYMEQSL-ESRWKNAQRTG
A0A372IT17      -------TG-------TRLIEIRYSDPDPALAARVVNRLVQALADYTF-QSRLAQTSESS
A0A4R1LC91      -------SG-------SRLIQITYLSSNPHTAAAVVNALSAALIDYTF-QTRFNATNQAS
A0A3M2BZG9      -------RD-------TQLVELTYRSDKPELAARIANGYAQAFIDWGI-ETRTSTVSRAS
A0A1Q7N5R7      -------LS-------GNFLRIALTGPSATGVTGVVNAVADRFVAVAT-DLKRAKLTELG
A0A2V9QB26      -------GL-------TRVVEASYDSTDPRFAAAFLNTLVQEFMDSNM-EARLKSSEYTS
A0A2V9VYY4      -------PS-------TRLIQVSYTHSDPRFATEITNALVKTFIEENF-RTKYNSASQTS
A0A3E0PHB0      -------EG-------TNLVKLTMNGSDPELIRRVADTLTEVYKDRSI-MLATKTQVEAH
A0A3M1SIV3      -------ER-------TNLFSINVANSNPELAAILANTIAEVYIERTI-RRETEGMQKSL
A0A3M2D491      -------ER-------TNLFSVKVVHTNPELAARLANAIVGVYIDRAA-RREVEGTRKSL
A0A353C9L6      -------ER-------TNLVNVRVKSTNQALAPKVADKIAEVFKLRDA-ERETQGAKNSA
A0A2V8RQV0      -------ER-------TNLVNVTIQNEDPALAGKVTDEIAAIFIEEDK-ERETQGERKAI
A0A2V8SJH5      -------ER-------TNLVNVSVTTPKAELSARVADKVEEVFIDKDA-QRETEGSRRTY
A0A357F267      -------ER-------TNLVNVSIRSTNPDLAARVADKVAEVFRDQDA-ERETQGAKNAS
A0A7C5ZUA8      -------EK-------TNLVDISVRSTNPELAAKVSLKVAELFRDRDA-ERETAGARKAV
A0A136JPP4      -------ER-------TSLFTLTINSTNPQIAANVANKVGEVFIEEDA-KRELETTQSAY
A0A399WUJ8      -------ER-------TSLFTVSVSSTNPQLAAAVSDKVAEVFIEEDA-KRELEGTQSAY
A0A2V9KIE8      -------RR-------SNLVEVSFGSHDPRVAAQVANRLAQDYIDSNL-QVKWDETIKAS
A0A352F549      -------KK-------TYLIDLRATHTDPVVATKVVNAMADAFALWNM-EVKTKTNTVAG
A0A3B9MLP9      -------KK-------TRLIDIRASHTDPGVAAKVVNAVADAFALWNI-EVKTKTNTLAG
A0A3D5SQ87      -------KK-------TRLIDIRASHTDPGVAAKVVNAVADAFALWNI-EVKTKTNTLAG
A0A2V8NW86      -------GL-------TRVVEASYDSTDPRFAAAFLNTLVQELMESNM-EARMKSSEYTS
A0A7C2GJ20      -------RN-------TRVVAVTYSAHDPQLAARAVNELFTQYGEYML-EARSDSTRKAT
A0A7C4BTL5      -------GQ-------TRIIEVTVDSTDPNIAATFANTLANEFIDQNM-EARWLMAQRTG
A0A2V8ZHL8      -------RD-------SHVVNISFEGPDSSLSAKIANSLASNFIEYNF-RQKYDATRQAS
A0A2V9B240      -------RD-------SHVVNISFESPDPGLSAKIANSLANNYIEYNF-RQKYDATRQAS
A0A2V9CBM2      -------NR-------SRLVAVRFDSHNPDLAARVANNLAADYVEQGL-DERWAAAQRAS
A0A2V8XN17      -------NR-------SRLVAVRFDSRDPELAARVVNTLASDYVDQSL-EARWQATQRAA
A0A2V8WX45      -------NR-------SRLVTVRFDSRDPELAARVVNTLAADYVDQSL-EARWQATQKAA
A0A1Q6YR79      -------NR-------SRLVTVRFDSRDPELAARVVNTLASDYVDQSL-EARWQATQRAA
A0A1Q7VA32      -------NR-------SRLVTVRFDSRDPELAARVVNTLASDYVDQSL-EARWQATQRAA
A0A2V9EY85      -------NR-------SRLVAVRFDSRDPELAARVVNTLASDYVDQSL-EARWQATQRAA
A0A2V9H8K0      -------NR-------SRLVAVRFDSHDPELAARVVNTLAADYVDQNL-EARWQATQKAA
A0A2V9FFE5      -------NR-------SRLVAIRFDSHDPELAARVVNTLAADYVDQSL-EARWQATQKAA
A0A2V9GM43      -------NR-------SRLVAVRFDSHDPELAARVVNTLAADYVDQSL-EARWQATQKAA
A0A2V9CYQ5      -------NR-------SRLVAVRFDSQNPDLAARVANALAADYVEQGL-DERWAAAQRAS
A0A2V9BWU8      -------SR-------SRLVTVRFDSGNAQLSARIANALAEDYIDQSL-EARWLATQKAT
A0A2V8ZG48      -------SR-------SRLVNVRFDSNDAQLSARIVNTLAEDYIDQNL-DSRWKATQKAT
A0A2V8Y334      -------SR-------SRLVTVRFDSNSAELSARIVNTLAEDYIDKNL-EARWKATQKAA
A0A2V9AY68      -------SR-------SRLVTVSFDSNNARLSASIVNTLAEDYIDENL-EARWMATQKAT
A0A1F2RFI7      -------RR-------SRLVEISFDSYDPALSARTANALAANFIDQNL-EAKWDATQKAS
A0A1F2RZS3      -------RR-------SQLVEITYESYEPSQSARVTNTIAANYIDMNL-EAKWDATQKAS
A0A1F2USE2      -------KY-------SRLVEVHFESEDPALAAQATNTLAANYIEQNL-EARWEASQKAS
A0A7C2VB08      -------KR-------SRLVEISFQSHDPELAAAVVNALADNYIDQSL-EVRWQATQKAS
A0A2V9C238      -------KR-------SRLVEISFESRDAELAARVLNALASHYIEQSL-EVRWEATQKAS
A0A1F2Q9F5      -------KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNF-ERRWEATQKAS
A0A1F2QQH9      -------KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNF-ERRWEATQKAS
A0A1F2QXK7      -------KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNF-ERRWEATQKAS
A0A2V9DEM9      -------KR-------SRLVEISFESRDAELAARVLNALASHYIEQSL-EVRWEATQKAS
A0A7C5TWV7      -------KD-------TNILELSMTGKDPDKVAEWLNVYVQEYIAINI-EDNLNRTRKVY
A0A2V7XDY0      -------PE-------SRLVLIHVTHRYPKEAALWANTLADVYIEDTI-STRVEAARKAY
A0A2V8G155      -------RN-------SRLVDIKYRLGDPALAQKIVNAVAHAYIEQTM-EFKFTASKQAG
A0A2V8HDM7      -------RN-------SRLVDIKYRLDDPALAQKIVNAVAHAYIEQTM-EFKFTASKQAG
A0A2V8DRT9      -------RN-------SRLVEIEFASPYPYVAANVANSLSKAYIELNL-EYKFTASRDAS
A0A2V7VYF3      -------KN-------SRLVDVVYRSPDPVFATTIVNELAHQYIQQNV-ELRFHASKDAS
A0A1F2SVH2      -------RN-------SRLVDVRFDSPDAAFSATVANALARAYIEQHL-EFKFLSSKEAS
A0A2V8AJG9      -------RN-------SRLVDVKFESPSAALSAQVANGLAKAYIEQNL-EFKFMSSKEAS
A0A2N9LQU7      -------PK-------TRVIEIRFQNVNPKLASDVVNGIVDAYLQRNF-DVKYQGAVQVS
A0A2P6WFK7      -------PN-------TQIVEVLFRCTDPKLATDVANAVVEKYMQHTL-QTRYEGTVQVS
A0A2V8U914      -------RD-------SQIIRVAFDAHDPQLAADFANTLARTFIEQSV-NGRRRAAQEIQ
A0A2V7W309      -------HG-------TNLIVITYTGSSPKLAQKIAEAWGDSFMRMTI-AKKLDSVRQAT
A0A2W0BGU4      -------PG-------SRVVLVGFESRDPELAARIANTQVENYSDYNF-RQKYDATRQAA
A0A2W0BVQ9      -------PG-------SRVVLVGFESRDPELAARIANTQVENYSDRNF-RQKYDATRQAA
A0A2V9MN96      -------PR-------TRVIEITYIHPDPQLAAEVTNALVKTFVEENF-RTKYESTSQTA
A0A2V7V2Z1      -------KS-------SRLVMVSYESFRPEMAAAAANGLSKLYIEQTL-EFRYQTSSEAA
A0A2V7X2F7      -------KG-------TRLVGVGSEAFRPDLAMNVANKLSQLYIEQTL-EYRYQTSSEAG
A0A2V7V2I1      -------RN-------SRLVLVGFEAYRPELAAQAANKLSQLYIQQTM-EFRYQTSADAG
A0A2V7U3M2      -------KN-------SRLVLVAYESYVPEMAAAAANWLSQLYIKQTL-EFRYETSSEAA
A0A2V7UHT0      -------RN-------SRLVTVTYESYRPDMAAAAANRLSQLYIQQTL-EFRYQTSSEAA
A0A2Z5FVL3      -------PG-------TRVIEVAFSSSDPNLAARVVNQLVASLVNYSF-QSRRTVDTEAS
A0A2V9KBD6      -------KG-------TRLIQIRFRSPDPQLAADVVNGLAKDYVDHYY-QSQFQVSEQIS
A0A2W0AJ66      -------RG-------TRLIEIKFRATDPRLAADVVNYVTKAYVDRNY-SSQLYASNQLS
A0A1Q7RBU1      -------KG-------TRLIEIQFRNTDPRLAADVVNELARAYVDQYY-KSLFQVSTQIS
A0A2V9JPV9      -------KG-------TRLLEIKFRNTDPRLAADVVNQLTKAYVDRYY-RNQFEASTQMS
A0A3P0X3W6      -------AS-------SLLLKITYRSKDPRKAADVANAVAHSYIDEAM-DMRLHSSMNLS
A0A2N9MK30      -------VN-------TYLLLISYRSPDRRLAADVANAIARSFVEHTY-DIRFRSSASLS
A0A3D1ASD2      -------PN-------TYLLQITYQSANPRLAAEVANGVANSFLQHSF-EIRFKSSESVS
A0A7C5AXI3      -------PN-------TYLLLISYRNTDPQLAAAVANAIAASYLEHTY-NIRFRSSASLS
A0A7C6E4H7      -------PN-------TYLVLVSYRSPDPRLAAEVANAIANSYIQHTY-NIRYRASVGLS
A0A1F2TCR2      -------QT-------TRLVSIQYRSPDPRFAALAANTIAEEYATQNL-DLHLDNVLGKL
A0A350UQT3      -------PN-------TYLLQVSYRSPDPQLAADVANQVAQSYIEHTY-NIRIRSSQSLS
A0A7C3HRX0      -------VN-------TTLLQLSYRSDDPRLAADVANSLAQSYIEHTY-NIRIRSSASIS
A0A1F2V330      -------G--------SDSFHLAFEGRGRTQVMNVTNDLSERFIRRLA-NMREQQVNEGA
A0A662EE63      -------AE-------SNVIELSMIGRNPDRVAEWLNVYVEQYIAANI-EDGIDKTRKIY
A0A2V8TLH7      -------KD-------TGIMQITLDGPEPKEVQTWVNSVAEAYVDRNL-DLSIEATGRAV
A0A1Q7ZJT1      -------KE-------TGIVEISMEGLNPEEVASWVNTISEVYVERNL-DQVVEATSRAV
A0A2V8VC99      -------KD-------TGIVVIGLEGLNPEEVAAWANAIAEVYVDRNR-DQAVEATAKAV
A0A348UZU3      -------RM-------TRLVEVAFKAHDPALASDCVNALFDSFVDMNI-EARYETTEQAT
Q01XL7          -------RG----VGATRLIELRCQSPSPEVAANFLNTLAAEHISQNL-AIRSSATQRTS
A0A2V8ERZ5      -------RG-------SHLVDVSFVSEDPKFAAEAVNALIEEYVNQNL-ELKLQSTQGML
A0A2V8GTX0      -------RG-------SRLVDVYFVSADPEFAARAVNVLAEEYVNENL-DFRLQNTDKTL
A0A2V8J0X9      -------PN-------SRLVKIVYSHSDPKFAALAANTVADEYTQQNI-DLRLQNTEKTL
A0A523DUV7      -------PD-------TRLAQIVVEHEDPREAARWADTLAESYIEQNL-ASKIEATRNVY
A0A372IRG7      -------TG-------TQIVEIHFQNPDPEVAAKVVNAIVQAYMERDL-RSRFEGTTRVS
A0A1F2U158      -------AE-------SKLVDVYFTSADPQFAATAANALADEYVASNL-EVKMQGTQSML
A0A2V8F6S9      -------TG-------SKLVDVTFQSSEPKFAATAANALVDEYVDSNL-EIKQAGTQNMI
A0A7D8BEX2      -------PK-------SEIISISATTHSGSLSANLVNTLINDYISNSL-EVRFGSTRRVS
A0A4Q1SCH5      -------EG-------TQLVDVSFRDQNPQMAALLLNHVVDAYLRQSF-NSRYGSVAQVR
A0A2V8K4L4      -------GT-------TRIIEITSDSTDPQLAADFANTLVDEFIQKNL-DDRWKTTERTG
A0A2V8NCZ3      -------NT-------TRIIEITADSADPRLAADFANTLVDEFIEKNL-DDRWKTTERTG
A0A4Q7YNP3      -------GI-------TRLVEITCDSWNAEFAARFCNTLTTQFKEADL-ETRSSESEKTS
E8UZE1          -------RG-------TEIVQIRYKSTNPALAATIANTVAAKYIQRNF-ETKYNTTHETS
A0A2U3JZ71      -------PN-------TYLLLISYRSTDPRLAADVANGVARSYLEHTY-NIRFKSSASLS
A0A2V8TTB0      -------PN-------TYLLLISYRSPNRQLAADVANAIALSYLAHTY-RIRYKATAGLS
A0A1V6HR88      -------GQ-------TQMVDISYRSTDPALAARIANGVAETYIDWGI-ESRSNLAGKTS
A0A3E0P0A3      -------SG-------TQLFNLTYSTGDPEIAMMLANGYAEAFIETGK-ASSRADAAQAS
A0A2V8EXP2      -------RN-------SRLVDVKFSSLSPMLSSQVANALARAYIDQNL-EFKFLSSKEAS
A0A2W4RYA1      -------RN-------SRLVDVSFESPSAAFSMRVANALAKAYVQETL-DYRLSASRDAN
G8P0Y7          -------PD-------TTLVQVGYSDPSPALAAEIANGITAAYIEQNV-KSRYDSTMQAA
A0A5M8T4U7      -------GG-------TQMVDIRYRNHDPKLATDVVNTLMDTFIHENL-RSKFDQTKQTS
A0A7D0PPG7      -------PN-------TFLIDISYRSPDPRLAADVANAVAHSYISHGM-ETRAHSSVEQT
A0A7D8BF18      -------PK-------TDIIRISCSTLDARLSADIVNRLVKDYITRSF-QSRQEAEQRVT
A0A1E3Y9R6      -------RN-------SRLVDLRFRSPDPEFAARVVNQHAAQYIEQSL-EFRLAATTQTN
A0A2W4TLP2      -------RN-------SRLVEIKFQSPDPEFAARVVNAHAEQYIEQSL-QFRLEATSQTN
A0A7C4BZ42      -------GT-------TRIVEVLCDSPDPRLAADFANAIVAEFIEESL-DARWRTTEKTG
A0A3R9WF43      -------PD-------TRLINVTFENPDPTVAALAANSLAKTFIDDYL-ERRHRSTSQAS
A0A317HKM4      -------KD-------TRLVNVGFRSTDPEIAARVANALARAYVRWNV-EYRSKMTGEAS
A0A2V9CG11      -------GN-------TRVLEVLYESPDPKLAADFANTLASEFIEETQ-GMRLKAFQRTA
A0A523E0N1      -------KK-------TQLMEVSFVSPDPELSAQLANSLVVQYRQFNI-DSESGLARDTS
A0A523ECP2      -------RN-------TQLMELKFTSTEPKVAADLANALARQYMTFSM-EKETTLARDTA
A0A2W0C122      -------KN-------TRVVEVSFTGRYRDLNARIVNTLVDVFIDDNI-RSRYEAANRAA
A0A2W0AUU7      -------KN-------TRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNI-RSRYEAANHAA
A0A2W0BQL1      -------KN-------TRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNI-RSRYEAANHAA
A0A4Q1SDL1      -------SG-------TRLIEIDFTNSDPKVAAAVVNHLIQALTDYAF-QTRVNSTSEAA
A0A3P0XH15      -------PG-------TQLVEVRFRNQSPAVAASVSNAIVDRYMDRSR-RARYEGTTRIS
A0A4R1LAZ7      -------PS-------TDVVEIHFSNPDPEVATNVANAIVDAYLERDL-KSRFEGTTRVS
A0A3M1WQW8      -------RD-------TRIVKVTYESPDPQLAAQIVNALMDQLIEYTL-MARFESTRQAR
A0A3N1JHC1      -------GM-------SNLIRITLIGPDPHLAADTANELTNQYIQQGQ-NARLAAASETG
C1F294          -------PE-------TDLAEIHFQNQNPKVAQEAANEIVNAYQDWTL-RAHFETMTRIS
A0A2V9KA79      -------GN--------DAFYVSFEGTGAAQVRDVANRLAEEFIHEVS-AADESRVEEAA
A0A522PSP1      -------PG-------TYLLNVSYRSSSPDQSAAVANALAEAFIEHEY-KTRNSALVSLT
G8P085          -------PS-------TQLVTISFRNPNPQVAALLANRLIEAYLRQTF-DSRYGSVTQVT
A0A7C6A629      -------PN-------TYLLLVSYRSPDPRLAAEVANAIANSYVEHTY-NIRFRSTMGLS
A0A4Q1SGQ1      -------PG-------TRLIDVSYADPNPYLATAVVNRLLSALTEYTY-QARFQATAQAS
Q1ILD9          -------PR-------TGIVQLRFRSSDPELAAAVVNELAEAYTEHNF-QVAYESTIKAS
A0A7C5SHM3      -------EY-------SSVVGVSFRHSSPELAADVVNAVVHAYQDFFVEEIGLAPRRRAL
Q1IJZ6          -------PD-------TRLIQIAFEDPDPNFAAQVLNTLIGQYTQDVL-TRRNASTTQAS
A0A2V8TCE6      -------KD-------SNLVEVVYLSPDPRFCAQLANAVADAYIEFAL-SSQFDTTEQAS
A0A522TBE8      -------PA-------SLLLNVSYQTQSATLAAQIANAIANSFLNLEY-NSRAQALNQST
Q1ITG0          -------PK-------TQVIEIRFRSTDPALAAKVVNTLTSSYMHHNF-MTRFEATMQAS
A0A7C2ML20      -------TD----IYGQRVIGVSYTSTNARLSADVLNALFETFIDYQR-EANTQAVEFAQ
A0A7C5AXS9      -------PQ-------TRLVEVKFDSTDPEAAAKFLNVLAAEFIEQNL-EVRWETTQKTG
A0A7C2RGE3      -------RN-------TRVVAVTYSAHDPQLAARAVNELFAQYGEYML-EARSDSTRKAT
A0A3N5PCI5      -------RD-------TRIIEVRYESPDPELAARVVNTLATTYITHNL-EVQSQASKEAT
A0A3M1Q0S9      -------RD-------SQLVTISFVHPDRVFAARVANALAEAYIRFSL-AAKLDIAAQSE
A0A2Z5G448      -------PN-------TDLVEIHYRDPDPNQASRIAQAVVDQYLELDL-RSRYEGTLRIS
A0A3M1VZ38      -------RD-------SHLVEISFVHPDPRIAAEVANAIAYGYLRFTL-DRKTRIAKQSK
A0A4Q1SD29      -------PN-------TEMVEISFRNPDPKVAMEGANGIVDAYLDRDL-RAKFQGTTRVS
A0A6N9FGE2      -------RQ-------SRIVTLRFSAFEPQLAADVVNALAELHVARDM-EFRYTTSRNAS
A0A3M1PY35      -------EK-------SNVVRVSYRHRDPEIAARIVNAVVRAYRDFFV-ESGTDARRGAS
A0A3M1VMP2      -------EY-------SSVVRVSFTHPSPEIAANVVNAVVDAYRDFFV-RTGVDARRGAA
                                                                            

A0A2V7VMF7      DWLQERLGETQKGMREAQDKLAKTYQGQDGFVPEGSGG----------------------
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      AQQANDLQQKVDE-----------------------------------------------
Q01X01          ASLSGDLKEIRNR-----------------------------------------------
A0A3M2D9H8      ESLQAQIQQVEAQIADLQKQLAQSSEQSSE------------------------------
A0A2V8JK38      ELLSQQIVNLKGGLEKAEERLQKYGQDNDILF---------------TEDGRNT------
A0A2V9IXG5      DVLKRQLYEIKSMLASQQTQMNQYAESSNLPV------------------------TPEM
A0A2V9J2P4      DVLKRQLYEIKSMLASQQTQMNQYAESSNLPV------------------------TPEM
A0A1Q7RLS4      KALLSEIAPLKEKLEDTQRTSFEFAEKANLYV--------------------------PE
A0A2V2R525      AFLKKRIYELQEQIKNGEERLINYAKDNQI-I-------------------SLE------
A0A321LPW6      SWLDRSTRELQAKVQKAEQSVADYTRDHNI-Y-------------------STE------
A0A2V9R9V4      EWLDRSTRELKSKIERSEQALADYTKTNNI-Y-------------------STD------
A0A321LE75      DWLNTMVRERRAEVQKAEEELANYTREHNL-F-------------------STD------
A0A2V8R8U7      ESLAQEIAKYQDKVNKEQDARFAFAKAKDLPL-------------------GPE------
A0A2V8QMP4      DVLANEIIDLQARIQANEQKRINYRKENDLPL-------------------GTK------
A0A2V8R4S3      DVLANEIIDLQARIQANEQKRINYRKENDLPL-------------------GTK------
A0A2V8NJ55      EKLANQIAELQLKIKADEEKLLNYKEKNDIPI-------------------STA------
A0A2V8Q7I0      DLLEREISEMQGKVRTKTERLFNYAREYSLPL-------------------TED------
A0A2V8S6K4      VATARQITDLQAQIAE-----LEKKRTDALVQ-------------------SGSAVNPEA
A0A317I2L9      TMLAKEIGELQFKVKHDQEVLFNYARENNLNP-------------------TGN------
A0A2V8LLF9      IDLTNQIAKVQDKIKKEEQDRFSFAKAHNLPI-------------------DNT------
A0A352FRF4      QDLGQEIAKYQGQVKQKQADVFNYAKQYELPL-------------------TDA------
A0A2V8MKV0      AQLGSQIGTYDELVKKERDDRIAYAKQYGLPL-------------------TPT------
A0A2V8PYY8      EQLANQIATYERKVKEERDARVAYAKQYNLPL-------------------TPT------
A0A1Q7YKQ8      ELLAQKIAELQLEIRRQDEERVNYIKLKNLPP-------------------SKS------
A0A352F3R7      DVLAKEIASYQTKIKQEQEAQFNYAKNHNLPL-------------------TID------
A0A0B6WXT1      VLLAKQIAELQLKIRQGEEARINYLRSHNLPL-------------------GQA------
A0A3B9MEU8      DQLAKEIAKLQTQIKHDQEAQFNYAKNHNLPL-------------------TAE------
A0A2V8MHG6      DFLQRRIADLQSEIRSDEEQLINYAKNHQI-L-------------------SLD------
A0A2V8P7N1      DFLQRRIDDLQSEIRSDEEQLINYAKNHQI-L-------------------SLD------
A0A2V8M3M6      DFLQRRIDDLQSEIRSDEEQLINYAKNHQI-L-------------------SLD------
A0A1Q7NJH5      DFLQRRIADLQSEIRSDEEQLINYAKNHQI-L-------------------SLD------
A0A2V8PJY0      DFLQRRIADLQSEIRSDEEQLINYAKNHQI-L-------------------SLD------
A0A1Q7Y6W9      GYLQRRIADLQGEIRSDEERLINYANQHQI-L-------------------SLD------
A0A2V8NC68      DFLQKRIADLQSEIRSGEEQLINYAKNHQI-L-------------------SLD------
A0A399WK13      DFLQERIASLQSDIRRDEEKLVEMTQNAGI-L-------------------KTS------
A0A352FLX4      TYLLKRIAELQSNIRGKEEELINYGKNHQI-L-------------------SLD------
A0A2V8RTL7      DFLQKRINDLQTDIRGDEIKLVELKQSEGI-L-------------------KTD------
A0A3E0PCJ6      EFLKKRIGELQSEIRQGEERLVDLKKNAGI-L-------------------KTD------
A0A3M1S4R8      DFLAERIATLQSEIKRDEMRLAELKNNAGI-L-------------------KKD------
A0A7C2G442      DFLAERIATLQSEIKRDEMRLAELKNNAGI-L-------------------KKD------
A0A1Q7YFI6      DFLQRRIAEIQSEIRNGEERLINYAKNNQI-L-------------------SLD------
A0A136KC10      DFLQERIASLQSDIRRDEEKLVEMTQNAGI-L-------------------KTS------
A0A3M2D6Y5      DFLSERIASLQAEIKRDEMRLAELKNSAGI-L-------------------KKD------
A0A2V8SEX6      DFLQRRITDLQSEIRSDELELAELQKNIGI-L-------------------KTD------
A0A7C5ZUU4      DFLQQRIAELQAEIRNDELKLVELKKTAGI-L-------------------KTE------
A0A0B6WWQ6      QFLQRRIAELQAQIRAGEAQLLAYSKSHQI-L-------------------SLD------
A0A3B9MK99      DFLQKRIAELQQQIRSDEERLVNYARNNKI-I-------------------SLD------
A0A352EX26      DVLQKRIAELQQAIRSDEERLVNYAKNNQI-I-------------------SLD------
A0A2V8MM59      EFLSKRVAELQDKIRSDEEKLVSYAKSNQI-L-------------------SLD------
A0A2V8PFE8      EFLSKRVAELQQQIRADEEKLVSYAKNNQI-L-------------------SLD------
A0A2V8PWS6      EFLSKRVAELQQQIRADEEKLVSYAKSNQI-L-------------------SLD------
A0A2V8LCT5      EFLSKRVTELQSQIRSDEEKLVVYAKSNQI-L-------------------SLD------
A0A352FTJ9      EFLSKRVEELQAQIRAAEEKLMAYAKSNQM-L-------------------SLD------
A0A257VBK0      EVMLAEAKKMQDQYARQQTTMTTSLAASGSYF---------------PQNQKEI------
A0A2G6PYV5      NFLEEKSNEYRQRIMELYSQLGEQQKNSEDLI--VG------------------------
A0A2V8F956      DWLGQQLLEQRKQVEGAEKKLQQYREQNDSIS--MK------------DRE---------
A0A1F2S1W5      EFLVQQLAEQRNKVEASEQALQAYRERTGSVS--FE------------ERQ---------
A0A1F2T595      DFLTQQLAEQRKKVEASERALQEYRERTDSVS--LE------------ERQ---------
A0A2V8JQV5      EWLQLQLQELKVNLEKSEQELQDFGRATGLMFTSEK-------------DS---------
A0A2V9AC41      EFLKQRLTELKERVEQSETALNSYRKDKGIIS--VD------------EKE---------
A0A2V9MAM9      EWLNPQLEELKGKLVKSEGELQAYLRSSGLIF--GA------------GQE---------
A0A348V070      EFLSTQISALRKDIEEAEKKLAELGTAQGILP--LS------------SAE---------
A0A2V9M454      GWMEQRLDELKLKVEKSEEAMVTYERQNNIAN--IG------------DKQ---------
A0A2V9IVR7      GWMEQQLDELKAKVERSQQALVDYERDNKIIN--IS------------DKE---------
A0A2V9ILE2      GWMEQQLDELKAKVERSQQALVDYERDNKIIN--IS------------DKE---------
A0A2V9LGY4      GWMEQQLDELKAKVERSQQALVDYERDNKIIN--IS------------DKE---------
A0A2V9J4D6      GWMEQQLDELKAKVEKSQEALVNYERANSIVN--VN------------DKQ---------
A0A2V9L9C5      GWMEQQLDELKAKVEKSQEALVNYERANSIVN--VN------------DKQ---------
A0A2N9M9N1      AWMEQQLDELKAKVEKAQQALVDYEREYSITN--LG------------DKE---------
A0A2V9JEC4      KWMEQQLDELKTKVERSQQALVDYEKANDIAS--IG------------DKE---------
A0A2V9LPQ3      GFMEQQLEELKAKVEKSQEALVGYERQNSIVN--VS------------DRQ---------
A0A2Z5G3A3      QWLTSQMADLRKQSEALQAKVADLQKEAGVYT--VGDG---------GPDG-----KTQA
A0A2V7UGP8      EFIGTQTTELKKQVSDLEAKLNQYGKENEIIG--LD------------DKE---------
A0A239MKT6      TWLTTQLEDLKRKIEENHRQVAAFQQKSGIVSEGMSAP---------APSAGGGARGNIG
A0A3E0PCN7      EFIQKRVAELQSKIRAGEQNLLSYSRNNEILS--LD------------PDQ---------
A0A2V8IYW3      QFLESQLEDAKLRLIDREKKLEEYRRR-------YIGE---------LPSQLQSNLQ---
G2LEI9          EFLSSTAARLQQEILEEERKLTEYLRTRKIVS--LK------------PED---------
A0A317J121      QWLSGQLEETRNKLQEAQQHLQEFVQSSGNLF--VL------------QDN---------
A0A2V7YW66      TFLGTQIETLKKEVQDKETQLQAFSRRTDIVT--LD------------PAT---------
A0A2V7Z0V0      TFLSSQIEKLKEEIQDKETQLQAFSRRSDIVT--MD------------PAA---------
A0A2V8GFD4      DWLAARMAEQRSAVEASERALQQYREQYDAIS--LE------------DRQ---------
A0A2V8HSS5      DWLAARMAEQRSAVEASERALQQYREQYDAIS--LE------------DRQ---------
A0A2V8KP55      ELLSQQIVNLKGGLEKAEERLQKYGQDNDILF--TE------------DGR---------
A0A399WNU1      DFLQKRVAELQAKIRTGEESLINYAKSNQILS--LD------------ANQ---------
A0A2V9JSI3      GWMEQQLDELKAKVEKSQQAMVDYERQNAIVN--IN------------DKQ---------
A0A2V9WI32      AWLSVQLSDLQMKVETSQEKLVRYQKEHDILG--ID------------EKQ---------
A0A2V8IVN9      DWLGERLGEERKQVEAAEARLQQYREQNDAIS--LK------------DRE---------
A0A7C5Z4J3      GYMREQLDELKAKVEQSQQALVNYERANSIVD--AT------------GKV---------
A0A1F2TPT3      GWLTARLAEQKEKLDASEQALEHFREQNQLIT--AE-------------GS---------
A0A2V8JTQ2      DFLANQLKELQARVEDSQRKLVDYQKENGLFG--LD------------DKQ---------
A0A2V8UZY0      SFLANQLKELQSKVEESQQRLLAYQKQSGLFG--LD------------NKQ---------
A0A350UEK1      EWLTRQMDDLRIKLERSEDALQSYAQRNKLVF--TG------------KDT---------
A0A350UIQ4      EWLTKQLDDMRIKLERSEDALQNYAQRNNLLF--TG------------NDT---------
A0A1H5Z7N3      DFLSTQLGDLKQQVETSQEQMIDLQKKIGILG--FD------------PTH---------
A0A1G7JVV8      QWLQGQLDDLKQQVEASQEQLMDLQKKIGVLGLGADAS---------KPVT---------
A0A1H4T6W9      QWLSGQLDDLRQQVETSQEQLIDLQKRLGVLGLGFDAT---------KPPT---------
I3ZEU5          QWLSGQLDDLRQQVETSQEQLIDLQKRLGVLGLGFDAT---------KPPT---------
A0A1I6MH75      AWLQNQLDGLKQEVETSQEQMMDLQKRLGTLG--FD------------PKD---------
E8WVF6          QWLSGQLDDLKRQVETSQEQVLDLGKKLGTLG--FD------------STH---------
A0A7D0PQC3      QWLSGQLDDLKQKVETSQQRMLDLQRKLGVLG--VD------------SSH---------
A0A428MDU2      QWLSGQLDDLKQQVQTSQERMMDLQRRLGMLG--FD------------PSH---------
A0A5B9EBI2      QWLTGQLDDLKQQVETSQEQLLELQRRLGSVGVSID------------PTH---------
A0A239HDF6      KWLSKQLEDLKADVEASQEKMINLQRRLGILG--FD------------PTH---------
A0A4Q0T270      QWLSGQLDDLKAQVELSQEQMMDLQKRLGVLG--FD------------PKD---------
A0A1Q3QQB6      RWLSSQLDDLKQQVETSQEQMMDLQRKLGIVG--FD------------PNH---------
A0A3N1K1G7      QWLQGQLDDLKQSVETSQEQMMELQKRLGILG--FD------------PSH---------
A0A4V2G466      TWLSGQLDDLKQQVQASQEQMLDVQRRLGILG--FD------------PNH---------
A0A6B9YNQ8      NWLSGQLDDLKQQVQSSQERMLDVQKRLGILG--FD------------PNH---------
A0A3N5YNR8      EFLKKQLQDMKGKVEKSEQELVQYARENNIVN--IG------------PDR-----G---
A0A3N6A5T6      EFLQKQMHELKVKVEKSEEQLVAYARAHNILS--LA------------GSSSKEGDRSQ-
A0A1F2Q9L4      TFLTSQIEALKQEIQDKEAQLQAYSRRSDIVA--LD------------PSS---------
A0A2U3KC61      EWLKAKLDDLRRKVQTSEEILVRYQKDHSILG--VD------------EKQ---------
A0A2V9Y2R7      EWLSGQLADLQLKVETSEGKLVRYQKEHSILG--ID------------EKQ---------
A0A2V9NGH6      DWLSKQLIDLQIKVETSQEKLVRYQKQHQILG--ID------------EKQ---------
A0A2V9PYE6      DWLSKQLIDLQMKVETSQEKLVRYQKQHQILG--ID------------EKQ---------
A0A2V9NL07      DWLSRQLVDLQMKVETSQEKLVKYQKDHQILG--ID------------EKQ---------
A0A2V9QD92      DWLSRQLVDLQMKVETSQEKLVKYQKDHQILG--ID------------EKQ---------
A0A2V9WPZ6      DWLSKQLVDLQMKVETSQEKLVKYQKQHEILG--ID------------EKQ---------
A0A2V9ZLH4      DWLSKQLVDLQMKVETSQQKLVKYQKEHSILG--ID------------EKQ---------
A0A2V9RQF1      DWLSKQLVDLQLKVETSQEKLVKYQKEHGILG--ID------------EKQ---------
A0A2V9YDK8      DWLSKQLVDLQMKVETSQEKLVKYQKQHEILG--ID------------EKQ---------
A0A2V9V8F7      DWLSKQLVDLQMKVETSQEKLVKYQKQHEILG--ID------------EKQ---------
A0A2V9XGR9      DWLSKQLVDLQMKVETSQEKLVKYQKQHEILG--ID------------EKQ---------
A0A2V9V3Q5      DWLSKQLVDLQMKVETSQEKLVRYQKEHEILG--ID------------EKQ---------
A0A2V9NWS3      DWLSKQLVDLQMKVETSQEKLVKYQKEHEILG--ID------------EKQ---------
A0A2V9USA9      DWLNKQLVDLQMKVETSQEKLVRYQKEHEILG--MD------------EKQ---------
A0A2V9XW18      DWLSKQLVDLQMKVETSQEKLVRYQKEHEILG--AD------------EKQ---------
A0A1H5SQF5      AWLTNQLSDLKNKVAESQRRVDDFRQKVGIIG--AP------------TMSSAGSPQVGS
A0A2V9AEW6      EWLTNHLDEMKTQLEASEAQLQDYARITGLSF--TS-------------EK-----E---
A0A2V8WQK6      EWLTSHLGKMKGELEASEAQLQDYARASGLSL--TS-------------EK-----E---
A0A2V8XIF4      EFLTNHLDQMKAQLEASETQLQEYARTSGLSI--TA-------------EK-----E---
A0A2V2R0I6      SWLTDQLSELKVKVQKSEDARIAYERQNQIWT--LD-------------DK-----Q---
A0A2V8XAR9      TWLADQLSELKIKVQKSEDARIAYERQNQIWT--LD-------------DK-----Q---
A0A2V8VZA0      SWLADQLGELKIRVQRSEDARIAYERQNQIWT--LD-------------DK-----Q---
A0A1Q7CB82      SWLADQLGELKIRVQRSEDARIAYERQNQIWT--LD-------------DK-----Q---
A0A2V8WIU1      SWLADQLGELKIRVQRSEDARIAYERQNQIWT--LD-------------DK-----Q---
A0A1Q6Y9F5      TWLADQLGELKIRVQKSEDARIAYERQNQIWT--LD-------------DK-----Q---
A0A2V9EVV8      TWLADQLGELKIRVQKSEDTRIAYERQNQIWT--LD-------------DK-----Q---
A0A2V8YF91      NWLADQLSELKVKVQKSEDARIAYERQNQIWT--LD-------------DK-----Q---
A0A2V8XZK2      DWLADQLNDFKIKVQRSEDARIAYERQNQIWT--LD-------------DK-----Q---
A0A2V8ZTX6      DWLADQLRDFKIKVQKSEDARIAYERQNQIWT--LD-------------DK-----Q---
A0A2V9BT79      DWLADQLRDFKIKVQKSEDARIAYERQNQIWT--LD-------------DK-----Q---
A0A2V9YHT3      DWLTRQLSELRMKVESSQEKLVKYEKDNDILG--ID-------------EK-----Q---
A0A7C2XNI7      DWLAAQLDELKIRVEKAEDARLAYERENRIWT--ID-------------EK-----Q---
A0A1Q8B793      SWLAGQLNELKIRVEKSEDARIAYERQNQIWT--ID-------------DK-----Q---
A0A2V9BCA0      SWLADQLNELKIRVEKSEDARIAYERQNQIWT--ID-------------DK-----Q---
A0A2V9BWU9      NWLKDQLNELQFKVEKSEDARIAYERQNQIWN--ID-------------EK-----Q---
A0A2V9DKX2      NWLKDQLRELQFKVEKSEDARIAYERQNQIWN--ID-------------EK-----Q---
A0A7C2YQY3      EWMSGQLQELKAKMEKAHQSLVNYERENQIYA--IS-------------EG-----Q---
A0A3E0NV31      KFLEDQLAELENEIEDSQDQLLAFARSRDLDV--DG--------------------E---
A0A3N5M5V0      AFLKKQLQDMKGNVEKSEGDLYRYARENNILN--IN------------DRG---------
A0A3N5XQP8      KFLAEELKELRVKVEQSERDLNDYARTKGIFT--TE-------------GS-----Q---
A0A2Z5G7H4      EWLTGQLSDLKKQAEALQARVIALQRQSGVVS--LG------------VQDAQGRDQ---
A0A2V9L5B5      QWLQGKNAEIKAKLEKAEDELQAYAQANSIVY--I------------------TEKQ---
A0A2V9LK56      EWLSGRLDELKGKLEKSDNALQEYAKKNSILF--V------------------DDRK---
A0A2V9L7I0      KWLEGKIVEIKAKLEKAEDALQAYAEANSIVY--I------------------TEKQ---
A0A522PPT0      EWLSGRLVELKAKLKASEDALQAYAAKNSILF--IQ------------NAV-NAQAQ---
A0A7C5V1G5      EWLSGRLVELKAKLKKSEDALQEYAAKNSILF--IQ------------NAV-NSQAE---
A0A2V9KCS3      DWLTRQLEDQRINLEKSEDRLQGYARSSGLMF--TA-------------EK-----D---
A0A372IT17      SWLAGQMSGLKKQAEALQTKAIGLQSEAGM-------------------YG-DNGSH---
A0A4R1LC91      GWLSNQLADLRKQSEDLQARVVELQKKAGIVT--LG------------DDG-TGRTP---
A0A3M2BZG9      TLLTSQIEELSREIEKLRTKLASSAAEANLVL--DP-------------------DG---
A0A1Q7N5R7      RLLREQLQAAEAGMHRAESALEAFRVRTITLP--GD------------PGV-AAAGA---
A0A2V9QB26      QWLSRQLEDMRIKLEHSEDALQSYARSTGLIF--TS-------------EK-----T---
A0A2V9VYY4      EWLGKELADLQLKVQTSEEKLVRYQKDHGILG--VD-------------EK-----Q---
A0A3E0PHB0      KELQNSIEKLKKTIEDGEQNYIGALRESNLPV--GD------------GKG-----A---
A0A3M1SIV3      EDITKSIDQLQENIAELENQRIAQMRESGLPL--AE-------------KG-----Q---
A0A3M2D491      EDLTKSIEELKENIAQLEQQRIEEMKSSGLPL--AE-------------KG-----Q---
A0A353C9L6      ADLAKSIEELQNTIAQQEIDLIAEMRSSGLPL--QE-------------RG-----Q---
A0A2V8RQV0      EDLTKSIEELKLTIQDQESQLMAQMRESDLPL--LE-------------KG-----Q---
A0A2V8SJH5      EDISKSIEELGKTISEQEADLISYMRSSGLPL--QE-------------KG-----Q---
A0A357F267      EDLGRSIDELRETIAQQEIELIEYMRSSGLPL--QE-------------KG-----Q---
A0A7C5ZUA8      EDLDKSIEELNKTIAAQELELIDEMRKSNLPL--QE-------------KG-----Q---
A0A136JPP4      DELTKSIADLKVTIADQENKLTEYMRSSNLPL--QE-------------KG-----S---
A0A399WUJ8      DELTKSIADLKVTIADQENKLTEYMRSSNLPL--QE-------------KG-----A---
A0A2V9KIE8      DWLQGQLVGLKAKLEKSDDQLQAYAQEHSILF--IT-------------EK-----Q---
A0A352F549      SYLQKRIAELQSQIRSGEEQLVNYAQSHEILS--LD-------------AS-----Q---
A0A3B9MLP9      TYLQKRIGELQSQIRNGEEQLVNYAQSHEILS--LD-------------AS-----Q---
A0A3D5SQ87      TYLQKRIGELQSQIRNGEEQLVNYAQSHEILS--LD-------------AS-----Q---
A0A2V8NW86      QWLSRQLEDMRIKLEHSEDALQSYARSTGLIF--TS-------------EK-----T---
A0A7C2GJ20      EWLQEQLALLRERAEKAQEELVRYSRENEIVQ--LS-------------EN-----Q---
A0A7C4BTL5      DWLGRQLDEMRIKLEKSEDALQDYARKAGLVF--------------------TGEKQ---
A0A2V8ZHL8      GWMEQQLDELKAKVEKSQQALVDYERQNAIVN--IS-------------DK-----E---
A0A2V9B240      GWLEQQLDELKAKVEKSQQALVDYERQNLIVN--IS-------------DK-----E---
A0A2V9CBM2      DWLSRQLLSVKAKLEKSEDQLQAYARHNGLVF--LQ-------------TD-NGTTQ---
A0A2V8XN17      EWLSQQLVGVKAKLEKSEDELQSYARRNGLVF--LE-------------TD-KGASQ---
A0A2V8WX45      EWLTQQLVGVKAKLEKSEDELQTYARRNGLVF--LE-------------TD-KGASQ---
A0A1Q6YR79      EWLSQQLVGVKAKLEKSEDDLQSYARRNGLVF--LE-------------TD-KGASQ---
A0A1Q7VA32      EWLSQQLVGVKAKLEKSEDDLQSYARRNGLVF--LE-------------TD-KGASQ---
A0A2V9EY85      EWLSQQLVGVKAKLEKSEDELQGYARRNGLVF--LE-------------TD-KGASQ---
A0A2V9H8K0      EWLSQQLVGVKAKLEKSEDELQSYARHNGLVF--LE-------------TD-KGASQ---
A0A2V9FFE5      EWLSQQLVGVKAKLEKSEDALQGYARHNGLVF--LE-------------TD-KGASQ---
A0A2V9GM43      EWLSQQLVGVKAKLEKSEDALQSYARRNGLVF--LE-------------TD-KGASQ---
A0A2V9CYQ5      DWLSRQLLSEKAKLEKSEDQLQAYAHRNGLVF--LQ-------------TD-NGTTQ---
A0A2V9BWU8      DWLSQQLVGVKAKLEKSEEQLQDYARHNGLVF--LE-------------ND-KGASQ---
A0A2V8ZG48      DWLSQQLVGVKAKLEKSEEQLQDYAQRNGLVF--LE-------------TD-KGTSE---
A0A2V8Y334      DWLSQQLVGVKAKLEKSEEQLQDYARHNGLVF--LE-------------TD-KGASE---
A0A2V9AY68      DWLSQQLVGVKAKLEKSEEQLQDYARHNGLVF--LE-------------SD-KGVSE---
A0A1F2RFI7      DWLSQQLVGLKGRLEKSEEDMQRYAKDNAILF--LD-------------EK-----Q---
A0A1F2RZS3      EWLSQQLVGLKGKLEKSEEDLQRYAKENSILF--LD-------------EK-----Q---
A0A1F2USE2      EWLSQQLTGLKAKLEQSEEELQTYAHEQGLLF--LQ-------------NQ-RGENE---
A0A7C2VB08      EWLGQQLDGLKVKLERSEEELQRYARENGLLF--LE-------------TS-EGQPE---
A0A2V9C238      EWLSQQLLELKARLEKSENEMQSYARENGLLF--LE-------------KE-KG-AE---
A0A1F2Q9F5      EWLSEQLLEIKANLEKSEEQLQAYARQNGLLF--LE-------------NE-AGQPE---
A0A1F2QQH9      EWLSEQLLEIKANLEKSEEQLQAYARQNGLLF--LE-------------NE-AGQPE---
A0A1F2QXK7      EWLSEQLLEIKANLEKSEEQLQAYARQNGLLF--LE-------------NE-AGQPE---
A0A2V9DEM9      EWLSQQLLELKARLEKSENELQSYARENGLLF--LE-------------RE-KGVPE---
A0A7C5TWV7      QVISEKLNPLRQQLEQSEQKLISFKEKEESFL---------------VGDQDKN------
A0A2V7XDY0      EWLQERLGATQKSMREAQDRLFKSYQSQDL-------F---------VPEGSTS------
A0A2V8G155      DWLEERLAEQRKVVEQAEARLQAYREEHDA-I-----V---------PAEDRQN------
A0A2V8HDM7      DWLEERLAEQRKVVEQAEARLQAYREEHDA-I-----V---------PAEDRQN------
A0A2V8DRT9      DWLGERMGEQRKTVDASERALQVYREQHDA-------V---------SLEERQN------
A0A2V7VYF3      DWLGQQLAEQRKKVEVSELAIQRFREDNDA-------V---------SLEDRQN------
A0A1F2SVH2      DWLGERLAEQRKQVEASEQAVQRYREQTDS-------V---------SLEEKQN------
A0A2V8AJG9      DWLGERLSEQRKQVEASEQALQRYREQTDS-------V---------SLEDKQN------
A0A2N9LQU7      EWLSKQMEELKLNAARAEQRLAEFQKQNNI-------L---------GTDENNN------
A0A2P6WFK7      NWLSKQMDDLQTRATQSQQRLSEFQMKNNM-------I---------GADENDN------
A0A2V8U914      EWLGPRIQELRSKLQTSEAALDEYTRESGL-------V---------LAPGDDT------
A0A2V7W309      EFLSQQIATVQANLEESRQDLLSYGKSKGI-------I---------SVDEGSN------
A0A2W0BGU4      GKMEEQLDELKAKVEKSQRALVEYERQNAI-------L---------SIGEKQN------
A0A2W0BVQ9      GKMEEQLDELKAKVEKSQRALVEYERQNAI-------L---------SIGEKQN------
A0A2V9MN96      DWLSKELSDLQLKVQASEEKLVRYEKQKGI-------V---------GIDEKQN------
A0A2V7V2Z1      QWLGQQIEEQKGKVEQAERALQQVKEQEGI-------V---------NIEERRT------
A0A2V7X2F7      VWLGGQIDQQRQKVEQATQELQKLKEREGI-------V---------NIEERRT------
A0A2V7V2I1      LWLGSQIEEQRHKVEQAELALQKLKEKDGI-------V---------NIEERRT------
A0A2V7U3M2      QWLGQQIEEQKAKVEAADLALQKVKEQEGI-------V---------NIEERRT------
A0A2V7UHT0      QWLGQQIEEQKTKVEEADRALQKVKEQEGI-------V---------NIEERRT------
A0A2Z5FVL3      KFLESQLAEMKADSDALEQKAVKLQKQTGV-------VQVAGSGDGDGQGQAYS------
A0A2V9KBD6      AFLTNQLKELQARVEDSQQKLMEYQKQNGI-------L---------GLDNQQN------
A0A2W0AJ66      QFLLNQLTDLKAKVEESQQKLVDYQNRNGI-------F---------GLDDKQN------
A0A1Q7RBU1      EFLANQLKELQAKVEESQQKLVDYQKENGI-------F---------GLDDKQN------
A0A2V9JPV9      EFLASQLKELQAKVEESQQKVVDYTKEIGI-------F---------GLGDKQN------
A0A3P0X3W6      GFMAKQLDDLKANMDKSAEALTTYQRQLGV-------I---------DPEQQTS------
A0A2N9MK30      TFMEKQLEELRAKMERSDTALAQFEKELNV-------I---------NPEEKTN------
A0A3D1ASD2      QFMTKELEELKAKMERSSDALAKFQRDLSV-------V---------NPEEKTS------
A0A7C5AXI3      AFMEKQLEELKAKMERSSAALAQFEKELNV-------I---------NPEERTN------
A0A7C6E4H7      SFMEQQLEELKAKMERSSAALAQFERELNV-------I---------NPEEKTS------
A0A1F2TCR2      AWLDDELKKQQQKVTDSEAAMMQYREQKDA-------L---------SLDSSQN------
A0A350UQT3      RFMERQIEELRVKMEDSSGRLAQMERELNV-------I---------NPEEKTN------
A0A7C3HRX0      RFMERQIEELRAKMEASSERLARLEREMNV-------I---------NPEEKTN------
A0A1F2V330      GLLNAELETLRSQLNEQEERLKIYKESAVN-------E---------LPDRLAT------
A0A662EE63      KVIQSRLDPLRLQVEAGQRKLMSFQEGHDS-L-----G---------FADEQKS------
A0A2V8TLH7      KALLSEIAPMREKLQDTQRSSFELAEKENL-------Y---------VPENQQK------
A0A1Q7ZJT1      KALLSEIAPLKEKLEDTQRTSFEFAEKANL-------Y---------VPENQQK------
A0A2V8VC99      RALLSEIAPLREKLKDSQQSTFEFAERANL-------Y---------VPENQQK------
A0A348UZU3      EFLSEQIAELKKEISQKEQELQNYGQEKDI-------V---------ILSDKET------
Q01XL7          QWMDSQMEEAKSRLQTAGEKLRDFVRQSGM-------D---------FFPEQST------
A0A2V8ERZ5      DWLDKELDNQQKRVEGSEKGLAEYREKENA-L-----S---------LDDK-QN------
A0A2V8GTX0      QWLTEEVAKQQSVVQASERMLAEYRENQNA-I-----S---------LEDR-QN------
A0A2V8J0X9      QWLGEELKRQEQQLAASEGALTEYRERNNA-L-----S---------LEDR-QN------
A0A523DUV7      SWLQERLAAAEGDVKSSENSLYEYTKQQDL-------F---------VPSGGQS------
A0A372IRG7      NWLSQQLSTLKSQVQSSQQELSDYQKKNNL-V-----G---------LGPTGTS------
A0A1F2U158      DWLEKEVATQQSKVEQSERDLAEYRDRENA-M-----S---------LDEK-NN------
A0A2V8F6S9      EWLDKELAKQLQKVQESERAMANYRERQNA-L-----S---------LDDK-QN------
A0A7D8BEX2      QWLIGQLNELKGQVQSDQEKLVDLESKLGL-L-----A---------LDPRNPAY-----
A0A4Q1SCH5      DWLSAQMDDLQKHAADAQQKLAKFQEDNNL-V-----G---------TDPT-DN------
A0A2V8K4L4      EWLTKQLDDLKIKLERSEDTLQSYALAVGLQFTASSKG---------KDGDQEN------
A0A2V8NCZ3      EWLTKQMDDLKIRLEKSEDTLQSYAVAVGLQFTGAA-S---------KDGEQEN------
A0A4Q7YNP3      RWLAQQAADIKLLAEESQHKLEAATGGNGL-------V---------LSQESTT------
E8UZE1          AWLQDQLETLRHQVDADQKNFEEFQERTGL-------L---------QTGEGHN------
A0A2U3JZ71      AFMEKQLEELKAKMERSSGALVQFERELNV-I-----S---------PEEK-TS------
A0A2V8TTB0      EFMERQLEELRAKMEKSSAALAQFERELNV-I-----N---------PEEK-TS------
A0A1V6HR88      VFLGAQIETLKQEIQDKENQALAYSKRADI-V-----T---------LDTG-GN------
A0A3E0P0A3      SDIQAEISSLEAEIQELEADLVSYTQSSDI-V-----A---------PNEE-TN------
A0A2V8EXP2      DWLGERLAEQRQKVEVSEQAVQRYREQTES-V-----A---------FEDR-QN------
A0A2W4RYA1      DWLMARLAEQRKAVEEAEAALQRYREQNNA-L-----S---------LQDS-QN------
G8P0Y7          DWLSKQLADMQIKMETAQAKLVQYQKEHAI-V-----G---------TDDK-QN------
A0A5M8T4U7      AWLEKQLEDLKEQAADAQIRLANFQKQHNI-V-----G---------TDEN-SN------
A0A7D0PPG7      AFMEKQIAELKKNMDNSAIALEAYQRRLGI-I-----N---------PDEK-TS------
A0A7D8BF18      EFFSHQLDDLKKQVEASQGNMIDLQKQLGV-L-----G---------FDPNLNQ------
A0A1E3Y9R6      AWLTSQLEEQRRLVEESERRLQDYKEQNNA-T-----S---------VDDK-QN------
A0A2W4TLP2      AWLNTQLEEQRRLVEESERKLQQYKEQHNT-V-----S---------VDDK-QN------
A0A7C4BZ42      EYLTRQLQDLKIKLEKSEDELQQYASAVGL-QLTASDS---------KDGGKEN------
A0A3R9WF43      YWLQKELDDLKKQVRDSEQRLADYERTTGL-AGVQVSG---------STSG-DGTSSVSV
A0A317HKM4      AWLSRQVEEQRKLLEASETALQAYRRDHGADALVRTNQ---------LGEERQN------
A0A2V9CG11      EHLTVKLDEMKAKLEQSEAQLQDYARTSGL-T-----F---------TSEK-DN------
A0A523E0N1      SFIDEEIGELRNDIQEKERLLRDYSRENQI-V-----I---------AEDENNS------
A0A523ECP2      GFIREQVEKIQVEIQEREQRLQEYSQRQDL-M-----M---------VDEK-EL------
A0A2W0C122      KFLSAQLTELRATVEESQQKLVAYEREHNI-L-----M---------VDDK-QN------
A0A2W0AUU7      KFLSTQLNELRAKVEESQQKLVAYEREHNI-V-----M---------VDEK-QN------
A0A2W0BQL1      KFLSTQLNELRAKVEESQQKLVAYEREHNI-V-----M---------VDEK-QN------
A0A4Q1SDL1      TWLTGQLGDLRKQSEEEQEKLAALEKQTGI-Y-----S---------FGTDNQGREQVYS
A0A3P0XH15      EWLAKQLEPLKNQVTESQDALSTYQKQNNL-I-----G---------VDSNGSGQD----
A0A4R1LAZ7      SWLAQQLTALKGQVEDSQKALAKFQRDNNL-I-----G---------IDSEGGN------
A0A3M1WQW8      EWLNKRLTELREKLEQLQEELVRYSREHEI-I-----Q---------LDEN-QT------
A0A3N1JHC1      VFLTQQLEGAKKKLQESGEALQEYARASGI-V-----L---------TSETQEP------
C1F294          DWLSQQIISLRESVNKSQNDLVQYQREHNL-L-----S---------VGQQGSS------
A0A2V9KA79      GLVGARVEQLRKQMQEQQDRITRYKQATLS-ELPENLG---------NNYKLLE------
A0A522PSP1      QYMREQVKELSERMKESQLALNAFERENSI-I-----N---------PENT-SG------
G8P085          KWLSSEMDSLRERAAEAQKKLADFQEKNNI-LMLGGGS---------SGSSKDGGGESPS
A0A7C6A629      SFMEKQLEELKAKMERSSAALAQFERELNV-I-----N---------PQEK-TS------
A0A4Q1SGQ1      DWLAGQLKGLRAQTQALEDRASRLQRDTGI-Y-----G---------DDAG-HN------
Q1ILD9          DWLAKQLVELKTGIQSSEQQIADYQKTHKI-I-----G---------TDEN-NN------
A0A7C5SHM3      EVIEDGIDEANAELREIEGQLEQATRTHDA-A-----L---------VASD-RD------
Q1IJZ6          EWMSAQIKDLNQQVEAAQQKLINYEKESGL-I-----A---------ITATDPKNPAAAP
A0A2V8TCE6      DFLSRRVGELRDEVEDLEKRLQSYRESRRI-L-----P---------SAGA-EN------
A0A522TBE8      AYMSGQLDNLRAQTEQAQQNLVSYESRANI-L-----D---------PDSK-DN------
Q1ITG0          AWLQQRLTELKNNVEESQRKLAEYQSKANI-I-----G---------TDET-DN------
A0A7C2ML20      DWLTRQLAELESKVNKSKETLLRYHENVDL-V-----T---------TGEGEEN------
A0A7C5AXS9      EWLTRQLQELKIKLERAEDELQRYARTAGL-M-----F---------TAEK-DN------
A0A7C2RGE3      EWLQEQLTLLRDRAEKAQEELVRYSRENEI-V-----Q---------LSEN-QT------
A0A3N5PCI5      TWLAEQLAEQRRKVEVSELALQKYRERENS-L-----S---------LEAG-QN------
A0A3M1Q0S9      AFLVDQVRSLKEDINRRRLELHEYAMRHNI-V-----T---------GDA--NE------
A0A2Z5G448      NWLSGQLTELKAHAADAQRKIAQFQRANNL-I-----G---------MDAEGGN------
A0A3M1VZ38      DWFVERVAELKREVSDLELALQDYAAQHQI-V-----L---------GQG--ED------
A0A4Q1SD29      NWLSQQLTSVKKQVEDAQQDLAKFQRENNL-V-----A---------MDATGGD------
A0A6N9FGE2      KWLEQRIAEQRQKLEASERALQTYREEHGA-A-----G---------IADR-QN------
A0A3M1PY35      EFLDRRIEDAQAELLELERRLAEERRRLGP-V-----L---------ARGS-DE------
A0A3M1VMP2      DFLERAIQEAQAEVLELEAKLAQARRQAPP-T-----V---------PERE-DE------
                                                                            

A0A2V7VMF7      -------SAAASSIGKLNEDYVAAQARRIGIEAALKQFAEMRKA-----RKNLDTIPQVA
A0A2V7YYV7      -----------GELKDIQTSHLQVPNSRL-------------------------------
A0A2V7Z0J5      -----------KEVNQIQQAETQSTNARS-------------------------------
A0A2V7Z3M4      -----------SEVKQIQQAETQSPNTRT-------------------------------
A0A399Y5V2      -------AT---------------------------------------------------
Q01X01          -------A----------------------------------------------------
A0A3M2D9H8      -----------KRLQDVTNIISGLQAE---------------------------------
A0A2V8JK38      -------VT--EKLRQLQEEYTRAQAERIQKQSYERMVR----T------GSADALPQIT
A0A2V9IXG5      ASVEF------EMVSRYRADYEDAKAKREEEEQKLAKLETYIAD-----SSKLTNIPELV
A0A2V9J2P4      ASVEF------EMVSRYRADYEDAKAKREEEEQKLAKLETYIAD-----SSKLTNIPELV
A0A1Q7RLS4      NQQKI--TN--DRLSTLQSELTEAQVKKGEIEGLLKQID-----------ANRQNGGAYE
A0A2V2R525      PSQNT--VV--ERLNSLNRSLLTAENDRTLAEAAYRAAL----E------PGAAEALAAS
A0A321LPW6      GKETL--TT--DKLSRLHDQVMRAETDRLLKGSLYEELN----M------GRLDRLSEAF
A0A2V9R9V4      GKATL--VA--EKLSRLHDLATRAETDRILKESLYEQVR----Q------GRVAQIPEAF
A0A321LE75      GKEAP--AV--NKLAQLYTQVTTAEVQRKLKESLYQQVK----G------GNIDVATEAF
A0A2V8R8U7      SGPNI--EA--VRDATYSSQLLAAENERRTFLAIYEAAKN---A------PDPFANPEVQ
A0A2V8QMP4      QGQDL--NA--LQLSTYSSQMQTAEAA-------YTSAEQTKNT------SGIWAIPQVQ
A0A2V8R4S3      QGQDL--NA--LQLSTYSSQMQTAEAARKQAEADYKSAVETRNT------SGIWAVPQVQ
A0A2V8NJ55      QGVDI--TN--VRVGSYSSQLIEAENKRKQAQATYDAARN---S------SDPWSIPEIQ
A0A2V8Q7I0      VMLNT--EA--QRLADLTKQLFESENKRKNAEAVYKSAST---A------TDKFSIPEVQ
A0A2V8S6K4      KGANV--TV--ERVAMLSTEWLNAQNEVTKLQSEYDAAQKAQAA------SDIFSIPKVQ
A0A317I2L9      QNLDV--EG--QRLNSLSGQLLDAENQRKTAQAIYNSAKN---A------SDPFTVPEVI
A0A2V8LLF9      PGTNL--EA--MRLQTYSAQLLAAEDNRRSQEAIYDAARD---A------NDPFNAPEIQ
A0A352FRF4      PASNL--RQ--QRVSTYSSQLLEAENQKRSLQSAYEAAKT---S------PDPFANPEVQ
A0A2V8MKV0      EN-NV--PI--QREQTYNKQLLDAQNEYRKLKADYDEAKA---S------TELLSNPEVQ
A0A2V8PYY8      EN-NV--AA--QSEQAYNKQLHDAENERRKLKADYEEAKG---A------ADLISNPEVQ
A0A1Q7YKQ8      PGADL--AA--DRLAQLSKQLLEAENNRKNLQSLYEAAAH---Q------SNPMAVPDVA
A0A352F3R7      ASSNL--EV--ARLSTLSSQLLQAENDRKLIQAQLEAARR---E------KDPFSIPDVN
A0A0B6WXT1      KGQNL--TL--ERLATLSGQLLEAENERKNLQSAYEAAQR---E------TDIWSVPEVQ
A0A3B9MEU8      AGGNL--EA--ARLATLSGQLLQAENDRKMIQAQLEAARK---E------PDPFSVPDVN
A0A2V8MHG6      ASQNT--VV--DRLAGLNKQLLEAENERKAAEAAYRATL----A------PGALEAQAEA
A0A2V8P7N1      ASQNT--VV--DRLAGLNKQLLEAENERKAAEAAYRAVL----A------PGALEAQAEA
A0A2V8M3M6      ASQNT--VV--DRLAGLNKQLLEAENERKAAEAAYRAVL----A------PGALEAQAEA
A0A1Q7NJH5      ASQNT--VV--DRLAGLNKQLLEAENDRKAAEAAYRAVL----A------PGALEAQAEA
A0A2V8PJY0      ASQNT--VV--DRLAGLNKQLLEAENDRKAAEAAYRAVL----A------PGALEAQAEA
A0A1Q7Y6W9      PGQNT--VV--ERLAGLNRQLLEAENQRKLAQAVYEASL----Q------PGASEARAED
A0A2V8NC68      ASQNT--VV--DRLVGLNRQLLEAENDRKMAEASYRAAL----R------PDAASAMVE-
A0A399WK13      DDSTI--VM--DRLSGLNKAMLEAENARKNAEANYFEIAK---S------PERLSAMAEA
A0A352FLX4      ANQNT--VV--ERLEGLSKQLLIAENERKMAESAYKASL----Q------PGAAEALAEG
A0A2V8RTL7      GDQTI--VI--DRLSGLNKQLLEAENARKLAEAKYFAIKD---S------PESLNALAEQ
A0A3E0PCJ6      ENTTI--VT--QRLMGLNEQLLEAEEQRKNAEAQFNAVRD---S------PSRLSALAEE
A0A3M1S4R8      EGQTI--VI--DRLAGLNKQLLEAENIRKIAEAEYMAVKD---S------PEKLRALAEE
A0A7C2G442      EGQTI--VI--DRLAGLNKQLLEAENIRKIAEAEYMAIKD---S------PEKLRALAEE
A0A1Q7YFI6      GSQNT--VV--ERLAGLNRQLLEAENERKLAEAAYRAAQ----A------PGAAEALARE
