BYKdb

Dataset for cluster tadcd of phylum acidobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

424 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2V7VMF7      MDVGQPAGFPGYDMDTFRTGVGYEVGPSMRASMGYERQRVPGAPDRPVIEAEADSVFLKV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A831T3F4      ---MTGERSELEKLSPLGELPVMPPA----------------------------------
A0A2V8JK38      MEAPNSIQATVPLTATAGPISVTTPAGTGTSSAPFKSATRFENTDPALTYTSGWDRTSTL
A0A7W0JWI4      ---MSSLDLRKPKELSAAPLP---------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A7Y9PHF8      ------------------------------------------------------------
A0A7W8J3G9      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A7W1TTH3      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7V0UHS9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A7V4SJP8      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A7Y8IYX6      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A7T9JJ28      ------------------------------------------------------------
A0A7T9GE94      ------------------------------------------------------------
A0A7Y4X7L5      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A843SYC7      ------------------------------------------------------------
A0A7V9BJ09      ------------------------------------------------------------
A0A7W1DT80      ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A841JWG5      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A7X7ZKA6      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A7W8J413      ------------------------------------------------------------
A0A7W8JCF5      ------------------------------------------------------------
A0A7W8IEB1      ------------------------------------------------------------
A0A7Y9T3I1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A841JVA9      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A7V4XQR5      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
A0A7X9FXC4      ------------------------------------------------------------
A0A7X7ZKL5      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
A0A7W8E8D3      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A843SRW6      ------------------------------------------------------------
A0A7W8E330      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
A0A7V2HGP7      ------------------------------------------------------------
A0A7R8B6H7      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A7Y5WWH8      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
A0A7V6D154      ------------------------------------------------------------
A0A7V1XXZ2      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7T9HIZ6      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A7V6D075      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A833M5K2      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A7V5ZKV2      ------------------------------------------------------------
A0A7Y8LRQ1      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A7V9TW03      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A7W1JC10      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A7Y2DUG3      ------------------------------------------------------------
A0A7Y2D8Q4      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A7W1CBZ8      ------------------------------------------------------------
A0A7W1FC90      ------------------------------------------------------------
A0A7W1ZXG0      ------------------------------------------------------------
A0A7W1ZIT3      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A7V9C3X9      ------------------------------------------------------------
A0A7V9ZSX9      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A7V1SCI4      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A7T9FQE4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A7T9G4W3      ------------------------------------------------------------
A0A838UAA0      ------------------------------------------------------------
A0A7W1HTU2      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7V9ICU8      ------------------------------------------------------------
A0A7T9JEF9      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A7Y4TLV3      ------------------------------------------------------------
A0A7W0MGQ3      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A7W1BYD3      ------------------------------------------------------------
A0A838PIP9      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A7V8YZQ7      ------------------------------------------------------------
A0A7V9ICV8      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A7W1IVA5      ------------------------------------------------------------
A0A7W1ZIE3      ------------------------------------------------------------
A0A7T9J551      ------------------------------------------------------------
A0A7V9NLN0      ------------------------------------------------------------
A0A7T9G8R2      ------------------------------------------------------------
A0A7Y2D047      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7V1SAJ0      ------------------------------------------------------------
A0A7W0N726      ------------------------------------------------------------
A0A7W1HTZ7      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A7V9C9Y7      ------------------------------------------------------------
A0A7W1G8A4      ------------------------------------------------------------
A0A7V9KMZ1      ------------------------------------------------------------
A0A7W0JTE4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A838PA20      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A7V9R410      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A841JU67      ------------------------------------------------------------
A0A7T9GJJ6      ------------------------------------------------------------
A0A7Y4UER8      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
A0A7V2HCZ0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A7V2MG68      ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A7V2HBQ5      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7R8B699      ------------------------------------------------------------
A0A7S7SGU3      ------------------------------------------------------------
A0A7Y8HY45      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A7V0Y3A1      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A7T9GJN6      ------------------------------------------------------------
A0A7T9GJN7      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7W7ZGZ3      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
A0A7Y9TM87      ------------------------------------------------------------
A0A7W8J1H5      ------------------------------------------------------------
A0A7Y9T5K4      ------------------------------------------------------------
A0A852VHP9      ------------------------------------------------------------
A0A7W8IFZ2      ------------------------------------------------------------
A0A7W8J9Y9      ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A7Y5RFT3      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A7V9Q528      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A7V9ZQ50      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A7W1GE99      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A7W0GRF6      ------------------------------------------------------------
A0A7W1H6G6      ------------------------------------------------------------
A0A7V9HZC8      ------------------------------------------------------------
A0A7W0XCB9      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A7W7ZUJ7      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A845TWB8      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7W1SCW7      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A7X7XDY5      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A7X8YVF2      ------------------------------------------------------------
A0A7X7YEP0      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A845TW47      ------------------------------------------------------------
A0A845TXC1      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      TDDRGPAGSGQVEVAYRDQRSPRAAAAGQRFRGLNYAATLRRAVGVNTLVELGGGRATDV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A831T3F4      ------------------------------------------------------------
A0A2V8JK38      RPWSVGTAAVASTAGQQVTFTFSGTDLTWIGFRGPQAGIARVSLDGVFIQQLDMYSVAEE
A0A7W0JWI4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A7Y9PHF8      ------------------------------------------------------------
A0A7W8J3G9      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A7W1TTH3      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7V0UHS9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A7V4SJP8      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A7Y8IYX6      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A7T9JJ28      ------------------------------------------------------------
A0A7T9GE94      ------------------------------------------------------------
A0A7Y4X7L5      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A843SYC7      ------------------------------------------------------------
A0A7V9BJ09      ------------------------------------------------------------
A0A7W1DT80      ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A841JWG5      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A7X7ZKA6      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A7W8J413      ------------------------------------------------------------
A0A7W8JCF5      ------------------------------------------------------------
A0A7W8IEB1      ------------------------------------------------------------
A0A7Y9T3I1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A841JVA9      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A7V4XQR5      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
A0A7X9FXC4      ------------------------------------------------------------
A0A7X7ZKL5      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
A0A7W8E8D3      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A843SRW6      ------------------------------------------------------------
A0A7W8E330      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
A0A7V2HGP7      ------------------------------------------------------------
A0A7R8B6H7      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A7Y5WWH8      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
A0A7V6D154      ------------------------------------------------------------
A0A7V1XXZ2      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7T9HIZ6      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A7V6D075      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A833M5K2      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A7V5ZKV2      ------------------------------------------------------------
A0A7Y8LRQ1      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A7V9TW03      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2V9KCS3      ----------------------------------------MWRCIPTTFSSFRAAPARRP
A0A7W1JC10      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A7Y2DUG3      ------------------------------------------------------------
A0A7Y2D8Q4      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A7W1CBZ8      ------------------------------------------------------------
A0A7W1FC90      ------------------------------------------------------------
A0A7W1ZXG0      ------------------------------------------------------------
A0A7W1ZIT3      ------------------------------------------------------------
A0A353C9L6      --------------------------------------------------------IDGL
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A7V9C3X9      ------------------------------------------------------------
A0A7V9ZSX9      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A7V1SCI4      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A7T9FQE4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A7T9G4W3      ------------------------------------------------------------
A0A838UAA0      ------------------------------------------------------------
A0A7W1HTU2      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7V9ICU8      ------------------------------------------------------------
A0A7T9JEF9      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A7Y4TLV3      ------------------------------------------------------------
A0A7W0MGQ3      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A7W1BYD3      ------------------------------------------------------------
A0A838PIP9      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A7V8YZQ7      ------------------------------------------------------------
A0A7V9ICV8      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A7W1IVA5      ------------------------------------------------------------
A0A7W1ZIE3      ------------------------------------------------------------
A0A7T9J551      ------------------------------------------------------------
A0A7V9NLN0      ------------------------------------------------------------
A0A7T9G8R2      ------------------------------------------------------------
A0A7Y2D047      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7V1SAJ0      ------------------------------------------------------------
A0A7W0N726      ------------------------------------------------------------
A0A7W1HTZ7      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A7V9C9Y7      ------------------------------------------------------------
A0A7W1G8A4      ------------------------------------------------------------
A0A7V9KMZ1      ------------------------------------------------------------
A0A7W0JTE4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A838PA20      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A7V9R410      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A841JU67      ------------------------------------------------------------
A0A7T9GJJ6      ------------------------------------------------------------
A0A7Y4UER8      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
A0A7V2HCZ0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A7V2MG68      ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A7V2HBQ5      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7R8B699      ------------------------------------------------------------
A0A7S7SGU3      ------------------------------------------------------------
A0A7Y8HY45      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A7V0Y3A1      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A7T9GJN6      ------------------------------------------------------------
A0A7T9GJN7      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7W7ZGZ3      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
A0A7Y9TM87      ------------------------------------------------------------
A0A7W8J1H5      ------------------------------------------------------------
A0A7Y9T5K4      ------------------------------------------------------------
A0A852VHP9      ------------------------------------------------------------
A0A7W8IFZ2      ------------------------------------------------------------
A0A7W8J9Y9      ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A7Y5RFT3      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A7V9Q528      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A7V9ZQ50      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A7W1GE99      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A7W0GRF6      ------------------------------------------------------------
A0A7W1H6G6      ------------------------------------------------------------
A0A7V9HZC8      ------------------------------------------------------------
A0A7W0XCB9      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A7W7ZUJ7      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A845TWB8      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7W1SCW7      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A7X7XDY5      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A7X8YVF2      ------------------------------------------------------------
A0A7X7YEP0      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A845TW47      ------------------------------------------------------------
A0A845TXC1      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      SGFEANAFYVSSFARGGLTVALPWELSLHAGRGGLGLEPLPTGRERDRAPARRRPLWLVR
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A831T3F4      ------------------------------------------SRPGPSVISYTDLASYSH
A0A2V8JK38      VQAEVFKATGLASGNHTLLIEVTGTSNPASTGSYVAVDAFDIAPQVPATVNITSPPSGST
A0A7W0JWI4      ----------------------------------------------------TVPSYGAQ
A0A1Q7RLS4      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A7Y9PHF8      ------------------------------------------------------------
A0A7W8J3G9      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A7W1TTH3      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7V0UHS9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A7V4SJP8      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A7Y8IYX6      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A7T9JJ28      ------------------------------------------------------------
A0A7T9GE94      ------------------------------------------------------------
A0A7Y4X7L5      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A2W4RYA1      --------------------------------------------------------MPDI
A0A2V8EXP2      ----------------------------------------MSTQFRDSTDSLQHRLTMAS
A0A843SYC7      ------------------------------------------------------------
A0A7V9BJ09      ------------------------------------------------------------
A0A7W1DT80      ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A841JWG5      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A7X7ZKA6      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A7W8J413      ------------------------------------------------------------
A0A7W8JCF5      ------------------------------------------------------------
A0A7W8IEB1      ------------------------------------------------------------
A0A7Y9T3I1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A841JVA9      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A7V4XQR5      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
A0A7X9FXC4      ------------------------------------------------------------
A0A7X7ZKL5      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
A0A7W8E8D3      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A843SRW6      ------------------------------------------------------------
A0A7W8E330      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
A0A7V2HGP7      ------------------------------------------------------------
A0A7R8B6H7      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A7Y5WWH8      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
A0A7V6D154      ------------------------------------------------------------
A0A7V1XXZ2      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ----------------------------------------------------------MP
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7T9HIZ6      ----------------------------------------------------------MN
A0A7C5AXS9      ----------------------------------------------------------MK
A0A7C2RGE3      -----------------------------------------------------------M
A0A7V6D075      -----------------------------------------------------------M
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A833M5K2      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A7V5ZKV2      ------------------------------------------------------------
A0A7Y8LRQ1      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A1F2T595      --------------------------------------MSTQIPPEFSQKA------PAS
A0A2V9AC41      ------------------------------------------------------------
A0A2V2R525      ----------------------------------------MKEDQITKHSS---------
A0A321LPW6      ---------------------------------------MAQERVELERVSTA----RVA
A0A2V9R9V4      ---------------------------------------MSDQKRYPDNLPPEVTFRQLP
A0A321LE75      ---------------------------------------MSDERTDIERIKPE----EMA
G2LEI9          -------------------------------------MPQEHPNNNVMLAP------TAA
A0A7V9TW03      ----------------------------------------MKEPSDLSKALEIILKS--S
A0A3N5XQP8      --------------------------------------------------------MADL
A0A2V9KCS3      GGARWKRCWAWARASAQAPRSIAVNRDLFRVNHSRADSTSGALMDQIVHLP----KGPQR
A0A7W1JC10      ----------------------------------------MKDPQELIQSM-----AERR
A0A3M2BZG9      -------------------------------------MKMIPSSEQPLPRPAVRDDFLAY
A0A1Q7N5R7      ----------------------------------------MPDHTSLRRTPPPPLTAADL
A0A352F549      ----------------------------------------MKEPSDLSKALEIILKN--S
A0A3B9MLP9      ----------------------------------------MKEPSDLAKALDIILKN--S
A0A3D5SQ87      ----------------------------------------MKEPSDLAKALDIILKN--S
A0A7Y2DUG3      ----------------------------------------MERDERLLPLP----NIGKL
A0A7Y2D8Q4      ----------------------------------------METDERLLPVPEVKGSKTGR
A0A2V8NW86      ----------------------------------------MDKHE----LP-------PT
A0A3M2D491      --------------------------------------MNKERDERLLPLP--------K
A0A7W1CBZ8      ----------------------------------------MEKDERLLPLP------NVN
A0A7W1FC90      ----------------------------------------MEKDERLLPLP------NVN
A0A7W1ZXG0      ----------------------------------------MEKDERLLPLP------NVN
A0A7W1ZIT3      ----------------------------------------MEKDERLLPLP------NVN
A0A353C9L6      KYGRFGVIRSKNRENTADIWYKTRLRKFCRVGDVQGQESSMEQDQRLTPLP----KS--A
A0A2V8RQV0      ----------------------------------------MEQEQRLTTLP----HL--G
A0A2V8SJH5      ----------------------------------------MEQDQRLTPLP----KS--L