A0A136KC10      DDSTI--VM--DRLSGLNKSMLEAENARKNAEANYFEVAK---S------PERLAAMAEA
A0A3M2D6Y5      EGQTI--VI--DRLAGLNRQLLEAENARKIAEAEYNAVKD---S------PDRLKALVEE
A0A2V8SEX6      GEQTI--VL--ERLAGLNKNLLEAENKRKNAEAQYVAIKD---S------PEAINALAEQ
A0A7C5ZUU4      GEQTI--VL--DRLSGLNRDLLEAENARKLAEAKYNSVLS---S------PDNARALTEE
A0A0B6WWQ6      PSQNT--VV--ERLAGLNRQLLDAENERKLAEAAYLASL----E------PGAAEAMVEK
A0A3B9MK99      ANQNT--VV--ERLGGLNKQLLEAENARIEAESKFNAAK----V------GGAATALAEV
A0A352EX26      ANQNT--VV--ERLAGLNKQLLEAENERKTAEAAFNAAK----A------PGAASALAEG
A0A2V8MM59      ANQNT--VV--ERLSGLNKQLLEAENDRKLAEAEYNAAK----A------PGAANALAEA
A0A2V8PFE8      ASQNT--VV--ERLAGLNKQLLEAENDRKMAEAEYNAAK----A------PGAATALAE-
A0A2V8PWS6      ASQNT--VV--ERLAGLNKQLLEAENDRKMAEAEYNAAK----T------PGAATALAEA
A0A2V8LCT5      ASQNT--VV--ERLAGLNKQLLEAENDRKMAEAEFNAAK----A------PGAASALAEA
A0A352FTJ9      ANQNT--VV--ERLAGLNKQLLEAENDRKMAEAEFNAAK----A------PGAASALAEA
A0A257VBK0      -------LD--TKIASINERLTQVGVKESEVAAIASQLE----AWRTSG-GDPLSIPAVA
A0A2G6PYV5      ---RAKSAVEEQALVKLNEEIAVANRSFIEKRNNLQALQ----A------STPSQAIEV-
A0A2V8F956      ---NI--VV--QKLTELTGAVTQAKTERFQREALYRQVE----S-LRGNPAMLDTFPAI-
A0A1F2S1W5      ---NV--VV--QRLADLNAAVTKANTVRIQKEATYNQVK----A-VLENPAAIDTVPAI-
A0A1F2T595      ---NI--VV--QKLQELNAAVTRANTARIQKEAVYNQVR----T-VLEDPAAMDTVPAI-
A0A2V8JQV5      ---SV--AE--EKLHHLEADLSEALADRVEKQSKYEIAK----S------APVESLPQI-
A0A2V9AC41      ---NV--VI--DRLLDLNRSLTKAEAERIGLEAQMHSIH----G------RNYDEVPLV-
A0A2V9MAM9      ---TL--AE--NRLHLIESELSKAQADRIAKTPAYQLAD----K----------EHPELL
A0A348V070      -------APLIQKITEVNTALTAATLDRVNKFSAYNQLK----A------LRPEELPES-
A0A2V9M454      ---TA--EE--ARFEDMSKELSQAQSDRISKESLYKMVV----S--------NEAQVGFI
A0A2V9IVR7      ---NV--EE--KKLGDLSKELTDAQAEVVRAESLYNVAR----N--------NENQMASL
A0A2V9ILE2      ---NV--EE--KKLGDLSKELTDAQAEVVRAESLYNVAR----N--------NENQMASL
A0A2V9LGY4      ---NV--EE--KKLGDLSKELTDAQAEVVRAESLYNVAR----N--------NENQMASL
A0A2V9J4D6      ---SV--AE--QRLSELSSDLTRAQSDRAEKESLHQLVK----S--------NEAQIALL
A0A2V9L9C5      ---SV--AE--QRLSELSSDLTRAQSDRAEKESLHQLVK----S--------NEAQIALL
A0A2N9M9N1      ---NV--VQ--QRLAQLSTDLTAAQVERANKQSVYDSAR----H--------NNAEAAVL
A0A2V9JEC4      ---NV--VQ--LRLEDLSKDLTTAQTDRAQKESLWESVQ----E--------DNSLAEVA
A0A2V9LPQ3      ---NV--VE--QRLSDLSRDLTTAESDRAQKESLYQMVK----S--------NPEQIAML
A0A2Z5G3A3      YSSDI------NRLELATTALSGAESNRILTGAVEQIVK----T------GDPELISGLA
A0A2V7UGP8      ---NI--TN--QKLGQLNQDVLEAQVESSRKEARYRGLL----T------TPPGSIKEV-
A0A239MKT6      AMAPSVDSTAFQRLSALNEELTRAEVARIQREALYHIIQ----T------NDVDLVLNSA
A0A3E0PCN7      ---NI--VV--QRLSDLNGKLNQAEMERINAEAALSAAQ----Q------DPMRGVTVAS
A0A2V8IYW3      ---VIQTTQ--IQLQSLSESLNRDRDRRLVLERGLADMR----A------DPATAAATAD
G2LEI9          ---NP--EV--ARLTGLNQALLEAEKERLRAEERYQASL----T------QPIDSLDEM-
A0A317J121      ---TL--DN--SKLRQLQGELSAIQADRIAKQAKYELVA----K------TSPEALPGV-
A0A2V7YW66      ---NV--IL--KRLEVLNGSLMEAKRVRIEKEAKYHETI----T------GPKENVADS-
A0A2V7Z0V0      ---NV--TL--KRLEALNTQYIEAKKMRIEREAQYHETQ----S------GPRESMSDS-
A0A2V8GFD4      ---NI--VV--QRLEDLNGAVTKAHTERLQKQALFEQLQ----AARGDA-AALDRFPTV-
A0A2V8HSS5      ---NI--VV--QRLEDLNGAVTKAHTERLQKQALFEQLQ----AARGDA-AALDRFPTV-
A0A2V8KP55      ---NT--VT--EKLRQLQEEYTRAQAERIQKQSYERMVR----T------GSADALPQI-
A0A399WNU1      ---NT--VV--QRLSDLNTKLSQAENDRITAEAAYKAAL----N------NPLAGTTAQA
A0A2V9JSI3      ---SV--EE--QRLAQLSNDYTNAQNVRLDKESLFELAS----S--------NEAEAAVL
A0A2V9WI32      ---NI--VT--SKLDELNKELTAAEGDRIQKESAYKLAS----A------GNPEIFAKA-
A0A2V8IVN9      ---NI--VV--QKLSDLNSAVTQAKTERLQKEALYSQLN----SLRSGRGAALDTFPAI-
A0A7C5Z4J3      ---NV--EE--QRLADLSQDLTAAQNDLAQEESLYLLVK----S-------NPEKVGML-
A0A1F2TPT3      ---PI--VM--ARLNELSASITRAQTGLFDKEASYNRAL----ALRA--NPDKLDQLPQM
A0A2V8JTQ2      ---NI--VT--TKLTDLNRELTAAEVDRVQKDVNYQLAR----S------GQPDLVARL-
A0A2V8UZY0      ---NL--VT--AKLDDLNRGLTAAEADRIQKEVNYRLAV----S------GRPELIAKL-
A0A350UEK1      ---NV--DE--EKLKQIQDQLTAVQGDRVSKQSRWEMAS----S------APAETLPDV-
A0A350UIQ4      ---NV--DE--VKLKQIQDQLTAVQGDRVSKQSRWEMAS----S------APAASLPDV-
A0A1H5Z7N3      ---NE--IT--TSLEDLNRAVGQAQISRIMAEVRYHTLS----G------MDPNQIDDSV
A0A1G7JVV8      ---TQ--VT--AAVEALSTAAIAAKVQRILAESRYRVLA----S------SDPALMESNL
A0A1H4T6W9      ---TQ--LA--VSVDALSTASVGAKVQRILAESRYRVLA----N------SDPDLLESNL
I3ZEU5          ---TQ--LA--VSVDALSTASVSAKVQRILAESRYRVLA----S------SDPDLLESNL
A0A1I6MH75      ---NQ--TT--STLEDLSKASGAAHIARILAESRYRMLS----G------MDPGTIDGTI
E8WVF6          ---NQ--IA--SSLEDLAKASGTAKLARIIAESRYRMLN----G------MDPNAIEGSI
A0A7D0PQC3      ---DE--IA--AAIEDLQKAAGVARLQRIVSEARYRLLA----G------MDPDAMEGSI
A0A428MDU2      ---NQ--IS--TSLEDLSKAAGDARIARIVAESRYRMLA----G------MDPNTMEGSI
A0A5B9EBI2      ---SQSEIT--SLIDSLTKAAGDARINRIIAESRYRALA----Q------ADPASMEGLI
A0A239HDF6      ---NQ--IS--TSLDDLAKASGQAKLARIIAESRYRMLS----G------MEPDAIEGSI
A0A4Q0T270      ---NQ--IS--SSLEDLSKASGTAKIARIVAESRYRMLS----G------MDPDSIDNSI
A0A1Q3QQB6      ---NQ--IS--SSLEDLSKAAGEAKIARIIAESRYRVLS----G------MDPDSVESSI
A0A3N1K1G7      ---NQ--IS--SSLEDLSKAAGEARIARIIAESRYRILS----G------MDPNTIEGSI
A0A4V2G466      ---SQ--IT--ASLEQLSTASNDAHIVRIMAESRYRMLS----G------MDPNTIEGSL
A0A6B9YNQ8      ---SQ--IT--SSLEQLSTASNQARIARIMAESQYRMLS----T------MDPNSIEGAV
A0A3N5YNR8      ---SI--VL--QTLEDLNRQMTTVEGELIGKTADYQAVR----D------ATPENFPQS-
A0A3N6A5T6      ---NI--IM--QKLADLNQEMTKVEAQMIERSAEFDAVK----N------ATVQDFPDAL
A0A1F2Q9L4      ---NV--TL--QRLEGLNKDYVGAMSERIGKEAHYKELA----N------TPDDMVADT-
A0A2U3KC61      ---NI--VT--AKLNELNNELTVAQTDRIQKESNYNLAM----A------GDPAEFAKPS
A0A2V9Y2R7      ---NI--VT--AKLDELNKELTEAQTDRIQKEANYKSAM----V------GDPTAFAKIQ
A0A2V9NGH6      ---NI--IT--AKLDELNRELTTAESGRMEKESIYGLVQ----A------TDSDAAAAAA
A0A2V9PYE6      ---NI--IT--AKLDELNKELTAAESGRMEKESIYGLVQ----A------TDSDAAAAAA
A0A2V9NL07      ---NI--TT--AKLDELNKELTAAESARMEKESVFRLSD----S------VDTESAAAVA
A0A2V9QD92      ---NI--TT--AKLDELNKELTAAESARMEKESVFRLSD----S------VDTESAAAVA
A0A2V9WPZ6      ---NI--TT--AKLDELNKELTAAESERMEKESVYRLIQ----S------GDPDVVASVP
A0A2V9ZLH4      ---NI--IT--EKLDELNKELTAAESDRMQRESLYRLTR----S------GDPDVIATAT
A0A2V9RQF1      ---NI--IT--SKLDELNKELTAAESDRMQKESVYRLVQ----S------GDPDTAASAA
A0A2V9YDK8      ---NI--TT--AKLDELNKELTSAESERMEKESVYRLIQ----S------GDPDVIASTT
A0A2V9V8F7      ---NI--TT--AKLDELNKELTAAESGRMEKESVYRLIQ----S------GDPDVVASAP
A0A2V9XGR9      ---NI--TT--AKLDELNKELTAAESGRMEKESVYRLIQ----S------GDPDVVASAP
A0A2V9V3Q5      ---NI--IT--QKLDELNKELTSAESERMEKEAIYRMTQ----T------GDPDAVASAV
A0A2V9NWS3      ---NI--TT--SKLDELNKELTSAESDRMAKESFYTLVQ----A------ADADTAAAAA
A0A2V9USA9      ---NI--TT--AKLDELNKELTSAESERMDKEAFYRLVE----S------GDPDAIASSA
A0A2V9XW18      ---NI--TM--AKLDELNKELTAAESERMDKEALYRLVD----S------GDPDAILSSA
A0A1H5SQF5      DLGSV--EL--ARLNDLNAQLTAAETVRIAAEAAYRMTQ----S------RDADVVLGI-
A0A2V9AEW6      ---SL--AE--ARLKEIQDELSKAQADRIANQAKYAEAA----G------KSADSLPEI-
A0A2V8WQK6      ---NP--VV--NRLKELQDELSKAQADRIAKQAKSEEAR----S------KPADSVPEM-
A0A2V8XIF4      ---NP--AE--NRLKELLDELSKAEADRIAKQAKFEEAQ----S------KPADSLPEM-
A0A2V2R0I6      ---NI--AT--QRLGDVNRELTQAQSERMKREALFEFAK----A------GNLDAVPQM-
A0A2V8XAR9      ---NI--TT--QRLSDINKQLTDAQSERMKKESLYEFAK----S------GNLDAVPQV-
A0A2V8VZA0      ---NI--TT--QRLSDINKQLTDAQSERMKKESLYQFAK----A------GNLDAVPEV-
A0A1Q7CB82      ---NI--TT--QRLSDINKQLTDAQSERMKKESLYQFAK----A------GNLDAVPEV-
A0A2V8WIU1      ---NI--TT--QRLSDINKQLTDAQSERMKKESLYQFAK----A------GNLDAVPEV-
A0A1Q6Y9F5      ---NI--TT--QRLSDINKQLTDAQSERMKKESLYQFAK----A------GNLDAVPEV-
A0A2V9EVV8      ---NI--TT--QRLSDINKQLTDAQSERLKKESLYQFAK----A------GNLDAVPEV-
A0A2V8YF91      ---NI--TT--QRLSDINRQLTEAQSERMKKESLYQFAK----S------GNLDAVPQV-
A0A2V8XZK2      ---NM--TT--QRLGDINRQFTDAQSERMKKESLYEFAK----A------GDLDAVPQV-
A0A2V8ZTX6      ---NM--TT--QRLSDINKQFTDAQAERMRKESLYEFAK----A------GNLDAVPQV-
A0A2V9BT79      ---NM--TT--QRLSDINKQYTDAQAERMKKESLYEFAK----A------GNLDAVPQL-
A0A2V9YHT3      ---NI--IT--AKLNDLNKAYTDATNDRIHKQATYRLTL----N------SSPELLSQA-
A0A7C2XNI7      ---NI--TT--QKLADLNTELTQAQADRMRKEASYRLAR----E------GNVDGLPEV-
A0A1Q8B793      ---SI--TT--QRLGEINKELTEAQSDRMKKEALYQLAQ----S------GSLDALPAV-
A0A2V9BCA0      ---SI--TT--QRLGEINKELTEAQSDRMKKEALYQLAQ----S------GSLDALPAV-
A0A2V9BWU9      ---NI--TQ--QKLSDLNKELTQAQGERMRSEALYQLVG----T------GHIDALPPV-
A0A2V9DKX2      ---NI--TQ--QKLSDLNKELTQAQGERMRSEALYQLVG----T------GHIDALPPV-
A0A7C2YQY3      ---NV--TM--QKLGQLNHELTLAQSERIARESQFQQVK----S------RRLDDLSAI-
A0A3E0NV31      ---SA--SS--RRVGDLARLQTEAEAEAARLRSYVDTLR----A------GRTEGVPDT-
A0A3N5M5V0      ---SI--VL--QTLEDLNRQMTTVEGELIGKTAEFQAVR----D------ATPEDFPQS-
A0A3N5XQP8      ---NE--VT--QKLNDLNTEITRAQANLIAEQSQYDQAR----A------ASATRVPTN-
A0A2Z5G7H4      ---AY--SVIVDRLQQATATLSQATSNRILKGAVYKIVQ----S------GNAELISGL-
A0A2V9L5B5      ---NM--AT--ARLEELLEAYTKAQSERFEKQSLYSLVE----A------GKIQDLPGV-
A0A2V9LK56      ---NL--AN--ERLGQLQQEYTKAQADRFQTESLYNLVK----P------DAAKDVPGT-
A0A2V9L7I0      ---NM--GN--ARLEELLQEYTKAQAQRFEKQSLYSLVE----A------GKVQDLPAV-
A0A522PPT0      ---SM--AN--ARLEQLEEEYTRAQADRAQKEAQYSLVH----T------GKVQDLPGV-
A0A7C5V1G5      ---SM--AN--ARLDQLVQEYTKAQADRAQKEALYSLVQ----E------GKVQDLPGV-
A0A2V9KCS3      ---NV--AE--ARLRQLQEELSKAQGDRVAKQSRYEVAL----S------SSLEALPEV-
A0A372IT17      ---DV--VL--AQLENLNQALSQAELNRILKEAIDHTAQ----S------GDPELISGLT
A0A4R1LC91      ---AY--SSVLDRLEQATTALTQAQSSRIEKGALYQAIK----S------GNGELISGL-
A0A3M2BZG9      ---EA--II--ERKKSLETTLNRAVIDRLDKQAIW---------------DELRNLTDAE
A0A1Q7N5R7      ---PP--RG--SPLGEFFSLRIEQDQMRRDADALEHVLI----SMRD--PGALADALAPI
A0A2V9QB26      ---KI--SE--EKLQQLQGELSKTQTDRITAQSRWEITA----A------SPPDALPDF-
A0A2V9VYY4      ---NI--VT--EKLGELNKELTEAETDRIQKEADYKLAM----NGDP--EMFMKTSPDGR
A0A3E0PHB0      ---EL--SA--SRLSTVSSQYLTAIDERRKLEAEYSAAV----QAKN--PYALSD-----
A0A3M1SIV3      ---EL--TA--GILRSKSEEWLKAEADRRKLEQMYEAAL----QAAN--RGEIFSIVSRE
A0A3M2D491      ---EL--AA--SILEQKSTEWLKAEAERRAIEQQYRTAV----EVAK--KGEILSVAS--
A0A353C9L6      ---DL--SA--SRLSSLSETWLKAMESRRQLEGRYNAAL----TANS--RGEGMNIPDL-
A0A2V8RQV0      ---DL--AA--QRLGAMSEAYMKAMETRRQLEATLNAAE----SANA--RGEAVNIPSI-
A0A2V8SJH5      ---DL--SA--ARLQSMSETWLKAMEGRRQLEARYTAAA----QAGA--RGEGMNIPDL-
A0A357F267      ---DL--AA--TRLGSMSETWLRALEARRQLESRYNAAV----SARA--RGEGMNLPDL-
A0A7C5ZUA8      ---DL--AA--SRLAALSETWLKAMEARRQLESRYNAAV----AANA--RGEGASIPEI-
A0A136JPP4      ---DL--AA--SRLQTLSEQWLSAADDRRKLEARYNGAV----QASS--RGEGRNIPDL-
A0A399WUJ8      ---DL--AA--SRLQTLSEQWLSAADDRRKLEARYNGAV----TASS--RGQGQNIPDL-
A0A2V9KIE8      ---NL--VN--DRLQQLEQEYTKAQAARFHAEASYTLVK----S------TKNMDLPSV-
A0A352F549      ---NT--VV--ERLAGLNKELLEAENDRGLAEAAFRTSK----L------PGATEASAE-
A0A3B9MLP9      ---NT--VV--ERLAGLNKELLVAENERSLAEAAYRASL----A------PGVTEANAE-
A0A3D5SQ87      ---NT--VV--ERLAGLNKELLVAENGRSLAEAAYRASL----A------PGVTEANAE-
A0A2V8NW86      ---NI--SE--EKLRQLQGELSKTQADRITAQSRWQGTT----T------SPPDALPDV-
A0A7C2GJ20      ---TI--TV--ERLADLNRRLIEAETDRIRAETLYRLSR----E------GEVEALPPV-
A0A7C4BTL5      ---NI--SE--EKLRQLQTALAAAQMDRVAKQSRYEMAK----N------SPPETLPDV-
A0A2V8ZHL8      ---SV--VE--QRLADLSRDLTNAQSDRVQKESLYELVK----S------NE-SQVAFV-
A0A2V9B240      ---SV--VE--QRLADLSRDLTNAEGDRVQKESLYELVR----S------NE-SQVAFV-
A0A2V9CBM2      ---NI--AN--ERLQQLQQELTKAQAELYEKESLYRLVQ----T------SDYGSLPGV-
A0A2V8XN17      ---NV--AN--ERLQQLQEQLTKAQSERYEKEALYRLVQ----T------GELGALPGV-
A0A2V8WX45      ---NV--AN--ERLQQLQEQLTKAQAERYEKEALYRLVQ----T------GEYESLPGV-
A0A1Q6YR79      ---NV--AN--ERLQQLQEQLTRAQSERYEKEALYRLVQ----T------GEFGALPGV-
A0A1Q7VA32      ---NV--AN--ERLQQLQEQLTRAQSERYEKEALYRLVQ----T------GEFGALPGV-
A0A2V9EY85      ---NV--AN--ERLQQLQEQLTKAQSERYEKEALYRLVQ----N------GEFGALPGV-
A0A2V9H8K0      ---SV--AN--ERLQQLQEQLTKTQAERYEKEALYRLVQ----A------GESGALPGV-
A0A2V9FFE5      ---NV--AN--ERLQQLQEQLTKAQSERYEKEALYRLVQ----T------GESGALPGV-
A0A2V9GM43      ---NV--AN--ERLRQLQEQLTKAQSERYEKEALYRLVQ----T------GESGALPGV-
A0A2V9CYQ5      ---NI--AN--ERLQQLQQELTKAQAELYEKEALHRLVQ----T------SDYGSLPGV-
A0A2V9BWU8      ---NV--AN--ERLQALQEELTKAQADGYQKESVYRLVQ----S------GNYGSLPGV-
A0A2V8ZG48      ---NV--AN--ERLQQLQEELTKTQAERYEKEAVYRLVQ----A------GDYGSLPGV-
A0A2V8Y334      ---NV--AN--ERLQQLQEELTKAQTERYQKEALYRLVQ----A------GDYGSLPGV-
A0A2V9AY68      ---NV--AN--ERLQQLQQELTKAQAQRYEKESVYRLVQ----A------GDYESLPGV-
A0A1F2RFI7      ---SL--TT--EKLKQLQEEATRAQADLFQKESLYNQVR----T------GDLSSVPGI-
A0A1F2RZS3      ---SM--NA--QKLQQLQEEATRAQSDLIQKESLYNQIR----D------GDFSSVPGI-
A0A1F2USE2      ---NI--VN--QRLRQLQEQLTQAEADRYQKEALYQLLA----Q------GDYASLPGI-
A0A7C2VB08      ---HI--LD--ERLRQLQEELTRAQAERFERESRYRLVE----A------GHFSALPG--
A0A2V9C238      ---NI--VN--ERLRQLQEELTRAQAARYEKESLYRLVQ----A------ADYASLPGM-
A0A1F2Q9F5      ---NI--VN--ERLLQLQAELTRAQAERIAKESLYRLTQ----A------GEYGALPGI-
A0A1F2QQH9      ---NI--VN--ERLLQLQAELTRAQAERIAKESLYRLTQ----A------GEYGALPGI-
A0A1F2QXK7      ---NI--VN--ERLLQLQAELTRAQAERIAKESLYRLTQ----A------GEYGALPGI-
A0A2V9DEM9      ---NI--VN--ERLRQLQEELTRAQAARYEKESLYRLVQ----A------ADYASLPGM-
A0A7C5TWV7      ----V--IT--EQVNTLTTEYAKAKAERIKLETKIAALQ----G------VDVTSLSRA-
A0A2V7XDY0      ----A--VT--SSITKLTADLIEAQARRIGLEAALKQIA----Q------LKAANQPLD-
A0A2V8G155      ----I--VV--QRLADLNTALTRAKTERIQKQAAYDQIR----N------ARDVPGSVD-
A0A2V8HDM7      ----I--VV--QKLADLNTALTRAKTERIQKQSAYDQIR----N------ARDVPGSVD-
A0A2V8DRT9      ----I--VV--QKLADLNAAVTRAKTERIQKESAYEQIK----A------VQSDREALD-
A0A2V7VYF3      ----I--VV--QKLADLNGAVTSAKNERITKEAGYNRLR----T------MADDRSALD-
A0A1F2SVH2      ----I--VV--QKLSELNAAVTRAKTERIEKEAAYNQIR----T------VQNDRATLD-
A0A2V8AJG9      ----I--VV--QKLADLNAAVTRAKTERIQKEAAHNQLR----G------LQHDRNALD-
A0A2N9LQU7      ----I--VI--DRLRHLNSQLADAEGDRIIKEARYRLAS-----------T----GNPE-
A0A2P6WFK7      ----I--TV--DRLKLLNQQLTEAEADRIVKEARHRLAA-----------T----RNPE-
A0A2V8U914      ----L--AA--DKLRGVQDELSKAQSDLIAKQVQFDLIA------------------KN-
A0A2V7W309      ----V--TL--QKLGKLNTDVTSAQGDMYDKQARYNSIQ-----------S----TAPE-
A0A2W0BGU4      ----V--VE--QRLGEISTNFTQSQNDRIQKEALYNQVQ----------------TNPD-
A0A2W0BVQ9      ----V--VQ--QRLGEISTNFTQSQNDRIQKEALYNQIQ----------------ANPD-
A0A2V9MN96      ----I--VT--AKLDELNKELTGAQTDRMQKEANYGLAE-----------A----GDPS-
A0A2V7V2Z1      ----L--LD--QKLKELGTSLTTLRTERLEREALYNQMR----G------A----ANPE-
A0A2V7X2F7      ----L--LA--QKLQQLGTALTETRTVRLEKEALYRQMR----G------A----DVPE-
A0A2V7V2I1      ----L--VE--QRLRELGTSLTALKTQRIEKEALYRQMK----E------A----PNSE-
A0A2V7U3M2      ----L--LE--QKLKELGTALTTLRTDRLEKEALYNQMR----N------A----ANPE-
A0A2V7UHT0      ----L--LD--QKLKELGTALTTLRTERLEKEALYRQMR----G------A----SNPE-
A0A2Z5FVL3      ----S--TL--DQLQKATAAVSQAHTNVILKGAIYEVVK-----------S----GDPE-
A0A2V9KBD6      ----I--VT--TKLADLNKELTASEADRVQKEVSYRLAR-----------S----GQPE-
A0A2W0AJ66      ----I--VT--AKLDDLNKELTAAEADRMQKEATYRLTP-----------S----SQPE-
A0A1Q7RBU1      ----I--VT--AKLDDLNRELTAAEAERVQKEVNYRLAS-----------S----GRPE-
A0A2V9JPV9      ----I--VT--AKLDDLNKELTSAEADRVQKEIDYRLAR-----------S----GEPE-
A0A3P0X3W6      ----I--LS--ARVAQLNSEYTEAENDRIRKQTAYQGVK-----------S----GNAS-
A0A2N9MK30      ----I--LS--ARLLQLNTDYTNAETERVKKEAAYKSVS-----------T----GSLE-
A0A3D1ASD2      ----I--LS--ARLQQLNTEYTNAQTDRVRKEAGFNAMQ-----------S----GQME-
A0A7C5AXI3      ----I--LS--SRLLQLNTEYTNAQADRVRKESAYQSMQ-----------A----GSIE-
A0A7C6E4H7      ----I--LS--ARLLQLNTEYTNAQADRVRKEAAYNSVR-----------S----GSIE-
A0A1F2TCR2      ----T--VL--PRLNSLNDSVTRARLARLQKGQVYEQVR----A------VKPDSDEAD-
A0A350UQT3      ----I--LS--ARLLQLNTEYTRAQAERVAAEAGYEQTR----S------GSLES-----
A0A7C3HRX0      ----I--LS--ARLLQLNTEYTKAQAERVAAEAAYNSTR----N------GDMEA-----
A0A1F2V330      -------NL--SLFAATQAQLRSSSGLKANDQARLAAVQ----Q------EITELEKEG-
A0A662EE63      ----V--IT--EQVDLLTKEYAQAKAERIDVETKLNALN----Q------LRARHVSEV-
A0A2V8TLH7      ----I--TN--DRLSALQADYTETQVKAAELESVLKRVD----E------VRQNGGSYE-
A0A1Q7ZJT1      ----I--TN--DRLSTLQSELTEAQVKKGEIEGLLKQID----A------NRQNGGAYE-
A0A2V8VC99      ----I--TN--DRLSTLQAGLTETQVKKGELEGLLKQID----S------VRLSHGSYE-
A0A348UZU3      ----T--ML--DKISELNKALTEAQIERVRKESYYNGIK----N------ASPDF-----
Q01XL7          ----L--AD--SKMKVLQGDLAAIQADRIAKQARWEMAK----N------TPIDS-----
A0A2V8ERZ5      ----I--VL--SRLNQLNDAVTRARTERVQKESLYNQV-----K------AIANGTAPD-
A0A2V8GTX0      ----I--IV--SRLNQVNDAASHARTNRIQKEALYNQV--------------AATKDRE-
A0A2V8J0X9      ----I--VV--SRLNQLNDKVTTSRNERLSKEAIYNQLR----R------ADPSSDAID-
A0A523DUV7      ----I--AA--STMTRLNEEATEAKTRRIEIESALAQVD----K------LKQSGGALD-
A0A372IRG7      ----L--VT--DDLRTINDQLAEARADRIVKEARYRMAQ----T------RNPDL-----
A0A1F2U158      ----I--VL--SRLNALNDAVLRARTTRIEKESVNNQIK----S------LGT-T-PVD-
A0A2V8F6S9      ----L--VG--ARLNKLNDDAMMARSRKLQKELLYNQVK----A------MAAGQ-PLD-
A0A7D8BEX2      ----L--NA--GALATLSRASSDATLQRIVAEARYRYLN----E------SDPNL--IE-
A0A4Q1SCH5      ----T--VI--DRLKLINEQLTQAEGDRIVKEAQYRAAE----T------GDPAV-----
A0A2V8K4L4      ----V--AS--ASVRLVQEELLKARADRMIAQSKYELLA----S------SPPEA-----
A0A2V8NCZ3      ----V--VS--TSVRLLQEELLKARAERMVTQSRFELIQ----S------SPPEA-----
A0A4Q7YNP3      ----V--GE--DKLRELQAELVRAQADRIQKESQSEIAA----V------ALSTT-----
E8UZE1          ----A--IV--DRLSQLNSDLSKAQADRIMKEVTFRESM----V------SDADQ-----
A0A2U3JZ71      ----I--LS--ARLLQLNTEYTNAQADRVRKEAAYKSVA----G------GSLEA-----
A0A2V8TTB0      ----I--LS--ARLLQLNTEYTNAQGDRVKKEAAYNSIQ----S------GSLAA-----
A0A1V6HR88      ----V--VL--SRLQALNADYTRAVSERIGKGAALKELE----V------ATPQI-----
A0A3E0P0A3      ----V--TL--QRLTAANSAFLEAQRRRIEAQAEYNELS----N------RPADD-----
A0A2V8EXP2      ----I--VV--QKLADLNAAVTRAKTERIQKEATYNQMK----A------LQTERAGLD-
A0A2W4RYA1      ----I--VA--QKLTDVNTEVTRARTERMRQESLYRQLQ----D------ALARSADLD-
G8P0Y7          ----L--TT--EKLDELNRELTSAQADRIQKESLYNVAK----R------GDPST-----
A0A5M8T4U7      ----L--TI--QKLGQTSSDLESAEADRIMRESRMREFA----S------QDTDM-----
A0A7D0PPG7      ----M--LA--SRLLQLNTQYTDAANDRIRKEASYRALE----S------GSQAA-----
A0A7D8BF18      -------VT--NNLADLNKAANAAELSRIEAETRYKVIA----G------TDPSSTTQE-
A0A1E3Y9R6      ----I--IV--QKLNALNEQFVQARIARMNAEVQVNAMA----E------RRARGESLE-
A0A2W4TLP2      ----I--VV--QKLNALNEQLVQARIERMNREVQVNAIR----E------LRASGESLE-
A0A7C4BZ42      ----V--AE--ERFRALQSELLKAQAERMAAQSKYEMAN----A------SPAEA-----
A0A3R9WF43      NSHNT--VL--DRLFTLNQEMTSAEANRISSEAVYHLVK----T------QNPEVVLGL-
A0A317HKM4      ----I--VV--QKLGDLQAAVTRARADTIEKDAQIKQMS----A------LEADHKPLD-
A0A2V9CG11      ----V--SD--ARLVELQSELTKAQAERIAKQAKFEQVK----S------TPVES-----
A0A523E0N1      ----I--VM--QRLETLNEQLAQAEVQRTAAEARYANLA----S------ADPFS-----
A0A523ECP2      ----L--VM--RQLQDLNGAVAVARTARAGAEANYTSLR----A------ADRQT-----
A0A2W0C122      ----V--VT--SKLNELNKQLTAAEEDRMEKEASYQAIA----A------GSLDR-----
A0A2W0AUU7      ----V--VT--SKLDELNKQLTAAEEDRMEKDASYQAIA----A------GSLDR-----
A0A2W0BQL1      ----V--VT--SKLDELNKQLTAAEEDRMEKDASYQAIA----A------GSLDR-----
A0A4Q1SDL1      ----D--VL--DRLQQSTAALSVASQNRILKEAVYKAVE----S------GNAEL-----
A0A3P0XH15      ----L--TI--EDMRVANQQLSEAQADRVVKEARYRMAM----T------RNPEL-----
A0A4R1LAZ7      ----L--VT--DSLRTVNQQLAQAEADRIVKEARYRLAQ----T------RNPEL-----
A0A3M1WQW8      ----I--AI--ERLTDLNRRLVEAEAERIRAETLYRLSQ----E------ADVDT-----
A0A3N1JHC1      ----V--AA--EHLREIQQGLAQAEVDRANRQSAVEMAR----N------ASVDS-----
C1F294          ----L--VD--ANLETINSQLAQAEADRIVKEARYKMAL----T------RNPDL-----
A0A2V9KA79      ----T--IQ--ARLQTVGERISNDAARRVAAANEMRELQ----R------QGATE-----
A0A522PSP1      ----L--LT--QQLSSLQQELGQEQSKQRTLEANLALAN----E------GSLDA-----
G8P085          PSAST--VT--DRLTQLNNRLTVAQGDRIVKEAQMRAAE----N------GNTAV-----
A0A7C6A629      ----I--LS--ARLLQLNTEFTNAQADRVRKEAAYNSVR----S------GSLEA-----
A0A4Q1SGQ1      ----I--VL--DRLTTLNQRLAAAETNRILMQAIAQAAE----S------GDPEL-----
Q1ILD9          ----L--TL--ATLDDVSKQYTDAQADRIMKEAKYRLAK----S------GNPEL-----
A0A7C5SHM3      ----M--RR--TRLERLDATLTEAKSRRASAEAQLHAYE----Q------SEPMA-----
Q1IJZ6          VLHIP--AL--DRLTALNQDLVTAEASRVTREALYRLAR----S------GDLDR-----
A0A2V8TCE6      ----I--AL--KGVSDIDAIYLQARARRIATESEWTAAR----G------TDPSS-----
A0A522TBE8      ----I--MV--ARLTELNSDLTKAKSQRMQMQAAVRVID----S------GAAAG-----
Q1ITG0          ----L--AV--SDLTDVSKQLTDAESDRIMKEAKYRLAQ----T------GNPEL-----
A0A7C2ML20      ----P--AL--KQLDKLYEQLAEAKAQHLHAEFLYRATR----E------GNPEA-----
A0A7C5AXS9      ----V--AE--EKLRQLQEELSKAQADRVAKQARYEQAR----A------APPET-----
A0A7C2RGE3      ----I--TV--ERLADLNRRLVEAETDRIRAETLYRLSR----E------GEIDA-----
A0A3N5PCI5      ----I--VV--QRLNSLNASVTQAKTDLIAVESLYRQLA----A------SQRDQGALD-
A0A3M1Q0S9      ----V--SL--QNLQDLRNRRVEAEADLEDKRARYQVLT----S------ASPDS-----
A0A2Z5G448      ----L--VS--DSLRLVNEQLIQAEADRIVKEARYHLAE----T------RNPEL-----
A0A3M1VZ38      ----V--TR--RNLSNIQERYTQAKIKLAEARARLDTVR----S------TRPES-----
A0A4Q1SD29      ----L--VT--ERLRTVNEQLAEAEADRIVKEARYRMAM----T------RNPDL-----
A0A6N9FGE2      ----I--IV--RELENLHAAATEATLARVESEARYRDLE----E------AQDDAEALG-
A0A3M1PY35      ----M--GS--ERLVALDQALTEAKRERAAAEARVEALD----G------AEPLS-----
A0A3M1VMP2      ----P--GS--TRLSRLEQTLTEVKAERAAAEARLAAYQ----E------ATPSG-----
                                                                            

A0A2V7VMF7      TDPVV----------------------------------AGLNAQIATFTVELSR---LK
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ---------------------------------------AELQQRDAELADAISK---TR
Q01X01          -----------------------------------------LQTESDLNAYGRGK---RA
A0A3M2D9H8      ------------------------I--------------NQLQADIVRLESDHETVLGVN
A0A2V8JK38      GSSLI----------------------------------SQFVGRLSDLKRQDAE---LT
A0A2V9IXG5      SSPSF----------------------------------RSYYIQWVEANNALEK---LR
A0A2V9J2P4      SSPSF----------------------------------RSYYIQWVEANNALEK---LR
A0A1Q7RLS4      NIPQISGDTV--------------V--------------RDLYREKAGLEREYER---LL
A0A2V2R525      NQ-------------------------------------STAAAKLSDLRQRLAQ---LK
A0A321LPW6      SDPKI----------------------------------SELTKIRGELAATYAQ---LS
A0A2V9R9V4      ADTKT----------------------------------VELQRKLGELATTAAE---LS
A0A321LE75      TDSKL----------------------------------TGLQARLNELEVKARE---LD
A0A2V8R8U7      KDERI----------------------------------LRLRGKISDLKDKLTF---LR
A0A2V8QMP4      SNPTV----------------------------------VKLRDKIGELEEQKAA---LL
A0A2V8R4S3      SNPSV----------------------------------LKLREKMGELEEQKAA---LL
A0A2V8NJ55      DDKSV----------------------------------QRLRDRISDLEEKRAS---LL
A0A2V8Q7I0      KSGRV----------------------------------TALRDRISALREKRET---LK
A0A2V8S6K4      DNKQI----------------------------------QDLQIKLAALNEQRVA---LL
A0A317I2L9      KSTRI----------------------------------VALRERISAIKERRDA---LL
A0A2V8LLF9      SDQRI----------------------------------QKLRDKIGDLEDKRNS---LL
A0A352FRF4      KDERI----------------------------------MKLREKISELKDKETG---LL
A0A2V8MKV0      KNESV----------------------------------LKLRDKLSELQAQRAA---LR
A0A2V8PYY8      KNESV----------------------------------MKIRDKLTELQSQRAA---LL
A0A1Q7YKQ8      DSKRI----------------------------------QQLREKLDQLKQKRSE---LL
A0A352F3R7      ASARV----------------------------------DKLRDRISALKEKRDA---LL
A0A0B6WXT1      SDQRI----------------------------------QKLRDRIGELEEKRAA---LL
A0A3B9MEU8      SSARV----------------------------------EKLRDRISALKEKRDA---LL
A0A2V8MHG6      TNN-SS---------------------------------ATTEAKLAELKQHRAQ---LL
A0A2V8P7N1      TSNKSS---------------------------------ATPEAKLAELKQHRAQ---LL
A0A2V8M3M6      TSNKSS---------------------------------ATPEAKLAELKQHRAQ---LL
A0A1Q7NJH5      TSNKSS---------------------------------AATEAKLAELKQRRAQ---LL
A0A2V8PJY0      TSNKSS---------------------------------AATEAKLAELKQRRAQ---LL
A0A1Q7Y6W9      ANK-QI---------------------------------QQYEANLVELRRKRAE---LL
A0A2V8NC68      -AK-SS---------------------------------SDADAKLNELKRKRAQ---LL
A0A399WK13      EMARFITEQQNNIRQFQ----------------------SDTLKKISDLRQARAL---KL
A0A352FLX4      GINEKDVPSATRIT-------------------------TDSELKLAELKQKRAE---LL
A0A2V8RTL7      DSQRYITERENSVLQLR----------------------TDVRKKINDLNAEKAR---KL
A0A3E0PCJ6      QMARYITERENDIRRFV----------------------NDTQKEITALRAKRQK---ML
A0A3M1S4R8      KLQRFITERENDMRSLN----------------------NETAKKIAELEAEKAK---LL
A0A7C2G442      KLQRFITERENDMRSLN----------------------NETAKKIAELEAEKAK---LL
A0A1Q7YFI6      NRN------------------------------------KQAEEQLLELRKKRAE---LL
A0A136KC10      EMARFITEQQNNIRAFQ----------------------SDTLKKISDLRQARAL---KL
A0A3M2D6Y5      KLQRYITERENDMRALN----------------------NEATKRIAELEAEKAR---LL
A0A2V8SEX6      DNQRIIQDRKLAIIAYR----------------------NDTQKKISDFRSQRAK---LL
A0A7C5ZUU4      RMARYITEQENSLRELR----------------------NETQKKIAELKANRAK---LL
A0A0B6WWQ6      EDGIS----------------------------------VAALNKLTELRQRRAQ---LL
A0A3B9MK99      DAKQV----------------------------------NETEGKLADLRQKRAL---LM
A0A352EX26      DNKQA----------------------------------GDGENKLADLRQKRAL---LM
A0A2V8MM59      GAKDI----------------------------------ADSESKLSDLKQKRAQ---LL
A0A2V8PFE8      GAKDI----------------------------------NESESKLADLKQKRAQ---LL
A0A2V8PWS6      GAKDI----------------------------------NESESKLADLKQKRAQ---LL
A0A2V8LCT5      G-KDI----------------------------------ELSESKLAELKQKRAE---LL
A0A352FTJ9      GAKEI----------------------------------EATDSELTKLRQKRAQ---LL
A0A257VBK0      QDPSV----------------------------------QDLAKQYNELNRDLGK---LQ
A0A2G6PYV5      NQNVA-------------------I--------------KDLSSQISRKKLEYEA---NL
A0A2V8F956      LANTF-------------------I--------------QQQKTELAQLQSQSAQ---LG
A0A1F2S1W5      LSNAF-------------------V--------------QQQKTELAQLLRQRAQ---LS
A0A1F2T595      LSNTF-------------------V--------------QQQKAALADLQRQRAQ---MS
A0A2V8JQV5      LDDGT-------------------L--------------RDLQSKLTELRSQTAE---LR
A0A2V9AC41      RDSLV-------------------I--------------GGLKGELAKSEADYAS---LA
A0A2V9MAM9      VDNAV-------------------I--------------RDYQVKLTELRKQLAD---LD
A0A348V070      PSNPA-------------------I--------------ARLREQYALLSREYAR---RL
A0A2V9M454      QTNSL-------------------L--------------PGLEAKELDLKEQYSE---AL
A0A2V9IVR7      VGNDL-------------------L--------------SRLEERYAELKSQYVE---AR
A0A2V9ILE2      VGNDL-------------------L--------------SRLEEKYAELKSQYVE---AR
A0A2V9LGY4      VGNDL-------------------L--------------SRLEERYAELKSQYVE---AR
A0A2V9J4D6      AQDHL-------------------L--------------ETLEQKVADVKTEYID---AR
A0A2V9L9C5      AQDHL-------------------L--------------ETLEQKVADVKTEYID---AR
A0A2N9M9N1      AEDAL-------------------L--------------GQLESKNAELHTEYAA---AT
A0A2V9JEC4      SNDAL-------------------L--------------QHLEQNYADLKTQYAA---SL
A0A2V9LPQ3      AQNDL-------------------L--------------QKLQEKSADLKAQYVD---AL
A0A2Z5G3A3      GSPML------GAASSGVASSLSLI--------------QGLRSQEAVLQGQMAE---YS
A0A2V7UGP8      TQSNL-------------------I--------------QQLRQKTAELEREYTQ---KS
A0A239MKT6      SSLGA---------GLAGGNEMRVL--------------GTLREQASAIKIRMAS---ES
A0A3E0PCN7      KDART----------------------------------TSLEQELSTLRLQLEQ---LK
A0A2V8IYW3      PSDRT-------------------------------------PDPLDAARTELAT---LG
G2LEI9          QSDPE-------------------L--------------QKLRGKISELKQRRLE---LL
A0A317J121      LEDIN-------------------V--------------RGYQTRIADLRREAAV---LK
A0A2V7YW66      LSGGM-------------------V--------------TELRKEVLNLQRDYDT---KL
A0A2V7Z0V0      LTTGV-------------------V--------------SDQRGQILKLEREYET---KL
A0A2V8GFD4      LSNGF-------------------I--------------QQLKGEIAALQRQHAE---MA
A0A2V8HSS5      LSNGF-------------------I--------------QQLKGEIAALQRQQAE---MA
A0A2V8KP55      TGSSL-------------------I--------------SQFVGRLSDLKRQDAE---LT
A0A399WNU1      KDART----------------------------------AGLESQLTTLRQQLAQ---LK
A0A2V9JSI3      MQSEV-------------------L--------------GRLEEKYAELKAQLVD---AS
A0A2V9WI32      EPSSL-------------------I--------------NQLRTQESDLRMKYAE---AT
A0A2V8IVN9      LSNTF-------------------I--------------QQQKSELLQLQSQYTQ---LS
A0A7C5Z4J3      AQDRL-------------------L--------------QNMDEKYADLKAAYAD---AL
A0A1F2TPT3      LNNAA-------------------L--------------QQLRLELERLRRDRAT---AA
A0A2V8JTQ2      EPDNL-------------------L--------------TRLRAQQADLENQIAQ---AS
A0A2V8UZY0      EPDNL-------------------I--------------TRLRAQLADLENQIAQ---AS
A0A350UEK1      LNDTL-------------------M--------------RGYQEKISDLRRQQQE---LL
A0A350UIQ4      LNDSS-------------------M--------------RGYQEKLSDLRRQQED---LL
A0A1H5Z7N3      ASTQV--GSSGNLTSGAPGAGDQQL--------------ATLRTQMETTKADLAK---LN
A0A1G7JVV8      QAS--------------GAGQESEL--------------SKLRDDAAQTKAQIAQ---SS
A0A1H4T6W9      DVA--------------GG--QSEL--------------SKLRSDAAETQASIAE---LS
I3ZEU5          DVA--------------GG--QSEL--------------SKLRSDAAETQASIAE---LS
A0A1I6MH75      D--------------MNPGTMPVQF--------------AQLRSQIALAKANYAQ---LM
E8WVF6          DAG----------TTATTGGATNGL--------------ANLRSNLATARATYAE---LT
A0A7D0PQC3      DIP---------MNPGINNLPPPAL--------------TSLRQSLATAKSNYAM---LE
A0A428MDU2      ETT--------------PGTAPGEL--------------NLLRGQVASAKANYAQ---ME
A0A5B9EBI2      DAT--------------PSIQPAPL--------------NALRSQLATARAHYAE---LT
A0A239HDF6      DAG--------------PGLPPSGL--------------NALRTQLSTARSTYAE---QE
A0A4Q0T270      ETT--------------PGTAPGEF--------------SALRGQVAFARSNLAQ---LL
A0A1Q3QQB6      DAA--------------PGAAPQEL--------------TQLRTQLATARASYAQ---MQ
A0A3N1K1G7      ETT--------------PGTAPGEL--------------NTLRAQIAVARASYAQ---LE
A0A4V2G466      EAS---------------GAAPSQL--------------NALRAQLATARATLAQ---ME
A0A6B9YNQ8      STG--------------QGIAPSQI--------------NTLRAQLATARASLAQ---IE
A0A3N5YNR8      LRTPS-------------------I--------------SLLEERLFGLQQNLAS---LS
A0A3N6A5T6      VTDN--------------------I--------------RQLETTLADLEQKLAN---MT
A0A1F2Q9L4      VSGGL-------------------V--------------TQLRGEQLKLERDYAT---KL
A0A2U3KC61      REGT-----------------SSML--------------EKLREKEADLNTQYAQ---AT
A0A2V9Y2R7      AGGT-----------------SSLV--------------DKLREKEADLNVQHAQ---AT
A0A2V9NGH6      ISADH-------STRNASLS-SSLL--------------EKLREQQADFRIQVSQ---LS
A0A2V9PYE6      TSADH-------STRIASLS-SSLL--------------EKLREQQADLRIQVSQ---LS
A0A2V9NL07      NSGSA-------KG---SGSTSGLL--------------DKLQAAKADLKIQIAQ---VS
A0A2V9QD92      NSGSA-------KG---SGSTSGLL--------------DKLQAAKADLKIQIAQ---VS
A0A2V9WPZ6      VGGDS-------NSGNNPNSGSPLL--------------DSLRGKQADLKILVAE---LS
A0A2V9ZLH4      ATGGT-------EG--NASSGSTLL--------------DKLRSQEADVKIQVAE---LS
A0A2V9RQF1      LSAAG-------TAGTNSST-SGLL--------------EKLREQQADIRIQTAQ---LS
A0A2V9YDK8      SVAGS-------NGGTGANSGSSLL--------------DNLRSKQADLKIQVAE---LS
A0A2V9V8F7      VGGDS-------NSGNNPNSGSPLL--------------DSLRGKQADLKILVAE---LS
A0A2V9XGR9      VGGDS-------NSGNNPNSGSPLL--------------DSLRGKQADLKILVAE---LS
A0A2V9V3Q5      TSAPV-------ATLAGTGS-SPLL--------------DKLHQQQADLKIQVAE---LS
A0A2V9NWS3      LSSAT-------GSGLSSAS-SNLL--------------EKLREQQADLKIQVAQ---LA
A0A2V9USA9      GGIET-------GSA--QSA-SALL--------------ESLRAKQAELHIQTAD---LN
A0A2V9XW18      NALEE-------AGAGGQSS-SALL--------------GGLRSKEADLKIQAAD---LS
A0A1H5SQF5      DSSQLNGAPGALASLDTVR-----L--------------HQLRTQTGQLEVQISA---ET
A0A2V9AEW6      LEDPT-------------------M--------------RDYRQKLTELQRQYAE---LS
A0A2V8WQK6      LEDPT-------------------M--------------REYRQKLTELQRQYAE---LS
A0A2V8XIF4      LEDPT-------------------M--------------REYRQKLTELQRQYAE---LS
A0A2V2R0I6      QNNSF-------------------L--------------NELIRKRNELNAEYND---AV
A0A2V8XAR9      QSDAG-------------------L--------------AELLRKRNDLSSQHSD---AL
A0A2V8VZA0      QNNSA-------------------L--------------GDLLKKRSDAASQYND---AL
A0A1Q7CB82      QNNSA-------------------L--------------GDLLKKRSDAASQYND---AL
A0A2V8WIU1      QNNSA-------------------L--------------GDLLKKRSDAASQYND---AL
A0A1Q6Y9F5      QNNSA-------------------L--------------GDLFKKRSDAASQYTD---AL
A0A2V9EVV8      QNNSA-------------------L--------------GDLFKKRSDAASQYTD---AL
A0A2V8YF91      QTNTA-------------------L--------------TELLKKRSDTSAEYAN---AL
A0A2V8XZK2      QSNAA-------------------L--------------TDLLKKQRDSSAEYTD---AL
A0A2V8ZTX6      ESNTA-------------------L--------------ADLLKKKGETSADYAD---AL
A0A2V9BT79      DSNSA-------------------L--------------TELLKKRGETSADYAD---AL
A0A2V9YHT3      DPNTL-------------------I--------------EQLRTREADLKTQYAQ---VS
A0A7C2XNI7      RESQV-------------------L--------------QELVARRTELLVQYRE---AE
A0A1Q8B793      RDSEL-------------------L--------------QDIYKKRNDAYTQYTS---AL
A0A2V9BCA0      RDSEL-------------------L--------------QDIYKKRNDAYTQYTS---AL
A0A2V9BWU9      RDSLL-------------------L--------------QDLQKKQSELNTQYVE---AL
A0A2V9DKX2      RDSLL-------------------L--------------QDLQKKQSELNTQYIE---AL
A0A7C2YQY3      SSSPY-------------------I--------------QELQSRLNKLNDEYAE---VR
A0A3E0NV31      AKTQE-------------------L--------------RALEAQIARQEQELAA---LS
A0A3N5M5V0      LRTPS-------------------I--------------SLLEERLFGLQQNLAS---LS
A0A3N5XQP8      LRSSV-------------------T--------------EQIEARLSALRQDYAR---LT
A0A2Z5G7H4      SANGI------VSGSPTLSTSLGLI--------------QSLRMQEAALQGQIAQ---DT
A0A2V9L5B5      LSNRL-------------------V--------------QDLEIRLADTKKEYAQ---VT
A0A2V9LK56      LSNKL-------------------I--------------QDLEFKIADLEREYAQ---LT
A0A2V9L7I0      LSNRL-------------------I--------------QDLEERLADVQKEYAL---VT
A0A522PPT0      LDNRL-------------------I--------------QTLEQNLSDLRRQYSE---LT
A0A7C5V1G5      LSNNL-------------------I--------------QNLEVNLSELKRQYAE---LT
A0A2V9KCS3      LDDAS-------------------L--------------QDYRQKLTELRRQLAE---LG
A0A372IT17      ASAGA-------EETGGLQHSLELI--------------ETLRSRESTAKAELAQ---DE
A0A4R1LC91      VGNSI-----TAGASPGVNSSLNLI--------------QNLRLQEATLQGQIGE---LS
A0A3M2BZG9      VANSL---------------ISSQI--------------TQLRSEVDKLERQYRK---AL
A0A1Q7N5R7      GAVQR-------------------S--------------ADLTQALHELTTKRAEQRALA
A0A2V9QB26      LNDSA-------------------L--------------RSLQEKLTELRRQHAE---LI
A0A2V9VYY4      GGSGL-------------------L--------------DKLREKEADLETQYAM---AT
A0A3E0PHB0      ASGGVLASQLRQTKTERKAKFDEQV--------------RALDEKVKTAESELAK---LR
A0A3M1SIV3      TPNSEFISTLRANIIAKKNSLDARL--------------SEIDNKIKAAESERAA---LL
A0A3M2D491      -DNKFIITAREQQ-LKLKKDSEARL--------------EDIEGQIEKAEKEKAA---LL
A0A353C9L6      YENKIFQDTIRLN-TERKAKLQDQI--------------RDIEKQIQETEAEKAE---LL
A0A2V8RQV0      GENKIFQDTMRLN-TERKAKLQDQI--------------RDIEKQIQQTEVEKSE---LL
A0A2V8SJH5      SESKIFQDTIRLN-TERKAKLQDQI--------------RDIEKKIQDSEVEKAE---LL
A0A357F267      YENKIFQDTMRLN-TERKAKLQDQI--------------RDIDKQIQQAETEKAE---LL
A0A7C5ZUA8      TESKIYQDAVRLS-TERRSKLQDDI--------------RSLERQIQSAETEKAE---LL
A0A136JPP4      YENKVYQDTVRLN-TERKAKLQDQI--------------REIEKQIKDAETEKAE---LL
A0A399WUJ8      YENKVYQDTVRLN-TERKAKLQDQI--------------RDIEKQIKDAETEKAE---LL
A0A2V9KIE8      LSDKF-------------------I--------------QELEGRLAELERQYAE---MT
A0A352F549      VSDKQ-------------------I--------------AELKTRLGELRQKRAQ---LL
A0A3B9MLP9      TSDKQ-------------------V--------------AEFKTRLAELKQKRAQ---LA
A0A3D5SQ87      TSDKQ-------------------V--------------AEFKTRLAELKQKRAQ---LA
A0A2V8NW86      LNDSS-------------------L--------------RSLQEKLTELRRQKAE---LI
A0A7C2GJ20      LADPQ-------------------V--------------QALNARLAELRQELAQ---LN
A0A7C4BTL5      LNDPT-------------------L--------------QDYQAKITDLRRQEAE---LA
A0A2V8ZHL8      AQNDL-------------------L--------------QRLEEKFADLKAQYVD---AL
A0A2V9B240      AQNEI-------------------L--------------QRLEEKFADLKAQYVD---AL
A0A2V9CBM2      FENRM-------------------L--------------QDLTVRLTDLKREYAQ---LS
A0A2V8XN17      FENKL-------------------I--------------QDLSERLAELKREHAQ---LS
A0A2V8WX45      FENKL-------------------I--------------QDLSERLAELKREHAQ---LS
A0A1Q6YR79      FENKL-------------------I--------------QDLSERLAELKREHAQ---LS
A0A1Q7VA32      FENKL-------------------I--------------QDLSERLAELKREHAQ---LS
A0A2V9EY85      FENKL-------------------I--------------QDLSERLAELKREHAQ---LS
A0A2V9H8K0      FENKL-------------------I--------------QDLSARLAELKREHAQ---LS
A0A2V9FFE5      FENKL-------------------I--------------QDLSERLAELKREHAQ---LS
A0A2V9GM43      FENKL-------------------I--------------QDLSERLAELKREHAQ---LS
A0A2V9CYQ5      FENRM-------------------L--------------QDLTVRLTDLKREYAQ---LS
A0A2V9BWU8      VENKL-------------------I--------------QDLSERLAELKRELAQ---LS
A0A2V8ZG48      VENKL-------------------I--------------QDLSERLAELKRQFAD---LS
A0A2V8Y334      VENKL-------------------I--------------QDLSERLADLKRELAQ---LS
A0A2V9AY68      VENKL-------------------V--------------QDLSERLAELKRELAQ---LS
A0A1F2RFI7      LENKL-------------------Y--------------QDLSIKLADLRREYSE---LT
A0A1F2RZS3      LENKL-------------------Y--------------QDLSLKLNDLRREYSD---LS
A0A1F2USE2      HDNTV-------------------M--------------ETLTVKLAELQREHAQ---LT
A0A7C2VB08      GESKV-------------------I--------------EDLLVRLADLRRERAE---LA
A0A2V9C238      AENKL-------------------V--------------ADLAVRLADLQREQAQ---LA
A0A1F2Q9F5      FENKL-------------------M--------------QDLTVQLAELRRQHAQ---AA
A0A1F2QQH9      FENKL-------------------M--------------QDLTVQLAELRRQHAQ---AA
A0A1F2QXK7      FENKL-------------------M--------------QDLTVQLAELRRQHAQ---AA
A0A2V9DEM9      AENKL-------------------V--------------ADLAVRLADLQREQAQ---LA
A0A7C5TWV7      TLPDVLQDPT--------------I--------------QQLKRQLDDLEVELAD---KL
A0A2V7XDY0      AVPQFAADPT--------------I--------------MILNTQVSAANNELTR---LR
A0A2V8G155      TFPLILTNGF--------------I--------------QQQKSQLSELQREYAQ---LS
A0A2V8HDM7      TFPLILTNSF--------------I--------------QQQKSQLSELQREYAQ---LS
A0A2V8DRT9      TIPAILSNVF--------------I--------------QQQKTELAELQRQESQ---LS
A0A2V7VYF3      AFPAILSNSF--------------V--------------QQLKSELADAQHKQAQ---FS
A0A1F2SVH2      TIPAILSNGF--------------I--------------QQQKNVLADLQRQQAQ---LS
A0A2V8AJG9      TFPAILSNTF--------------I--------------QQQKGEIAELQRQQAQ---LS
A0A2N9LQU7      LVAAVVPSTT--------------L--------------QALRMQEADLKSQYAQ---LD
A0A2P6WFK7      LLGTVDPN----------------L--------------QTLRTQEADLKAQLAQ---VS
A0A2V8U914      PAEITTENPG--------------I--------------RDYETKLTDLRRQLAD---LE
A0A2V7W309      TVAQ--QDAT--------------V--------------IHLNEELSRLQRDFNA---KR
A0A2W0BGU4      QVPAIANNEV--------------M--------------QKLEENYANLRGQYVE---AL
A0A2W0BVQ9      QVPAIANNEV--------------M--------------QKLEENYANLRGQYVE---AL
A0A2V9MN96      GFAKLSADNL--------------L--------------EKLRVQQAELETQYAQ---AT
A0A2V7V2Z1      ELPEVMRSPL--------------V--------------QSLRIELAGLERQQAQ---LL
A0A2V7X2F7      DLPEVRKDSV--------------V--------------QQLRMDLSTLEQKQTQ---LL
A0A2V7V2I1      ELPEVMRNPL--------------I--------------GSLRVELASLQRQSVQ---LQ
A0A2V7U3M2      ELPDVMRSPL--------------V--------------QALRIELATLERSQAQ---LL
A0A2V7UHT0      ELPEVMRNPL--------------V--------------QSVRIELASLERAQAQ---LL
A0A2Z5FVL3      TIMGLPSNTA--------------LAGAASGMSNDLAVISSLRTREATLNGQINE---LL
A0A2V9KBD6      LLAKLEPGSL--------------L--------------TTLRAQQDDLERQNAQ---AS
A0A2W0AJ66      LIAKSEPDNL--------------V--------------TKLRAQEADLQMQLAQ---AS
A0A1Q7RBU1      LIAKLEPDNL--------------I--------------TKLRAQQADLENQMAQ---AS
A0A2V9JPV9      LIAKLGPDNL--------------I--------------TKLRAQQADLENQMAQ---AS
A0A3P0X3W6      AIDISTQAEQ--------------L--------------TRLQQQMQDAEQAMAI---VQ
A0A2N9MK30      SAQASTQGDA--------------L--------------KTIAERLEQAQEKFAE---VK
A0A3D1ASD2      AALISSQGQS--------------L--------------KKLTEAYDEAQSRLAD---VK
A0A7C5AXI3      AALVSSQGES--------------L--------------RRLVERRDEAEQKFAE---VR
A0A7C6E4H7      AAQASPQGEG--------------L--------------KKLTERLYEAEEKFAQ---IR
A0A1F2TCR2      NLSIIATSPG--------------V--------------VTAKSRLADLNSQRLT---LS