A0A136JPP4      ----------------------------------------MDQDQRLTPLP----KG--L
A0A399WUJ8      ----------------------------------------MDQDQRLTPLP----RG--L
A0A7V9C3X9      ----------------------------------------MQEDQRLTPLP----KA--T
A0A7V9ZSX9      ----------------------------------------MEKDQRLTPLP----NTTVT
A0A3M1SIV3      ----------------------------------------MEKDERLLPLP--KELEANK
A0A7V1SCI4      ----------------------------------------MEKDERLLPLP--KELEANK
A0A7C5ZUA8      ----------------------------------------MEQEQRLTPIS-----KT-A
A0A7T9FQE4      ----------------------------------------MENDQRLTPLP-----VT-T
A0A3E0PHB0      ----------------------------------------MESNDRLLQIPEIQERRSKK
A0A7T9G4W3      ----------------------------------------MESNDRLLQIPEIKDRRSER
A0A838UAA0      ----------------------------------------MEQDQRLTPLP-----RV-V
A0A7W1HTU2      ----------------------------------------MEKDERLLPLP-----ET-K
A0A357F267      ----------------------------------------MEQDQRLTHLP-----KA-V
A0A7V9ICU8      ----------------------------------------MEQDQRLTPLP-----RSGG
A0A7T9JEF9      ----------------------------------------MQRNNQLAVRT------KDE
A0A399WNU1      ----------------------------------------MQSNFQVVKRN------SRQ
A0A3E0PCN7      ----------------------------------------MQKNKQLALRP------KEE
A0A7Y4TLV3      ----------------------------------------MQGNNSIAKRN------QSQ
A0A7W0MGQ3      ------------------------------------------------------------
A0A1Q7Y6W9      ----------------------------------------MKESRELITRV------KEA
A0A2V8NC68      ----------------------------------------MKESSRPTETT------ALV
A0A352FLX4      ----------------------------------------MNQSTNLSRTN------TVP
A0A2V8MHG6      ----------------------------------------MKEPTELIEKS------NGS
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ----------------------------------------MKEPAELIEKS------NGS
A0A1Q7NJH5      ----------------------------------------MKEPTELIEKS------NGS
A0A2V8PJY0      ----------------------------------------MKEPTELIEKS------NGS
A0A7W1BYD3      ----------------------------------------MKDRDQLIQ-----------
A0A838PIP9      ----------------------------------------MKDRHQLIQ-----------
A0A399WK13      ----------------------------------------MKETRNIITTT------SPE
A0A7V8YZQ7      ----------------------------------------MQESREIIQKS------VKE
A0A7V9ICV8      ----------------------------------------MKEVRDLAPKA------PVE
A0A136KC10      ------------------------------------------------------------
A0A7W1IVA5      ----------------------------------------MKDTREIIHRQ-------ME
A0A7W1ZIE3      ----------------------------------------MKDTREIIHRQ-------ME
A0A7T9J551      ----------------------------------------MQESRDITKNL------PAD
A0A7V9NLN0      ----------------------------------------------------------VE
A0A7T9G8R2      ----------------------------------------MRESRDIVRSP------RTE
A0A7Y2D047      ----------------------------------------MKESREIIKQP--------A
A0A3M2D6Y5      ----------------------------------------MRKTNELIVRE------AQE
A0A2V8SEX6      ----------------------------------------MKETREIIQKP------LNE
A0A7C5ZUU4      ----------------------------------------MKESREILKKP------VSE
A0A3E0PCJ6      ----------------------------------------MRESRDIVRNP------RTE
A0A2V8RTL7      ----------------------------------------MKEIRELVPTK------PND
A0A3M1S4R8      ----------------------------------------MRESRELISTR------SAG
A0A7V1SAJ0      ----------------------------------------MRESRELISTR------SAG
A0A7W0N726      ----------------------------------------MQDRREIVHRQ------MET
A0A7W1HTZ7      ----------------------------------------MKDSREIIHKK------VEA
A0A1Q7YFI6      ----------------------------------------MEKETQLVKAS------VEP
A0A7V9C9Y7      ------------------------------------------------------------
A0A7W1G8A4      -----------------------------------------------------------M
A0A7V9KMZ1      ----------------------------------------MKPSRELAKRE------PEP
A0A7W0JTE4      ------------------------------------------------------------
A0A0B6WWQ6      -----------------------------------------MMKGDPEKEP------QSL
A0A3B9MK99      ------------------------------------------------------------
A0A838PA20      ----------------------------------------MNPSRELAKRE------PEP
A0A352EX26      ----------------------------------------MNPSNELIRKE------PAD
A0A7V9R410      ----------------------------------------MNPSNELIRKE------PAA
A0A2V8MM59      ----------------------------------------MNEGTKLARVE------TEP
A0A2V8PFE8      ----------------------------------------MNQATKLVKRE------DEP
A0A2V8PWS6      ----------------------------------------MNQGTKLVKRE------DEP
A0A2V8LCT5      ----------------------------------------MNEATKLVRRD------DQP
A0A352FTJ9      ----------------------------------------MNEATKLVKQD------E-S
A0A1F2S1W5      ---------------------------------------------MSVPSQFERKSPESS
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------MDMEFS
A0A2V8U914      ------------------------------------------------------------
A0A2V8DRT9      ---------------------------------------------MADQFQLDPGDLDNQ
A0A2V7VYF3      ---------------------------------------------MSKR-----------
A0A1F2SVH2      ---------------------------------------------MSEE-----------
A0A2V8AJG9      ---------------------------------------------MSEQFSSNPGPAAAG
A0A2V9MAM9      ---------------------------------------------------------MLP
A0A2V8F956      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A841JU67      ------------------------------------------------------------
A0A7T9GJJ6      ---------------------------------------------------MPEETNKPV
A0A7Y4UER8      -------------------------------------------------MAEENQNKSAL
A0A2V8IYW3      ------------------------------------------------------------
A0A7V2HCZ0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A2W0BGU4      -----------------------------------------------------------M
A0A2W0BVQ9      -----------------------------------------------------------M
A0A317J121      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      -------------------------------------------------MAYSFGYRLRS
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A3P0X3W6      ----------------------------------------------MSSVYNNKPRILPA
A0A7V2MG68      -----------------------------------------------------------M
A0A7C6A629      ----------------------------------------------------MSDPSHML
A0A7V2HBQ5      -------------------------------------------------MPRDNESALLV
A0A2U3JZ71      -----------------------------------------------MVGDKEMVENNLT
A0A2V8TTB0      ---------------------------------------------------MKKFENNL-
A0A2N9MK30      -----------------------------------------------MNTSLQELTIVEE
A0A3D1ASD2      ---------------------------------------------------MSEMRLDR-
A0A7R8B699      ---------------------------------------------------MQNSNQDGK
A0A7S7SGU3      ----------------------------------------------MPEDKFDALDLTGP
A0A7Y8HY45      ------------------------------------------------------------
A0A7C5AXI3      ---------------------------------------------------MAEQKLDRN
A0A7C6E4H7      -----------------------------------------------------MSDPSRL
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V8GFD4      ---------------------------------------------------------MSD
A0A2V8HSS5      ---------------------------------------------------------MSD
A0A2V8KP55      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------MGESLM
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      -----------------------------------------------------MTRYFEL
A0A1Q7RBU1      -----------------------------------------------------MSKYFEL
A0A2V9JPV9      --------------------------------------------MSRYFNKDEERRYFEL
A0A7V0Y3A1      --------------------------------------------------------MNTS
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ---------------------------------------------------MSDEPRSNP
A0A2V8JTQ2      --------------------------------MSESFELMNQRARDFDPVQLPRVALSSG
A0A2V8UZY0      --------------------------------MSKYFELMNRLRRD-SPLAVSACDIGPE
A0A350UEK1      --------------------------------------------MSQQSPPP---GDARD
A0A350UIQ4      --------------------------------------------MPKPTPPSNPQGDSAS
A0A7T9GJN6      ----------------------------------------------------------MA
A0A7T9GJN7      ----------------------------------------------------------MA
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7W7ZGZ3      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
A0A7Y9TM87      ------------------------------------------------------------
A0A7W8J1H5      ------------------------------------------------------------
A0A7Y9T5K4      ------------------------------------------------------------
A0A852VHP9      ------------------------------------------------------------
A0A7W8IFZ2      ------------------------------------------------------------
A0A7W8J9Y9      ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A7Y5RFT3      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------MADLMIPGTEGL
A0A2V8R8U7      ---------------------------------------------------------MIQ
A0A7V9Q528      --------------------------------------------------------MMSQ
A0A2V8QMP4      ---------------------------------------------------------MMQ
A0A2V8R4S3      ---------------------------------------------------------MMQ
A0A2V8NJ55      --------------------------------------------------------MMSQ
A0A7V9ZQ50      --------------------------------------------------------MMSQ
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ---------------------------------------------------------MSQ
A0A317I2L9      --------------------------------------------------------MMSQ
A0A2V8LLF9      ---------------------------------------------------------MTH
A0A352FRF4      ---------------------------------------------------------MTQ
A0A7W1GE99      ---------------------------------------------------------MSQ
A0A1Q7YKQ8      --------------------------------------------------------MVSQ
A0A0B6WXT1      ----------------------------------------------------------MQ
A0A2V8MKV0      ---------------------------------------------------------MTQ
A0A2V8PYY8      ---------------------------------------------------------MTQ
A0A3B9MEU8      --------------------------------------------------------MMSQ
A0A352F3R7      ---------------------------------------------------------MAQ
A0A7W0GRF6      --------------------------------------------------------MMSP
A0A7W1H6G6      ------------------------------------------------------------
A0A7V9HZC8      --------------------------------------------------------MMSP
A0A7W0XCB9      --------------------------------------------------------MMSP
A0A3N5YNR8      ------------------------------------------------------------
A0A7W7ZUJ7      --------------------------------------------------------MRGE
A0A2V2R0I6      ---------------------------------------------------------MAD
A0A2V8XAR9      ---------------------------------------------------------MAD
A0A2V8VZA0      ---------------------------------------------------------MAD
A0A1Q7CB82      ---------------------------------------------------------MAD
A0A2V8WIU1      ---------------------------------------------------------MAD
A0A1Q6Y9F5      ---------------------------------------------------------MAD
A0A2V9EVV8      ---------------------------------------------------------MAD
A0A2V8YF91      ---------------------------------------------------------MTD
A0A2V8XZK2      ---------------------------------------------------------MAE
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ---------------------------------------------------------MTD
A0A2V9YHT3      ---------------------------------------------------------MDS
A0A7C2XNI7      --------------------------------------------------------MNSN
A0A1Q8B793      --------------------------------------------------------MEEN
A0A2V9BCA0      --------------------------------------------------------MEEN
A0A2V9BWU9      ---------------------------------------------------------MDE
A0A2V9DKX2      ---------------------------------------------------------MDE
A0A7C2YQY3      -------------------------------------------MDPKNA-----------
A0A845TWB8      -------------------------------------------MDEKGSNGSGGANGSGG
A0A2U3KC61      -----------------------------------------------------------M
A0A2V9Y2R7      -----------------------------------------------------------M
A0A2V9NGH6      ----------------------------------------------------------MD
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      --------------------------------------------MYLLFQFSIQLGRQME
A0A2V9QD92      ----------------------------------------------------------ME
A0A2V9WPZ6      -------------------------------------MACWSALLGRNRMQDCCSGVGMD
A0A2V9ZLH4      ----------------------------------------------------------ME
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ----------------------------------------------------------MD
A0A2V9V8F7      --------MCSARMRQTFITNNFLSASEHPRRRLWSLWACWSALLGRNRMQDCCSGVGMD
A0A2V9XGR9      ----------------------------------------------------------MD
A0A2V9V3Q5      ----------------------------------------------------------MA
A0A2V9NWS3      -----------------------------------------------MVGLNFFLGASMA
A0A2V9USA9      ----------------------------------------------------------MD
A0A2V9XW18      ----------------------------------------------------------MD
A0A1H5SQF5      -------------------------------------------------------MPYDP
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------MSDIRN----FDPSVKLRFEEAAN
A0A7W1SCW7      ------------------------------------MKDELNLGTELDAQQTLRLATPGR
A0A3E0NV31      ------------------------------------------------MDRESYFNEDLR
A0A3N5M5V0      ---------------------------------------------MGDLIRREPSSFADP
A0A7X7XDY5      ------------------------------------------------MGNNPNLPVLSP
A0A2V9L5B5      ------------------------------------MNESIDVHQRRGLVQGDQDSSGES
A0A2V9LK56      -------------------------------------------------MDEIQNSNGFQ
A0A2V9L7I0      -------------------------------------------------MDESENLQRDP
A0A522PPT0      -------------------------------------------------MDSNEITPINQ
A0A7C5V1G5      -------------------------------------------------MEEHGITPVNQ
A0A4R1LC91      ------------------------------------------------------------
A0A2V9QB26      -----------------------------------------------MTEPMDKHALPPA
A0A2V9VYY4      ------------------------------------------MALQPTRNNSDDFEALAP
A0A2V9KIE8      -------------------------------------------MGKSEILPGDRLNRIAP
A0A7C2GJ20      ----------------------------------------------MSDSTEKPSLPATP
A0A7C4BTL5      ------------------------------------------------MAPEESKDLTLR
A0A7X8YVF2      ------------------------------------------------MSEENNGNQNRR
A0A7X7YEP0      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------MGEQNQSEPYSH
A0A2V8XN17      ------------------------------------------------MDDQNQVELYGR
A0A2V8WX45      ------------------------------------------------MEDQKQVELYGR
A0A1Q6YR79      ------------------------------------------------MDDQNQVELYSR
A0A1Q7VA32      ------------------------------------------------MDDQNQVELYSR
A0A2V9EY85      ------------------------------------------------MDDQNQVELYGR
A0A2V9H8K0      ------------------------------------------------MDDKNQVELYGR
A0A2V9FFE5      ------------------------------------------------MDDRDQVELYGR
A0A2V9GM43      ------------------------------------------------MDDRDQVELYGR
A0A2V8ZHL8      -----------------------------------------MPPGVKDMPDNEALSLRGA
A0A2V9B240      -----------------------------------------MPHKVKDMPDNQALSLRGP
A0A2V9CYQ5      ------------------------------------------------MGEQNQSEPYRH
A0A2V9BWU8      ------------------------------------------------MSEPNKLEPFAQ
A0A2V8ZG48      ------------------------------------------------MSEQNKVELYAR
A0A2V8Y334      ------------------------------------------------MGEQQNVELYSR
A0A2V9AY68      ------------------------------------------------MSEQNKVELYAR
A0A1F2RFI7      ------------------------------------------------MSEEMSLEKIPP
A0A1F2RZS3      ------------------------------------------------MEENNSLERVSR
A0A845TW47      ------------------------------------------MNGGKPLQGEGNIERYEP
A0A845TXC1      ------------------------------------------------MNEEANLARRDP
A0A1F2USE2      --------------------------------------MGEEIPDSKREVPDGRIERYEP
A0A7C2VB08      ------------------------------------------------MSEAHPLVPHRP
A0A2V9C238      ------------------------------------------------MDPENKIKLYEP
A0A1F2Q9F5      ------------------------------------------------MSDEKSVERYEP
A0A1F2QQH9      ------------------------------------------------MSDEKSVERYEP
A0A1F2QXK7      ------------------------------------------------MSDEKSVERYEP
A0A2V9DEM9      ------------------------------------------------MDPENKIKLYEP
                                                                            

A0A2V7VMF7      GSEPVVRPPPLPARGLPARPARLQHPRLRSRDPRIHRPARDRPVPRQGHRGEGHAVKSLA
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A831T3F4      GNGTE-------------------------------------------------------
A0A2V8JK38      VSGTDKAKTPGRRAGKDKLVRINHRKY---------------------------------
A0A7W0JWI4      YAG---------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A7C5TWV7      -------MKQAAPMGPAGPPAGWGMPP---------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A1F2TCR2      -------------MFDTHDLQQAPAIA---------------------------------
A0A7Y9PHF8      ----------MRPITAEMEIPMLPAKG---------------------------------
A0A7W8J3G9      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ---------MRHRDIDMDRWMPADQGA---------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
Q01XL7          ---------MNDHYEPESNGSGPHGLP---------------------------------
A0A523DUV7      ------------------------MDP---------------------------------
A0A7W1TTH3      ------------MFKTPQALEPATHES---------------------------------
A0A1F2U158      -----------MSESSPAHPTPASAPT---------------------------------
A0A2V8F6S9      -----------MADSTPSGSRPASSAS---------------------------------
A0A7V0UHS9      ------------------------------------------------------------
A0A7D8BEX2      -----------------MPQSATNNTS---------------------------------
A0A4Q1SCH5      ------------------MNQPAAASP---------------------------------
A0A7V4SJP8      --------------------------M---------------------------------
A0A372IRG7      ------------------MQGSAIAPQ---------------------------------
A0A2V8K4L4      -----MRNHDDSSNLPVPFTPPPGNQL---------------------------------
A0A2V8NCZ3      -----MKDQDDSSNLPVPFKSARGSQL---------------------------------
A0A4Q7YNP3      ----MGNTFNTNGIDRRPVGIVARDES---------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7YW66      -----------------------MSPL---------------------------------
A0A2V7Z0V0      -----------------------MSPL---------------------------------
A0A2V9M454      --------MNGDELVPLNSGPVTPPPN---------------------------------
A0A2V9J4D6      ----MTHRSRFTPSSASLRPGSSNAPP---------------------------------
A0A2V9L9C5      ------MREEFGKSGTLVGRAINDSPE---------------------------------
A0A2N9M9N1      ---------MAENDKLIPVSAVSSDRL---------------------------------
A0A2V9JEC4      ----MPRNTDHEQTASARSETALSERP---------------------------------
A0A2V9LPQ3      -MADIQKLTTTEPAPLARRRAASSESI---------------------------------
A0A7Y8IYX6      -------------MESLIPTTHTSLAP---------------------------------
A0A2V9IVR7      ----MENDPIESRELAPVEAAPQDRLS---------------------------------
A0A2V9ILE2      ----MENDPIESRELAPVEAAPQDRLS---------------------------------
A0A2V9LGY4      ----MENDPIESRELAPVEAAPQDRLS---------------------------------
A0A7T9JJ28      ---MNIYDENQQSLTNVAGQGRELRKN---------------------------------
A0A7T9GE94      -----MQEELKNKLMTVEEAAAALD-L---------------------------------
A0A7Y4X7L5      ----MQVEERNNKLITADEAATQLDLL---------------------------------
G8P0Y7          -----------MSTGRMRGEFAEPVRH---------------------------------
A0A2W4RYA1      NLDDLDDASRRGAAG--DGQPPAGATV---------------------------------
A0A2V8EXP2      ADAENAGAARAADSGPAAAAPP---PT---------------------------------
A0A843SYC7      -MADYSFDAEAGTPGPQPGREPAVAPS---------------------------------
A0A7V9BJ09      ------------------------MKS---------------------------------
A0A7W1DT80      ------------------------MKL---------------------------------
A0A5M8T4U7      ------------------MAIEPQSEH---------------------------------
A0A7L5A491      --MESRPSFANNALTPSQRLRERLYLP---------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      --------------------------M---------------------------------
A0A2W4TLP2      --------------------------M---------------------------------
A0A7G8BDY8      -----------MSFLTQNRPASRTSGV---------------------------------
A0A7C4BZ42      -MNRFPGNNPKHLPGGGGPPMVPDRPV---------------------------------
A0A3R9WF43      ---------MDRSPPKVSITKKEHRSF---------------------------------
A0A317HKM4      --------------MSLDSHRPARSDP---------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      -------------------------MS---------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A841JWG5      ------------------------------------------------------------
A0A4R1LAZ7      ---------MEGPRTTTRVSPAGDMQA---------------------------------
A0A7G8BMP1      ---------MQGQAITPR-------PS---------------------------------
A0A7X7ZKA6      --------------------------M---------------------------------
A0A523ECP2      ----------MELKKSEQGSNANWAPP---------------------------------
A0A2W0C122      ----------MDARELIKSNPAELSAQ---------------------------------
A0A2W0AUU7      ----------MDARGLMKWNSTDISTQ---------------------------------
A0A2W0BQL1      ----------MDARGLMKWNSTDISTQ---------------------------------
A0A2V8ERZ5      ---MLPSSPPDAPAPSTTAVTAGSPSH---------------------------------
A0A7W8J413      ----------MSALQPHSSL-TRPQST---------------------------------
A0A7W8JCF5      ----------MSALQPHPTLSTKNQSA---------------------------------
A0A7W8IEB1      ----------MSALQPHPTLSTKNQSA---------------------------------
A0A7Y9T3I1      ----------MSALQPHPSLS-KHQPA---------------------------------
A0A3P0XH15      ---------------------MEGPAV---------------------------------
A0A3E0P0A3      ---------------------MNLRQR---------------------------------
A0A3M1WQW8      -MSERDERTHLPAPADTGAMDRNVVTR---------------------------------
A0A841JVA9      -----MKRFPEDAGDRPLYPPVLQPQT---------------------------------
A0A3N1JHC1      ------MRTPAGKLRAIAPAETPGPRL---------------------------------
A0A7V4XQR5      ------------------MDALDPQGR---------------------------------
C1F294          ------------------MDTLDPQRQ---------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
A0A7X9FXC4      ------------------------------------------------------------
A0A7X7ZKL5      ------------------------------------------------------------
A0A522PSP1      ---MNFNITERSDAVLRSAGPEEATRL---------------------------------
A0A7W8E8D3      ------------------MRVQTTQPD---------------------------------
G8P085          ------------------MRVQTTQPD---------------------------------
A0A843SRW6      ------------MADRSSGTSAHDSEP---------------------------------
A0A7W8E330      ------------------------------------------------------------
A0A4Q1SGQ1      ---------------------MNEKAL---------------------------------
A0A7V2HGP7      -----------MTNQEQMPEKTIELAP---------------------------------
A0A7R8B6H7      --------MRRYQSDDITGRAIATVNT---------------------------------
A0A2V8GTX0      ------MFTPGGLSTTGPAAGSPPPVP---------------------------------
Q1ILD9          --------------MSATNLATRKDLL---------------------------------
A0A7G8BJH7      ------------------------MAV---------------------------------
A0A2V8J0X9      ---------------MFDTQEVRAQLP---------------------------------
A0A7Y5WWH8      ---------------MFDTQEIRTHAP---------------------------------
A0A7C5SHM3      ------------------------------------------------------------
A0A7V6D154      ---------------MFVSEKQLPNGS---------------------------------
A0A7V1XXZ2      ------------MEDRLAVRSQEDRQA---------------------------------
Q1IJZ6          --------------MDSLFRKSELPPL---------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      KAVQQPSPIPPPQPVAGRAGAPAPWWQ---------------------------------
Q1ITG0          -------------------MEKFSQIE---------------------------------
A0A7C2ML20      ----------------MSGLIGGADQQ---------------------------------
A0A7T9HIZ6      QPVPPLSPAQGSLPLASPPPMAPFDPS---------------------------------
A0A7C5AXS9      QLPEPGKPEEARLPVRYEYVEVPAPET---------------------------------
A0A7C2RGE3      AESGERPFLPPTPSERSSLHAPGAPSG---------------------------------
A0A7V6D075      KETAMESSLVPSQLSQVKPTSSPEQPL---------------------------------
A0A3N5PCI5      ---------------MSDTQQPPSEHD---------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ---------------MQGPDPASERQQ---------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ---------------MQGWSAPPQEPQ---------------------------------
A0A833M5K2      -----------------MNAPVPPAVD---------------------------------
A0A1F2Q9L4      ---------------MVARRPAAPDKI---------------------------------
A0A7V5ZKV2      -----------------MAGQLPFDRP---------------------------------
A0A7Y8LRQ1      -----------------MTDPFPTEQL---------------------------------
A0A3M1PY35      --------------------MAASEPY---------------------------------
A0A3M1VMP2      --------------------MPAMTVP---------------------------------
A0A1F2T595      QGSGSESPVFNAVPSNGSGGSGYGSGS---------------------------------
A0A2V9AC41      ---MEQVNQPSPYFIKRTARVEQGTID---------------------------------
A0A2V2R525      -----IHDLDSPYNVFPFPPVIQTGER---------------------------------
A0A321LPW6      LDAAPPPR---YPALAGAAGTEYGLGY---------------------------------
A0A2V9R9V4      ARQAHDSGAVIYPEIDLP---RYG------------------------------------
A0A321LE75      FGRPGYPRAVGYPEAYATGSYGYG------------------------------------
G2LEI9          ELDLATPTVQDRMRRRGSYQYTLPQED---------------------------------
A0A7V9TW03      ALEQMNGSARNGHANPPIVTY-GEEAS---------------------------------
A0A3N5XQP8      AKQSRQGMQERGGG-----PRLFEPSP---------------------------------
A0A2V9KCS3      ELIRRTNGGVPASG-----SLPYGDSP---------------------------------
A0A7W1JC10      LPVRRPETNAASLP-----AISYVERE---------------------------------
A0A3M2BZG9      DAAPATATPVPPMP------------G---------------------------------
A0A1Q7N5R7      SRAGTAVEKFSPNG----------------------------------------------
A0A352F549      ALEQSNGSSHNGHGNPPIVAY-GEEAS---------------------------------
A0A3B9MLP9      SLEPTNGSLRNGYATPPIVAY-GEEAS---------------------------------
A0A3D5SQ87      SLEPTNGSLRNGYATPPIVAY-GEEAS---------------------------------
A0A7Y2DUG3      QPTETDQDYPASYP-----SS-YDDV----------------------------------
A0A7Y2D8Q4      EIQTQAADYPAAYS-----PM-YDDDS---------------------------------
A0A2V8NW86      SHELVPRKSTEAYP-----GHGEAGSY---------------------------------
A0A3M2D491      EIQEYELT-SRYYP-----SYGGSTEL---------------------------------
A0A7W1CBZ8      NLQTTNQEEPAQYS-----PI-YEDD----------------------------------
A0A7W1FC90      NLQTANQEEPTQYS-----PI-YEDE----------------------------------
A0A7W1ZXG0      NLQTANQEEPTQYS-----PI-YEDE----------------------------------
A0A7W1ZIT3      NLQTANQEEPTQYS-----PI-YDDE----------------------------------
A0A353C9L6      DLRANASEYGSSYS-----SF-YDEEV---------------------------------
A0A2V8RQV0      ELRHSKHEYAGSYS-----GA-YSDEV---------------------------------
A0A2V8SJH5      DLRASKTEYPATYA-----GF-YDDEV---------------------------------
A0A136JPP4      ELNQPAGDLTTSYA-----AY-YDHES---------------------------------
A0A399WUJ8      DLNQPHGELPAAYT-----AY-YDHES---------------------------------
A0A7V9C3X9      NLREVAGEYQAGYS-----SY-YDDEG---------------------------------
A0A7V9ZSX9      DLQKDNQDYPTSYA-----PF-YDDEN---------------------------------
A0A3M1SIV3      NAITYQEEGPRYFA-----SYAYGDDI---------------------------------
A0A7V1SCI4      GAITYQEEGPRYFA-----SYAYGEDI---------------------------------
A0A7C5ZUA8      ESPLAPAGYASAYP-----AF-YDEEA---------------------------------
A0A7T9FQE4      DLQPAQVDYPFNYS-----PS-YDDSF---------------------------------
A0A3E0PHB0      SLQTAPQDYPPAYS-----PF-YDDEA---------------------------------
A0A7T9G4W3      GLQPQPQDYPPAYS-----PF-YDDDS---------------------------------
A0A838UAA0      DLQSTQSEYPTNYS-----GF-YDDE----------------------------------
A0A7W1HTU2      DLQPTNQDYSTNYA-----PF-YDDDT---------------------------------
A0A357F267      DLRANGGDYGSGYS-----SF-YDEEI---------------------------------
A0A7V9ICU8      ELKTGPTEYPVGYT-----GM-YDDEI---------------------------------
A0A7T9JEF9      DREAII----------LADLDEYHDSN---------------------------------
A0A399WNU1      DPESLDFYDQD-D---LYPESYYGDSI---------------------------------
A0A3E0PCN7      GQETIVYGDYEGD---YFDSSYYGGA----------------------------------
A0A7Y4TLV3      VPDPLLRLEPE-E---FYVDDYYGSA----------------------------------
A0A7W0MGQ3      ------------------------------------------------------------
A0A1Q7Y6W9      NELEVAGETFSPS---PSAYKGYDSAA---------------------------------
A0A2V8NC68      HGNGNSGEPLM-Q---PSFRQDYRYMG---------------------------------
A0A352FLX4      I-GDEHIGLERTNGGHVLPGVMQGAYS---------------------------------
A0A2V8MHG6      --RDVGGVLERS----LTPYTRYDSYE---------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      --RDVGGVMERS----LAPYTRYDSYA---------------------------------
A0A1Q7NJH5      --RDVGGPWDRS----LAPYTRYDSYA---------------------------------
A0A2V8PJY0      --RDVGGPWDRS----LAPYTRYDSYA---------------------------------
A0A7W1BYD3      --SAPESRLPARRTEAYSPSLPVISYG---------------------------------
A0A838PIP9      --SASESRLPARRTEANYPSLPAIGYG---------------------------------
A0A399WK13      P-VELQRPPDPAI----PTTGRYPGYS---------------------------------
A0A7V8YZQ7      P-LDFERQFEPQI---VAGTGRYPAYK---------------------------------
A0A7V9ICV8      TVVDLERQFDSHI---VPATGRYPGYR---------------------------------
A0A136KC10      --MEMERPADPTI---AAT-GRYPGYP---------------------------------
A0A7W1IVA5      T-VEIERPFEPQI---PATNGSYGAYR---------------------------------
A0A7W1ZIE3      T-VEIERPFEPQI---PATNGSYGAYR---------------------------------
A0A7T9J551      N-LELERPFDYRP---AVP-GQYPSYR---------------------------------
A0A7V9NLN0      T-VDIERPFELQN---TSANNGYGAYR---------------------------------
A0A7T9G8R2      K-AEIERPFEAVA---PITSYGYARYR---------------------------------
A0A7Y2D047      Q-AEIERPFDSPP---VTPTGRYAMYR---------------------------------
A0A3M2D6Y5      N-TEVEFRSQ-PF---V-SSGNYYSAA---------------------------------
A0A2V8SEX6      P-VELERHFE-PQ---IVPAGRYPSYR---------------------------------
A0A7C5ZUU4      P-VDLEKVLE-TP---L-PIGRYPAYR---------------------------------
A0A3E0PCJ6      S-AEVERPFEAVA---PITNYGYARYR---------------------------------
A0A2V8RTL7      TVVELERPFETHV---IPGTGRYPAYR---------------------------------
A0A3M1S4R8      --RE-ELEPRWQS---PSYYPSYKSFS---------------------------------
A0A7V1SAJ0      --RE-ELEPKWQS---PSYYPSYKSFS---------------------------------
A0A7W0N726      --VDIERPFELQN---SSANNGYGAYR---------------------------------
A0A7W1HTZ7      --MDIEHQFEPQI---PAANGGYGAYR---------------------------------
A0A1Q7YFI6      --RVVELQANGNGAGLPYGSYAYGSSE---------------------------------
A0A7V9C9Y7      ----------MTS---LPPSGGSY-IL---------------------------------
A0A7W1G8A4      --QGLEKLIETPP---LPPSYASY-GV---------------------------------
A0A7V9KMZ1      --TAIEKPIEMGA---PPHSYNYG-VD---------------------------------
A0A7W0JTE4      ------------------------------------------------------------
A0A0B6WWQ6      --IRLDASAPYPK---LYADYDHR-WE---------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A838PA20      --AAIEKPIEGVA---APHSYNYG-VD---------------------------------
A0A352EX26      --TAIGRPADSNG---IPHSYNYG-VD---------------------------------
A0A7V9R410      --TAIDGPAHSNG---IPHSYNYG-VD---------------------------------
A0A2V8MM59      --QDLDRRLDDHG---P-RPYAYG-YG---------------------------------
A0A2V8PFE8      --GEIDRRFDGSA---NYRGPVYG-YG---------------------------------
A0A2V8PWS6      --GEMDRRFDDAA---NYRGGVYG-YG---------------------------------
A0A2V8LCT5      --REIDRRTGDTT---SYRTA-YG-YN---------------------------------
A0A352FTJ9      --RPVERRSDESQ---PYR-G-YG-YG---------------------------------
A0A1F2S1W5      VLGLDAAPDAGLAPQPSAATGGSGYGY---------------------------------
A0A2N9LQU7      -------------MQNIPEQQLARVTA---------------------------------
A0A2P6WFK7      ------MRPAACQESHMPEIEQDSLAT---------------------------------
A0A2V8JQV5      EHDLTNKGNGEPSQDPVRKVSKSGKPQ---------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V8DRT9      KKNLAP---------RPRRAVRAASGK---------------------------------
A0A2V7VYF3      -----IGHDETAEDTRPQAESYWNDDR---------------------------------
A0A1F2SVH2      ---------------SPRIAMAGEDAR---------------------------------
A0A2V8AJG9      RLEMAPGLDSIDAGAAPPISAAAPNGR---------------------------------
A0A2V9MAM9      VSKLSKAPQRPSHSLSRAEFQRLARPS---------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A348V070      ------------------------MDK---------------------------------
A0A2Z5G3A3      -----------------------MKTL---------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------MAFDNNDAS---------------------------------
A0A2Z5G7H4      ------------------MGPRADVRE---------------------------------
A0A372IT17      ------------------MTSPTHILE---------------------------------
A0A841JU67      ------------------MTTGVRILE---------------------------------
A0A7T9GJJ6      ERPMLPPDESLYIRPSAAQQITSLDQL---------------------------------
A0A7Y4UER8      EKLATHNDEALLQRPLMAPARPVSNDD---------------------------------
A0A2V8IYW3      ------------------------------------------------------------
A0A7V2HCZ0      --MGVYHSANDSSQRQLVPASTANVPA---------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      MKPSEFPLDKTDRRRNELSRGAEQRPT---------------------------------
A0A2V8XIF4      MQASQFSIEKSKRRPNGLSANGKQRPV---------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A2W0BGU4      TNPLMKSDPATRRELVDYEIAPHPTPE---------------------------------
A0A2W0BVQ9      TNPLMKSDPATRRELVDYEIAPHATPE---------------------------------
A0A317J121      -MRHLNHDQPEPGNNRLPALPNSYFVQ---------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      SSRCPAPTWPPGPSRSERRRGSPAVSP---------------------------------
A0A2V7X2F7      ---------------------MASPSQ---------------------------------
A0A2V7V2I1      ------------------------MST---------------------------------
A0A2V7U3M2      ------------------MEGTSPVTP---------------------------------
A0A2V7UHT0      ----------MWPRRTVLSKELSSVTP---------------------------------
A0A3P0X3W6      SAPPSQIAHYTGPQ----------------------------------------------
A0A7V2MG68      IPDPGKLPALTGDARLPAYPPHSSAAG---------------------------------
A0A7C6A629      PPGSGGLPAAPAYP----------PAP---------------------------------
A0A7V2HBQ5      PDRPIPVSAQGGWVFTPAL-----ASG---------------------------------
A0A2U3JZ71      PALPAPLEALPGRNLPVPMEVYRTSNL---------------------------------
A0A2V8TTB0      PAVP---------------EVYRAAAP---------------------------------
A0A2N9MK30      RGPRSLPVAAGFGPAQPASW----------------------------------------
A0A3D1ASD2      ----------SNLPALPSTYSVSHITA---------------------------------
A0A7R8B699      QQGLIALSGNPNGNGALSPIYLQQVMP---------------------------------
A0A7S7SGU3      VRRMTPAMAYQQSPLAPATVILS-------------------------------------
A0A7Y8HY45      ----------MQLPAAAPAVFIQ-------------------------------------
A0A7C5AXI3      LPAVSETYSVS--IPQPVVF--P-------------------------------------
A0A7C6E4H7      LPSGSGPVAAPGYPPAPVGWYGP-------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V8GFD4      NEQHQHHEIRIDMPADSAFASARDAVE---------------------------------
A0A2V8HSS5      NEQHQHHEIRIDMPADSAFASARDAVE---------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A2V9JSI3      ---MTNDNALAPIEHVPFERVGYRKPS---------------------------------
A0A2V9WI32      DSGIVRRRSDTSTLEQLPTEIQFPADP---------------------------------
A0A2V9KBD6      -----------MDLSRPEPRLPPKVPS---------------------------------
A0A2W0AJ66      TGEPAPDSAA-QTLVQTPPNLKPGLPN---------------------------------
A0A1Q7RBU1      MNQLGRDSAAVQ-----LTRAAPNLPN---------------------------------
A0A2V9JPV9      MNQHPRNSLAVQPPSRGVPRSTPNLSN---------------------------------
A0A7V0Y3A1      PKQLPGYDGPDGRENPAALMRRNEAPL---------------------------------
A0A7C5Z4J3      ---------MPQEANESASETVLPERA---------------------------------
A0A1F2TPT3      PAEATPPDDIRLSMEGTAEPALRRYEN---------------------------------
A0A2V8JTQ2      --------------------PNPANHY---------------------------------
A0A2V8UZY0      EPENLEVHGTRAAPRFVRSLPNHPPHP---------------------------------
A0A350UEK1      HDSRLPARFEIVEAGVPHRLEGPQVNY---------------------------------
A0A350UIQ4      ANSRLPVKFEIVDA--PPANSDP---Y---------------------------------
A0A7T9GJN6      NELKTIEK----------LPPDQALTS---------------------------------
A0A7T9GJN7      DDNKEISRPLTNEETALMRPFTAPRPS---------------------------------
A0A1H5Z7N3      --------MIPVRAQTSQASESEVVMP---------------------------------
A0A1G7JVV8      --------MPPLTNQ---PSDRVVPET---------------------------------
A0A1H4T6W9      ------------MNQ---PVTH-DPAN---------------------------------
I3ZEU5          --------MPPATNQ---PVPT-DPAS---------------------------------
A0A7W7ZGZ3      --------MALQIEQ-PASPRESASFT---------------------------------
A0A7G8BSK5      --------MGPQSAQ-TPPNTMGVSDT---------------------------------
A0A428MDU2      ---------MGLENP-QQPGPGAPETN---------------------------------
E8WVF6          --------MSSDNPY-SNPGPGMSQAQ---------------------------------
A0A1I6MH75      --------MDRQTTE-TTSPTGVPHTP---------------------------------
A0A7Y9TM87      --------MTSQGTP-NPPNVGVPGAR---------------------------------
A0A7W8J1H5      ---------MGSKNT-QPPLVGVPETN---------------------------------
A0A7Y9T5K4      ---------MGSKNT-QPPHVSVPETN---------------------------------
A0A852VHP9      ---------MGSKNT-QPPHVGVPETN---------------------------------
A0A7W8IFZ2      ---------MGSKNT-QPPHVGVPETN---------------------------------
A0A7W8J9Y9      ---------MGSKNT-QPPHVGVPETN---------------------------------
A0A7L5A6M5      --------MTPDASQ-DATAVGAPRPT---------------------------------
A0A5B9EBI2      --------MGPQNPQ-QPL---PPTTD---------------------------------
A0A7Y5RFT3      --------MGPQNPQ-QPL---PPTTD---------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ----------MADDG-PGT--GTPHAP---------------------------------
A0A1Q3QQB6      --------MGLQNTQ-PSADGDTSELN---------------------------------
A0A3N1K1G7      --------MGPKETP-PVA--GAPDLS---------------------------------
A0A4V2G466      --------MGPQSAQTPSHTGGASETT---------------------------------
A0A6B9YNQ8      --------MGLQSAQTPPQAGGASDTS---------------------------------
A0A3N6A5T6      PTQIRPSPSPNWAHQKPKAPSKVEVP----------------------------------
A0A2V8R8U7      DERLVPAGR---GLDNSLADLTQAKPF---------------------------------
A0A7V9Q528      DNRLMPLSSE--TLDRPLRDFTQPVP----------------------------------
A0A2V8QMP4      DNRLLPLTPE--TLDRPLRDLAQPSP----------------------------------
A0A2V8R4S3      DNRLLPLTPE--TLDRPLRDLAQPSP----------------------------------
A0A2V8NJ55      DNRLLPLTST--SLDRPLSDLAQ-SK----------------------------------
A0A7V9ZQ50      DNRLLPLPST--SLDRPLNDLAP-SK----------------------------------
A0A2V8Q7I0      ------MPAVDRGLEKPQTD----QI----------------------------------
A0A2V8S6K4      DNRLLPLPTPAGNIDRPLRDLTQPAV----------------------------------
A0A317I2L9      DNRLMPMPAVERSLDKPLTDLN--AA----------------------------------
A0A2V8LLF9      DEHLVPART-GRDFDSTLADLTQSKPY---------------------------------
A0A352FRF4      DERLVPARP-ARDLDRTLAELTQSKGY---------------------------------
A0A7W1GE99      DNRLMPLSS--ESLDRPLRDLAYSAPA---------------------------------
A0A1Q7YKQ8      DNRLLPLPQ-ERGLDRPLSSLPHSKS----------------------------------
A0A0B6WXT1      DNRLLPLSQTEQQLDRPLHDLTLGQP----------------------------------
A0A2V8MKV0      DERLIPARA-GRELDRSLADFATAKPY---------------------------------
A0A2V8PYY8      DERLIPARA-GRELDRSLADFATAKPY---------------------------------
A0A3B9MEU8      DNRLLPVSALDRSIDRPLADIAQAKP----------------------------------
A0A352F3R7      DNRLLPVSALDRSIDRPLADLVPAKP----------------------------------
A0A7W0GRF6      DNRLMPVSTLDRHLDRPLAEIAQAKP----------------------------------
A0A7W1H6G6      ----MPVSTLDRHLDRPLAEIAQAKP----------------------------------
A0A7V9HZC8      DNRLVPVSPLDRHLDRPLAEIAQAKP----------------------------------
A0A7W0XCB9      DNRLIPLSPLDRQLDRPLAEIAQGKP----------------------------------
A0A3N5YNR8      ------MGDLIRREYSSIPDPSIRIQR---------------------------------
A0A7W7ZUJ7      FAEPVRHDSPRLASLQEM------------------------------------------
A0A2V2R0I6      EHKLVRRESGSNVPVEIVP----PANR---------------------------------
A0A2V8XAR9      DNKLVPRENGSNGPVELVP----LPAR---------------------------------
A0A2V8VZA0      ENKLVPRENGSSGAVEVVS----LSNR---------------------------------
A0A1Q7CB82      ENKLVPRENGSSGAVEVVS----LSSR---------------------------------
A0A2V8WIU1      ENKLVPRENGSSGAVEVVS----LSSR---------------------------------
A0A1Q6Y9F5      ENKLVPRENGSNGAVELVS----LQSR---------------------------------
A0A2V9EVV8      ENKLVPRENGSNGAVELVS----LQSR---------------------------------
A0A2V8YF91      ENKLVSRGNGSNGAIELAP----VTPR---------------------------------
A0A2V8XZK2      ENKLVPRENGSNGAVELVP----NTPR---------------------------------
A0A2V8ZTX6      -------------HVELAP----LPNR---------------------------------
A0A2V9BT79      ENKLVPHENGSNGNVELVP----IPGR---------------------------------
A0A2V9YHT3      GKLIRAEDAGNGKSSLDF-----PPPL---------------------------------
A0A7C2XNI7      GKLVPREPLERAGTLAPAETTGGTPFV---------------------------------
A0A1Q8B793      GSKLAAHDNGANGAVEIIQ----APLR---------------------------------
A0A2V9BCA0      GSKLAAHDNGANGAVEIIQ----APLR---------------------------------
A0A2V9BWU9      STALMQRDRRAGSSFEVIT----AHPQ---------------------------------
A0A2V9DKX2      STALIQRDRRAGSSFEVIT----AHPQ---------------------------------
A0A7C2YQY3      ------------LERRASPVTLLAEPF---------------------------------
A0A845TWB8      SRGRDHDSELRILARRREPLTILAETA---------------------------------
A0A2U3KC61      PLQPKRNNSDALEALEPIDPLPVKGPQ---------------------------------
A0A2V9Y2R7      DSPIVVRSADNLPGQRSLEILDQTPPS---------------------------------
A0A2V9NGH6      SAPLIAANTRVLRELPSAHPVEFRRQF---------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      PSPVMQI-GNQVREM-GPASMQIGRNI---------------------------------
A0A2V9QD92      PSPVMQI-GNQVREM-GPASMQIGRNI---------------------------------
A0A2V9WPZ6      SGPLVHTNGQMIREVQAPYPVEFSRQL---------------------------------
A0A2V9ZLH4      PGSLIPSNGQPVRELQAIAPVEFSQQV---------------------------------
A0A2V9RQF1      ----MPANAQGLRESPDPLPVEVNRTT---------------------------------
A0A2V9YDK8      SGPLVQTNGQTIREVQPVYPVEFGRQM---------------------------------
A0A2V9V8F7      SGPLVHTNGHMIREVQAPYPVEFSRQL---------------------------------
A0A2V9XGR9      SGPLVHTNGQMIREVQAPYPVEFSRQL---------------------------------
A0A2V9V3Q5      LGPLVPHNDG-FREIQPAEPTELIKPI---------------------------------
A0A2V9NWS3      SGPLIPANGQMLREISSLSSFDLNR-Q---------------------------------
A0A2V9USA9      SGPLVPANSGVVREI-PLTSPEFGRAA---------------------------------
A0A2V9XW18      LGPLAPLGTPTIREIQPSQNVDLVRPQ---------------------------------
A0A1H5SQF5      LQDVTSRSASTHR-----------------------------------------------
A0A2V8G155      -MSDTKEGLRMMGAPAPGDYALND------------------------------------
A0A2V8HDM7      -MSDTKEGLRVVGAPAPGDYALND------------------------------------
A0A2V8IVN9      PEDAV---LRAPGEAAGGGYASYPDIV---------------------------------
A0A7W1SCW7      PAQSAQPQVSAAAPAPDGGKAS--------------------------------------
A0A3E0NV31      RHGGGGVGPGARRG----------------------------------------------
A0A3N5M5V0      TIRMQRTGNYQ-------------------------------------------------