A0A350UQT3      -AQVSGQGEA--------------I--------------RRLLERQNEAAERFAE---VK
A0A7C3HRX0      -AQVSGQGEQ--------------L--------------KRLIDRRNEAYERFSD---IR
A0A1F2V330      VLDAAPPKEK-----------------------------TPAETNLEERRLHLKQ---LR
A0A662EE63      AFPEVLEDAT--------------I--------------SNLMQRRGEVEVELLD---KL
A0A2V8TLH7      VIPQISGDAV--------------V--------------QDVYREKAILERDLEK---LS
A0A1Q7ZJT1      NIPQISGDTV--------------V--------------RDLYREKAGLEREYER---LL
A0A2V8VC99      NIQQISGDPV--------------V--------------QELYREKVGLEREYER---LL
A0A348UZU3      -IPEAMNNPL--------------I--------------QRLREEYLKLSREYAK---ME
Q01XL7          -LPDVLSDPT--------------L--------------LGLKSRIVDLRREMAQ---LT
A0A2V8ERZ5      AIPAIATNAG--------------V--------------ASAKAKLSDLQREKAK---LL
A0A2V8GTX0      GLSQIASNPF--------------V--------------QQLKTRIVELQRDRVR---LE
A0A2V8J0X9      NFPIVGTNSA--------------V--------------VDAKNALATLTAQKAN---YA
A0A523DUV7      AMPQIAADPL--------------V--------------QRLNLSKAELEVERVQ---LK
A0A372IRG7      -LVSVSGGV---------------L--------------GSLRSQEADLMVQKAQ---LQ
A0A1F2U158      SIPAIAQNAQ--------------V--------------QLHKAQLSELQRQKAQ---LS
A0A2V8F6S9      SVPAIAQNPT--------------V--------------VGAKNKVQELQRTLTE---LS
A0A7D8BEX2      SEQAVLGGEQ---------SQNSLL--------------KNLRASQADALANYAS---LT
A0A4Q1SCH5      -LAALMPDQN--------------L--------------QSLQTTEASLYAQEAQ---LA
A0A2V8K4L4      -LPQVLDDSS--------------L--------------REYESKLVDLKRQRAE---LS
A0A2V8NCZ3      -LPQVLDDPS--------------L--------------REYESKLVDLRRQGAE---LG
A0A4Q7YNP3      -LPSVMDSPE--------------Y--------------RRYQEKLADLKGKVAQ---LV
E8UZE1          -IVPTTTFPG--------------L--------------TSLRAQKITLESQYAS---LS
A0A2U3JZ71      -AQVSTQGEA--------------L--------------KRLSERLDEEQQKFAE---IK
A0A2V8TTB0      -AQVSSQGEA--------------L--------------KKLTENLNEAKERFAE---VR
A0A1V6HR88      -AAEILPDPV--------------V--------------AQLRGEVVEMEREYAS---RL
A0A3E0P0A3      -LAETLSGGL--------------V--------------SSQRAELIRLQREYDT---KL
A0A2V8EXP2      TFPAILSNQF--------------I--------------QQQKGELAELQRQQAQ---LS
A0A2W4RYA1      GFPAVLNNQL--------------V--------------QQQKLELAALNQKKAQ---LS
G8P0Y7          -LSVILQDPI--------------L--------------SALRQRQSELQTRYAQ---LD
A0A5M8T4U7      -AALTGDNPQ--------------V--------------AALRTQLADLQTQRDQ---LA
A0A7D0PPG7      -AIEVSTQAA-------------DL--------------AKLTDTMHVAQQKMET---IK
A0A7D8BF18      -MDASRTSPA--------------V--------------ISLRTQLNTARARMAE---LT
A0A1E3Y9R6      SFPPVLASPV--------------V--------------QKLRADIVAKESERAR---LG
A0A2W4TLP2      TYPAIMNSPV--------------V--------------QALRADIAAKEAERAR---LG
A0A7C4BZ42      -LPQVLDDAT--------------L--------------REYQSKLVDLKRQLAE---LN
A0A3R9WF43      GSMSIASGNGSSSGALTADGGVDLL--------------RSLRTQEASLRREYAS---YA
A0A317HKM4      TLPAIAANPF--------------I--------------QTLKGELTTSERELGQ---AS
A0A2V9CG11      -LPEMLDDPT--------------L--------------REYRLRLTDLQRQFVE---LT
A0A523E0N1      -LSEVRTSGP--------------V--------------RDLERRYLDLSERYSE---LR
A0A523ECP2      -LPAVLANPT--------------V--------------QGLVQQRGVLEGQVAE---LT
A0A2W0C122      -IGENKSGEA--------------L--------------QSLRLREAELKNEYAQ---AT
A0A2W0AUU7      -LSESKSGDA--------------L--------------QSLYLREAELKNEYAQ---AT
A0A2W0BQL1      -LSESKSGDA--------------L--------------QSLYLREAELKNEYAQ---AT
A0A4Q1SDL1      -ISELGGTST-ADTAPAVTNALSLI--------------QNLRLQQANIETEIAS---GE
A0A3P0XH15      -LLSVAPSAT--------------L--------------SQLQQQAAALTVQQAQ---LQ
A0A4R1LAZ7      -LVSVAPTTV--------------L--------------ASLREQQAALLVQAAQ---LE
A0A3M1WQW8      -LPPVMSNPI--------------V--------------QTLRQRLADDRRRLVK---LQ
A0A3N1JHC1      -LPQVADDPT--------------M--------------RDDRAKLTELHRQLAE---MS
C1F294          -LVSVAPNTV--------------L--------------TSLRSQEANLLVQQAD---LQ
A0A2V9KA79      -NRAVVEEAS------------------------------AVQKKLEDLRLELKG---LQ
A0A522PSP1      -LLVSDRGDS--------------L--------------ATLVQAQQQTQLQLDA---LS
G8P085          -LAAMFPSAN--------------L--------------AALQSQQATLYGQYVQ---LS
A0A7C6A629      -AEASTQGEA--------------L--------------KKLTERLSEAEEKFAQ---AK
A0A4Q1SGQ1      -LPALSGGGGSGMPGYGPQLAV--I--------------QELRMREAALEAEIAE---ND
Q1ILD9          -IGMLVPDSV--------------L--------------PVLRTQEADIQNQLSQ---AT
A0A7C5SHM3      -LEVVRSNLQ--------------V--------------LKYHEQLASIQAEIAD---ME
Q1IJZ6          -LTSLGAESLTSPTDQAQAAMFTNL--------------QALRQRQSQLKQQMAS---AV
A0A2V8TCE6      -LPAVVENPT--------------V--------------QRLQHEVNDLEIQRAE---LL
A0A522TBE8      -WTNPTLTQE--------------V--------------QTLRGRLQTDQNQLQV---LG
Q1ITG0          -IGTILPDSV--------------L--------------PVLRSQEADLRNQLAQ---YS
A0A7C2ML20      -LAEPVDDPV--------------V--------------EGLKQERVKLEAELSQ---LL
A0A7C5AXS9      -LPEILEDST--------------L--------------ASQSSRLTDLRRELAE---LE
A0A7C2RGE3      -LPPVLADPQ--------------V--------------QALNARLAELRQELAQ---LN
A0A3N5PCI5      TFPLIRSNGV--------------V--------------QEIRGRLANLQRERMQ---LA
A0A3M1Q0S9      -IDEVRQHPT--------------I--------------AQLSAEVARLERDYAN---KR
A0A2Z5G448      -LVSVAPTTT--------------L--------------VSLRTQQAELLVQSAE---LK
A0A3M1VZ38      -LQEVLENPV--------------V--------------RELRSRVSALESEYRE---KL
A0A4Q1SD29      -LVSVAPGTV--------------L--------------GSLRTQQAALLVQAAQ---LK
A0A6N9FGE2      RFPEILRNEV--------------I--------------QEQRLIVAGLRRERAR---LA
A0A3M1PY35      -IEAVRSDPL--------------V--------------VRLREELASREQRLEE---LR
A0A3M1VMP2      -IPEVNANPQ--------------V--------------QRYRQDLAELRRELAE---LE
                                                                            

A0A2V7VMF7      EK-YKEGHPEVQKVNKQVVQIQ----KA-----------KEERAAQ--------------
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      GE----------------------------------------------------------
Q01X01          AG----------------------------------------------------------
A0A3M2D9H8      ALGQPARVTPTLTVDQQIELTQ-----------------KRSRLDE--------------
A0A2V8JK38      VT-FAPDYPSRRRIRSQIEEIQ----KQ-----------IEGERGR--------------
A0A2V9IXG5      LDGKGEEHPTLVAKRTELDNLR----KQ-----------LRNELVK--------------
A0A2V9J2P4      LDGKGEEHPTLVAKRTELDNLR----KQ-----------LRNELVK--------------
A0A1Q7RLS4      VT-YKDKHVRVLEKQKEIEETT----QK-----------IASEVDR--------------
A0A2V2R525      AE-YTDKWPEIKVVQEQIAEIE----K-----------QDVENKTN--------------
A0A321LPW6      VR-YGPENPRVAESKKQMAEID----N---------------QIRA--------------
A0A2V9R9V4      VT-YGPKYPKMAEINQQMAAIR----D---------------QIAA--------------
A0A321LE75      VK-FGADHPRVVEIRNQMVTIQ----E---------------QINR--------------
A0A2V8R8U7      QK-YTDEWPDVKQASAQIDELE----K---------------ELKK--------------
A0A2V8QMP4      VN-YTPEWPAVQKIEKQLKSLH----E---------------QLDK--------------
A0A2V8R4S3      VN-YTPEWPAVQKIEKQLKSLH----E---------------QLDK--------------
A0A2V8NJ55      RT-YTEEWPAVQATNDEIKQVK----S---------------ELDK--------------
A0A2V8Q7I0      VT-YTDKWPEVLKLDAAIKPLE----A---------------ELDR--------------
A0A2V8S6K4      KQ-YTENWPAVQKVEAQIKQTE----D---------------AQQK--------------
A0A317I2L9      VT-YTPEWPEVRKLEASLKPLE----A---------------ELQA--------------
A0A2V8LLF9      EI-YTPEWPEVKKIEAQLEPLK----K---------------QLIA--------------
A0A352FRF4      QK-YTKEWPEVQQVEAQIAQLE----V---------------ELKK--------------
A0A2V8MKV0      QT-YTDEWPDIKKLDAQIKPLE----Q---------------ALEA--------------
A0A2V8PYY8      QT-YTTEWPDVKKLDAQIKPLE----Q---------------ALEA--------------
A0A1Q7YKQ8      VI-YTVEWPEVKRVDEQIKTIE----E---------------ALTK--------------
A0A352F3R7      IV-YTSEWPEVKKIDAQLKGLE----A---------------ELAK--------------
A0A0B6WXT1      VQ-YTPEWPEVKKVDEQIKRLK----Q---------------DLDK--------------
A0A3B9MEU8      IV-YTPEWPEVKKIDAQLKGLE----A---------------ELAK--------------
A0A2V8MHG6      QE-YTEKYPEVRDLDQQIAMLE----K-----------QAEQSRAH--------------
A0A2V8P7N1      LE-YTEKYPEVKDVDQQIAMLE----K-----------QVDQSRRH--------------
A0A2V8M3M6      LE-YTEKYPEVKDVDQQIAMLE----K-----------QVDQSRRH--------------
A0A1Q7NJH5      LE-YTEKYPEVKDVEQQIAMLE----K-----------QVDQVRTH--------------
A0A2V8PJY0      LE-YTEKYPEVKDVEQQIAMLE----K-----------QVDQVRTH--------------
A0A1Q7Y6W9      VE-NTEEHPDVQQVEQQIAEIE----R-----------QLKEAKSH--------------
A0A2V8NC68      LE-YTEKYPEVKDLDEEIALLE----K-----------QTKEGKTH--------------
A0A399WK13      QE-YQEGAPEIKEIDAQITSYQ----NSIDNAVQKFQNDLDKYRDS--------------
A0A352FLX4      VE-NTEKWPAVREIDKQIAAIE----K-----------VMGDARRR--------------
A0A2V8RTL7      ED-YKETAPEIIEIDKQIASLE----DSLEKLLEKNNKDIQAYKER--------------
A0A3E0PCJ6      VE-YVERAPEIQEIDREIATLM----NEIADFRDKNDKALQQYRKT--------------
A0A3M1S4R8      IE-YQESAIEVQEINRKMEALK----STVEKAQEKNREELEKYRAR--------------
A0A7C2G442      IE-YQESAIEVQEINRKIEALK----NTVEKAQEKNREELEKYRAR--------------
A0A1Q7YFI6      VE-NTEDWPEVKEIDRQIAILE----A-----------QVNQSHSE--------------
A0A136KC10      QE-YQEGAPEIKEIDAQITSYQ----NSIDNAVQKFQGDLEKYREA--------------
A0A3M2D6Y5      VE-YQESALEVQEINRKIDALK----RTVEVAQEKNRKDLEEYRSR--------------
A0A2V8SEX6      QE-YKESAPEIVEIDTQIRSLE----DSLTKLVDENTTEVQKLQER--------------
A0A7C5ZUU4      EE-YKESAPEIREIDTQIKSLE----DSIAREVQKNKAELDDFRKR--------------
A0A0B6WWQ6      VE-ATEEMPEVKEVNEQIAELE----R-----------QINEARAR--------------
A0A3B9MK99      VD-ATEEAPEVKEVDQQIAELE----R-----------QVKDVRSR--------------
A0A352EX26      VD-ATEEAPEVKEVDQQIAELE----R-----------QVNDSRNR--------------
A0A2V8MM59      VD-ATEEAPEVKEIQQQIAELQ----K-----------HLGETRSR--------------
A0A2V8PFE8      VD-ATEEAPEVKEVDQQIAELQ----K-----------HLHESRAR--------------
A0A2V8PWS6      VD-ATEEAPEVKEVDQQIVELQ----K-----------HLNESRAR--------------
A0A2V8LCT5      VT-ATEEAPEVKEVDQQIDVIQ----K-----------HLVETRSR--------------
A0A352FTJ9      IE-ATEEAPEVKEIDQQIDVLQ----K-----------HLADTRAR--------------
A0A257VBK0      AK-FTPKHPEVLKKQEEIRGLK----ER-----------ISQQAET--------------
A0A2G6PYV5      SK-YKPQLPKMVALNAEIKSME----KR-----------LANEQKK--------------
A0A2V8F956      DK-LGPNHPDMVKIRSAIRLTQ----AK-----------LDGEIGK--------------
A0A1F2S1W5      EK-LGPNHPDMIKVNTAIQLAE----TR-----------LQAEVAQ--------------
A0A1F2T595      EK-LGPNHPEMVKINVALRGAE----TR-----------LQNEIAQ--------------
A0A2V8JQV5      VS-LTPAHYRVQRLEAQMGELE----TA-----------FERERAN--------------
A0A2V9AC41      KE-FKAGYPPLDNLKVRMEETR----RR-----------LQAEIQN--------------
A0A2V9MAM9      SV-LTPENYKVVRLKAQITALE----SA-----------LAKEREE--------------
A0A348V070      AT-LKPEYPEMQKLKSEIEATY----DS-----------LTREKEN--------------
A0A2V9M454      AH-YGPTYPKVLSLQDQIKDLQ----AL-----------VVRERKR--------------
A0A2V9IVR7      EQ-YGPNFPKVVRLRDQAEEIR----SS-----------LEAERKR--------------
A0A2V9ILE2      EQ-YGPNFPKVVRLRDQAEEIR----SS-----------LEAERKR--------------
A0A2V9LGY4      EQ-YGPNFPKVVRLRDQAEEIR----SS-----------LEAERKR--------------
A0A2V9J4D6      TT-YGPNFPKVVRLQQQIDEVQ----LL-----------IQQERHR--------------
A0A2V9L9C5      TT-YGPNFPKVVRLQQQIDEVQ----LL-----------IQQERHR--------------
A0A2N9M9N1      SQ-YGPNFYKVKQLGNQINEVE----EL-----------IDRERKR--------------
A0A2V9JEC4      AQ-AGPNFYKAVQIRKQLAEVE----SL-----------INRQRMR--------------
A0A2V9LPQ3      GQ-FGPNFPKVVRLRGQVAQMQ----SL-----------IEQEQKR--------------
A0A2Z5G3A3      SK-FSPDYPKLVDMKSNLQVIQ----AA-----------IASEVAR--------------
A0A2V7UGP8      KQ-FKPDWPDMVRLQAEWDSAR----KT-----------MAEESQK--------------
A0A239MKT6      VK-FGSQYPAVLELQNQLNSID----AQ-----------VHEQMVR--------------
A0A3E0PCN7      VE-FTEEWPAVKEVRRKIAAVE----NE-----------LKGTRKL--------------
A0A2V8IYW3      RR-LLPTHPDVIAAKRRVAQLE----AERVAMPKASDAPASAAAPQ--------------
G2LEI9          GT-YTELHPDVVQIDQVLAQAE----NE-----------LKEAKAN--------------
A0A317J121      TT-LTPDNPKVKKIEVQINELQ----IT-----------LNKEVTA--------------
A0A2V7YW66      KT-YKPDFPEMVTLKAEIEKSQ----QH-----------INDVVKE--------------
A0A2V7Z0V0      KT-YKPDFPDMVTLKADIEKAR----QH-----------LNEVLGE--------------
A0A2V8GFD4      DN-LGERHPTMIKLKASLQSAD----AK-----------LQAEIAK--------------
A0A2V8HSS5      DN-LGERHPTMIKLKASLQSAD----AK-----------LQAEIAK--------------
A0A2V8KP55      VT-FAPDYPSRRRIRSQIEEIQ----KQ-----------IEGERGR--------------
A0A399WNU1      VD-YTDEWPEVQKVEKQIAGIE----KE-----------LQSNRKR--------------
A0A2V9JSI3      GQ-YGPNYPKVVRLQDQVNEIQ----GF-----------IERERKR--------------
A0A2V9WI32      TQ-FGSSYPKVMQLGNQLKQVE----AS-----------IQAEDER--------------
A0A2V8IVN9      EK-FGDKHPDIIKVKSAIQLAQ----AR-----------LDGEIGK--------------
A0A7C5Z4J3      AR-YGPKFPEVIRLGHQINEIQ----SL-----------IKQYRTL--------------
A0A1F2TPT3      RT-LRAQHPSMLKLEETIQATQ----AK-----------LDVERSR--------------
A0A2V8JTQ2      VQ-LGPAHPKMAELSKQLAQVR----RS-----------VDAEVKG--------------
A0A2V8UZY0      VQ-LGPAHPKMVELSKQLDQAR----RS-----------VDAEVNR--------------
A0A350UEK1      ET-FTPENQRVKRVAAQVASLE----KS-----------LEVERAQ--------------
A0A350UIQ4      EV-FTPETSRVKRVNAQISSLE----KS-----------LANERDQ--------------
A0A1H5Z7N3      VA-MGDRNPQIRALRAQVDTLN----QE-----------IRAEQDR--------------
A0A1G7JVV8      VS-LGPKNPQILALQAHLREVD----RE-----------IKTEETR--------------
A0A1H4T6W9      IT-LGPKNPKIVALQAHQREIQ----RE-----------LRSEENR--------------
I3ZEU5          IT-LGAKNPKIIALRAHQREVQ----RE-----------VQAEENR--------------
A0A1I6MH75      TT-LGPNNPKALELSNEIKELD----AQ-----------LAAEQKR--------------
E8WVF6          AT-LGPNHPQVKAARAQIDEFQ----HA-----------VEAEQNR--------------
A0A7D0PQC3      GT-LGVNHPQALASRAQIDELS----KE-----------VTAEQNR--------------
A0A428MDU2      ST-LGPNHPQAQALKAQIDELE----KE-----------IDAEQKR--------------
A0A5B9EBI2      SQ-LGPNHPQVKAAKAQMDELA----TE-----------INTEQGR--------------
A0A239HDF6      AT-LGPNHPQAKSTKAQIDELA----RQ-----------VAAEQNR--------------
A0A4Q0T270      TT-YGANHPLVKAQSNELAELE----KQ-----------LKAEQER--------------
A0A1Q3QQB6      AT-LGPNHPQAKALRAQIDELS----KE-----------VTKEQNR--------------
A0A3N1K1G7      AT-MGPNHPQAKAQKAQIDELA----KE-----------IDAEQSR--------------
A0A4V2G466      SD-LGPNHPQAKAQKAQIAALS----TE-----------INTEQQR--------------
A0A6B9YNQ8      SD-LGPNHPTVKAQKAQIDELS----KE-----------ISTEQQR--------------
A0A3N5YNR8      AQ-FGSEWPAVIQVRQQIQEVE----KQ-----------LQREKKE--------------
A0A3N6A5T6      SH-YGPVWPEVVQLKREVNEVN----TQ-----------LVREKKR--------------
A0A1F2Q9L4      NT-YKPEWPAMQELKAQIDKGR----QH-----------LGNVTKE--------------
A0A2U3KC61      TQ-FGSGYPKVVELKNQLKQVR----TE-----------IVAEETR--------------
A0A2V9Y2R7      TQ-FGSAYPKVVELRNQLQEVR----SG-----------ISVEQTR--------------
A0A2V9NGH6      TQ-FGPAYPKVAQLNSQLQEVE----SQ-----------IQLEMKK--------------
A0A2V9PYE6      TQ-FGPAYPKVAQLNSQLQEVE----SQ-----------IQLEMKK--------------
A0A2V9NL07      TQ-FGPAYPKLAELNNQLQEID----SQ-----------IQGETKK--------------
A0A2V9QD92      TQ-FGPAYPKLAELNNQLQEID----SQ-----------IQGETKK--------------
A0A2V9WPZ6      TQ-FGASYPKVAQLNNQLKEID----IQ-----------IQGEMKK--------------
A0A2V9ZLH4      TQ-FGPSYPKVAQLNNQLKEID----VQ-----------IQSEIRK--------------
A0A2V9RQF1      TQ-FGPSYPRLAQLNNQLKEVE----AQ-----------TQVEMKK--------------
A0A2V9YDK8      TQ-FGSSYPKVAQLSNQLKEIV----AQ-----------IQAETKK--------------
A0A2V9V8F7      TQ-FGASYPKVAQLNNQLKEID----IQ-----------IQGEMKK--------------
A0A2V9XGR9      TQ-FGASYPKVAQLNNQLKEID----IQ-----------IQGEMKK--------------
A0A2V9V3Q5      TQ-FGPAYPKVAQLNSQLKEIE----NQ-----------IQVETRK--------------
A0A2V9NWS3      TQ-FGPAYPKLTQLNGQLKEVD----AQ-----------LQAEMKK--------------
A0A2V9USA9      TQ-FGPSYPKLAQLNNQLKEID----TQ-----------IQGEMKK--------------
A0A2V9XW18      TQ-FGPSYPRLNQLNNQLKEID----SQ-----------IQGEMKK--------------
A0A1H5SQF5      QK-YGPRNPAILSLKSELAELQ----RQ-----------TNEEISR--------------
A0A2V9AEW6      AT-LTPEHYKVLRVQAQIDELK----AQ-----------IEKERGN--------------
A0A2V8WQK6      AT-LTPEHYKVKRVQAQITELR----SE-----------MQKERAN--------------
A0A2V8XIF4      AT-LTPEHYKVQRVQAQINDLK----AE-----------MQRERNN--------------
A0A2V2R0I6      SQ-YGPNFPRVQRLQAQLKDLD----AT-----------IEKEKQN--------------
A0A2V8XAR9      SQ-YGPNFPKVQRLQAQLKDLD----AN-----------IEKEKKK--------------
A0A2V8VZA0      AQ-YGPNFPKVQRLQAQLKEFD----QT-----------IEKEKQK--------------
A0A1Q7CB82      AQ-YGPNFPKVQRLQAQLKEFD----QT-----------IEKEKQK--------------
A0A2V8WIU1      AQ-YGPNFPKVQRLQAQLKEFD----QT-----------IEKEKQK--------------
A0A1Q6Y9F5      AQ-YGPNFPKVQRLQAQIKEFD----QT-----------IEKEKQN--------------
A0A2V9EVV8      AQ-YGPNFPKVQRLQAQIKEFD----QT-----------IEKEKQK--------------
A0A2V8YF91      TQ-YGPNFPKVLRLQAQLKEID----EN-----------IQGEKRG--------------
A0A2V8XZK2      AQ-YGPNFPKVQRLKTELKDIE----DS-----------IEKEKRK--------------
A0A2V8ZTX6      TQ-YGPNFPKVLRLKAQLKDID----DN-----------IEKEKQK--------------
A0A2V9BT79      QQ-YGPNFPKVLRLKAQLKDID----DN-----------IEKEKRK--------------
A0A2V9YHT3      TQ-FGPAYPKVVEVGNQLKQVQ----ET-----------IQGETRR--------------
A0A7C2XNI7      AQ-FGPNYPKVQRLKVQLDELD----ST-----------IAREKKN--------------
A0A1Q8B793      NQ-FGPNFPRVQRLQEQLKEFD----GL-----------IDAEKKN--------------
A0A2V9BCA0      NQ-FGPNFPRVQRLQEQLKEFD----GL-----------IDAEKKN--------------
A0A2V9BWU9      NQ-YGPSFPKVVRLQAQLKEIE----HL-----------IAREKAN--------------
A0A2V9DKX2      NQ-YGPSFPKVMRLQAQLKEIE----HL-----------IAREKAN--------------
A0A7C2YQY3      TT-FGPKYPKVQRLEQQIADAK----AQ-----------MEREKQQ--------------
A0A3E0NV31      AR-YGPEWPSVRQTRSELAELR----RD-----------LSAAGGR--------------
A0A3N5M5V0      AQ-FGNEWPAVVQVRQQIREVE----QQ-----------LVREKRE--------------
A0A3N5XQP8      SQ-FGPEWPEVIQAQRQITQGE----QE-----------LKQERER--------------
A0A2Z5G7H4      SK-FGPSYPRLMDSRANLSGME----SA-----------IEDEVHR--------------
A0A2V9L5B5      TW-VKPDYPKAQQVEKQIDALQ----AE-----------LDKQKKA--------------
A0A2V9LK56      AV-VKPDYPSAVRLKKQIDLLQ----SI-----------LGKDKRT--------------
A0A2V9L7I0      TW-VKPEYPKALQVKKQIDALQ----AE-----------IDRQKKA--------------
A0A522PPT0      AT-VKPGYPKAMALKKQIETLQ----AN-----------LDHQKQA--------------
A0A7C5V1G5      TT-VKPAYPKAVALKKQIDTLQ----AN-----------LNRQKQA--------------
A0A2V9KCS3      AT-YTSTHPKVERVDAQIASVQ----SA-----------LERERVN--------------
A0A372IT17      TR-YGAAWPGMQERQAQLTEIQ----KS-----------IHDEVRR--------------
A0A4R1LC91      AK-FGSAYPKIEELQGNLHSIQ----KA-----------IQAETHR--------------
A0A3M2BZG9      QT-FRDDWPSVTKLKEELEGKR----AK-----------LTALVSA--------------
A0A1Q7N5R7      YR-YTPDHPTLQRVTSEIETLE----RT-----------TIPALAK--------------
A0A2V9QB26      TI-YTEKHNKVKQVEAQIALLE----AA-----------LQKEQAA--------------
A0A2V9VYY4      TQ-FGSGYPRVTELNNQLKQVR----AA-----------IEAEKTK--------------
A0A3E0PHB0      VK-YTEQHWKVKEAISLIASLK----EQ-----------KNQLEDE--------------
A0A3M1SIV3      AR-YTPENPKVKQIEATIQKLQ----EG-----------KEKIRQE--------------
A0A3M2D491      AR-YTEEHPSVKQIEAQIQQLR----ET-----------KEKVKNE--------------
A0A353C9L6      VK-YTPEYPEVGKKEAKIASLK----ET-----------KDKTERE--------------
A0A2V8RQV0      VK-YTEAYPEVGKKDAKIASLR----ET-----------KEKTEKE--------------
A0A2V8SJH5      VK-YTPEYSKVKVVEERIASLK----AT-----------KDRTESE--------------
A0A357F267      VK-YTPEYFEVKKKVERIAALQ----ET-----------RAKTETE--------------
A0A7C5ZUA8      VK-YTEEYPEVKKLNERIASLR----ST-----------KERMESE--------------
A0A136JPP4      VK-YTPEYVKVKQVEEKIASLK----TT-----------KQQTETE--------------
A0A399WUJ8      VK-YTPEYVKVKQVEEKIVSLK----NT-----------KQQTESE--------------
A0A2V9KIE8      SM-VKPEYPKAVQLKKQIDVLE----AR-----------ITAQKQA--------------
A0A352F549      LT-DTEESPEVKDATQQIATLE----KQ-----------LADTRGS--------------
A0A3B9MLP9      LT-DTEESPEVKDVNQQIAILE----KQ-----------LDETRGS--------------
A0A3D5SQ87      LT-DTEESPEVKDVNQQIAILE----KQ-----------LDETRGS--------------
A0A2V8NW86      TI-YTEKHNKVKQVEAQIASLE----AA-----------LQKERTA--------------
A0A7C2GJ20      VE-YQPTHPRVARVREQIAEAE----RQ-----------LALAKRR--------------
A0A7C4BTL5      AT-YKPEYSRVKRVQAQLAAVE----SA-----------LQRERQA--------------
A0A2V8ZHL8      EQ-YGPKHPKVERFRSQVDEVQ----SL-----------IDTERKR--------------
A0A2V9B240      EQ-YGPKHPKVERLRSQVDEIQ----SL-----------IDTERKR--------------
A0A2V9CBM2      TT-FGSDYPRVKEIQSQITDVE----AS-----------LQQERKR--------------
A0A2V8XN17      TT-FSPDYPRVKEIQSQIDEIE----AS-----------LRDERQR--------------
A0A2V8WX45      TT-FNADYPRVKEIQSQIDEIE----GS-----------LQVERKR--------------
A0A1Q6YR79      TT-FSPDYPRVKEIQSQVDEIE----SS-----------LREERQR--------------
A0A1Q7VA32      TT-FSPDYPRVKEIQSQVDEIE----SS-----------LREERQR--------------
A0A2V9EY85      TT-FSPDYPRVKEIQSQIDEIE----SS-----------LREERQR--------------
A0A2V9H8K0      TT-FNPDYPRVKEIQSQIDEIA----AS-----------LREERQR--------------
A0A2V9FFE5      TT-FNPDYPRVKEIQSQIDEIA----AS-----------LREERQR--------------
A0A2V9GM43      TT-FNPDYPRVKEIQSQIDEIA----AS-----------LREERQR--------------
A0A2V9CYQ5      TT-FGSDYPRVKEIQSQITDVE----AS-----------LQQERKR--------------
A0A2V9BWU8      TK-FNAEYPRVKEIQSQIDEIE----AT-----------LREERQR--------------
A0A2V8ZG48      TK-FNPEYPRVKEIQSQINEIE----AT-----------LKEERQR--------------
A0A2V8Y334      TK-FNAEYPRVKEIQSQIDEIE----GT-----------LKEERQR--------------
A0A2V9AY68      TK-FNPEYPRVKEIQSQIDEIE----AA-----------LKDERKR--------------
A0A1F2RFI7      AT-FTPEYPRVKRLKNQIEEIE----RT-----------VQRERGA--------------
A0A1F2RZS3      AT-FTEEYPRVQRLKSQIDQTA----AA-----------LDRERQA--------------
A0A1F2USE2      TT-FTAKYPRVEQLENQIQEVQ----GL-----------LGQEQDK--------------
A0A7C2VB08      TL-FTGEYPRVRQLDNQIGELE----QL-----------LAAERAR--------------
A0A2V9C238      TT-FTADYPKVRQIQSQINELD----AA-----------LARERGR--------------
A0A1F2Q9F5      TT-FSPDYPTVKQLQNQIDEIE----RL-----------LAQERAR--------------
A0A1F2QQH9      TT-FSPDYPTVKQLQNQIDEIE----RL-----------LAQERAR--------------
A0A1F2QXK7      TT-FSPDYPTVKQLQNQIDEIE----RL-----------LAQERAR--------------
A0A2V9DEM9      TT-FTADYPKVRQIQSQINELD----AT-----------LARERGR--------------
A0A7C5TWV7      RT-YKSGHPVIKELRSRISSIK----LR-----------IKQQIQT--------------
A0A2V7XDY0      QQ-YKEGHPEIQKLLLQLDQAQ----KT-----------KERQGTQ--------------
A0A2V8G155      EK-LGDKHPEIIKVKSAIQISQ----AK-----------LSGEISK--------------
A0A2V8HDM7      EK-LGDKHPEIIKVKSAVQISQ----AK-----------LSGEISK--------------
A0A2V8DRT9      EK-LGQRHPDMLKAKLNVQNAE----AR-----------IQAEINK--------------
A0A2V7VYF3      ET-LGDKHPDMIKARSAVDTAL----AK-----------LNTEIDK--------------
A0A1F2SVH2      DK-LGPNHPDMVRLSSAVREAE----SK-----------IQGEIAK--------------
A0A2V8AJG9      EK-LGPRHPDMLKVSNAIQLAE----SK-----------LQGEIAK--------------
A0A2N9LQU7      AK-FGSGFPRVQELQAQLARLD----QN-----------IADELTN--------------
A0A2P6WFK7      AK-YGNGYPKLRELQTQLSKLN----AA-----------IADEVAN--------------
A0A2V8U914      SI-LQPESYKVVRVKAQIVQLE----AA-----------IARESRR--------------
A0A2V7W309      AQ-YTEAHPVMQDLAQQIEKTKLARAAA-----------VREAYSR--------------
A0A2W0BGU4      NQ-YGPNYPKVLRLDKQVKEAS----AL-----------IAAERGR--------------
A0A2W0BVQ9      NQ-YGPNYPKVLRLDKQVKEAS----AL-----------IAAERGR--------------
A0A2V9MN96      TQ-FGPSYPEVIQLRSQLNQVR----NS-----------IATEQKN--------------
A0A2V7V2Z1      ER-YMDQHPEVVKVRNQIQETR----KK-----------IAAESQR--------------
A0A2V7X2F7      EQ-YLDQHPEVIKVRRQIEDTR----KR-----------LSAEGQR--------------
A0A2V7V2I1      ER-YLDQHPEVVKNRNQITETR----EK-----------IASEAQR--------------
A0A2V7U3M2      ER-YMDQHPEVVKVRNQIQETR----KK-----------IAAESQR--------------
A0A2V7UHT0      ER-YMDQHPEVVKVRNQIQETR----KK-----------IAAESQR--------------
A0A2Z5FVL3      AK-FGPAYPKVDELKADLTAIQ----NS-----------IKEEIQR--------------
A0A2V9KBD6      VQ-LGPTNPKMAELSSQLSQVR----SS-----------IDAEVKR--------------
A0A2W0AJ66      VQ-LGPTHPKIRELSNQLAQTR----RS-----------IRSEVKR--------------
A0A1Q7RBU1      VQ-LGPAHPKMGELSNQLAQAQ----RS-----------VDAEVRR--------------
A0A2V9JPV9      VQ-LGPANPKISELSKQLAQAR----QS-----------VDVEVRR--------------
A0A3P0X3W6      TH-YGPNNANYKVAANTLAEVT----RE-----------YQAARDN--------------
A0A2N9MK30      TH-YGPNHPEFHKAQTQLDQVQ----AQ-----------FDATRGS--------------
A0A3D1ASD2      LH-YGINHPEYRKAQGQVAELD----RQ-----------LQTAKTS--------------
A0A7C5AXI3      TH-FGSNHPEYKKAQAQLNEVK----RL-----------LAETTQD--------------
A0A7C6E4H7      TH-FGTNHPEYRKAAAQVAQLK----QQ-----------LDETLRT--------------
A0A1F2TCR2      SR-YMDTHPDIQKLDAQIAIAK----KD-----------LIAQRQR--------------
A0A350UQT3      AH-FGVNHPEFRKAQAQLREIQ----SQ-----------VDATRDN--------------
A0A7C3HRX0      TH-FGPNHPEHRRALAATNELD----RQ-----------IAEMRAS--------------
A0A1F2V330      SV-FTEQYPEVVSTEREIKELE----KA-----------VAAAPPK-------PTVAEPS
A0A662EE63      GT-YKEGHPAIKELRVRLEGID----QA-----------IERQIQT--------------
A0A2V8TLH7      VT-YKDKHVRVLEKQSEIDKTN----QK-----------LASEVDR--------------
A0A1Q7ZJT1      VT-YKDKHVRVLEKQKEIEETT----QK-----------IASEVDR--------------
A0A2V8VC99      VT-YKDKHIRVQEKQKEIDEIS----RK-----------IASEVDR--------------
A0A348UZU3      EK-FQPEYPEMQRLKAELDTAR----EL-----------LKNETQR--------------
Q01XL7          AT-LTPEHYKVQKIQAQISELQ----QT-----------LDKEKTG--------------
A0A2V8ERZ5      ER-YQDKHPQVINAVAALQDAQ----RQ-----------LDLEIAR--------------
A0A2V8GTX0      ER-YGEKHPDVQRVNGQIQDAQ----RQ-----------LDAEIER--------------
A0A2V8J0X9      GR-YGPEHPRMMEVKDQIENAK----RR-----------LVAERTK--------------
A0A523DUV7      NR-YKEGHPKVKKVVTQIEQLQ----DA-----------VRTQAEK--------------
A0A372IRG7      SK-FGPEYPKLREIDRQLGSVR----SD-----------IQTEITN--------------
A0A1F2U158      ER-YGEKHPDIINVNARLGDEQ----RQ-----------LDLETAK--------------
A0A2V8F6S9      AR-YGEKHPSIQKARTDLAEGQ----KQ-----------YEFEVAR--------------
A0A7D8BEX2      AQ-FGKNYPAVKEAKAKVDTLS----QQ-----------IKTEEDR--------------
A0A4Q1SCH5      TK-FGSSYPPLVETREQLASVR----DQ-----------IRKNVGN--------------
A0A2V8K4L4      PS-FTPDHPRMQKLEAQITELE----TA-----------LEAARQK--------------
A0A2V8NCZ3      SS-FTPAHPRMQKLEAQIAEME----TA-----------LEDARQK--------------
A0A4Q7YNP3      PP-LTEENPKVIHLRSEIREVE----AG-----------MEAARNA--------------
E8UZE1          SK-YGDSYPRVAQIKSELAEVN----RT-----------ITTELRR--------------
A0A2U3JZ71      AH-YGPNHPEYRKASLQLAELE----RQ-----------LQSGKEN--------------
A0A2V8TTB0      NH-YGINHPEYRKAQTKVQELE----TQ-----------IADTGAS--------------
A0A1V6HR88      AT-FKPEWPAMVELKGRIDQAR----GN-----------LIPAARE--------------
A0A3E0P0A3      ET-YRPDFPTMVELKTQIDEAR----RQ-----------LNQLIEE--------------
A0A2V8EXP2      EK-LGPRHPDMVKIGLAINAAE----ER-----------IQGEIAK--------------
A0A2W4RYA1      ET-FGDRHPEIVAINRAIELAQ----QK-----------LDTEIQK--------------
G8P0Y7          TW-AGQSYPQMREITSQLDQLN----KS-----------INEQVKN--------------
A0A5M8T4U7      LE-VGPRHPKMQAMNAQIAKVK----VD-----------LDHEVSL--------------
A0A7D0PPG7      AI-YGPNYIEYKRAANELAEAT----RE-----------YNDTKTS--------------
A0A7D8BF18      AN-LGPNHPQVLAVKDQIAELT----RE-----------LTEEQNR--------------
A0A1E3Y9R6      TQ-YGPAYPAMRDLASQIEAAN----RD-----------LDLEIDK--------------
A0A2W4TLP2      TQ-YGPAYPAMRELATQIERAR----RD-----------LETEVSK--------------
A0A7C4BZ42      TT-LMPANPKVQRVQAQIEEIE----GA-----------LRREQSN--------------
A0A3R9WF43      TK-YGEKNPRLLQLQEQINAVD----AQ-----------MQTEMAR--------------
A0A317HKM4      KE-LGEHHPTIIKLREAVQNAD----RK-----------LQAEIAA--------------
A0A2V9CG11      AT-LTPAHYKVQRVQAQIAELQ----SA-----------VKNQRTL--------------
A0A523E0N1      TT-FGPDWPEIKRVKGALDETK----RD-----------LDVVATE--------------
A0A523ECP2      AK-FKDDWPDLRRAREGLTDIK----SR-----------IEIERNV--------------
A0A2W0C122      TT-YGPNHPKVIELTNRINAIN----LS-----------IQTELKR--------------
A0A2W0AUU7      TT-YGPNHPKVLELTNRIKAMD----TS-----------IQTELKR--------------
A0A2W0BQL1      TT-YGPNHPKVLELTNRIKAMD----TS-----------IQTELKR--------------
A0A4Q1SDL1      KH-YGSAYPHMVELRASLDKVN----QA-----------ISDEVSR--------------
A0A3P0XH15      SK-FGPEWPRVKEVQGSLVQVR----KA-----------IDVEINN--------------
A0A4R1LAZ7      SK-YGPDWPRVREIRSQLSQVQ----RD-----------IDSEINS--------------
A0A3M1WQW8      QQ-YTDEWPEIQSLKGEIAETE----QQ-----------LAEIEKQ--------------
A0A3N1JHC1      TT-MTPSNYKVQKVESQIKELE----EE-----------MQRHRFT--------------
C1F294          SR-FGPRYPKLEEVRQQLKQVR----SD-----------INKEITN--------------
A0A2V9KA79      ARGYTENHPEVIRLRRQIQEFE----AS-----------ASAQAPVEGPVSARRPAGEPS
A0A522PSP1      SK-YGPGNYLFQQKQRELTQID----NS-----------IRKGQQH--------------
G8P085          TK-FGQNYPPLAQVKDQMQKTD----AE-----------LERQSSI--------------
A0A7C6A629      TH-YGANHPGYRQAAAQVAELK----SQ-----------LNQTVRS--------------
A0A4Q1SGQ1      AR-YGPAHPHTAELQAELTGVQ----RS-----------IRAEAER--------------
Q1ILD9          AI-YGPNYPRVVELKKQLAQVN----AS-----------LAKETRD--------------
A0A7C5SHM3      GK-VGPSWPRLRELHTAEQETR----RN-----------LQAEAEK--------------
Q1IJZ6          QI-YGARNPHLVDVDKQLSDVD----SQ-----------IKGELKL--------------
A0A2V8TCE6      RT-FKPGWPQVEVLTRKLEGAR----QQ-----------LSSETEA--------------
A0A522TBE8      QI-YGTSHPRYRQQSTVVRRDE----EA-----------VQQAQAR--------------
Q1ITG0          TK-FGSNYPKVIQLNNQLAQTD----AS-----------LKKEIRD--------------
A0A7C2ML20      LT-YQPTAPPVKQAEQKLASLE----TR-----------MKRAEIE--------------
A0A7C5AXS9      TT-LTASHPKVRKVQAQITALE----NS-----------FERQRRN--------------
A0A7C2RGE3      VE-YQPTHPRVARVREQIAEAE----RQ-----------LALAKRR--------------
A0A3N5PCI5      SN-LGAKHPEMVRVNSAIEAAE----RE-----------LDSEVAK--------------
A0A3M1Q0S9      VL-LGERHPDVQQIATELAAGR----ER-----------LASETER--------------
A0A2Z5G448      SK-YGFDYPRVREVEKQLTAVQ----TD-----------IDAEISN--------------
A0A3M1VZ38      VQ-LGEKHPEVQTVKAKLDSSR----EH-----------LQEQIAA--------------
A0A4Q1SD29      AK-FGPNYPKVVEVNNQLEKVQ----SD-----------IDQEINS--------------
A0A6N9FGE2      ES-LGPRHPDMIATESSLGDAE----DR-----------LRNEVLA--------------
A0A3M1PY35      TR-FGPDWPEVRELSRAIAEAR----VR-----------LAERAAA--------------
A0A3M1VMP2      GK-VGPNWPRLVELRAAVKETE----RN-----------LENEMEA--------------
                                                                            

A0A2V7VMF7      -------I----ADGL---------------Q----AEFAQLQKRESELRDAIDAQKADA
A0A2V7YYV7      ------------SDVL--------------------------------------------
A0A2V7Z0J5      ------------GDTF--------------------------------------------
A0A2V7Z3M4      ------------ADDF--------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------LKSL---------------L----NIYQQIYVNLSFSPASQSSQNGTN
A0A2V8JK38      -------I----VKTF---------------E----VEYSAATERERLLSVALEQQRDAV
A0A2V9IXG5      -------Y----ADGM---------------R----VSVSVLRNREQASQKSYSEKMAER
A0A2V9J2P4      -------Y----ADGM---------------R----VSVSVLRNREQASQKSYSEKMAER
A0A1Q7RLS4      -------I----INGL---------------R----SQYDLLKDREAKLIKATDETRTES
A0A2V2R525      -------SKSLAVKGL---------------E----TKFREAQRREQEIRDAFEKARSET
A0A321LPW6      -------SRASLEARL---------------R----ADYERSARDEVSLKGALDRAKTEA
A0A2V9R9V4      -------GRVQLEEKL---------------K----ADYERVVRDENALKAALEEAKAGA
A0A321LE75      -------SRGDLEARL---------------K----AEYERAIRDETALKESLERAKIDA
A0A2V8R8U7      -------APQEVLASM---------------K----SRADAAEAHERSLEKAYSVQHGKT
A0A2V8QMP4      -------MPDEIIAGL---------------E----NRYEAAVKNERSATGSYFAARAKA
A0A2V8R4S3      -------MPDEIIAGL---------------E----NRYEAAIKNERSATGSYFAARAKA
A0A2V8NJ55      -------KPAEIINSL---------------K----LRYETALATEQKIKTDYEHERGAA
A0A2V8Q7I0      -------AADEIIARL---------------K----SEYQESYAHENSVRAMYNSQHGTA
A0A2V8S6K4      -------IAKAIVIGM---------------G----ASLDGAKKRAASLQAAYYKERSAA
A0A317I2L9      -------AAAEAIQGL---------------K----AQYEAALAHEQSIKSMYNAQRGVT
A0A2V8LLF9      -------APKEVLAGL---------------K----SRRDSAIAHEKSLVGAYSRQHGTT
A0A352FRF4      -------APTEVLASM---------------K----AKSDAATTQLADLKTAYTKESGLT
A0A2V8MKV0      -------AKRQILVSM---------------E----SRYKAAEATERSLAQAYSQAHGVT
A0A2V8PYY8      -------AKRQILASM---------------E----SRYKAAEATEKSLAQAYSQAHGVS
A0A1Q7YKQ8      -------APGEVLATM---------------K----SKYDAAVTTENSLRASYNQQHSEF
A0A352F3R7      -------APPEIVTSI---------------Q----RRYEAAVSRENLLRRSYEQQKGTT
A0A0B6WXT1      -------APYEVIKAM---------------R----SRYEAALARENKLKQAYYQEAAAA
A0A3B9MEU8      -------APPEIVTSI---------------Q----RRYEAAVSRENLLKRSYEQQKGTT
A0A2V8MHG6      -------TESVVKTNL---------------E----TRYRQALQKEEALRQAFEKQRAET
A0A2V8P7N1      -------TESMVKTNL---------------E----TSYRQALQKEEALRQAFDKQRAET
A0A2V8M3M6      -------TESVVKTNL---------------E----TSYRQALQKEEALRQAFDKQRAET
A0A1Q7NJH5      -------TESVVKTNL---------------E----TSYRQALQKEEALRQAFAKQRAET
A0A2V8PJY0      -------TESVVKTNL---------------E----TSYRQALQKEEALRQAFAKQRAET
A0A1Q7Y6W9      -------AANILTTNL---------------K----TNYLQAKAQEDSLRDAFNKQRSET
A0A2V8NC68      -------ATSVAITNL---------------E----TSYRQAMAREQALRADFEKQRGET
A0A399WK13      -------TKKTLLYNL---------------Q----TKYLQAKANEDKIRADFNKQFGEA
A0A352FLX4      -------ATGVVTTNL---------------A----TRYRQALATEELLRKAYDQQRAET
A0A2V8RTL7      -------SATILLENY---------------K----TQYQQAKDQETKIRSAYDVQYNEA
A0A3E0PCJ6      -------VGETILENL---------------K----TRYLQTKEREDKVRSAFNAQYNEA
A0A3M1S4R8      -------TAKEILTNL---------------Q----TRYEQAKAQEDKIRRAFEEQYRKA
A0A7C2G442      -------TAQEILTNL---------------Q----TRYEQAKAQEDKIRRAFEEQYRKA
A0A1Q7YFI6      -------DVSTLKTNL---------------E----TRYHQALAREESLRQAFDQQRAQT
A0A136KC10      -------TKKTLLYNL---------------Q----TKYLQAKANEDKIRADFNKQFGEA
A0A3M2D6Y5      -------TAKEILTNL---------------Q----TKYEQAKAQEDKIRKAFDEQYRRA
A0A2V8SEX6      -------ASKLLVDNL---------------R----TKYLQTKNEEDKIRAAYDEQYNAA
A0A7C5ZUU4      -------STQVLLDSL---------------R----TDYVQAKDREDKIRKAYNEQYNLA
A0A0B6WWQ6      -------AKDVMLTNL---------------R----TRYRQALAREEALRQAFDEQRGET
A0A3B9MK99      -------KSVTLLTNL---------------E----TDYRQTLAREQALRKAFEQQRGET
A0A352EX26      -------KTNTLLTNL---------------E----TQYRQTLGREQALRAAFQQSRSET
A0A2V8MM59      -------STSVLLTNL---------------E----TRYRQTLAREQALRKSFDQQRAET
A0A2V8PFE8      -------NTNTLLTNL---------------E----TKYRQSLAREESLRKSFNQQKGET
A0A2V8PWS6      -------NTNTLLTNL---------------E----TKYRQALAREDSLRKSFNQQKGET
A0A2V8LCT5      -------STATLLTNL---------------E----TKYRQAAEREDSLRKSFNQQKGET
A0A352FTJ9      -------GTATLLKNL---------------E----TKYRQAADREEALRKSFNQQKGET
A0A257VBK0      -------V----LGSY---------------R----NQLSALRGERANLAQEVDGARREG
A0A2G6PYV5      -------L----YNRLIQSISKDVQD-----RKNELAYLEAQRKKQNQKIVLADLKTKEQ
A0A2V8F956      -------V----VQGV---------------K----NEYLAALAKENSLTGALNAQKGDA
A0A1F2S1W5      -------V----LQAM---------------R----NDYEAALTEERTLANELNRQKIEA
A0A1F2T595      -------I----AQAI---------------R----SEYEAALAEERSLSASLNQQKIEA
A0A2V8JQV5      -------I----LRGI---------------A----NQYEDAKRREELLAQEYDAQTRVV
A0A2V9AC41      -------E----VKRI---------------E----VTYTAAKNNETGLRATMEDQKKTT
A0A2V9MAM9      -------T----RQRL---------------R----NDYLTARRREALLSSAYQQQTHLA
A0A348V070      -------L----IKTA---------------Y----AEYQGALAKEQNLQKLLDDLKAQA
A0A2V9M454      -------V----VDNL---------------H----NDYLAAVEREKFLATAVAQQKVQV
A0A2V9IVR7      -------I----VERY---------------H----GEYVAAQQREAMISEALARQKVEL
A0A2V9ILE2      -------I----VERY---------------H----GEYVAAQQREAMISEALARQKVEL
A0A2V9LGY4      -------I----VERY---------------H----GEYVAAQQREAMISEALARQKVEL
A0A2V9J4D6      -------V----VERI---------------Q----RDYEAAVEREKLLEATVAQQKFEV
A0A2V9L9C5      -------V----VERI---------------Q----RDYEAAVEREKLLEATVAQQKFEV
A0A2N9M9N1      -------I----MERI---------------E----SDYRTAVRREQLLSQDVSAQRTEV
A0A2V9JEC4      -------L----VKQT---------------K----DAYDTAVRRETLLSRTVAEQRKDV
A0A2V9LPQ3      -------T----VERI---------------Q----NDYRAASTRVSLVSTSVVQQKAEV
A0A2Z5G3A3      -------M----GARA---------------E----NDFKVAKTAEAQSQMSYKALKKRA
A0A2V7UGP8      -------I----FDDT---------------LKTAKMEYEEASAHEKTVRGALEGQKSEA
A0A239MKT6      -------L----NSET---------------R----SSYLLAKADEDGIRKRATDQRQQV
A0A3E0PCN7      -------S----ADVQ---------------LSDLQRQFREASSRENELRRNFEAQRNAV
A0A2V8IYW3      -------V----ADNVVVRRMRETQTEIDKLD----RQIAGKEADSVRLRGTIAEYQRRV
G2LEI9          -------T----LVRI---------------K----TAYENAKRREEELRARVEKQRNEV
A0A317J121      -------E----IQRI---------------K----NDYDVALRREKLLSADYTKQASQV
A0A2V7YW66      -------L----TEKA---------------RNAAAASYQTALRQEQSLDGELTTLKGQA
A0A2V7Z0V0      -------Q----VDKA---------------KSNSLAAYQTAQRQEQELEGELNALKRDV
A0A2V8GFD4      -------I----AESV---------------R----TEYLAAAAQERSLQAALDQQKHEA
A0A2V8HSS5      -------I----AESV---------------R----TEYLAAAAQERSLQAALDQQKHEA
A0A2V8KP55      -------I----VKTF---------------E----VEYSAATERERLLSVALEQQRDAV
A0A399WNU1      -------S----ADTQ---------------IASLLQTYREAASRENELRSNFDAQRSAV
A0A2V9JSI3      -------I----AGRV---------------R----NDYRAAMGREKLLAAALAREKEAV
A0A2V9WI32      -------I----ASRV---------------Q----NEYLSALQREKLLGAALDVQKQEA
A0A2V8IVN9      -------V----VQSV---------------K----NEYLGSLAKENSFIAALNQQKGEA
A0A7C5Z4J3      -------A----VERI---------------V----HNYQAAFGRVKLLSASVAREKMEV
A0A1F2TPT3      -------V----LEAM---------------R----EDLGVSRAAEANLGKELESLKIEA
A0A2V8JTQ2      -------I----GERI---------------T----YEYQTAAERERMLRDALEAQKQVV
A0A2V8UZY0      -------I----GKRI---------------T----YEYQSAVGRERILQDALEAQKQTA
A0A350UEK1      -------I----LRRI---------------R----NEYEEAMRKERLLQTDYDRQTRLV
A0A350UIQ4      -------I----LRRI---------------R----NEYEEAMRKERLLQADYDKQTRLV
A0A1H5Z7N3      -------I----LAQA---------------R----QNYIASRTNEQQTRGALEAEKSTA
A0A1G7JVV8      -------M----VTEA---------------K----QALVAAQANEAQTEGALEDQKNQS
A0A1H4T6W9      -------L----LTEA---------------K----QALVAAKANEDQTSSALEEQKQES
I3ZEU5          -------L----LTEA---------------K----QALVAARANEDQTTSALEQQKQES
A0A1I6MH75      -------L----LIQT---------------R----EAYLATKANEQQTSAALEQQKTDA
E8WVF6          -------L----LTQA---------------K----ETYLIAKANETQTTAALEAEKQDA
A0A7D0PQC3      -------L----LEQA---------------K----QNFELAKSNQTQTESVLEAQKTAA
A0A428MDU2      -------L----LLQA---------------K----QNYVVARTNEDQTSAALEKQKSDA
A0A5B9EBI2      -------L----LNQA---------------K----QTYLAAKATEEQTQAALEAQKADA
A0A239HDF6      -------L----LLQS---------------K----ENYLIAQANEEKTNAALDAQKADA
A0A4Q0T270      -------L----LTQA---------------R----ENFNAAKANEEQTTAALEKQKADA
A0A1Q3QQB6      -------L----LLQA---------------K----ENFVVARANEVQTKAALEQQKTDA
A0A3N1K1G7      -------L----LLQA---------------K----QNYVIARANEDQTAAVLEAQKTDA
A0A4V2G466      -------L----VLQA---------------K----ENFLAARTNQEETAAALEKEKSDA
A0A6B9YNQ8      -------L----VLQA---------------K----QTYLAALKDEQDTTAALEAEKNQA
A0A3N5YNR8      -------T----INRV---------------Q----SEYRVAVNRRQMLLGALNRQKSEA
A0A3N6A5T6      -------A----IQRA---------------R----AQYQVAVDRRNRLQTALVAQKEMA
A0A1F2Q9L4      -------M----VGKA---------------RDSARAEYQGALRREEALVAELTRQKSDA
A0A2U3KC61      -------M----QHGV---------------R----DEYLAAVQRENLLTTAFNQQTQQA
A0A2V9Y2R7      -------M----QHRI---------------R----DEYLAAAQRERLLTSAFEQQKQRA
A0A2V9NGH6      -------V----IARV---------------R----SDYLASVHREEMLRAAMEKQKQEA
A0A2V9PYE6      -------V----IARV---------------R----SDYLASVHREEMLHAAMEKQKQEA
A0A2V9NL07      -------V----GGRL---------------R----GDYLAALQRENMLRSALEEQKQQE
A0A2V9QD92      -------V----GGRL---------------R----GDYLAALQRENMLRSALEEQKQQE
A0A2V9WPZ6      -------M----GGRV---------------R----GQYMASLHREGLLRDALEKQKQQA
A0A2V9ZLH4      -------I----AGKV---------------R----NQYLAAVQRESMLHDAMEKQKQEA
A0A2V9RQF1      -------I----TSRV---------------R----SDYLASLQRENMLRDALDRQKQQA
A0A2V9YDK8      -------I----AGHV---------------R----SQYMASLQRENMLRAALEKQKQEA
A0A2V9V8F7      -------M----GGRV---------------R----GQYMASLHREGLLRDALEKQKQQA
A0A2V9XGR9      -------M----SGRV---------------R----GQYMASLHREGLLRDALEKQKQQA
A0A2V9V3Q5      -------A----VDHL---------------R----GQYQTALQRETMLRAALEKQKQEA
A0A2V9NWS3      -------V----VARV---------------R----SDYLAALQRETMLRGALTKQKQEA
A0A2V9USA9      -------I----ASKV---------------R----GQYMTALQRENMLRDALEKQKQEA
A0A2V9XW18      -------I----VAKV---------------R----GQYNAALQRENMLHTALDKQKQEA
A0A1H5SQF5      -------V----GNQA---------------A----RNLDLARKTEDGLLQSVDREKLRL
A0A2V9AEW6      -------V----LGRM---------------R----NEYEAALRREKLLTEAHDAQQKVV
A0A2V8WQK6      -------V----LRGL---------------G----NEYAAAVRRERLLSKAQAEQEKIA
A0A2V8XIF4      -------V----LRRI---------------G----NEYTAAVRRERLLVEVHANQEKVV
A0A2V2R0I6      -------I----LNGL---------------E----ADYREARQHENLLMRELEDQKAQA
A0A2V8XAR9      -------I----VDVL---------------E----SDYREARQRESMLTQALDQQKAAA
A0A2V8VZA0      -------I----LDVL---------------E----SDYHEAQQRETLLTQALDQQKAET
A0A1Q7CB82      -------I----LDVL---------------E----SDYHEAQQRETLLTQALDQQKAET
A0A2V8WIU1      -------I----LDVL---------------E----SDYHEAQQRETLLTQALDQQKAET
A0A1Q6Y9F5      -------I----LNVL---------------E----SDYHEAQQREALLTRALDQQKADT
A0A2V9EVV8      -------I----LDVL---------------E----SDYHEAQQREALLTRALDQQKADT
A0A2V8YF91      -------I----LDAL---------------E----SDYREARQRETLLTDALDQAKAEA
A0A2V8XZK2      -------V----LEVL---------------E----SDYREARQRETLLSEALDQAKVEA
A0A2V8ZTX6      -------I----LDVL---------------E----SEYREARQRETLMGQALDQAKAET
A0A2V9BT79      -------I----LEVL---------------E----SDYREARQRETLLADALNEAKAET
A0A2V9YHT3      -------I----GGRL---------------Q----SEYQAATQRETLLQEALNQQKREA
A0A7C2XNI7      -------I----VDRI---------------E----SEYRAARQRELLLSQALEQQKAEA
A0A1Q8B793      -------I----VTSI---------------E----NEYRAARQRELLLLKALDQQKAEA
A0A2V9BCA0      -------I----VTSI---------------E----NEYRAARQRELLLLKALDQQKAEA
A0A2V9BWU9      -------I----INRI---------------E----AEYHTARQRENLLSQALDKQKGES
A0A2V9DKX2      -------I----VNRI---------------E----AEYHTARQRETLLSQALDKQKGES
A0A7C2YQY3      -------I----GNRI---------------E----NEYQAALRREQLLRKAVEGQKAEA
A0A3E0NV31      -------A----ADAV---------------L----QQYRAAQRRADSFAAQIRAERRSS
A0A3N5M5V0      -------T----IRRA---------------Q----SEYKVAVNRQQMLRRALQKQKAEA
A0A3N5XQP8      -------A----LEEA---------------Q----GRYRASLQQYSQLSRVMDRQRQLA
A0A2Z5G7H4      -------V----AERS---------------K----NDYEIARREEDESRTEFATEKHQA
A0A2V9L5B5      -------V----VDNI---------------V----DEYRSATAKEQYFAQAVDDQKREV
A0A2V9LK56      -------L----VQNL---------------V----DAYSSAVNREKYLEQALKGQEKQV
A0A2V9L7I0      -------V----TENI---------------V----DEYRSAAAKEKYFAQAVEDQKREV
A0A522PPT0      -------L----TQNI---------------A----QQYDAAVVREKYLNSLVSQQESLV
A0A7C5V1G5      -------L----TKNI---------------A----QEYQAAEARERYLNDLIKKQEKLV
A0A2V9KCS3      -------I----LKRI---------------R----NEQEAAVRRESLLAAEYGSQAKLV
A0A372IT17      -------V----GERA---------------H----ADYEIAQRAEDTAREEFEKQKTLA
A0A4R1LC91      -------V----AERA---------------Q----NDYLVAQGVENSTQKVFDEEKKQA
A0A3M2BZG9      -------E----VNQR---------------RDLARTAYQEALRKEQNVEEELRKLTDEI
A0A1Q7N5R7      -------A----LATE-------------------------LESREAVLGTQITAGGREL
A0A2V9QB26      -------I----VDRI---------------R----NDYKTALRREKLLSAAYRNQSRLV
A0A2V9VYY4      -------L----QQKM---------------R----DDYLAALQRENLLDSAFNKQKQEA
A0A3E0PHB0      -------S----KQIIEDESKTLEKAVQKEITSALAAKLNTARRREAQLAAAYEQESAKA
A0A3M1SIV3      -------E----SAQIEQESKQAEERAKKEILTGLAAQLNSARKREAKAKESYLREVEKA
A0A3M2D491      -------V----EKKLELESKLLEQRAQKELLTALSAQLNAAKQKEEQARASYLAEVERS
A0A353C9L6      -------V----SGIIDRDQKKIEKDAVTGALVSLRAQLDSKRREEAQALDAYEKEAALA
A0A2V8RQV0      -------V----SKIIDTDQKKIEKEAVSGALVSLRAQLNAARTQEAQAQAAYEQESGTA
A0A2V8SJH5      -------V----STIIDKDQKKIEKDAVNGALVTLRSQLSAAQKQEAQSLAAYEQEASQA
A0A357F267      -------V----TQIIDRDQKKIEVDAINGALVSLKAQLDAKRKEEAQAQAAYDAEAARA
A0A7C5ZUA8      -------V----SQIIERDKKSLEKDAVSGALVSLRSQLESKRREEAQALAAYEKEAALA
A0A136JPP4      -------V----SQIIDRDQKKIEKDAVSGALVSLRSQVDAARRREDQLLNAYEVEAERA
A0A399WUJ8      -------V----SQIIDRDQKKIEKDAVSGALVSLRSQLDAAKRREDQLLNAYEVEAERA
A0A2V9KIE8      -------L----VENI---------------V----EEYHAAESNEKLLAQAVVQQKAEV
A0A352F549      -------A----KQII---------------TTNLEVNYRKAVEREKTLRDSFNKQRGET
A0A3B9MLP9      -------A----RKII---------------TVSLDSNYRQALDREKTLRDSFNKQRAET
A0A3D5SQ87      -------A----RKII---------------TVSLDSNYRQALDREKTLRDSFNKQRAET
A0A2V8NW86      -------I----VDRI---------------R----NDYETALRREKLLSAEYRNQSRLV
A0A7C2GJ20      -------I----LANI---------------E----AEYKAAVRRERDLRAALEQQRAET
A0A7C4BTL5      -------I----VNRI---------------R----NEFEEAAQRERMLARDYAEQTRVV
A0A2V8ZHL8      -------I----VERL---------------R----NDYMAALGREKLLAAAVAKEKADV
A0A2V9B240      -------V----VERL---------------R----NDYEAALGREKLLAAAVAKEKVGV
A0A2V9CBM2      -------A----ADQI---------------T----NEYFAASSRESLLRHELAEQQKQI
A0A2V8XN17      -------A----ADRI---------------A----NDYSAAVRRENLVQQALDNQQKQV
A0A2V8WX45      -------A----ADRI---------------A----NDYSAAVRRENLVQQALGEQQEQV
A0A1Q6YR79      -------A----ADRI---------------A----NDYSAAVRREDLVHQAVDGQQKQV
A0A1Q7VA32      -------A----ADRI---------------A----NDYSAAVRREDLVHQAVDGQQKQV
A0A2V9EY85      -------A----ADRI---------------A----NDYSAAVRREDLVHQAVDGQLKQV
A0A2V9H8K0      -------A----TDRI---------------V----NDYSAAVRRENLVQQALNDQQKQI
A0A2V9FFE5      -------A----ADRM---------------V----NDYSAAVRRENLVQQALDDQQKQV
A0A2V9GM43      -------A----ADRM---------------V----NDYSAAVRRENLVQQALDDQQKQV
A0A2V9CYQ5      -------A----ADQI---------------T----NQYLAASSRESLLRHELAEQQKQI
A0A2V9BWU8      -------A----ADKI---------------T----NEYSAAVRREELVKQALDDQQKQV
A0A2V8ZG48      -------V----ADKI---------------V----NEYLAAVRRESLVKQALDEQQKQV
A0A2V8Y334      -------A----ADKI---------------T----NEYFAALRRESLVKEALDGQQKQV
A0A2V9AY68      -------A----ADKI---------------T----NEYFAALRREGLVKGALDTQQNQV
A0A1F2RFI7      -------F----AKRV---------------T----DDYRAALNRKRLLDQAVEQQTKEI
A0A1F2RZS3      -------F----AQRV---------------A----NDYKAAANRKRLLDQAVAQQTSDF
A0A1F2USE2      -------A----AERI---------------R----KEYGAAQQRQEFLRQAFQKQEEQA
A0A7C2VB08      -------M----AERV---------------G----NEYRAALAREQMLVRAFAEQQQRR
A0A2V9C238      -------V----AGRI---------------T----NDYLAAVRRENLVAQAFAEQQKQA
A0A1F2Q9F5      -------A----AERL---------------A----NDYQAAMRRETLLRRAFADQQAQA
A0A1F2QQH9      -------A----AERL---------------A----NDYQAAMRRETLLRRAFADQQAQA
A0A1F2QXK7      -------A----AERL---------------A----NDYQAAMRRETLLRRAFADQQAQA
A0A2V9DEM9      -------V----AGRI---------------I----NDYLAAVRRENLVAQAFAEQQKQA
A0A7C5TWV7      -------I----VKGL---------------R----TDYRIRKAREASLYRALQQLRDQA
A0A2V7XDY0      -------I----IAAL---------------R----ADYEQLQKRESELRGAIDTEKAQA
A0A2V8G155      -------V----VDSV---------------K----TDYLAAVAQERSLTAALEQQKTEA
A0A2V8HDM7      -------V----VDSV---------------K----TDYLAAVAQERSLTAALEQQKTEA
A0A2V8DRT9      -------V----VHAL---------------S----NDYQAALAQEQSLMHALDQQKNDA
A0A2V7VYF3      -------V----VESV---------------H----NEYLTALAREQDLVAALNAQKNEA
A0A1F2SVH2      -------V----VQAM---------------R----NDYRQTVAQEQSLMSALEQQKSEA
A0A2V8AJG9      -------V----VQSV---------------K----NEYQAALIQEQTLTGALDQQKRDA
A0A2N9LQU7      -------V----GQRL---------------H----DEFLAAQNSESLLRDQFEHQRQEA
A0A2P6WFK7      -------V----GRRM---------------E----TEYQSAAKTEAALRNQFNKQKEEA
A0A2V8U914      -------V----RQSV---------------Q----NDYVAAQRRQTGLASVYARQSALV
A0A2V7W309      -------A----LEEA---------------R----AQVSAASSREGSVRSAYEQQRTEA
A0A2W0BGU4      -------I----AQRI---------------R----NDYFAAARREQLLGATLAEQKKES
A0A2W0BVQ9      -------I----AQRI---------------R----NEYFAAARREQLLGATLAEQKKES
A0A2V9MN96      -------L----LSKV---------------R----DEYMAAIQRETLLTSAFDHQKQEA
A0A2V7V2Z1      -------V----IRAA---------------E----NDYKAYAAQEASVASALEAAKAEA
A0A2V7X2F7      -------V----IRSA---------------E----NDYKAAAAQEASLAAALESTKEEI
A0A2V7V2I1      -------V----IRAA---------------E----NDYRAAVAQEHGVADALEMAKREA
A0A2V7U3M2      -------V----IRAA---------------E----NDYKAAAAQEASVSSALEAAKAEA
A0A2V7UHT0      -------V----IRAA---------------E----NDYKAAAAQEASVSSALEAAKEEA
A0A2Z5FVL3      -------M----RDRA---------------R----NEYVVAQQVESGAKQLYDAEKQRA
A0A2V9KBD6      -------I----GDRL---------------T----YEYHSAAERERMLRAALEKQKQVA
A0A2W0AJ66      -------T----RERM---------------T----NEYRMALERERMLRNALETQKQAA
A0A1Q7RBU1      -------I----GEHI---------------T----YEYKSAVGRERMLRSALEAQKQAA
A0A2V9JPV9      -------I----GERI---------------T----YEYKSAVGRERMLRYALEAQKQAA
A0A3P0X3W6      -------T----GRRI---------------Q----TDFAQADTREKMLAATLAAAKAQS
A0A2N9MK30      -------V----MRRV---------------E----VEFREGVNREEMLKKAVTETKAEF
A0A3D1ASD2      -------I----TEQV---------------A----IEYRTATQREQMLKQELARTKSES
A0A7C5AXI3      -------I----KRRV---------------E----IEYQEALRRESMLQKAVQETKAEF
A0A7C6E4H7      -------I----VRRA---------------E----VEYREALNREAMLKKAVDQTKAEF
A0A1F2TCR2      -------V----IETA---------------K----TDYEAAVAEERSFASSLEDQKRVA
A0A350UQT3      -------A----IRRM---------------Q----VEYEQAQAREKMLERSVNETKAEY
A0A7C3HRX0      -------I----ARRM---------------E----VQFREVSAREQMLARSVAETKAEY
A0A1F2V330      AARMHYVQIRAEKESL---------------E----QRLTSYGQEERALESEMGRLQRRV
A0A662EE63      -------L----RLGM---------------E----TRFDMVKRREQSLFENIQGLRNQT
A0A2V8TLH7      -------I----ISNL---------------R----TQYALLKDRESKLAVAINETRSES
A0A1Q7ZJT1      -------I----INGL---------------R----SQYDLLKDREAKLIKATDETRTES
A0A2V8VC99      -------I----INGL---------------R----AQYELLKDREAKLIKVSDDTRAES
A0A348UZU3      -------L----IRAA---------------Y----ADYQAALKKEASLKELFEQQKEEA
Q01XL7          -------L----LKRL---------------D----NDYQEALRREKLLSGAYNAQTHAV
A0A2V8ERZ5      -------A----VQSV---------------K----NEYETAVLQEQTLARNLDGAKSEA
A0A2V8GTX0      -------S----VAAI---------------K----ADYQAALDEEKQLSADLEGQKAQA
A0A2V8J0X9      -------V----LESL---------------K----NDYNAAFAQERSFSSQLEEQKGAS
A0A523DUV7      -------L----VAGM---------------R----ADYQQLRRRERELLASINSQRKES
A0A372IRG7      -------L----TQRF---------------Q----TEYDAAVKTEGLLQQRLDDTKQQA
A0A1F2U158      -------A----LQTV---------------R----NEYERAVLEERTFAANLEEAKKDV
A0A2V8F6S9      -------A----ATTI---------------K----NDYESAVLEEQTIARGLESAKADA
A0A7D8BEX2      -------I----LSQS---------------K----LAYSAATANEAMTKTALAEQQKDA
A0A4Q1SCH5      -------I----TAHL---------------K----QDLDASRQAESLMHQEYQDAVSQA
A0A2V8K4L4      -------V----VTRL---------------R----NDYAAAESHEKLLNDEFAKQLDTV
A0A2V8NCZ3      -------V----VTRL---------------N----NDYAAAQSHEKLLNDEFAKQLNTM
A0A4Q7YNP3      -------N----SNRL---------------K----NELETARHREMLLMTAYHMQEANV
E8UZE1          -------G----RNQL---------------E----LEYKLASENENKLRAATEAQKQQI
A0A2U3JZ71      -------I----GQRV---------------E----VEYREALNRESMLRKTVSETKAEF
A0A2V8TTB0      -------I----AQRV---------------E----IEYREAVNREAMLEKAVAETKAEF
A0A1V6HR88      -------ALAKAREAA---------------R----AEYQGAQRREAALAAEINSLKVEN
A0A3E0P0A3      -------NSRQAVTAA---------------R----ARYQQALQTERSLEREYEAMKEET
A0A2V8EXP2      -------V----VQAV---------------R----NEYLSAQTQEQSLINVLDQQKREA
A0A2W4RYA1      -------V----VASI---------------T----AQYEAAVAHENNLLAALAQQEREA
G8P0Y7          -------S----VSRI---------------H----NDYQTAVNREQMLQEALGEQMGIA
A0A5M8T4U7      -------A----HRQI---------------Q----DEYQGALRTEQLLRQRLDAQKEEA
A0A7D0PPG7      -------I----AKRM---------------Q----VDYEEAKSRESMLLAELTRAKSES
A0A7D8BF18      -------V----LVDA---------------K----AAYIAAKAEEDHTKAALEAQQDEA
A0A1E3Y9R6      -------V----AAAL---------------Q----AEFQTARAREAALQQSLAGQQRES
A0A2W4TLP2      -------V----AAAI---------------E----ADFETALARERALQQSLDQQQRES
A0A7C4BZ42      -------V----VRRL---------------G----NDYQSALRREQLLLAETNVQSRLV
A0A3R9WF43      -------I----TKRA---------------E----NAYQYAKDNENSIKGQFEKQQHEA
A0A317HKM4      -------A----AHTI---------------R----NDFEAAQSREQALEAALDRSKREV
A0A2V9CG11      -------I----LRRI---------------G----SEYSAARQREEFLAKAYADQEMIA
A0A523E0N1      -------QAAKVVGTA---------------K----GEFQEARDRENSLRKSLNAQKSQV
A0A523ECP2      -------LAVEVVAKA---------------R----VEYRAAVEREHLLLAEVESQKKEA
A0A2W0C122      -------L----QARA---------------E----LEYQVASRREQKLRAAFEAQKVEA
A0A2W0AUU7      -------L----QGRA---------------E----LEYQVAARREQKLRAAFEAQKIEA
A0A2W0BQL1      -------L----QGRA---------------E----LEYQVAARREQKLRAAFEAQKIEA
A0A4Q1SDL1      -------V----QARA---------------K----SDYEIAQKTENDSRAQYEANRQAA
A0A3P0XH15      -------M----QQRF---------------Q----VEYETALSTENLMRKRLEDAKQQA
A0A4R1LAZ7      -------L----TQRF---------------Q----EEYNAASNTEALMRKRLDATKQEA
A0A3M1WQW8      -------I----LAKI---------------E----ADYKAARTREENLRAELMAQRAET
A0A3N1JHC1      -------I----VKRL---------------S----VEDDTAARRQQLLKQQYDRQLAVV
C1F294          -------L----TQRF---------------K----AEYDAAVQTQNLLEARLENTKQQA
A0A2V9KA79      PFFLRYLQLKSEVEAI---------------D----QRLNSSKQEQRDLTAQLETYRSRV
A0A522PSP1      -------I----LAQI---------------K----AQARAQAVQVKLTERQLADVKAQL
G8P085          -------V----KNRL---------------K----QEYDTAVAIQSSLQQQYDEQTDKA
A0A7C6A629      -------I----LRRA---------------E----VEYREAMNREAMLKKAVDEAKAEF
A0A4Q1SGQ1      -------M----GHRA---------------R----VDLDIAQNTENAARDAFEKQRSTA
Q1ILD9          -------I----EARF---------------S----SEYEASLNTENKIKGNFDQHQQEA
A0A7C5SHM3      -------LYHQALSGA---------------R----ADVVAAREQEQRLRDLYEREKQLA
Q1IJZ6          -------I----VDRT---------------E----LDLELARQSEDALRQAYEKQEQEA
A0A2V8TCE6      -------IARRIVSAE---------------Q----AKYRAALDEEERLGKLLEEQKSEA
A0A522TBE8      -------L----AGAA---------------R----AQFVAARLQEMLLEQAVAQQKQAM
Q1ITG0          -------I----EERF---------------R----TEYESAKRTEDQLRASVENRKKEA
A0A7C2ML20      -------ARRALLSKV---------------A----KEYKNADNRLQTLTGELERQKKEI
A0A7C5AXS9      -------V----LERI---------------R----NEFEAAERRERLLARDYEAQSKVV
A0A7C2RGE3      -------I----VANI---------------E----AEYRAAVRRENDLRAALERQRAET
A0A3N5PCI5      -------T----VESV---------------R----QEYLAALSREKELTAELDAQKSRA
A0A3M1Q0S9      -------IARQVREAA---------------K----IDYEQARRRAEGLRRLYEETEQRV
A0A2Z5G448      -------L----LKRF---------------E----EEYNAAVNTEALLKGRLEQVKQEA
A0A3M1VZ38      -------IAASAIDSA---------------Q----AAFEQARREEQQLAQLLADATREA
A0A4Q1SD29      -------L----TKRF---------------T----EEYDASVNTESLMRARLEATKQEA
A0A6N9FGE2      -------V----VDSL---------------R----IEFEVASSRERELAAELDRQTANA
A0A3M1PY35      -------VFEEAVGAA---------------R----ADLELARTREARLQALFQQELAAT
A0A3M1VMP2      -------IYRQALESA---------------R----AELALRRESEARLQRLIEEEQARA
                                                                            

A0A2V7VMF7      ARQSQKKTEVEVLKKEAQSAASLYDVLLQKLNESD--------------IA-A--SIRTN
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      -------------KTSDTGSQALVATLTNRREQAAAVQSFWKTALDKLQIQ-S--NLQTS
Q01X01          -------------RAEGDGNREFYDAMARRANEAS--------------VA-S--TLRQS
A0A3M2D9H8      NQLQAALVLY----------QQIYANLLSNYEAIR--------------LA----RLQST
A0A2V8JK38      NKMNREIIQYNILKREADSSKDIYNGLLTRLKEAG--------------IS-G--GLRAS
A0A2V9IXG5      RVTSRHMAEMSSFIKSKENWASAFAAVEQKLRDLS--------------LQ-E--GFVTS
A0A2V9J2P4      RVTSRHMAEMSSFIKSKENWASAFAAVEQKLRDLS--------------LQ-E--GFVTS
A0A1Q7RLS4      LQVNRKASGYEMVRGEATETKRIYDLISARVKEID--------------LS-S--SLLSN
A0A2V2R525      ITQNSAAVNYRILQQEIQTNQELLNGLWQRYKEND--------------VIL-AGT--PN
A0A321LPW6      ARQNQDAIQYGILKQDVDTAKSLYTEFLQKTNQAN--------------LEL-AQQ--SS
A0A2V9R9V4      AQENQRAIQYSLLKQDVDTAKSLYTEFLQKTNQAY--------------LEV-AQQ--QS
A0A321LE75      AQQNQDAITFNILRQNVETAKTLYTDFLQKQSQAR--------------VQV-AEQ--HN
A0A2V8R8U7      VSQTRNVIDLAIKTQELTTDAQYLNTLMQKRRELA--------------AGG-ADR--GT
A0A2V8QMP4      NDQSVADTKLADLDQQIATDRQNLNLYMQRANELK--------------VTAPDRA--SG
A0A2V8R4S3      NDQSVADTKLADLDQQIATDRQNLNLYMQRANELK--------------VTAPDRA--SG
A0A2V8NJ55      QAQGKAALDIGGLTQELETYRQLFQTLSQKQNEID--------------LAG-NDQ--GN
A0A2V8Q7I0      TQQTRNQIEMAQYKQELETDKQYLNTLMARKRDVQ--------------TSN-TDR--AN
A0A2V8S6K4      QAQGIQVIGLSNVEQQLTTSKQMLSTLLQRRQELE--------------TADIEGQ--SN
A0A317I2L9      SQQTRAQIDMVSYTQTLETNKQYLNTLQQRLREIQ--------------ASS-GDR--GN
A0A2V8LLF9      IQQTKDQIDMAIITQALTTDQQYLNTLTQRLRELT--------------ATS-GSG-TAS
A0A352FRF4      AQQTKNIIELASMRADLASDQQYLNTLFQKRRELN--------------AVS-GET--GT
A0A2V8MKV0      AAQLDHELELAAMTQKLTSDEQYLNTLNQKERELK--------------ATG-SDK--GT
A0A2V8PYY8      TAQIQHELELAAMTQNLTSDEQYLNTLNQKERELK--------------ATG-TDK--GT
A0A1Q7YKQ8      SQQTQDQIQLTMIEQEIETNRQYLTTLLQRQRELE--------------NEQ-TGRMQTN
A0A352F3R7      TQQTRDQIDLIALTQGLETDKQYLNTLLQRQRELQ--------------VTS-GDR--SN
A0A0B6WXT1      NEQNQAEIELSRITQELETNKQFYNTLFQRQKELE--------------ITS-NDR--AN
A0A3B9MEU8      TQQTRDQIDLMAITQELETNKQYLNTLLQRERELT--------------VAS-GDR--SN
A0A2V8MHG6      LTQNEAAVNYRIIQQQIETNKSLLDGLLQRSKENE--------------VIL-AGT--PN
A0A2V8P7N1      LTQNEAAVNYRIIQQQIETNKSLLDGLLQRSKENE--------------VIL-AGT--PN
A0A2V8M3M6      LTQNEAAVNYRIIQQQIETNKSLLDGLLQRSKENE--------------VIL-AGT--PN
A0A1Q7NJH5      LTQNEAAVNYRIIQQQVETNKSLLDGLLQRSKENE--------------VIL-AGT--PN
A0A2V8PJY0      LTQNEAAVNYRIIQQQVETNKSLLDGLLQRSKENE--------------VIL-AGT--PN
A0A1Q7Y6W9      LVQNEAAVNYNIIKQGIETNKQLLDGLLQQERTND--------------VVG-EGT--PN
A0A2V8NC68      LTQNEAAVNYRILQQEIDTNKSLLDGLLQRAKEND--------------VVL-AGT--PN
A0A399WK13      TGQNQSAVSLALLKQTIDTNKGFLENLRKQVSSND--------------VAA-QGS--DN
A0A352FLX4      LTQNEAAVSYRIIQQEIETNKTLLDGLLQRTKEND--------------VVM-AGT--PN
A0A2V8RTL7      QGQNSGAVMIKLLEQTIETNRGFLDNLRKQQSGND--------------VAS-QGS--DN
A0A3E0PCJ6      QGQNQSEVTIKLLEQDIETKKGFYANLENQQKGND--------------LAG-AGT--EN
A0A3M1S4R8      EGENRAAIDIKLLEQNIETNRGFLKNLIEQQSSND--------------VVA-QGT--TN
A0A7C2G442      EGENRAAIDIKLLEQNIETNRGFLKNLIEQQSSND--------------VVA-QGT--TN
A0A1Q7YFI6      LTQNEAAVNYRIIQQEVETNKQLLDGLLQTAKGND--------------VVM-SGT--PN
A0A136KC10      TGQNQSAVSLALLKQTIDTNKGFLENLQKQVSSND--------------VAA-QGS--DN
A0A3M2D6Y5      EGENRAAIDIRLLEQNLETNRGFLKNLIEQQSSND--------------VIA-RGT--EN
A0A2V8SEX6      QVQNGGAVRLKLLEQTIETNRGFLDNIRKQQSSND--------------VAS-QGS--DN
A0A7C5ZUU4      QGQNVGAVQIRLLEQNIETNKGFLDNLRKQQSGND--------------IAS-QGS--DN
A0A0B6WWQ6      LTQNEAAINYRIIQQEIETNKSLLDNLLQRAKENG--------------MAM-AGV--AN
A0A3B9MK99      LSQNEAAINYRIIQQEIDTNKTLLDSLLQRSKEND--------------VIM-ASK--PN
A0A352EX26      VTQNEAAINYRIIQQEIDTNKTLLDSLLQRSKEND--------------VIM-ASK--PN
A0A2V8MM59      LTQNEAAINYRITQQEIDTNKGLLDSLLQRSKEND--------------VVL-AGR--PN
A0A2V8PFE8      VTQNEAAINYRILQQEIETNKGLLDNLLQRSKEND--------------VVL-AGR--PN
A0A2V8PWS6      VTQNEAAINYRILQQEIETNKGLLDNLLQRSKEND--------------VVL-AGR--PN
A0A2V8LCT5      LSQNEAAINYRILQQQIETNRGLLDNLLQRSKEND--------------VVL-AGR--PN
A0A352FTJ9      VTQNEAAINYRILQQEIETNKGLLDNLLQRSKEND--------------VVL-AGR--PN
A0A257VBK0      LQFVEGLSRGEGLNTSSAAIKKYMDLLYDKMSELN--------------VS-S--SLMSS
A0A2G6PYV5      NASLDSKIQVLEQNSLVIDKRKEYLELALGLKEIG--------------RTDK-------
A0A2V8F956      ----------------VQSSRQIFDSLMQRAKETG--------------VS-A--ELKTS
A0A1F2S1W5      QQLNRTSIDYSALQRDAAANRQMFEALLKRTQETG--------------VS-E--ELKTG
A0A1F2T595      QSLNRAGIEYGALERDATANRQMFEALLKRTQETG--------------VT-E--ELRTG
A0A2V8JQV5      SDQADKVAHYARLKREADSNRQLYEAMLQKVKEYN--------------IA-S--AVTAN
A0A2V9AC41      LNLKDAAVQYAMLAREVDMNKQLYDGVLQRLKEIG--------------VA-A--EIRSS
A0A2V9MAM9      SDLRKKMIHYDTLNREVATTRQFYEAMLQKVNDAG--------------VA-T--AIRPS
A0A348V070      YKANSTAILYNSLKIETDNKKALLEALSKRQSETD--------------LASRLKDLQAL
A0A2V9M454      DRVNQLLIQHNLLKREFESNQQLYDNLLQHLKDGN--------------VS-A--GLRAT
A0A2V9IVR7      EKLNQLLIQQNILKHEFETNQQLYEGLLQRLKDAT--------------LS-S-------
A0A2V9ILE2      EKLNQLLIQQNILKHEFQTNQQLYEGLLQRLKDAT--------------LS-S--GLRAT
A0A2V9LGY4      EKLNQLLIQQNILKHEFQTNQQLYEGLLQRLKDAT--------------LS-S--GLRAT
A0A2V9J4D6      GKLNQLLIQHNILKRDSDTNQQLYDNLLQRLKDAT--------------VT-A--GLRAT
A0A2V9L9C5      GKLNQLLIQHNILKRDSDTNQQLYDNLLQRLKDAT--------------VT-A--GLRAT
A0A2N9M9N1      EKLNQLLIKYTILKGDFETNQQLYDELLKRLKDAT--------------VS-V--SLRAT
A0A2V9JEC4      ERLNQLLIQHNILKGEFETNQQLYNDLLRRLKDAT--------------LS-V--SLRAA
A0A2V9LPQ3      GRLNQLLIQHNILQREFQTNQQLYDDLLQRLKDAT--------------VS-A--GLRAT
A0A2Z5G3A3      DALNDKTIEYELTRQEATDSRTLYVSLLGRLKEAG--------------LL-E--GLRST
A0A2V7UGP8      IKQKQYGVEYSNLKAAVDSKREILNKLMQRETETG--------------SLSQLKNAGTG
A0A239MKT6      LELGNSLTALTFLQQEENTSRGLYQDLYTRLQEAS--------------IS-A--GVRST
A0A3E0PCN7      LNQNEAAINYNIIRQEIATNKTLLDSLLQRARETE--------------VI-L--NGTPN
A0A2V8IYW3      ETAPTRESEMAELTRDYETLKKGYESLLAKKEDSN--------------IA-A--NLEKQ
G2LEI9          VTQNGDGVMQRMMQDNIDNKKKMLQALQATTKDTE--------------IN-L--RMDLN
A0A317J121      SAEATKASQYSGLKREVETLQQTYSAMLLQANESN--------------IN-SSVPLGMG
A0A2V7YW66      IDQNSAAVGFTNLKVEIQTRRDLLNELMHKQSETE--------------VAVRLQDTRQS
A0A2V7Z0V0      INQSSAAVEYTNLKVEIQTRRDLLDELMRKQSETE--------------VAVRLQDTRQS
A0A2V8GFD4      QELNRRAIDYGVLQRDAATNRQIFDALLQRSKETG--------------IS-G--ELRTS
A0A2V8HSS5      QELNRRAIDYGVLQRDAATNRQIFDALLQRSKETG--------------IS-G--ELRTS
A0A2V8KP55      NKMNREIIQYNILKREADSSKDIYNGLLTRLKEAG--------------IS-G--GLRAS
A0A399WNU1      LNQNEAAINYRIIQQEIDTNKSLLNSLLQKARETE--------------VV-L--NGTPN
A0A2V9JSI3      GRLNQVLIQHNLLKREFETTQQLYENLLQHLKDAT--------------VS-A--GLRAT
A0A2V9WI32      NHLNESAIEYNLLKRDAESNRQLYEGLLQKLKEAG--------------VS-A--GLRSS
A0A2V8IVN9      LTMNRKAIDYGVLDRDVQSSKQIYESLLQRAKETG--------------VS-T--ELKTS
A0A7C5Z4J3      GKLNQLMIQHNLLKHEFETNQALYDNLLTKVKDAA--------------VS-S--GLRAS
A0A1F2TPT3      TAQNRKNVELSILTREVASNRQIYDMFMQRARETG--------------VA-K--DINPS
A0A2V8JTQ2      DHLNASAVQSDILKREFETNRKLYEDLLQKQKEVG--------------IS-A--SLKSS
A0A2V8UZY0      DKLYANAVQSEILKHEFETNRKLYEDLLQKQKEVG--------------IS-A--SLKSS
A0A350UEK1      TALGEKAIQYNILKREVETNRQLYESMLQRVKEAG--------------LA-S--ALRAS
A0A350UIQ4      TVQGEKAIQYNILKREVETNRQLYESMLQRVKEAG--------------LA-S--ALKAS
A0A1H5Z7N3      YQLRDQMVQYTLRQREYETNRQLYDGLLQRLRSAA--------------VE-A--GLEST
A0A1G7JVV8      YRLRDDLVEYTLRQRDYETNRALYEALLAKLRSAS--------------VQ-A--GLDAL
A0A1H4T6W9      YRLRDDLVEYTLRQRDYEANRTLYESLLSKLRAAS--------------VQ-A--GLDSL
I3ZEU5          YRLRDDLVEYTLRQRDYEANRTLYESLLSKLRAAS--------------IQ-A--GLDSL
A0A1I6MH75      YKLRDDLVEYTLKAREYETTRTLYDGLVSRLRTAS--------------VQ-A--GLEST
E8WVF6          YSLRDAQVEYTLRLREFESNRTLYEGLLQKLRTAG--------------VE-A--GLESS
A0A7D0PQC3      YKMRDDLVEYTLRQREFESDRTLYEGLLQRLRSAG--------------VE-A--GLESM
A0A428MDU2      YKLRDDLVEYTVRQRDFESNRTLYEGLLQRLRTAG--------------VQ-A--GLESL
A0A5B9EBI2      YKLRDELVEYTLRQREFESGRQLYDSLLQRLRAAG--------------IQ-A--GLESL
A0A239HDF6      YKLRDDLVEYTLRQREFESNRTLYEGLLQRLRTAG--------------IQ-A--GLESL
A0A4Q0T270      YKMRDDLIEYTIKQREFESSRTLYEGLLERLRTAG--------------VQ-A--GLESL
A0A1Q3QQB6      YKLRDDLIEYTLRQREFESNRTLYEGLLQRLRTAG--------------VE-A--GLESL
A0A3N1K1G7      YKLRDDLVEYTLRQREFESNRTLYEGLLQRLRTAG--------------VQ-A--GLESL
A0A4V2G466      YKLRDDLVEYTIRQREFESSRHLYESLLERLRTAG--------------IE-A--GLESL
A0A6B9YNQ8      YKMRDDLVEYTIRQREFESDRNLYEGLLQRLRTAG--------------VE-A--GLESL
A0A3N5YNR8      NQLNQDSIQYNILQREVDTNRQLYEGLLQRLKETG--------------IS-A--GMRAS
A0A3N6A5T6      DQLNENSIQYNILQREVETNKQLYEGLLQRLKEAG--------------VA-A--GLKSS
A0A1F2Q9L4      MQLNSAAVEYNNLKVEVSTRRTLLDELVRKQSETE--------------VASRLQGTHDS
A0A2U3KC61      NQLNESAIEYSVLKRDAEANRQLYQDLLQRFSEAS--------------VS-E--TLKSS
A0A2V9Y2R7      NLLNESAIEYSVLKRDAESNRQLYLSLLQKLKEAG--------------VT-A--GLRSS
A0A2V9NGH6      NQLNESAIEYTLLKRDVDTNRTLYEGLLEKLKEAG--------------VT-A--GLRSN
A0A2V9PYE6      NQLNESAIDYTLLKRDVDTNRTLYEGLLEKLKEAG--------------VT-A--GLRSN
A0A2V9NL07      NKLNESAIEFSLLKRDFETNRTLYEGLLQKLKEAG--------------VT-A--GLRSN
A0A2V9QD92      NKLNESAIEFSLLKRDFETNRTLYEGLLQKLKEAG--------------VT-A--GLRSN
A0A2V9WPZ6      NKLNESAIEYSLLKRDVETNRQLYEGLLEKLKEAG--------------VT-A--GLHSS
A0A2V9ZLH4      NKLNESAIEYSLLKRDVETNRQLYEGLLEKLKEAG--------------VT-A--GLRSN
A0A2V9RQF1      NRLNESAIDYSLLKRDVETNRTLYEGLLEKLKEAG--------------VT-A--GLRSN
A0A2V9YDK8      NKLNQSAIEYSFLKRDVETSRQLYEGLLEKLKEAG--------------VT-A--GLRSS
A0A2V9V8F7      NKLNESAIEYSLLKRDVETNRQLYEGLLEKLKEAG--------------VT-A--GLHSS
A0A2V9XGR9      NKLNESAIEYSLLKRDVETNRQLYEGLLEKLKEAG--------------VT-A--GLHSS
A0A2V9V3Q5      NRLNENAIDYTLLKRDVDSNRQLYEGLLEKLKQAG--------------VT-A--GLKSN
A0A2V9NWS3      NKLNESAIEFTLLKRDVETNRALYEGLLEKLKEAG--------------VS-A--GLRSN
A0A2V9USA9      NKLNESAIQYNILKRDSESYRQLYEGLLQRMKEAG--------------VS-A--GLKSN
A0A2V9XW18      NKLNESAIEYTLLKRDVDTNRQLYEGLLQKLKEAG--------------VS-A--GLKSN
A0A1H5SQF5      GHMTTSADQLLLLEQEETSNRTLYQDLYGKLEAAN--------------IL-A--GAKSS
A0A2V9AEW6      ADQSSKAIHYDTLKRDVDSNRRLYETMLQRVKEAS--------------LA-A--AMRDS
A0A2V8WQK6      ADQSDKVIHYDTLKRDVDSNRRLYEVMLQRVKEAS--------------LA-T--AMRDS
A0A2V8XIF4      ADQSSKAIHYDTLRRDVDSNRRLYEVMLQRVKEAS--------------LA-T--AMRDS
A0A2V2R0I6      NAMAEKLVEYNILKREAEANKTLYDGLMNKLKEVG--------------IA-E--SLKSS
A0A2V8XAR9      NQMAEKLVEYNILKREAEANKALYEGLMTKLKETA--------------IS-L--GLRSS
A0A2V8VZA0      NQMAGRLVEYNILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLRSS
A0A1Q7CB82      NQMAGRLVEYNILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLRSS
A0A2V8WIU1      NQMAGRLVEYNILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLRSS
A0A1Q6Y9F5      NQMAGKLVEYNILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLRSS
A0A2V9EVV8      NQMAGKLVEYNILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLRSS
A0A2V8YF91      NQMAERLVEYNILKREAEANKALYEGLTTKMKETA--------------IS-A--GLRSS
A0A2V8XZK2      NQMSEKLVEYNILKREAEANKALYEGLMTKMKETA--------------IS-A--GLRSS
A0A2V8ZTX6      NQMAEKMVEYNILKREAEANKALYEGLMTKMKETA--------------IS-G--ALRSS
A0A2V9BT79      NQMAEKMVEYNILKREAEANKALYEGLMTKMKETA--------------IS-G--ALRSS
A0A2V9YHT3      NRLNERAIQYTLLKRDLDTNQQLYDGLLQRLKEAG--------------IS-A--ALKSS
A0A7C2XNI7      NALAEKLVQYNILKREAEANKELYDGLLQKLKEAG--------------IS-A--GLRSS
A0A1Q8B793      NQMAERLVQYNILKREAEANKALYEGLLTKLKEAG--------------IS-A--GLRSS
A0A2V9BCA0      NQMAERLVQYNILKREAEANKALYEGLLTKLKEAG--------------IS-A--GLRSS
A0A2V9BWU9      NAMAEKLVQFNILKREAEANKQLYEGLLQKMKEAS--------------IS-A--GLRSS
A0A2V9DKX2      NAMAEKLVQFNILKHEAEANKQLYDGLLQKMKEAS--------------IS-A--GLRSS
A0A7C2YQY3      NVMNAKLVEYSLLKREYETNQQLYDGLLNRLKEAG--------------VS-A--GMRSN
A0A3E0NV31      DRESEAAVQLEILERKTQTNKQLYDGILQRLRETD--------------IV-A--ELQKE
A0A3N5M5V0      NQLNQDSIQYNILQREVDTNRQLYEGLLQRLKETG--------------IS-A--GMRTS
A0A3N5XQP8      YRLNSDLVQFNTLKREADTNRQLYEGLLARLKQAG--------------VE-A--GFRSN
A0A2Z5G7H4      DSLNDKAIEYAIVRQEADDSRGLYEDLLKRLKEAG--------------VL-E--GLRSS
A0A2V9L5B5      NEIAARSIQYNILKREVDSNRQLYEGLLQRMKEAQ--------------AS-A--GLRAS
A0A2V9LK56      NDIAEKTIQYNILKREADSNKDLYNGLLQRMKEAQ--------------VS-A--GLRAS
A0A2V9L7I0      NRIADKSIQFNILKREVDTNKQLYEGLLQRMKEAQ--------------VS-S--GLNAS
A0A522PPT0      DVVSQKTIQYNILKREVDTNRSLYDGVLQRMKEAQ--------------VA-A--GLNAS
A0A7C5V1G5      DVVSQKTIQYNILKRDVETNQSLYDGVLQRMKEAQ--------------VA-A--GLNAS
A0A2V9KCS3      SEQSGKTIHYNILRREVDTNRQLYDSMLQRVKEYG--------------IA-S--AMHAS
A0A372IT17      AQMNDRRIAWTLARQEADESRRLYDQLFGKLKQAG--------------VL-E--GLHTS
A0A4R1LC91      DAMNDKSIEYAIARQEADQSRTLYETLLNHLKEAG--------------VL-E--GLRST
A0A3M2BZG9      SAYSSSALDYTTAKLELETKQRLFNDLLKKQSEAE--------------VASSFHDAKES
A0A1Q7N5R7      RGIPQRAIEEARLRRDATIAENLFTSVQQRYSEAR--------------LA-E--ASSTA
A0A2V9QB26      TDQDEKSIQYGILKREVDSNRETYQAMLQRVKEAN--------------IA-S--AVRPS
A0A2V9VYY4      NKLNESAIEYTVLKRDAETNRQLYQDLLQRLKEAG--------------VS-A--GLRSS
A0A3E0PHB0      NQQGQKETMLTTARREIENNRGILDRLLQREREME--------------LSIN--TSAPD
A0A3M1SIV3      NQQGQAAMSLTDLTQKIETSRSLLNTYVQRQKELE--------------SAIS--SSRPD
A0A3M2D491      NQQGQAGMRLKTLTQAIDTNRELLNTYIQRQKELE--------------LAIS--SSRPD
A0A353C9L6      NVQGQAQTKLTTLKREIETKRNLLDTYTQRLKEKE--------------LEVE--SGAPD
A0A2V8RQV0      NVQGQAQTKMITLKREIETNRNLLDTYTQRLKEQE--------------LSRA--NDAPE
A0A2V8SJH5      NVQGQAQTELITKKRAIETNRNLLDTYTQRQKEQE--------------LAIA--SGRPE
A0A357F267      NIQGQAETKLTTLKRGIETNRNLLDTYTQRQKEAE--------------LAIA--SGRPD
A0A7C5ZUA8      NLQGQAETRLTTLKRGIETNRNLLDTYTQRKKEQE--------------LAIA--NTQPD
A0A136JPP4      NVQGQAATTLTTLKRALETNRGLLDTYTQRQKEQE--------------LALA--SGKPN
A0A399WUJ8      NVQGQATTTLTTLKRALETNRGLLDTYTQRQKEQE--------------LSLA--AGKPN
A0A2V9KIE8      NDIAQKTIQYNILKREADTNKQLYESLLQRLKEAQ--------------VS-E--GLKAS
A0A352F549      VAQNQAAINYNILKQEIETNKGLLAGLMQRSKEND--------------VT-M--AGTPN
A0A3B9MLP9      VAQNQAAINYNILKQEIETNKGLLEGLMQRSKEND--------------VT-M--AGTPN
A0A3D5SQ87      VAQNQAAINYNILKQEIETNKGLLEGLMQRSKEND--------------VT-M--AGTPN
A0A2V8NW86      TDQDEKSIQYGILKREVDSNRGIYEAMLQRVKEAN--------------IA-S--AVRAT
A0A7C2GJ20      LRQNERAIELSLRKREVEVTTQLYEGLLEKLNDVK--------------LL-S--TLTTT
A0A7C4BTL5      TAEAERSIQYNILKREVETNRQLYEAMLQRVKESS--------------IL-S--ALRAS
A0A2V8ZHL8      GALSQLLIQHNLLKREFDSNQQLYDSLLQRLKDAT--------------VS-A--GLRAT
A0A2V9B240      GALSQLLIQHNLLKREFDTNQQLYDSLLQRLKDAT--------------VS-A--GLRAT
A0A2V9CBM2      DRIAEKSVQYNILKREVDTNKQVYDGLLQQLKSAG--------------LA-A--SLKAS
A0A2V8XN17      SLIAEKSVQYNILKREVDTNKQLYEGLLQQLKEAG--------------VS-A--GLKAS
A0A2V8WX45      SLIAEKSVQYNILKREVDTNKQLYEGLLQRLKEAG--------------VS-A--SLKAS
A0A1Q6YR79      SLIAEKSVQYNILKREVDTNKQLYEGLLQQLKEAG--------------VS-A--GLKAS
A0A1Q7VA32      SLIAEKSVQYNILKREVDTNKQLYEGLLQQLKEAG--------------VS-A--GLKAS
A0A2V9EY85      NLIAEKSVQYNILKREVDTNKQLYEGLLQQLKEAG--------------VS-A--GLKAS
A0A2V9H8K0      NLIAEKSVQYNILKREADTNKQLYEGLLLQLKEAG--------------VS-A--SLKAS
A0A2V9FFE5      NLIAEKSVQYNILKREVDTNKQLYEGLLLQLKEAG--------------VS-A--SLKAS
A0A2V9GM43      NLIAEKSVQYNILKREVDTNKQLYEGLLLQLKEAG--------------VS-A--SLKAS
A0A2V9CYQ5      DLIAEKSVQYNIRKREVDANKQVYEGLLQQLKSAG--------------LA-A--SLKAS
A0A2V9BWU8      NVIAEKAVQYNILKREVETNRQLYEGLLQRLKEAG--------------VS-A--SLKAS
A0A2V8ZG48      NLIAEKAVQYNILKREVDTNRQLYEGLLQRLKEAG--------------VS-A--SLKAS
A0A2V8Y334      NLIAEKAVQYNILKREVETNKQLYEGLLQRLKEAG--------------VS-A--SLKAS
A0A2V9AY68      NVIAEKAVQYNILKREVETNKQLYEGLLQRLKEAG--------------VS-A--SLKAS
A0A1F2RFI7      NQIAEKSIPYNILKREADTNKQLYEGLLQRLKEAS--------------VS-A--GLRAS
A0A1F2RZS3      NAMAEKSIQYNILKREADTNKQLYDGLLQRLKEAS--------------VS-A--GLRAS
A0A1F2USE2      NLIAEKSVQYSILQREVETNQQLYEGLLQRLKEAG--------------VS-A--GLKAS
A0A7C2VB08      NQVAERSVQYNILKREVETNRQLYEALLQRLKEAG--------------VS-S--GIKSS
A0A2V9C238      NLIAGRSVQYNILKREVETNQQLYEGLLQRLKEAG--------------VS-A--GLKAS
A0A1F2Q9F5      GRVAEKSVQYNILKREVDTNKQLYEGLLQRLKEAG--------------MS-A--GMKAS
A0A1F2QQH9      GRVAEKSVQYNILKREVDTNKQLYEGLLQRLKEAG--------------MS-A--GMKAS
A0A1F2QXK7      GRVAEKSVQYNILKREVDTNKQLYEGLLQRLKEAG--------------MS-A--GMKAS
A0A2V9DEM9      NLIAGRSVQYNILKREVETNQQLYEGLLQRLKEAG--------------VS-A--GLKAS
A0A7C5TWV7      INLSKQNLEYEKLQHEYEQNKTFYEQMLQRSKETD--------------IS-A--SAAL-
A0A2V7XDY0      ASQSRKAAELDAIKKEAESAKGLYDVLLQKLNETD--------------IA-A--SIRS-
A0A2V8G155      LVMNRKAIEYGVLERDAKSSRQIYESLMQRAKETG--------------VS-A--ELK--
A0A2V8HDM7      LVMNRKAIEYGVLERDAKSSRQIYESLMQRAKETG--------------VS-A--ELK--
A0A2V8DRT9      LALNRKGIEYGALQRDAASNRQIFESLLQRTKETG--------------IS-G--ELK--
A0A2V7VYF3      LGQNRKAIAYGALQRDAASNRQMFEALLQRTKETG--------------LS-E--ELR--
A0A1F2SVH2      LSLNRKGIEYGVLARNAASNRQIFESLMQRTKETG--------------IS-G--ELK--
A0A2V8AJG9      LALSRKGIDYGALQRDNATNRQVFESLLQRAKETG--------------VS-T--ELK--
A0A2N9LQU7      FNLNASAVQFATLKHEVESSQELSDTLQLKLKEAG--------------LM-A--GLA--
A0A2P6WFK7      FKLNEHAVQYLVLKHDVENSRDLYDTLQLKLKMAG--------------VT-A--GLS--
A0A2V8U914      SKMTAKMTHYNTLKHEVDTNRQFYEAMLQKVNEAG--------------LA-S--AVR--
A0A2V7W309      QRLNVDAAKYFDLRMAVDSKQTLLAALQKQLNETQ--------------VT-A--RLRGS
A0A2W0BGU4      GNFNRLLIEHDLLKGDFEANQQLYQRLLQRVKDAT--------------VI-A--GLS--
A0A2W0BVQ9      GNFNRLLIEHDLLKGDFEANQQLYQRLLQRVKDAT--------------VI-A--GLS--
A0A2V9MN96      NQLNESGIEYTALRRDADSNRQLYQSLLQRLKEAS--------------VT-A--GLR--
A0A2V7V2Z1      LDLSRRSVQYDTAKREAEAGKEVLNSLLSRHKQTD--------------VA-Q--ELK--
A0A2V7X2F7      QELGARSGHYDSVKREVEASRAVLNSLTERHKETD--------------VA-Q--ELK--
A0A2V7V2I1      LELSRRGVQYDSLKRELDASKEVLNSLMARHKQTD--------------VA-Q--ELK--
A0A2V7U3M2      LDLSRRSVQYDNAKREADAGKEVLNSLLSRHKQTD--------------VA-Q--ELK--
A0A2V7UHT0      LDLSRRSVQYDNAKREADAGKEVLNSLLSRHKQTD--------------VA-Q--ELK--
A0A2Z5FVL3      DEMNDKAVQYSMARQQADQSRSLYEKLQSRMKEAG--------------VL-E--GFH--
A0A2V9KBD6      DDLDAHAVQSEILKHEFETNRKLYEDLLQKQKELG--------------IT-A--SLK--
A0A2W0AJ66      DTLNANAIQYNILKRDVDTNRKLYEDLLEKQKELG--------------IS-A--TLK--
A0A1Q7RBU1      DKLNANAIQNNILKHEFETNRKLYEDLLQKQKEMA--------------IS-A--SLK--
A0A2V9JPV9      DELNANAIQYDILKHEFETNRKLYEDLLQKQKEVG--------------IS-A--SLK--
A0A3P0X3W6      DALSLKSLEYQQLKRDADANKTLYNELFQKIKEAG--------------IN-S--GFQ--
A0A2N9MK30      DRLNARSFEYESLKHEAEADKKLYEELITKIREAE--------------IN-A--GFQ--
A0A3D1ASD2      DALNARSFGYEELKREAEADKKLYDELIRKIKEAS--------------IN-A--NFQ--
A0A7C5AXI3      DNLNARSFEYQALKREAEADKALYEELVRKIKEAG--------------IN-A--SFQ--
A0A7C6E4H7      DRLNARSFEYQALKREAEADKKLYEELVRKIKEAG--------------IN-A--GFQ--
A0A1F2TCR2      MDLDRKSTDYSMLQRQADGDRKMYDTLLQEQKSLQ--------------VI-S--NSRS-
A0A350UQT3      DTLNFRSFEYQRAKREAEADKNLYDELVRKIREAG--------------IN-A--GFQN-
A0A7C3HRX0      DALNMRGFDYQRAKREAEADKQLYEELVRKIREAG--------------IN-A--GFQN-
A0A1F2V330      QSTPQHEIAITELTRGYEATKTRYNALLAKQQEAG--------------LA-S--RPERM
A0A662EE63      IELSKTSLEYDRLEETYLQNRRFLDDMLARSNEAD--------------LS-A--TAWM-
A0A2V8TLH7      LRVNQKASNYELMRTEALDTKRIYDLISARVKEID--------------LS-A--SLLS-
A0A1Q7ZJT1      LQVNRKASGYEMVRGEATETKRIYDLISARVKEID--------------LS-S--SLLS-
A0A2V8VC99      LQVNRKASSYEMVRGEEAETKRIYDLISIRVKEID--------------LS-S--SLMS-
A0A348UZU3      FRLNSNAILYNSLKIELENKKNLLESLLKRQSETG--------------VS-A--RLKGL
Q01XL7          GAQADKASQYAMLKRDAEMAQQVYNGLLQQANQAA--------------LI-A--LVPA-
A0A2V8ERZ5      QDLNRKGIGYGVMEREAKSNREVYQSLLTREKELR--------------VS-A--NSRT-
A0A2V8GTX0      TDLNRKSIDYSVLQREAESNRQVYESLLQREKELR--------------VV-S--NSRA-
A0A2V8J0X9      MDLDRKSGDYKLLQRKADSDRQVYQSLLSQQKELA--------------VV-A--NSRA-
A0A523DUV7      IEDSRKTVQLEMLQREALSNKSLYEAILQKIKETD--------------VA-S--SLRE-
A0A372IRG7      FHENESAAQFEILQHGAESASELYDALQMKLKEAG--------------IT-A--GLNS-
A0A1F2U158      QDLGRKSVSYNVLEREARSNRTVYESLLQRENELR--------------VS-S--NSRA-
A0A2V8F6S9      QNLSRLGVDYNVMQRDAQTNRTIYDTLLARQKELT--------------VS-S--NSRQ-
A0A7D8BEX2      FQSRDEMVRYAILQREYESHRTLYEGLVQRLEEAS--------------VD-S--GLQS-
A0A4Q1SCH5      YALNRKQADYAVLAAEGAASRDLYDTLQYKIQQAS--------------VN-A--GLDS-
A0A2V8K4L4      SSQAANEVHYNILKREVDTNRQLYESMLSKVKESS--------------IA-S--AMRA-
A0A2V8NCZ3      SSQTAKEIHYNILKREVETNRQLYESMLARVKESS--------------IA-S--AMRA-
A0A4Q7YNP3      SSDLGKAAQVSLLRREVESEQQLYQTLLQRAKEAG--------------FA-S--AMQA-
E8UZE1          FSMNEDALHYSILQGQVASGRALYQDLTRKLQEAQ--------------IT-S--GLSS-
A0A2U3JZ71      DALNARSFEYQSLKREAEADKTLYEELVRKIREAS--------------IN-S--GFQN-
A0A2V8TTB0      DRLNARSFEYQTLKREAESDKKLYEELVRKIKEAG--------------IN-A--SFQN-
A0A1V6HR88      REVNSASIEYNNLRLEIDTRRQLLDEMLRKQSETD--------------VS-S--RLQAT
A0A3E0P0A3      RRYQSASTALQNLTGDIAAKRETLDRLRRSQSQAN--------------IS-A--SSGN-
A0A2V8EXP2      LALNRKGIDYSALQRDALSNRQIFESLLQRTKETG--------------IS-G--ELKT-
A0A2W4RYA1      QQLNAKAVEYRVLERNAQSARQLYDSLLQRAQETG--------------VS-G--ELRT-
G8P0Y7          DQLNQNAIEYKILKQEADSNRQIYDGLLQQLKEAS--------------LA-A--GLTS-
A0A5M8T4U7      FRLNEDVGQYAILRHEAELNRDLYDTLQMRLKEAS--------------VT-A--GLSA-
A0A7D0PPG7      DAVNSNTIDYQQLKNEAEANKTLYNELFRKVKEAG--------------MN-G--SFQG-
A0A7D8BF18      FRLRDALVNYTLKQREFDANRTLYDNLSQRLRTAG--------------VQ-A--GLES-
A0A1E3Y9R6      LGLDRQMLDYSALEREAQSNRQLYENLLARAKETG--------------AA-G--EYRG-
A0A2W4TLP2      LGLDRRMLEYAALEREALSNRQLYENLMARAKETG--------------AA-A--DYRG-
A0A7C4BZ42      SVQAAKSVHYNILKREVDTNRSMYESMLQKVKEAG--------------IA-S--AMRA-
A0A3R9WF43      IQLADNTVQLQVLAQEAYSNRALYQNLFSKLQEAS--------------LS-S--GVRA-
A0A317HKM4      QALNAKAVEYSALEREAASNREVLDKLLQRSTEAR--------------LA-R--ELES-
A0A2V9CG11      ADQSSKAIRYRTLKGEVDSSRQLYEAMLERVKQAE--------------LA-T--AMRA-
A0A523E0N1      RKLAHAASDYGHIKAELANQRQILKRLLRRRSETA--------------IT-A--ELGEK
A0A523ECP2      QELSKLTTNYTQIKAGIDNQRSMLRQLLRRQSETG--------------LS-A--ELFER
A0A2W0C122      NRLNVSAIQYGLLRRESEANRQLYDNLEERMKEAG--------------VA-A--GLRS-
A0A2W0AUU7      NKLNESAIQYGLLKRESEANRQLYDTLEERMKEAG--------------VT-A--GLRS-
A0A2W0BQL1      NKLNESAIQYGLLKRESEANRQLYDTLEERMKEAG--------------VT-A--GLRS-
A0A4Q1SDL1      DALKDKAIDYSILREEATQSRGLYEDLLRKLKEAG--------------VL-E--GLKA-
A0A3P0XH15      YQQNRSSAEYQILRHGADSASDLYDALQTRLKEAG--------------IT-A--GLNA-
A0A4R1LAZ7      FRENESSAEFEILKHGAESASDLYDALQIKLKEAG--------------IM-A--GLNS-
A0A3M1WQW8      LRQNERAINLSIKQQQVEASAELYRSLLQKMNDVD--------------LL-S--TLTT-
A0A3N1JHC1      TDQGSKQVRFNMLKHEVDVNEQVYQSMLQKAKEAG--------------VI-A--ALRA-
C1F294          FKQNESSAQFEILKHKAQTSSELYDALQLRLEEAG--------------IT-A--GLNS-
A0A2V9KA79      QSTPTHAGALADMTRDLESTRTQYQSLLDKQQQAT--------------LA-S--KRGKV
A0A522PSP1      EEFNRKGVEFQILKHQADTDKLVYDDLLERLDAAD--------------VS-A--GYHS-
G8P085          YALNRKAAEFAVLYAEGSSSRELYNTLQYKLQQAG--------------VD-A--GLQS-
A0A7C6A629      DRLNARSFEYQALKGEAEADKKLYEELVRKIKEAG--------------IN-A--GFQN-
A0A4Q1SGQ1      DAMSNRTVAYQLARQEADSSRNVYEGLLAKLKQAG--------------VL-E--GLRS-
Q1ILD9          LSKSQNFSEYSRLRREVDTSRDIYDDLLRKLREAG--------------VM-A--SLKA-
A0A7C5SHM3      NAKQYQASEVESLRRQYDQKKANLERLLARREEVA--------------RS-S--DLREI
Q1IJZ6          NKINDSQIRLAVLQQEADSTRQLYETLYGRLEVSK--------------LD-E--GIKS-
A0A2V8TCE6      QRTGRDSIEYATLQAEVERKRAVLNALLQRQNETA--------------VS-S--QLRDM
A0A522TBE8      DQFERRAITYRSLQAAAQNYTKLYYDLLQRIAESK--------------LA-A--GFHT-
Q1ITG0          FSQSAKFSQYDILKNEVASGRSLYEDLLRKLNEAG--------------IA-A--GLKS-
A0A7C2ML20      QQHNREALQFSLLKRQSEVDEKLFQMLSERLREAG--------------LM-R--SLTP-
A0A7C5AXS9      SDQAARAVHYNILKREVDTQRSLYEAMLQRVKEYG--------------IA-S--AMQA-
A0A7C2RGE3      LRQNERAIELSLRKREVEVTTQLYEGLLEKLNDVK--------------LL-S--TLTT-
A0A3N5PCI5      LALNRQGIEYGVLLREVESNRQIYQNLLQRSNETA--------------VS-K--DIQG-
A0A3M1Q0S9      SELQQAFVEYEARKAEIDRKQATLRELLDRKNQMT--------------LS-A--SLAED
A0A2Z5G448      FRVSDSSADFEILKHEAQSTTDLYDALQMKLKEAS--------------VT-A--GLNS-
A0A3M1VZ38      SEADRAMIEYEARSLELERKKATLNELIAKENEME--------------QS-A--NLGD-
A0A4Q1SD29      YRENESAAQFDILKHGAESASELYDALQMRLKEAG--------------IT-A--GLSA-
A0A6N9FGE2      LALDRTGIEYNVMLRGAESDRSLYESLLRRAAETG--------------VT-G--ELET-
A0A3M1PY35      DALQRRAQDYDRLYREYEQKRQVLDRLLARREEIG--------------IA-K--DLRSI
A0A3M1VMP2      AQLQLATGELEALRSLYKQKREALDRLLARREEVA--------------VT-R--DLQSI
                                                                            

A0A2V7VMF7      NA----SVVERASPP--LAPVWPNKRKMAGVGILVGVALGLGLVL-LRDFLS-NT-----
A0A2V7YYV7      ------VPVSPAVVP--DRPVSPTKALNISIAFGAGLLLAVGLAY-LLERLD-QS-----
A0A2V7Z0J5      ------VVLSPAVLP--KNPVSPNKALNVAVAFVAGLLLALGLAL-LFDYLD-QS-----
A0A2V7Z3M4      ------VVLSPAVLP--SKPVSPNKVLNVAIALMAGLLLALGVAF-LLDYLD-QS-----
A0A399Y5V2      SA----ETVAPATLP--TAPVEPKLSRKVIFALTIGILLGAGIAF-LVEYLD-DS-----
Q01X01          NV----RLVDPAQPA--THHHKPNVPLNLLFGLFGGLALATGYVM-LQEQTN-SA-----
A0A3M2D9H8      PEV---VQVEEARVP--SRPVRPQTATNVLLGGILGLILAGGIVF-LIEYLD-DS-----
A0A2V8JK38      NI----RVVDQAEVP--KGAVTPNHKLNLAWGIFFGLIFGVGSAV-FQEYID-RS-----
A0A2V9IXG5      NI----KVVEHAGA---GYRVATRGANFVILATLGGMILGMALVV-LGEVIN-PR-----