A0A7X7XDY5      GEPDPRHPAVLTTPTYQLVV----------------------------------------
A0A2V9L5B5      QHAIEPAFSRSLQESEVL------------------------------------------
A0A2V9LK56      GASLAPRTTA-LPDSRVL------------------------------------------
A0A2V9L7I0      VRALARTATQPLEKPEIL------------------------------------------
A0A522PPT0      TGNVERLNGHYLREEDVL------------------------------------------
A0A7C5V1G5      TRSVERLDGSYLHEEKIL------------------------------------------
A0A4R1LC91      ------------MKALTGSQANFA------------------------------------
A0A2V9QB26      SHDLVLRKSEGSPGHGEAGSYLYG------------------------------------
A0A2V9VYY4      IDPLPVNGHQPLH-----------------------------------------------
A0A2V9KIE8      VSMEQVRGQEFL------------------------------------------------
A0A7C2GJ20      PERSSLQAPGAMSGHVMKFYPASAFR----------------------------------
A0A7C4BTL5      PAPIEAPAPSVSQTRVYEQDG---------------------------------------
A0A7X8YVF2      GDRP-PAGALVPAGTIPMPPGPFDPYA---------------------------------
A0A7X7YEP0      ---------MATNPQPPVFEEPQL------------------------------------
A0A2V9CBM2      AHRLARK-RGSLEASVVELADSYE------------------------------------
A0A2V8XN17      GHRLDRRGPGAPDSRVIELPDSYE------------------------------------
A0A2V8WX45      GHRLDRRGPGALDGRVVELPDSYE------------------------------------
A0A1Q6YR79      GHRLDRRGPGALDGRVLELPDSYE------------------------------------
A0A1Q7VA32      GHRLDRRGPGALDGRVLELPDSYE------------------------------------
A0A2V9EY85      SHRLDRRGPGALDSRIIELPDSYE------------------------------------
A0A2V9H8K0      DQRLERRGPDALNTRVIEMPDSYE------------------------------------
A0A2V9FFE5      RHQLERRGPDALNTRIVELPDSYE------------------------------------
A0A2V9GM43      RHQLERRGPDALNTRIVELPDSYE------------------------------------
A0A2V8ZHL8      KLPVLE-----SPQSPAFPVLGID------------------------------------
A0A2V9B240      RLPVPE-----SPHLPAFPVLGTD------------------------------------
A0A2V9CYQ5      AHRLVRRTGNGLEASVVELADSYE------------------------------------
A0A2V9BWU8      GPRSGHGGLRFMDNRVVDLSDSYE------------------------------------
A0A2V8ZG48      DARFERARLGFLDHRIVDLSDSYE------------------------------------
A0A2V8Y334      GPRFERGGRAFLDHRVLDLSDAYE------------------------------------
A0A2V9AY68      RPRFERGGSVLLDNRVLDLSDSYE------------------------------------
A0A1F2RFI7      LKGE-------VPATTTVAAYTIS------------------------------------
A0A1F2RZS3      GQID-------APASVPVSSYPVE------------------------------------
A0A845TW47      A--R-------LERRPLAATGSSG------------------------------------
A0A845TXC1      VIGT-------LTRRAATAVAPIE------------------------------------
A0A1F2USE2      SPPM-------LARPEPPVPVAYE------------------------------------
A0A7C2VB08      PGPI-------VP--GPLPAPRAT------------------------------------
A0A2V9C238      AVRK-------WERLRPTPAVRAE------------------------------------
A0A1F2Q9F5      AART-------LERRRPGVPAPLQ------------------------------------
A0A1F2QQH9      AART-------LERRRPGVPAPLQ------------------------------------
A0A1F2QXK7      AARA-------LERRRPGVPAPLQ------------------------------------
A0A2V9DEM9      AVRK-------WERLRPTAAVRAE------------------------------------
                                                                            

A0A2V7VMF7      LLLAALVLPGARMVAQEAPRPPATPAPEYVVGPGDILQITVYGNEELSRAPTVQSNGTIG
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A831T3F4      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A7W0JWI4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A7Y9PHF8      ------------------------------------------------------------
A0A7W8J3G9      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A7W1TTH3      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7V0UHS9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A7V4SJP8      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A7Y8IYX6      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A7T9JJ28      ------------------------------------------------------------
A0A7T9GE94      ------------------------------------------------------------
A0A7Y4X7L5      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A843SYC7      ------------------------------------------------------------
A0A7V9BJ09      ------------------------------------------------------------
A0A7W1DT80      ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A841JWG5      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A7X7ZKA6      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A7W8J413      ------------------------------------------------------------
A0A7W8JCF5      ------------------------------------------------------------
A0A7W8IEB1      ------------------------------------------------------------
A0A7Y9T3I1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A841JVA9      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A7V4XQR5      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
A0A7X9FXC4      ------------------------------------------------------------
A0A7X7ZKL5      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
A0A7W8E8D3      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A843SRW6      ------------------------------------------------------------
A0A7W8E330      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
A0A7V2HGP7      ------------------------------------------------------------
A0A7R8B6H7      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A7Y5WWH8      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
A0A7V6D154      ------------------------------------------------------------
A0A7V1XXZ2      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7T9HIZ6      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A7V6D075      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A833M5K2      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A7V5ZKV2      ------------------------------------------------------------
A0A7Y8LRQ1      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A7V9TW03      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A7W1JC10      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A7Y2DUG3      ------------------------------------------------------------
A0A7Y2D8Q4      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A7W1CBZ8      ------------------------------------------------------------
A0A7W1FC90      ------------------------------------------------------------
A0A7W1ZXG0      ------------------------------------------------------------
A0A7W1ZIT3      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A7V9C3X9      ------------------------------------------------------------
A0A7V9ZSX9      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A7V1SCI4      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A7T9FQE4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A7T9G4W3      ------------------------------------------------------------
A0A838UAA0      ------------------------------------------------------------
A0A7W1HTU2      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7V9ICU8      ------------------------------------------------------------
A0A7T9JEF9      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A7Y4TLV3      ------------------------------------------------------------
A0A7W0MGQ3      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A7W1BYD3      ------------------------------------------------------------
A0A838PIP9      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A7V8YZQ7      ------------------------------------------------------------
A0A7V9ICV8      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A7W1IVA5      ------------------------------------------------------------
A0A7W1ZIE3      ------------------------------------------------------------
A0A7T9J551      ------------------------------------------------------------
A0A7V9NLN0      ------------------------------------------------------------
A0A7T9G8R2      ------------------------------------------------------------
A0A7Y2D047      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7V1SAJ0      ------------------------------------------------------------
A0A7W0N726      ------------------------------------------------------------
A0A7W1HTZ7      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A7V9C9Y7      ------------------------------------------------------------
A0A7W1G8A4      ------------------------------------------------------------
A0A7V9KMZ1      ------------------------------------------------------------
A0A7W0JTE4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A838PA20      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A7V9R410      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A841JU67      ------------------------------------------------------------
A0A7T9GJJ6      ------------------------------------------------------------
A0A7Y4UER8      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
A0A7V2HCZ0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A7V2MG68      ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A7V2HBQ5      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7R8B699      ------------------------------------------------------------
A0A7S7SGU3      ------------------------------------------------------------
A0A7Y8HY45      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A7V0Y3A1      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A7T9GJN6      ------------------------------------------------------------
A0A7T9GJN7      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7W7ZGZ3      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
A0A7Y9TM87      ------------------------------------------------------------
A0A7W8J1H5      ------------------------------------------------------------
A0A7Y9T5K4      ------------------------------------------------------------
A0A852VHP9      ------------------------------------------------------------
A0A7W8IFZ2      ------------------------------------------------------------
A0A7W8J9Y9      ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A7Y5RFT3      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A7V9Q528      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A7V9ZQ50      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A7W1GE99      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A7W0GRF6      ------------------------------------------------------------
A0A7W1H6G6      ------------------------------------------------------------
A0A7V9HZC8      ------------------------------------------------------------
A0A7W0XCB9      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A7W7ZUJ7      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A845TWB8      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7W1SCW7      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A7X7XDY5      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A7X8YVF2      ------------------------------------------------------------
A0A7X7YEP0      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A845TW47      ------------------------------------------------------------
A0A845TXC1      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LPLLGDVAVTGLSASEIQRKLTALLARDFLVNPQVEVKVKEYQSQFVSVVGEVNNPGRKA
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A831T3F4      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A7W0JWI4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A7Y9PHF8      ------------------------------------------------------------
A0A7W8J3G9      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A7W1TTH3      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7V0UHS9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A7V4SJP8      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A7Y8IYX6      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A7T9JJ28      ------------------------------------------------------------
A0A7T9GE94      ------------------------------------------------------------
A0A7Y4X7L5      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A843SYC7      ------------------------------------------------------------
A0A7V9BJ09      ------------------------------------------------------------
A0A7W1DT80      ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A841JWG5      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A7X7ZKA6      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A7W8J413      ------------------------------------------------------------
A0A7W8JCF5      ------------------------------------------------------------
A0A7W8IEB1      ------------------------------------------------------------
A0A7Y9T3I1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A841JVA9      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A7V4XQR5      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
A0A7X9FXC4      ------------------------------------------------------------
A0A7X7ZKL5      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
A0A7W8E8D3      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A843SRW6      ------------------------------------------------------------
A0A7W8E330      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
A0A7V2HGP7      ------------------------------------------------------------
A0A7R8B6H7      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A7Y5WWH8      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
A0A7V6D154      ------------------------------------------------------------
A0A7V1XXZ2      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7T9HIZ6      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A7V6D075      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A833M5K2      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A7V5ZKV2      ------------------------------------------------------------
A0A7Y8LRQ1      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A7V9TW03      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A7W1JC10      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A7Y2DUG3      ------------------------------------------------------------
A0A7Y2D8Q4      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A7W1CBZ8      ------------------------------------------------------------
A0A7W1FC90      ------------------------------------------------------------
A0A7W1ZXG0      ------------------------------------------------------------
A0A7W1ZIT3      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A7V9C3X9      ------------------------------------------------------------
A0A7V9ZSX9      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A7V1SCI4      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A7T9FQE4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A7T9G4W3      ------------------------------------------------------------
A0A838UAA0      ------------------------------------------------------------
A0A7W1HTU2      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7V9ICU8      ------------------------------------------------------------
A0A7T9JEF9      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A7Y4TLV3      ------------------------------------------------------------
A0A7W0MGQ3      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A7W1BYD3      ------------------------------------------------------------
A0A838PIP9      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A7V8YZQ7      ------------------------------------------------------------
A0A7V9ICV8      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A7W1IVA5      ------------------------------------------------------------
A0A7W1ZIE3      ------------------------------------------------------------
A0A7T9J551      ------------------------------------------------------------
A0A7V9NLN0      ------------------------------------------------------------
A0A7T9G8R2      ------------------------------------------------------------
A0A7Y2D047      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7V1SAJ0      ------------------------------------------------------------
A0A7W0N726      ------------------------------------------------------------
A0A7W1HTZ7      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A7V9C9Y7      ------------------------------------------------------------
A0A7W1G8A4      ------------------------------------------------------------
A0A7V9KMZ1      ------------------------------------------------------------
A0A7W0JTE4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A838PA20      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A7V9R410      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A841JU67      ------------------------------------------------------------
A0A7T9GJJ6      ------------------------------------------------------------
A0A7Y4UER8      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
A0A7V2HCZ0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A7V2MG68      ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A7V2HBQ5      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7R8B699      ------------------------------------------------------------
A0A7S7SGU3      ------------------------------------------------------------
A0A7Y8HY45      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A7V0Y3A1      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A7T9GJN6      ------------------------------------------------------------
A0A7T9GJN7      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7W7ZGZ3      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
A0A7Y9TM87      ------------------------------------------------------------
A0A7W8J1H5      ------------------------------------------------------------
A0A7Y9T5K4      ------------------------------------------------------------
A0A852VHP9      ------------------------------------------------------------
A0A7W8IFZ2      ------------------------------------------------------------
A0A7W8J9Y9      ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A7Y5RFT3      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A7V9Q528      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A7V9ZQ50      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A7W1GE99      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A7W0GRF6      ------------------------------------------------------------
A0A7W1H6G6      ------------------------------------------------------------
A0A7V9HZC8      ------------------------------------------------------------
A0A7W0XCB9      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A7W7ZUJ7      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A845TWB8      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7W1SCW7      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A7X7XDY5      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A7X8YVF2      ------------------------------------------------------------
A0A7X7YEP0      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A845TW47      ------------------------------------------------------------
A0A845TXC1      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LRGRTRLFDVLIEAGGFTPRASGEVVITRREGTFDNGGHSLRLQFSGASPAPKDLVNLEV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A831T3F4      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A7W0JWI4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A7Y9PHF8      ------------------------------------------------------------
A0A7W8J3G9      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A7W1TTH3      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7V0UHS9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A7V4SJP8      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A7Y8IYX6      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A7T9JJ28      ------------------------------------------------------------
A0A7T9GE94      ------------------------------------------------------------
A0A7Y4X7L5      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A843SYC7      ------------------------------------------------------------
A0A7V9BJ09      ------------------------------------------------------------
A0A7W1DT80      ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A841JWG5      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A7X7ZKA6      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A7W8J413      ------------------------------------------------------------
A0A7W8JCF5      ------------------------------------------------------------
A0A7W8IEB1      ------------------------------------------------------------
A0A7Y9T3I1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A841JVA9      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A7V4XQR5      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
A0A7X9FXC4      ------------------------------------------------------------
A0A7X7ZKL5      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
A0A7W8E8D3      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A843SRW6      ------------------------------------------------------------
A0A7W8E330      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
A0A7V2HGP7      ------------------------------------------------------------
A0A7R8B6H7      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A7Y5WWH8      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
A0A7V6D154      ------------------------------------------------------------
A0A7V1XXZ2      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7T9HIZ6      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A7V6D075      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A833M5K2      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A7V5ZKV2      ------------------------------------------------------------
A0A7Y8LRQ1      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A7V9TW03      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A7W1JC10      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A7Y2DUG3      ------------------------------------------------------------