A0A2V9J2P4      NI----KVVEHAGA---GYRVATRGANFVILATLGGMILGMALVV-LGEVIN-PR-----
A0A1Q7RLS4      NL----RILDKAPVP--KVPVRPRTVLNLAIGMLLGILLGVGAIF-FLDYMD-NT-----
A0A2V2R525      NI----RVADYANTP--ERPIGPQRTRGVGLAFAFSLAFGIGLAL-LRELSN-NT-----
A0A321LPW6      AL----HVIEPAEVP--TFPVDAKRLQGVLIALFVSLCAGLIFAF-LLEYLD-NT-----
A0A2V9R9V4      NI----RIISPARVP--KEPVSPNRQRTILIGLLLSLSGGIGLAW-LLERFD-DS-----
A0A321LE75      NM----RVIEPAQPP--GGPIGPNRMRGILIGLFLSLVAGIGLAF-VLEYFD-NT-----
A0A2V8R8U7      DV----SVSNYSRTP--QL-VGPQRMRNIMIAFVLALVAGIGLAF-LIDYLD-DT-----
A0A2V8QMP4      NV----TMVEEARTP--REPIGPPRVRNIIIALLLSIAVGIGLAF-LLDYLD-DT-----
A0A2V8R4S3      NV----TMVEEARTP--REPIGPPRVRNIIIALLLSIAVGIGLAF-LLDYLD-DT-----
A0A2V8NJ55      NV----TVATPARLP--RGPVGPARSRNIIVAFLLSLGVGIGLAF-LLDYLD-DT-----
A0A2V8Q7I0      EV----SIENYSRIP--RSPIGPARLRNVMIAFVLSLVAGIGLAF-LLDFLD-DT-----
A0A2V8S6K4      NV----IIQTPARTP--QL-VGPPRVRNIIIALLLALGAGIGLAF-LLDYLD-DT-----
A0A317I2L9      EV----SVENYSRVP--KAPIGPARIRNVMIAFLLSLVAGIGLAF-LLDFLD-DT-----
A0A2V8LLF9      EV----SIANYSRLP--HEPVGPARLRTIILALVMSLLVGIGLAF-LLDFLD-DT-----
A0A352FRF4      NV----SVSNPSRLP--RAPVGPARLKTILIALILSLVAGIGLAF-LLDFLD-DT-----
A0A2V8MKV0      NV----SVVSYSRLP--HEPTGPPRTRNILLALALALLAGIGLAF-LLDFLD-DT-----
A0A2V8PYY8      NV----SVVSYSRLP--HEPVGPQRTRNILVALALAFLAGIGLAF-LLDFLD-DT-----
A0A1Q7YKQ8      NV----SVSQYSREP--RAPVGPPRLRNILIAFLLSLGAGIGLAF-LLDYLD-DT-----
A0A352F3R7      EV----NIATYSRLP--KEPIGPQRLRNIFIAFLLSLGAGIGLAF-LLDFLD-DT-----
A0A0B6WXT1      NI----TVATPARVP--REPVGPKRLRNILIALLVALGAGIGLAF-LLDYLD-DT-----
A0A3B9MEU8      EV----SIPTPSRLP--KTPVGPQRLRNIFVALLLSLGAGIGLAF-LLDFLD-DT-----
A0A2V8MHG6      NV----HVVDHAAIP--KTPIGPKRMQAIALAALFALILGIALAR-YLDYMD-DS-----
A0A2V8P7N1      NV----HVVDHAAIP--KNPIGPKRMQAIVLAALFALIVGIALAR-YLDYMD-DS-----
A0A2V8M3M6      NV----HVVDHAAIP--KNPIGPKRMQAIVLAALFALIVGIALAR-YLDYMD-DS-----
A0A1Q7NJH5      NV----HVVDHAAIP--KTPIGPKRMQAIVLAALFALIAGIALAH-YLDYMD-DS-----
A0A2V8PJY0      NV----HVVDHAAIP--KTPIGPKRMQAIVLAALFALIAGIALAH-YLDYMD-DS-----
A0A1Q7Y6W9      NI----HIVDYALVP--DGPVGPNRTRVVMLALVLSFGFGIGFAL-FLDYLD-DT-----
A0A2V8NC68      NI----HVLDYSPQP--KVPVGPHRMQGILLASLFSLVFGVALAR-YLDYLD-DS-----
A0A399WK13      NI----TVTEPAVPS--NIPVSPRRLTTVLGALFLSTLFGVGLAL-FLEYLD-DT-----
A0A352FLX4      NI----RVVDYAIAG--KKPVAPRRVLTVALAFLFSIGCGIGLAF-IIEYLD-DS-----
A0A2V8RTL7      NI----SVASFGIPP--EAPVAPRRLMTVVAALLLSSLFGMGLAL-FLEYLD-DT-----
A0A3E0PCJ6      NI----SVAEIAIPP--ERPVSPRRLTTVAVVMMLSLLFGAGLAL-FLEYLD-DS-----
A0A3M1S4R8      NI----SVVDLAIPP--DTPVSPRRLLTVMMALFLSTCFGVGLAF-FLEYLD-DT-----
A0A7C2G442      NI----SVVDLAIPP--DTPVSPRRLLTVMVALFLSTCFGIGLAF-FLEHLD-DT-----
A0A1Q7YFI6      NV----HVLDYAPIP--KSPVGPRRMQGVALGFLFSLVIGIALAR-YLDYLD-DT-----
A0A136KC10      NI----SVTEPAVPS--NIPVSPRRLATVLGALFLSTLFGMGLAL-FLEYLD-DT-----
A0A3M2D6Y5      NI----SVVDPAIPP--DTPVSPRRLLTVMMAFFLSIVFGVGLSL-FLEYLD-DS-----
A0A2V8SEX6      NI----SVAGFAIPP--EHAVSPSRLMTVFAALFLSTLFGMGLAL-FLEYLD-DT-----
A0A7C5ZUU4      NI----SIADYAIPN--ETPVSPRRLMTVFAAFFLSLLFGVGLAL-FLEYLD-DT-----
A0A0B6WWQ6      NI----HIVEYAFPP--NRPIGPARLQAVGLAIVLGLAVGIGLAI-FLDYLD-DS-----
A0A3B9MK99      NI----SIVDYAVTP--DGPIGPNRSSTVSMALFLSLGLGVGLAL-LLEYFD-DT-----
A0A352EX26      NI----SVVDYAITP--AGPVGPNRMRTVALALFLSLGLGVGLAL-FLEYLD-DT-----
A0A2V8MM59      NI----SIVDYAIQP--DGPVGPARMRSVMLALVLSLALGVGLAL-FLEYLD-DS-----
A0A2V8PFE8      NI----SIVDYAITP--DFPVGPARMRSVMLAFVLALALGVGLAL-FLEYLD-DS-----
A0A2V8PWS6      NI----SVVDYAITP--DFPVGPARMRSVMLAFVLALALGVGLAL-FLEYLD-DS-----
A0A2V8LCT5      NI----SVVDYAIVP--DFPVGPGRMRTVMLAFVLSLGLGIALAL-FLEYLD-DT-----
A0A352FTJ9      NI----SVVDYAIVP--DFPVGPARLRTVMLAFLLALGFGAALAL-FLEYLD-DT-----
A0A257VBK0      NV----RMVEPAQPP--MAPVKPNKRMNLLMGLLFGLMLSVGSIV-AWQYLD-TS-----
A0A2G6PYV5      ------VIVEHARLP--HSPYAPSLKRHLFSGFIIAAGLAGLLIF-LIEITD-RK-----
A0A2V8F956      NI----RVVDRAQTP--TEPVSPQKGLNLLLALFGGSLLACGLVF-FFEHID-SR-----
A0A1F2S1W5      NI----RVVDLAENP--TGPISPNIFNSLLMALLGGLTLAVGLAF-GLEYAD-DR-----
A0A1F2T595      NI----RVVDPAEMP--TGPVSPNIINNLLLALFGGMVLAVGLAF-TLEYAD-DR-----
A0A2V8JQV5      NV----NIVDPARPP--GGAYKPDVYMYAMLGLATGVFLGLMLIV-RQEQAD-RS-----
A0A2V9AC41      NI----YLMGKAEPP--GGPSYPDKNGILLRGLFLGLLMGVGLAF-LFDQLD-NT-----
A0A2V9MAM9      NI----RVVGPAQPA--LQPYKPNFLLNVAIGLFGGLVLAIGCVT-VVNQAEAGR-----
A0A348V070      NV----WIVDRASPP--VNPSFPNRRKTFIIGVLLALIGGAGTSL-FINYLV-AT-----
A0A2V9M454      NI----RIIDEATIP--SFPVRPNRPRNIEFALAAGLILGIALAF-TREALD-NS-----
A0A2V9IVR7      -----------------GAPVRPRKLFNVTIGLLVGLILGVALAF-VQEALD-DS-----
A0A2V9ILE2      NI----HIVDQARVP--GAPVRPRKLFNVTIGLLVGLILGVALAF-VQEALD-DS-----
A0A2V9LGY4      NI----HIVDQARVP--GAPVRPRKLFNVTIGLLVGLILGVALAF-VQEALD-DS-----
A0A2V9J4D6      NI----HVVDKAVPP--ATPVRPKKALNVALGLLAGIILGTAFAF-LEEQLEQKT-----
A0A2V9L9C5      NI----HVVDKAVPP--ATPVRPKKALNVALGLLAGIILGTAFAF-LEEQLEQKT-----
A0A2N9M9N1      SV----RLADAALVP--ATPIRPDKRVDIAVGLLVGLILGVTLAF-IREGLD-RT-----
A0A2V9JEC4      SV----RVADRARVP--AVPVRPDTRRNFPLFAFAGLVIGVTLAF-AQEALN-NS-----
A0A2V9LPQ3      NI----HIVDTASPP--AVPVRPNKLLNLMLGLVAGGLLGLVLAF-AEEGLERRS-----
A0A2Z5G3A3      NV----SVVDPGRSP--AKPTKPNIPLFLGGGLASGLFLGFCAAL-LFDTTD-TK-----
A0A2V7UGP8      NV----WVVDAAEIP--DRIFRPNKKMNILLSLFVGLALGVGMAF-FLEYLD-NS-----
A0A239MKT6      DM----VIVDPARPP--SLNSSPNASRLLATGTAAGLLLGLLIGI-ALHLRD-RF-----
A0A3E0PCN7      NV----NLVDRAQPP--SAPQGPNRSRAVLMAFVASLIGGIGLAF-VLNWLD-DT-----
A0A2V8IYW3      QVGEQFKVLDPARVP--ERPFSPKRLQLNLTAIGIGLMLGMAVSA-LLEYRD-TS-----
G2LEI9          NI----TVVDRAGTP--GAPISPRVSYTLSVAFFLSLFGGVGLAF-AREYLN-TR-----
A0A317J121      TI----RLVDPSTPP--AKPYKPRPALNIAFGTMAGLFLSVGIAF-LWERMD-KS-----
A0A2V7YW66      NI----RIIDKALVP--GGPFRPSLRQDVTYGLLLGLLAGLGLAV-LIELMD-RT-----
A0A2V7Z0V0      NI----RIIDKATVP--GGPFQPSLRKDGSYGLLLGLLFGVGCAV-LIEVLD-RT-----
A0A2V8GFD4      NV----RVVDAAEEP--PWPAYPRKRTNVTYGLLAAVLLAGMFGF-VIEALD-TC-----
A0A2V8HSS5      NV----RVVDAAEEP--PWPAYPRKRTNVTYGLLAAVLLAGMFGF-VIEALD-TC-----
A0A2V8KP55      NI----RVVDQAEVP--KGAVTPNHKLNLAWGIFFGLIFGVGSAV-FQEYID-RS-----
A0A399WNU1      NV----HVVDRALVP--GAPSGPQRTKNVVIAFFASLFGGIAIAF-GLNWLD-DT-----
A0A2V9JSI3      NI----HVVDPALPP--AAPIRPKKTQNIAMGLLGGLALGVMLAL-FADVLD-NS-----
A0A2V9WI32      NI----RIVDVARVP--TSPSAPNIPRDIVLGLALGLFGGIGLAF-VLESLD-NT-----
A0A2V8IVN9      NI----RVVDPAERP--RKPSSPQYALNLLLGLLGGTMLGVGLAF-FFEYLD-SH-----
A0A7C5Z4J3      NV----RLVDRAFAP--PQPIRPKKARNIAVGLMVGLVLGTTLAF-LNEALD-TS-----
A0A1F2TPT3      RI----RILDAATVP--SSPVGPDKGRSILGAVFAGLGLALVLAF-GFEYLD-NR-----
A0A2V8JTQ2      NI----WIVDPARPP--KLPAEPNILRNLALSLLFGICGGVWLSFGLAKIEE-KT-----
A0A2V8UZY0      NI----WIVDPARPP--KLPVEPDIRRNFALSLLFGIFGGVLLAFGLAKVNE-KT-----
A0A350UEK1      NV----RVVDEAQPP--ERPYKPSLPLNAVLGLLAGGFLAVGFVV-TTEKAD-RA-----
A0A350UIQ4      NV----RIVDPAKAP--ERPYKPRLPLNALLGLLAGGFLAVAFVV-TTEKAD-RA-----
A0A1H5Z7N3      EI----EIVDNAVPP--VYPTLKPRSTILMIDLVVALIVGLIVAF-VLDSLD-TG-----
A0A1G7JVV8      EI----DVVDPAFKP--IGPTMTPRSSILSRDLILSLVFGIMLAF-ALESLD-TG-----
A0A1H4T6W9      EI----DIVDQALKP--AAPSITPRSTILLRTLLISLVAGLMIAF-TMESLD-TG-----
I3ZEU5          EI----DIVDQALKP--AGPSMTPRSTILLRTVLIGLVAGLMIAF-TMESLD-TG-----
A0A1I6MH75      EI----DVVDLAMIP--ASPRLQPYSSVVLTACIFALLVGIILAF-TLESLD-TG-----
E8WVF6          EI----DIIDQAVPP--SDPQSTPQSTIILTYFAVSLVLGTLLAF-LLESLD-TG-----
A0A7D0PQC3      EV----DIVDQAIPP--ARPTMRSKSFDLLLASLVALIIGVLLAF-LLENLD-TG-----
A0A428MDU2      EI----DVVDQALPP--ASPMLRPQSTIIMTSFVFGLLGGIVLAF-LMESLD-TG-----
A0A5B9EBI2      EI----DVVDQALIP--AAPTLQSATTIIIVTLLFSLFGGIVIAF-LLESLD-TG-----
A0A239HDF6      EI----DIVDQAVPP--ASPMLRPKSTLVLTTLAVAMILGVLIAF-LLDTLD-TG-----
A0A4Q0T270      EI----DVVDQALLP--AYPTLQPYSSIITTNVLFALIVGIVVAF-VLDSLD-TG-----
A0A1Q3QQB6      EI----DVVDQALPP--AKPTLKRRSTVVLTGMVFGLLGGIIIAF-IVESLD-TG-----
A0A3N1K1G7      EI----DVVDQALPP--ANPVLRPQSTIILTMLFVGLIAGIIIAF-LMESLD-TG-----
A0A4V2G466      EI----DVVDPALLP--ATPTLKPKSTVVLTYLFMGLVAGVMLSF-LLESLD-TG-----
A0A6B9YNQ8      EI----DVVDPALLP--ANPTLKRKTTVVLTYLVLGFIAGVMMAF-LLESLD-TG-----
A0A3N5YNR8      NI----HVVDHAEVP--ETPYSPQRAGDLALGLGVGLFLAIGLAF-LMEYLD-NT-----
A0A3N6A5T6      NI----NVVDRGETP--RRVYRPRTAINLALGLILGLMLGVSMAF-FIDYLD-NT-----
A0A1F2Q9L4      NI----VVVDRALVP--GGPYRPSLRRNLGLGLVLGLALGLGFVF-FLEYLD-RS-----
A0A2U3KC61      NI----RVVDFARTP--TSPITPNVPRNIELGLLLGLACGIGLAF-VLESLD-TS-----
A0A2V9Y2R7      NI----RVVDVARTP--MFPVKPDVPRNIKLGFILGLCLGVGLAF-VLESCD-NT-----
A0A2V9NGH6      NI----RPVDLARVP--IEPAEPDVPRNLSFALVLGLTTGVSLAF-LLEGID-NT-----
A0A2V9PYE6      NI----RPVDLARVP--IEPAEPDVPRNLSFALVLGLTTGVSLAF-LLEGID-NT-----
A0A2V9NL07      NI----RQVDIARTP--AGPAEPNIPRNLGFALALGLTSGIGLAF-LLEGID-NT-----
A0A2V9QD92      NI----RQVDIARTP--AGPAEPNIPRNLGFALAFGLTSGIGLAF-LLEGID-NT-----
A0A2V9WPZ6      NV----KIVNAARVP--MAPSEPNIPRNLAFGLLLGLTSGIGLAF-LLENLD-NT-----
A0A2V9ZLH4      NV----KIVDAARVP--QAPSEPNIPRNLAFALLLGLTSGVGLAF-LLENLD-NT-----
A0A2V9RQF1      NI----RNVDIARAP--RSPAEPNVPRNLSFALALGITTGIGLAF-LLEGID-NT-----
A0A2V9YDK8      NV----KIVNAARVP--MAPSEPNIPRNLAFALVLGLTSGVGLAF-LLENLD-NT-----
A0A2V9V8F7      NV----KIVNAARVP--MAPSEPNIPRNLAFGLLLGLTSGIGLAF-LLENLD-NT-----
A0A2V9XGR9      NV----KIVNAARVP--MAPSEPNIPRNLAFGLLLGLTSGIGLAF-LLENLD-NT-----
A0A2V9V3Q5      NF----RIVDPARSP--NAPVEPNIPRNLLFALVLGVSSGVGLAF-LLEGMD-NT-----
A0A2V9NWS3      NI----RNVDAARVP--SEPVEPNVPRNLAFALALGLSTGIGLAF-LLEGVD-NT-----
A0A2V9USA9      NF----RIVDTARVP--NGPIEPNIPRNLGFALVLGLMSGVGLAF-LLEGLD-NT-----
A0A2V9XW18      NF----RIVDSARPP--TGPIEPNVPRNLLFAAVLGLASGMGLAF-LIEALD-NT-----
A0A1H5SQF5      NV----TIVNPARVP--SGPSRPQPVQNIALGFLAGLATGLFLAF-ATAYHN-DV-----
A0A2V9AEW6      NV----MVIDRARPP--KLPYRPSLPMNSAIGLLGGMFLGLGFVL-LRERLD-RR-----
A0A2V8WQK6      NV----LVVDRAKPP--LLPYRPSLPVNSAIGLFSGVFLGFGFVL-LRERID-RR-----
A0A2V8XIF4      NV----LVVDRAKPP--LLPYRPSFPMNSAIGLFSGLFLGFGFVI-LRDRLD-RR-----
A0A2V2R0I6      NI----RVVDPAMIP--SYPSRPAKARNLALAFLVGLVGGVGLAL-LREYLD-NT-----
A0A2V8XAR9      NI----RIVDPAMIP--STPSRPAKARNITLAFLVGLVGGIGLAL-MREYLD-NT-----
A0A2V8VZA0      NI----RVVDPAMIP--STPARPAKTRNVALAFLVGLVGGMGLAL-MREYLD-NT-----
A0A1Q7CB82      NI----RVVDPAMIP--STPARPAKTRNVALAFLVGLVGGMGLAL-MREYLD-NT-----
A0A2V8WIU1      NI----RVVDPAMIP--STPARPAKTRNVALAFLVGLVGGMGLAL-MREYLD-NT-----
A0A1Q6Y9F5      NI----RVVDPAMIP--STPARPAKTRNIALAFLVGLVGGIGLAL-MREYLD-NT-----
A0A2V9EVV8      NI----RVVDPAMIP--STPARPAKTRNIALAFLVGLVGGIGLAL-MREYLD-NT-----
A0A2V8YF91      NI----RIIDPAMVP--TSPARPAKTKNITLAFLVGLVGGIGLAL-LREYLD-NT-----
A0A2V8XZK2      NI----RIVDPAMVP--TSPARPAKARNIMLAFLVGLIGGIGLAL-MREYLD-NT-----
A0A2V8ZTX6      NT------------------------KNIILSFLVGLVGGIGLAL-LREYLD-NT-----
A0A2V9BT79      NI----RVVDPAMVP--ATPARPAKGKNIMLSFLAGLVGGIGLAL-LREYLD-NT-----
A0A2V9YHT3      NI----RIVDSARPP--VLPSQPDVPRNLLLGLAAGLIAGVVLAF-GAEVMD-ST-----
A0A7C2XNI7      NI----RIVDPALVP--PAPARPQKARNVLLALLVGLVGGVGLAF-LREYLD-NT-----
A0A1Q8B793      NI----RVVDPAMIP--SSPARPAKMRNISLAFLVGLVGGIGLAL-LREYMD-NT-----
A0A2V9BCA0      NI----RVVDPAMIP--SSPARPAKMRNISLAFLVGLVGGIGLAL-LREYMD-NT-----
A0A2V9BWU9      NI----RVVDPAMVP--SAPSRPQKTRNILLAFLIGLVGGVGLAL-LREYLD-NT-----
A0A2V9DKX2      NI----RVVDPAMVP--SAPSRPQKTRNILLAFLIGLVGGVGLAL-LREYLD-NT-----
A0A7C2YQY3      NI----HIVDRARPP--LAPIRPRKSLNIALSAVVGLILGGALAL-FNEYLD-NS-----
A0A3E0NV31      GI----RISIPATRP--NSQYAPNKTRSTLFALGIGLALGIAAAL-GLEFLD-QT-----
A0A3N5M5V0      NI----HIVDHAQVP--TAPYSPQRAADLALGFGVGLLIAVGLAF-LMEYLD-NT-----
A0A3N5XQP8      NI----QIVDRARTP--LNTWWPRRTMNLALAFLGGLFLGLGLAV-TLHLLD-NR-----
A0A2Z5G7H4      NI----TVVDPGRIP--STPKQPNIPVYLAIAAGVGLFLGVCGAF-ISDSID-DK-----
A0A2V9L5B5      NI----RVVDAAEAP--KYPAKPRVLLNLVLGLILGLGLGVGMAF-FQEYLD-KT-----
A0A2V9LK56      NI----RIVDAAEVP--RRPVRPRVILNLALGIIFGLGLGVAGVI-LLEYLD-NT-----
A0A2V9L7I0      NV----RIVDAAEIP--KGPAKPRVLLNLILGLVVGLALGVGVAF-LQEHLD-KT-----
A0A522PPT0      NI----MVVDPAQVP--KGPAKPRVILNLAVGFILGLSLGVGLAF-LQEYLD-NT-----
A0A7C5V1G5      NI----MVVDPAEVP--KSPAKPRVVLNLAFGCILGLSLGVGLAF-LQEFLD-NT-----
A0A2V9KCS3      NM----RVVDPAKAP--RLPYKPNLLQHAGVGFIAGLLLGTVFVV-IQEQAD-RS-----
A0A372IT17      SF----SIVNPARIPPGNHPKSPNLPLYYAAALGAGLFLGCAGAI-TCEFTD-RS-----
A0A4R1LC91      NI----TVVDPGRVP--AKPAKPNVPLVLAGSLLGGLFLGCCGAL-LADVMD-NK-----
A0A3M2BZG9      NV----RVVDYAIVP--SAPFRPVLRKDLTTALLLGLLAGVGLIL-LIEFFD-RT-----
A0A1Q7N5R7      DV----RVLDAAVAP--RRPVKDSASRLIALGFLAGLGFGVVGAV-LVDRLD-RR-----
A0A2V9QB26      NV----RIIDAAEPP--EHPYKPNLPMNAAVGLLSGLCIGVAFVV-TRGRAD-RT-----
A0A2V9VYY4      NI----RIVDIARVP--TQPISPNVHRSLVLGFLLALGLGVGLAL-VRETFD-ST-----
A0A3E0PHB0      NI----KVSGKA--Q--VNRTGPQRTRNILIALFISLAGGIGLTF-LLDYLD-DS-----
A0A3M1SIV3      NV----AVSTKASKP--DSPIGPPRNRNILISLIVSLFLGIGLAF-LLDYLD-DS-----
A0A3M2D491      NI----SIATEATKP--DAPIGPQRNRNILLAFLASLFVGIGLAF-LFDYLD-DS-----
A0A353C9L6      NI----KIAANA-GG--AYPVGPQRSRNILVAFLLSLAAGLGLAF-LLDYLD-DS-----
A0A2V8RQV0      NI----KIAANA-GP--AILVGPPRGRNIFVAFLFSLAAGIGLAF-LMDYLD-DS-----
A0A2V8SJH5      NI----KIAANAVTP--GGPIGPARTRNILVAFLVSFGVGIGLAF-LLDYLD-DS-----
A0A357F267      NI----KIAARAITP--KSPIGPQRNRNIFVAFMLSLAAGIGLAF-LLDYLD-DS-----
A0A7C5ZUA8      NI----KIPAPAEVP--TVPEGPQRGRNVLIAFLVSLFAGVGLAF-LLDYLD-DS-----
A0A136JPP4      NI----KISERAEAP--TYPVGPNRARNIFIALLASLGAGIGLAF-LLDYLD-DS-----
A0A399WUJ8      NI----KISNRAVVP--TSPDGPKRARNIFIALLASLGAGIGLAF-LLDYLD-DS-----
A0A2V9KIE8      NI----RIVDQAETP--KLPVKPRVILNLALGFAFGLALGIGLAF-FQEYLD-NT-----
A0A352F549      NI----HVVDYAAIP--KGPVGPRRMQAVTLAMMLATAFGIALAL-FLEYLD-DT-----
A0A3B9MLP9      NI----HVVDYAAVP--KGPIGPRRMEAVFLALVLALVFGVALAL-FLEYLD-DT-----
A0A3D5SQ87      NI----HVVDYAAVP--KGPIGPRRMEAVFLALVLALVFGVALAL-FLEYLD-DT-----
A0A2V8NW86      NV----RIIDAAEPP--KRPYKPSLPVNAAVGLLSGLCIGVAFLV-TRGRAD-RT-----
A0A7C2GJ20      NV----QILDKAEVP--LRPARPRKLFNIGLSVLVGLVLGVGLAL-FVEYLD-NT-----
A0A7C4BTL5      NV----RVVDPAKPP--KTPYKPDVPMNAGVGLLAGLGLGVAFVI-IRERAD-RT-----
A0A2V8ZHL8      NI----HVVDPARPP--RVPVRPQKLLNIAIGLVVGLILGVTLAF-VKEALD-TS-----
A0A2V9B240      NI----HVVDLARPP--KVPVRPQKLFNIAVSLVVGLILGVTLAF-VKEALD-SS-----
A0A2V9CBM2      NI----LIVDPAEPP--AKPAKPKILLNLVLASILGLALGVGEAF-LQERLD-DT-----
A0A2V8XN17      NI----RLVDSAEPP--AKPVKPRTLLNLSVALFLGLALGICAAL-FQERMD-DT-----
A0A2V8WX45      NI----RIVDSAEPP--ARPVKPRIALNLMVAAFLGLGLGVCAAF-FQERMD-NT-----
A0A1Q6YR79      NI----RLVDSAEPP--AKPFKPRTLLNLSVAVFLGLALGICAAL-FQERMD-DT-----
A0A1Q7VA32      NI----RLVDSAEPP--AKPFKPRTLLNLSVAVFLGLALGICAAL-FQERMD-DT-----
A0A2V9EY85      NI----RLVDSAEPP--AKPFKPRTLLNLSVAVFLGLALGICAAL-FQERMD-DT-----
A0A2V9H8K0      NI----RLVDSAQPP--AKPVTPRTLLNLAVAMFLGLGLGICTAL-FQERMD-DT-----
A0A2V9FFE5      NI----RLVDSAQPP--AKPVKPKILLNLAVAMFLGLGLGIGTAL-FQERMD-NT-----
A0A2V9GM43      NI----RLVDSAQPP--AKPVKPKILLNLAVAMFLGLGLGIGTAL-FQERMD-NT-----
A0A2V9CYQ5      NI----LIVDPAEPP--TKPAKPKILLNLLVASILGLALGVGEAF-LQEHLD-DT-----
A0A2V9BWU8      NI----RVVDSAEPP--ARPAKPRIPLNLAVAALLGLGLGISTAF-LQERLD-DT-----
A0A2V8ZG48      NI----RIVDSAVPP--AKPAKPKIPLNLAVATLLGLGLGISAAF-LQERLD-DT-----
A0A2V8Y334      NI----RIVDPADPP--AKPAKPRIPLNLAVGVLLGLGLGISTAF-LQERLD-DT-----
A0A2V9AY68      NI----RIVDSAEAP--AKPAKPKIPLNLAVASLLGLGLGISAAF-LQERLD-DT-----
A0A1F2RFI7      NI----RVVDQAEVP--EMPAKPQKLVNLALALIFGLGLGVGMAF-FQEYLD-NT-----
A0A1F2RZS3      NV----RVVDPAEVP--TLPSKPRKLMNLALALMVGLSLGIGMAF-FQEYLD-NT-----
A0A1F2USE2      NI----RIVDSARPP--EKPAKPKVLLHLAMGFLLGLGLGVGAAF-LQEYLD-NT-----
A0A7C2VB08      NI----RVVDRATPP--RRPAKPNLLLNLLLGTAFGLGLGIGAAL-LAEHVD-SS-----
A0A2V9C238      NI----RIVDAAEPP--KKPARPNLPLNLALAVLLGTGLGV-----VQEHVD-NS-----
A0A1F2Q9F5      HV----RVVDPAQPP--DKPAKPSLALNLLLALVLGLGLGLAAVF-LQEHFD-NS-----
A0A1F2QQH9      HV----RVVDPAQPP--DKPAKPSLALNLLLALVLGLGLGLAAVF-LQEHFD-NS-----
A0A1F2QXK7      HV----RVVDPAQPP--DKPAKPSLALNLLLALVLGLGLGLAAVF-LQEHFD-NS-----
A0A2V9DEM9      NI----RIVDAAEPP--KKPARPNLPLNLVLAVLLGTGLGVGAAF-LQEHVD-NS-----
A0A7C5TWV7      --NNV-RVIDPAEPP--KHPYKPNPPRILSLSLILGLFLGVGLAF-GLDFID-QT-----
A0A2V7XDY0      --NNV-SVVERASAP--TSPIRPNKKRIAAVAGFLGLLLGVGLVI-ARDYLD-NT-----
A0A2V8G155      -TSNI-SVIDRAETP--RTPVEPRVQYMLTLGGCGAFLFALCLAF-FFEHFD-NR-----
A0A2V8HDM7      -TSNI-SVIDRAETP--RTPVEPRVQYMLTLGGCGAFLFALCLAF-FFEHFD-NR-----
A0A2V8DRT9      -VSNI-RIVDAAELP--QVPASPDKPLNVLLAILGGSIMAVGLAF-FFEYCD-NR-----
A0A2V7VYF3      -ATNV-RIVDAAEVP--RSPAGPNTRTDFLLAVLVGGVVAVGFVF-GLEYLD-NR-----
A0A1F2SVH2      -TSNI-RVVDAAETP--RGPVRPNTRNNLLLALFGGATLAVGLAF-FFEYLD-NR-----
A0A2V8AJG9      -TSNI-RVVDAAEVP--RRPASPNVPTNLLLAFFGGGTLALGLAF-FFEYLD-NR-----
A0A2N9LQU7      -SADI-SIVSRGMVA--ARPAFPKKSLMLPLGFLISVFGGLVFVF-VLESFD-DS-----
A0A2P6WFK7      -SGYI-SIIDRAEIP--ATPVEPRIKRNLALGLFGGVIAGLLLAF-GVEALD-DT-----
A0A2V8U914      -QSNI-RLVAPAEPA--FRPYKPNLPLNLSIGLFAGLVLAVGSVM-LTEQTN-SR-----
A0A2V7W309      ASSNV-HWVDHAETP--GSRINLSMKKNLQTAFPLGLFLGFAAIF-FLEYMD-RS-----
A0A2W0BGU4      -STNI-HIVDPALAP--IIPVRPRTRLNIVLGLLVGMIFGSMLAF-IQDSLD-NS-----
A0A2W0BVQ9      -STNI-HIVDPALAP--IIPVRPRTRLNIVLGLLVGMIFGSMLAF-IQDSLD-NS-----
A0A2V9MN96      -SSNI-RVIDVARLP--TGPAKPDVRRNIFLGFLLGLAGGVALAF-LQESMD-TT-----
A0A2V7V2Z1      -NSNI-RIVDPASVP--RGPVRPRTTRDILYGVFLGLALGIGLAF-FLDYLD-NT-----
A0A2V7X2F7      -ASNI-RIVDPAVMP--NGPVRPNRQRDILTGALLGLVLAFGAAF-FLEYLD-NT-----
A0A2V7V2I1      -ASNI-RIVDAAAVP--GSPVRPNRPSDIAMGLFLGLALGVMAAF-FLEYLD-NS-----
A0A2V7U3M2      -NSNI-RIVDAASVP--RSPVRPQKTRDIAMGVALGLFLGIGLAF-FLDYLD-NT-----
A0A2V7UHT0      -NSNI-RIVDGASVP--RGPVRPQKTRDIAMGLALGLFLGIGLAF-FLDYLD-NT-----
A0A2Z5FVL3      -SSNI-TVVSPALAP--SAPSRPNIPLYLAGSLATGLLFGCIMAV-VVDLMD-SK-----
A0A2V9KBD6      -SSNI-WIVDPARAP--KLPSEPNLVRNVALSLAFGLFGGMCLAF-GLEKIN-EKT----
A0A2W0AJ66      -LSGL-RVIDPAQPP--KRPSEPNVPRNFGLSVGFGLVGGVLLAF-GLAKMH-EP-----
A0A1Q7RBU1      -SSNI-WIVDPARPP--KLPAEPKILRNLALSLLFGIFGGVLLAF-GLTKMN-EK-----
A0A2V9JPV9      -SSNI-WIVDPARPP--KRPAEPNILRNFALSLLFGIFGGVLLAF-GLTKMN-ET-----
A0A3P0X3W6      -NSSI-RIADEARPQ--NAPVFPKKGIFIFIGFFLSGVIAVAATL-LSDMMD-KS-----
A0A2N9MK30      -SNTV-RIADNARPG--LSPVFPNVPLNVGLALLFAAILAVGAAV-LSDTLD-NT-----
A0A3D1ASD2      -TSNV-RIADSARPP--LKPVFPRTRLNVLIAFLFSTILAIGAAV-MSDVLD-NT-----
A0A7C5AXI3      -NSSI-RIADPARPA--VKPVFPNMKLNVLLAFLFSTLIAVGMAV-LSDVLD-NT-----
A0A7C6E4H7      -NSSI-RLADPARPA--LKPVFPNLKLNLALAFLLSSLLAVGAAI-LSDSLD-KT-----
A0A1F2TCR2      --NNV-QLMDRAEVP--AAPFTPNPRKDWFTAIMAGLLVGVGLAF-GIEYLD-DT-----
A0A350UQT3      --NMV-RIADAARPA--WKPVFPKLTLNLLLAFLFSSLLAVGAAI-LVDTLD-NT-----
A0A7C3HRX0      --NAV-RVADPARAP--WKPVFPKMWLNLLIAFLFSSVLACSAAL-LADSLD-TT-----
A0A1F2V330      NKTVAFRIVEPASLP--KGPSTPRRSRLLLVGLFVGLALGLAVAF-VAEQMD-TT-----
A0A662EE63      --NNI-RVIEKATPP--SGPFSPNLRRAVALGGVLGLFLGIGLVL-GLDFLD-HT-----
A0A2V8TLH7      --NNL-RVLDRAPLP--QMPIRPRPILNLLIGVMLGLLLGVGTVF-FLDYMD-NT-----
A0A1Q7ZJT1      --NNL-RILDKAPVP--KVPVRPRTVLNLAIGMLLGILLGVGAIF-FLDYMD-NT-----
A0A2V8VC99      --NNL-SILDKAPVP--KVPVRPRTVLNMAIGVLFGLLLGVGTVF-FMDYMD-NT-----
A0A348UZU3      RTSNI-RIVDRADIP--LRPDSPRKFRNLLLALFLGLFGGLGLAL-GMEYLD-NT-----
Q01XL7          --SNI-RVVDAAVAD--NIPSSPTPMRDIPTWSLFGGALCYGLLW-FREVLR-RKRLTQL
A0A2V8ERZ5      --NNV-RLVDRAETP--RGPITAGGRRTVLMSLMIGLVLAVAVAL-GLDYMN-DT-----
A0A2V8GTX0      --NNV-RLLDRSEVP--ESPFTPNTRRAWLMAILFGLGFGIAAAF-AIDYLD-DT-----
A0A2V8J0X9      --NNV-QVLDRADVP--PFPVSPNPRRDWMTAILAGLSIALGLAF-GMEYLD-DS-----
A0A523DUV7      --NNV-SIVERASIS--AVPIRPQPTKNLAIALVLGVLSGCGLIL-LRDYLD-NT-----
A0A372IRG7      --NNI-DVIDTAMIP--PYPVLPQKRQDATFGFLGGLIVGLILAV-FLESMD-DT-----
A0A1F2U158      --NNV-RVVERAEVP--AGPLTPTGRRTWLLSFAVGLVAAISVAY-GLDYMN-DT-----
A0A2V8F6S9      --NNV-RVIDHAELP--RGPMAPTGRRTWLLSLAVGLAIAVAVAY-GLDYMN-DT-----
A0A7D8BEX2      --AQI-DVVDLGVPP--SRARLPSPWMLFVGAVFVLLLLGAIAAV-TIDLLK-AT-----
A0A4Q1SCH5      --INT-MIVDRARLQ--RFPVEPKKALILASGLILGCVAGIGAAL-LRESMG-GE-----
A0A2V8K4L4      --SNF-RIVDLAKPA--GAPYKPNLMNNAMLGSMAGIFLGVVLVL-LKEQAD-RS-----
A0A2V8NCZ3      --SNF-RIVDLAKPA--NLPYKPSPVNNAILGLMAGIFVGVVLVL-LREQAD-RS-----
A0A4Q7YNP3      --STV-RLVDAAHKP--KMPFSPRRGTSTMAGLLLGSLFGIGFAF-YKDRNS-DI-----
E8UZE1          --DTI-SVIDPALTP--NIPSEPRRALNMEAGALLGLVVAFAVVF-LIENAN-AT-----
A0A2U3JZ71      --SAI-RIADLARPA--FKAVFPNIKLNVLLAFLLSTLLAIGTAI-CADLLN-NA-----
A0A2V8TTB0      --SSI-RVADPARPG--LKPVFPLTWLNVLLAFLFATFLGVGAAV-LTDVLD-NT-----
A0A1V6HR88      RESNV-RIVDRALVP--GGPFRPSLRRNVTFAGGAGLVLGFGLVL-LLHYMD-RT-----
A0A3E0P0A3      --QAIVTQTERAVLP--TSPVSPSLRRHLPFGVALGLLCGVALVL-LIDFLD-RS-----
A0A2V8EXP2      --SNI-RVIDVAETP--RRPASPNVVANLLLALFGGLTLAVGIAF-FFEYLD-NR-----
A0A2W4RYA1      --SGI-RIVDPAVLP--RTPSSPRKVLNLSLGFVVAVLGALGLAF-FFEYFD-NR-----
G8P0Y7          --SNT-RVVDRARLP--RYPTKPNIPRNLEFALLVGLVVGIALAF-GLEALD-AT-----
A0A5M8T4U7      --TNI-SVVDPAQVP--IIPIAPRKTMSMLFGLIGGFVGGLVMAF-IIESID-DR-----
A0A7D0PPG7      --SAS-RIADEARPQ--IHPVFPNKMVFIFLGFLFSSVVSLIVVI-VSDMFD-KS-----
A0A7D8BF18      --TEI-DIVDVAMPP--IGPSLRPKSTIMMIDALGMLIIGVVLAF-VLDSLD-MG-----
A0A1E3Y9R6      --TAI-QVLDPATVP--SAPVLPRTPRDLLLAALAGGLLALGLAF-GFEYFD-SR-----
A0A2W4TLP2      --TSI-QVLDRAEVP--RVPVLPRTQRDLMLAALAGLVLAFGLAF-GVEHFD-SR-----
A0A7C4BZ42      --STY-RVVDAAQAP--SAPYRPRPGRMAFFGLLGGLVLGFGFVI-LRERAD-RT-----
A0A3R9WF43      --TRI-DVVNEARPA--GTPSSPDYPKYLTLVAGIGIFLGISSAF-VRESLD-ES-----
A0A317HKM4      --TNI-RIVDSAEIP--TVPSLPRQTHNLMLAFAGSSSLALVLVF-VLEVFN-TR-----
A0A2V9CG11      --SNV-LVIDHAEVP--RLPYKPNLPMNAALGMFGGFFLALGLVL-FRERLD-RR-----
A0A523E0N1      QPVRV-KFIERAEAP--TVPFAPGSNRRFALLLALGVILGAGTAY-LLDHWD-DA-----
A0A523ECP2      EPVNV-RIVEAALVP--KVPTGPRLSRSLLLGSVVGIALALGLAL-FLDYWE-TS-----
A0A2W0C122      --TNV-RLIDPAEAT--ELPVSPYLPRSSYLGLFLGFLLSAAVIG-FRESMD-RA-----
A0A2W0AUU7      --TNI-RLIDPAGAT--GLPVSPNLRRTSCIGLFLGFLLSAAAIG-IREGMD-RA-----
A0A2W0BQL1      --TNI-RLIDPAGAT--GLPVSPNLRRTSYIGLFLGFLLSAAAIG-IREGMD-RA-----
A0A4Q1SDL1      --SDI-TVVDPGRVP--AKPKKPNVPLYLLIAAFGGLVLGLAGAL-IAEAMD-RR-----
A0A3P0XH15      --TQI-DIVDRAVTP--ALPVFPVKRNDAAIGLAAGLVLGLALAL-FAETID-DT-----
A0A4R1LAZ7      --NNI-DVIDRASIP--ALPISPVKRVDLGVGLAAGLLVGISLSL-LLESLD-DT-----
A0A3M1WQW8      --TNI-QILDRAQVP--TTPARPRKLFTTGVSGLVGLLLGIVLAL-FVEYLD-NT-----
A0A3N1JHC1      --ANA-RVVSPAKAS--LIPTSPKLSICIFLAVLLGGVFSLLYIL-ISERRD-NS-----
C1F294          --NSL-EVVDHANLP--VIPVTPQKKRTVVFGFLGGLIAGIAISL-LLESLD-DT-----
A0A2V9KA79      ETNVLWRIADPARLP--SAPVTPGRVRILLLGLAAGLCLGLGLAV-LAENLD-TT-----
A0A522PSP1      --TAL-RIIDPARPN--SAPVYPRTKQTLMLALILSGMLGVLGAV-AADGMD-RT-----
G8P085          --VNT-MRVDTARAP--LIPVEPKKLVILSFGLVLGLFAGVGSAF-LREALS-DK-----
A0A7C6A629      --SSI-RLADPARPA--LKPVFPDLKLNLALAFLLSSLLAIGAAI-LSDAMD-KT-----
A0A4Q1SGQ1      --TNL-TVVAPAQVPPTHRPSSPRMLLVYACALIGGLFLGCTGGW-TAERFD-HS-----
Q1ILD9          --ANI-DVVDAAPVP--IKPVEPAMKLAMALGLIGGLFMGFAGVV-VAEAVD-QS-----
A0A7C5SHM3      LERQV-AIIGPATVP--ESPAVPRVKLNLALGLVFGIFLGIGAAF-LAEAMD-NK-----
Q1IJZ6          --TNV-AVISAGLPP--AKPSHPDPLVNGIVGLGGGLFVGLILAF-VVETLD-DS-----
A0A2V8TCE6      NAGNA-RIVDRAIPP--TAPCKPRPGVELPLGLFVGLLLGMGAAF-GMESWD-NT-----
A0A522TBE8      --TNA-RVVSPARPD--FRPVAPRPKLTAAVALLLSLLAGVGFVL-ARDALD-QS-----
Q1ITG0          --TNV-DVIDPSAVP--QLPVLPNVPLFIALGLFGGAFLGVCSAF-VKESID-QT-----
A0A7C2ML20      -NTNI-RIIDRAEVP--LLPSNSR-RSPLVHGALLGLILGIGFAF-FLEFLD-DK-----
A0A7C5AXS9      --SNV-RVVDKAKPP--HFPYKPNYPLNSALGLMLGLMLGVGFVL-IRERAD-RT-----
A0A7C2RGE3      --TNI-QILDKAEVP--LRPARPRKLFNIGLSVIVGLLLGIGLAL-FVEYLD-NT-----
A0A3N5PCI5      --PDI-QVVDAAEVP--RRPVRPDTRSTLMIGLLLSGILAVAIAF-IREAFD-SR-----
A0A3M1Q0S9      RALNI-RVIEKATPP--RMIFKPKKKLNVALGFLFGLFLGIGAAF-VMEYVD-NT-----
A0A2Z5G448      --NNV-NLVDKAEVP--AFAVAPKKRTNYGFGALIGLFIGIAAAL-FLETLD-DT-----
A0A3M1VZ38      TAHNV-QIIDEAVPP--EIIYRPKKKLNILLGFLLGLCLGIGGAV-LAEYID-NT-----
A0A4Q1SD29      --TNI-DVIDRANIP--PFPVLPAKRSDVMFGLLGGLIVGMALAF-FMEGLD-DT-----
A0A6N9FGE2      --SNV-RILDTAETP--VRPARPRRQLILLLGLLGGGTLGVGLVF-AVEFVD-DR-----
A0A3M1PY35      LERQV-SVVAPATPP--ERPAVPRYRLDLALSALLGLFLGIGAAF-AAEARD-NK-----
A0A3M1VMP2      LERQV-HVVDRAKPP--KSPSAPRVKLNLALGLLLGLLLGVGGAF-GAEALD-VK-----
                                                                            

A0A2V7VMF7      VRDPEEIERYLHLDLLSAVPRYE-------------------------------------
A0A2V7YYV7      IKTNEDLTERLGLLPVGHIGYVL-------------------------------------
A0A2V7Z0J5      IKSDAELTDRVGLISLGHVPFLV-------------------------------------
A0A2V7Z3M4      IKSDQELTERLGLVPHGHIAFVP-------------------------------------
A0A399Y5V2      LRSKQDAEKAFGAPILGMIPRA--------------------------------------
Q01X01          LRSPGDAGAYLTLPELGAIPRAA-------------------------------------
A0A3M2D9H8      IRNGETVTKNLDLPVLGYISEMN-------------------------------------
A0A2V8JK38      IKSPDDVTRHLGLLALGTVPRLH-------------------------------------
A0A2V9IXG5      VKTVEEIQTSLSVPALGFLPRTK-------------------------------------
A0A2V9J2P4      VKTVEEIQTSLSVPALGFLPRTK-------------------------------------
A0A1Q7RLS4      VRTSDDVEQYLRLNLLAIVPKEA-------------------------------------
A0A2V2R525      VRTMSDVTRSIRLPTIAVVPTVK-------------------------------------
A0A321LPW6      IKTVDDVARFVRLPALGVIPMMT-------------------------------------
A0A2V9R9V4      IRSVDDVNRYTQLPALAVIPVIG-------------------------------------
A0A321LE75      IKSVEDVNRYAQLPALGIIPAIT-------------------------------------
A0A2V8R8U7      VKSLDDIDRYIHLPALALIPSVR-------------------------------------
A0A2V8QMP4      LKSIEDVDRHLHLPTLALIPAPR-------------------------------------
A0A2V8R4S3      LKSIEDVDRHLHLPTLALIPAPR-------------------------------------
A0A2V8NJ55      VKSIEDVDRYIHLPALALIPGQR-------------------------------------
A0A2V8Q7I0      VKSVDDIDRYVHLPALALIPASR-------------------------------------
A0A2V8S6K4      LKSIEDVDRHVHLPTLALIPAPR-------------------------------------
A0A317I2L9      VKSIEDIDRYVHLPALALIPASR-------------------------------------
A0A2V8LLF9      LKSVDDVDRYLHLPALALIPTAR-------------------------------------
A0A352FRF4      IKSVDDVDRYINLPALALIPAVR-------------------------------------
A0A2V8MKV0      VKSLDDVDRYIHLPTLALIPAAR-------------------------------------
A0A2V8PYY8      VKSLDDVDRYIHLPTLALIPAAR-------------------------------------
A0A1Q7YKQ8      LKSVEDVDRYLHLPALALIPSTR-------------------------------------
A0A352F3R7      VKTVDDIDRYLHLPALALIPASR-------------------------------------
A0A0B6WXT1      LKSAEDVERYLHLPTLALIPAPR-------------------------------------
A0A3B9MEU8      LKSVDDVDRYLHLPALALIPSNR-------------------------------------
A0A2V8MHG6      VRTSEDVENFLRLPALTVIPTIG-------------------------------------
A0A2V8P7N1      VRTSDDVENFLRLPALTVIPTVG-------------------------------------
A0A2V8M3M6      VRTSDDVENFLRLPALTVIPTVG-------------------------------------
A0A1Q7NJH5      VRTSEDVENFLRLPALTVIPTIG-------------------------------------
A0A2V8PJY0      VRTSEDVENFLRLPALTVIPTIG-------------------------------------
A0A1Q7Y6W9      VRTADDVEKVLRLPALGVIPSIE-------------------------------------
A0A2V8NC68      VRTVEDIERTLRLPSLAVIPAIG-------------------------------------
A0A399WK13      VRSTEEVESLLQLPALAAIPTID-------------------------------------
A0A352FLX4      VRSMEDVENLLRLPAIALIPQVG-------------------------------------
A0A2V8RTL7      INTTEEVENLLQLPALTAIPTID-------------------------------------
A0A3E0PCJ6      IKTTEEAETYLQLPALAAIPTVE-------------------------------------
A0A3M1S4R8      IKTAEDVENYLGLPVLVVIPSMN-------------------------------------
A0A7C2G442      IKTAEDVENYLGLPVLVVIPSMN-------------------------------------
A0A1Q7YFI6      LHSAAEVDEMLRLPTLAVIPAVG-------------------------------------
A0A136KC10      VHSTEEVESLLHLPALAAIPTIQ-------------------------------------
A0A3M2D6Y5      VKTVEDVETYLGLPALAVIPTIG-------------------------------------
A0A2V8SEX6      IRSTEEIETYLQLPALAAIPTID-------------------------------------
A0A7C5ZUU4      ISSTEEIETYLQLPALAAIPMME-------------------------------------
A0A0B6WWQ6      LQSAEEVERELHLPALAAIPTVS-------------------------------------
A0A3B9MK99      LRSSEEVERLLQLPALGVIPSAN-------------------------------------
A0A352EX26      VHSTDEVERLLHLPALAVIPSAN-------------------------------------
A0A2V8MM59      VHSTDDVERLLGLPALAVIPSMS-------------------------------------
A0A2V8PFE8      IHSTDDVEKFLRLPALAVIPSMS-------------------------------------
A0A2V8PWS6      IHSTDDVEKFLRLPALAVIPSMS-------------------------------------
A0A2V8LCT5      VHSTEDVEKFLRLPALAVIPAMG-------------------------------------
A0A352FTJ9      VHSTDDVERFLRLPALAVIPAMS-------------------------------------
A0A257VBK0      VKSVEDLETRMGVALLTMVPKFE-------------------------------------
A0A2G6PYV5      IHNTEVLEMVTVLPTLATIPKVS-------------------------------------
A0A2V8F956      IKTPDEVTAHLQLPHLGLLPALN-------------------------------------
A0A1F2S1W5      IKNPDEMKKHLGLPFLGMVPALF-------------------------------------
A0A1F2T595      IKNPDELKKLLGLPFLGMIPALS-------------------------------------
A0A2V8JQV5      IHAPAEAPVYLNVPELGVVLSAE-------------------------------------
A0A2V9AC41      IKSPEEAERFIQLPTLGVVPDFA-------------------------------------
A0A2V9MAM9      SREPGDVEARLNLVELGAIPSAR-------------------------------------
A0A348V070      VKSSRDIAQATGWPTIGTIPAFE------------------------------KEFKPRG
A0A2V9M454      IKNAQEIEKLTSLPTLSIVPLSH-------------------------------------
A0A2V9IVR7      IKSIGQVERYLSTNALAVIPLAR-------------------------------------
A0A2V9ILE2      IKSIGQVERYLSTNALAVIPLAR-------------------------------------
A0A2V9LGY4      IKSIGQVERYLSTNALAVIPLAR-------------------------------------
A0A2V9J4D6      VKTMEDVQRLVGLPSLGLIPLWA-------------------------------------
A0A2V9L9C5      VKTMEDVQRLVGLPSLGLIPLWA-------------------------------------
A0A2N9M9N1      VKTAEDIENQIAIPTLAVIPLGT-------------------------------------
A0A2V9JEC4      IRTPDDLEGSFSIRALTIVP--A-------------------------------------
A0A2V9LPQ3      IRTPDDVERLLGIPALAIIPSAS-------------------------------------
A0A2Z5G3A3      IQDLDELELMLGGVPIGILPAFD-------------------------------------
A0A2V7UGP8      IKSTSDVEKYVQLPTLGTIPMVV-------------------------------------
A0A239MKT6      LYTIEDFQAAWSAPVIGVVPHFV-------------------------------------
A0A3E0PCN7      VRADDNFELHEGVSVLGMVPGAD-------------------------------------
A0A2V8IYW3      LRTESQLLEALKIPVLAVLPVME-------------------------------------
G2LEI9          IKSVEDVDRLLNLPTLGLIPQVS-------------------------------------
A0A317J121      VRTPGHSRTLLNVPELGVIPSIE-------------------------------------
A0A2V7YW66      VKSPEEVERRLGLPPLAVIHDVT----------------------------------EMG
A0A2V7Z0V0      VKAPEEIERKLGLPTLAVIQDLS----------------------------------ESG
A0A2V8GFD4      LKTPDDIKVQLGLPFLGLVPQLR-------------------------------------
A0A2V8HSS5      LKTPDDIKVQLGLPFLGLVPQLR-------------------------------------
A0A2V8KP55      IKSPDDVTRHLGLLALGTVPRLH--------------------------NLSLWRGYKYK
A0A399WNU1      IRVPVASQAQLGAPIVGMIPQSN-------------------------------------
A0A2V9JSI3      VKSVEDIERLTGMPTLAVIPLAA-------------------------------------
A0A2V9WI32      VRTPEEAQIISALPSLGIIPLST-------------------------------------
A0A2V8IVN9      IKTPDEIRAHLGMPALGMLPAVQ-------------------------------------
A0A7C5Z4J3      IKTAEDIERSIAEPVLSVIPSAG-------------------------------------
A0A1F2TPT3      IKLPEEIGQRLGLPVLGFLPEIK-------------------------------------
A0A2V8JTQ2      INTVEQAQSLSSLPALGVLPLLE-------------------------------------
A0A2V8UZY0      IITLEQARLLSPLPALGVLPLLK-------------------------------------
A0A350UEK1      LREPSDIPFYLGARELGVVPSAG-------------------------------------
A0A350UIQ4      LREPSDVPFYLGVRELGVVPSAS-------------------------------------
A0A1H5Z7N3      LRDVMEIERITGLPSLAVIPKTR-------------------------------------
A0A1G7JVV8      IRSVSEVEHITQLPSLSIIPRVR-------------------------------------
A0A1H4T6W9      IRSVAEVEQITQLPSLSVIPRVR-------------------------------------
I3ZEU5          IRSVAEVEQITQLPSLAVIPKVR-------------------------------------
A0A1I6MH75      LRSIAEIESVIELPSLAIIPKAR-------------------------------------
E8WVF6          LRSVAEIEAITELPSLSIIPRAR-------------------------------------
A0A7D0PQC3      LRSIAEIEAITELPSLAIIPRSR-------------------------------------
A0A428MDU2      LRSVAEIESITELPSLAVIPRSR-------------------------------------
A0A5B9EBI2      LRTIAEVEGITELPALAIIPRSR-------------------------------------
A0A239HDF6      IRSVTELEAITEMPSLAVIPRLR-------------------------------------
A0A4Q0T270      LRSIAEIESVIELPSLAVIPKAR-------------------------------------
A0A1Q3QQB6      LSSVAEIESLIELPSLAVIPKAR-------------------------------------
A0A3N1K1G7      LRSIAEIESITELPSLAIIPRAR-------------------------------------
A0A4V2G466      LRSVAEVESIIELPSLAIIPRFR-------------------------------------
A0A6B9YNQ8      LQSVADVEAFLELPSLAIIPRFK-------------------------------------
A0A3N5YNR8      LKTPEDMEQSLGLPSLGVIPAMA-------------------------------------
A0A3N6A5T6      IKTPDDIEKTLDLPSLGVIPAFK-------------------------------------
A0A1F2Q9L4      VKTAEDVDRILSLPVLAVIPDVA-------------------------------------
A0A2U3KC61      IRNMEELSAISTLPALGTIPL---------------------------------------
A0A2V9Y2R7      VRNMEQVSAISTLPALGMIPL---------------------------------------
A0A2V9NGH6      VRTPEQAQAISGLPSLGIIPDGS-------------------------------------
A0A2V9PYE6      VRTPEQAQAISGLPSLGIIPDGS-------------------------------------
A0A2V9NL07      VRTPEQAQLISGLPSLGMIPLGS-------------------------------------
A0A2V9QD92      VRTPEQAQLISGLPSLGMIPLGS-------------------------------------
A0A2V9WPZ6      VRTPEQAQIISSLPSLGS-RTGV-------------------------------------
A0A2V9ZLH4      VRTPEQAQMISALPALGMIPLGS-------------------------------------
A0A2V9RQF1      VRTPEQAEAISGLPSLGMIPLGS-------------------------------------
A0A2V9YDK8      VRTPEQAQIISGLPSLGMIPQGS-------------------------------------
A0A2V9V8F7      VRTPEQAQLISSLPSLGMIPQGS-------------------------------------
A0A2V9XGR9      VRTPEQAQIISSLPSLGMIPQGS-------------------------------------
A0A2V9V3Q5      VRTTEQAQMISALPSLGMIPLGS-------------------------------------
A0A2V9NWS3      VRTPEQAQAISALPSLGIIPMGS-------------------------------------
A0A2V9USA9      VRTTEQAQTISGLAPLGMIPLGS-------------------------------------
A0A2V9XW18      VRTTEQAQMIAGVASLGMIPLGS-------------------------------------
A0A1H5SQF5      LSTPEEVASLTSLPLLGLVPQAG-------------------------------------
A0A2V9AEW6      ISAPGEAQIYLDLPELGVIPLDD-------------------------------------
A0A2V8WQK6      ISAPGDAQVYLDLPELGVLPLDQ-------------------------------------
A0A2V8XIF4      ITAPGDAQAYLDLPELGVIPFDQ-------------------------------------
A0A2V2R0I6      VKSPDDVENLARLPSLAVVPHFT-----------------------------------GS
A0A2V8XAR9      VKSPDDVETLARLPSLAVVPQFA-----------------------------------SS
A0A2V8VZA0      VKSPDDVETLSGLPSLAVVPQFA-----------------------------------GS
A0A1Q7CB82      VKSPDDVETLSGLPSLAVVPQFA-----------------------------------GS
A0A2V8WIU1      VKSPDDVETLSGLPSLAVVPQFA-----------------------------------GS
A0A1Q6Y9F5      VKSPDDVETLSRLPSLAVVPQFA-----------------------------------SS
A0A2V9EVV8      VKSPDDVETLSRLPSLAVVPQFA-----------------------------------SS
A0A2V8YF91      VKSPDDIEALARLPSLAVVPQFS-----------------------------------GS
A0A2V8XZK2      VKTPDDIESLARLPSLAVVPQFT-----------------------------------GL
A0A2V8ZTX6      VKTPDDIETLARLPSLAVVPQFA-----------------------------------GT
A0A2V9BT79      VKTPDDIETLARLPSLAVVPQFA-----------------------------------GS
A0A2V9YHT3      IRTPEQVQIVSALPSLGIVPMSI-----------------------------------SL
A0A7C2XNI7      VKTPDDIEHLARLPSLAVVPAFS-----------------------------------LV
A0A1Q8B793      VKTPDDVEMLARLPSLAVVPAFI-----------------------------------DT
A0A2V9BCA0      VKTPDDVEMLARLPSLAVVPAFI-----------------------------------DT
A0A2V9BWU9      VKTPGDIEMLTRLPSLAVVPAFV-----------------------------------TL
A0A2V9DKX2      VKTPGDIEMLTRLPSLAVVPAFV-----------------------------------TL
A0A7C2YQY3      VKVPEEVEQLIGLPALGVIPGVS-------------------------------------
A0A3E0NV31      VKSSDHITESIGLPVLGTVPSIG-------------------------------------
A0A3N5M5V0      LKTPEDMEQSLGLPSLGVIPAIS-------------------------------------
A0A3N5XQP8      VHSPEDV-LALHIPALGIVPKSQ-----------------------------------EL
A0A2Z5G7H4      IQTIEEIERDLELVPLGILPHLG-----------------------------------EP
A0A2V9L5B5      LKTPDEVERLLRLPSLGVLPRFT-------------------------------------
A0A2V9LK56      LKSPSQVESLLRLPSLGVILEFD-------------------------------------
A0A2V9L7I0      LKTPDEVERLLHLPSLGVLPRFT-------------------------------------
A0A522PPT0      LKTPDEVEFLLRLPSLGLIPSVH-------------------------------------
A0A7C5V1G5      LKTPDEVESLLRLPSLGMIPSVH-------------------------------------
A0A2V9KCS3      LQSPGDGPTYLNLPELGVIPSAK-----------------------------------AD
A0A372IT17      ITSLTEVERLTGAPLFSVIPLLE-------------------------------------
A0A4R1LC91      IQDVSELEGYIGGLPIGILPKYT-------------------------------------
A0A3M2BZG9      IKSPEELEKITGLPTLTVIPDVAERNRSYAARLRYGLGNGYGYGYGYGYGYGYGYGYYGA
A0A1Q7N5R7      VRYPDQVTNGMGLRILGALPHVK-----------------------------------NR
A0A2V9QB26      FRAPGEAQLWLNVPELQVIPTAV-----------------------------------EE
A0A2V9VYY4      VRSMEEVRAVSTLPALGTIPLQL-----------------------------------VT
A0A3E0PHB0      IKSSDDIGRSLGLPTLGLIPHQK-----------------------------------MM
A0A3M1SIV3      VRDVDDITRHLNLPTLALIPEAQ-----------------------------------EK
A0A3M2D491      VRTVDDVTKHLGLPTLAIIPEAT-----------------------------------AS
A0A353C9L6      VKTSEDIGRHVGLPTLALIPHYF-----------------------------------GS
A0A2V8RQV0      VRTSEDIGRHLGLPTLGLIPHHG-----------------------------------IA
A0A2V8SJH5      VKTSDDIGRHLGLPTLALIPHHF-----------------------------------GS
A0A357F267      VKESEDIGRHLGLPTLALIPHYF-----------------------------------GS
A0A7C5ZUA8      VKTSEDISRQLGLPTLALIPHY------------------------------------GS
A0A136JPP4      IRTSDDISRALGLPTLAMIPHH------------------------------------GI
A0A399WUJ8      VRTSDDVSRALGLPTLAMIPHH------------------------------------GI
A0A2V9KIE8      VKSPDEVEELVRLPSLAVLPSFA-----------------------------------LN
A0A352F549      VKDSRDIESGLRLPSLAVIPIAG-----------------------------------KS
A0A3B9MLP9      IKSPGDIESGLRLPSLAIIPIAG-----------------------------------RS
A0A3D5SQ87      IKSPGDIESGLRLPSLAIIPIAG-----------------------------------RS
A0A2V8NW86      LRAPGEAQLWLNVPELQVIPTAV-----------------------------------EE
A0A7C2GJ20      VKSAEDVDRLLGLPVLGLVPALE-----------------------------------SL
A0A7C4BTL5      LQEPGDAPFYLNVPELGVIPVAD-------------------------------------
A0A2V8ZHL8      IKSIEEAERVVNAPALAVVP----------------------------------------
A0A2V9B240      IKSIEEAERVVNAPALAVVP----------------------------------------
A0A2V9CBM2      VTGADDVERLCGLSVLALIPAVQ-----------------------------------PS
A0A2V8XN17      LKGDDDVERLLGLPSLALIPVVA-----------------------------------SA
A0A2V8WX45      LKGDDDVERLFGLPSLALIPVVP-----------------------------------PS
A0A1Q6YR79      LKGDDDVERLLGLPSLALIPVVP-----------------------------------AS
A0A1Q7VA32      LKGDDDVERLLGLPSLALIPVVP-----------------------------------AS
A0A2V9EY85      LKGDDDVERLLGLPSLALIPVVP-----------------------------------AS
A0A2V9H8K0      LKGDDDVERLFGLPSLALIPAVP-----------------------------------PS
A0A2V9FFE5      LKGDDDVERLFGLPSLALIPVVP-----------------------------------PS
A0A2V9GM43      LKGDDDVERLFGLPSLALIPVVP-----------------------------------PS
A0A2V9CYQ5      VRGADDVERLFGLSVLGLIPAVQ-----------------------------------PS
A0A2V9BWU8      LKGADDVERLFGLSALALIPSVH-----------------------------------CL
A0A2V8ZG48      LKGADDVERLFGLPALALIPAVH-----------------------------------HL
A0A2V8Y334      LKGADDVERLFGLPALALIPSVH-----------------------------------HL
A0A2V9AY68      LKGADDVERLFGLSALALIPSVH-----------------------------------QL
A0A1F2RFI7      LKTPEDVQRFLHLPTLGIIPAAS-----------------------------------A-
A0A1F2RZS3      LKTPEDVQRYLRLPTLGVIPAAN-----------------------------------A-
A0A1F2USE2      LKTPEDVERFLHIPALALIPSVE-----------------------------------SL