A0A7Y2D8Q4      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A7W1CBZ8      ------------------------------------------------------------
A0A7W1FC90      ------------------------------------------------------------
A0A7W1ZXG0      ------------------------------------------------------------
A0A7W1ZIT3      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A7V9C3X9      ------------------------------------------------------------
A0A7V9ZSX9      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A7V1SCI4      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A7T9FQE4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A7T9G4W3      ------------------------------------------------------------
A0A838UAA0      ------------------------------------------------------------
A0A7W1HTU2      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7V9ICU8      ------------------------------------------------------------
A0A7T9JEF9      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A7Y4TLV3      ------------------------------------------------------------
A0A7W0MGQ3      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A7W1BYD3      ------------------------------------------------------------
A0A838PIP9      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A7V8YZQ7      ------------------------------------------------------------
A0A7V9ICV8      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A7W1IVA5      ------------------------------------------------------------
A0A7W1ZIE3      ------------------------------------------------------------
A0A7T9J551      ------------------------------------------------------------
A0A7V9NLN0      ------------------------------------------------------------
A0A7T9G8R2      ------------------------------------------------------------
A0A7Y2D047      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7V1SAJ0      ------------------------------------------------------------
A0A7W0N726      ------------------------------------------------------------
A0A7W1HTZ7      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A7V9C9Y7      ------------------------------------------------------------
A0A7W1G8A4      ------------------------------------------------------------
A0A7V9KMZ1      ------------------------------------------------------------
A0A7W0JTE4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A838PA20      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A7V9R410      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A841JU67      ------------------------------------------------------------
A0A7T9GJJ6      ------------------------------------------------------------
A0A7Y4UER8      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
A0A7V2HCZ0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A7V2MG68      ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A7V2HBQ5      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7R8B699      ------------------------------------------------------------
A0A7S7SGU3      ------------------------------------------------------------
A0A7Y8HY45      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A7V0Y3A1      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A7T9GJN6      ------------------------------------------------------------
A0A7T9GJN7      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7W7ZGZ3      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
A0A7Y9TM87      ------------------------------------------------------------
A0A7W8J1H5      ------------------------------------------------------------
A0A7Y9T5K4      ------------------------------------------------------------
A0A852VHP9      ------------------------------------------------------------
A0A7W8IFZ2      ------------------------------------------------------------
A0A7W8J9Y9      ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A7Y5RFT3      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A7V9Q528      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A7V9ZQ50      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A7W1GE99      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A7W0GRF6      ------------------------------------------------------------
A0A7W1H6G6      ------------------------------------------------------------
A0A7V9HZC8      ------------------------------------------------------------
A0A7W0XCB9      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A7W7ZUJ7      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A845TWB8      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7W1SCW7      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A7X7XDY5      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A7X8YVF2      ------------------------------------------------------------
A0A7X7YEP0      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A845TW47      ------------------------------------------------------------
A0A845TXC1      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      PLQNGDLITASAKYYVTVEGEVVRPGRYPLEEETTISTAVIAAGGLTRFAKNDVRIRRVS
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A831T3F4      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A7W0JWI4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A7Y9PHF8      ------------------------------------------------------------
A0A7W8J3G9      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A7W1TTH3      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7V0UHS9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A7V4SJP8      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A7Y8IYX6      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A7T9JJ28      ------------------------------------------------------------
A0A7T9GE94      ------------------------------------------------------------
A0A7Y4X7L5      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A843SYC7      ------------------------------------------------------------
A0A7V9BJ09      ------------------------------------------------------------
A0A7W1DT80      ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A841JWG5      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A7X7ZKA6      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A7W8J413      ------------------------------------------------------------
A0A7W8JCF5      ------------------------------------------------------------
A0A7W8IEB1      ------------------------------------------------------------
A0A7Y9T3I1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A841JVA9      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
A0A7V4XQR5      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
A0A7X9FXC4      ------------------------------------------------------------
A0A7X7ZKL5      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
A0A7W8E8D3      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A843SRW6      ------------------------------------------------------------
A0A7W8E330      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
A0A7V2HGP7      ------------------------------------------------------------
A0A7R8B6H7      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A7Y5WWH8      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
A0A7V6D154      ------------------------------------------------------------
A0A7V1XXZ2      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7T9HIZ6      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A7V6D075      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A833M5K2      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A7V5ZKV2      ------------------------------------------------------------
A0A7Y8LRQ1      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A7V9TW03      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A7W1JC10      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A7Y2DUG3      ------------------------------------------------------------
A0A7Y2D8Q4      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A7W1CBZ8      ------------------------------------------------------------
A0A7W1FC90      ------------------------------------------------------------
A0A7W1ZXG0      ------------------------------------------------------------
A0A7W1ZIT3      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A7V9C3X9      ------------------------------------------------------------
A0A7V9ZSX9      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A7V1SCI4      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A7T9FQE4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A7T9G4W3      ------------------------------------------------------------
A0A838UAA0      ------------------------------------------------------------
A0A7W1HTU2      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7V9ICU8      ------------------------------------------------------------
A0A7T9JEF9      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A7Y4TLV3      ------------------------------------------------------------
A0A7W0MGQ3      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A7W1BYD3      ------------------------------------------------------------
A0A838PIP9      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A7V8YZQ7      ------------------------------------------------------------
A0A7V9ICV8      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A7W1IVA5      ------------------------------------------------------------
A0A7W1ZIE3      ------------------------------------------------------------
A0A7T9J551      ------------------------------------------------------------
A0A7V9NLN0      ------------------------------------------------------------
A0A7T9G8R2      ------------------------------------------------------------
A0A7Y2D047      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7V1SAJ0      ------------------------------------------------------------
A0A7W0N726      ------------------------------------------------------------
A0A7W1HTZ7      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A7V9C9Y7      ------------------------------------------------------------
A0A7W1G8A4      ------------------------------------------------------------
A0A7V9KMZ1      ------------------------------------------------------------
A0A7W0JTE4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A838PA20      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A7V9R410      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A841JU67      ------------------------------------------------------------
A0A7T9GJJ6      ------------------------------------------------------------
A0A7Y4UER8      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
A0A7V2HCZ0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A7V2MG68      ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A7V2HBQ5      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7R8B699      ------------------------------------------------------------
A0A7S7SGU3      ------------------------------------------------------------
A0A7Y8HY45      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A7V0Y3A1      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A7T9GJN6      ------------------------------------------------------------
A0A7T9GJN7      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7W7ZGZ3      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
A0A7Y9TM87      ------------------------------------------------------------
A0A7W8J1H5      ------------------------------------------------------------
A0A7Y9T5K4      ------------------------------------------------------------
A0A852VHP9      ------------------------------------------------------------
A0A7W8IFZ2      ------------------------------------------------------------
A0A7W8J9Y9      ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A7Y5RFT3      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A7V9Q528      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A7V9ZQ50      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A7W1GE99      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A7W0GRF6      ------------------------------------------------------------
A0A7W1H6G6      ------------------------------------------------------------
A0A7V9HZC8      ------------------------------------------------------------
A0A7W0XCB9      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A7W7ZUJ7      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A845TWB8      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7W1SCW7      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A7X7XDY5      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A7X8YVF2      ------------------------------------------------------------
A0A7X7YEP0      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A845TW47      ------------------------------------------------------------
A0A845TXC1      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      PETGKTEILEADLKAIRNGKETDLLLXXXEDGDAPMSTAPPVFDPPSERELDLRYY----
A0A2V7YYV7      --------------------------------------------------MELGRY----
A0A2V7Z0J5      --------------------------------------------------MELNRY----
A0A2V7Z3M4      --------------------------------------------------MELNRY----
A0A399Y5V2      ------------------------------------------MTESHATTLELRDY----
Q01X01          -----------------------------------------------------MEC----
A0A3M2D9H8      --------------------------------------------------MLPRDY----
A0A2V9IXG5      --------------------------------------MQDLNVSESLPQLDIRYI----
A0A2V9J2P4      --------------------------------------MQDLNVSESLPQLDIRYI----
A0A831T3F4      -----------------------------------------------NDSIHLRDL----
A0A2V8JK38      --------------------------------PEIVENLPRNLATQEEDETHLLAY----
A0A7W0JWI4      -----------------------------------------------EDKVHLREY----
A0A1Q7RLS4      --------------------------------------------MEEKREIHLLDY----
A0A257VBK0      --------------------------------MADSDPPQVQAEFSAAQDVDLLHW----
A0A7C5TWV7      --------------------------------AQWPMQEGPWFEEETEREFSLVEY----
A0A2V7XDY0      ----------------------------------MPSPVPAPAGGSSESPIDFRYY----
A0A2G6PYV5      --------------------------------------MQDNQPFDQQADFNIFHY----
A0A1F2TCR2      --------------------------------IEAPPQLPMPPVAQSQQPLHVLDR----
A0A7Y9PHF8      --------------------------------REMIRGSVGGAHAATEPVFAFSHY----
A0A7W8J3G9      ---------------------------------------------MESGGLSIGDI----
A0A1F2V330      -----------------------------------------MPSDGTGKEISVLAL----
A0A662EE63      --------------------------------MPPGGPAMGGWVDDQGHEIDVMEY----
A0A2V8TLH7      -------------------------------------MSENLPIVEEQREVHLLDY----
A0A1Q7ZJT1      -------------------------------------MPDSLNPLEEKREIHLLDY----
A0A2V8VC99      -------------------------------------MPETLAPLEEKRDVHLLDY----
Q01XL7          --------------------------------VGPDVRMLPSPSDGWVPEPTKISY----
A0A523DUV7      --------------------------------QDSHHQEHTNLIAGLSGEFDLKYG----
A0A7W1TTH3      --------------------------------YAAG--APPTLPGGGDGEIHLLDR----
A0A1F2U158      --------------------------------SSGAPRAPQPLTYAVDKDVHILDR----
A0A2V8F6S9      --------------------------------NSNGGVAP-PLTYGTDGDVHILDR----
A0A7V0UHS9      -----------------------------------------MAVKTPDNTISIFSL----
A0A7D8BEX2      --------------------------------PQGLQEAFDVQTDQAADLPSLARI----
A0A4Q1SCH5      --------------------------------LQAQPAAFSSPGVGDSEGISFREI----
A0A7V4SJP8      --------------------------------PGSDTGNPILQESPEPQEFDLLKW----
A0A372IRG7      --------------------------------GQQELHPPGGVPPHESPAFTPADF----
A0A2V8K4L4      --------------------------------STPLQARFMPEPQEEASREGVVAY----
A0A2V8NCZ3      --------------------------------PTPVPARFTAE--DDSSREGVVAY----
A0A4Q7YNP3      --------------------------------GETFPKSWTANDRVEQRTSLFAEY----
E8UZE1          --------------------------------MKNPGIPDEVAARSSFSAVGLPEI----
A0A2V7YW66      --------------------------------SPVPFEEEPEGAAEPASELNFGEY----
A0A2V7Z0V0      --------------------------------TPVPLDDEPEVAPEPESELNLTEY----
A0A2V9M454      --------------------------------RNGSGPHSYIDLEQVDAFGQLRAT----
A0A2V9J4D6      --------------------------------SFA--PLPSCASAGG-------------
A0A2V9L9C5      --------------------------------PIH--PIISITSAGEFERPSVLRA----
A0A2N9M9N1      --------------------------------GYSGYPVTDLDPAGSEAYSFQSYW----
A0A2V9JEC4      --------------------------------AIGEYVVPQLEDAEGGASAFRVYW----
A0A2V9LPQ3      --------------------------------GFG--LLPT--DFDGFSSVLRVYW----
A0A7Y8IYX6      --------------------------------ASEVQSYAAARARDFSGQFDVRRI----
A0A2V9IVR7      --------------------------------YPRPPKITELDAGSDEAYSYVRAY----
A0A2V9ILE2      --------------------------------YPRPPKITELDAGSDEAYSYVRAY----
A0A2V9LGY4      --------------------------------YPRPPKITELDAGSDEAYSYVRAY----
A0A7T9JJ28      --------------------------------GGYGYPMYSRYPAIDVEKNTVREY----
A0A7T9GE94      --------------------------------KRDYGYAYARGMAVETESTHLRDY----
A0A7Y4X7L5      --------------------------------RRDYG--YGRGGAHEPDETHLRDY----
G8P0Y7          --------------------------------DSPRLASLQEMYRPPAREHSISDY----
A0A2W4RYA1      --------------------------------PSRAGAQHAHGLDEDHGDVHLRDY----
A0A2V8EXP2      --------------------------------AYGYG-----SNVVGDDQVHLLDY----
A0A843SYC7      --------------------------------AARYNPRPDHNDPVDDVDTPLLDY----
A0A7V9BJ09      --------------------------------ADRPRPPLASRTESVPEERHVWDY----
A0A7W1DT80      --------------------------------AERSPVASTSRTESVGEEKHIWDY----
A0A5M8T4U7      --------------------------------QLDRVMINPATIAAPSESLSLMDV----
A0A7L5A491      --------------------------------EPLDQLPSPLEVEAPEQVLSIGHY----
A0A7D8BF18      ----------------------------------MESHGLPLTAVDQASENALSDA----
A0A1E3Y9R6      --------------------------------AHLPNA-GGRQASAKGGGWHPTDY----
A0A2W4TLP2      --------------------------------AHLPPAHGGRAARRGGSSWHPTDY----
A0A7G8BDY8      --------------------------------VFNAPIPEGPGIPSGPSEIGLSDL----
A0A7C4BZ42      --------------------------------EVMQPAYYQPAYDDAASGGGLLEY----
A0A3R9WF43      --------------------------------LAEMQTRAHLAPVNASEYESLSGL----
A0A317HKM4      --------------------------------DSDDARGTGSPDTWGTDTLQIRDY----
A0A2V9CG11      -----------------------------------MESPPNREVATAGGYDSFLDY----
A0A523E0N1      --------------------------------TERLPPDYSDYAPEIYPRASLREI----
A0A1V6HR88      ------------------------------------------------------------
A0A4Q1SDL1      ----------------------------------MNNYLLEAPPTHVEPGLTLGDL----
A0A841JWG5      ----------------------------------MNSYLLEAPPS-VEAGLTVNDI----
A0A4R1LAZ7      --------------------------------ELPVN---------ERSILTPGDV----
A0A7G8BMP1      --------------------------------ELPLALAPAAGNTLEHSVLTPGDV----
A0A7X7ZKA6      --------------------------------KNGNEIQLADYEVAEAQEIDLRDY----
A0A523ECP2      --------------------------------PTPTSEPERVDFHPPESETHLRDY----
A0A2W0C122      --------------------------------NTPASQGIHYGWARLVPLNPVQRV----
A0A2W0AUU7      --------------------------------QSSASQNLHRASSRRVPLNPMQVV----
A0A2W0BQL1      --------------------------------QSSASQNLHRASSRRVPLNPMQVV----
A0A2V8ERZ5      --------------------------------AGSSHGQGSAPHYAPEQDVHLLDR----
A0A7W8J413      --------------------------------ALGTLSDGSLFGSVPSEYETLSGV----
A0A7W8JCF5      --------------------------------ALGTLSDDALFASGPSEYETLSGV----
A0A7W8IEB1      --------------------------------ALGTLSDDALFASGPSEYETLSGV----
A0A7Y9T3I1      --------------------------------ALGTLSEDALFGSSPSEYETLSGV----
A0A3P0XH15      --------------------------------QPERQVAAGPQLAPEQAIITPSDI----
A0A3E0P0A3      --------------------------------TVAPRESDEAFAGSGDDLKLIAEY----
A0A3M1WQW8      --------------------------------LYPIGYGHERYGTAVERDVHLLDY----
A0A841JVA9      --------------------------------AYDPADLAPLPPEAEEQRSFLLEY----
A0A3N1JHC1      --------------------------------PSAGTLDPFRSSTVYGTPEEQIDY----
A0A7V4XQR5      --------------------------------PVSVGAAAQEKTVGPTSTISLSDL----
C1F294          --------------------------------SGSAIASADEKTVAPQSTINLSDL----
A0A2V9KA79      -----------------------------------------MQNGTANTSASLTNL----
A0A348UZU3      -----------------------------------MSENYVDPQSLETAEIDLRKY----
A0A7X9FXC4      -----------------------------------MNENNVEIEPAEGGEIDLRKY----
A0A7X7ZKL5      --------------------------------------MKGFASKTDRKEADLLEY----
A0A522PSP1      --------------------------------APDNQKGTWGFPTEPAISLALSRY----
A0A7W8E8D3      --------------------------------TEGKLDQRSLAEADSASALSLGDI----
G8P085          --------------------------------TEGKLDQRSLTEADSASALSLGDI----
A0A843SRW6      --------------------------------AAQNGTVYVGPQLTSGEGFHLLDH----
A0A7W8E330      -----------------------------------MANYALDTPQAVEAGLTVNDL----
A0A4Q1SGQ1      --------------------------------LAGRPLEWTDLLTRPRREWTMLDL----
A0A7V2HGP7      --------------------------------ARQAPPLRQSTPPADTPAMLIRHY----
A0A7R8B6H7      --------------------------------DSVRLLGAAKSPGGSSQPHELIQH----
A0A2V8GTX0      --------------------------------VHQPQARKTAGLFSPDPNIHLFDR----
Q1ILD9          --------------------------------PQNGKGARWQPSESDGQKIDFDGL----
A0A7G8BJH7      --------------------------------APVRIAQVPDLRAIREDEMTLGGA----
A0A2V8J0X9      --------------------------------AEVSPSALIALPSSTSQSTHVLDR----
A0A7Y5WWH8      --------------------------------ADVSTSGAIALPTAAPQPMHILDR----
A0A7C5SHM3      ---------------------------------MQDRPSEMSPEQSAAGDWSLKAV----
A0A7V6D154      --------------------------------SPAVPTVQWTLLDPDDYGLPLAHY----
A0A7V1XXZ2      --------------------------------ALANVRAANEFFYQTHEANPLITY----
Q1IJZ6          --------------------------------GVSEQSTTNAGLEDEDL--SLRQV----
A0A2V8TCE6      ------------------------------------------MTSPREAESEIREF----
A0A522TBE8      --------------------------------ATEEAGPQAERPAGSGT--PWVYY----
Q1ITG0          --------------------------------NVQGASRTSWADVQEDREADLLHV----
A0A7C2ML20      --------------------------------PGLNPPGLLAGLSQEKMSDVWRRY----
A0A7T9HIZ6      --------------------------------RELGAPE-------PEI--HLADY----
A0A7C5AXS9      --------------------------------GAEPEGP------------TLLDY----
A0A7C2RGE3      --------------------------------HVMKFYPASAFEEGGERDIHLLDY----
A0A7V6D075      --------------------------------YLPPGPE------SELVSKPISHY----
A0A3N5PCI5      --------------------------------AVTSRAE-------PQW--QLEDV----
A0A3M1Q0S9      --------------------------------MTESSEQ-------REF--NLRDY----
A0A2Z5G448      --------------------------------GTSVAGK-PAGSDRQDFILTPADF----
A0A3M1VZ38      --------------------------------MIQQDPQ------NQEF--NLRSY----
A0A4Q1SD29      --------------------------------KVASSPAVGSVQEHTVF--TPADL----
A0A833M5K2      --------------------------------PFAPDPG-------GEFDLHLRDY----
A0A1F2Q9L4      --------------------------------GFEVEPE-------SEF--HISQW----
A0A7V5ZKV2      --------------------------------PLPLEPE-------QEF--HLSQW----
A0A7Y8LRQ1      --------------------------------SFQPEAE-------EEF--HISQW----
A0A3M1PY35      --------------------------------RREPPTG-------GEW--DLDAL----
A0A3M1VMP2      --------------------------------GVGP--G-------GDW--DLAAV----
A0A1F2T595      --------------------------------YGGYSGYGYGTSVTSDSELTLVHY----
A0A2V9AC41      --------------------------------LNE-------FAVVDDQVHPLREY----
A0A2V2R525      --------------------------------QDQ-------------SQASLAFY----
A0A321LPW6      --------------------------------PEE------------YGRIHLLEV----
A0A2V9R9V4      ---------------------------------EA------------ED-FHLRML----
A0A321LE75      ---------------------------------EA------------DDRINIRAI----
G2LEI9          --------------------------------AGQ----------------PIRQA----
A0A7V9TW03      --------------------------------PEG-------EI-------HLRDY----
A0A3N5XQP8      --------------------------------SSR-------DR------STVRFY----
A0A2V9KCS3      --------------------------------VDQ-------EYGADAVSGGLLYY----
A0A7W1JC10      --------------------------------DVD-------EL-------PLRDY----
A0A3M2BZG9      --------------------------------DAG-------EL-------DVAKY----
A0A1Q7N5R7      ---------------------------------DE-------GP-------DWHRY----
A0A352F549      --------------------------------PEG-------EM-------HLRDY----
A0A3B9MLP9      --------------------------------PEG-------EM-------HLRDY----
A0A3D5SQ87      --------------------------------PEG-------EM-------HLRDY----
A0A7Y2DUG3      --------------------------------SAD-------SR-------SIREY----
A0A7Y2D8Q4      --------------------------------FAD-------RR-------SIREY----
A0A2V8NW86      --------------------------------LHG-------RR-------DEFEHGGFV
A0A3M2D491      --------------------------------VEQ-------RF-------DPREY----
A0A7W1CBZ8      --------------------------------FDA-------KR-------SLREY----
A0A7W1FC90      --------------------------------FDA-------NR-------SLREY----
A0A7W1ZXG0      --------------------------------FDA-------NR-------SLREY----
A0A7W1ZIT3      --------------------------------FDA-------NR-------SLREY----
A0A353C9L6      --------------------------------IEG-------KR-------TVQQY----
A0A2V8RQV0      --------------------------------IEG-------RR-------TVQQY----
A0A2V8SJH5      --------------------------------SEG-------RR-------SIQQY----
A0A136JPP4      --------------------------------QSG-------KR-------TLRQY----
A0A399WUJ8      --------------------------------QSG-------QR-------TLRQY----
A0A7V9C3X9      --------------------------------AEG-------QR-------SIKQY----
A0A7V9ZSX9      --------------------------------FDD-------KR-------SVRQY----
A0A3M1SIV3      --------------------------------LEK-------KF-------NPRDY----
A0A7V1SCI4      --------------------------------LEK-------KF-------NPRDY----
A0A7C5ZUA8      --------------------------------GES-------KV-------SIRQY----
A0A7T9FQE4      ---------------------------------ES-------KR-------SIRQY----
A0A3E0PHB0      --------------------------------LGD-------SR-------SIREY----
A0A7T9G4W3      --------------------------------LGD-------SR-------SIREY----
A0A838UAA0      --------------------------------FAG-------KR-------SIKQY----
A0A7W1HTU2      --------------------------------FDE-------RR-------SIREY----
A0A357F267      --------------------------------ADG-------RR-------SLQQY----
A0A7V9ICU8      --------------------------------SEG-------SR-------SIRHY----
A0A7T9JEF9      --------------------------------YYG-------GATRPSERQQLLAA----
A0A399WNU1      --------------------------------QEP------------TEKQQLFNL----
A0A3E0PCN7      --------------------------------PAP------------SERQQLMAA----
A0A7Y4TLV3      --------------------------------PEP------------AEKQQLFAV----
A0A7W0MGQ3      ------------------------------------------------------------
A0A1Q7Y6W9      --------------------------------EDE---------------VHLLDY----
A0A2V8NC68      --------------------------------EDS-------FQTSGGGYARLREY----
A0A352FLX4      --------------------------------YER-----------EERGSRLLDY----
A0A2V8MHG6      --------------------------------DES------------NGYSRLRDY----
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      --------------------------------DES------------NGYHRLRDY----
A0A1Q7NJH5      --------------------------------DDS------------NGYSRLRDY----
A0A2V8PJY0      --------------------------------DDS------------NGYSRLRDY----
A0A7W1BYD3      --------------------------------EPE-----------DVNGVPLREY----
A0A838PIP9      --------------------------------EPE-----------DVNELPLREY----
A0A399WK13      --------------------------------ATP-----------QGEGFQLIDY----
A0A7V8YZQ7      --------------------------------DVN-----------AQDGFQLLEY----
A0A7V9ICV8      --------------------------------DGY-----------AAEGFQVLDY----
A0A136KC10      --------------------------------QTG-----------QAEGFQLIDY----
A0A7W1IVA5      --------------------------------ETG-----------TQDGFQLINY----
A0A7W1ZIE3      --------------------------------ETG-----------TQDGFQLINY----
A0A7T9J551      --------------------------------GES-----------AAADFRLLDY----
A0A7V9NLN0      --------------------------------DNA-----------VQDNFQLITY----
A0A7T9G8R2      --------------------------------NED-----------LREHSPLFQY----
A0A7Y2D047      --------------------------------GEN-----------ARVESPLFEY----
A0A3M2D6Y5      --------------------------------TRD-----------SAGSLKLREY----
A0A2V8SEX6      --------------------------------E-N-----------VAEGFQLLDY----
A0A7C5ZUU4      --------------------------------EFY-----------EPDGFQFLEY----
A0A3E0PCJ6      --------------------------------NED-----------LREHSPLFEY----
A0A2V8RTL7      --------------------------------DVY-----------GPEGFQIVDY----
A0A3M1S4R8      --------------------------------EGS-----------A----KIFEY----
A0A7V1SAJ0      --------------------------------EGS-----------A----KIFEY----
A0A7W0N726      --------------------------------DNQ-----------VQDNFQLITY----
A0A7W1HTZ7      --------------------------------EDY-----------AQEGFQFVAY----
A0A1Q7YFI6      --------------------------------PQE-----------ESGFSRLQAY----
A0A7V9C9Y7      --------------------------------ENR-----------TQDETHLRDY----
A0A7W1G8A4      --------------------------------EDG------------GDENQLREY----
A0A7V9KMZ1      --------------------------------PNA------------ETEVHLLDY----
A0A7W0JTE4      ------------------------------------------------------------
A0A0B6WWQ6      --------------------------------REE-----------RTQQI-VAGY----
A0A3B9MK99      ------------------------------------------------------------
A0A838PA20      --------------------------------PNA------------ETEVHLLDY----
A0A352EX26      --------------------------------PNA------------ESEVHLLDY----
A0A7V9R410      --------------------------------PNA------------ESEVHLLDY----
A0A2V8MM59      --------------------------------TNG-----------FDGEVNLLDY----
A0A2V8PFE8      --------------------------------PES-----------SEGEVHLLDY----
A0A2V8PWS6      --------------------------------PEG-----------SEGEVHLLDY----
A0A2V8LCT5      --------------------------------MDA-----------GENEVHLLDY----
A0A352FTJ9      --------------------------------ADA-----------GDGEVHLLDY----
A0A1F2S1W5      --------------------------------GYGYSGSMPSGDSELS----FIHY----
A0A2N9LQU7      --------------------------------RGRISGPVPLPPALRNPDVSLGEI----
A0A2P6WFK7      --------------------------------MRESGLKRFGNDSVTERELSVTEI----
A0A2V8JQV5      --------------------------------QSPAYSGPMTSPA--G----VFDY----
A0A2V8U914      ------------------------------------------------------------
A0A2V8DRT9      --------------------------------P--------AAAEHALEEVHLSDY----
A0A2V7VYF3      --------------------------------D---------ADNAAPEEAHLLEH----
A0A1F2SVH2      --------------------------------AQTSPVYGYGSNVLGDTEVHLLDY----
A0A2V8AJG9      --------------------------------G---PAYGYGSNVIGDGEVHLLDY----
A0A2V9MAM9      --------------------------------PEALAAGTSAEIE--TGSLSIIEY----
A0A2V8F956      ------------------------------------------------------------
A0A2V7W309      --------------------------------------MDLNTQQEVH----LSQY----
A0A348V070      --------------------------------ITPTTPTTGARQTQQNLLEQILYY----
A0A2Z5G3A3      --------------------------------PSPQSIYTPIPETPLT----ISDM----
A0A2V7UGP8      ------------------------------------------MDVLSQKEINLVDY----
A0A239MKT6      --------------------------------IASDLNDAEQGSSDLT----LESV----
A0A2Z5G7H4      --------------------------------RP---------IT-------LGDL----
A0A372IT17      --------------------------------RDAM--AVYDEWT-------VADL----
A0A841JU67      --------------------------------LADLLQTGRQEWT-------FTDL----
A0A7T9GJJ6      --------------------------------YSYNNYYAPGGGEGFN----YRDI----
A0A7Y4UER8      --------------------------------YGYGRYDESEG--GLH----VRDI----
A0A2V8IYW3      -------------------------------------MIPGHKYT-------PQDV----
A0A7V2HCZ0      --------------------------------RVMYLEPYDPPAAPAVSTSGLYEF----
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      --------------------------------VYKYVESPSTEVGASPGYDSLLDY----
A0A2V8XIF4      --------------------------------LYAYLDSPAAEGAATPGYDNLLEY----
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A2W0BGU4      --------------------------------PITIAPRYYPDPNASPEAGSLALY----
A0A2W0BVQ9      --------------------------------PITISPRYYPAPNSGPEAGSLALY----
A0A317J121      --------------------------------PGELTIEPASSSP-------GIDY----
A0A2V9MN96      ------------------------------------PYRIGGQHP-------LLSY----
A0A2V7V2Z1      --------------------------------SASSGYEGEPQEA--H----LWEY----
A0A2V7X2F7      --------------------------------PPPSEPAG---ED--H----LWDY----
A0A2V7V2I1      --------------------------------TAPAGQAGVPEET--H----LWEY----
A0A2V7U3M2      --------------------------------TPPTSSESEAQET--H----LWEY----
A0A2V7UHT0      --------------------------------IPPAGSEGEPQEA--H----LWEY----
A0A3P0X3W6      --------------------------------------AAAEPDELLP----MQHY----
A0A7V2MG68      --------------------------------PLPAGVDIEIDPPSIP----LSHY----
A0A7C6A629      --------------------------------AGWYGPEMEFEEPGTP----LSHY----
A0A7V2HBQ5      --------------------------------PPPSGPESDPEAVSVP----LSHY----
A0A2U3JZ71      --------------------------------MP----EVEAAPSSVP----LSHY----
A0A2V8TTB0      --------------------------------VPVIDAEFEPQAPQVP----LAHY----
A0A2N9MK30      --------------------------------------DLEPEEQTLP----LSHY----
A0A3D1ASD2      --------------------------------------EPEARETTVP----LTHY----
A0A7R8B699      --------------------------------GNGPTGDPEIAEQTVP----LSHY----
A0A7S7SGU3      --------------------------------------ESDADQVSLP----LSHY----
A0A7Y8HY45      --------------------------------------DSEPDDVKLP----ASHY----
A0A7C5AXI3      --------------------------------------EPVQEEPALP----LSHY----
A0A7C6E4H7      --------------------------------------EMEFEEPGTP----LSHY----
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V8GFD4      --------------------------------KDGVERLPPGSGEMVDGTLSGFDY----
A0A2V8HSS5      --------------------------------KDGVERLPPGSGEVVDGTLSGFDY----
A0A2V8KP55      ----------------------------------------EEDET--H----LLAY----
A0A2V9JSI3      --------------------------------VVTVEAEEFDSPL--D----LRHY----
A0A2V9WI32      --------------------------------ARSYAPLPEEGFL-------LREY----
A0A2V9KBD6      --------------------------------PRVQRVVGAPDEA--L----ASTL----
A0A2W0AJ66      --------------------------------RYTQKVVEALEET--F----LGNL----
A0A1Q7RBU1      --------------------------------RYPQRLIDAPEQM--S----TAGL----
A0A2V9JPV9      --------------------------------RYPQRVIDAPEQV--S----AAGL----
A0A7V0Y3A1      --------------------------------AAPLPYIFTEPAAEPDDFQTLLRY----
A0A7C5Z4J3      --------------------------------EMYHRTVLDLQRDWTDSFVYLRSY----
A0A1F2TPT3      --------------------------------DALWQGLEGEDRH-------FQYY----
A0A2V8JTQ2      --------------------------------LPRVG---APDEV--F----AAGM----
A0A2V8UZY0      --------------------------------VARASDERASDEM--F----AAGL----
A0A350UEK1      --------------------------------YGSPAPEEDPDSG--G----LLDY----
A0A350UIQ4      --------------------------------YGGPQFDSDEEEG--G----LLEY----
A0A7T9GJN6      --------------------------------LDDLLPHDPHGTQ--NSGPDYSEL----
A0A7T9GJN7      --------------------------------IQSYDSYDYGGDP--NGGIHLREV----
A0A1H5Z7N3      --------------------------------QAMQD--RASGDT--T----LSDA----
A0A1G7JVV8      --------------------------------NAGFS--AITAES--A----LSEA----
A0A1H4T6W9      --------------------------------PAGFT--STAADS--A----LSEA----
I3ZEU5          --------------------------------PTGFT--TTSADS--A----LSEA----
A0A7W7ZGZ3      --------------------------------PAGSG---ATTES--S----LSES----
A0A7G8BSK5      --------------------------------PPAFS--TAVTDT--T----LSEA----
A0A428MDU2      --------------------------------PTGFS--TTVTDT--T----LSEA----
E8WVF6          --------------------------------QPTFV--APSNDT--T----LSEA----
A0A1I6MH75      --------------------------------GGGFAAATAATET--T----LSDA----
A0A7Y9TM87      --------------------------------ASEFS--VTSSDT--S----LSEV----
A0A7W8J1H5      --------------------------------QAGFS--TTVTDT--T----LSEA----
A0A7Y9T5K4      --------------------------------QAGFS--TTVTDT--T----LSEA----
A0A852VHP9      --------------------------------QAGFS--TTVTDT--T----LSEA----
A0A7W8IFZ2      --------------------------------QAGFS--TTVTDT--T----LSEA----
A0A7W8J9Y9      --------------------------------QAGFS--TTVTDT--T----LSEA----
A0A7L5A6M5      --------------------------------FSFSA--PESTDT--T----LSEA----
A0A5B9EBI2      --------------------------------YRAAA--SAPTDA--S----LSEA----
A0A7Y5RFT3      --------------------------------YRAAA--SAPTDA--S----LSEA----
A0A239HDF6      --------------------------------MPGSI--PQAADA--S----LADA----
A0A4Q0T270      --------------------------------LGGLS--TSGSET--T----LAEA----
A0A1Q3QQB6      --------------------------------SPRFG--SAVTDT--A----LSDA----
A0A3N1K1G7      --------------------------------PSAFS--STATDT--T----LSEA----
A0A4V2G466      --------------------------------PPAFS--TATTDT--T----LSET----
A0A6B9YNQ8      --------------------------------PLAFG--TAATDT--T----LSET----
A0A3N6A5T6      -----------------------------------------------H----LRDY----
A0A2V8R8U7      --------------------------------GRYDRYNSAPAET--N----VREY----
A0A7V9Q528      ---------------------------------VAVAA-PPSEAA--H----LREY----
A0A2V8QMP4      ---------------------------------VAV---SSNEPV--N----LRDY----
A0A2V8R4S3      ---------------------------------VAV---SSNEPV--N----LRDY----
A0A2V8NJ55      ---------------------------------KYYGV-SATSET--H----LRDY----
A0A7V9ZQ50      ---------------------------------KYYGA-ASDNPT--H----LRDY----
A0A2V8Q7I0      ---------------------------------RSYGP-AANEPT--Q----LRDY----
A0A2V8S6K4      ---------------------------------QVTGSYSLPEPT--H----LRDY----
A0A317I2L9      ---------------------------------RSYGP-AANEPT--Q----LRDY----
A0A2V8LLF9      ---------------------------------GKYA-RYGTTQSETN----VKEY----
A0A352FRF4      -----------------------------------GGRYGGGSPAEVN----LKEY----
A0A7W1GE99      ---------------------------------PATA-APAHQSAEIH----LRDY----
A0A1Q7YKQ8      -----------------------------------YGYGAAAEST--H----LRDY----
A0A0B6WXT1      --------------------------------------ATFIEQA--H----LREY----
A0A2V8MKV0      ---------------------------------ERYG-AAGVE-T--S----LRDY----
A0A2V8PYY8      ---------------------------------DRYG-ATAVE-T--S----LRDY----
A0A3B9MEU8      -----------------------------------YG-VSGADTT--T----FRDY----
A0A352F3R7      -----------------------------------YG-TSGSEPT--T----LRDY----
A0A7W0GRF6      -----------------------------------YG-VSAVEPT--S----MRDY----
A0A7W1H6G6      -----------------------------------YG-VSAVEPT--S----MRDY----
A0A7V9HZC8      -----------------------------------YG-VSALEPT--T----FRDY----
A0A7W0XCB9      -----------------------------------YG-VSALDPT--T----FRDY----
A0A3N5YNR8      --------------------------------NTEYQWASDDDSL--D----IRRY----
A0A7W7ZUJ7      -------------------------------------YTPPAREH--S----ISDY----
A0A2V2R0I6      --------------------------------LPA--WELSPREP--H----LYDY----
A0A2V8XAR9      --------------------------------LPS--WELSPREP--H----LYDY----
A0A2V8VZA0      --------------------------------VPS--FELSPREP--H----LYDY----
A0A1Q7CB82      --------------------------------VPS--FELSPREP--H----LYDY----
A0A2V8WIU1      --------------------------------VPS--FELSPREP--H----LYDY----
A0A1Q6Y9F5      --------------------------------VPS--FELSPREP--H----LYDY----
A0A2V9EVV8      --------------------------------VPS--FELSPREP--H----LYDY----
A0A2V8YF91      --------------------------------FVS--FDLSPREP--H----LYDY----
A0A2V8XZK2      --------------------------------FAS--FELSPREP--H----LYDY----
A0A2V8ZTX6      --------------------------------FAS--FDLSPREP--H----LYDY----
A0A2V9BT79      --------------------------------FAS--FDLSPREP--H----LYDY----
A0A2V9YHT3      --------------------------------LPAGYFPATLPQP--A----LLDY----
A0A7C2XNI7      --------------------------------HPG--WDAERRQI--H----LLDY----
A0A1Q8B793      --------------------------------MPV--FDLSPHEP--H----LYDY----
A0A2V9BCA0      --------------------------------MPV--FDLSPHEP--H----LYDY----
A0A2V9BWU9      --------------------------------FSS--WETPPREP--H----LLDY----
A0A2V9DKX2      --------------------------------LSS--WETPPREP--H----LLDY----
A0A7C2YQY3      --------------------------------SWRSVPAGSFDPV--STGLPLREY----
A0A845TWB8      --------------------------------RAHPAPALA-DQM--ALALPIRDY----
A0A2U3KC61      --------------------------------SVYPHFAQPQNS--------ILHY----
A0A2V9Y2R7      --------------------------------CQIPYSYNSYSAS--GHAINLLHY----
A0A2V9NGH6      --------------------------------GFGIYNPATFQDS--V----VHEY----
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ---------------------------------AAIHPAMAAQDS--I----LREY----
A0A2V9QD92      ---------------------------------AAIHPAMAAQDS--I----LREY----
A0A2V9WPZ6      --------------------------------LTGIYPNAPAQDS--V----LREY----
A0A2V9ZLH4      --------------------------------GPGVYPPLPTNDS--V----LREY----
A0A2V9RQF1      --------------------------------QHYAYPVLPSQDS--V----LREY----
A0A2V9YDK8      --------------------------------LTGIYPTLHPQDS--A----LREY----
A0A2V9V8F7      --------------------------------LTGIYPNAPAQDS--V----LREY----
A0A2V9XGR9      --------------------------------LTGIYPNAPAQDS--V----LREY----
A0A2V9V3Q5      --------------------------------GPGLYTVLPSQES--A----LREY----
A0A2V9NWS3      --------------------------------LAAYYPNAPIQDS--V----VREY----
A0A2V9USA9      --------------------------------VPQVYPVLPSQES--A----AGEY----
A0A2V9XW18      --------------------------------DPRFYPPLASHES--G----AREY----
A0A1H5SQF5      -------------------------------------RSAFRREM--H----LSDA----
A0A2V8G155      -------------------------------------AALPPASP--H----VVNS----
A0A2V8HDM7      -------------------------------------AALPPASP--H----VVNS----
A0A2V8IVN9      --------------------------------G----GSGEGGEP--H----LLDY----
A0A7W1SCW7      ------------------------------------------DAG--H----LVDY----
A0A3E0NV31      -------------------------------------DNDPSEGI--K----VRQL----
A0A3N5M5V0      -------------------------------------WGPDEDSL--D----VRRY----
A0A7X7XDY5      -------------------------------------PPAPENEI--H----LLDY----
A0A2V9L5B5      -------------------------------------DVSPEEVP--H----LLDY----
A0A2V9LK56      -------------------------------------DIGPEKVP--S----LFDY----
A0A2V9L7I0      -------------------------------------DVSPEEVP--D----LIDY----
A0A522PPT0      -------------------------------------DVLPEESP--R----LLDY----
A0A7C5V1G5      -------------------------------------DVSPEEAP--R----LLDY----
A0A4R1LC91      -------------------------------------QNSLDGEL--T----IKGL----
A0A2V9QB26      -------------------------------------HRDELEPG--G----FVED----
A0A2V9VYY4      -------------------------------------TYFGEPHN--A----LLHY----
A0A2V9KIE8      -------------------------------------EVGHEEAP--H----LMDY----
A0A7C2GJ20      -------------------------------------EESGERDV--H----LLDY----
A0A7C4BTL5      -------------------------------------FEEGDERG--G----VLEY----
A0A7X8YVF2      --------------------------------YPPEYMMAAEEGK--H----LREY----
A0A7X7YEP0      -------------------------------------VQEPESEF--H----ISQW----
A0A2V9CBM2      -------------------------------------IIGPEEGI--D----LRAC----
A0A2V8XN17      -------------------------------------ILESGEAL--D----LRSY----
A0A2V8WX45      -------------------------------------ILESDEGL--D----LRAY----
A0A1Q6YR79      -------------------------------------ILEPGEAL--D----LRSY----
A0A1Q7VA32      -------------------------------------ILEPGEAL--D----LRSY----
A0A2V9EY85      -------------------------------------ILEPGEAL--D----LRSY----