A0A7C2VB08      IKSSEEIERYLQIPTLAFIPAED-----------------------------------SL
A0A2V9C238      LKTSEDVERFLGLPALALIPAVE-----------------------------------SL
A0A1F2Q9F5      LKTSEDVERFLHLPVLALIPSLE-----------------------------------SL
A0A1F2QQH9      LKTSEDVERFLHLPVLALIPSLE-----------------------------------SL
A0A1F2QXK7      LKTSEDVERFLHLPVLALIPSLE-----------------------------------SL
A0A2V9DEM9      LKTSEDVERFLGLPALALIPAVE-----------------------------------SL
A0A7C5TWV7      LRRPEEAERYLGLETLAAVPKFT-----------------------------------DE
A0A2V7XDY0      IKDPEEIERYLHIDLLAAVPQYD-----------------------------------EA
A0A2V8G155      IKTPEEIQTHLRLASLGLVPAVR-----------------------------------LK
A0A2V8HDM7      IKTPEEIQTHLRLASLGLVPAVR-----------------------------------LK
A0A2V8DRT9      IKSPAEIKAHLGLPFIGMIPKMA-----------------------------------VA
A0A2V7VYF3      IKSPDEITAHLRMPCLGLVPAAP-----------------------------------DK
A0A1F2SVH2      IKSPDEIKQHLGLPFLGMVPALF-----------------------------------DK
A0A2V8AJG9      IKTPDEVKAHLGLPFLGMVPALF-----------------------------------GD
A0A2N9LQU7      LRTSEEVEAASSIPALATIPL---------------------------------------
A0A2P6WFK7      LSNSEELETCLALPVLCTIP----------------------------------------
A0A2V8U914      LRAPGEASFYLNLPELGTIP----------------------------------------
A0A2V7W309      IKTPEELERVTKFASLGVIPAAG-----------------------------------TI
A0A2W0BGU4      LKSPEEVEMLIATRALALIPMKR-----------------------------------LT
A0A2W0BVQ9      LKSPEEVEMLIATRALALIPMKR-----------------------------------LT
A0A2V9MN96      VGSLEELSAITALPMLGVIPLQL-----------------------------------AE
A0A2V7V2Z1      IKTPEDVRKQLAAPLLAVIPEIA-----------------------------------N-
A0A2V7X2F7      LKTPDDVRNHLGAPLLGVVPETG-----------------------------------QS
A0A2V7V2I1      IKTPEEVRLHLGVPLLGVIPEHG-----------------------------------QD
A0A2V7U3M2      IKTPEDVRKQLGAPLLAVIPEIS-----------------------------------V-
A0A2V7UHT0      IKTPEDVRKQLGAPLLAVIPEIG-----------------------------------S-
A0A2Z5FVL3      IADIHGLESLMGEAPFGILPSFA-----------------------------------AK
A0A2V9KBD6      IRTVEQVQLLSPLPVLGALPLLE-----------------------------------AN
A0A2W0AJ66      ISTLEQAQILSPLPALGVVPLLE-----------------------------------G-
A0A1Q7RBU1      ISTLEQALALSPLPSLGVVPLLE-----------------------------------AK
A0A2V9JPV9      ISTLEQAIALSPLPSLGVVPLLE-----------------------------------AK
A0A3P0X3W6      VRDPEQARRSLQVEVLGILPDVL-----------------------------------QL
A0A2N9MK30      IRNTEQVARIVKAEVIGGLPQVK-----------------------------------SW
A0A3D1ASD2      LKDPEQIARTLKTQVIGTLPSMK-----------------------------------SW
A0A7C5AXI3      LRDPEQVARVLRTEVVGTLPVVK-----------------------------------PW
A0A7C6E4H7      VRDPEQVARTLNTEVVGSLPMVK-----------------------------------SW
A0A1F2TCR2      VKTPEDITKVLGLPLLGLVPAIR-----------------------------------GE
A0A350UQT3      IRDPEQVSRTLKTHIIGTLPSVK-----------------------------------NT
A0A7C3HRX0      IRDPEQVTQTLRTHIAGTLPAAR-----------------------------------NA
A0A1F2V330      FGNIVEFQTFTNLPAIAVLPSMS-----------------------------------AD
A0A662EE63      LRTPDQVERYLGLEVLAALPKLT-----------------------------------DD
A0A2V8TLH7      VRTSEDVERYLKLNILAVVPRDN-----------------------------------DA
A0A1Q7ZJT1      VRTSDDVEQYLRLNLLAIVPKEA-----------------------------------DG
A0A2V8VC99      VRTSEDVEQYLRLNLLAIIPKQS-----------------------------------DE
A0A348UZU3      VKSAEDVERYSGWPTLGVVPIFD-----------------------------------QD
Q01XL7          FESPGHTRTILGVPELGVIPSAT-----------------------------------ID
A0A2V8ERZ5      IKTPEDVTRRLKLPFLGLVPVVR-----------------------------------GD
A0A2V8GTX0      VKTPEDVTWRLHLNFLGLVPKVH-----------------------------------GE
A0A2V8J0X9      VKTPEDITKRLRLPLLGLVPAVR-----------------------------------GE
A0A523DUV7      LKEQEDIERHLRVDCLAIVPEHD-----------------------------------AA
A0A372IRG7      LRTSDDAEAVSLLPALAVIPHFQ-----------------------------------PF
A0A1F2U158      IKTPEDVTRMLKMTFLGLIPSVR-----------------------------------GD
A0A2V8F6S9      IKTPEDVTRRLKLPFLGLVPSVR-----------------------------------GD
A0A7D8BEX2      FETLEEIEQGLHLPGLCLLPLET-----------------------------------DE
A0A4Q1SCH5      IQSISQVESNVGLANLATVPHMD-----------------------------------WE
A0A2V8K4L4      IQQPGDSSLYLGISELGVIPSDR-----------------------------------PT
A0A2V8NCZ3      IQQPGDSALYLGVSELGVIPSDR-----------------------------------QG
A0A4Q7YNP3      LRVPGEVERYLNLNELGVIPSSR-----------------------------------YE
E8UZE1          IRTGEDIYRYSGLPLLSIVPHLS-----------------------------------PA
A0A2U3JZ71      VRDPEQVARTLSTEVIGTLPSVK-----------------------------------EW
A0A2V8TTB0      IRDPDQVARLMNTNVVGSLPTVK-----------------------------------DW
A0A1V6HR88      LKSSEEVERLFGVPVLAVIPDVG-----------------------------------AG
A0A3E0P0A3      IKSPEELERRLGLPVLGVVPDLN-----------------------------------RR
A0A2V8EXP2      IKTPDEIKAHLGLPFLGLVPALF-----------------------------------AK
A0A2W4RYA1      LRTPEEMQAVLGLTSLAMLPSVP-----------------------------------AS
G8P0Y7          VRTPEQAETTSGLPVLGVIPMQP-----------------------------------VF
A0A5M8T4U7      MQTSEEVESVSTLASLATIPHME-----------------------------------DG
A0A7D0PPG7      LRDPDQARRALGTEIIGVLPHVH-----------------------------------TF
A0A7D8BF18      LRTVSEVESVSGLPSLALIPRTR-----------------------------------RG
A0A1E3Y9R6      IKLPEEIKTHLNLPFLGMIPVFP-----------------------------------DA
A0A2W4TLP2      IKLPEEIKTHLGLPFLGMIPTFP-----------------------------------GG
A0A7C4BZ42      LQQPGDLTLYLNLPELGVIPSGK-----------------------------------TA
A0A3R9WF43      IRTPLDIEAASHLSILAYIPTKS-----------------------------------RA
A0A317HKM4      VTSVEDVKRHLRIPVLGLMPQVP-----------------------------------SK
A0A2V9CG11      IQSPGDAHVYLNISELGVITSAE-----------------------------------IK
A0A523E0N1      IHTVDDVKQHVPLPYLGMIPRYG-----------------------------------TD
A0A523ECP2      IYTIEDLRRHVPLPYMGMVPRLD-----------------------------------SD
A0A2W0C122      LRDPADVESFTAMPSLAIIPQHR-----------------------------------GS
A0A2W0AUU7      LRDPAEVESFTAMPSLAIIPQHH-----------------------------------PS
A0A2W0BQL1      LRDPAEVESFTAMPSLAIIPQHH-----------------------------------PS
A0A4Q1SDL1      IQTVEQLDRL-GVPLVAILPRYS-----------------------------------KE
A0A3P0XH15      IRTSDDAESVVGLPSLAVIPHFE-----------------------------------PA
A0A4R1LAZ7      IQTSEDAETVSGLTTLAVIPHFR-----------------------------------GA
A0A3M1WQW8      VKSTEDVDRLLGLPSLGVVPALE-----------------------------------SL
A0A3N1JHC1      VRNPGESEQYVERPELAVIPRDR-----------------------------------LI
C1F294          LRTSEEVESIGHLPALAIVPRFV-----------------------------------SG
A0A2V9KA79      FENAEQFQSFFDFPVLCIIPSMN-----------------------------------LH
A0A522PSP1      LRDPRAVPSELGAGLLGSLPELQ-----------------------------------ND
G8P085          LQSVDQIERALGYQLLAIIPHIS-----------------------------------IA
A0A7C6A629      IRDPEQVARTLNTEVVGSLPMVK-----------------------------------SW
A0A4Q1SGQ1      VRSLEQLEEEVGSPLLGILPEFS-----------------------------------RR
Q1ILD9          LKTPDDVELITSLPVIGVIPNTA-----------------------------------VG
A0A7C5SHM3      IRGGAHLAELTGLPLLGSIPRLA-----------------------------------TP
Q1IJZ6          VATTTDAEELTGIAVLGVIPIVN-----------------------------------EN
A0A2V8TCE6      LRTQEEIERFLGTPTLARIPSAS-----------------------------------LD
A0A522TBE8      VASAEQVELLFRVPVLGLLPLLE-----------------------------------SE
Q1ITG0          ISSPEDAEEMAGISTIGLIPHFS-----------------------------------ME
A0A7C2ML20      VKTVEDVESFVRLPNLGVIPLTK-----------------------------------TD
A0A7C5AXS9      IQAPGEVSLWLDAPELGVIPCAH-----------------------------------RH
A0A7C2RGE3      VKSTEDVDRLLGLPVLGLVPALE-----------------------------------SL
A0A3N5PCI5      LQTPSAVRAL-GIPFLGMLPYVG-----------------------------------KR
A0A3M1Q0S9      IKTPDDVRDVLQLPVLGMIPAQE-----------------------------------PA
A0A2Z5G448      IRTSEDAEAISSLPSLAVVPRFT-----------------------------------TA
A0A3M1VZ38      IKSPDDVRDILDLPLLGMVPA---------------------------------------
A0A4Q1SD29      VRTSDDAEQIAHLPTLAVIPRF--------------------------------------
A0A6N9FGE2      IRTPDDMRTHLKAPYLGMIPQS------------------------------------EV
A0A3M1PY35      VRSVEQLGELGGLPVLGSVPHV------------------------------------EG
A0A3M1VMP2      LRTASQMREITGLPLLGSIPRA------------------------------------SA
                                                                            

A0A2V7VMF7      ------------------------------------------------------------
A0A2V7YYV7      ------------------------------------------------AGKGNRGELITL
A0A2V7Z0J5      ------------------------------------------------AGKGKRGELVTL
A0A2V7Z3M4      ------------------------------------------------AGKGKRGELVAL
A0A399Y5V2      -----------------------------------------------QSWNDRRSAMLLS
Q01X01          -------------------------------------KRKFAVLGFLSESNGKSQVERAS
A0A3M2D9H8      -------------------------------------GKLPREDYPPHVVA---------
A0A2V8JK38      ---------------NLSLWRGYKYKYGYGYGFRFGRKKEQNEPANAEKSDNRSIELAPH
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ---------------SWP--ASKLLPSR---------KLFLQ--PRNGNKNGRPLIMY-D
A0A321LPW6      ---------------A----GKRGLGPKRRA------YALAAAGPAARALLASQAEIVEC
A0A2V9R9V4      ---------------A----NKSLLNGRRRKDNTPELLALGSGDKASAIMQRA--RLMEF
A0A321LE75      ---------------S----SRPKLLTAKGQGA----LGANGSAPAAAGLQRAASTLATL
A0A2V8R8U7      ---------------S----EKRLRGAE---------PL--------KPSDTTALAMV-T
A0A2V8QMP4      ---------------E----SRRLLARS---------GHEA------EPATTTALALI-E
A0A2V8R4S3      ---------------E----SRRLLARG---------SHEP------EAGTTTALALI-E
A0A2V8NJ55      ---------------S----ERSLLKSK---------NPPPN-----TGKESTALALI-E
A0A2V8Q7I0      ---------------G----DRGRLKGV---------VPATA----GGPSETTALAMI-D
A0A2V8S6K4      ---------------E----ARRLAFGR---------TAHVH-----DHTESTALALI-E
A0A317I2L9      ---------------S----IGGRLKGM---------TSANV-----GPSESTALAMV-D
A0A2V8LLF9      ---------------N----EKTKL--I---------AGDAA-----APAATTALTMV-N
A0A352FRF4      ---------------N----DRTRLRGG---------EAALA-----GPNDTTALAMV-K
A0A2V8MKV0      ---------------S----EKRL---R---------EGEAP-----TAGASTALAMV-E
A0A2V8PYY8      ---------------S----EKRL---R---------EGDAP-----AAGASTALAMV-E
A0A1Q7YKQ8      ---------------S----EQRL-RLK---------GGAQA-----EHGESTALALV-A
A0A352F3R7      ---------------E----RGRLIG-T---------GPSPE-----GPSDTTALALV-H
A0A0B6WXT1      ---------------T----ERLLLKGK---------ASEPE-----GVAEKTALALI-S
A0A3B9MEU8      ---------------D----RGRLIGIS---------GGPPS-----APSDTTALAMI-T
A0A2V8MHG6      ---------------NS---ARRRLLSA---------MPGSKRNGHQ---GGPELLLY-G
A0A2V8P7N1      ---------------NS---ARRRLLSA---------MPGSKRNGHQ---GGPELLLN-G
A0A2V8M3M6      ---------------NS---ARRRLLSA---------MPGSKRNGHQ---GGPELLLN-G
A0A1Q7NJH5      ---------------NS---ARRRLLSA---------MPGSKRNGHQ---VGPELLLN-S
A0A2V8PJY0      ---------------NS---ARRRLLSA---------MPGSKRNGHQ---VGPELLLN-S
A0A1Q7Y6W9      ---------------GK---TRRKLLPS---------VGSLQIRNGKGGINQPELIFS-T
A0A2V8NC68      ---------------SL---SKRRLLRN---------VSALQKRNGN---HPAELLLSHT
A0A399WK13      ---------------SM---PKRRLQLV---------AENGE---PADDNLGSELLIH-A
A0A352FLX4      ---------------TVK--PKRNLAAS---------GKKGALVSSNGSGSGEVLLTN-I
A0A2V8RTL7      ---------------SI---PKRKLLLV---------GGKGE--EVEEDRLNSELLIF-A
A0A3E0PCJ6      ---------------AS---SKRRLLLV---------GVNES--E-EP-EPGNALLIS-N
A0A3M1S4R8      ---------------AA---QKRRLLLV---------GSSDN--E-PAFKNRSELLIY-D
A0A7C2G442      ---------------AA---QKRRLLLV---------GSNDD--E-SASKNRSELLIY-D
A0A1Q7YFI6      ---------------NA---SRRFLPKM---------TALQK--SDNGDHGS---LLE-P
A0A136KC10      ---------------SM---PKRRLQLV---------GEGGE--T-PEDRPGSELLIH-A
A0A3M2D6Y5      ---------------VS---QRRKLLPV---------GTGEE--NGSQGKAGSEILIY-N
A0A2V8SEX6      ---------------SI---PKRRLLLV---------GASNE--EVEDPGNNSELLIS-A
A0A7C5ZUU4      ---------------SA---PKRKLLLV---------GSGNS--EESEERQRSELLIY-A
A0A0B6WWQ6      --------------------SRRSLSKA---------VALQT-----DGTAHPELLVG-D
A0A3B9MK99      ---------------ASA--RRRLIGAS---------GALQK--RNGH-SDSPELLMN-V
A0A352EX26      ---------------GMG--RRKLLGGP---------GALQK--RNGH-SGNHELLMN-V
A0A2V8MM59      ---------------GGST-RRRLLSPG---------TSLQK--RNGNGTGSPELLLH-V
A0A2V8PFE8      ---------------GGVARRRRLLSSA---------TALQK--RNGNTSGTPELLLN-V
A0A2V8PWS6      ---------------GGVA-RRRLLSSA---------TALQK--RNGNPGGNPELLLN-V
A0A2V8LCT5      ---------------AASA-PRRLLSSA---------TALQK--RNGNNGGNPELLLN-I
A0A352FTJ9      ---------------SASA-PRRLLSSA---------ASLQK--RNGSNGSNPELLLN-I
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      -----------------GFNKGKITKNK---------VKQKAMATKLRQEIGLLTHL---
A0A2V8F956      ------------------------------------------------EKQFANTYPLIS
A0A1F2S1W5      ------------------------------------------------DKGAHTPLIGR-
A0A1F2T595      ------------------------------------------------GNRASPPLISE-
A0A2V8JQV5      --------ADSSLGVPPESSPVRSLRNA---------IEFGKRIAGSDRSTPYGKDRPKP
A0A2V9AC41      ------------------LLTGTRTGYV---------SKLVNSAKAELPAPTRDEDRPSV
A0A2V9MAM9      ----------------------------------------SVVGASPGRSLRSDSHNATE
A0A348V070      PRAEFRTLSGLLKGRPGILDKKKKKKHD---------TPRPKSVSLKTEEGAPENDKNNH
A0A2V9M454      ------------------SSVLRRPGLF---------HSKAANGANGDGGYAVELAVLK-
A0A2V9IVR7      ------------------TVRSR----S---------LDRGGNGSADRRE-AVELTLLK-
A0A2V9ILE2      ------------------TVRSR----S---------LDRGGNGSADRRE-AVELTLLK-
A0A2V9LGY4      ------------------TVRSR----S---------LDRGGNGSADRRE-AVELTLLK-
A0A2V9J4D6      ------------------PNHNGRQYGL---------RRKKNSELPASNG-QTGLAALE-
A0A2V9L9C5      ------------------PNHNGRQYGL---------RRKKNSELPASNG-QTGLAALE-
A0A2N9M9N1      ------------------RSRGRYG--R---------YFARGALKPPGNG-SPGLAIMN-
A0A2V9JEC4      ------------------VFSSRLPYSR---------LPRLRSKHPLPPS-RIELAVLE-
A0A2V9LPQ3      ------------------LLIRRYGSSK---------RGGAQGEAQKRSE-SVAVMMLT-
A0A2Z5G3A3      ----------------------RPATFL---------RLTSSSGLDRIDAVDPVTRNVIA
A0A2V7UGP8      ---------------------------------------SSALAGESAGGRRLRREPVSP
A0A239MKT6      ------------------------------------------------ENGQSKNVPASP
A0A3E0PCN7      ----------------------------------------RRLGNGFVGSLIRKTQTKLV
A0A2V8IYW3      -----------------SIDEKRRRMLR---------LAFTFTGGFLLVAARITETGVLM
G2LEI9          ------------------PKELSKSSGY---------YSYGGETRALAKLADGRPLPADF
A0A317J121      -------------------PRGSRPAWR---------LLLGRESRNAGEMVGSEVSLDTR
A0A2V7YW66      KAYGYAGGYGYGYGYGEPGAGDKPRPVR---------PARSAAEKRGDRKERKERKRAAA
A0A2V7Z0V0      KAYGYS-----AYGYGETAADDKPR-AR---------PGKAPAGGW-----REKKKAPAA
A0A2V8GFD4      ------------------------------------------------RREFAKPSPMIN
A0A2V8HSS5      ------------------------------------------------RREFAKPSPMIN
A0A2V8KP55      YGYGYGFRFGRKKEQNEPANAEKSDNRS---------IELAPHD----------------
A0A399WNU1      -----GHRRSNHFLAKFNRHRNGDGDPD---------PAESRSAYADS------------
A0A2V9JSI3      ---------------------------------------SDRARRAWRKGAGEKAASSTT
A0A2V9WI32      ---------------KQIARDRKNGHPR---------LSLGSRSSESADSLQLITFA---
A0A2V8IVN9      --------------------------------------------EKEFGGSYPMVGA---
A0A7C5Z4J3      ----------------------------------------VVGRSSLWSVGGRNLAAGRG
A0A1F2TPT3      ------------------------------------------------LKSGVTGPLATN
A0A2V8JTQ2      ------------------------------------------AKSQNGAHRELAGGSGHV
A0A2V8UZY0      ------------------------------------------TMSRNGAARQLTGVGGDV
A0A350UEK1      -----------------RVEDGKKHRLL---------TGRSKKADAETQSLTLATNGLSE
A0A350UIQ4      -----------------LLEEKKGRKLL----------------GEESQSLVLTNVGLGE
A0A1H5Z7N3      ------------------------------------------------RTSAEQNAT-GL
A0A1G7JVV8      ------------------------------------------------RMQSDGSGSATV
A0A1H4T6W9      ------------------------------------------------RLSSD-TGTMSV
I3ZEU5          ------------------------------------------------RLSSD-TGSMSV
A0A1I6MH75      ------------------------------------------------RTAAEQVGSLTT
E8WVF6          ------------------------------------------------RATPEQLAAMST
A0A7D0PQC3      ------------------------------------------------RSTAEQLAGMTT
A0A428MDU2      ------------------------------------------------RAGVSEAAM-ST
A0A5B9EBI2      ------------------------------------------------RTVSELPAGMSV
A0A239HDF6      ------------------------------------------------KPAGAAVPDTSP
A0A4Q0T270      ------------------------------------------------RTAADQAANLSV
A0A1Q3QQB6      ------------------------------------------------RLSVEQSSTLTP
A0A3N1K1G7      ------------------------------------------------RSSAEQAGNLTT
A0A4V2G466      ------------------------------------------------RSTAEVPGQ-ST
A0A6B9YNQ8      ------------------------------------------------RSAEAAGQG-GT
A0A3N5YNR8      --------------------DLPAGSSR---------LLASRNESGDSKTGLPAPIS---
A0A3N6A5T6      ------------------MFETPVGTRL---------LTAASTQSTDASVDAVLQGSQ--
A0A1F2Q9L4      -----RSRNGYGYGGSYGYGYGQRRGKG---------QPGRPTLAGQRPGGDSGAGQIEL
A0A2U3KC61      -----------------QLSSNGYLRKR---------LKTVSAETEKPESPALVAYA---
A0A2V9Y2R7      -----------------QVSGNGNLRKR---------LKTVPAADGELQSPTLVTYA---
A0A2V9NGH6      -----------------KLSIESSARRR---------LSLTSSR----EAIELVTQS---
A0A2V9PYE6      -----------------KLSIESSARRR---------LSLTSSR----EAIELVTQS---
A0A2V9NL07      -----------------RTAAEANP-TG---------LSVAASK----EAVELITIS---
A0A2V9QD92      -----------------RTAAEANP-TG---------LSVAASK----EAVELITIS---
A0A2V9WPZ6      -----------------EGKNEN----R---------LIVASSK----ESVELVTKS---
A0A2V9ZLH4      -----------------KRPNEDGS-RR---------LAVAASK----ESVELVTQS---
A0A2V9RQF1      -----------------KSSSDSKS-KR---------LSLASSR----EVVELVTQS---
A0A2V9YDK8      -----------------KS-IEASNQKR---------LTVASSK----EAVELVTQA---
A0A2V9V8F7      -----------------RTGVEGKNENR---------LIVASSK----ESVELVTKS---
A0A2V9XGR9      -----------------RTGVEGKNENR---------LIVASSK----ESVELVTKS---
A0A2V9V3Q5      -----------------KSRNNGTGIGR---------LTLTSSR----EVVELVTQV---
A0A2V9NWS3      -----------------KAPTESNGRQR---------LSLASSK----EPVELVTQS---
A0A2V9USA9      -----------------KGIREGSTGKR---------LALAASN----EAVELITQV---
A0A2V9XW18      -----------------KSAREGPNPKR---------LVIASSK----EAVELVTQV---
A0A1H5SQF5      ------------------KRRRWAYAYP---------YAPTKKA----DAAAESEGKFAW
A0A2V9AEW6      ------------TAVSRHGANLLNMRRL---------TPSVPSG----VESDSS-DKSPE
A0A2V8WQK6      ------------AAVSWQIPNRLPPHRA---------ASSRPPE----SALRSSLGDCPE
A0A2V8XIF4      ------------GGLAGQIAGRLHSHRP---------TRTLTSD----TAPDSS-ANWPE
A0A2V2R0I6      N----GNGKRRALLQ--TVAANGHEKRI---------ELVAQH-----------------
A0A2V8XAR9      N----GSSKRQGLLQ--GFAANGQDKRI---------ELVAQH-----------------
A0A2V8VZA0      N----GNGKRHGLLQ--GLSSNGHDKRI---------ELVAQH-----------------
A0A1Q7CB82      N----GNGKRHGLLQ--GLSSNGHDKRI---------ELVAQH-----------------
A0A2V8WIU1      N----GNGKRHGLLQ--GLSSNGHDKRI---------ELVAQH-----------------
A0A1Q6Y9F5      N----GRSKRHGFFQ--GLSSNGHDARI---------ELVAQH-----------------
A0A2V9EVV8      N----GSSKRHGFFQ--GLSSNGHDARI---------ELVAQH-----------------
A0A2V8YF91      S----G-GNRRGFLP--SFSGNGHEKRM---------ELVAQH-----------------
A0A2V8XZK2      N----G-SKGRGVLP--GLSSNGHERRI---------ELVAQH-----------------
A0A2V8ZTX6      N----G-SKRRSMLQ--GFSENGHNKRI---------ELVAQH-----------------
A0A2V9BT79      N----G-HKRRGMLP--DFSQNGHDKRI---------ELVAQH-----------------
A0A2V9YHT3      SSQAQGRNGKGIVLR------PGKRERV---------EMIAHS-----------------
A0A7C2XNI7      N----GRARGVRMLK--SAEQEPSRASV---------ALVSHE-----------------
A0A1Q8B793      N----GRNGRRRFLRGLAAATNGREARV---------ELVSHH-----------------
A0A2V9BCA0      N----GRNGRRRFLRGLAAATNGREARV---------ELVSHH-----------------
A0A2V9BWU9      N----GRNRVPKMLK--SGSGNGTESRV---------ELVSHT-----------------
A0A2V9DKX2      N----GRNRVPKMLK--SGSGNGTESRV---------ELVSHT-----------------
A0A7C2YQY3      --------------------------------------SIPAGA----LRALPGVVPKPQ
A0A3E0NV31      ------KQEGNWLAAKLKLPRRKPSRTP---------PKLLEPK----GD----------
A0A3N5M5V0      --------------------DLPAGGSR---------LLAEKST----SGADKTELPARI
A0A3N5XQP8      T----NGANPLVLA----LPEQVQADHR---------SASDQDR----MGSALARSA---
A0A2Z5G7H4      N----WYRRP--------------------------------GG----PSLSRARSPSSG
A0A2V9L5B5      ------------------PNGAGE-VRQ---------DSLEAVE----PGVATALAPAI-
A0A2V9LK56      ------------------LFSARK--SG---------EARLTKG----SEAGGKSDIVI-
A0A2V9L7I0      ------------------LNGNGKVPEE---------EDSLAAV----PEVEMAVAPAI-
A0A522PPT0      ------------------LNGSSK-SLE---------HGITAIG----KGSNGLYGLAL-
A0A7C5V1G5      ------------------LNGSSK-SSE---------PGLVTPG----DSADGSYGLAL-
A0A2V9KCS3      R----GLNSYFKRLPALKGPKDSEQTLG---------SALVKKN----GRRNGNGNHEIE
A0A372IT17      --------------------------PS---------FHLPRLL----RGGGSSGVTAAA
A0A4R1LC91      ------------------QDDRKQLPSS---------LSKGLTG----PGSNFMALQ---
A0A3M2BZG9      E----GRKRR--------------------------------KL----KGASSDEPEPDR
A0A1Q7N5R7      K----AGPDD--------------------------------------------------
A0A2V9QB26      S----RRCLYTERCNKTTTLSLSRQQRD---------SGL--PK----RTSKQVDSPSVE
A0A2V9VYY4      D----ERFR---------------------------------KR----RLTISPDGERSG
A0A3E0PHB0      D----RGKKQKL------LT----------------------GG----SNGR------GP
A0A3M1SIV3      K----KVKSL---------------------------------------GSEING---NT
A0A3M2D491      K----KTKL---------LP----------------------AG----EKEQ------SS
A0A353C9L6      E----KRRLRLL------AA----------------------NG----NGNGGA----P-
A0A2V8RQV0      E----RRRL---------MA----------------------AG----NGAALS----PH
A0A2V8SJH5      E----KRRLKLIAANGNGLA----------------------NG----NGNGNS----AT
A0A357F267      E----KRKHR--------LA----------------------AA----NGSEA-----VA
A0A7C5ZUA8      A----DRRKL--------LT----------------------AG----DGE-------AL
A0A136JPP4      N----EKKRR--------SR----------------------RG----LGSETNAKA-AS
A0A399WUJ8      N----EKKRL--------SL----------------------RG----IAGESNGKSTAA
A0A2V9KIE8      D----GKGDASKQ-----LAKAAPGDRV---------VAPAIQT----TAVGK-------
A0A352F549      ------------------TQRFFPISRA---------LQRT-NG----NGASPELLI---
A0A3B9MLP9      ------------------AQRLLPITRA---------LQRT-NG----NGSGPELLI---
A0A3D5SQ87      ------------------AQRLLPITRA---------LQRT-NG----NGSGPELLI---
A0A2V8NW86      S----GRCLDTERCDK--TTTLLPSRQQ---------RDPGLPK----RTSEHADSLSVE
A0A7C2GJ20      E----RRRWSALPR----VHRAKEGERP---------ILI--------------------
A0A7C4BTL5      ------------------TGRHLLYYKR---------RKLPEET----KAVTKGDRR---
A0A2V8ZHL8      ------------------LEREIPHRPA---------LSRA-RN----NGNSKPSET---
A0A2V9B240      ------------------LERELPHRPA---------RSLT-RN----NGNSKSSGA---
A0A2V9CBM2      N----GDQHGGV------HYKLLEHAGA---------LSL--RE----NGGARKLVP---
A0A2V8XN17      N----GNHLG--------IHRFLPRDKS---------LVL--AG----NGSGKNSRS---
A0A2V8WX45      N----GDQHG--------IHRFLQQDKA---------LVL--KG----NGTGKDARS---
A0A1Q6YR79      N----GDHLG--------IHRFLPRDKS---------LSLAGNG----NGSGKDRRP---
A0A1Q7VA32      N----GDHLG--------IHRFLPRDKS---------LSLAGNG----NGSGKDRRP---
A0A2V9EY85      N----GDHLG--------IHRFLPRDRF---------LSLAGNG----NGPGKDPRP---
A0A2V9H8K0      N----GDLQG--------IHRFLPRDKA---------LIL--EG----NAAGKNSRS---
A0A2V9FFE5      D----SDQHG--------IHRFLPRDKA---------FEF--KG----NGAGKNSRS---
A0A2V9GM43      D----SDQHG--------IHRFLPRDKA---------FEF--KG----NVAGKNSHS---
A0A2V9CYQ5      N----GDQHS--------IHKLVEHPGS---------LSL--RE----NGCARKLVA---
A0A2V9BWU8      N----GDRPS--------VRKLLDRTLP---------LKS--AH----NGTASNPAA---
A0A2V8ZG48      N----GNGPS--------VRRLLDHSNL---------LRS--RQ----NGTASNPCA---
A0A2V8Y334      D----GDRHG--------VRKLLDRTNH---------PGN--GH----NGTASNPGA---
A0A2V9AY68      G----GNRNG--------VRKLLRRTNG---------LRH--GH----NGTASNPGV---
A0A1F2RFI7      N----GRAGLSYGYG---YGYGYGSRKS---------L----PE----DTSAPDGEK---
A0A1F2RZS3      A----SRKKLA-------YGYGYSSRQT---------L----AE----VTSEAANGK---
A0A1F2USE2      S----GRRGRAYGYGYGLYGQTRQLESG---------AEG--TT----EKGLARGGTPH-
A0A7C2VB08      V----GRRGAV-------YGRRPQISGS---------LLA--GR----RTQKPNGKPAPG
A0A2V9C238      N----GRRKGA----YRLYGGSKPLANG---------K----PQ----TSALPSTTP---
A0A1F2Q9F5      N----GRRRA--------YG--LPTPKR---------L----AS----RSVVPAAAP---
A0A1F2QQH9      N----GRRRA--------YG--LPTPKR---------L----AS----RSVLPAAAP---
A0A1F2QXK7      N----GRRRA--------YG--LPTPKR---------L----AS----RSVVPAAAP---
A0A2V9DEM9      N----GRRRGV----YRLYGGSKPLANG---------K----PR----TLALPSTTP---
A0A7C5TWV7      T-----------------------------------------------------------
A0A2V7XDY0      N-----------------------------------------------------------
A0A2V8G155      -------------------------------------------------GSMS--PSLYK
A0A2V8HDM7      -------------------------------------------------GSIS--PSLYK
A0A2V8DRT9      -------------------------------------------------DGES-APLLDK
A0A2V7VYF3      -------------------------------------------------YATGGAPLINN
A0A1F2SVH2      -------------------------------------------------ALEN--PLISD
A0A2V8AJG9      -------------------------------------------------DVKD--PLMNN
A0A2N9LQU7      -----------------------ITRRS---------LRKDMRGRNHQPGLGGLGTMAVQ
A0A2P6WFK7      ------------------------THQQ---------QPPATSNSREAPKAVPLAPILLG
A0A2V8U914      -----------------------SAESL---------EPALQKLIGTENGKQPVERITWD
A0A2V7W309      S------------RQYGYNYSYGRASGP---------QLRAVDAPPEEKPSPGIELLPHL
A0A2W0BGU4      -----------------------RAERL---------LATNRSINARENGTAILNVA--A
A0A2W0BVQ9      -----------------------RAERL---------LATNRSINARENGTALLNVA--A
A0A2V9MN96      -----------------------NGRRH---------LHPAGGSLITASTVDGPVAH--V
A0A2V7V2Z1      -----------------------PAE-V---------IIKS------------------G
A0A2V7X2F7      -----------------------PADLL---------IQKG------------------G
A0A2V7V2I1      -----------------------SGSPV---------LSNS------------------H
A0A2V7U3M2      -----------------------PGDIV---------IIQG------------------G
A0A2V7UHT0      -----------------------PTD-V---------VIKS------------------G
A0A2Z5FVL3      -----------------------KKGLR---------LSGHSFALPGREAIAAL-----K
A0A2V9KBD6      -----------------------SKNGA---------PANLPALSIYRNRALVSL----L
A0A2W0AJ66      -----------------------SANQS---------LVEGNVPQTASKPELVSF----L
A0A1Q7RBU1      -----------------------SKSRA---------RAQLNGVNGDLKPEMVSF----L
A0A2V9JPV9      -----------------------GKSRA---------PAQLNGVNGDLKPELVSV----L
A0A3P0X3W6      -----------------------KPAGR---------QLLLKSGSDVPAPVAGKQPLDWS
A0A2N9MK30      -----------------------K--SR---------PALVAAGGAASTPVLLRHPDD-D
A0A3D1ASD2      -----------------------R--AR---------LGPIAKGG-AKAELVPLGELG-D
A0A7C5AXI3      -----------------------R--GR---------LGPIPAAA-STTALVPTNGNR-D
A0A7C6E4H7      -----------------------R--RQ---------LPVLKPEG-DSKALVPA-GAG-E
A0A1F2TCR2      R-----------------------------------------------------VPLLSE
A0A350UQT3      R-------------------------EL---------MLPAKLLTAGETHVEDPSARPKD
A0A7C3HRX0      K-------------------------DL---------LLPAAAPTSGAPSLL-PVRLEAD
A0A1F2V330      L----------DPGVKPLTGTIPLIPPC---------GGDLSPTLLAFADLHRNHIVMVT
A0A662EE63      N-----------------------------------------------------------
A0A2V8TLH7      T-----------------------------------------------------------
A0A1Q7ZJT1      T-----------------------------------------------------------
A0A2V8VC99      T-----------------------------------------------------------
A0A348UZU3      A---------TLNGHYYAYRSAEDEDGK---------KKRKEEKGETENEPRSIELISHF
Q01XL7          R-------------PKKLAAAQRALNGA---------TSIHPLGTLVEDGQKTLEFATWQ
A0A2V8ERZ5      K----------------------------------------------------HPLLASS
A0A2V8GTX0      R----------------------------------------------------HPLLSGP
A0A2V8J0X9      R----------------------------------------------------VPVLTET
A0A523DUV7      N-----------------------------------------------------------
A0A372IRG7      S----------------------KKAIN---------AKDEAADRNGSLAKVSPDLLAYN
A0A1F2U158      K----------------------------------------------------HPVLASS
A0A2V8F6S9      K----------------------------------------------------HPLLASS
A0A7D8BEX2      D--------------------------------------------------QHLPFVSIT
A0A4Q1SCH5      N--------------------------------------KAADGTATKMGHGVRLIT-LR
A0A2V8K4L4      M-------------------LRRGQRPS---------ALIPSVSGNNSNAGNPVELVTWQ
A0A2V8NCZ3      ----------------------RGQGTA---------AVIPIGNGNTK---NPVELVTWQ
A0A4Q7YNP3      D----------------KAFPASRSDSI---------ITLQSGSSTIVRNADVLDMAGWS
E8UZE1          Q-------------------------RN---------MKLGKKEVAGTADSLGLEPRVLQ
A0A2U3JZ71      H-------------GRITAASEPGT-------------------------DLIPHDPSRG
A0A2V8TTB0      R-------------RRLSPISSSGSANG---------HRNGNGAIPAPPNGAVPAADNTD
A0A1V6HR88      GKGYGLRGRYGYGYGYGYGYGEKPAKAR---------ARKPGKGGGNGEPTQIELLP-HL
A0A3E0P0A3      G--------------------SSRRVYG---------ARAPAKRVDRGADLAIDLLP-HS
A0A2V8EXP2      D-------------------------------------------------LH--DPLISK
A0A2W4RYA1      S-------------------------------------------------LRSGDPLMTG
G8P0Y7          D--------------------KAGTNAA---------RSRLLNKMPGTGTGPQPLIS-YL
A0A5M8T4U7      P--------------------------L---------RRKRPELEDGGSSAQVRQLTALH
A0A7D0PPG7      G--------------------------P---------ITSRSELALVSSLPFRKSQTDWF
A0A7D8BF18      S------------------------------------------PEVSHLSLVYRSLVVLA
A0A1E3Y9R6      G-------------------------------------------------RDGEAPLLQP
A0A2W4TLP2      D-------------------------------------------------ESGEAPLLSA
A0A7C4BZ42      V--------------------TERLAGR---------GAAALLPGKGGEADKLELVT-WK
A0A3R9WF43      E---------------------------------------------TVTAGTVGECALIT
A0A317HKM4      N---------------------------------------------------GRVPLLVQ
A0A2V9CG11      H---SRQIA-------NHKQANPALAME---------AGSSELVLESHLDDRPELAA-WN
A0A523E0N1      SALKSIKSR-------LAPRSGNSRGPL---------ASGRDAKRSTYLPTIYDKRPALA
A0A523ECP2      TASRWDALA-------ASSMARDTDKHG---------KNMSQTRSALALSQSTKIASRAK
A0A2W0C122      P-----------------------------------------RLLTSKVGEAPQVLS-LT
A0A2W0AUU7      P-----------------------------------------RLLTPRVGEAPQIMC-LT
A0A2W0BQL1      P-----------------------------------------RLLTPRVGEVPQIMC-LT
A0A4Q1SDL1      K---------------------------------------------RALDGIQHVRT-LN
A0A3P0XH15      Q-------------------KKGVSAAG---------TAAAEAERERMARVSPDLIS-YT
A0A4R1LAZ7      S--------------------------K---------KSSAERDDGRPESLSPDLVA-YL
A0A3M1WQW8      E-----------------RKKRLALPRW---------SRERRTTKP-------ILIL-DD
A0A3N1JHC1      A---------------------KKSKAH---------PQMRLNGAGSKDVHPILEHW-KE
C1F294          A---------------KRKTAYGSYGAE---------KRPKEPVAEKEDQISRDLLT-LL
A0A2V9KA79      NLRRKVRSE-------EISPRAPARRHT---------GEQRVSIASVPDRPGKHSLT-SQ
A0A522PSP1      I---------------------EIKSLL---------TPASVRGND-------------E
G8P085          Q-------------------------------------RTDNKGDAPAFDASQMLVA-YN
A0A7C6A629      R------------------------------------RQLPTVKPSGDTKALVPAGH-TD
A0A4Q1SGQ1      L----------------KTRRRASWREI---------LMRRESVSTSPLFMSRTGIA-DQ
Q1ILD9          R------------------------------------SSNGRPGRTAVKQEAMGIDV-LT
A0A7C5SHM3      H---------------------KPRLAF---------SRKRSGTTP---------VM-AA
Q1IJZ6          P-----RVL-------RAAGRAKANGSN---------GSKPGRPTA------------MV
A0A2V8TCE6      P---------------------------------------QRRGGPAWGTGEIDLMS-HH
A0A522TBE8      N--------------------ELQLAGG---------GSEEDREAR--------------
Q1ITG0          G--------------------LNALATE---------NQSVLARVP---------LA-AD
A0A7C2ML20      E------------------------------------GRSLLPRKPELEGAPLLMMA-SE
A0A7C5AXS9      S-----GLL-------GYCRHRRGKEEG---------GKRPEGKTGLEV----ELAT-AN
A0A7C2RGE3      E--------------------RRPWSAL---------PRLPRRKEEER-----PILI-SQ
A0A3N5PCI5      A--------------------LKGR----------------------------SLLL-TH
A0A3M1Q0S9      T--------------------RRERRRS---------ASRGEQAAEIEDP---SLIS-AR
A0A2Z5G448      A--------------------KEARSTY---------GQQAKPITPADSQFPSDLVS-YL
A0A3M1VZ38      P--------------------RPVKKAH---------GEEPVRCDP-------AVIT-AE
A0A4Q1SD29      P--------------------IAARKGT---------DPQPQKVSP-------DLVS-LL
A0A6N9FGE2      E--------------------KGSTDDH---------GPPTRSRTP-------QLLL-GA
A0A3M1PY35      P--------------------PRPRLVF---------SRKRREGAS-------PVV---A
A0A3M1VMP2      P--------------------PRPRLVF---------SRKGRSRSR-------PVI---P
                                                                            

A0A2V7VMF7      -------------------------------------------------ADAEHLVTEAY
A0A2V7YYV7      -------------------------------------------------DAHSHA-SEAY
A0A2V7Z0J5      -------------------------------------------------DAQSHA-AEAY
A0A2V7Z3M4      -------------------------------------------------DAQSHA-SEAY
A0A399Y5V2      VK-----------------------------------------------DPASTT-AEAY
Q01X01          LE-----------------------------------------------QPASHV-SESF
A0A3M2D9H8      -------------------------------------------------QPRSPV-TEAF
A0A2V8JK38      -------------------------------------------------DEPSSVIAESY
A0A2V9IXG5      -------------------------------------------------DFGLHQIRESY
A0A2V9J2P4      -------------------------------------------------DFGLHQIRESY
A0A1Q7RLS4      -------------------------------------------------DGTHSAFKEAY
A0A2V2R525      -------------------------------------------------DAHSRL-AEVY
A0A321LPW6      -------------------------------------------------DSASSA-AEAY
A0A2V9R9V4      -------------------------------------------------DGRSPA-SEAY
A0A321LE75      -------------------------------------------------DTRSSA-AEAY
A0A2V8R8U7      -------------------------------------------------DVRSPI-AESY
A0A2V8QMP4      -------------------------------------------------DVRSPV-AEAY
A0A2V8R4S3      -------------------------------------------------DVRSPV-AEAY
A0A2V8NJ55      -------------------------------------------------DVRSPI-AEAY
A0A2V8Q7I0      -------------------------------------------------DVRSPI-AESY
A0A2V8S6K4      -------------------------------------------------EVRSPV-AEAY
A0A317I2L9      -------------------------------------------------DVRSPV-AESY
A0A2V8LLF9      -------------------------------------------------DVRSPI-AESY
A0A352FRF4      -------------------------------------------------DIRSPI-AESY
A0A2V8MKV0      -------------------------------------------------DVRSHV-AESY
A0A2V8PYY8      -------------------------------------------------DVRSHV-AESY
A0A1Q7YKQ8      -------------------------------------------------DARSSI-AEAY
A0A352F3R7      -------------------------------------------------DARSPI-AESY
A0A0B6WXT1      -------------------------------------------------DVRSPI-TEAY
A0A3B9MEU8      -------------------------------------------------DVRSPI-AEAY
A0A2V8MHG6      -------------------------------------------------SQRSAL-AESY
A0A2V8P7N1      -------------------------------------------------SQRSAL-AESY
A0A2V8M3M6      -------------------------------------------------SQRSAL-AESY
A0A1Q7NJH5      -------------------------------------------------SQRSAL-AESY
A0A2V8PJY0      -------------------------------------------------SQRSAL-AESY
A0A1Q7Y6W9      -------------------------------------------------DGRSSL-AEAY
A0A2V8NC68      -------------------------------------------------DGQSPL-AEAY
A0A399WK13      -------------------------------------------------DPRSSL-AEAY
A0A352FLX4      -------------------------------------------------EKRSPV-AEAY
A0A2V8RTL7      -------------------------------------------------DPRSSL-SESY
A0A3E0PCJ6      -------------------------------------------------DSRSST-AEAY
A0A3M1S4R8      -------------------------------------------------NSRSSSLSEAY
A0A7C2G442      -------------------------------------------------NSKSSSLSEAY
A0A1Q7YFI6      -------------------------------------------------DTRSPM-AEAY
A0A136KC10      -------------------------------------------------DPRSSL-AEAY
A0A3M2D6Y5      -------------------------------------------------SSNSSL-SEAY
A0A2V8SEX6      -------------------------------------------------DSRSAL-AEAY
A0A7C5ZUU4      -------------------------------------------------DSRSSL-AEAY
A0A0B6WWQ6      -------------------------------------------------GGESGL-AETY
A0A3B9MK99      -------------------------------------------------DGHSPL-AEAY
A0A352EX26      -------------------------------------------------DSRSPL-AESY
A0A2V8MM59      -------------------------------------------------TGRSPL-AESY
A0A2V8PFE8      -------------------------------------------------NGRSAL-AESY
A0A2V8PWS6      -------------------------------------------------NGRSAL-AESY
A0A2V8LCT5      -------------------------------------------------TGRSAL-AEAY
A0A352FTJ9      -------------------------------------------------NGRSAL-AEAY
A0A257VBK0      ------------------------------------------------PETQKVS-AEAF
A0A2G6PYV5      -------------------------------------------------KPNDAF-SESY
A0A2V8F956      K------------------------------------------------TAPPNF-SEAI
A0A1F2S1W5      -------------------------------------------------GVSALF-TESF
A0A1F2T595      -------------------------------------------------GVPGVF-SECF
A0A2V8JQV5      KIELMAWE-----------------------------------------KPFSLF-AECF
A0A2V9AC41      LDH----------------------------------------------HPLSLV-AEAY
A0A2V9MAM9      LTGWE--------------------------------------------NKFNAL-SESF
A0A348V070      QIELIIQR-----------------------------------------EPRCIQ-SEAF
A0A2V9M454      -------------------------------------------------KPGAAI-SEAF
A0A2V9IVR7      -------------------------------------------------RPASEL-AEAY
A0A2V9ILE2      -------------------------------------------------RPASEL-AEAY
A0A2V9LGY4      -------------------------------------------------RPASEL-AEAY
A0A2V9J4D6      -------------------------------------------------HPASSV-AESY
A0A2V9L9C5      -------------------------------------------------HPASSV-AESY
A0A2N9M9N1      -------------------------------------------------APGSEM-AESF
A0A2V9JEC4      -------------------------------------------------NSSLDV-AEAF
A0A2V9LPQ3      -------------------------------------------------EPASAV-AESY
A0A2Z5G3A3      LQ-----------------------------------------------QPNSGY-VEAL
A0A2V7UGP8      AVDLVTLR-----------------------------------------DPASPA-SEAY
A0A239MKT6      DKQEDAAWLIR--------------------------------------APKSKS-AESY
A0A3E0PCN7      GENFYSLDR----------------------------------------FARPVM-VEAF
A0A2V8IYW3      PETAEIGVFVPLKNPIGVSEELFDPALTGKVAAP---------------GMLPVA-TEQY
G2LEI9          NVGLSAFA-----------------------------------------LSASPI-GEAY
A0A317J121      VGFWDSA------------------------------------------PASQLL-ADSF
A0A2V7YW66      AAGAPQIELVPHE------------------------------------RPRTLI-SEAY
A0A2V7Z0V0      ALPPSQIELVPHE------------------------------------RPRTLI-SESY
A0A2V8GFD4      H------------------------------------------------HVPGMF-PEAL
A0A2V8HSS5      H------------------------------------------------HVPGMF-PEAL
A0A2V8KP55      -------------------------------------------------EPSSVI-AESY
A0A399WNU1      -------------------------------------------------FNNPLI-AEAF
A0A2V9JSI3      PVGLAVLK-----------------------------------------HPASPL-AESY
A0A2V9WI32      -------------------------------------------------RPRSEL-AESY
A0A2V8IVN9      -------------------------------------------------HVTTNF-NEAF
A0A7C5Z4J3      AAEWALLK-----------------------------------------HPTSAL-AESY
A0A1F2TPT3      -------------------------------------------------GVPPEF-SEEL
A0A2V8JTQ2      DHALVSLL-----------------------------------------QPMSLA-AESY
A0A2V8UZY0      KPELVSLL-----------------------------------------QPLSLA-AESY
A0A350UEK1      KLELVTLQ-----------------------------------------RRLSAT-AESF
A0A350UIQ4      KLELVTVQ-----------------------------------------RRLSAV-AESF
A0A1H5Z7N3      VARNIGVLA----------------------------------------APKSQF-AESF
A0A1G7JVV8      AQTNIGVLA----------------------------------------TSKSQF-SEAF
A0A1H4T6W9      AQNNIGVLA----------------------------------------TSKSQF-SEAF
I3ZEU5          AQSNIGVLA----------------------------------------TSKSQF-SEAF
A0A1I6MH75      AQRNINVLT----------------------------------------QPKSQF-SESF
E8WVF6          VERNINVLT----------------------------------------QPKSQF-TEAF
A0A7D0PQC3      VERNINVLT----------------------------------------QPKSQF-TESF
A0A428MDU2      AQRNISVLT----------------------------------------QPKSQF-AEAF
A0A5B9EBI2      TQLNMGVLT----------------------------------------MPKSQF-AEAF
A0A239HDF6      ----LPVIS----------------------------------------QPKSQF-TESF
A0A4Q0T270      AQRNISVLT----------------------------------------QPKSQF-AESF
A0A1Q3QQB6      TQKNLSVLS----------------------------------------QPKSQF-TESF
A0A3N1K1G7      AQRNISVLT----------------------------------------QPKSQF-AESF
A0A4V2G466      TARNIISLA----------------------------------------QPKSQF-AEAF
A0A6B9YNQ8      AIRNITSLS----------------------------------------QPKSQF-AESF
A0A3N5YNR8      -------------------------------------------------PARFRV-WEAY
A0A3N6A5T6      -------------------------------------------------DMRSRV-WEAY
A0A1F2Q9L4      VSHF---------------------------------------------KPRLAV-SEAY
A0A2U3KC61      -------------------------------------------------RPKSEA-AEAY
A0A2V9Y2R7      -------------------------------------------------RPKSQA-AESY
A0A2V9NGH6      -------------------------------------------------RPQSQM-AEAY
A0A2V9PYE6      -------------------------------------------------RPQSQM-AEAY
A0A2V9NL07      -------------------------------------------------RPQSQM-SESY
A0A2V9QD92      -------------------------------------------------RPQSQM-SESY
A0A2V9WPZ6      -------------------------------------------------RPQSQM-AESY
A0A2V9ZLH4      -------------------------------------------------RPQSQM-AESY
A0A2V9RQF1      -------------------------------------------------RPQSQM-AESY
A0A2V9YDK8      -------------------------------------------------RPQSQM-AESY
A0A2V9V8F7      -------------------------------------------------RPQSQM-AESY
A0A2V9XGR9      -------------------------------------------------RPQSQM-AESY
A0A2V9V3Q5      -------------------------------------------------RPQSQM-AESY
A0A2V9NWS3      -------------------------------------------------RPQSQM-AESY
A0A2V9USA9      -------------------------------------------------RPQSQM-AESY
A0A2V9XW18      -------------------------------------------------RPQSQM-AESY
A0A1H5SQF5      VLK----------------------------------------------APRSVV-AEAC
A0A2V9AEW6      LATWK--------------------------------------------RKPSLI-AECV
A0A2V8WQK6      LATWK--------------------------------------------RKPSLL-AECT
A0A2V8XIF4      LATWK--------------------------------------------RKPSFL-AECA
A0A2V2R0I6      -------------------------------------------------LPKSQM-SEAF
A0A2V8XAR9      -------------------------------------------------LPKSQI-SEAF
A0A2V8VZA0      -------------------------------------------------LPKSQM-SEAF
A0A1Q7CB82      -------------------------------------------------LPKSQM-SEAF
A0A2V8WIU1      -------------------------------------------------LPKSQM-SEAF
A0A1Q6Y9F5      -------------------------------------------------LPKSQM-SEAF
A0A2V9EVV8      -------------------------------------------------LPKSQM-SEAF
A0A2V8YF91      -------------------------------------------------LPKSQI-SEAF
A0A2V8XZK2      -------------------------------------------------LPKSQM-SEAF
A0A2V8ZTX6      -------------------------------------------------LPKSQV-SEAF
A0A2V9BT79      -------------------------------------------------LPKSQM-SEAF
A0A2V9YHT3      -------------------------------------------------HPKSEI-AESY
A0A7C2XNI7      -------------------------------------------------RPQSQI-SEAF
A0A1Q8B793      -------------------------------------------------LPKSQM-SEAF
A0A2V9BCA0      -------------------------------------------------LPKSQM-SEAF
A0A2V9BWU9      -------------------------------------------------LPQSQI-SEAF
A0A2V9DKX2      -------------------------------------------------LPQSQI-SEAF
A0A7C2YQY3      AQELATIS-----------------------------------------QPHSVV-SEAY
A0A3E0NV31      -------------------------------------------------RRSNIV-RESY
A0A3N5M5V0      A------------------------------------------------PTRFRV-WEAY
A0A3N5XQP8      -------------------------------------------------ALDSPM-WEAY
A0A2Z5G7H4      VNSLAIFA-----------------------------------------HPNSPY-TEAL
A0A2V9L5B5      -------------------------------------------------QTHAEV-LEAF
A0A2V9LK56      -------------------------------------------------RRDPAA-VEAF
A0A2V9L7I0      -------------------------------------------------QSHADA-VEAF
A0A522PPT0      -------------------------------------------------QKDPTA-VEAF
A0A7C5V1G5      -------------------------------------------------QKDPMA-LEAF
A0A2V9KCS3      LVTWY--------------------------------------------RKPSLL-AESF
A0A372IT17      SWELQGTGS----------------------------------------ASGSPF-SESL
A0A4R1LC91      -------------------------------------------------EPRSAY-TEAV
A0A3M2BZG9      QIELLPHR-----------------------------------------KPRLAV-CEAY
A0A1Q7N5R7      -------------------------------------------------EQVLQV-IETM
A0A2V9QB26      LVTWY--------------------------------------------RKASLI-AESF
A0A2V9VYY4      MLALVTYE-----------------------------------------RPKSEA-AEAY
A0A3E0PHB0      STEFVALE-----------------------------------------DNRSGM-AEAY
A0A3M1SIV3      SAALITLR-----------------------------------------ETSSAT-AEAF
A0A3M2D491      SVALVTLS-----------------------------------------SKQSPL-AEAF
A0A353C9L6      STGLVTLE-----------------------------------------ERHSPM-AEAY
A0A2V8RQV0      AAALITLE-----------------------------------------ERNSPM-AEAY
A0A2V8SJH5      ATGLITLA-----------------------------------------ERRSPM-AEAY
A0A357F267      STALVTLD-----------------------------------------ERNSPM-AEAY
A0A7C5ZUA8      PTQLVTLE-----------------------------------------ERQSPM-AEAY
A0A136JPP4      NTALITLE-----------------------------------------ERHSPM-AEAY
A0A399WUJ8      STALITLE-----------------------------------------DRHSPM-AEAY
A0A2V9KIE8      ---------------------------------------------------------ESF
A0A352F549      ------------NG-----------------------------------TGSSVQ-AEAY
A0A3B9MLP9      ------------NS-----------------------------------RGPTLQ-AEAY
A0A3D5SQ87      ------------NS-----------------------------------RGPTLQ-AEAY
A0A2V8NW86      LVTWYRKASLIAESYRSLLTSILFSGSNGLPERTSKQADSLSVELVTWYRKASLI-AESY
A0A7C2GJ20      ------------SE-----------------------------------RRRSSF-AEAF
A0A7C4BTL5      --LLQDRVELATWQ-----------------------------------QKPSLV-AESF
A0A2V8ZHL8      --ALALLKQ-----------------------------------------PSSAL-AESF
A0A2V9B240      --ELALLKE-----------------------------------------PSSAL-AESF
A0A2V9CBM2      --SWYRIDV---HA-----------------------------------TRHAPL-VEAF
A0A2V8XN17      ---WHLIDR---DG-----------------------------------AQHAAL-GEAF
A0A2V8WX45      --SWHRIDL---DG-----------------------------------TQHGAL-VEAF
A0A1Q6YR79      --SWHLIDR---DG-----------------------------------TQHAAL-GEAF
A0A1Q7VA32      --SWHLIDR---DG-----------------------------------TQHAAL-GEAF
A0A2V9EY85      --SWHLIDR---DG-----------------------------------TQHAAL-GEAF
A0A2V9H8K0      --FWHRIDR---DG-----------------------------------TQHAAL-VEAF
A0A2V9FFE5      --CWHRIDR---DE-----------------------------------TQHASL-VEAF
A0A2V9GM43      --YWHRIDR---DE-----------------------------------TQHASL-VEAF
A0A2V9CYQ5      --SWYRIDV---HA-----------------------------------TRHAPL-VEAF
A0A2V9BWU8      --RWHRIDQVDRGE-----------------------------------KPQAAL-VEAF
A0A2V8ZG48      --CWHRIDQ---GG-----------------------------------KRHAAL-VEAF
A0A2V8Y334      --RWHRIDQ---SG-----------------------------------KPQPAL-VEAF
A0A2V9AY68      --RWHRIDQ---GG-----------------------------------KPQAAL-VEAF
A0A1F2RFI7      --KLHPELI---AG-----------------------------------DGTNPL-SEAY
A0A1F2RZS3      --PLSLELI---GA-----------------------------------NGNAAL-SEVY
A0A1F2USE2      --GWYRIDE---LD-----------------------------------PQRSTL-AEAF
A0A7C2VB08      LNLWLRIDR---AE-----------------------------------TQHSVL-AEAF
A0A2V9C238      --RWYRIDV---EA-----------------------------------TQQSAL-AEAF
A0A1F2Q9F5      --LWHLVSG---NG-----------------------------------EGSTKL-GEAF
A0A1F2QQH9      --LWHLVSG---NG-----------------------------------EGSTKL-GEAF
A0A1F2QXK7      --LWHLVSG---NG-----------------------------------EGSTKL-GEAF
A0A2V9DEM9      --RWYRIDA---EA-----------------------------------TQQSAL-AESF
A0A7C5TWV7      ---------------------------------------------------THVA-REVY
A0A2V7XDY0      ---------------------------------------------------VHFV-TEAY
A0A2V8G155      -------------------------------------------------RAPGNF-AEAL
A0A2V8HDM7      -------------------------------------------------RAPGNF-AEAL
A0A2V8DRT9      -------------------------------------------------GATPNF-AEAM
A0A2V7VYF3      -------------------------------------------------GVPAHF-SEAF
A0A1F2SVH2      -------------------------------------------------GVPSNF-SESF
A0A2V8AJG9      -------------------------------------------------GVPANF-AEAF
A0A2N9LQU7      -------------------------------------------------RPASLL-AESY
A0A2P6WFK7      -------------------------------------------------SPRSQA-AEAF
A0A2V8U914      -------------------------------------------------KRFSKM-SEAF
A0A2V7W309      -------------------------------------------------DARSPV-SEAY
A0A2W0BGU4      -------------------------------------------------QATSEQ-SEAY
A0A2W0BVQ9      -------------------------------------------------QTTSEQ-SEAY
A0A2V9MN96      -------------------------------------------------RPKSEA-AESY
A0A2V7V2Z1      --------------------------------------------------VESPL-ADGY
A0A2V7X2F7      -------------------------------------------------STQSTF-AEAY
A0A2V7V2I1      --------------------------------------------------QQGPF-MEGY
A0A2V7U3M2      --------------------------------------------------VESPL-ADGY
A0A2V7UHT0      --------------------------------------------------AETPL-ADGY
A0A2Z5FVL3      -------------------------------------------------DPHSAY-VEAL
A0A2V9KBD6      -------------------------------------------------EPMSLA-AESY
A0A2W0AJ66      -------------------------------------------------QPLSPA-AESY
A0A1Q7RBU1      -------------------------------------------------QPLSLA-AESY
A0A2V9JPV9      -------------------------------------------------QPLSLA-AESY
A0A3P0X3W6      -------------------------------------------------RTQDAY-TEAI
A0A2N9MK30      -------------------------------------------------RLLAGF-GEAV
A0A3D1ASD2      -------------------------------------------------RYASGY-DEAV
A0A7C5AXI3      -------------------------------------------------RVLTGY-DEAI
A0A7C6E4H7      -------------------------------------------------RTVTSY-QEAI
A0A1F2TCR2      -------------------------------------------------QVPHDF-GEAF
A0A350UQT3      -------------------------------------------------RQFSTY-EEAV
A0A7C3HRX0      -------------------------------------------------RQFTAY-EEAV
A0A1F2V330      -------------------------------------------------DPHSVA-SEQC
A0A662EE63      ---------------------------------------------------SRAL-REAF
A0A2V8TLH7      ---------------------------------------------------RRAV-REAY
A0A1Q7ZJT1      ---------------------------------------------------HSAF-KEAY
A0A2V8VC99      ---------------------------------------------------LSAV-KEAY
A0A348UZU3      -------------------------------------------------APDSTF-AESY
Q01XL7          -------------------------------------------------NKSSIL-AESF
A0A2V8ERZ5      -------------------------------------------------HVPHDF-GESF
A0A2V8GTX0      --------------------------------------------------VPHDF-GEAF
A0A2V8J0X9      --------------------------------------------------VPHDF-GEAF
A0A523DUV7      ---------------------------------------------------PSVI-TESY
A0A372IRG7      -------------------------------------------------EPQSIV-AEGF
A0A1F2U158      -------------------------------------------------HAPHDF-SEAF
A0A2V8F6S9      -------------------------------------------------RVPHDF-GESF
A0A7D8BEX2      -------------------------------------------------KPTTHY-AEGI
A0A4Q1SCH5      -------------------------------------------------EPRSRA-AESY
A0A2V8K4L4      -------------------------------------------------RQGSLI-AESF
A0A2V8NCZ3      -------------------------------------------------RQGSLI-AESF
A0A4Q7YNP3      -------------------------------------------------SHFSVV-AEAY
E8UZE1          -------------------------------------------------FPQSHF-AESF
A0A2U3JZ71      -------------------------------------------------TSLNSF-QEAI
A0A2V8TTB0      -------------------------------------------------QALSNY-EEAI
A0A1V6HR88      -------------------------------------------------RPRMPV-AEAY
A0A3E0P0A3      -------------------------------------------------QPRLPA-SEAY
A0A2V8EXP2      -------------------------------------------------GVPANF-SEAF
A0A2W4RYA1      -------------------------------------------------PVPAGF-AEAL
G8P0Y7          -------------------------------------------------EPRSEI-AEAY
A0A5M8T4U7      -------------------------------------------------SPKSLA-GEAY
A0A7D0PPG7      -------------------------------------------------NSTEFY-DESI
A0A7D8BF18      -------------------------------------------------SPRSQS-AEAF
A0A1E3Y9R6      -------------------------------------------------DAPAAF-SEAI
A0A2W4TLP2      -------------------------------------------------DAPPAF-AEAI
A0A7C4BZ42      -------------------------------------------------RKPSLI-AESF
A0A3R9WF43      -------------------------------------------------NPYSPF-SESF
A0A317HKM4      -------------------------------------------------GAPARL-TELF
A0A2V9CG11      -------------------------------------------------RKSSLS-ADCY
A0A523E0N1      -------------------------------------------------ENRDAL-SERF
A0A523ECP2      -------------------------------------------------EDMSLI-AERF
A0A2W0C122      -------------------------------------------------EPRTAI-AEAY
A0A2W0AUU7      -------------------------------------------------EPRTAA-AEAC
A0A2W0BQL1      -------------------------------------------------EPRTAA-AEAC
A0A4Q1SDL1      -------------------------------------------------APRSAY-SEAM
A0A3P0XH15      -------------------------------------------------EPQSYV-SEGF
A0A4R1LAZ7      -------------------------------------------------EPHSVI-AESF
A0A3M1WQW8      -------------------------------------------------QRRSSF-AEAF
A0A3N1JHC1      -------------------------------------------------ADKTFL-TETY
C1F294          -------------------------------------------------EPQSIV-AEGF
A0A2V9KA79      -------------------------------------------------PPPSIA-TDQY
A0A522PSP1      -------------------------------------------------VDGTPF-AESL
G8P085          -------------------------------------------------SPLSVN-AEAF
A0A7C6A629      -------------------------------------------------RVATSF-QEAV
A0A4Q1SGQ1      -------------------------------------------------ARQEIF-VEAL
Q1ILD9          -------------------------------------------------RPNSQF-SESF
A0A7C5SHM3      -------------------------------------------------QRNHDV-EEAF
Q1IJZ6          -------------------------------------------------YEQAMA-TEAF
A0A2V8TCE6      -------------------------------------------------HPSSPL-AESF
A0A522TBE8      ----------------------------------------------------HPY-HEAI
Q1ITG0          -------------------------------------------------RPQSKL-AEAF
A0A7C2ML20      -------------------------------------------------NGNWAT-AEAY
A0A7C5AXS9      -------------------------------------------------RSGALL-AESF
A0A7C2RGE3      -------------------------------------------------RQRSSF-AEAF
A0A3N5PCI5      -------------------------------------------------GVPAPY-AEAC
A0A3M1Q0S9      -------------------------------------------------APLSPV-AEAY
A0A2Z5G448      -------------------------------------------------TPQTVG-AEAF
A0A3M1VZ38      -------------------------------------------------MPLSPA-AEAY
A0A4Q1SD29      -------------------------------------------------EPQSIA-AESF
A0A6N9FGE2      -------------------------------------------------GAPASF-TEAI
A0A3M1PY35      -------------------------------------------------PGAHSV-EEAF
A0A3M1VMP2      -------------------------------------------------EEQMDV-EEAF
                                                                         :  

A0A2V7VMF7      QNLRTALL-FA-RKDDA-GQVVLITGTAPQEGKTTTLVNLAKLLAG-S-GERTIVIDCDL
A0A2V7YYV7      RALRTSLL-FS-AIDRE-LKEIVVTSAEVGEGKSRTAANLAIVLAQ-A-GHWTLLIDADF
A0A2V7Z0J5      RALRTGIL-FS-GVERS-VKQLIVTSAEMGEGKSRTAANLAVVLAQ-A-GYKTLLMDADF
A0A2V7Z3M4      KALRTGIL-FS-GINHR------LXXXGSGEGKSRTAANLSVVLAQ-A-GHQTLLIDADF
A0A399Y5V2      RSVRTNLQ-FS-LLDSG-SRVVLVTSPSASEGKSTTAANIAVVLAQ-S-GKSVIIVDCDL
Q01X01          RATLASIL-SS-SHNGDHPHVLVVTSSRPMEGKTTVVSNLGIALAE-I-GNRVLLIDGDL
A0A3M2D9H8      RSVRTNLE-FV-EIDRP-LKTLLIGSPGPDEGKTTVAVNLAIVMAQ-G-GNRVLLMDTDL
A0A2V8JK38      RSVRTSFF-LS-SGSAP-TRSVVITSAVPGEGKTVTAVNTAVIVAQ-T-GARVILIDADM
A0A2V9IXG5      NVLRTELL-FN-KNLRQ-HKVIMVTSSLPEEGKTTVTMNLAKTLAA-A-GDRTMVVDFDL
A0A2V9J2P4      NVLRTELL-FN-KNLRQ-HKVIMVTSSLPEEGKTTVTMNLAKTLAA-A-GDRTMVVDFDL
A0A1Q7RLS4      QTLRTSLL-FS-RKSRG-ANTVLITSAGPQEGKSCTTVNVARTLAT-A-GEKVIIVDCDL
A0A2V2R525      RKLRTTVL-LS-RPGKT-PKTLLVTSSMPAEGKTTTAVNMATILAQ-T-GASVLIIDADM
A0A321LPW6      RVLRTSVL-LC-AAGSP-PRTILVTSGQQGEGKTTTVINTAVSLAQ-L-GAKVLIIDCDL
A0A2V9R9V4      RALRTALL-LS-AAGNP-PKTILVTSVRMEEGKTTTATNTAIALAQ-L-GASVLLIDCDM
A0A321LE75      RVLRTSVL-LS-TAGNP-PKTILITSGQPGEGKTFTAINTAISLAQ-L-GASVLIVDCDL
A0A2V8R8U7      RHLRTSLL-LS-SAGTP-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GADVLIIDCDL
A0A2V8QMP4      RHLRTSLL-LS-SAGQP-PKTVLVTSSQPSEGKTTTVVNIATMLAQ-T-GADVLILDCDL
A0A2V8R4S3      RHLRTSLL-LS-SAGQP-PKTVLVTSSQPSEGKTTTVVNIATMLAQ-T-GADVLILDCDL
A0A2V8NJ55      RHLRTSLL-LS-SAGQP-PKTILVTSSQPSEGKTTTAVNTAVMLAQ-T-GAEVLIIDCDL
A0A2V8Q7I0      RHLRTSLL-LS-SAGQP-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GVDVLIIDCDL
A0A2V8S6K4      RHLRTSLL-LS-SAGQP-PKTMLVTSSQPSEGKTTTAVNTAMMLAQ-T-GAEVLILDCDL
A0A317I2L9      RHLRTSLL-LS-SAGQP-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GADVLIIDCDL
A0A2V8LLF9      RHLRTSLL-LS-SAGMQ-PRTILVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDL
A0A352FRF4      RHLRTSLL-LS-SAGTA-PRTILVTSSQPSEGKTTTAINTAFILAQ-T-GAEVLIIDCDL
A0A2V8MKV0      RHLRTSLL-LS-SAGQA-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDL
A0A2V8PYY8      RHLRTSLL-LS-SAGQA-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDL
A0A1Q7YKQ8      RHLRTSIL-LS-SAGQP-PKTILVTSSQPSEGKTTTAVNTAVMMAQ-T-GADVLIVDCDL
A0A352F3R7      RHLRTSLL-LS-SAGQP-PKTILVTSSQPSEGKTTTTINTAFMLAQ-T-GAEVLVVDCDL
A0A0B6WXT1      RHLRTQLL-LS-TAGQP-PRTVLLTSSQPSEGKTTTAVNMAMMLAQ-M-GAEVLLLDCDL
A0A3B9MEU8      RHLRTSLL-LS-SAGQP-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDL
A0A2V8MHG6      RQLRTLVL-LS-SAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDM
A0A2V8P7N1      RQLRTLVL-LS-SAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVIIVDGDM
A0A2V8M3M6      RQLRTLVL-LS-SAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDM
A0A1Q7NJH5      RQLRTLVL-LS-SAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDM
A0A2V8PJY0      RQLRTLVL-LS-SAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDM
A0A1Q7Y6W9      RQLRTSVL-LS-TAGRA-PKSLLVTSSQPAEGKTTTATNIAISLAQ-T-GASVLIIDADM
A0A2V8NC68      RQLRTSVL-LS-SAGGA-PQTLLVTSSQPAEGKTTTVVNTATILAQ-T-GATVVVIDADM
A0A399WK13      RQLRTSIL-LS-TAGHA-PKSLLITSSLPSEGKTTTATNTAISLAQ-T-GASVVIIDADM
A0A352FLX4      RHLRTSIL-LS-TAGRP-PRTLLITSSVPSEGKTTTAVNTAISLAQ-T-GAKVLIIDADM
A0A2V8RTL7      RQLRTSIL-LS-TAGHA-PKSLLITSSLPSEGKTTTATNTAISLGQ-T-GAKVLIIDADM
A0A3E0PCJ6      RQLRTSIL-LS-TAGHA-PKSLLITSSLPAEGKTTTAVNTAISLAQ-T-GAKVLVIDADM
A0A3M1S4R8      RQLRTSIL-LS-VAGHA-PKSLLVTSSLPAEGKTTTAVNTAITLAQ-T-GAKVLVIDADM
A0A7C2G442      RQLRTSIL-LS-VAGHA-PKSLLITSSLPAEGKTTTAVNTAITLAQ-T-GAKVLVIDADM
A0A1Q7YFI6      RQLRTSVL-LS-SAGGA-PQALLVTSGVPSEGKTTTALNMAQIMAQ-T-GATVLLIDADM
A0A136KC10      RQLRTSIL-LS-TAGHA-PKSLLITSSLPSEGKTTTATNTAISLAQ-T-GAQVLIIDADM
A0A3M2D6Y5      RQLRTSIL-LS-VAGHA-PRSLLVTSSLPSEGKTTTAVNTAISLAQ-T-GAKVLIVDADM
A0A2V8SEX6      RQLRTSIL-LS-TAGHA-PKSLLITSSLPSEGKTTTATNTAISLAQ-T-GAKVLIIDADM
A0A7C5ZUU4      RQLRTSIL-LS-SAGHA-PKSLLITSSLPSEGKTTTATNTAISLAQ-T-GARVLIIDADM
A0A0B6WWQ6      RQLRTSVL-LS-TPGHA-PKTLLVASSAEAEGKSTVAVNVALILAQ-T-GAQVLLIDADM
A0A3B9MK99      RHLRTSVL-LS-TAGRA-PRSLLVTSSLPGEGKTTTAVNTAVSLAQ-T-GASVVIIDADM
A0A352EX26      RHLRTSLL-LS-TAGRA-PRSLLVTSSLPGEGKTTTAVNTAVSLTQ-T-GASVVLIDADM
A0A2V8MM59      RQLRTSVL-LS-TAGRA-PKTLLVTSSLPGEGKTTTAVNTAISLAQ-T-GASVVIIDADM
A0A2V8PFE8      RQLRTSVL-LS-TAGRA-PKTLLITSSLPGEGKTTTAVNTAITLAQ-T-GASVVIIDADM
A0A2V8PWS6      RQLRTSVL-LS-TAGRA-PKTLLITSSLPGEGKTTTAVNTAITLAQ-T-GASVVIIDADM
A0A2V8LCT5      RQLRTSVL-LS-TAGRA-PKTLLVTSSLPGEGKTTTAVNTAISLAQ-T-GANVLIIDADM
A0A352FTJ9      RQLRTSVL-LS-TAGRA-PKTLLVTSSLPGEGKTTTAVNTAISLAQ-T-GASVVIIDGDM
A0A257VBK0      QTLRTAMV-FA-TDNHQ-NNAILVTSASPKEGKTSVSANLAKTLAA-G-GDRVLLMDCDL
A0A2G6PYV5      RHLRTNIQ-LSKTTD---NKVLLLSSALSGEGKTVSSLNLAISFAQ-L-EKKTLIIDCDL
A0A2V8F956      RDLRTNVL-FS-SAEKG-SRSVVVTSTGPGEGKSLVAANLAISLAH-A-TQRVLVLDADL
A0A1F2S1W5      RSIRTNVL-FS-STEEG-GRLVVITSSAPGEGKTMVVTNLAVALAQ-A-GHRVLLMDADM
A0A1F2T595      RSIRTNVL-FS-STDEG-GRMIAVTSSAPGEGKTVVSTNLSIALAE-A-GHRVLLLDADM
A0A2V8JQV5      RTTAASVL-FS-EHGGTVPQILVVTSANPQDGKSTMASNLAVALAE-T-QRRVLVIDSDL
A0A2V9AC41      RSLRSSLL-LS-QAGGP-PHTMLMTSATRGEGKTTTLVNTAIVFSQ-L-GIRVLVIDADL
A0A2V9MAM9      RCLVTSILRLGGDEGQSPPRVLVITSTLPAEGKTTVATNLGITLAS-I-QRRVLLIDGDM
A0A348V070      RSIRTSLL-LS--FDSPTRKALIFSSPLSKDGKSSVISNLGLALAQ-A-HKRVVIVDSDL
A0A2V9M454      RTLRTSVL-LS-TAERP-PKVLLITSAQPSEGKTATTLNLAVTLAQ-K-GSRVLLIDSDL
A0A2V9IVR7      RSMRTAIL-LA-TSPRP-PQVIVMTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADF
A0A2V9ILE2      RSMRTAIL-LA-TSPRP-PQVIVMTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADF
A0A2V9LGY4      RSMRTAIL-LA-TSPRP-PQVIVMTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADF
A0A2V9J4D6      RALRTSIM-FS-TSPKP-PQVVLVTSGHPKEGKTATAVNLASLMAQ-T-GSRVLLVDCDL
A0A2V9L9C5      RALRTSIM-FS-TSPKP-PQVVLVTSGHPKEGKTATAVNLASLMAQ-T-GSRVLLVDCDL
A0A2N9M9N1      RVLRTSIL-LS-SSPQP-PQVLLVTSAHPSEGKTFASVNLALALAQ-R-GGRVLLVDGDL
A0A2V9JEC4      RILRTSIL-LS-MTPRP-PQLLLITSPLPCEGKTSCSINLAASLAQ-R-GGRVLLLDADL
A0A2V9LPQ3      RALRSAIL-FS-STPEP-PKVLLVASSQPKEGKTCTSINLALSLAQ-N-SVPVLIIDADL
A0A2Z5G3A3      RAIRTSLY-LS-KGGSP-PQVVLITSSIEGEGKSTLAANFAVLLAR-Q-GKKVLLVDGDL
A0A2V7UGP8      KTLRTSLL-LS-TADAP-PKIIVVTSSEPQEGKTVTTLNTAISLTQ-S-GKKVLLVDGDM
A0A239MKT6      RQIRTAIL-FS-RIDDP-PKVILFTSGISGEGKSTTAYNMAVAFAL-Q-TKRVLLIDADM
A0A3E0PCN7      NQIRTSLM-LS-TAGGP-PKSVLVTSGQPFEGKTINSLCLAKSMAE-L-GKKVLLIDADM
A0A2V8IYW3      RRLAAILH-HA-QADTG-MRVVMVTSAISGEGKSLTITNLALTLTR-SYERRVLLIDADL
G2LEI9          RQLRTSIL-LS-SSEDVRNRIILITSSQPGEGKTTTSFNTAISLAQ-T-GASVLLIDCDL
A0A317J121      RVTLASLM-LGNGTRRP-PRVILVTSPGAGEGKTTIVSNLGTALAE-T-GRSVLILDGDF
A0A2V7YW66      RSLRTGLL-LS-SARE--LKTVAVTSAMAGEGKTATAVNLAIVLAQ-L-GRQVLIVDCDL
A0A2V7Z0V0      RSLRTALM-LS-SARE--LKAIAVTSAVAGEGKTATASNLAVVLAQ-L-GRQVLLVDCDL
A0A2V8GFD4      RAIRTNVL-FS-FAEGS-AKTLVITSTAPEEGKTMVAANLAIALAM-T-SQRVLLVDADM
A0A2V8HSS5      RAIRTNVL-FS-FAEGS-AKTLVITSTAPEEGKTMVAANLAIALAM-T-SQRVLLVDADM
A0A2V8KP55      RSVRTSFF-LS-SGSAP-TRSVVITSAVPGEGKTVTAVNTAVIVAQ-T-GARVILIDADM
A0A399WNU1      HQLRTSLL-LS-TAGGS-PKTVLVTSGEPSEGKTITSLNLAKSLAQ-L-GGKVLLVDADL
A0A2V9JSI3      RALRTSVL-LS-TPGHP-PQVILITSSQPNEGKSCTCLNLALTLAQ-R-GGRVVIIDGDL
A0A2V9WI32      RALRTSIM-LS-SLGSP-PKVILVTSALPQEGKTTTSINSAIVLAQ-R-GGRVLLVDADL
A0A2V8IVN9      RAVRTNII-FS-SAEEG-SRILVVTSTGPGEGKTTFASNLAVSLAQ-T-GQRVLLIDGDM
A0A7C5Z4J3      HTLRTAVL-LS-SAPCP-PRVILVTSTQPFEGKTSTSINLAMGLTQ-I-GKRVLFIDADL
A0A1F2TPT3      RRIRTNLV-FS-FAGDA-TRSVVITSASPTEGKTVVGSNLAVALAQ-A-GERVLLMDADL
A0A2V8JTQ2      KTVLTSLL-LS--QPTP-PRVIQVTSALPGGGKTTVSTNLAILLAR-L-RRRVLLVDADL
A0A2V8UZY0      RAMLTPLM-LS--AATP-PGIILVTSAVPGEGKTTVCTNTAILLAR-L-HRRVLLVDADL
A0A350UEK1      RAVLTSIL-FSGNGHGP-PRMIVVTSASPSEGKTTVATNLALAMAE-T-GQRVLLVDGDT
A0A350UIQ4      RAALTSIM-FSGNGSGP-PRMIVVTSPNPSEGKTTVATNLAVAMAE-T-GQKVLLIDGDT
A0A1H5Z7N3      RGLRTSLL-LA-TAGKE-PKVVLVTSSTPSEGKTTVSTNLATVLAQ-R-DVKTLLIDADL
A0A1G7JVV8      RSLRTALL-LA-TTGHP-PKFILITSSTPSEGKTTVSTNLAAILAQ-R-ETRVLLIDADL
A0A1H4T6W9      RSLRTSLL-LA-TTGHP-PKVILISSSTPGEGKTTVATNLAAILAQ-R-DTKVILIDGDL
I3ZEU5          RSLRTSLL-LA-TTGHP-PKIILISSSTPGEGKTTVATNLAAILAQ-R-ETRVLLIDADL
A0A1I6MH75      RALRTSLL-LS-STGHP-PKFVLFTSATPSEGKTTTACNLACILAQ-R-DTRVLLIDADL
E8WVF6          RSLRTALL-LA-STGKE-PRLLLFTSATPSEGKTTAASNLAVILAQ-G-GTRTLLIDADL
A0A7D0PQC3      RSLRTALL-LSMSEGRE-PKYILFTSATPSEGKTTAATNLATVMAQ-G-DARVLLIDADL
A0A428MDU2      RSLRTALL-LS-SAGHP-PKFILFTSATPSEGKTTTASNLACILAQ-R-DARVLLIDADL
A0A5B9EBI2      RSLRTSIL-LA-DTAHP-PRTILFTSATPSEGKTTCSTNLSCILAQ-R-ETRVLLIDADL
A0A239HDF6      RALRTALL-LS-TAGRE-PKLLMFTSAAPGEGKTTTSINLAAILAQ-R-GARVLLIDADL
A0A4Q0T270      RSLRTSLL-LS-TTGQP-PKFILFTSSTPSEGKTTTACNLACILAQ-G-DVRVLLIDADL
A0A1Q3QQB6      RALRTSLL-LA-TTGHP-PKFILLTSATPSEGKTTLSTNLACILAQ-G-DARVLLIDADL
A0A3N1K1G7      RALRTSLL-LS-TTGHP-PKFILFTSATPSEGKTTTASNLACILAQ-A-DTRVLLIDADL
A0A4V2G466      RSLRTALL-LS-SAGHP-PKYILLTSATPSEGKTTASTNLATILAQ-G-DARVLLIDADL
A0A6B9YNQ8      RSLRTALL-LS-SAGHP-PRTILLTSATPSEGKTTASVNLATVLAQ-G-NARVLLIDADL
A0A3N5YNR8      RSLRTSIL-LS-HSGKP-PKVIMVTSSVPGEGKTTTVANTGIVLAQ-T-GARTLLIDLDM
A0A3N6A5T6      RSLRTSLL-LS-NSGKP-PQIILVTSALPAEGKTTTALNAAIVLAQ-T-SARTLLIDLDM
A0A1F2Q9L4      RSLRTALL-LS-TTNR--LKSVVVTSAIPGEGKTSTAVNLAVVLAQ-L-GRQVLLVDADL
A0A2U3KC61      RALRTSIL-LS-SFGAP-PKVILVTSAMPQEGKTTVSANSALVLAQ-R-GSRVLLVDADL
A0A2V9Y2R7      RALRTSIL-LS-SFGAP-PKVILVTSALPQEGKTTISANSAVVLAQ-R-GSRVLLVDADL
A0A2V9NGH6      RALRTALL-LS-SVGAA-PKVVVVTSALPSEGKTTTSINTAIVLAQ-K-GNRVLLVDADL
A0A2V9PYE6      RALRTALL-LS-SVGAP-PKVVVVTSALPSEGKTTTSINTAIVLAQ-K-GNRVLLVDADL
A0A2V9NL07      RALRTSLL-LT-SLGAP-PKTILITSALPQEGKTTTSINTATVLAQ-K-GTRVLLIDADL
A0A2V9QD92      RALRTSLL-LT-SLGAP-PKTILITSALPQEGKTTTSINTATVLAQ-K-GTRVLLIDADL
A0A2V9WPZ6      RALRTSLL-LS-SLGAP-PKIILITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADL
A0A2V9ZLH4      RALRTSLL-LS-SSGAP-PKVILVTSAMPQEGKTTTSINCAIVLAQ-K-GTRVLLVDADL
A0A2V9RQF1      RALRTSLL-LT-SLGAP-PKIILITSALPQEGKTTTSINTAVVLAQ-K-GTRVLLIDADL
A0A2V9YDK8      RALRTSLL-LS-SSGAP-PKIILVTSALPQEGKTTTSINCAIVLAQ-K-GVRVLLIDADL
A0A2V9V8F7      RALRTSLL-LS-SLGAP-PKIILITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADL
A0A2V9XGR9      RALRTSLL-LS-SLGAP-PKIILITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADL
A0A2V9V3Q5      RALRTSLL-LS-SLGGP-PKVIMVTSARPQEGKTTTAINSAIVLAQ-K-GVRVLLVDADL
A0A2V9NWS3      RALRTSLL-LT-SIGAP-PKVILVTSALPQEGKTTTSINTAIVLAQ-K-GTRVLLIDADL
A0A2V9USA9      RALRTSLL-LT-NLGAP-PKVIMVTSALPQEGKSTTSINCAIVLAQ-K-GVRVLLIDADL
A0A2V9XW18      RALRTSLL-LS-NLGAP-PKVIIVTSALPQEGKTTTSINTAVVLAQ-K-GVRVLLIDADL
A0A1H5SQF5      RQIRTAIL-LS-RAEQ--PRTLLFTSSFSGEGKSTLTSNMAFAFGL-Q-GSRVLLMDADM
A0A2V9AEW6      RTTLTSIL-LP-NQDGDPPQVVLLTSPCLGDGKTTVACNLSIAMAE-I-GRKVLLIDGDL
A0A2V8WQK6      RTTLISIL-SP-NQNGEGPRIIVLTSACPGDGKTTVACNLSIAMAE-I-GRKVLLIDGDL
A0A2V8XIF4      RTTLTSIL-LP-SQNGDCPGVVVLTSPSSGDGKTTVACNLAIAMAE-I-GRKVLLIDGDL
A0A2V2R0I6      RALRTSIL-LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVVVDADL
A0A2V8XAR9      RALRTSIL-LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADL
A0A2V8VZA0      RALRTSIL-LS-QAGHP-PQVILVTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADL
A0A1Q7CB82      RALRTSIL-LS-QAGHP-PQVILVTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADL
A0A2V8WIU1      RALRTSIL-LS-QAGHP-PQVILVTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADL
A0A1Q6Y9F5      RALRTSIL-LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADL
A0A2V9EVV8      RALRTSIL-LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADL
A0A2V8YF91      RALRTSIL-LS-QADHP-PQVILVTSALPREGKTTVAANLAVTLAQ-L-GDSTVLVDADL
A0A2V8XZK2      RALRTSIL-LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADL
A0A2V8ZTX6      RALRTSIL-LS-QAEHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADL
A0A2V9BT79      RVLRTSIL-LS-QAEHS-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDRTVLVDADL
A0A2V9YHT3      RALRTSIL-LS-SLGAP-PQVILVTSALPQEGKTTTAVNCGIVLAQ-Q-GSRVLLVDADL
A0A7C2XNI7      RALRTSLL-LS-QAEHP-PQVILVTSALPREGKTTAAVNLAVTFAH-L-GDRTVLVDGDL
A0A1Q8B793      RALRTALL-LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDKTLLIDADL
A0A2V9BCA0      RALRTALL-LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDKTLLIDADL
A0A2V9BWU9      RALRTSLL-LS-QAEHP-PQVILVTSALPREGKTTAAVNLAVTLAQ-L-GDRTLLVDADL
A0A2V9DKX2      RALRTSLL-LS-QAEHP-PQVILVTSALPREGKTTAAVNLAVTLAQ-L-GDRTLLVDADL
A0A7C2YQY3      RALRTSIL-LS-TSKHP-PQTILITSGQPREGKTTTALNLAITLAQ-R-GDRVVLMDSDL
A0A3E0NV31      RSVRTSLL-LS-SASEP-PRTILVTSALPAEGKSTTVANMAISFAN-N-NARTLIIDLDL
A0A3N5M5V0      RSLRTSIL-LS-HSGKP-PKVIMVTSSIPGEGKTTTVANTGIVLAQ-T-GARTLLIDLDM
A0A3N5XQP8      RRLRTCLL-LS-HPDQP-PVRILIASAMPGEGKTTTAAYTGVVLAE-T-GAPTVLIDLDL
A0A2Z5G7H4      RGLRTALL-LA-KSSAP-PQLLLITSSVAGEGKSILSANLAAVLAQ-S-GRRVLLVDADL
A0A2V9L5B5      RSLRTSIL-LS-A--SPVPRVILITSALPGEGKTTTAVNLGAALAS-L-GSKVVVIDCDM
A0A2V9LK56      RSLRTSIL-LS-A--NPSPKIVLVTSALPSEGKTTITVNMGATLAS-L-GSKVLVLDCDM
A0A2V9L7I0      RSLRTSIL-LS-A--SPVPRLILITSALPGEGKTTTTVNLGAALAS-L-GSRVVIVDCDM
A0A522PPT0      RSLRTSIL-LS-A--HPVPKVLLVTSALPGEGKTTTTVNLGATLAS-L-GSKVLILDCDM
A0A7C5V1G5      RSLRTSIL-LS-A--SPVPKVLLVTSALSGEGKTTTTVNLGATLAS-L-GSRVVIVDCDM
A0A2V9KCS3      RTTLASIL-FF-EADGNRPRILVMTSSAPGEGKTTVTSNLAIALAE-I-SRRVLVIDADM
A0A372IT17      RTLRASLM-LS-RSSAP-PQVLLVTGTRDAEGKSTIALNLAAILAH-Q-GAQVLLVDGDL
A0A4R1LC91      RALRTSLL-LS-RGGSP-PQSILLTSSIEGEGKTTLSINLAILLAQ-Q-GKRVLLVDADL
A0A3M2BZG9      RSLRTALL-LS-SAEE--LRSVAVTSAEPGEGKTATTTNLGVVMAQ-L-GRSVLIVDCDL
A0A1Q7N5R7      RSVRLSLL-HA-YGTAG-PMVITITSPAVGDGKSFVSTNLALACAQ-A-GQRTMLVDGDT
A0A2V9QB26      RSLLTSIL-FS-GSNGACPRVLVLTSAGPKEGKTMVASNLGIALAE-T-KRKVLIIDGDL
A0A2V9VYY4      RALRTSIL-LS-SFGAP-PKVILVTSAMPREGKTTISANSALVLAQ-R-GSRVLLVDADL
A0A3E0PHB0      RHLRTSLL-FS-SAGKP-PETILVTSSQPSEGKTTTAINTAITLAQ-S-GAEIVIIDCDL
A0A3M1SIV3      RHLRTSLL-FS-SAGRP-PQTILITSSQPSEGKTTIAVNTAVALAQ-A-GADVVLIDCDL
A0A3M2D491      RHLRTSLL-FS-SAGKP-PQTILITSSQPAEGKTTTAINTAIALAQ-S-GADVVLIDCDL
A0A353C9L6      RHLRTSLL-FS-SAGKP-PQTILITSSQPSEGKTTTAINTAITLAQ-S-DVDVVIVDCDL
A0A2V8RQV0      RHLRTSLL-FS-SAGKP-PQSILVTSSQPSEGKTTTAINTAITLAQ-S-DVDVVIVDCDL
A0A2V8SJH5      RHLRTSLL-FS-SAGKP-PQSILVTSSQPSEGKTTTAINTAVTLAQ-A-DADVVIVDCDL
A0A357F267      RHLRTSLL-FS-SAGKP-PQSILVTSSQPSEGKTTTAINTAVTLAQ-S-DVDVILVDCDL
A0A7C5ZUA8      RHLRTSLL-FS-SAGKP-PQSILITSSQPSEGKTTTAVNTAVTLAQ-A-DVDVIIIDCDL
A0A136JPP4      RHLRTSLL-FS-SAGKP-PQSILVTSSQPSEGKTMTAINTAITLAQ-A-DADVVLIDCDL
A0A399WUJ8      RHLRTSLL-FS-SAGKP-PQSILVTSSQPSEGKTTTAINTAVTLAQ-A-DADVVLIDCDL
A0A2V9KIE8      RTLRTSIL-LS-A--HPVPRTILITSALPGEGKTTTTVNLGVALAG-L-GSKVLIIDCDM
A0A352F549      KHLRTSIL-LS-TAGRP-PKTLLVTSSVPAEGKTTTVVNTATVLAQ-T-GAQVLIIDADM
A0A3B9MLP9      KHLRTSIL-LS-TPGRS-PKTLLVTSSVPAEGKTTTAVNTATVLAQ-T-GAKVLLIDADM
A0A3D5SQ87      KHLRTSIL-LS-TPGRS-PKTLLVTSSVPAEGKTTTAVNTATVLAQ-T-GAKVLLIDADM
A0A2V8NW86      RSLLTSIL-FS-GSNGDCPRVLVLTSAGPKEGKTTVATNLGIALAE-T-KRKVLIIDGDL
A0A7C2GJ20      RTLRTSVL-LS-HAEHP-PRTILFTSSSPGEGKTTTAVNTAISLAQ-M-GARVLLIDGDL
A0A7C4BTL5      RVVLTSIL-FS-SENGSRPRVLVLTSAASGEGKTTTASNLAIAMAE-I-RLKVLIIDADL
A0A2V8ZHL8      RTLLTSVV-LS-TAPRP-PQALLITSATAREGKSTTALNLAIALAQ-R-GDSTLIIDADL
A0A2V9B240      RTLLTSVV-LS-TAPRP-PQALLITSATAREGKSTTALNLAIALAQ-R-GDSTLIIDADL
A0A2V9CBM2      RSLRASIL-LS-AAEGP-RNSFLVTSTQPSEGKTTVASNLAIALAQ-L-GRRVLLVDADL
A0A2V8XN17      RSLRTSVL-LS-TPDRP-PSSLLVTSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADL
A0A2V8WX45      RSLRTSVL-LS-TPDRP-PGSLLVTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLVDADL
A0A1Q6YR79      RSLRTSVL-LS-TPDRP-PSSLLITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADL
A0A1Q7VA32      RSLRTSVL-LS-TPDRP-PSSLLITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADL
A0A2V9EY85      RSLRTSVL-LS-TPDRP-PSSLLITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADL
A0A2V9H8K0      RSLRTSVL-LA-TPDRP-PGSLLVTSTQPAEGKTTVACNLAISLGQ-L-GHRVLLLDADL
A0A2V9FFE5      RNLRTSVL-LS-TPDRP-PSSLLVTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLLDADL
A0A2V9GM43      RNLRTSVL-LS-TPDRP-PSSLLVTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLLDADL
A0A2V9CYQ5      RSLRASIL-LS-AAGGP-PNSFLVTSTQPSEGKSTVATNLAIALAQ-I-GRRVLLVDADL
A0A2V9BWU8      RSLRASVL-LS-TADHP-PGSLLITSTQAGEGKTTIATNLAISLAQ-L-GQRVLLVDADL
A0A2V8ZG48      RSLRASVL-LS-TADHP-PGSLLITSTQPGEGKTTVATNLAISLAQ-L-GQRVLLVDADL
A0A2V8Y334      RSLRASVL-LS-TADHP-PGSLLVTSTQPGEGKTTIATNLAISLAQ-L-GQRVLLVDADL
A0A2V9AY68      RSLRASVL-LS-TADHP-PGSLLVTSTQSGEGKTTIATNLAISLAQ-L-GQRVLLVDADL
A0A1F2RFI7      RSLRTSVL-LS-TSGRP-PRVILVTSGQPGEGKTTTVVNLAIALVQ-L-GGRVLVVDSDM
A0A1F2RZS3      RSLRTSVL-LS-TSGRP-PRVMLITSGQPGEGKTTTTVNLAIALVQ-L-GGRVLVVDSDM
A0A1F2USE2      RSLRTSVL-LS-TAERP-PRILLVTSAQPGEGKTTITLNLAISLAQ-L-GQRVLLIDGDM
A0A7C2VB08      AGLRTSVL-LS-AADRP-PRTLLVTSAQPGEGKTTVSTNLAISLAQ-L-GQRVLLIDGDM
A0A2V9C238      RSLRTSVL-LS-TADRP-PRTLLVSSSQPSEGKTTVSINLAISLAQ-L-GQRVLLIDGDM
A0A1F2Q9F5      RSLRTSVL-LS-TPEQA-PRLLLTSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADL
A0A1F2QQH9      RSLRTSVL-LS-TPEQA-PRLLLTSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADL
A0A1F2QXK7      RSLRTSVL-LS-TPEQA-PRLLLTSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADL
A0A2V9DEM9      RSLRTSVL-LS-TADRP-PRTLLVSSSQPSEGKTTVSINLAISLAQ-L-GQRVLLIDGDM
A0A7C5TWV7      QSLRTAVM-MA-AREEGP-QVLMVTSAAPQEGKTTTAFNLAKALAA-G-GSRVLVVDADL
A0A2V7XDY0      QNLRTALI-FG-RKDERG-QIVLVTGTVPQEGKTTTIVNLGKLLAS-S-GEKAVLVDFDL
A0A2V8G155      RTIRTNVL-FA-LPEEAAR-CILVTSTAPGEGKSVIASNLAMSLAH-S-GARVLLVDGDM
A0A2V8HDM7      RTIRTNVL-FA-LPEEAAR-CILVTSTAPGEGKSVIASNLAMSLAH-S-GARVLLVDGDM
A0A2V8DRT9      RTVRTNVL-FS-STADGGQ-SIVVTSSGPGEGKTVVSSNLALALAQ-T-GQRVLLIDADM
A0A2V7VYF3      RTIRTNVL-FS-SVEEGSR-TIVVTSTGPGEGKTVVSSNLALALAQ-A-NQRVLLVDADM
A0A1F2SVH2      RNIRTNLL-FS-SADEGGR-SVLITSTGPSEGKTVVATNLAVALAQ-A-GQRVLLMDADM
A0A2V8AJG9      RAIRTNVL-FS-SAEEGSK-TIVITSTAPGEGKTTVASNIGIALAQ-A-SQRVLIVDADM
A0A2N9LQU7      RVLCNSLL-LT-AADRPPQ-LLVVTSAFPSEGKSVSSCNLAITLAQ-R-GSRVLLVDADL
A0A2P6WFK7      RGLRTSLL-LS-SPDHEPK-IITVVSSVPAEGKTTVSVNLASAFAQ-R-GESVLLIDADL
A0A2V8U914      RATVASIL-SA-EQNGDHHDVLVITSPLAGEGKTTVSSNLGIALAE-V-RGRVLLIDGDM
A0A2V7W309      RAFRTSLL-LA-SANSP-K-IIVITSSFAREGKTTTSVNLATVLAQ-M-GKPVLLIDADL
A0A2W0BGU4      RALRTSVL-LS-VASRAPQ-TVLITSAKIGEGKSSTALNLAMALAQ-C-GSSVVLLDCDL
A0A2W0BVQ9      RALRTSVL-LS-VASRAPQ-TVLITSAKIGEGKSSTALNLAMALAQ-C-GSSVVLLDCDL
A0A2V9MN96      RALRTSIL-LS-SFGAPPK-VVLVTSALPQEGKTTVSANSAVVLAQ-K-GGRVLLVDADL
A0A2V7V2Z1      RLLRTSLS-YS-WPEAASR-ILLVTSTSAGEGKTVTSVNLALILAS-L-GGRVLLVDCDL
A0A2V7X2F7      RVIRTSLN-YS-WPNTVPR-IIVVTSTAPGEGKTLTSVNLSLTLAS-S-EGKVLLIDADL
A0A2V7V2I1      RVLRMALS-YS-WPGQDSR-VLVLTSTAPGEGKTLTSVNLALTLAT-M-DGQVLLLDADL
A0A2V7U3M2      RLLRTSLT-YS-WPESSPR-ILLVTSTSAGEGKTVTSVNLALILAS-L-GGKVLLIDCDL
A0A2V7UHT0      RLLRTSLT-YS-WPDSSSR-ILLVTSTSPGEGKTVTSVNLALILAS-M-GGKVLLIDCDL
A0A2Z5FVL3      RALRTTLL-ST-RGGAPPQ-VLLVTSSTEGEGKSTLSSNLAVVLAQ-Q-GKRVLLVDADL
A0A2V9KBD6      RSVLTSLL-LS-QPTPPV--VIQVTSALAAEGKTTVSANLAILLAR-L-RRRVLLIDADL
A0A2W0AJ66      RALLTSIL-LS-RPTPPA--VIMMTSALPSEGKTTVAMNTAIALAR-L-GRRVLLVDGDL
A0A1Q7RBU1      RALLTSIL-LS-QSTPPA--VILVTSALPREGKTTVSTNLAIAIAR-L-RKRVLLVDADL
A0A2V9JPV9      RAILTSIL-LS-QPTPPA--VILVTSALPREGKTTVSTNLAITLAR-L-RRRVLLVDADL
A0A3P0X3W6      RTMRSLVL-LE-RTREKLR-SVQVTSAVAGEGKSTCTAHLAIAHAM-Q-GRKTLLIDADL
A0A2N9MK30      RTLRNSIL-LS-SFDRQIK-SLMVTSATPGEGKSTVCVHLAMAHAQ-Q-NHRTLLIDCDL
A0A3D1ASD2      RTLRNSIL-LT-DFDRRLR-SVLLTSASPSEGKSTVAAHLAVAHAE-Q-KHRTLLIDGDL
A0A7C5AXI3      RTLRNSIL-LA-DFDRRLR-SLLVTSASPGEGKSTVAAHLAVAHAE-Q-GHRTLLIDCDL
A0A7C6E4H7      RTLRNAVL-LA-DFDRGLR-SLMVTSACPGEGKTTTAAHLAIEHAA-Q-GHKTLLIDCDL
A0A1F2TCR2      RSLRTSLV-FT-GKSEGP-RVIAVTSSQPLEGKTTTACNLAMVLAL-G-GSRVLLIDADM
A0A350UQT3      RTIRSSVL-LT-DFDRRL-RTLLMTSATASEGKSTTAGHLAFAHAE-Q-RKRTLLIDCDL
A0A7C3HRX0      RTLRSSIL-LS-DFDRRL-RTMFLTSATAGEGKSTTAGHLAVAHAE-Q-GRKTLIVDCDL
A0A1F2V330      RMLALKTR-QQ-LSGVRS-PLLAISSVVGGEGKTVTSLNLSLALAGTV-SGRVLLIDSDL
A0A662EE63      QTLRTALM-LA-ARDEGC-QILLVTSSVPSEGKTTASFNLAKVLAA-G-GARVLLIDGDL
A0A2V8TLH7      QTLRTSLL-FS-RKARTA-NAVLVTSAGPQEGKSCTSVNVARTLAN-A-GEKVVIIDCDL
A0A1Q7ZJT1      QTLRTSLL-FS-RKSRGA-NTVLITSAGPQEGKSCTTVNVARTLAT-A-GEKVIIVDCDL
A0A2V8VC99      QTLRTSLL-FS-RKNRSA-NTVLITSAGPQEGKSCTTVNVARTLAT-A-GERVMILDCDL
A0A348UZU3      RSLRTALL-LS-GPLSSL-KSLIITSPLPNEGKSVTISNLAVSLAQ-T-EKKVLLMDADL
Q01XL7          RQTLTSIL-RA-QPKGEC-PVYVITSGGPGEGKTTLSANLAIAMAM-I-GQRVLLIDADL
A0A2V8ERZ5      RSLRTSLL-SK-YQGDAT-KIITVTSAQPLEGKTTTAANIAMALAY-G-GARVLLIDADM
A0A2V8GTX0      RALRTALV-AS-SGTDAT-RLVAITSTQPLEGKTTTAVNVALALAI-G-GARVLLIDADM
A0A2V8J0X9      RSLRTSLV-FT-SGAQST-RIIAVTSSQPLEGKTTTACNLAMALAF-G-GSRVLLIDADM
A0A523DUV7      RTLRASLL-FT-REREHG-NMILVTSSIPQEGKSTTAVNLAKALAE-S-GDPTLVVDFDL
A0A372IRG7      RSLRSSIL-LS-AVDREP-KLLLLTSGFAAEGKSTCSSNLAVSFAQ-R-NARVLLVDTDL
A0A1F2U158      RSLRTSIA-SR-YPGEGA-KTMIVTSAQPLEGKTTTAANIAMALAY-G-GARVLLIDADM
A0A2V8F6S9      RALRTSLV-SK-YPGAGT-KVLLVTSAQPLEGKTTTAANVAMALAY-G-GSRVLLIDADM
A0A7D8BEX2      QMVRNALL-MA-KPDERN-NLFMVVSTVPAEGKSTIARETAATFAE-H-GSKVLLIDGDL
A0A4Q1SCH5      RTLRNSVL-LS-SIDMPP-RLMLVTSSLPGEGKSSTSANYAVVLAQ-N-GAKVLIIDADL
A0A2V8K4L4      RAVLTSIM-FS-EQRP---RVVVISSANPSEGKTTVSTNLSIALSE-I-SQRVLLIDADM
A0A2V8NCZ3      RTVLTSIM-FS-EQRP---RVLVISSANPSEGKTTVSTNLSIALSE-I-SQRVLLIDADM
A0A4Q7YNP3      RSTTFSIL-LT-GNSSNRARVYVVTSPNAGDGKTTVTSNLGVALSK-S-NLRVVILDGDL
E8UZE1          RVLRSALL-LS-HAGNPP-QLIVICSAWTKEGKSTITINLATVLAQ-M-NRKVLLVDADL
A0A2U3JZ71      RTLRNSIL-LT-DFDRRI-RSLMITSSGPAEGKSTTAAHLALAHAQ-Q-GRKTLLIDGDL
A0A2V8TTB0      RTLRTSIL-LT-DFDRSL-RSVLLTSASPSEGKSTVAAHLAATHAG-Q-HKRTLLIDGDL
A0A1V6HR88      RALRTALL-LS-TASEL--KVIVITSSIPGEGKTSTASNLAIVLAQ-L-GKNVLLIDGDL
A0A3E0P0A3      RALRTATL-LS-KADEP--RLLVVTSTEAQEGKTATALNLAIVMAQ-L-ARRTLLIDGDL
A0A2V8EXP2      RAVRTNVL-FS-SADEGP-KVIVVTSAGPGEGKTLVASNLAVAMAQ-A-AQRVLLMDADM
A0A2W4RYA1      RMLRTNLL-FA-RADPDM-RSVMVTSTGVGEGKSVVAGNLAVAIAQ-T-GQRVLLVDADL
G8P0Y7          RALRTSIL-LS-SVSHPP-RSILVTSSVPEDGKTMTSINIAIVMAQ-Q-EKRILLVDADM
A0A5M8T4U7      RGLRSSLL-LS-SIDKPP-RVIAITSAFPGEGKTTTAVNCALALAQ-R-GERVLLVDADL
A0A7D0PPG7      DTLLTSIL-ID-PREKPL-HSILVTSAAPGEGKSSCVAHMAAAFAR-H-GHRTLLIDADL
A0A7D8BF18      RALRTSLL-LS-VAGGEP-QTILLTSATPAEGKTTVSMNLATVLAQ-R-GVRVLLIDADL