A0A2V9H8K0      -------------------------------------ILESAEAL--D----LRSY----
A0A2V9FFE5      -------------------------------------ILESGEAL--D----LRSY----
A0A2V9GM43      -------------------------------------ILESGEAL--D----LRSY----
A0A2V8ZHL8      -------------------------------------VQDFESFS--Y----LQAY----
A0A2V9B240      -------------------------------------VQEFESFS--Y----LQTY----
A0A2V9CYQ5      -------------------------------------ILGPEEGI--D----LRAC----
A0A2V9BWU8      -------------------------------------IIEAEEPV--D----LRAY----
A0A2V8ZG48      -------------------------------------ILEPDEPL--D----LRAY----
A0A2V8Y334      -------------------------------------IVEPEEPL--D----FRAY----
A0A2V9AY68      -------------------------------------ILEPDEPL--D----LRAY----
A0A1F2RFI7      -------------------------------------QEEEAATP--S----FLDY----
A0A1F2RZS3      -------------------------------------VLEEQDSF--P----LLEY----
A0A845TW47      -------------------------------------TIEMERAP--E----LVAY----
A0A845TXC1      -------------------------------------LSDTEESP--D----LLAY----
A0A1F2USE2      -------------------------------------TVETEEAP--D----LLAY----
A0A7C2VB08      -------------------------------------DSQRETPV--D----LLAY----
A0A2V9C238      -------------------------------------PLEMKESA--D----LLAY----
A0A1F2Q9F5      -------------------------------------TLEMEPAA--D----LLSY----
A0A1F2QQH9      -------------------------------------TLEMEPAA--D----LLSY----
A0A1F2QXK7      -------------------------------------TLEMEPAA--D----LLSY----
A0A2V9DEM9      -------------------------------------PVEMKESA--D----LLAY----
                                                                            

A0A2V7VMF7      --AGLVWRSRVFIVALGLVGLGLGFVVALLQTPQYRAGAM--IQIEPPAPTFMTVTDALA
A0A2V7YYV7      --LRVARHRLWMIIACPILAALSAGIVSFALPPVYEAHAA--LLVLPSN-LGTSDPNVIP
A0A2V7Z0J5      --LRVVRHRLWMIVACPLLAAVTAGVVSFALPPVYEAKVD--LAVKPAQLLPSTDPNAPS
A0A2V7Z3M4      --LRVVRHRLWMIVACPLLAAVTAGIVSFAVPPVYEAKVD--LAVRPAQLLPSTDPNAPS
A0A399Y5V2      --LGILRRRKWFIILPTVVILVAAITASLLTTPIYEASAD--VLIQSNKRSSV----IAD
Q01X01          --ARTLYRRKATVLWITFFAVIAAALISVAQPRMYESQAS--IQVQGVNENFLNLRDIFP
A0A3M2D9H8      --LFLAKRWAWLLGVGVLIGLIGGLIYSLVQEPVYQATTK--VMVLGAPQSNLSDILNQN
A0A2V9IXG5      --LHVLWTGKWVILACMLVALALAAVNNNFQKVSYRAQAQ--IQIDAPPFLPSPGADFNA
A0A2V9J2P4      --LHVLWTGKWVILACMLVAMALAAVNNNFQKVSYRAQAQ--IQIDAPPFLPSPGADFNA
A0A831T3F4      --WHTVRKRKWLVIVIAIVVTTIATIEVYRTKSIYQASAT--IEIGKDHATL---VKSGD
A0A2V8JK38      --WRVIVTRRWTVVAVFATIVLLTLIWTLKQKPMYAATIT--IQIERETPSL---VNLRD
A0A7W0JWI4      --WRSARKHLWLIIGITVLLTAIAAVYMARKPDVYEAEAL--VQVDLEDINAAIGISNSS
A0A1Q7RLS4      --WRTIWRGRWTILSIFVVVFTLVAIGTFTQKPVYRASVT--VEITPQSRKVSPVAEVAE
A0A257VBK0      --VQILWDQRFWIAGVTAAVVILVALYTFLATPIYSATAT--VYVQTYSRQPMSGFNP--
A0A7C5TWV7      --TDLLWRQRWLIAAVVLICILAGGAWAFTTTKMYRARTR--IAFEQAPQIIKSQIYG--
A0A2V7XDY0      --GNLLWKNRILLATAAVLGLALGLVIAFAQTPEYRASVM--VQIDPPTPTFMSVQEA--
A0A2G6PYV5      --IGLLRKHFFLTLSLLILGLGLAYLAWLVKPPLYKSSVL--IKMNHLSMDVIGFTEK--
A0A1F2TCR2      --LSAVFKHRRVAGAAFVIVVMAMMVQTYSTIPLYLATAR--VMIEDERSIAVANLNA--
A0A7Y9PHF8      --LWLMRRHRWTIVAVVVVCTSLAVALSYKLQPMYEATAK--IAIDVRATSNVIGEAS--
A0A7W8J3G9      --FRTIANRWPFIVSCVIVCTGLSYLYARSLTRIYEAVGT--IRIDPNRSGSIGLASI--
A0A1F2V330      --LDIVMRRKLFVLIPAAVLIVAVGIYTVYQPPLYRAQAL--LGVEPGARNYVQTMDG--
A0A662EE63      --ARLLWSRRWLVLAVLLSTVVLTTAWSVTRPKLYRAATK--LIVEPTSSINNNQFDA--
A0A2V8TLH7      --WRTISRGRWTILSVFVVIVTLVAIGTFTQKPVYRARAT--VEITSQASKVAPVADV--
A0A1Q7ZJT1      --WRTIWRGRWTILSIFVVVFTLVAIGTFTQKPVYRASVT--VEITPQSRKVSPVAEV--
A0A2V8VC99      --WRIIWRGRWTILTIFVVVVTLVAIGTLTQKPVYRAQAT--IEISPQSRKVSPVADV--
Q01XL7          --WKIAWGHKFILLLCIFAGALGGTAYVILKTPEYAAAST--VELIGFNQSFMNMSQV--
A0A523DUV7      --LRLLWVGKSWILVIALLGLGVGFLATFLQVPIYSARAL--VQIDPPGQNISQLSNP--
A0A7W1TTH3      --LSVLYRYRRLAISLVLLVFIGGIVQTFSTIPRFRATSV--VEIAEERPLASSLRDV--
A0A1F2U158      --LAVVYRYKRIALSVFLLTALALMIQGYSGEQVFQAKAQ--VLIEDERSTAMPGIAA--
A0A2V8F6S9      --LAVLYRYRRIAITVFVLTTAALMIQGYSTTPMFEARAQ--IEIDAERATALPGITT--
A0A7V0UHS9      --LETLKRRKLFVIIPTILVGAGFFLYAWFQPNRYRAQTL--LAAEHLTPPGYLKEVA--
A0A7D8BEX2      --WVGLLRRRRIVLAAFLVGLLIGTALLFK-PRNYLSVGL--LRIEPSRSSMFQLSAS--
A0A4Q1SCH5      --FRAILKGKWFILASTVLCGAIALIYITVTKPVYEADGI--VRIDPNRSGTLGLTDA--
A0A7V4SJP8      --VQLFWEHRWWIAGITAAAVLAAGLYSFLARPIYSATAT--IYVQSYSRTPLNTYNP--
A0A372IRG7      --RKIIIKRKWVILFCVLVGVGIAFYHIFTTIPQYEAISR--MSIDFSRSTNIGIEDI--
A0A2V8K4L4      --WRMVMRHKWIVVLVAFLGTVAGILFTLPQTPIYQSSTS--LEVQGLNENFLNLENL--
A0A2V8NCZ3      --WRMVMRHKWIVILVAFLGATAGILITLPQTPIYQSTTL--VEVQGLNENFLNMQNL--
A0A4Q7YNP3      --LRILSRHRWMIFASAIAGILLSFLLSFASLPYYRARTS--LDIQSLNSDFMNMRAV--
E8UZE1          --YRLLKRRKWLVLLIFLVFVAASALYTLRLPKRYEALCK--IDIDLSTPKSVLALDS--
A0A2V7YW66      --LGIARRHWKLAAVCCLLGLAGAAVHYAITPKAFQATAT--IQIERRNLTPLGNGGQ--
A0A2V7Z0V0      --LGMLRRHWRLAAVCCALGLAGAGIHYAITPKAYQASTI--IQIERRNLTPLGN-TQ--
A0A2V9M454      --WDILLKHQWLILVTAFVLTLLVTVYSYKMKPVYRATAR--VDVEAEEPLLQSLNDL--
A0A2V9J4D6      ---KSFRWRW--------LSWISVTIYTFKAERVYQATAR--LDIEAETPMNLSAESL--
A0A2V9L9C5      --IAVLRKRWWEVLSVAMVVLISVTIYTFKAERVYQATAR--LDIEAETPMNLSAESL--
A0A2N9M9N1      --EIL-RKRRSTVFAAAFLVTLLVTVVVYRMKPIYRATAR--MEVQAETPALQTLNEL--
A0A2V9JEC4      --HVL-KRRWPTVITVASAVTLLATLISLKMQPVYKATAR--LEVKGEMPQLQTINEI--
A0A2V9LPQ3      --EIVYRRRWQIVAITVAAVTIMA-IYSFKVNPIYRATAH--VEIEAEAPLTMSVSDR--
A0A7Y8IYX6      --FMALASRKLLILIATLVVMIPGTIYTFLVTPTYVSTAV--VQIEPEAVKVLPYNSV--
A0A2V9IVR7      --WRMLVRHGWTILTVAFVVTMLVALISFRLQPVYQATAR--VEIEAATPEIRTLSDL--
A0A2V9ILE2      --WRMLVRHGWTILTVAFVVTMLVALISFRLQPVYQATAR--VEIEAATPEIRTLSDL--
A0A2V9LGY4      --WRMLVRHGWTILTVAFVVTMLVALISFRLQPVYQATAR--VEIEAATPEIRTLSDL--
A0A7T9JJ28      --FRIIRKHKWIILATLLAITTIVTIGTLLTRPVYRAQTK--IEIGKETERVLAGQRI--
A0A7T9GE94      --WRIIRRRLWVPISVVILTVTLTTIYNLRLPSIYEGRTS--VEVLREDQTVNIKDVQ--
A0A7Y4X7L5      --WRIIRRRLWVPMTVMILAVTLTTIYNLRLPSIYEGVTR--IEIAGKDRVVNLKDIQ--
G8P0Y7          --WHILLKRKWIVIVSVAIVLITTALISLHTTPIYEAVTK--ITISPPTSNPLNFKDN--
A0A2W4RYA1      --VRILYKRRWLMASAFLTVMVAVALYTFTATPLYEARTR--LLIDSD-PNIVSFEGV--
A0A2V8EXP2      --VKVLHKRRVAALTAFLLVFVSTAVYTFTAKPIYESKVQ--ILIEKENANVVTFKEV--
A0A843SYC7      --VRVLYKRRWTAFAVFMLIVGTVTVYTFTATPIFEARTR--LLIEADNQNIVSFKAV--
A0A7V9BJ09      --VRVVYKRRWIAMPALLLVFSAMTFNSIRETPVYRSQVQ--LLIEKDAPTVARLDQM--
A0A7W1DT80      --VRVVYKRRWIAIPALLLVFGTMTFNSMRETPIYRSQAQ--LLIEKDAPTVARLDQM--
A0A5M8T4U7      --WRVVMKQRFVILAVTIISFAAATVYSFRTKSVYESGGR--LQINPNVPKVGLQGYG--
A0A7L5A491      --AWLLRRHAWKIAIAVTVCTTLAGVAAYTMTPVFESTAR--VAIDMKTPASVLGEPT--
A0A7D8BF18      --WITIRKRLWVILLLSVLGAGWGYYKAVTQPRIYEASGT--IEIRSGSTNEFRLSSG--
A0A1E3Y9R6      --LRVLYKRRWVAIPGFLLVFVSGAIGSIRTVPVYEARTQ--IIIEKDARRNTSINTV--
A0A2W4TLP2      --LRVLYKRRWVAIPGFLLVFLSGAIGSIRTVPVYEARTQ--LIIEKDARRATSINTV--
A0A7G8BDY8      --VRILRRRIRIIIAAVVIVFVLGSLYCVVKTRRYEATSD--LAIYPEGSDALDMGDI--
A0A7C4BZ42      --WRLAIRNRWTLATAGVLGALLGFLYTVPQTPIYQASTT--VEVQGLNENFLNMGNY--
A0A3R9WF43      --LRVLRRRWRSAVLVAVVIALLGTVAVLLMTPRYSATAT--IEVNREDHEEASGPRT--
A0A317HKM4      --ARIVYRRRWIIFLIVVAGLIGGALYNWTAPRIFEAGAT--LQIEGDTNILALDRPL--
A0A2V9CG11      --WRILIRHKKMLLLVTLAGLIAAILIGLVQTPVYRARTS--LEIQDFNENFLDLKSV--
A0A523E0N1      --YFVLLKHRWPFVAVILATWMFAFISKYTETPYYRATAL--IQIDWGKINVVQDVMI--
A0A1V6HR88      --MKVFTARWRLIALTTLLAIAGGVLAYLVTPKEYRATTT--ILIERRLSIPVQSAVE--
A0A4Q1SDL1      --SKIIRRRRRTVYSIFGAILLLAILYCIFATRRYMATGI--VQLQKDTDSGLSMSDLQN
A0A841JWG5      --WKVVRRRSRVGFAILGTVVLLAAIYCAVTTRRYQASGI--VQLQKESAAGLNMADIDG
A0A4R1LAZ7      --RKIFIRRKWLLLAFALIGLGAGVLFLLMSVPLYEATAR--IDIDPGRSTNIGINDL--
A0A7G8BMP1      --RKIIIKRKWVILVCLLFGLLVAGYFAFLSTPLYEAVAE--VDIDLGRSTNIGISDL--
A0A7X7ZKA6      --WERLMRRRGTVIAVALGVFVLGAFWTFIQKPVYTAKAQ--LLIEKEPNILSFEQVLQI
A0A523ECP2      --WYIILKRRWVILAVFISVLSYTAVKALMRQPVYSATTI--LQIDRGRINLVQDVMV--
A0A2W0C122      --VRLLHKHVWIILGCTSLSVSVSVLYAMRQPRLYRATTN--IAIDRDSNATVPLNKA--
A0A2W0AUU7      --FRLLHKHLWTIAACTSLALSISLLYAVHQPRLYRATAN--IAIDRDSNAGVSLNKT--
A0A2W0BQL1      --FRLLHKHLWTIAACTSLALSISLLYAVHQPRLYRATAN--IAIDRDSNAGVSLNKT--
A0A2V8ERZ5      --LAVIYRYRRICAATFVLVSAALIIQGYSTVQMYQAQAR--LLIEDERSTAVPGLQN--
A0A7W8J413      --LRVLRRRWKTVALVTLGIFLLGLAVCLLMTPKYAAVTT--IEINKEDNSANVSTDV--
A0A7W8JCF5      --LRVLRRRWRTVVLVTLGIFLLGLLVCLIMTPKYASTAV--IEINKEDNSANVSTDT--
A0A7W8IEB1      --LRVLRRRWRTVVLVTLGIFLLGLLVCLIMTPKYASTAI--IEINKEDNSANVSTDT--
A0A7Y9T3I1      --LRVLRRRWKTVVLVALGIFLLGLLVCLLMTPKYASTAI--IEINKEDNSANVSTDT--
A0A3P0XH15      --RKILIKRKWLILAGIVVGLAFAAVYILTTIPQYEAIAL--IDINEGQQSNIGISEL--
A0A3E0P0A3      --GSILLRGWKVLIAFAVLGLALGIARYLSAPVVYSATSQ--IQI--ERRAPNLLGGQ--
A0A3M1WQW8      --WRIIKKRKWIVLGVLMMVVTVVAIRMYRARPIYQASGK--VIINQQTPVPLANRQE--
A0A841JVA9      --YRTVARHRFLIISLALCGVLASVILHLTTLPVYRTRTS--LEIHSLNGDFMNMRSI--
A0A3N1JHC1      --LLLLRRHRFAVMMIFALCLLGGLLYAFFVPKSYKAQTV--LEITGINQDFMNTRDA--
A0A7V4XQR5      --RKLFLKRKWIILICILAGVGVALYLAETAVPQYEAVAS--VSIDMNKSTGVELTSL--
C1F294          --RKLFLKRKWIILICVLAGIGVALYHVETATPQYEAVSS--VSIDMNKSTGVELTSL--
A0A2V9KA79      --VAIFKRRLWLVLATTFVGTLCGGGASVLLPVRYRAQVL--LAAESAPTRDYLRLGG--
A0A348UZU3      --IDIFYRRRWTVISLTLIAVALSLIISFVTRPVYKARGT--VMIEKEPNILSFEDIFQI
A0A7X9FXC4      --IDIIIRQRWIIISVTVIALVITLLVSFTMRPVYTAQGT--VMIEKEPNILSFEEIFQV
A0A7X7ZKL5      --ARVLLKRKWVLITFAGALVVAAAVASFTKTPLYRATAT--LLIDEPGASLLNIQDV--
A0A522PSP1      --WGAIRRHALRIAIFVAATFLFTGIILLRLPRKYESTCV--IRL--DPSVPVSVVNN--
A0A7W8E8D3      --AQMLGRHKWFILVCIVIGTVVAVVYVKSVTPIYEATAS--IRIDPGRIGSLGLADL--
G8P085          --AQMLGRHKWFILACIVIGTVVAVVYVKSVTPIYEATAS--IRIDPGRIGSLGLADL--
A0A843SRW6      --VRVLYKRRGLAAAIFLVVMITVTWVVFAANPIYEARVQ--LLIENENRQIVLFKEV--
A0A7W8E330      --VRVLRRRRNVGLIILGAFVFITLLYCMVATKRYAAVAV--VQVQKEGSTAIDLSDLGG
A0A4Q1SGQ1      --WQVMRRRRRWVLWPTGAALLLATLYWLLATPRFQANGE--IEVQRESAAAFGLDNSVN
A0A7V2HGP7      --FWVVRRRWWVLLLLVALASGATYWWSKRITPLYESTAS--IDL--DFQAPAGVVGD--
A0A7R8B6H7      --AHLLLRNAPWIVLLTLGGGLTGFFYMLTQTPGYRASTV--IEIQGVNEAFMNLDRA--
A0A2V8GTX0      --LAIIIKHWKACAAIAVLVIAGMMYQTFTTVPLYRAQAR--IQIDEEQTTAQ-------
Q1ILD9          --FRIIVRRRKLLAAGVLLGILLATAYCILKTRRYEGEAT--VYVHPEGSDVLGSMPD--
A0A7G8BJH7      --TAVLKKRWAIFLCIFAVFLAATTLYCLFATRRYEATGQ--IQIQKDSSGAFGLEGSVM
A0A2V8J0X9      --LNAVFKHRRLSGTAFVLVVTAMMVQTYSTIPVYEAWSR--VQIQDERTTQVGTLNA--
A0A7Y5WWH8      --LNAVFKHRRLAGTASLLVVTAMMVQTYSAIPVYEAWAR--VQIQDERTTQVGTLNA--
A0A7C5SHM3      --QRLLMQRRWLVVAIAAQVFIVTGLVTFLRTPLYDASAR--ILI--ERSTPKVLESD--
A0A7V6D154      --VWLLRRYAQWIALVVITSVLVALLVSLRLPRIYESTVV--IDV--DRNLPTGVVGE--
A0A7V1XXZ2      --WHILTKRKWAVFTTFLILTTLTTIATLRATPIYESVGR--VAIFRENSDSLGLRES--
Q1IJZ6          --IRILRKRKNLILGAAGACLACALLLSFVMRSYYNSSAT--IEIQKDQDASLGSALD--
A0A2V8TCE6      --WSILVRRQWAIYTVAGLVLGLTALRLLMVQSTYKAKAL--VEI--QRSSPDVLAFR--
A0A522TBE8      --GRLLQRNLWRLVTFVCVVTAVATLIALTRPKQYAAVTT--LQV--DALGAQVVGDE--
Q1ITG0          --LYVLRRHLQMIIGVTAFGVLVAILFCLFMKPRYEGMAD--LNVHPEESAALDMGAL--
A0A7C2ML20      --WRVVWRRRWEVLGVFVTILIISGVMAYRTKPVYTATGT--ISI--EPARQQVIIGV--
A0A7T9HIZ6      --LRIVQERWRLIALLTAICALLGFVSYLVTPKLYSGTTT--ILI--ERRLSVPVKNA--
A0A7C5AXS9      --WRILKRHKGTLALFALSGVAAAILFSLPQTPVYQAKMT--LEI--LNLNENVLNRR--
A0A7C2RGE3      --WRVIKKRRWIVLSVMLVVVTIVTIRMSQLPVVYESTGR--III--NPQMPLRVTRE--
A0A7V6D075      --AWVLWRNRWRLLSLVGFCGVLTLFVSLRMQPVYEATAI--VDI--DRQGRAGVVGQ--
A0A3N5PCI5      --FAVLYKRRWIALFTFLIAAAGVVTYTMSVTPIYEAHTQ--LLL--QQRAS-----I--
A0A3M1Q0S9      --WQIVVRRRWLIVTCVLVATVAALVSSLLATPVYRATCT--LAI--ERTGVRVL--R--
A0A2Z5G448      --RKILIKRQFIILACLATGLILGAVITFFTTPVFESTAR--IDI--NPDRSTNLGIS--
A0A3M1VZ38      --WQILVRRRWLIGTCVLVTTVAAAVSSFLATPIYKATTT--ISI--ERRGVRLLNTS--
A0A4Q1SD29      --RKVVFKRKWIILACLLLGLGIGLYFALATIPQYEATAR--VHI--DFSRSANIGIE--
A0A833M5K2      --LEIVTARWRLVALVAGLAVGVALLHYLMTPKEYRATSL--IQI--ERRVSVPLGGL--
A0A1F2Q9L4      --LGVVRRRRLLLILVAGLVAAISIVLYFMTPRQYRATTV--LQI--ERRPT-SAAAM--
A0A7V5ZKV2      --IAVVRRRYRLLVAVCGVVLGVSVVKYAMTPKEYRATTT--LQI--ERRVT-GIASM--
A0A7Y8LRQ1      --IAVARRRYRLLVAVCGVAVAVSLVKYVMTPKEYRATTT--LQI--ERRVA-GIATM--
A0A3M1PY35      --RRVLWQRRWLVAAIALEVLLVGAVVTFLRTPLYEASAR--LII--EKTMPRVLDSE--
A0A3M1VMP2      --RKVLWQRRWLVAAIAAEVFLLTALVTFLRTPVYTASAR--LLI--ERTTPRVLDTE--
A0A1F2T595      --LQILYRRRYAAITVFLATVVTVALFTFTATRVYEGSVR--ILIE------------RD
A0A2V9AC41      --WLTIKRHRWLIVMTALAILACAMLYLFTRIPLYTAEAT--VLIE---------RKAPQ
A0A2V2R525      --VQIIRKHFLMIIALTALCTLTTAVYMARKPDVYGAAVR--VQID---------VESNP
A0A321LPW6      --WRTIRKRRWLIAATVVIVTSIVTVEMFRIKTAYQASAM--IEIG------------KD
A0A2V9R9V4      --WRIVRKRRWLIIGIASIITTLVTIDVFRTKPLYEATTT--IEIG------------RD
A0A321LE75      --WRTVRKRLWLISLIALIVTTIVTLEMFRTKSMYKASTT--IEIE------------KE
G2LEI9          --FLTILRYKFTVILCVVLTMTVTGLALSRMQPVYEASSH--IEVA------------PE
A0A7V9TW03      --WKTIRKRLWLIIGLALIVGAITALRQARQPDIYQAHAR--VQVG-------AETYSPA
A0A3N5XQP8      --WEAIIKYRRFVLLVLFLVVALVALETFTATPLYRASVR--VEVD---------AEPAK
A0A2V9KCS3      --WHMILRRKWTVLIIGFVGTLSGFLVSLPQTPVYRSRTS--VEIQALNDNLMNTRQIDP
A0A7W1JC10      --WRAVLKHRWLIVGITLLVTMLTAIHMARKPDIYEAKAR--VQVD-----LENNPALGG
A0A3M2BZG9      --LGALQRRWPLILIFCALAAAYSLVRYSLTTKMYQATAV--IQIE---------RRQLA
A0A1Q7N5R7      --LTVVWRYRWWILAATALGTIGGAAASRFLPPRYVAQAT--IWIQ---------TSGGN
A0A352F549      --WKTIRKRLWLIIGLALIVGSVTALRQARQPDIYQARAR--VQVG-------TQTYSPA
A0A3B9MLP9      --WQTIRKRLWLIIGLALIVSTIAALKQARQPDIYQARAR--VQVD-------TETYSPA
A0A3D5SQ87      --WQTIRKRLWLIIGLALIVSTIAALKQARQPDIYQARAR--VQVD-------TETYSPA
A0A7Y2DUG3      --LHVVYKRLPLILAMTILATAVTAFYMYRQPSLYRANTS--MLIY---------PRNSK
A0A7Y2D8Q4      --FNIIYKRLPYILAITILTTAAAAFYMYRQPSVYLAMAE--MIIE---------PRKPQ
A0A2V8NW86      EDWRILCRQKDILAWITFLGALAGVLLTIWQSPVYRARTA--LEIQNINEDFLNIKQVNP
A0A3M2D491      --LIIIYKRLPMIIALVVIVTSLVAFYMYRQPSIYEARAV--LLIE---------PRRPK
A0A7W1CBZ8      --YNVVYKRLPVILALTILTTAVVAFYMYRQPSIFEAQTE--MIIE---------PRKAK
A0A7W1FC90      --FNVVYKRLPIILALTILTTAAVAFYMYRQSSIYEARTE--MIIE---------PRKPK
A0A7W1ZXG0      --FNVVYKRLPIILALTILTTAAVAFYMYRQPSIFEARSE--MIIE---------PRKPK
A0A7W1ZIT3      --FNVVYKRLPIILALTILTTAAVAFYMYRQPSIFEARSE--MIIE---------PRKPK
A0A353C9L6      --FRIVYKRLPLIIAIVTIVTAAAAIYMYRQPTVYQATTD--MIIE---------PRRPK
A0A2V8RQV0      --FNIVYKRLPLILALTILVTAAAAFYMYRQASVYQASTQ--LVIE---------PRKPK
A0A2V8SJH5      --FNVVKKRLPIILAITLLATVAAALYMYKQPSLYQATTE--MVIE---------PRKPK
A0A136JPP4      --VRVVTKRLPMIGAIAVVVTAAAAFYSFRQPSIYSASTE--MLIE---------PRKAA
A0A399WUJ8      --VRVITKRLPLIGAIAIVVTAAAAFYSFRQPSIYSASTE--MLIE---------PRKAA
A0A7V9C3X9      --IDVVYKRLPLIIALTVLVTAAAAFYMHRMPSQYEATTQ--MLIE---------PRKPK
A0A7V9ZSX9      --FNIIYKRLPLILALTILTTAVAAFYMYRQPSVFLARTE--MLIE---------PRKPK
A0A3M1SIV3      --LLVIHKRLPLIIALVLVITTLTALYMYRQPSIYQATAI--LLIE---------PPKPK
A0A7V1SCI4      --LLVIYKRLPLIIALVLVITTLTALYMYRQPSIYQATAV--LLIE---------PPKPK
A0A7C5ZUA8      --VNIITKRLPLILVLTILTTAITAFYMYRQPSIYRARTQ--MVIE---------PRKPK
A0A7T9FQE4      --VNVVIKRLPVILALTVLVTAAAAIYSYRQPSIFQAQTA--IIIE---------PRKPE
A0A3E0PHB0      --FNIVYKRLPLILAATIIVTAAVAFYMFRLSDQYAAAAT--MIVE---------PPKPK
A0A7T9G4W3      --FSIVYKRLPLILAITIIVTAAVAFYMFRQPNEYAATAT--MIVE---------PPKPK
A0A838UAA0      --ISIVKKRLPIILAIVLLATIAAAIYSFRQPSVYLATTE--MIIE---------PRKAQ
A0A7W1HTU2      --FNVIYKRLPIILALAIVTTAVVAFYMYKQPLIYQAHTE--MIIE---------PRKPK
A0A357F267      --FNIVYKRLPMILTLAIIVTAATAFYMYRQKSVYQATTE--MLIE---------PRKPK
A0A7V9ICU8      --ANVVVKRLPMILALTLIVTTMAAFYMFRQPSVYSASTQ--MIIE---------PRRPK
A0A7T9JEF9      --LAIVRKNWLWIAVITVLGTAASLFYVAQQPDYYVATAR--VQVN----NEF-----NP
A0A399WNU1      --LSILKKHWLLVLSITLIGTFLVIVYEAQKPDFYEASVR--VQVN----NES-----NP
A0A3E0PCN7      --IGVLRKYWLMIVAITLLGSLAAVVYVAQKPDYYTATVR--IQVN----NEN-----NP
A0A7Y4TLV3      --LSILRKYWLMILGLTLLGTCLVIIYEARKPDYYTAEVR--IQVN----NET-----NP
A0A7W0MGQ3      -----MRKHQWLIVGITLLFTILSAIYAARKPDIYEAQAR--VQVD----LENA------
A0A1Q7Y6W9      --WRSIRKRLWLVISITVLMTTLAAIYMARKPDIYTAQAR--VQVD----LENIN---PA
A0A2V8NC68      --WCSIRKHIWLVMGIILLITMLATIYMARQPDVFEARAR--VQVD----LEINN---PA
A0A352FLX4      --WRIVSKHLWLILGISVLIPTLVAIYVVRKPDIYESQAR--IQVD----LENANPLLGG
A0A2V8MHG6      --WRSVRKHLWLVMGIVVLVSGVTAMYMARQRDIYESLAR--VQVD----SETANN--PA
A0A2V8P7N1      ---------------------------------------K--VQVD----SETANN--PA
A0A2V8M3M6      --WRSVRKHFWLIIAILILVTGITAIYMARQPDVYESLSK--VQVD----SETANN--PA
A0A1Q7NJH5      --WRSIRKHVWLVIGIVVVVTGLTAVYMARQPDVYESASR--VQVD----SETANN--PA
A0A2V8PJY0      --WRSIRKHVWLVIGIVVLLTGLTAVYMARQPDVYESASR--VQVD----SETANN--PA
A0A7W1BYD3      --WRAVLKHRWLIIGITFLVTMLTAIHMARKPDIYEARAR--VQVN----LENN----PA
A0A838PIP9      --WRAVLKHRWLIIGITLLVTMLTAIYMARKPDIYEARAR--VQVN----LENN----PA
A0A399WK13      --WRAVRKRLWLVVGIAVVMTTLATIYIARKPNVYRAKAV--VQVD----NEQV----NP
A0A7V8YZQ7      --WRAVRKRIWLVIGIAVLITTLVAIYMARKPDIFSATAL--IQVD----SEQA----NP
A0A7V9ICV8      --WHAIRKRLWLVVGLAVLMTTLTAIYMARKPNVYEAAAV--VQVD----LEQP----NP
A0A136KC10      --WRAIRKRLWLVAGIAVVMTTLATIYIARKPNVYRAKAV--VQVD----NEQV----NP
A0A7W1IVA5      --WRIIRKRFWLVVGIAVLVTTLTAIYMARKPDIFQSRAI--IQVD----LEQA----NP
A0A7W1ZIE3      --WRIIRKRFWLVVGIAVLVTTLTAIYMARKPDIFQSRAI--IQVD----LEQA----NP
A0A7T9J551      --WRAIRKRLWLVIGLAALITTLTAIYMARKPNVYASRSV--VQVD----LEQV----NP
A0A7V9NLN0      --WRIIRKRFWLVVGIAVLLTTLAAIYVARKPDIYEASGW--VQVD----MEQA----NL
A0A7T9G8R2      --WRIIRKRLWLVLGITVLLTTVTAIYMARKPNIYMANAT--VQVD----LEQA----NQ
A0A7Y2D047      --WRAVRKRLWLVIGVTVLLTTLAAIYMARKPNVYMASAV--VQVD----MEQA----NP
A0A3M2D6Y5      --WNAIRKRLWLIVSIAILVTTLTAIYVARKPNIYEAKAR--IQVD----LEQN----NP
A0A2V8SEX6      --WKAIRKRLWLVAGIAVLVTTLVAIYMARKPDIFSATAR--IQVD----LEQV----NQ
A0A7C5ZUU4      --WRAIRKRLWLIAGICVLVTTLVAIYMARKPNIYLAKAT--IQVD----LEQI----NP
A0A3E0PCJ6      --WRIIRKRLWLVLGITVLLTTVTAIYMARKPNVYMASAT--VQVD----LEQA----NQ
A0A2V8RTL7      --WRAIRKRLWLVVGIAVLITTLAAIYMARKPNIYLASSV--VQVD----LEQT----NP
A0A3M1S4R8      --WNAIRKRLWLIVGLVVLVTTLTAIYVARQPNVYEARAR--VQVD----LEQG----NP
A0A7V1SAJ0      --WNVVRKRLWLIVGLVVLVTTLTAIYVARQPNVYEARAR--VQVD----LEQG----NP
A0A7W0N726      --WRIIRKRFWLVVGIAVLLTTLAAIYVARKPDIFEASGW--IQVD----MEQA----NL
A0A7W1HTZ7      --WRIIRKRFWLVVGIAVLLTTLAAIYVARKPDIYEARGK--VQVD----SEQA----NP
A0A1Q7YFI6      --WQSVRKHLWLIIGIVVLITMIAAVYMARQADIYEAKSR--VQVD----LEVNNPGIGA
A0A7V9C9Y7      --WRAVRKHLWLVIGITLFVTMLAAIYMARKPDIYQAQAR--VQVN----LENA----QA
A0A7W1G8A4      --WRAVRKHLWLVLAITVAVTMLAAINAARQPDIYTAQVR--VQVD----LENNLAAGAT
A0A7V9KMZ1      --WRAVRKRLWLVISIVVLLTMLSVLYVVRKPDIYQAEAR--VQVD----LENN----SA
A0A7W0JTE4      ----------WLVISIVVMITMLSVLYVTRQPDIYEAEAR--AQVD----LEDN----AA
A0A0B6WWQ6      --WRAVRRYLWLVIGLVALAAAATAIYMARQPDLYLARAR--VEIG----SEED----SA
A0A3B9MK99      ---MCIRDR---VISVLVLITTISVIHVARKPDIYQASAR--VQVG----LENN----AD
A0A838PA20      --WRAVRKRLWLVISIVVLVTMLSVLYVARKPDIYQAEAR--VQVD----LENN----AA
A0A352EX26      --WRAVRKRLWLVIGIVILITTLAVINAAQKPDIYSANAR--VQVD----LENN----GA
A0A7V9R410      --WRAVRKRLWLVISIVVLITTLAVINAAQKPDIYSANAR--VQVD----LENN----GA
A0A2V8MM59      --WRAVRKRLWLVIGVAALITAMAVIYAARKPDVYEAASQ--VRVD----LENN----PM
A0A2V8PFE8      --WRAIRKRLWLVLGVAALITALSTVYVARKPDVYEAKSQ--VQVD----LENN----PM
A0A2V8PWS6      --WRAIRKRLWLVLGVAALITALSTIYVARKADVYEASSR--AQVD----LENN----PM
A0A2V8LCT5      --WRAIRKRLWLVIGVAALLTTLALVYVARKPDIYEAKSQ--VQVD----LENN----PM
A0A352FTJ9      --WRAIRKRLWLVIGVAVLMTTLAIIYVARKPDIYESSSR--VQVD----LENN----PM
A0A1F2S1W5      --LQVLYRRRYVAATAFLVVVLSVALYTFTAVRIYEGTVR--ILIER--DDP-NVVSFQE
A0A2N9LQU7      --WLKIWKRRVAASLFASGIFLAVILYTFLKKPVYESVAQ--IRVDS--SQQ-GSLGLED
A0A2P6WFK7      --SRTIFKHKLLILLTALTVFGIITLRTLTMTPVYESAVR--LQVDP--SRS-SSLGLDE
A0A2V8JQV5      --WRVFLNRKGTVLIAAVLGTAIGLLISFPRTPIYQARTT--LEIQG--LND-NLLNTRE
A0A2V8U914      --MRVLYRRRVTLLSVTLAGVFIAALLSMAQPRLYRSVAS--LEVQG--VNE-NFLNLRD
A0A2V8DRT9      --VKIMYRRRWPAGTAFMLVVLVVLVYTFTATPIYKARVQ--LLIED--EKS-NVVSFKE
A0A2V7VYF3      --LRVLYKRRWTAVTTFVLVVLAMMLRTLNGIPVYEARVQ--LLIDV--EAP-KVLNFKD
A0A1F2SVH2      --VKVLYKRRWTALTAFLIVVLSVSVYTFTATPVFEARVQ--ILIEK--EAT-NVVTFKE
A0A2V8AJG9      --VKVLYKRRWTAITAFLVVFLSVTIYTFTATPIYEAKVQ--ILIEK--ENT-NVVTFKE
A0A2V9MAM9      --LRVLRRHSLLLAVITAATVGAAFLVSIAQPRLYQSVAS--VEVQG--LNE-NFLNLRD
A0A2V8F956      -----------MAITTFLLVVGSVTVYTFTATPIFEAKTR--LLIEA--ENR-NVVSFKA
A0A2V7W309      --WNVIRKRWKVAAAIVLVVMIGTFLASYFSKPLYQSWIQ--IEVEEESQNV-TIEDLFG
A0A348V070      --WHAVLRWKWTGLTVAVLIVALTLVYILISPHIYTASGTIWIDETQ------SVLPFEE
A0A2Z5G3A3      --GALVVRRRAIIAGVTFAFLAIASLYCLLSTRRYMATGT--IQIQK--DSS-DALRLES
A0A2V7UGP8      --WNVLKRRRWVVFTAVVVLVITVTLGSFLIPPSYQAICT--LQIER--EQP-NVLTFQQ
A0A239MKT6      --WEFLRRRKIWIALGIVLGFLSGLAVYLHTPPLYTATAI--VELNKDSSSGLGLQELSG
A0A2Z5G7H4      --RHIFRRRRRVMVSCVGGCVALAVLVCVFCTRRYQAFGE--IQVQK--DSS-DALGLDS
A0A372IT17      --LSILRRRRRIVLGMVFALLLLVTLYCLLITPLYQATGE--IEIQR--EPS-GAFGLDN
A0A841JU67      --INVLRRRRGYVIGCVGTMLALATIYCIAATPRFQAIGE--IEVQK--EPP-PVFGLEN
A0A7T9GJJ6      --WRKIRKRKWLILTIVFIATTIVSIESFRTKSLYEASAK--VAFNQ--E--NTVIKAGD
A0A7Y4UER8      --WRIMRKRKWLILPLAALITLLVTIEVHRTPSVYEAENK--IKASK--EGGGAVISTKD
A0A2V8IYW3      --LDAVNRRKWLLICPVLVFGIAAFLITRSLPNLYQSETT--ILVVP------QRVPESY
A0A7V2HCZ0      --WQLLLSRKWLILAFAALGVGLATLWSLRQTPIYLARIS--LEMQDGAGGN-TVLGLRE
A0A2V9AEW6      ----------MTLLGFAVVGLLASIMISLVQTPIYRVRTS--LEIQ----GT-NFQEMKG
A0A2V8WQK6      --WHILIRHRMTVLRFAVAGLLGAIVVSLVQTPIYRVRTS--LEIQ----GP-NFPEMKG
A0A2V8XIF4      --WHLLAQHKMTLLAFGVCGLVAAILFSFIQTPTYRVRTS--LEIQ----ST-NFVEIKG
A0A350UQT3      --VSRIDEEMWKIGAFILVVLIATAVISLRLTPVYESTAT--LYVDR--QEAKGIVGQES
A0A7C3HRX0      ------RRHALRIILFVAALTAATGIITLRLTPVYEATAT--LYVDR--QEARGIVGQDS
A0A2W0BGU4      --WNILLRRRWSILAVVFLATLTATLASLKMKPVYKATAR--IEVEA------DTPQTQM
A0A2W0BVQ9      --WNILLRRRWSILAVVFLATLTATLASLKMKPIYKATAR--IEVEA------DTPQTQM
A0A317J121      --WHLLRKYLILLSLFAVAGAAAGFFSVAFLNPVYQSRAL--LEVQA--PTV-TLFKNSG
A0A2V9MN96      --WRILKKRKWTIVATFAIILVLAIIATLRMPRLYEAASR--IAIYP--ENS-NVLGLKD
A0A2V7V2Z1      --IYVILRRRRLVLAVFLGVAALATFRSLLTRPVYEASAQ--ILIER--DTP-SVLTFKE
A0A2V7X2F7      --LAVVLRHRKFALAIFLTATAVATIRTLLTRPVYMATAQ--ILIER--EKS-NVLSFKD
A0A2V7V2I1      --LHVVLRRRRLVLAVFLTVAAAATVRTLLTRPVYEADVQ--ILIER--ENP-NVLTFKE
A0A2V7U3M2      --IYIVLRRRRLVLAVFVAVTALATLRALLTRPVYEASAQ--ILIER--DTP-NVLTFKE
A0A2V7UHT0      --IYVVLRRRRLVLAIFLGVAALATLRALLTRPVYEASAQ--ILIER--DTP-NVLTFKE
A0A3P0X3W6      --MWLLRRAWWKIALFVVTCTALTAVACFLMTPVYEATVR--LAVDS--KVPASVIGQDS
A0A7V2MG68      --FWILRRHRWRILAFVAAVVIATLIVSYRITPVYESTAT--IDVDR--RMPSMVLGQDS
A0A7C6A629      --LWILKRHRWKILAFVATSVIATLIVSSRVTPVYESTAT--IDIDR--RMPTGILGPEA