A0A1E3Y9R6      RAVRTAVL-FS-SAEDGA-RSVVVTSTGPHEGKTVVSSSLAITLAQ-A-GQRTIVVDADM
A0A2W4TLP2      RAVRTAVL-FS-SAEEGA-RSVVITSTGPHEGKTVVSSSLAIALAQ-A-GQRTVVVDGDM
A0A7C4BZ42      RATLTSIL-LS-GQNGERPRVIALTSAGPSEGKTTAASNLAIALAE-T-NRRVLLVDADM
A0A3R9WF43      RTLRTSIL-HS-HSVTRL-QTLLVTSPHGGDGKTTVAYNLAVAFAQ-Q-GSRVVLLDADL
A0A317HKM4      QAARTNLI-MA-PELARP-HILLVTSSEPGEGKTVTAANLAASLAG-L-HQRVLLIDADL
A0A2V9CG11      RATVTSIL-LA-NQNGDLPQVIVVTSPCQGEGKTTVASNLSIAIVE-L-GRRVLLIDGDL
A0A523E0N1      RFLRGSML-LS-TPNAVP-KIVLVTSPDKNCGKTFISSNLSCALGQ-L-DKKVLLIDSDL
A0A523ECP2      KFLRGSLL-LS-TPGRPP-RTVLVTGPDKNAGKTFVACNLATSLAD-L-DKKVLLIDADL
A0A2W0C122      RSLGTSIL-LA-SRDL---KSLLVSSPLPAEGKTMTAANVAVVLAQ-Q-GKAVLLVDADL
A0A2W0AUU7      RALGTSVL-LA-SADL---KSLLVSSPLPGEGKTMTAANLAVVLAQ-Q-GKRVLLVDADL
A0A2W0BQL1      RALGTSVL-LA-SADL---KSLLVSSPLPGEGKTMTAANLAVVLAQ-Q-GKRVLLVDADL
A0A4Q1SDL1      RGLRASLT-PT-RTTMEPPRVVVVTSASPGEGKSLTAKNLAVSTAQ-Q-GKRVLLIDADL
A0A3P0XH15      RTLRSSIL-LS-AVDREP-KLILLTSSFATEGKSTCAANLAISFAR-R-SARVLLVDTDL
A0A4R1LAZ7      RNLRSTIL-LS-AVDTQP-KVLLLTSSFAAEGKSTCASNLAISFAQ-R-NARVLLVDTDL
A0A3M1WQW8      RSLRTSVL-LS-HAERPP-RTILFTSSSPGEGKTTTAVNTAISLTQ-T-GARVMLIDGDL
A0A3N1JHC1      RSAGASIL-FS-RNGGMAPKVLLVTSPHPRCGKTVTIANLAISLAE-G-GRRVLLIDGDL
C1F294          RTLRSSIL-LS-SVDREP-KAILLTSGLAAEGKSTCAANLAISFAQ-R-PARVLLVDTDL
A0A2V9KA79      NILAMKIR-SQ-LGDENG-RVLTITSAAGGEGKTLTSVNLSLALASTF-EGQVLLVDADL
A0A522PSP1      LGIRSTLL-LG-ASGNSM-RALAVISSRPEEGKTTIAMALAMSMAA-L-GRRTVLVDGDL
G8P085          RNLRNALL-LS-SIDRPA-KMLLVSSTIPGEGKSSTTANYGVVLAQ-K-GARVLLVDADL
A0A7C6A629      RTLRNSIL-LA-DFDRGL-RSLMVTSACPAEGKTTTATHLALAHAT-Q-GHKTLLIDGDL
A0A4Q1SGQ1      CSLRTSLL-RL-RDGDSS-QVVLITSAVAGEGKSTIAANLAGVLAQ-S-GERVLLVDADL
Q1ILD9          RTLRTSIM-LS-FPSRPP-KSLVVTSALPGEGKSTISMNVAGTLVQ-R-GARVLLVDADM
A0A7C5SHM3      RAMRSALL-LA-QAERPP-ASLMVTSALPGEGKSTIAANLARTLAS-F-GHSVVMIDADL
Q1IJZ6          RSLRTTLL-LS-QAGSAP-KSLLLTSSLPGEGKSTTTYGLGRCFGS-L-GTRVLLIDADL
A0A2V8TCE6      RDLRTALS-LS-SAGSTP-RSLTVASTRPEEGKSTIAINLATVLAQ-S-GKKVLLVDSDL
A0A522TBE8      VSLQSAIL-LG-AAEA---RVVAITSALPAEGKSTAAGHLAASMAQ-M-GQSTLLVDGDL
Q1ITG0          RALRTSLL-LA-NAGAPP-KVIMITSAQPGDGKSTVSVNISAVLAQ-S-GARVLLVDADL
A0A7C2ML20      RTLRTSVL-LS-SATHPP-RSILITSHEARAGKTTTAVNVAIALAQ-T-GKRVLLIDADL
A0A7C5AXS9      RATLTSIL-FS-SKNGHAPKVLVFTSPNPREGKTSMVSNLGLALAE-I-HRRVLLVDADL
A0A7C2RGE3      RTLRTSVL-LS-HAEHPP-RTILFTSSGPGEGKTTTAVNTAISLAQ-M-GARVLLIDGDM
A0A3N5PCI5      RALRTNVL-AS-AGGGTTGRSLLVTSAAPGDGKSIVAVNLAVALGR-S-GGRVLVIDADL
A0A3M1Q0S9      RELRTAVL-LA-MPDHPP-RTLAVTSCQPGEGKTTTAINLATTLAQ-L-GRRVLVVDTDL
A0A2Z5G448      RTLRSSIL-LS-SADNEA-RLILITSSLEAEGKSTIAANLAISFAR-R-DARVLLVDTDL
A0A3M1VZ38      RELRTAVL-LA-TPGHPP-RDLTVTSCQPGEGKTTTAVNLAIALAQ-L-GRQVLLVDSDL
A0A4Q1SD29      RTLRSSIL-LS-AVDNEM-KLLLITSSFAAEGKSTCAANIAISFAQ-R-SARVLVVDTDL
A0A6N9FGE2      RSVRTNLI-FS-SADEGS-RAVLVTSAAPSEGKSCISANLAIALAQ-L-GRKTLLVDADL
A0A3M1PY35      RTLRSSLL-LS-HPGGPP-RVLMVTSALPGEGKSTFSANLARTLAA-F-GDRVVLLDADL
A0A3M1VMP2      RALRSSIL-LA-QPQHPP-RSLLVTSALPGEGKSTIAANLARTLGA-F-GRKVVLIDADL
                                               **:      .            :.:* * 

A0A2V7VMF7      RRAQIHQRLE-I-S-RA---PGFTDYFVRHE----DLDSLIQS--TRVPNLFALTAG-PL
A0A2V7YYV7      RRPAQHRMFARI---RN---VGLSNLILQDA----AESEAIAT-VESVPNLCVLTSG-PT
A0A2V7Z0J5      RRPAQHRIFARV---RN---IGLSNVIIQDA----AEEETITA-VDAVPNLWLLTSG-SI
A0A2V7Z3M4      RRPSQHRMFGRV---RN---VGLSNVILGAT----TEEATVIA-VDSVPNLWLLTSG-PT
A0A399Y5V2      RRPRVHKFFE-L-R-NT---EGVTTAILAERPLVDL-LQRPRI-AGAPPSLLALTSG-PI
Q01X01          RRPRLHKVFD-Q-A-NS---WGLSDLLREKNAIEDLPLDVLVK-KTAVPRLSLLPSG-TG
A0A3M2D9H8      RQPQVHERLR-L-P-NR---LGLSDILREHS----TLDESLHH--LTTEGIDVLTSG-TL
A0A2V8JK38      RRPRMHKIFK-C-A-NA---NGLSSVLEGHC----SLENAVSE--TNIKNLFLLPSG-PV
A0A2V9IXG5      RKARLRSILS-TGKQNG---NSIFSPVEGLK---------LRVEQTQLPSLHLTVAE-SL
A0A2V9J2P4      RKARLRSILS-TGKQNG---NSIFSPVEGLK---------LRVEQTQLPSLHLTVAE-SL
A0A1Q7RLS4      RRPAIHTRLN-L-G-RD---GGVTNYILSSE--GDDWRSYIKN--TDMPNLYAMTCG-PI
A0A2V2R525      RQPTLHEIFQ-L-D-NS---HGLSTLLAGKN-NQAEMLSLIHQ--HEETGLYVLPAG-PP
A0A321LPW6      RRPSAHKLFK-L-P-NT---AGLSTYLSREI-DVEALIHTQ-----ELKNLSLLPCG-PI
A0A2V9R9V4      RNPSVHDVFG-T-S-RT---LGLSTYLVRNV-EIDELTQDL-----PGENLRMISSG-PI
A0A321LE75      RKPSTHKALG-I-D-HS---HGLSNYLSRDV-AIDGLIQKL-----PIPNLSILTCG-PI
A0A2V8R8U7      RRPRLHSHFN-L-S-NT---RGLTNCLSGES-EVADLLQTY----DKLPKLKLLTSG-PI
A0A2V8QMP4      RRPRVHAHFG-L-P-NS---RGVTNYLSGEA-QVSELVQTY----DKLPNLKVITSG-PV
A0A2V8R4S3      RRPRVHAHFG-L-P-NS---RGVTNYLSGEA-QVSELVQTY----DKLPNLKVITSG-PV
A0A2V8NJ55      RRPRIHTHFN-I-S-NV---KGLTNCLSGDL-NTDELIQAY----EKLPNLKIMTSG-PV
A0A2V8Q7I0      RRPRLHAQFE-I-S-NA---RGLTTWLSGEK-DLDGIIQTC----PRVPHLKILTSG-PV
A0A2V8S6K4      RRPRVHMHFN-L-P-NT---RGVTNYLSGEI-NVSELIQTY----DKQPNLKVITSG-PV
A0A317I2L9      RRPRLHAQFE-V-S-NA---RGLTTWLSGEK-DLDGLLQSL----PRNPNLKILTSG-PV
A0A2V8LLF9      RRPRLHSQFN-L-P-NS---RGLTNCLSGDGKDLDALLHVY----DKQPNLKLLTSG-PI
A0A352FRF4      RRPRLHAHFN-I-S-NA---RGLTNCLSGEASEIDSVIQSY----AALPNLKLLPSG-PM
A0A2V8MKV0      RRPRLHSNFN-I-S-NV---RGLTNFLSGEL-PLDEVIQPF----EKLPNLKLLPSG-PI
A0A2V8PYY8      RRPRLHSNFN-I-S-NV---RGLTNHLSGEL-PLDEVIQPF----DKQPNLKLLPSG-PI
A0A1Q7YKQ8      RRPRLHAQFN-I-P-NA---RGVTNYLSGEA-GLDELIRSY----DKLPNLKLMTSG-PV
A0A352F3R7      RRPRLHAHFN-A-P-NN---KGLTNWLSGET-DIDNLMQTL----PAQPNLKFLTSG-PV
A0A0B6WXT1      RRPRVHVHFN-L-A-NA---KGVANYLAGER-NLDALMQTY----APLPNLKIMTSG-PV
A0A3B9MEU8      RRPRLHAHFG-A-P-NS---KGLTNWLSGET-DIDALIQTY----EQHANLKFLTSG-PV
A0A2V8MHG6      RRPRLHSIFD-V-D-ND---KGLSGILASKM-TEGEMLGCVQQ--HEESSLYLLPSG-RL
A0A2V8P7N1      RRPRLHSIFD-V-D-ND---KGLSGILASKM-SEAEMLNCVQQ--HEESSLYLLPSG-RL
A0A2V8M3M6      RRPRLHSIFD-V-D-ND---KGLSGILASKM-SEAEMLNCVQQ--HEESSLYLLPSG-RL
A0A1Q7NJH5      RRPRLHSIFN-V-D-ND---KGLSGILASKM-SEREMLGWVQQ--HEESSLYLLPSG-RL
A0A2V8PJY0      RRPRLHSIFN-V-D-ND---KGLSGILASKM-SEREMLGWVQQ--HEESSLYLLPSG-RL
A0A1Q7Y6W9      RRPRLHTIFE-T-E-NR---KGLSTYLSSDM-SDAELLDMIEQ--HGASGLHYLTSG-PV
A0A2V8NC68      RRPRLHSIFG-L-K-NE---SGLSTILANKM-SEAEMLSLVEQ--HEESGLYMLSSG-PI
A0A399WK13      RRPRLHSVFG-I-S-NA---DGLSTILSNDL-SEAEILNIITQ--DESSKLHLLTSG-PV
A0A352FLX4      RRPRLHSIFN-L-S-ND---SGLSALLSREA-SEAEIISAIQH--DEASGLSVLTAG-PV
A0A2V8RTL7      RRPRLHSVFN-V-S-NN---QGISTVLSSEL-STKEILDVINY--DERTKVSVMTSG-PI
A0A3E0PCJ6      RRPRVHSFFN-L-G-NA---EGLSTVLSSDL-AEKEILNLVKK--DEASGLYLMPSG-PL
A0A3M1S4R8      RRPRIHSIFN-I-S-NR---EGLSNLLSSEI-KRDKVLDSVYF--DMSSRLYLLPSG-PV
A0A7C2G442      RRPRIHSIFN-I-S-NR---EGLSNLLSSEI-KRDKVLDSVYF--DMSSRLYLLPSG-PV
A0A1Q7YFI6      RRPMLHTLMN-L-D-NA---RGLSTILSTDM-SAAEMLSLIEQ--QAGSGLYLLSSG-PV
A0A136KC10      RRPRLHSVFG-I-G-NA---DGLSTILANEL-SEAEILNLITQ--DPSSKLHLLPSG-PI
A0A3M2D6Y5      RRPRVHSIFN-V-Q-NR---EGLSNLLSSEI-KADKVLDKVQF--DSAAKLYILPSG-PV
A0A2V8SEX6      RRPRLHSVFN-I-E-NG---DGLSTILSTEM-TEKEILKVVKQ--DEGTKLNLLTSG-PI
A0A7C5ZUU4      RKPRVHSVFD-I-T-ND---EGLSTVLSSNL-SDREILDIIKY--DERTKLSILTSG-PI
A0A0B6WWQ6      RRPKLHELFG-L-K-NE---RGLSTLLSSEI-RNGDAFKCIH---DSARGVQVLTSG-PL
A0A3B9MK99      RRPRLRSIFG-L-S-DR---AGLSSILSSDV-SEADMLEMVST--DEATGLRVLTSG-PI
A0A352EX26      RRPRMRSIFG-F-S-ER---PGLSSILSSDV-SREDTLAMISK--DEVTGLHVLTSG-PI
A0A2V8MM59      RRPRLRSIFD-L-A-EQ---TGLSSILSSAM-TEAEMLGSVHQ--DEASGLHVLSSG-PI
A0A2V8PFE8      RRPRLRSIFD-L-P-ER---EGLSSILSSEI-KPEDMLHAIHR--DEATGLNVLASG-PI
A0A2V8PWS6      RRPRLRSIFD-L-P-ER---EGLSSILSSET-KPEDMLHAIHR--DEATGLNVLASG-PI
A0A2V8LCT5      RRPRLRSIFD-L-S-ER---EGLSSILSSEM-KPDQMLGAIVK--DPTTGLNVLTSG-PV
A0A352FTJ9      RRPRLRSIFD-L-P-ER---DGLSSILTSEA-TPEDMLRSVAR--DESSGLFVMSSG-PV
A0A257VBK0      RRPSIHRILK-----APAGVRGLTNYLAERT---AQIEDFVVP--GPQPNLFVLYSG-PT
A0A2G6PYV5      RRPKLHKIFN-L-P-NA---KGLVTSLVKGK----SPIDFIQS--TKIPHLFLLSSG-PL
A0A2V8F956      RKPQVHDIFE-V-A-QE---PGLSNLLAGQA----KASESVRK--TAIPGLWVLTSG-RI
A0A1F2S1W5      RKPRVHEVFG-V-P-SS---PGLSNLMVANA----TASEVIQE--SSTPGLWVLSAG-TH
A0A1F2T595      RKPRVHEIFS-R-R-VD---PGLSNLLVGNA----TASESIFE--SEIPGLWLMPAG-TH
A0A2V8JQV5      RRPDLHRIFH-A-E-NR---WGLIDILQGDIEIRDYPLDMLAR-QTEVPNVHLLTSG-TA
A0A2V9AC41      RRPRCHMLLK-M-E-NT---AGLADVLAGQI----GMEEAIRP--TQAENLFLISAG-TI
A0A2V9MAM9      RQPRIHHIFD-L-P-NT---WGFSNLLRGAD----ELPMDTIVKRTTVPNLYVLSSG-PG
A0A348V070      RKPRQQEIFN-V-D-YT---WGLTHFLSSIV----DASEIIRP--TAYTNLFVVPSG-VT
A0A2V9M454      RRPGLAKALK-L-----RNQNGLAEILTGAC----EFDETLLEKVEGLDRLSLLPAG-PY
A0A2V9IVR7      RKPGIAAAMG-M-----SNERGLSNILRGEQ----SVDEVLLQ-AHTLPNLWVLPAG-PV
A0A2V9ILE2      RKPGIAAAMG-M-----SNERGLSNILRGEQ----SVDEVLLQ-AHTLPNLWVLPAG-PV
A0A2V9LGY4      RKPGIAAAMG-M-----SNERGLSNILRGEQ----SVDEVLLQ-AHTLPNLWVLPAG-PV
A0A2V9J4D6      RIPGASKLMG-I-----SNSKGLSGILTGAY----SVDEALQE-VKGQPGLWALPSG-PP
A0A2V9L9C5      RIPGASKLMG-I-----SNSKGLSGILTGAY----SVDEALQE-VKGQPGLWALPSG-PP
A0A2N9M9N1      RKPTVLRALG-MGN-GESEANGLSSYLAGGQ----GIDSALMS-FTALPNLSVLPSG-PV
A0A2V9JEC4      RRPGVARALS-L-----DGKKGLSTVLTGGH----QIEVALET-FQNLSTLSILCAG-PV
A0A2V9LPQ3      RKPGVTRELN-L-----PSTKGLSGVLTGRY----SLDEALRE-VEN-TSLSVLPAG-PT
A0A2Z5G3A3      RRPKLHTTFD-V-A-ME---GGLSSILSGSS-SEKDSSQYSAP-VTSLPNLKLLVAG-AP
A0A2V7UGP8      RRPRLHKALG-S-G-NG---HGLSSYLSGNA----ELDPIIQE--TEIPNLFLVSSG-PV
A0A239MKT6      RRPTIRERVN-L-Q-QG---RGLSDLLSLNL----ELDEVLQQ-HPNQDNLFIIEAG-TI
A0A3E0PCN7      RCPKMHLIND-L-S-NT---TGLSTLITADYLSDERIDNAIRK--EVDYCLDVLPSG-PR
A0A2V8IYW3      RRPTLHTIFK-L-E-SP---CGVNEYVHSHG------AKPLEL-LPVAPRLFLLPAG-RP
G2LEI9          RRPQLQKLFDSYGQ-ERTFQPGLSRYLSGQC----KIGEIFTP--SPIPYLTLITCG-QM
A0A317J121      RRPRLHKVFD-L-A-DT---WGLTNILEEGS----AAPERFGL-LTTVPGLFVMPNG-PK
A0A2V7YW66      RKPRLHQVLR-V-S-NR---HGLVNQLTATG----EE--AIFP--TEVPNLWITPSG-PI
A0A2V7Z0V0      RKPRLHQVFR-V-S-NR---FGLVNQLTATA----ESETVFLP--TEVPNLWLTPSG-PI
A0A2V8GFD4      RRPKIHQLFA-L-D-QE---AGLSNVLIGSA----KANDAVKK--TTVPKLWVLPAG-RV
A0A2V8HSS5      RRPKIHQLFA-L-D-QE---AGLSNVLIGSA----KANDAVKK--TTVPKLWVLPAG-RV
A0A2V8KP55      RRPRMHKIFK-C-A-NA---NGLSSVLEGHC----SLENAVSE--TNIKNLFLLPSG-PV
A0A399WNU1      RCPKMHLINN-I-D-NS---CGLSTLLTAEEVDQDLVDRAVTK--SSEPDLDILPSG-PR
A0A2V9JSI3      RKPGVASVLG-L-A-NG---KGLSSILTGAH----GLEEALQQ-LDALPGLWVLPGG-PR
A0A2V9WI32      RRPGVHKALG-L-R-NT---SGLSTLLTGGD----GSQNAILS--TEIPNLFVLTAG-PP
A0A2V8IVN9      RKPKLQEAFG-M-T-QE---PGLSNLLVGTA----KASESVRR--SKTAGLWLLPAG-KI
A0A7C5Z4J3      RQSSLRRMIN-T-N-GR---PGLSSILTGTA----ASEAALCQ-VKDLPNLRFLPAG-QQ
A0A1F2TPT3      RRPMIHTHFA-F-P-QE---PGLSNVLVSGA----KAGEVVRR--SAVANLWVLPAG-RC
A0A2V8JTQ2      RRSQIHLAMR-L-S-GN---TGLGPLLRNTV----TFEEAVVS-WANVPNLFILPAG-PV
A0A2V8UZY0      RRPSIHRAMR-L-S-CN---TGLGALLRKSV----TFDEAVIQ-RAEVPNLYILPAG-PV
A0A350UEK1      RRPRQHGIFE-V-P-ND---AGLTDLLKPGD----GDWKKLIH-ESGAPGLWVLPAG-PG
A0A350UIQ4      RRPRIHGIFE-I-E-NE---AGLSDLLKPDC----GEWKKLIH-QTPVPNLSVMTAG-PG
A0A1H5Z7N3      RRPTVHHRFG-L-N-GK---IGLSSVLTGSA----TLEQALQR-VPELPNLDVLVSG-PV
A0A1G7JVV8      RRPNVHHRFG-L-N-GR---VGLSTVLSGGA----TLEEAVKN-VPEVPNLDVLCSG-PV
A0A1H4T6W9      RRPNVHHRFG-L-N-GR---VGLSTVLSGGS----TLEDAVKN-VPEVPNLDVLCSG-PV
I3ZEU5          RRPNVHHRFG-L-N-GR---VGLSTVLSGGS----TLEEATKN-VAEIPNLDVLCSG-PV
A0A1I6MH75      RRPNVHHRFG-L-S-GK---VGLSTLLTGTT----GLEESLQR-VPEVPNLDIMASG-PV
E8WVF6          RRPNVHHRFG-L-N-GK---LGLSTILSGQT----TLENSVQT-LKEVPTLDILASG-PV
A0A7D0PQC3      RRPNVHHRFG-L-A-GK---LGLSTILSGSS----TLENSVQN-VPEVPNLDVLASG-PV
A0A428MDU2      RRPNVHHRFG-L-N-GK---VGLTTLLTGAS----KLKDTVQN-IPNVPNLDILPSG-PV
A0A5B9EBI2      RRPSVHHRFG-L-N-GK---VGLSTVLSGST----SLEEAVQQ-VADVPNLDILASG-PV
A0A239HDF6      RRPAVHVRLG-L-E-GR---LGLSTYLSGSS----TLEESLQH-LDELPSLDILTSG-PV
A0A4Q0T270      RRPNVHHRFG-L-S-GK---VGLSTVLSGGS----TLEDSLQH-VTEVPNLDILASG-PV
A0A1Q3QQB6      RRPSVHHRFG-M-S-GK---TGVTTVLTGAA----PLEEAVQT-VPEVPNLDILPAG-PM
A0A3N1K1G7      RRPNVHHRFG-L-N-GK---VGLTTVLTGAT----TLEDTVQH-IPDAPNLDILPSG-PV
A0A4V2G466      RRPTVHQRFG-L-T-SK---IGLSTLLAGAT----TLEAAIQK-IPEVPNLDVLVSG-PM
A0A6B9YNQ8      RRPTVHEQFG-L-S-AR---VGLSSVLTGST----PLEQAVQQ-ISSVPNLDVLVSG-PM
A0A3N5YNR8      RKPALASTFG-Y-N-GN---QGISAYLSGNG----DLSSQIRQ--TNYPNLFLLPAG-FR
A0A3N6A5T6      RRPKIGSHFG-L-N-GH---QGMSYFLTGNS----DLTSQVRK--TSVPNLFVVSAG-YV
A0A1F2Q9L4      RKPRLHEIFG-V-S-NR---LGLVNFLTGSA----DETGIFLR--TSVPNLYLTPTG-PV
A0A2U3KC61      RRPSIAKLFG-F-Q-SR---GGLSTLISGSD----KVEDVVIP-CPEVPNLWVLPAG-PI
A0A2V9Y2R7      RRPGIGKMFG-I-R-SG---GGVSTVISGVE----KFEDVVVP-FTQVPKLWILPAG-PI
A0A2V9NGH6      RRPSIHKTLG-M-G-PR---TGLSSVLTGSA----NVQQTIVR-SALLPSLFILPAG-PP
A0A2V9PYE6      RRPSIHKTLG-M-G-PR---TGLSSVLTGSA----NVQQTIVR-SALLPSLFILPAG-PP
A0A2V9NL07      RRPSIHKTLG-M-G-PR---AGLSNVLTGGT----TLQQATVR-STLLPNLFILPAG-TP
A0A2V9QD92      RRPSIHKTLG-M-G-PR---AGLSNVLTGGT----TLQQATVR-STLLPNLFILPAG-TP
A0A2V9WPZ6      RRPGVHKALG-M-G-PR---SGLSNILTGSA----TLQQAITR-SPLLPNLFVLPAG-TP
A0A2V9ZLH4      RRPGVHKALG-M-G-PR---SGLSNVLTGSA----DVQQTITR-SQVVPSLFVLPAG-TP
A0A2V9RQF1      RRPSIHKTLG-M-G-PK---IGLSNVLTGNA----PLQQAIVR-SNVLPSLFVLPAG-PP
A0A2V9YDK8      RRPGVHKTLG-M-G-PR---SGLSNVLTGSA----TLQQTITR-SPLVPSLFVLPSG-TP
A0A2V9V8F7      RRPGVHKALG-M-G-PR---SGLSNILTGSA----TLQQAITR-SPLLPNLFVLPAG-TP
A0A2V9XGR9      RRPGVHKALG-M-G-PR---SGLSNILTGSA----TLQQAITR-SPLLPNLFVLPAG-TP
A0A2V9V3Q5      RRPSVHKTLG-M-G-PR---SGLSNVLTGNA----TLEQAISP-SPILPNLFILTAG-SP
A0A2V9NWS3      RRPSIHKALN-I-A-TK---IGLSNVLTGNA----TMSQATVR-STILPTLFVLPAG-PP
A0A2V9USA9      RRPSIHKTLG-M-G-PR---SGLSNVLTGST----TLQQAITR-TPILPNLHVLPAG-TP
A0A2V9XW18      RRPSIHKTLG-M-G-PH---SGLSNVLTGST----TLEQAISD-TTILPNLFVLPAG-TP
A0A1H5SQF5      RRPTLHTKLG-L-T-NG---SGLSQCLTSDI----DPASVIQV-HPDMDKVHVMTSG-PV
A0A2V9AEW6      RRPRIHQVFG-M-T-NR---WGLNDVLLSDTPFEEFPMSHLAR-KTEVAGLSVLPSG-NC
A0A2V8WQK6      RRPRLHKIFG-V-A-NT---WGLSDLLWADNPLETVPISHLVR-ETEVSSLSLLPGG-SC
A0A2V8XIF4      RRPRLHKVFG-A-P-NN---WGLSDVLWGDTPLETLPISHLVR-ETEVAGLSLLPGG-SC
A0A2V2R0I6      RKPGVGRLLN-L-S-NN-KYAGLSSYLAGAS----SLDLVTVP-HPAIPNLAAIPTG-PL
A0A2V8XAR9      RKPGIGRLLN-L-G-SG-KYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTG-PL
A0A2V8VZA0      RKPGIGRLLN-L-A-GG-KYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTG-PL
A0A1Q7CB82      RKPGIGRLLN-L-A-GG-KYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTG-PL
A0A2V8WIU1      RKPGIGRLLN-L-A-GG-KYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTG-PL
A0A1Q6Y9F5      RKPGIGRLLN-L-A-AG-KYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTG-PL
A0A2V9EVV8      RKPGIGRLLN-L-A-AG-KYAGLSSYLAGVS----SLDFVSVP-HPAIPNLVAIPTG-PL
A0A2V8YF91      RKPGIGRLLN-L-G-PG-KYAGLSSYLAGAS----SLDLVSVP-HPSIPNLVAIPTG-PL
A0A2V8XZK2      RKPGIGRLLN-L-G-TG-KYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTG-PL
A0A2V8ZTX6      RKPGIARLLN-L-G-GG-KYAGLSSYLAGVS----SLDLVSIP-HPAIPNLVAIPTG-PL
A0A2V9BT79      RKPGIGRLLN-L-G-AG-KYAGLSSYLAGVS----SLDLVSIP-HPAIPNLVAIPTG-PL
A0A2V9YHT3      RRPAVHHSLG-I-R-S--NGGGLSTLLAGQH----SAEEVLVR-SNQLSNLYVLPAG-PP
A0A7C2XNI7      RKPGIGKLLS-L-S-DGSRHAGLSTYLAGVS----SLDLVTIP-HPVIPNLAAIPSG-PI
A0A1Q8B793      RKPGVGRALS-L-G-EG-KYAGLSSYLAGVS----SLDLVTVP-HPAIENLAAIPTG-PL
A0A2V9BCA0      RKPGVGRALS-L-G-EG-KYAGLSSYLAGVS----SLDLVTVP-HPAIENLAAIPTG-PL
A0A2V9BWU9      RKPGISRALS-M-S-DG-KYAGLSSYLAGVS----SLELVTVP-HPAITNLAAIPTG-PV
A0A2V9DKX2      RKPGISRALS-M-S-DG-KYAGLSSYLAGVS----SLELVTVP-HPAITNLAAIPTG-PV
A0A7C2YQY3      RRPRVHRSFN-I-S-ND---VGLSSFLAGVV----GIDDLPRA-VTHIPNLFVIPSG-PT
A0A3E0NV31      RKPALAPLFE-V-D-SE---NGMSKFLAGRA----EFADLLQQ--TKHKNLALVSAG-PC
A0A3N5M5V0      RKPALAGTFG-F-T-GN---QGISSYLSGNA----DLSSQIRQ--TSYPNLFLLPSG-FR
A0A3N5XQP8      RRAGLTGLFE-I-E-NK---WGMSVYLSGHS----DLEQEIQP--TGVPNLSILPAG-LR
A0A2Z5G7H4      RKPSLGDRLG-M-E-SR---TGLSQYLTDER----SPEDILEV--GRLPKLHLLTSG-PV
A0A2V9L5B5      RRPSCHRSVG-V-K-NS---PGFVQCLTGHV----ELAEAVLP-APGVPNLSVIPCG-PI
A0A2V9LK56      RRPTCHRATG-V-P-NR---PGFVQCLAGRV----ELKQAIFP-VPGTENLFVIPCG-PI
A0A2V9L7I0      RRPACHRSTG-V-R-NA---PGLVQCLTGKG----DLAQAVLP-VPGVANLNVIPCG-PI
A0A522PPT0      RRPACHRATG-V-R-NS---PGFVQCLTRRV----QLSEAILP-VNGIPNLSIIPCG-PV
A0A7C5V1G5      RRPAVHRAAG-V-K-NS---PGFVQCMTGRV----TLSQAILP-LSGVPNLYIIPCG-PI
A0A2V9KCS3      RRPRIHDIFD-V-A-NT---WGLSDLLREKDAVDDYPFEALSR-KTLIPGLYVLPSG-PG
A0A372IT17      RRPALHRYLN-M-P-ES---PGLSEALAGSA-----APPEPQP-LTALPSLALLHAG-RK
A0A4R1LC91      RRPSLHKSFN-V-S-DT---LGLSSVLAGQIDSYLDAGTTAPL--KQVPTLHVLPAG-PI
A0A3M2BZG9      RRPRMHQVFK-T-S-NR---LGVVNHLTGTE----RAEDLVLP--TAVPNLYLCPSG-PI
A0A1Q7N5R7      RRGALHRVLG-G-V-RK---PGLTDFLAGRV----PLEAVKQA--LPYPLLHFIGAG-SR
A0A2V9QB26      RKPRMHELFG-L-P-NG---RGLSSLLRDPQRALAKLSRIVQE--TNIPGLFVLTSG-PL
A0A2V9VYY4      RRPGVEKLFG-V-R-AH---GGLSTLISGSS----NVEEVILP-SSEVPNLWILPAG-PI
A0A3E0PHB0      RRPRLHSLFD-L-E-NT---HGLTNYLSGER----NTDNLLKP-YPKLPNLKVITSG-PI
A0A3M1SIV3      RRPRIHQHFS-L-K-NS---VGLTNYLSGDQ----ELQDLLKS-PEGLPKLKIITSG-PL
A0A3M2D491      RRPRIHEHLS-L-S-NK---TGLTNYLSGDQ----SLEGLLKP-IPELPNLKVITSG-PI
A0A353C9L6      RRPRLHSHFD-L-E-NT---QGLTNYLSGER----NTQNLIKT-CRDLPRLKVITSG-PI
A0A2V8RQV0      RRPRVHSYFD-L-D-NT---QGLTNYLSGER----NTENLIKS-SRELPRLKVITSG-PI
A0A2V8SJH5      RRPRLHTYFD-L-E-NT---QGLTNYLSGER----NTEHLIKT-CRELPRLKVITSG-PI
A0A357F267      RRPRLHSYFD-L-D-NT---HGLTNYLSGER----NTDNLIKS-CRDLPRLKVITSG-PI
A0A7C5ZUA8      RRPRLHNYFG-F-E-NT---KGLTNYLSGDR----NTENLIKT-CRELPRLKVITSG-PI
A0A136JPP4      RRPRMHSHFG-L-S-NS---QGLTNYLSGEK----STENLIKA-APGLPHLKIITSG-PI
A0A399WUJ8      RRPRMHSHFG-L-S-NT---QGLTNYLSGEK----STENLIKA-APGLPHLKIITSG-PI
A0A2V9KIE8      RRPACHRATG-V-E-NK---PGFVQCLTGRV----QISEAILP-VPGVANLWVIPCG-PI
A0A352F549      RRPRLHQVLD-M-S-ND---DGLSAILSSEV-SEADVLSKIRK--YQDSNVYLLSSG-AI
A0A3B9MLP9      RRPRLHHVFG-L-S-NN---EGLSAILSSET-SEAEILAKINR--YLETDIYLLSSG-AI
A0A3D5SQ87      RRPRLHHVFG-L-S-NN---EGLSAILSSET-SEAEILAKINR--YLETDIYLLSSG-AI
A0A2V8NW86      RKPRMHELFD-L-P-NG---HGLSSLLRDPQRAVAKLSRIVQE--TKIPGLFVLTSG-PL
A0A7C2GJ20      RKPGLHKVLN-V-K-NH---PGLSAYLTRPL----DLEAVILH--QPAENLFVIPAG-AI
A0A7C4BTL5      RRPRLHSVFD-V-D-NQ---RGLSTLLSERPLAEGALEGVIQQ--SLIPGLYVLPSG-PE
A0A2V8ZHL8      RRPGIAESLD-L-I-DG---EGLAGFLTGAH----SIEAALIQ-FSPVPALRVLPAG-PK
A0A2V9B240      RRPGIAESLD-L-V-DG---EGLAGYLTGAH----SIEAALRQ-FSPVPTLWVLPAG-PK
A0A2V9CBM2      RSPSLHRLFG-A-R-ES---SGLVSYLTDPQ----DWRTLVRH--SGSSGLDLLFCG-PV
A0A2V8XN17      RSPSLHKLFG-I-D-RS---LGLVSYLTGQQ----DWRAVVHP--SGSRGLDLLLCG-PV
A0A2V8WX45      RFPSLHKLFG-T-S-GS---LGLVSYLTGQQ----DWHAAVRP--CGSHGLDVLVCG-PV
A0A1Q6YR79      RSPSLHKLFG-I-D-RT---LGLVSYLTGQQ----DWRAAVHP--SGSRGLDLLVSG-PV
A0A1Q7VA32      RSPSLHKLFG-I-D-RT---LGLVSYLTGQQ----DWRAAVHP--SGSRGLDLLVSG-PV
A0A2V9EY85      RSPSLHKLFG-I-D-RT---LGLVSYLTGQQ----DWRAAVHP--SGSRGLDLLVSG-PV
A0A2V9H8K0      RFPSLHKLFG-T-S-GS---LGLVSYLTGQE----DWRAVVRP--SGSRGLDLLVCG-PV
A0A2V9FFE5      RYPSLHKLFG-T-S-GS---LGLVSYLTGQQ----DWRAVVRP--SGSRGLDLLVCG-PV
A0A2V9GM43      RYPSLHKLFG-T-S-GS---LGLVSYLTGQQ----DWRAVVRP--SGSRGLDLLVCG-PV
A0A2V9CYQ5      RSPSLHRLFG-A-R-ES---SGLVSYLADHQ----DWRTLVRH--SGLSGLDLLFCG-PV
A0A2V9BWU8      RFPSLQRLFC-I-R-ES---LGLVSYLTGQQ----DWRTAVCP--SASPGLDLLLCG-PV
A0A2V8ZG48      RFPSLEKLFC-I-R-EN---LGLVSYLTGQE----DWRTAVCP--SGSPGLDLLPCG-PV
A0A2V8Y334      RFPSLQKLFC-I-R-ET---LGLVSYLTGQQ----DWRAAVCP--SGSPGLDVLLCG-PV
A0A2V9AY68      RFPSLQKLFC-I-R-EC---PGLVSCLTGQQ----DWHAAVCP--SGSPGLDLLLCG-PV
A0A1F2RFI7      RRPRVGNLLE-LPA-TP---AGLSTYLTGQF----GLDDVVTP--TQIPNLFAIPCG-PI
A0A1F2RZS3      RRPRIGTLLK-LPT-TP---AGLSTYLTGQF----PLEDVLVG--THVPNLYAVSCG-PV
A0A1F2USE2      RRPCLHKVFQ-L-Y-ES---GGLSSYLTGQA----EWRRYALS--TGVPHLDLMACG-PI
A0A7C2VB08      RRPSVHLAFG-L-G-RQ---QGLSGYLSGRV----EWMDVVQP--TGVPGLDALVCG-PV
A0A2V9C238      RRPSVRKAFD-I-D-NS---LGLVSYLTGQQ----DWRAAVRP--TGLESLDALVCG-PV
A0A1F2Q9F5      RRPCIHKAFK-M-A-GG---RGLVSYLTGQQ----EWEAVVHP--SPVENLDLVICG-PI
A0A1F2QQH9      RRPCIHKAFK-M-A-GG---RGLVSYLTGQQ----EWEAVVHP--SPVENLDLVICG-PI
A0A1F2QXK7      RRPCIHKAFK-M-A-GG---RGLVSYLTGQQ----EWEAVVHP--SPVENLDLVICG-PI
A0A2V9DEM9      RRPSVRKAFD-I-D-NS---LGLVSYLTGQQ----DWRAAVRP--TGLESLDALVCG-PV
A0A7C5TWV7      RKPRFHRILG-V-K-NV---RGLTSIVLGERGIR----DVIHT-VADQPNLDIITSG-PL
A0A2V7XDY0      RRGQLHSRLG-L-T-RE---PGVTNFFVNHEDL-----DALVR-PTRVPNLFALTTG-PL
A0A2V8G155      RKPRGHELLG-G-P-QE---PGLSNVIVGETKL-----ADAVR-RTPIPSLWLLAAG-KT
A0A2V8HDM7      RKPRGHELLG-G-P-QE---PGLSNVIVGETKL-----ADAVR-RTPIPSLWLLAAG-KT
A0A2V8DRT9      RRPRVHQVFA-E-R-QE---PGLSNILVGDTKT-----GDAVR-PTSCSTLWILPAG-HL
A0A2V7VYF3      RRPQIHSYFS-H-P-QE---PGLSNFIVGNSEV-----GDVVR-PSGVPELWLLPSG-LI
A0A1F2SVH2      RKSRVHIVFD-R-S-QG---PGLSNVLVGNAKA-----SEAVH-KTAVPGLWVMPAG-PH
A0A2V8AJG9      RKPRVHSVFG-Q-T-QE---PGLSNVLVGNAKA-----SEAIR-GTAVSGLWTMTAG-ML
A0A2N9LQU7      RRSTLLRQLG-LEAGTS---AGLSSMISGNDASE----AVRKP-FPQLPTLEVIAAG-PQ
A0A2P6WFK7      RRSTTHTHFG-LPY-SR---YGTSTVLTRGMDER----AIVTP-LKSLPSLKLMPAG-PH
A0A2V8U914      RRPRLHKIFG-L-A-NS---WGLSDILRERNATEDLPLDALVK-KTGVPRLYLLPSG-PC
A0A2V7W309      RRPRLQKVFP-G-K-LN---LGIVNYLAANIPF-----EDTVQ-PTQVPNLSVVLSG-PI
A0A2W0BGU4      RKPVLARLLG-I-Q-NE---RGMSTHLTGHDSIN----DVIQP-YKEQPNLWLIPSG-PI
A0A2W0BVQ9      RKPILARLLG-I-Q-NE---RGMSTHLTGHDSID----DVIQQ-YGEQPNLWLIPSG-PI
A0A2V9MN96      RRPGVARALG-L-K-TS---GGLSTLLSGVDTME----NVMVP-FPGLPFLQVLPAG-PI
A0A2V7V2Z1      RRPQSHVLLR-G-R-KS---PGVSDLLVGQARPS----EAIQR-PAG-TTLSLLASG-TR
A0A2V7X2F7      RRPQAHTLLR-G-R-RT---PGLSDVLVGKAKPS----EAIQV-FAG-GH-SLLPAG-TT
A0A2V7V2I1      RKPQAHELLG-L-K-KS---PGLSDILVGLADTA----ECVER-VKG-TNLSLLPSG-SH
A0A2V7U3M2      RRPQSNTLLH-A-K-RS---PGLSDLLVGRARPS----EAIQR-PAG-TTLSLLAAG-TR
A0A2V7UHT0      RRPQSHTLLR-G-K-KS---PGLSDLLVGKARPS----EAIQR-PSG-TTLSLLAAG-TR
A0A2Z5FVL3      RRPNLHVLFN-S-S-LE---VGLSTILAGQLSVDAMG-QAFLQ-VEAVPGLDILLSG-PI
A0A2V9KBD6      RRPRIHLAMQ-L-N-AT---AGLGALLKKSVAFE----EAVCS-FPNLPDLFILPAG-PV
A0A2W0AJ66      RRPSVHRAMQ-L-T-ST---IGLTALLSNSAPFE----DAVIR-CAELPNLFILTAG-KV
A0A1Q7RBU1      RRPSIHRAMG-LKT-TN---AGLGALLRKSTAFE----EAVMG-CTDVPNLFILPAG-PV
A0A2V9JPV9      RRPSIHRAMG-L-S-TN---TGLGALLRKSTVFE----KAVSD-CAKIPNLFILPAG-PI
A0A3P0X3W6      RRPSQHNHFS-L-P-NE---EGLADVIMDGRSLA----DVLHT-IEGIENLHVVTAG-AS
A0A2N9MK30      RRPSVHRRLG-L-T-SE---TGLSAVLLHGLAWR----DCVMQ-APGVPNLDVLPAG-PT
A0A3D1ASD2      RRPSLHKFFD-M-P-MN---AGLSSVVLQSANWR----EVVVP-AENVAGLDVLPAG-PP
A0A7C5AXI3      RRPSVHRRFD-L-P-GS---TGLSNILVSDLPWQ----QAVIN-IPHIPDLDVLPAG-PP
A0A7C6E4H7      RRPGIHRVLG-L-N-GS---GGLSQVILQGERWQ----ALLVQ-PEHLPNLDVLPAG-SG
A0A1F2TCR2      RRPGLHKIVG-I-P-NS---VGLSHLLVGQV---RVR-EAVQR-T-SEANLFVMTAG-RT
A0A350UQT3      RRPSQHKLFG-I-P-LG---AGLSNVLNGET---GWR-DVLVR-PANNEYLEIITAG-PP
A0A7C3HRX0      RRPTQHKLFG-V-S-IT---AGLSNVLQDEI---PWR-DAVLR-PAAAETLDLITAG-PP
A0A1F2V330      RKPRVHEYLG-L-K-PG---KGFSDLLRAPE-----D-EIGKY-VSKLGDLYIMPGG-SS
A0A662EE63      RKPRLHHMMK-V-K-NM---RGLTSLVLGES---QLK-DVIHG-LADVPNLDMVTSG-PL
A0A2V8TLH7      RRPTVHQWLK-L-S-KD---QGITNYILSTE---GDDWRTYLK-TTDQSNLYALTSG-PI
A0A1Q7ZJT1      RRPAIHTRLN-L-G-RD---GGVTNYILSSE---GDDWRSYIK-NTDMPNLYAMTCG-PI
A0A2V8VC99      RRPAIHTRLN-L-S-RD---HGVTNYILSSD---GDDWRNYIK-ASDLPNLYALTCG-PI
A0A348UZU3      RRPKQHRIFN-L-K-NH---DGLSNYLTM-----GLELKKLVK-TTMVPSLYFINSG-PI
Q01XL7          RRARLHSVFG-L-D-NC---PGLSDLLTSTESLEEADLAPYLS-PTKVDNLRVMTHGLAQ
A0A2V8ERZ5      RRPGLHRPLR-L-T-ND---RGLSQVLTGQA---RVR-DVIQR-T-VDPNLLAITAG-RS
A0A2V8GTX0      RRPSLHKAMR-L-P-ND---RGLAELLSGKA---RMR-EVVQR-C-GDPNLLVIPAG-HT
A0A2V8J0X9      RRPGLHKTVG-L-R-NE---TGLSHLLVGQA---RVR-EAVQR-T-SEPNLVVITAG-RT
A0A523DUV7      RRSSIHTHLR-L-Y-RE---PGLADYCTRDL-----KLDVIIQ-STREPHLSAVTSG-KL
A0A372IRG7      RKGTLHMKFR-L-S-NR---TGLSTYLSRES---KEE-SFEYP-IPGLPNLAVMTRG-PI
A0A1F2U158      RRPGLHRSLR-L-T-ND---RGLSQILTGQA---RVR-DVIQR-T-VDPNLLAITAG-RT
A0A2V8F6S9      RRPGLHRPLR-S-T-NE---RGLSQVLIGQA---RVR-DVIQR-T-VDPNLLAITAG-KT
A0A7D8BEX2      RKPSQHIRMG-L-R-RE---PGLTSVVSGAT---TFE-KAVQR-PAGADNLWVLTAG-AA
A0A4Q1SCH5      RRPTLHKIFG-V-S-NT---IGISDLLIDRG---TSK-DIAQP-IEELPNLHFLPAG-KS
A0A2V8K4L4      RRPRLHRLFD-L-K-ND---KGLSELLLSKHALKTSEVVGAVR-ESWIPGLHILTSG-PW
A0A2V8NCZ3      RRPRLHRLFD-M-K-ND---KGLSELLREKHSTKTSEVLEAAR-ETWIPGLHVLTSG-PW
A0A4Q7YNP3      RKPGMHNALH-V-P-ND---VGLRNLLRGEIDLARATIGTFCK-ATRIPNLSVIPSG-SG
E8UZE1          RRPSLHHKLG-L-PKTE---KGLSNLLAVSQ-SPPLV-EYLHP-AAVFPGLDFLPAG-PL
A0A2U3JZ71      RRPSIHRRFE-V-P-ST---RGLSNVLTSGI---PWR-TVLVR-PDGHPNLDILPAG-PP
A0A2V8TTB0      RRPSVHRLYQ-V-P-NS---VGLSNVLLQQI---SWR-DVVIR-MDDPKGLDVLPAG-PP
A0A1V6HR88      RKSRLHELFG-M-S-NR---AGLVSYLTGQV---PPE-QIVLR-T-DIPNLYAIPAG-PS
A0A3E0P0A3      RKPRIHEALG-I-S-NR---VGLVNCLVHQT---ELE-NVVQA-T-PVPNLWVLPSG-PL
A0A2V8EXP2      RRPRVHSLFG-I-A-QE---PGLSNVLVGNA---KPS-DAVRI-T-SVPGLWAMPAG-MI
A0A2W4RYA1      RRPRAHGLFG-L-A-QE---PGLSNLLVGTA---ESR-ECVHE-T-PVEGLYVLPAG-HI
G8P0Y7          RRPSVHTAFK-I-K-GH---VGLSNVLTGGA---KVR-DAIQS-T-VQPNLFVLPAG-LV
A0A5M8T4U7      RRGTLHQVFR-I-NDRS---FGLSSVLSHPE---ERR-MAPNP-VPELPQFHILPTG-MR
A0A7D0PPG7      RRPSQQRHFG-L-DRRK---KGLSDAIATKE---PLS-AIRQN-VDGYDNLHVVTAG-SS
A0A7D8BF18      RRPTIHHRLG-L-T-GN---VGLTSVLTGSA---TLK-EAIQS-LHDAPGLDVLVSG-PV
A0A1E3Y9R6      RRPRMHEALD-R-S-QE---PGLSNVLVGEA---SLA-DAART-T-AVPNLTLLAAG-HI
A0A2W4TLP2      RRPRMHEALD-R-S-QE---PGLSNVLVGEA---ALA-DALRP-T-SVPNLTLLAAG-HI
A0A7C4BZ42      RRPRLHAVFD-L-A-ND---EGLSTLLQAKDPLKGRSLPASVR-QTEVPGLFLLTSG-PP
A0A3R9WF43      RNPDLHRLFG-C-E-NS---PGLGDVSAADT--HIEV-SNLIQ-HSSIKTLYILPAG-NR
A0A317HKM4      RKPGLHQLFG-E-E-QQ---PGLADVLAGKT-----T-SRDFR-QTKISRLWLLPAG-TA
A0A2V9CG11      RRPRLHKVFG-L-C-NN---RGLSSILSVND-IVHIK-QLLCE-T-AISGLYVLPAG-SS
A0A523E0N1      RNPRLHRVFR-Y-R-NR---VGLSNVLTGQK---SLK-DGCIM-RTEIPNLYLMMSG-PK
A0A523ECP2      RNPQLHKVFR-F-K-NR---VGLSSVLSGQT---SIE-KGCVF-STLIPNLYVLLAG-PA
A0A2W0C122      RKPGLDREFG-I-A-GT---PGLSDLLSGGA---GEE-CVIHK-IEGVANLSIVAAG-SS
A0A2W0AUU7      RKPGLDREFR-I-A-ST---PGLSDLLSGSA---GEE-PVIQQ-IERVSGLSIVSAG-SS
A0A2W0BQL1      RKPGLDREFR-I-A-ST---PGLSDLLSGSA---GEE-PVIQQ-IERVSGLSIVSAG-SS
A0A4Q1SDL1      RKPSDKKGLE-F-S-GK---DGLSLLLTEEE----QV-PHILT-VDGVPNLSLLPSG-PV
A0A3P0XH15      RKGTLHMKFR-T-S-NR---FGLSTLLVREN---EES-SYENP-LPDLPNLTLVTRG-PV
A0A4R1LAZ7      RKGTLHIKFR-R-S-NR---VGLSTLLSRES---GAE-AYEQP-LADLPNLTVVSRG-PV
A0A3M1WQW8      RKPGLHKMLS-I-N-HQ---PGLSTYLTRGI---TID-SVIVP-N-RIDNLWIIPSG-PV
A0A3N1JHC1      RRPALPQLFG-V-Q-NI---EGLSNTLDEAE--CADP-NSLIQ-TTAFPGVSILTSG-TT
C1F294          RKGTQHLKFR-V-S-NR---VGLSTYLSRES---GEE-SIVFP-LPELPNLGVLPRG-PV
A0A2V9KA79      RKPRIHHYLD-I-R-PG---TCFDDLLVQPR-----L-AIEDC-LTTVRTLHVMLGRRSL
A0A522PSP1      RRPQVHRILD-I-P-NR---LGLSSILQDQA---KVQ-EAVVP-G-QIDRLSILPAG-PL
G8P085          RRPALHSKFG-V-E-NK---RGLSNLILGDD---TAE-PFTNP-LPDLDNLFLLTAG-KK
A0A7C6A629      RRPGIHRVFG-L-N-GS---SGLAEVVSQGE---RWQ-EAVVK-LEQMPNLDVLPAG--G
A0A4Q1SGQ1      RRPGIYHELG-M-P-AG---LGLRHALRSKS-----E-PAIQK-FPGLPSLSVLCGS-TA
Q1ILD9          RRGRLASRAG-A-Q-EG---DGLTECLSGLR---RWT-DVVQD-ASGIAGLRILSAG-VR
A0A7C5SHM3      RHPRLHRVFK-A-D-KN---RGLTNVLASTL---PIE-DVVVP-T-VYPNLSLVPGG-PC
Q1IJZ6          RRPTLHKHAM-K-E-ND---RGLSNLLTSVA---EPS-DFIQK-DSSAPNLDILCAG-PI
A0A2V8TCE6      RRPRLHRAFG-L-R-NG---SGLSTFLCGKA---SLE-EAVQM-T-LVARLWLLASG-PV
A0A522TBE8      RKPRVHRLFG-V-A-NQ---RGLSPVLRGTM---DLE-AALQP-S-RRDNLTLLTAG-PT
Q1ITG0          RRGVLARNLK-V-M-PE---GGLSECLAGRK---SWR-DLIIP-VNGVANMWVLPAG-HR
A0A7C2ML20      RHPSCAPLFG-V-D-NE---AGLSTCLSFDE---KST-AIHHD-C-AVAGLDVLPSG-PI
A0A7C5AXS9      RKPRLHEIFD-V-P-ND---YGLGDLLSGETPPEGRE-GAIVE-T-SHPGLFVAPAGKQA
A0A7C2RGE3      RKPGLHKALN-V-K-NY---PGLSAYLTRPL---DLE-TVIIH-Q-PAENLFVIPAG-AV
A0A3N5PCI5      RRPVLHQVLE-C-E-QR---PGLAEVLTGKR---KPS-EAIVA-T-RSPGVWLLPSG-AG
A0A3M1Q0S9      RRPRCHQILK-A-S-TG---RGVSTYLTGMS---DLP-ALVQT-S-DLERVAVIPAG-PI
A0A2Z5G448      RRGTLHLKFR-L-P-NR---EGLSTLLVRES---GSS-AYQSP-IDDLPNLFVLTRG-PI
A0A3M1VZ38      RRPRCHDVLG-V-E-KD---RGVSTFLTGLN---DLD-PLIQQ-T-RIDRLSLIAAG-PV
A0A4Q1SD29      RKGTLHMKFR-M-S-NR---VGLSTLLSRES---GNE-SFEHP-IPELPNLTVLSRG-PI
A0A6N9FGE2      RRPHQHLAFE-L-D-RE---PGLSNLLVGDA---AET-AVVKA-T-FVPGLSLITAG-KT
A0A3M1PY35      RHPRLHRAFK-A-P-RD---RGLANVLAGAT---GLD-DVLFE-T-RYDNLALVPGG-PC
A0A3M1VMP2      RHPRLHRVFR-V-P-SE---RGLTNLLASHD---PAD-GFVVP-T-RYANLHLLPGG-PC
                *                                                           

A0A2V7VMF7      PPNPPAMLARKNVADLFSHLRR--Q--FEWILVDSPPLASVTDALLLARHADLAVMVVQH
A0A2V7YYV7      PPNPSELLGSGRMRELMARLRT--S--FSYVIVDTPPVNAVTDASILSASANGTILVVEH
A0A2V7Z0J5      PPNPSELLGSGRMRELIGHLLA--N--FNYVIIDTPPVNAVTDAAILAAYANGTILVVEQ
A0A2V7Z3M4      PPNPSELLGSGRMKDLMSRLSD--A--FVYVIIDTPPVNVVTDAAILSAQASGTVLVVEQ
A0A399Y5V2      PPNPADLLGSARVSELIETLGT--L--ADYVVIDSPPIVPLSDAAVLAPKTDGAIIVAKA
Q01X01          TDNIFGLLCSGRMARLLPRFRQ--E--FDYVIVDAPPCLEFADARIISRYTERLLLVVRA
A0A3M2D9H8      PPNPAEVLSSERMATLLSEVAT--R--YDKVILDGPPFL-ISDAIVLASRVDGVLLTLRA
A0A2V8JK38      RPNPGELILSPRFKEVLKSLKK--D--FDLVILDSPPLSNVSDGRILASVSDTAILVVKA
A0A2V9IXG5      PQNPPYLLSQPSLRDFISYLSD--R--YDWVLIDTPPVTSVTDPVIIAALVDTILFVIKY
A0A2V9J2P4      PQNPPYLLSQPSLRDFISYLSD--R--YDWVLIDTPPVTSVTDPVIIAALVDTILFVIKY
A0A1Q7RLS4      PPNPADVFGHERFLSLLKELRA--E--FDWVFIDSPPVVSLADSMILASLADMVAFVIRH
A0A2V2R525      PIKPAELLSSGQMRRLLEITSP--S--FTHVVIDSTPVVSFTDSVLIANLVDGVILVVQG
A0A321LPW6      PPNPAELLSSQKMKDLLSAMSE--R--FDHVLIDSPPLINVTDPIILSTIVDGVILVVHG
A0A2V9R9V4      PPNPAELLSSERMKRLLAQLSE--R--YDHIVLDSPPLASVTDAVILSTMVNGVILVVHG
A0A321LE75      PPNPAELISSEKMKNMLAMLCE--R--YDHIVIDSPPLMHVTDPVILSTLVDGVILVVHG
A0A2V8R8U7      PPNPAELLGSEEMRKLLVSLSE--K--FTHIIVDSPPAISFTDSSILSTFVDGVILVVHG
A0A2V8QMP4      PPNAAELLGSEEMRRLLYVLSE--N--FTHIVIDSPPAISFTDASILSTMVDGVMLVVHG
A0A2V8R4S3      PPNAAELLGSEEMRRLLYVLSE--N--FTHIVIDSPPAISFTDASILSTMVDGVMLVVHG
A0A2V8NJ55      PPNPAELLGSDEMRKLLNSVSE--R--FTHVIIDSPPSISFTDASILSTMVDGVMLVVHG
A0A2V8Q7I0      PPNPAELLGSEEMRRLLGQLGE--R--YAHIIIDSPPAISFTDASILSTMVDGVMLVVHG
A0A2V8S6K4      PPNAAELLGSEQMRRLLQLLGE--Q--FTHIIIDSPPAISFTDASILSTMVDGVVLVVHG
A0A317I2L9      PPNPAELLGSEEMRRLLGTLSE--R--FAHIIIDSPPAISFTDASILSTMVDGVMLVVHG
A0A2V8LLF9      PPNPAELLGSDEMRKLLILLSE--R--FTHIIVDSPPAISFTDASILSTFVDGVILVVHG
A0A352FRF4      PPNPAELLGSEEMRNLLLSLRE--K--FTHVIVDSPPAISFTDASILSTFVDGVILVVHG
A0A2V8MKV0      PPNPAELLGSEQMRRLLTLLGE--K--FAHIIVDSPPAVSFTDASILSTFVDGVILVIHS
A0A2V8PYY8      PPNPAELLGSEQMRQLLTSLGE--R--FAHIIVDSPPAVSFTDASILSTFVDGVILVIHS
A0A1Q7YKQ8      PPNPAELLGSDEMRKLLSELSE--R--FTHVIIDSPPAISFTDASILSTLVDGVILVVHG
A0A352F3R7      PPNPAELLGSDEMRKLLGILSE--R--FSHIVLDSPPAISFTDASILSTMVDGVVLVVHG
A0A0B6WXT1      PPSPAELLSSEEMRRLIDEASA--R--FAHVIIDSPPAVSFTDAAILSTMVDGVVLVVHG
A0A3B9MEU8      PPNPAELLGSDEMRKLLGILSE--R--FTHIVIDSPPAISFTDASILSTMVDGVVLVVHG
A0A2V8MHG6      PPNPAELLGSDQIRSLMSVLEN--T--FTHIVIDSPPVASFTDGVLLSSVADGVLLVVHG
A0A2V8P7N1      PPNPAELLGSDQIRSLMSVLEN--T--FTHIVIDSPPVASFTDGVLLSSVADGVLLVVHG
A0A2V8M3M6      PPNPAELLGSDQIRSLMSVLEN--T--FTHIVIDSPPVASFTDGVLLSSVADGVLLVVHG
A0A1Q7NJH5      PPNPAELLGSDQIRTLMSVLGN--T--FTHIVIDSPPVASFTDGVLLSSVADGVLLVVHG
A0A2V8PJY0      PPNPAELLGSDQIRTLMSVLEN--T--FTHIVIDSPPVASFTDGVLLSSVADGVLLVVHG
A0A1Q7Y6W9      PPNPAELLGSEQMRKLLSCIEK--T--FTHVIIDSPPIASFTDGVLISTIVDGVLLVVHG
A0A2V8NC68      PPNPAELLGSDQMRRLIAALEN--T--FTHVIIDSPPVASFTDGVLLSSIADGVLLVVHG
A0A399WK13      PPNPAELIGSDQMAKLLKMLQG--H--FTHVVVDSPPIASFTDGVLIASMVDGVVLVVNS
A0A352FLX4      PPNPAELVGSEQMLKLLSVVAD--N--FAHIVVDSPPIAAFTDGVLIAAIVDAVLLVVHS
A0A2V8RTL7      PPNPAELIGSEQMVGLLKTLQS--E--FTHVVIDSPPITSFTDGVLLASLVDGVILVVHS
A0A3E0PCJ6      PPNPAELVGSEQMKRLLVTLEK--N--FTHLVIDSPPIASFTDGVLMASLVDGVIMVVHS
A0A3M1S4R8      PPNPAELIGSTQMSTLMEIFQK--E--FTHVIIDSPPIASFTDGVLIAAMVDGVIMVVHS
A0A7C2G442      PPNPAELIGSAQMSTLMEIFQK--E--FTHVIIDSPPIASFTDGVLIAAMVDGVIMVVHS
A0A1Q7YFI6      PPNPSELIGSEQMQRLLATMRT--S--FTHIVIDSPPIASFTDGVLMSTMVDGVLLVVQG
A0A136KC10      PPNPAELIGSEQMAKLLKTLEG--H--FTHVVVDSPPIASFTDGVLIASMVDGVILVVHS
A0A3M2D6Y5      PPNPAELIGSKSMLNLMEILHN--E--FTHVVIDSPPIASFTDGVLIASMVDGVIMVVHS
A0A2V8SEX6      PPNPAELIGSEQMANLLKLLSQ--N--FTHVVVDSPPITSFTDGVLIASMVDGVILVVHS
A0A7C5ZUU4      PPNPAELIGSEQMTKILALFQN--H--FDHVVVDSPPITSFTDGVLIASMVDGVILVVHA
A0A0B6WWQ6      APHPAELLGSDQMRALLEELRA--R--FDYIIVDSPPIAYFTDGVVVATLVDGVMLVVRR
A0A3B9MK99      PPNPAELLGSDQMRRLMATLQS--Q--FSHVVVDSPPVNSFTDGVLLSSMVDGVLLVVHG
A0A352EX26      PPNPAELLGSEQMRRLMTLLQA--E--FTHVVVDSPPINSFTDGVLISSLVDGVLLVVHG
A0A2V8MM59      PPNPAELLGSDQMRKLIAVLSA--Q--FTHIVIDSPPVSSFTDGVLIASMVDGVLLVVYG
A0A2V8PFE8      PPNPAELLGSEQMRKLIAVLSG--A--FTHIVIDSPPVSSFTDGVLIASMVDGVLLVVHG
A0A2V8PWS6      PPNPAELLGSEQMRKLIAVLSG--S--FTHIVIDSPPVSSFTDGVLIASMVDGVLLVVHG
A0A2V8LCT5      PPNPAELLGSEQMRKLIAVLSI--P--FTHIVIDSPPVSSFTDGVLIASIVDGVLLVVHG
A0A352FTJ9      PPNPAELLGSDQMRKLLATLSE--K--FTHVVIDSPPVNSFTDGVLLGSMVDGVLLVVHG
A0A257VBK0      PPNPPELFSMKRFRDLIERFKG--E--YSWVIMDSPPCLSISDAFILGGMADRTILVARY
A0A2G6PYV5      PPNPAELVASQKMREVLTELKA--N--FDFIIIDTAPLLAVTDASILGNIVDSLIFVTKA
A0A2V8F956      PPNPAELLGSQRFKDFLVSVKE--H--FDWVIVDTPPVMAVTDARLVAHHATGVLFVVGA
A0A1F2S1W5      PPNPSELLGSKRFKEFAAFLMQ--Y--FDWVLLDTPPVMAVTDASIVANLSHGVLFVVGS
A0A1F2T595      PPNPAELIGSRRFRDFTAFLLQ--H--FDWIIVDTPPVMVVTDATIAANFAHGVLFVVGA
A0A2V8JQV5      SRSVVHLLHSTRLPELLQRLRK--D--YDLILIDAPPVLQMADARVLGRLADGVVFVIRS
A0A2V9AC41      PPNPAELLGSRKMHELLQQLRE--Q--FEFIFIDSSPVMAVSDAVFLSTMVEGTLMVVNR
A0A2V9MAM9      TEDIFSLLFSPRLRRLIERFRE--E--FDHVIIDAPPSLEFADARLLGLTADGVLMVVRA
A0A348V070      PSDPLEVMFSEKMRAFITFLKQ--Q--FDFVLFDSPPVLAVSDALVLGKQVDGLILVVRA
A0A2V9M454      PPNPAELLCSTKMENLIKHLRD--Q--YDHLVLDSPPVLPITDATILSSLVDGVIMVVEC
A0A2V9IVR7      PSNPTDLLSSPDMARLVEELKQ--R--FEHIVLDSPPILLMTDATVLSILSDGVVLVVEG
A0A2V9ILE2      PSNPTDLLSSPDMARLVEELKQ--R--FEHIVLDSPPILLMTDATVLSILSDGVVLVVEG
A0A2V9LGY4      PSNPTDLLSSPDMARLVEELKQ--R--FEHIVLDSPPILLMTDATVLSILSDGVVLVVEG
A0A2V9J4D6      PPNPAELLSSPEMQSVMQNLRQ--R--FDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSS
A0A2V9L9C5      PPNPAELLSSPEMQSVMQNLRQ--R--FDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSS
A0A2N9M9N1      PANPAELVSSPAMGRLVSELRQ--R--FEHIVLDSPPLLLVTDGVLLSTLADGVVLVVES
A0A2V9JEC4      PPNPSELVSSATMEQVIGELRR--R--FDHIVIDSPPALVFTDATILSALVDAVVLVVES
A0A2V9LPQ3      PPNPAEMLSSPAMRQLITELVE--R--FKHVVIDSPPLLMVTDATILSTMVDGTVLVAES
A0A2Z5G3A3      PTEPTDLLSSTRMLEALAAWRR--E--YSFVIIDAAPVLSATDSVILSGLVDTTLLLGRY
A0A2V7UGP8      PPNPSELLASEHFDFLLAALKSSAR--FDHVLIDSPPLLSVADPVIMASKAGATILVVQC
A0A239MKT6      PPMPAELLGSKRFLAILEKARK--E--FDYVLIDGPPVLLVTDPLLIAPHADAIVAVFRS
A0A3E0PCN7      VPNPANLLGSIEMRSLLDRLGA--R--YSHIIIDSPPILYFADSVILAANVEAVVIVSRA
A0A2V8IYW3      DSDPIGALTSETMQRIVKEGRE--Q--FDWVLIDTPPIGLLPDAGLLGGIADGALLVVRA
G2LEI9          PPNPAELLGSQRMRSLLAYAVE--K--FDYVILDTPPMLSFADATILAAMADSVILVVNC
A0A317J121      SGSISKMLYGSEIRRFFQMVRE--K--YDIVLIDAPPILEVADGRLLAEFADGVLLVLRS
A0A2V7YW66      PPNPSELLSSDRMRDWLRTMRS--R--FDFVVLDTPPALAVTDATIVGLLVDGVVLTLRS
A0A2V7Z0V0      PPNPSELLSSDRMRDWLKAVRA--R--FDFVVLDTPPALAVTDATIVGMLADGVVLTLRS
A0A2V8GFD4      PPNPPELLGSPRFAELMAAFRE--N--FDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGA
A0A2V8HSS5      PPNPPELLGSPRFAELMAAFRE--N--FDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGA
A0A2V8KP55      RPNPGELILSPRFKEVLKSLKK--D--FDLVILDSPPLSNVSDGRILASVSDTAILVVKA
A0A399WNU1      VPNPASLFASTHMKGLIERLSA--T--YSYIVIDSPPILYFADSVILSTQVDAVVAVARV
A0A2V9JSI3      PPNPADLLSSVSMKEVLAELRG--R--FDHVVIDSPPVLLVTDATILTPLVDGIMLVVES
A0A2V9WI32      PPQPAELLGSILMKDYLCRLRK--E--FDHIVIDTPPALSVTDAVLLSVEADSVLVVVRS
A0A2V8IVN9      PPNPAELLGSQRFRELLASLKD--H--FDWVIVDSPPVMAVIDAAVVAHRATGVVFIIGA
A0A7C5Z4J3      PPNPADLLASSSMKELMTTLRE--R--FDHVVVDTPPVLMVTDATVLSSFVDGVILVTES
A0A1F2TPT3      PPNPSELLGSYQFRKFLAALGQ--H--FDWIVIDTPPVMAVTDACVVGHAVTGTLFVVGA
A0A2V8JTQ2      FLPGDTELLMWSFQDWVKRWRE--Q--FDHIIIDTPPVLSVADAVRISVEADSVILVIRS
A0A2V8UZY0      MLPDDTELLVSGFKDLVDHWRD--Q--FDHIIIDTPPVLAMTDAVRMSVEADSVILVIRS
A0A350UEK1      VAAPSHLLYSKKLRAALEWFRE--E--FDMVVIDTPPMLQIPDARLFGKLVDGVVLVVRA
A0A350UIQ4      VAAASNMLFSKRLLSALEWCRS--E--FDMVVIDTPPVLQIPDARLFAKVADGVVLVVRA
A0A1H5Z7N3      PPFPTEMLSSQVMRNLVEQCRG--I--YTHIVIDSPPLLSVTDSIVLAPEVDTVVLVVRH
A0A1G7JVV8      PPFPTEMLSSESMKNLLQECGE--L--YTHVVIDSPPILSVTDAVILAHYADAIVMVVRH
A0A1H4T6W9      PPFPTEMLSSEAMHDLLLYCCS--I--YTHIVIDTPPILSVTDGVILARQADAIVLVVRH
I3ZEU5          PPFPTEMLSSEAMHDLLLHCCT--L--YTHVVVDSPPILSVTDGVILARQADAIVLVVRH
A0A1I6MH75      PPFPTEMLSSAAMTSLLERCAT--L--YTHVVIDSPPILSVTDGVILARQADAVVLVVRH
E8WVF6          PPFPTEMLSSASMAELIRHASE--I--YTHIVIDSPPILSVTDGIILSRQVDVCVLVVRH
A0A7D0PQC3      PPFPTEMLSSESMSQLLAKAGQ--M--YGYVIIDSPPILSVTDGVLLARQSDITVLVIRH
A0A428MDU2      PPFPSEMLSSEAMDAFLNHCGD--L--YTHIVIDSPPILSVTDGVILARRADAVVLVIRH
A0A5B9EBI2      PPFPTEMLSSEGMQHLIESAKT--K--YTHVVIDSPPILSVTDGVILGRQTDAAVLVIRH
A0A239HDF6      PPFPTELVSSTAMRELLRYAGE--I--YTHVVIDSPPILSVTDGVELGGMVDAVILVLRH
A0A4Q0T270      PPFPTEMLSSGAMTQLLERCGN--L--YTHVVVDSPPVLSVTDGVILARLADAVVLVVRH
A0A1Q3QQB6      PPFPTEMLGSEAMDQLLRQCGD--L--YAYVVIDTPPILSVTDGVILARHADAVVMVVRH
A0A3N1K1G7      PPFPTEMLSSEAMNTLLRHCGE--V--YTHVVIDSPPILSVTDGVILAREADAVVLVVRH
A0A4V2G466      PPFPTEMLSSEAMRQLLDHAGE--I--YTHIVIDSPPVLSVTDAVLLARQADAVVLVIRH
A0A6B9YNQ8      PPFPTELLSSEMMRQLLQSAKE--S--YTHVVIDSPPVLSVTDAVILSREADAVVLVIRQ
A0A3N5YNR8      PPNPAELIGSERMESALRLLGD--Y--FKYILIDTPPILSVTDGLLLSPHVDGVVMVIKG
A0A3N6A5T6      PPNPAELIGSDRMDKALKLLRD--Y--FQYVVIDSPPILSVTDALVLSPKVDGVVMVVRG
A0A1F2Q9L4      PPNPSELLSSERMMDLVAVAYQ--R--FENVVFDSPPILPVTDATLLGAMSDGVVLCVGS
A0A2U3KC61      PPQPAELLGSAVMKDHIAHWRN--V--FDHVIIDTPPCLSVTDAVLLSPEADRVILVARS
A0A2V9Y2R7      PPQPAELLSSTVMKDYIARWRN--E--FDHIIIDTPPCLSVTDAVVLSPEADRVILVARS
A0A2V9NGH6      PPNPAELLSSGNMKKVLDELRE--Q--YDHIVVDTPPTLSVTDPVILSTRADAVVLVIRS
A0A2V9PYE6      PPNPAELLSSGNMKKVLDELRE--Q--YDHIVVDTPPTLSVTDPVILSTRADAVVLVIRS
A0A2V9NL07      PPNPAELLASSQMLDLLAELRE--Q--YDHIIVDTPPTLSVTDAVVLSTRSDAVVLVIRS
A0A2V9QD92      PPNPAELLASSQMLDLLAELRE--Q--YDHIIVDTPPTLSVTDAVVLSTRSDAVVLVIRS
A0A2V9WPZ6      PPNPAELLASSDMRDLLAQLRD--Q--YDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRS
A0A2V9ZLH4      PPNPAELLASANMRDLIESLKR--D--YDHIVIDTPPTLSVTDAVVLSTRSDAVVLVIRS
A0A2V9RQF1      PPNPAELVASSNMRDVLAELRD--Q--YDHIIVDTPPTLSVTDAVVMSTRADTVVLVIRS
A0A2V9YDK8      PPNPAELLASSNMKDALAELRD--Q--YDHIVIDTPPTLSVTDAVVLSTKADAVVLVIRS
A0A2V9V8F7      PPNPAELLASSDMRDLLAQLRD--Q--YDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRS
A0A2V9XGR9      PPNPAELLASSDMRDLLAQLRD--Q--YDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRS
A0A2V9V3Q5      PPNPAELLASSNMKDVLDELRE--Q--FDHVVIDTPPTLSVTDAVVLSPRVDAIVLVIRS
A0A2V9NWS3      PPNPAELLASAQMKDSLAELRE--Q--YDHIVIDTPPILSVTDAVVMSIRADTVLLVIRS
A0A2V9USA9      PPNPAELLASTNMKDVLAQLRE--E--YDHIVLDTPPTLSVTDAVVLSPRADAVVLVIRS
A0A2V9XW18      PPNPAELLASSNMRDVLNQLRE--Q--FDHIVIDTPPSLSVTDAVVLSPRADAVILVIRS
A0A1H5SQF5      PPAPSELLGSPRFVKLLEQMKK--E--YDYVFIDSPPVLLVTDAVLTSTLVDGVILVVRS
A0A2V9AEW6      GVTPTNLFYSPRMSKLLARLRR--E--FDMVLIDAPPMIQLADARVLGRLADGVILVVRA
A0A2V8WQK6      GITPSNLFYSPRMSRLLRRLRS--E--FDMVMIDAPPVIHLADARVLGRLADGVILVVRA
A0A2V8XIF4      GITPTNLFYSPRMARFLKRMRK--E--FEMVMIDAPPMIHLADARVLGRHADGVILVMRA
A0A2V2R0I6      PPNPADLLSSHKLSDAIAELRT--K--YKFVVIDSPPVMAATDAVIVSVQTDGVLLVVRS
A0A2V8XAR9      PPNPADLLSSHKLADAIAELRT--K--FKFIVIDSPPIMAATDAVILSVQADGVLLVVRS
A0A2V8VZA0      PPNPADLLSSHKLVDAIAELRT--K--FKFIVIDSPPIMAATDAVILSVQADGVLLVVRS
A0A1Q7CB82      PPNPADLLSSHKLVDAIAELRT--K--FKFIVIDSPPIMAATDAVILSVQADGVLLVVRS
A0A2V8WIU1      PPNPADLLSSHKLVDAIAELRT--K--FKFIVIDSPPIMAATDAVILSVQADGVLLVVRS
A0A1Q6Y9F5      PPNPADLLSSHKLADAIAELRA--K--FKFIVIDSPPIMAATDAVILSVQADGVLLVVRS
A0A2V9EVV8      PPNPADLLSSHKLADAIAELRA--K--FKFIVIDSPPIMAATDAVILSVQADGVLLVVRS
A0A2V8YF91      PPNPADLLSSHRLAEGIAELRT--K--FKFVVMDSPPIMAATDAVIVSVHSDGVLLVVRS
A0A2V8XZK2      PPNPADLLSSHRLADAIAELRT--K--FKFIVIDSPPIMAATDAVILSVLADGVLLIVRS
A0A2V8ZTX6      PPNPADLLSSHRLADAIVELRS--K--FKFIVLDSPPIMVATDAVILSVQADGVLLVVRS
A0A2V9BT79      PPNPADLLSSHKLADAIVELRT--K--FKFIVIDSPPVMAATDAVILSVQADGVLLVVRS
A0A2V9YHT3      PPQPAELLSSALMKQWISTWRK--H--FDHVVIDTPPCLSVTDAVALSVVADSVVLVIRS
A0A7C2XNI7      PPNPADLLSSKRLQDAVNQLRE--Q--FRFIIIDSPPVMAATDAIVLSVIADGVLLVVRS
A0A1Q8B793      PPNPADLLSSHRITDAIAELRA--K--YKFIVIDSPPVMAATDAVILSVQADGVLLVVRS
A0A2V9BCA0      PPNPADLLSSHRITDAIAELRA--K--YKFIVIDSPPVMAATDAVILSVQADGVLLVVRS
A0A2V9BWU9      PPNPADLLSSRRLSEAVSILRQ--E--YKFIVIDSPPLMAATDGVILSVLVDGVLMVVRS
A0A2V9DKX2      PPNPADLLSSRRLSEAVSILRQ--E--YKFIVIDSPPLMAA