A0A7V2HBQ5      --IWVLRTHRWKIVSFVLACTIATWIVSRRITPVYESTAT--IDVDR--QTPQGVIGQEA
A0A2U3JZ71      --LWILRRNWWKMLLFVSCAVAATLMVSARLIPVYESTST--IDIDR--QMPSAIIGQES
A0A2V8TTB0      --LWILRKHGWTIAGFVVAAVLGTLIVSLRLTPVYESTVT--VDIDR--QMPTGVLGPES
A0A2N9MK30      --LWVLRRHRWKILSFIGVSAIATLIVSARLTPMYEATVT--VDVDR--KVPTAVVGQDS
A0A3D1ASD2      --VWVLRRHKWKILGFVLACCIATLLVSTRLTPIYAATAT--VDVDR--QMPTNVLGQDS
A0A7R8B699      --LWTIKRHAWKIAVWVVLCMLGTFLVSVRLAPIYESVAT--IDIDR--QAPSAIVGQDS
A0A7S7SGU3      --LWILRRHVWKIVAFVAVMLIATAVVSLRLTPVYESTST--LYVDR--QEAKGIVGQES
A0A7Y8HY45      --LWVLRRQAWKIGLFVAAVTLAAGLVSLRLTPIYEATAT--LYVDR--QEARGIVGQES
A0A7C5AXI3      --LWILKRHRWRILAFVAASVAATIIVSSRLTPVYESTAT--VDIDR--QTPTGVIGQEA
A0A7C6E4H7      --LWILKRHRWKILAFVATCVIATLVISSRITPLYESTAT--IDIDR--RMPTGVLGPES
A0A2Z5FVL3      --------------------------MCILMTRRYTAVAE--IQVQK--PNS-DSLTLDS
A0A2V8GFD4      --LRILYKRRWLCLAVFVLTLGSVVMYTFTATPIYEARTQ--ILIET--ENP-NVVSFQE
A0A2V8HSS5      --LRILYKRRWLCLAVFVLTLGSVVMYTFTATPIYEARTQ--ILIET--ENP-NVVSFQE
A0A2V8KP55      --WRVIVTRRWTVVAVFATIVLLTLIWTLKQKPMYAATIT--IQIER--ETP-SLVNLRD
A0A2V9JSI3      --WNNLVKRRWTVVTVAFVVSTVVAMVNFRMPPVYEARVS--VEVEG--EAP-EVQSISN
A0A2V9WI32      --GRILKKRKWVVISTWLIIAILATVYALHMTPVYDATGR--IAINR--ENS-VNLGFKD
A0A2V9KBD6      --WRIIRPHKWITAGFTLAVVAIVTVASLVMKPQYDAVGRMVVVFHRDND-S-GVLGFKG
A0A2W0AJ66      --WRVVRSRKKIIAAFAVMVVSTVMTASFLMKPRYDAVGR--VLFFREDEGA-GVLGFKG
A0A1Q7RBU1      --WRIIRNRKWTIAVFALVVVAIVVTASLLMKPQYEAVGR--VVFHREND-S-GVLGFKS
A0A2V9JPV9      --WRIIRNRKWVIALFALVVVAIVATASFLMKPQYEAVGR--VVFHREND-S-GVLGFKG
A0A7V0Y3A1      --ARILWRHKWTLAFSLLLGIIAALGVSLTITPMYRSAAS--IEIQGVRETF-GSLGGND
A0A7C5Z4J3      --CKILSKRRWTILSVAIVVTTLAAIYSFKQKPVYRATAE--LEVDS------EVPELQS
A0A1F2TPT3      --LAVLYKRRWIAITALLVVLTFAINRNFTAVPVYEASVR--VLLDA--ERL-NLVNVED
A0A2V8JTQ2      --WRIIRDRKWTIAAFALVVVGIVVTASLLMEPQYKAVGR--VVVVFHRDNDSGVLGFRG
A0A2V8UZY0      --WRIIQDRKWTITAFALVVVAIVLTASYYMKPRYEAVGR--VVVVFHRENDSGVLGFKG
A0A350UEK1      --WRILRRRKGTLIIGAVAGLLIGIASTLPRTPIYQAKTT--LEIQS--FNQ-NFMNMGN
A0A350UIQ4      --WRILRRRKGTLVIGATVGLLLGIAVTLPQTPIYQAKTT--LEIQS--FNQ-NFMNMGN
A0A7T9GJN6      --LRRLRKHIWLILVITLSITSIVAIESYRNKSVYRATTT--LEILS--DNR-TLFRSGD
A0A7T9GJN7      --WRIIRKRKWLVAAIAIIATTLVTIEVHRTPSIYRAETT--LEVAK--DAS-TVVRTDS
A0A1H5Z7N3      --WLTIRKRKYWILAAALIGILLALYQSATQPRLFEAYGN--IEIRS--GAS-NEYKIGA
A0A1G7JVV8      --LNVLRKRKWVLIIAAILGILYGVYQAATQPIVYVATGR--IQVAK--PNG-QASLGVA
A0A1H4T6W9      --LAVIRKRRWILIACAIVGILYGYYLASTQPIIFTATGR--IQVHE--ANS-TAT----
I3ZEU5          --LAVIRKRKWILVACAVIAILYGYYTASTQPIIYTATGR--IQIHE--ANS-AAT----
A0A7W7ZGZ3      --LIVLKKRKLVVILAITLGLVYGVYRAVTQIRMFDSSAK--IEVRN--GAS-QEYKIDP
A0A7G8BSK5      --LITLRKRKRILLVFVLLGLAYGIYRAEMQPRIFEAFGR--IQVRS--GSS-NEYRMSN
A0A428MDU2      --LITLRKRRWILITSVVLGIAYGVYKAETQPKLFEAFGR--IEVRS--GSS-NEYRVSA
E8WVF6          --LITLRKRRMVLIIAVVLGTLFGFYKSVTQIKPYEAYGR--LEVNT--GAS-NQFKLSP
A0A1I6MH75      --LMTLRKRKWVLVACVLLGMVYGSYDAITQPRLYESHSR--IQVRS--GAS-NEYRVSA
A0A7Y9TM87      --LITLRKRRWVLIITVLLGLFYGFYRAISQPKLYEATGR--IQVRT--GSS-NEYRMTS
A0A7W8J1H5      --LIVLRKRKLILIVAALLGLAYGIFKAESQPKLYESYGR--IQVRS--GSA-NEYRVNA
A0A7Y9T5K4      --LIVLRKRKLVLIIAVLLGLAYGIFKAESQPKLYESYGR--IQVRS--GSS-NEYRVST
A0A852VHP9      --LIVLRKRKLVLIIAVLLGLAYGIYKAESQPKLYEAYGR--IQVRS--GSS-NEYRVSA
A0A7W8IFZ2      --LIVLRKRKLVLIIAVLLGLAYGIYKAESQPKLYEAYGR--IQVRS--GSS-NEYRVSA
A0A7W8J9Y9      --LIVLRKRKLVLIIAVLLGLAYGIYKAESQPKLYEAYGR--IQVRS--GSS-NEYRVSA
A0A7L5A6M5      --LVVLRKRRWVLIVAIILGVLGGLYRGFTEPRLYVATGR--IQVHS--SSSASEYKMNV
A0A5B9EBI2      --ILVLRKRRWVLLIAIAVGLAYGMYRSVSQPRLYIATGR--IEVRS--GSS-NEYRLTT
A0A7Y5RFT3      --ILVLRKRRWVLLIAIAVGLAYGMYRSVSQPRLYIATGR--IEVRS--GSS-NEYRLTT
A0A239HDF6      --LLTLRKRRWVLIVAFVLGAAFGLYRAFFQPRIFEAYGR--IQVRT--GSA-DQYKLTS
A0A4Q0T270      --LTTLRKRKWVLILAVLIGFAYGYWKASSQPRLFEAYAR--IQVRS--GSS-NEYKVSA
A0A1Q3QQB6      --ILTLKKRRKILILAILLGLGYGIYKAQTQPKLYEAVGR--IQVRS--GSS-NEYRLSA
A0A3N1K1G7      --IITLRKRRWILIVAVLLGLIYGVYKAETQPKLYEAYGR--IQVRS--GSS-NEYRVTA
A0A4V2G466      --LITLRKRKRILLVFVLLGLIYGIYRAETQPRIYEAFGR--IQVRS--GSS-NEFRVSA
A0A6B9YNQ8      --LVTLRKRKRVLLAFVLAGLLYGIYAAETQPRIYEAFGR--IQVRS--GSS-NEYRVSS
A0A3N6A5T6      --WNVVLKRKWLVLTVLVTVVVGTAVQTMTTTKVYRSTAR--VRIDP--EST-NILPYED
A0A2V8R8U7      --LYVILKRKWLILSLVLVVTSLVTIQAYRQPSIYEGGTT--IRIES--KPA-PVLATGQ
A0A7V9Q528      --LAVVLKRKWLILSLAVVVTSLVAIQMYRLPSLYEAETT--IQIEQ--KNS-SVLEMKG
A0A2V8QMP4      --LAVVLKRKWLILSLMVVITSLVAIQMYRLPSIYEAQAT--IQIEQ--KKG-GVLQTAG
A0A2V8R4S3      --LAVVLKRKWLILSLMVVITSLVAIQMYRLPSIYEAQAT--IQIEQ--KKG-GVLQTAG
A0A2V8NJ55      --LAIILKRKWLILSLVVVVTSLVTIQMYRQPPIYEAETT--IQIEQ--KK--NILQTKE
A0A7V9ZQ50      --LAVVLKRKWLILSLVVVVTSLVTIQMYRLPPIYEAETT--IQIEP--KRQ-SIVQTKE
A0A2V8Q7I0      --LFVVLKRKWLILSLCLVVTSLVAVQMFRQPSIFQAETT--IRIE---RKQ-NVLVSKD
A0A2V8S6K4      --LNIVLKRKWLILSLVTVVTTLVAIQMYRLPSIYEAKTT--IQIEP--KRN-ALIKTKD
A0A317I2L9      --LFVILKRKWLILSLCLVVTSLVAVQMFRQPSIYEAETT--IRIEQ--RKS-NILQSDK
A0A2V8LLF9      --FFIILKRKWLIMSLLLVVTSLATIQAYREPSIYQASTM--IRIEG--RPQ-SVLSTGN
A0A352FRF4      --LFVVLKRKWLIMSLVLIITSLATIQAYREPSIYEGATT--IKIEQ--KTP-SILQSGN
A0A7W1GE99      --VAVVMKRKWLILSLAVVVTSLVAIQMYRLPSIYEAKTT--IQIEQ--RNK-SVLQSRD
A0A1Q7YKQ8      --LNVVLKRKWLILTLMLVVTSLVAIQMYRLPPIYQAEAT--IQIEP--KHD-SILKAGN
A0A0B6WXT1      --WAIVYKRRWLILSLALAVTSLVAIYMYRQPNVYEAMVT--IDIEP--RRS-VLQTKGD
A0A2V8MKV0      --LFVILKRKWLILSVALVITSMAAIQQYRQPSIYDGIAQ--LKIEE--KPP-NILSSSQ
A0A2V8PYY8      --LFVILKRKWLILGVVLVITSMAAVQQYRQPSIYDGIAQ--LKIEE--KPP-NILSSSQ
A0A3B9MEU8      --LSVVLKRKWLILSLVLVITSLVTIQSFRAPSIYEGETT--IRIEQ--KPM-SVLQTKE
A0A352F3R7      --LFVVLKRKWLILSLVLVITSLVTIQSFRAPSIYEGETT--IRIEQ--RPM-SVLQTKE
A0A7W0GRF6      --LFVVLKRKWLILSLVLAVTSLVTIQMFRSPSIYEGETT--IRIEP--KPR-SVLQTKD
A0A7W1H6G6      --LFVVLKRKWLILSLVLAVTSLVTIQMFRSPSIYEGETT--IRIEP--KPR-SVLQTKD
A0A7V9HZC8      --LFVILKRKWLILSLVLAVTSLVTIQMFRSPSIYEGETT--IRIEP--RPR-SVLQTKD
A0A7W0XCB9      --LFIVLKRKWLILSLVLAVTSLVTIQMFRSPSIYEGETT--IRIEP--KPR-SVLQTKD
A0A3N5YNR8      --FQVLLKRKWLIGLVVGAVLLLVGLQSFTTTPLYRATAR--VQIDP--ESA-SILPYQP
A0A7W7ZUJ7      --WHILLKRKWIVIVSVAIILITTALISLHTTPIYEAVTK--ITISP--PTS-NPLNFKD
A0A2V2R0I6      --LLVLRKHQWLILSFMLAVVTIVAIATFRMQPVYTATAR--IEIDR--ENS-NILPFQG
A0A2V8XAR9      --LLVLRKHQWLILSFMLAVVTIVTISTFRMQPVYNATAR--IEIDR--ENA-NILPFPG
A0A2V8VZA0      --LLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATTR--VEIDR--ENA-NILPFQG
A0A1Q7CB82      --LLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATTR--VEIDR--ENA-NILPFQG
A0A2V8WIU1      --LLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATTR--VEIDR--ENA-NILPFQG
A0A1Q6Y9F5      --LLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATAR--IEIDR--ENA-NILPFQG
A0A2V9EVV8      --LLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVGTAR--IEIDR--ENA-NILPFQG
A0A2V8YF91      --LLILRKHLWLIVSFMLTVVTIVAIANFRMKPVYVATAR--IEIDR--ENA-NLLPFQG
A0A2V8XZK2      --LLILRKHQWLILSFMLAVVTIVAIATFRMQPVYVATAR--VEIDR--ENA-NILPFQG
A0A2V8ZTX6      --LLILRKHQWLILSFMLAVVTIVSIATFRMQPVYVAIAR--IEIDR--ENA-NILPFPG
A0A2V9BT79      --LLILRKHQWLIVSFMLSVVTIVSIATFRMQPVYVATAR--IEIDK--ENA-NILPFQG
A0A2V9YHT3      --WHILVKRKAVVLITLAVVFALVAFRTYRTTPLYESTGR--VAIYH--ESQ-TLTGFKD
A0A7C2XNI7      --LVILRKHMWLSLAFLLAVVTVVTIATFKMQPVYVAVAR--VAVDR--EDP-NLLPFQN
A0A1Q8B793      --LLILRKHQWLILTFLLTVVTIVSIATFRMKSVYVAPAR--IEVDR--ENA-NFLPFQP
A0A2V9BCA0      --LLILRKHQWLILTFLLTVVTIVSIATFRMKSVYVAPAR--IEVDR--ENA-NFLPFQP
A0A2V9BWU9      --WRILRKYQWSILSFLLTVVTFVTIATLRMHPVYEATAR--VEIDN--ENT-NFLPFK-
A0A2V9DKX2      --WRILRKYQWSILSFLLTVVTFVTIATLRMHPVYEATAR--VEIDN--ENT-NFLPFK-
A0A7C2YQY3      --LRILRKHRWIILTVVAVMVTVVSVVSFQMQPVYQASSR--LEING--EAP-DLTNLRE
A0A845TWB8      --LRVLHKHRLLIFGVVALTVAVVALVSFRTQPVYQASAR--LEISG--EIP-DMANLRE
A0A2U3KC61      --WQILRKRKWAVLATFAIVFALSVIKTLRETRLYQATSK--VAIFE--ENP-NVLGFK-
A0A2V9Y2R7      --WHVLRKRKWAVLVTLIVVWVLSAVATMKQTRLYEAVSQ--LAIFP--ENL-NALGLK-
A0A2V9NGH6      --LRVLIKRKWVVISSVVMIFVVVAIATLKATPVYDATGS--IAINK--LDP-ALISFK-
A0A2V9PYE6      -------------------------------------------------MDP-ALISFK-
A0A2V9NL07      --LRVLIKRKWIVVGTLAAIFGASLVATLRITPIYDAVGS--IAINK--PDP-MLQNLR-
A0A2V9QD92      --LRVLIKRKWIVVGTLAAIFGASLVATLRITPIYDAVGS--IAINK--PDP-MLQNLR-
A0A2V9WPZ6      --LRVLIKRKWTILFCLAGIFIMVAISSLKMTPVYEASGS--IAVNK--ADP-GLVNFK-
A0A2V9ZLH4      --LRILIKRKFVALSCVVVIFLLVLIATLRMTPIYDAAGS--IAINK--LDP-SFINFK-
A0A2V9RQF1      --LRVLIKRKWIVISSVTVIFGVVAIATLKSIPIYDASGS--IAINK--SDP-ALLNIK-
A0A2V9YDK8      --LRVLIKRKWTIILCFSGIFIAVAIASLKMTPIYEASGS--IAVNK--TDP-GLVNFK-
A0A2V9V8F7      --LRVLIKRKWTVLFCLAGIFIMVAISSLKMTPVYEASGS--IAVNK--ADP-GLVNFK-
A0A2V9XGR9      --LRVLIKRKWTILFCLAGIFIMVAISSLKMTPVYEASGS--IAVNK--ADP-GLVNFK-
A0A2V9V3Q5      --LRVLLKRKWIIIACVVGIFAAVAIASLRQTPVFDAVGR--IAINK--ADS-NLVTFK-
A0A2V9NWS3      --MRVLIKRKWVIISCLAIIFGAVSVVTMRSTRIYDATGS--IAINK--SDP-ALLNFK-
A0A2V9USA9      --IRVLAKRKWVIFSCVAAIFAVVAIASLKMTPIYEANGS--IAINK--PDS-T-LNFQ-
A0A2V9XW18      --LRTLIKRKWIVIICLVTIFSVVAIATLKTTPVYEAGGT--IAINK--PDT-T-LNFQ-
A0A1H5SQF5      --LVILRKKLWLIVGCVVVGVGLAVLLTSLMQRRFSSTVT--IEVHK--EGG-TSLSLED
A0A2V8G155      --LMVVYRRRWTVVTAFVLATAGATVYTFSQPRLYEARTR--LLIET--ENP-NVVNFKA
A0A2V8HDM7      --LMVVYRRRWTVVTAFVLATAGATVYTFSQPRLYEARTR--LLIET--ENP-NVVNFKA
A0A2V8IVN9      --VRVLYKRRWIAGTAFTVVMLLVTVYTFTVTPIYQATTK--LLIES--DSP-NVVSFKE
A0A7W1SCW7      --LKILHKRRWTAATAFLIVFVGTMLYTFTVTPIYEAKTR--LLIES--DNP-NVISFKE
A0A3E0NV31      --IESIRVRIFTVVLVWLLTVVVMVVHVWTQTPLYRSTAT--LEIEP---KQ-NLLPYQD
A0A3N5M5V0      --FQILRKRKWLIVAVVTTVLVLVAVQSFTTTPLYRATAR--IQIDP--ESE-NILPYKD
A0A7X7XDY5      --WKIIVKRKWLIVLCFVVAAATAYLWTLRQTPLYSATAT--LQIEV--SSP-NILPYQD
A0A2V9L5B5      --WQVVLKRRWTVLVCLLVVFTTVAIGTLKKRPVYEGKVL--LEINP--EEP-QVLNFRE
A0A2V9LK56      --WQIILKHRWLLISTLLIVFSIVAVGTLKQKPSFQGSIL--VEIDP--DPP-SVVNFKE
A0A2V9L7I0      --WQLILKRRWTVLVCLLAVFTTVAIGTLKQRPVYVGKVL--LEINP--EEP-QVLSFKE
A0A522PPT0      --WHVMLKRRWAVLTCLLIVFTTVAIGTFKQKPIYAGKIL--IEINP--EEP-QVLSFQQ
A0A7C5V1G5      --WNIILKRRWTVLTCLLVVFSTVAIATFKEKPVYAGRIL--IEINP--EEP-QVLSFQQ
A0A4R1LC91      --WALLRRRRSVVYGTTLVLFGAAILYCLLSTRRYEVTGE--VQVQK--TPA-DSLGLDV
A0A2V9QB26      --WRILCRHTGILAGITLMGALAGVLLSIWQSPVYRARTA--LEIQN--INE-DFLNIK-
A0A2V9VYY4      --WHVLTKRKWVVLPTFAIVFALSAIATLSETRLYQATSK--VAIFP--EVP-NVLGFK-
A0A2V9KIE8      --WHLILKRRWTVLTALLAVFLTVAIGTFKQKPGYSGTAL--LEINP--EPP-NVLNFKE
A0A7C2GJ20      --WRVIKKRRWIVLSVLLVIVTIVTIRMYQLPVVYEATGR--IIINP--QLP-LRVTREK
A0A7C4BTL5      --WRMVSRRKGTVILVAALGGLAGVLVTMPQTPVYQARTT--IEIQE--MNE-NFLNMK-
A0A7X8YVF2      --WLILVRRKWAALAVLAAALAVAVAYVWYKTPLYLAATQ--IELES--QAE-NILPYDQ
A0A7X7YEP0      --IEVIRRRRRLLYATTGIVLTGAIVAFLITPKQYRAATV--VQIERRLQTS-STTQTSQ
A0A2V9CBM2      --GHIVRRRLSTILAVFFVVFVVIAIATLKQKPTYRAQVV--LEIQK--ENP-DIPTIQE
A0A2V8XN17      --GRILRKRLPTILVVFFILFTGILIATLKQKPVYRAQVL--LEIQK--ENP-DIPTIKE
A0A2V8WX45      --GRILHKRLPTILIVFFILFTTILVVTLKQRSVYRAQVL--LEIQK--ENP-DIPTIKE
A0A1Q6YR79      --GRILRKRLPTILVVFFILFTGILIATLKQKPVYRAQVL--LEIQK--ENP-DIPTIKE
A0A1Q7VA32      --GRILRKRLPTILVVFFILFTGILIATLKQKPVYRAQVL--LEIQK--ENP-DIPTIKE
A0A2V9EY85      --GRILRKRLPAILVVFFILFTAILIYTLKQKPVYRAQVL--LEIQK--ENP-DIPTIKE
A0A2V9H8K0      --GRILRKRLPTILIVFFILFTAILIATLKQRPVYRAQVL--LEIQK--ENP-DIPTIKE
A0A2V9FFE5      --GRILRKRLPSILVVFFILFTVILIATLKQRPVYRAQAL--LEIQK--ENP-DIPTIKE
A0A2V9GM43      --GRILRKRLPSILVVFFILFTVILIATLKQRPVYRAQAL--LEIQK--ENP-DIPTIKE
A0A2V8ZHL8      --WNIVNKRRWTIATVAFIATLLVAIASFKMTPIYEATAR--LDIEA--DTA-QIQSFND
A0A2V9B240      --WNIINKRRWTIVTVAFIVTLLVAIASFKMVSIYEATAH--LDIEA--DTP-QIQSLND
A0A2V9CYQ5      --GHIIRRRLSTILTVFFVVFVGIAIATLKQKPTYRAQVM--LEIQK--ENP-DIPTIQE
A0A2V9BWU8      --GRILRKRFATVAIVFFLVFAGSLIATLKEKPVYRAQVL--LEIQK--ENA-DIPTIKD
A0A2V8ZG48      --GRILRKRLPTILIVFFLVFTVGLIATLKEKPIYRAQLL--LEIQK--ENP-DIPTIKD
A0A2V8Y334      --ARILRKRFSTVLIVFFLVFAVTLIATLKEKPLYRAQVL--LEIQK--ENP-DIPTIKD
A0A2V9AY68      --GRILRKRFSTILIVFFLVFAATLIVTLKEKPVYQAQVL--LEIQK--ENP-DIPTIKD
A0A1F2RFI7      --WRVLRKRRWTVLGLLLLVVVTVMIGTLKQKPVYRAKAV--LQIDK--ESS-NIFSFKD
A0A1F2RZS3      --WRVLQKRRWTILSILLLVVVTVMIGTLKQRPIYEAKTV--IQIDR--ESP-NILSFQG
A0A845TW47      --WNVLRKRRWTVLAVFFVLFTLVLLGTLKQRPVYRATAL--LEIQK--ENA-NILTMKE
A0A845TXC1      --WRTIRKHRGTILIILVIVFAVALIGTLKQKPIYRGKAL--LEIQK--ENP-DVASLKE
A0A1F2USE2      --WRVVQKRRWTILTIFFVFLTLVLLWTLKQKPIYGATVL--LEIEK--ENP-GLATVQE
A0A7C2VB08      --WRVLRKRRWTVLTLFSVVWLLVLIGTLKMRPVFEARGL--IEIEK--ENP-NFLTVKE
A0A2V9C238      --WRVLRKRRWTILTVFFVLFTVVLLGTLKQKPIYRAKAL--LEVAK--ENP-NILTVQE
A0A1F2Q9F5      --WRILRKRRWTLASILVVLLVVVLVGTLKQKPVYRAKAL--LEIER--EGP-NILTVQE
A0A1F2QQH9      --WRILRKRRWTLASILVVLLVVVLVGTLKQKPVYRAKAL--LEIER--EGP-NILTVQE
A0A1F2QXK7      --WRILRKRRWTLASILVVLLVVVLVGTLKQKPVYRAKAL--LEIER--EGP-NILTVQE
A0A2V9DEM9      --WRVLRKRRWTILTVFFVLFTVVLLGTLKQKPIYRAKAL--LEVAK--ENP-NILTVQE
                                                                            

A0A2V7VMF7      ----------GMGNYWQNADFY-----NTQFRVLKS----KTLGSRVVERLKLD---D--
A0A2V7YYV7      LTPDQIL--------------------RTYALLLTQ----RKLLDEVIADLRLK---T--
A0A2V7Z0J5      ISATTIL--------------------ATYALFMTE----PPLLNKVIADLGLK---T--
A0A2V7Z3M4      VSSATIL--------------------ATYALFMTE----PPLLNKVISDLRLN---T--
A0A399Y5V2      ----------VAMPAEDPAREL-----QTQIQVITS----RPVAEETAKRLQLN---V--
Q01X01          ----------TAAPSADSAVYV-----QTQAEMLQQ----DALLERVVKKLRLE---D--
A0A3M2D9H8      TELLS----------------------QTFTELLVT----RPVLEAASERLGYYISSS--
A0A2V9IXG5      ----------QSSYYLNIDRYF-----KTEKQKLTS----RRMHLLFAGRLKQQ------
A0A2V9J2P4      ----------QSSYYLNIDRYF-----KTEKQKLTS----RRMHLLFAGRLKQQ------
A0A831T3F4      VV--------IQTDDSDS---I-----KTKMLMLKS----RPLLEDVVIDLKLA---L--
A0A2V8JK38      YY--------QADSDTYVDYML-----QSYFRILKS----RSLARRVVTELHEE---L--
A0A7W0JWI4      SV--------VLNSGINDPAYF-----NTQLRILTS----SGLLRRVVKTLDLE---R--
A0A1Q7RLS4      TGM-------AQYGWYAEERYF-----NTQYEIIKS----RDVARRVFDRLDLY---N--
A0A257VBK0      -----TGASSWMEEQK----FY-----NSQQQIMTS----SVVMQDVVDKLKLQ---S--
A0A7C5TWV7      -------GPSWWELQQ----YT-----KDQMLVLQT----HRLAERVAEKLGLN---A--
A0A2V7XDY0      ------LGGGYWQNAD----FY-----NTQFRVLRS----SALGEKVLDRLKLK---D--
A0A2G6PYV5      -------LQWNPYREE----YF-----KTEFRIIKS----LPVAEEVARTLGVK---Y--
A0A1F2TCR2      -----NDPMFWQDSTQ----YY-----NTQYSILKS----RVLGQRVVRRLHLQ---D--
A0A7Y9PHF8      ------APAGAADVDQ----VF-----NTEMQLIQS----DGVLRPVVERFHLL---D--
A0A7W8J3G9      -------EGKGMPNDD----EM-----GTDIEIFKS----DSVAVETLNTLSDG---D--
A0A1F2V330      ---------SVARVQD----QL-----LTIREVLFS----RPVLEPVMRNFHLL---P--
A0A662EE63      -------FVSYWQLDR----YI-----SDQVQVLET----DRLAKRVVDQLGLA---S--
A0A2V8TLH7      -SQLGTSNFGWSAEER----YF-----NTQNEIIKS----RDVAQRVFDKLDLY---H--
A0A1Q7ZJT1      -AETGMAQYGWYAEER----YF-----NTQYEIIKS----RDVARRVFDRLDLY---N--
A0A2V8VC99      -AEMGASQYGWFAEER----YF-----NTQYEIIKS----RDVARRVFDRLDLY---N--
Q01XL7          --DPQAGTDMTTASAS----NI-----QTQTRILTS----RSMLARVAERMSLE---MTP
A0A523DUV7      ---YPTSAFNYFDYRN----YY-----NTQYRIIRS----KSLGERSIEKLDLA---D--
A0A7W1TTH3      -----EQQISWQDPEV----HM-----ETQLSVLRS----RDLARIVVKHLDLK---T--
A0A1F2U158      -----AD--YYQDPIP----YY-----NTQYRILRG----RDLARRVVKRIDLQ---N--
A0A2V8F6S9      -----PDNTYYEDPEP----YY-----KTQYRIIKG----RELTRRVVKKLNLQ---D--
A0A7V0UHS9      --------PQPLNIQE----HL-----WTVREVLFA----PPVLEAAARVLPQY---Q--
A0A7D8BEX2      -----SALQGSSSLDD----KL-----NTEVLVLTS----DSLLLHVAKDLDLA---N--
A0A4Q1SCH5      ---------LLGANSD----EV-----PTEIGILGS----AQVALSALEMLTPE---Q--
A0A7V4SJP8      -----TGATSWMEEEK----FY-----NSQAEIIRS----QAVMQDAADRLKLA---T--
A0A372IRG7      ---IESKLSGGEESDQ----KL-----QTELRIMQS----DSVVMDVINSLDLY---H--
A0A2V8K4L4      --NPTSSPSGYLDPSY----EI-----LTQVKVFQS----RSLLQQTTERLLKE---K--
A0A2V8NCZ3      --NPTSVTGGW---GY----EI-----MTQVRVLQS----RSLMEKVTERLLND---K--
A0A4Q7YNP3      ---APTGEGNGSSAET----NV-----QTQIKLLQS----DTLLQRTKARLAAE---P--
E8UZE1          ------QSTASVATEQ----KM-----ATQLSILES----QSIAWKVIEELKLD---A--
A0A2V7YW66      -----NPWLENYWNME----FY-----PTQYELLQS----RGLAERVVKSLDLM---E--
A0A2V7Z0V0      -----NPWLENYWNME----FY-----PTQYELLQS----RGLAERVVKSLDLM---E--
A0A2V9M454      -------FRTEQADDS----FL-----ASQISILQS----DNLAWETIQQLGLA---R--
A0A2V9J4D6      -----YRNESTPADET----FL-----LTQTQVLRS----DNLAWETIQQLKLA---D--
A0A2V9L9C5      -----YRNESTPADET----FL-----LTQTQVLRS----DNLAWETIQQLKLA---D--
A0A2N9M9N1      -----GP--SGATDAA----FL-----QTQVDLLQN----NNLSWQTMQELGLA---NGN
A0A2V9JEC4      -----DR--HAPVDST----FL-----QTQVDLLQN----DSLMWQTIHRLDLE---S--
A0A2V9LPQ3      -----FR--SMPADEA----FL-----KTQALVIGS----DHLAWETIGQLGLA---E--
A0A7Y8IYX6      ---SDSVFQPSRDYEL----YM-----KTQDELLRS----PTLMMSSYERAAKE---Y--
A0A2V9IVR7      -------FEAMPADDM----FL-----QTQVNVLQS----DNLAWQTIEQLRLG---E--
A0A2V9ILE2      -------FEAMPADDM----FL-----QTQVNVLQS----DNLAWQTIEQLRLG---E--
A0A2V9LGY4      -------FEAMPADDM----FL-----QTQVNVLQS----DNLAWQTIEQLRLG---E--
A0A7T9JJ28      ----MEFETANVFNPL----YL-----QTQIEILNS----RDLSRRVIQRLNLI---E--
A0A7T9GE94      ------ISMAGGDDNS----YI-----NTQLKIMQS----PKIAYLVARSLDLE---H--
A0A7Y4X7L5      ------LNLGGSEDPA----YL-----ATQLKILES----PNIAYRVAKALELD---R--
G8P0Y7          ----NSSSSALEDPQA----GI-----NTQVKILQS----DTMAELVIHRMNLD---T--
A0A2W4RYA1      -------VDQEQAQPD----YY-----TTQINLLRS----RLLARRTIEALDAW---N--
A0A2V8EXP2      -------FEQNQVADD----YY-----QTQYKILQG----RALARRTLDALRLW---D--
A0A843SYC7      -------IDGDQTRAD----YY-----QTQYNILQS----RALARRTIDKLKLW---D--
A0A7V9BJ09      -----FQSQDGWFNDE----FY-----QTQHRILQS----RSLAKRTIDSLNMW---D--
A0A7W1DT80      -----FQSQDGWSGDS----FY-----QTQFRILQS----RTLAKRTIDSMNLW---D--
A0A5M8T4U7      ------DQERSSADTS----AI-----QTELLILQS----DSVLLQTAEKLDIY---G--
A0A7L5A491      ------VAGSASDAEQ----VF-----NTELQLIQS----DAVLRPVAERFHLV---S--
A0A7D8BF18      ---------TGSDNTF----PI-----PTQVALLKS----DTLLLNVARDLNLA---N--
A0A1E3Y9R6      -----LEERESWYQDD----FY-----PTQYRVLQS----RTLAQRTARVLARE---P--
A0A2W4TLP2      -----LEDRDSWYQDD----FY-----PTQYRILQS----RTLASRTAAAIEGG---L--
A0A7G8BDY8      ---TASIGGGGLDFDE----KL-----ETQVRILKS----NSLAWTVISQLRLD---K--
A0A7C4BZ42      ---SPTTPGYSYDPSY----DI-----TTQIKLMES----GAVKKRAMDRLLKQ---G--
A0A3R9WF43      ----DTPSDSADDLKA----EV-----QTDTSILQS----DGLVLRVIKDLDLA---K--
A0A317HKM4      -------VDQRDWMST----FL-----PTQVGILMS----ADLARTAHDELTSS---E--
A0A2V9CG11      --DPTVTADDYTTGAS----YF-----ETQVKLLQS----ESLLERVIEKLNLR---E--
A0A523E0N1      --------NPSRTYAD----IY-----GTQEKIVNS----RQLAEHVVEDLELW---E--
A0A1V6HR88      ------AAWENYYSME----FY-----PTQYRLLQS----RGLAERTVQNLRLD---Q--
A0A4Q1SDL1      N-AAAGGGDDALAANI----NL-----ETQSQILQS----DTLALRVIEDLNLE---K--
A0A841JWG5      APGAAAAADDALAANI----NL-----ETQAGILTS----DTLALRVINDLDLE---H--
A0A4R1LAZ7      ---IEQKLTGGEGSSD----RM-----QTEIRIMQS----DSVSMAVINSQDLY---H--
A0A7G8BMP1      ---VEQNLAGEDASSE----RL-----QTEVAIMRS----NTVALDVINTLDLY---H--
A0A7X7ZKA6      E-SM---------RDD----FY-----QTQYRLLSG----RGLADTVVERLKLF---E--
A0A523ECP2      -------QDYWSGYDE----FY-----PTQQRVLMS----RNLSRRIVKHLRLW---E--
A0A2W0C122      ---FASALGDADDYSV----SL-----ETQIRVLAS----RSLAEVVVRKLDLA---H--
A0A2W0AUU7      ---FASPLGDADDYSV----SL-----ETQIHVIAS----RSLALAVVRKLDLT---H--
A0A2W0BQL1      ---FASPLGDADDYSV----SL-----ETQIHVIAS----RSLALAVVRKLDLT---H--
A0A2V8ERZ5      -----DANQYYEDPEP----YY-----QTQYKILKG----RDLTRRVVRKLRLD---T--
A0A7W8J413      ----VPASPTADELKA----EI-----ETDISVLQS----DGLALAVIHDLNLT---Q--
A0A7W8JCF5      ----GTASPTADELKA----EI-----ETDISVLQS----DGLALAVIQDLNLT---H--
A0A7W8IEB1      ----GTASPTADELKA----EI-----ETDISVLQS----DGLALAVIRDLNLT---H--
A0A7Y9T3I1      ----GAASPTADELKA----EI-----ETDISVLES----DGIALAVIRDLNLT---H--
A0A3P0XH15      ---VQQEQGGIEADLT----RT-----ATEIAIMQS----DTVSLDVINSLDLY---H--
A0A3E0P0A3      ------MFAQPWWNPE----FF-----PTQEQLLKG----RGLAEAVTRDLALW---N--
A0A3M1WQW8      ------ALPYSSNDTQ----YL-----RTQINVLQS----RTLARRVIEELSLD---R--
A0A841JVA9      -----DPTEAPSTGET----NI-----QTQIKLLES----DSLMERTGERLTAE---N--
A0A3N1JHC1      -----DPYANGVTQDS----YL-----ETQIMLLKN----EVVADRVAMVMA--------
A0A7V4XQR5      -----ASSSGGLQTQD----RV-----ETQLHIMQS----NTIAWNVIESLKLY---E--
C1F294          -----ASSSGGLQSQD----RV-----ETQLHIMQS----NTIAWNVIKTLKLY---N--
A0A2V9KA79      -----------YGDAI----HI-----QDQLRIIKEHLYKPALLERIIREFGLY---P--
A0A348UZU3      E-TF---------RDD----YF-----QTQYKLLQS----RSLAERTIERLKLW---E--
A0A7X9FXC4      E-TF---------RDD----YF-----QTQYKLLQS----RSLAERTIERLKLW---G--
A0A7X7ZKL5      --LNAGAYYRNDFMGT----YF-----NTQLRLLTS----RSLAERVAKRLDLA---A--
A0A522PSP1      ----QPGTVSLDSMDV----LF-----ATATKEIIT----PAVVTPAILKLGLW---A--
A0A7W8E8D3      -------TGTQADSAE----MI-----ATEMAIIKS----DAVAIDTMHSLSEE---E--
G8P085          -------TGTQADSAE----LI-----ATEMAIIKS----DAVAIDTMHSLSDE---E--
A0A843SRW6      -------IEQQDPEKD----YQ-----QTQHRILQS----RSLARSTLDRLQLW---D--
A0A7W8E330      P-GA-ALGGDLAAANM----NL-----ETQSQILQS----DTLALNVIRDLNLE---A--
A0A4Q1SGQ1      G-EPSQAEGDSLDYSM----TL-----ETESKILES----PTLALRVMHDLELE---T--
A0A7V2HGP7      ----ESRQLLSNNTEQ----FL-----QTQLRLLTS----DSVLRPVAQRFNLI---P--
A0A7R8B6H7      A-PQ-GGVGDYGPNLI----NI-----QTQLKLIES----PSLIARTVANVRSN---R--
A0A2V8GTX0      V-DFKQPELVYSDPEP----YY-----QTQYKILQG----RDLALRAVKRVKLE---D--
Q1ILD9          -----LGLSSGMDWNS----QL-----ATQIKILQS----DALAWDVVKRLRLD---Q--
A0A7G8BJH7      G-DAADSASDALDYNI----TL-----QTEANILNS----ESLALRVIQDLHLE---T--
A0A2V8J0X9      S-DP----AFWQESGP----YY-----QTQYSILQS----RGLGRRVVRKLDLQ---N--
A0A7Y5WWH8      N-DP----AFWQESGP----YY-----QTQYSILQS----RGLARRVVRKLDLA---N--
A0A7C5SHM3      D-VM-PMVWNEFEIQR----FY-----QTQYLLIKD----AKVLMRALHREDYP---I--
A0A7V6D154      A-AT---VVPAQDINQ----FL-----TTQVKLVQS----DSVLRPVVQEFDLL---R--
A0A7V1XXZ2      S-SYGMGDTDDYDYTV----AL-----ETQVNVLKS----DQLALKVARAMKLD---R--
Q1IJZ6          T-LASTVGGGSGDTKT----EV-----QTQVAILQS----DDLAIETIERTGFE---K--
A0A2V8TCE6      D-II-RTDPSYQGYSA----FY-----ETQYRILQS----RAVARRAAERLDLP---R--
A0A522TBE8      H-LQ---RASTADSDA----LV-----LTDQTVMTS----PAVLLQVVEQLHLQ---D--
Q1ITG0          G-DL-ATGAGGLDWSS----KL-----ETQARILKS----DTLAWDVISQLRLD---Q--
A0A7C2ML20      Q-DF-STTDQGSYEGT----II-----KTHLDILQS----RALAERVIERLSRS---G--
A0A7T9HIZ6      A-EG---AWENYYNIE----FY-----PTQYKLLQS----RGLAERVVQNLRLD---Q--
A0A7C5AXS9      Q-LE-PTEAPAGSPEL----DI-----RTQVRILQS----EALVERVLSKVGNE---Q--
A0A7C2RGE3      K-ET--GADLSSNDAQ----YL-----ETQQNVLRS----RELARRVIEALGLE---K--
A0A7V6D075      E-AL---QPGVQDAEQ----FI-----ATQIALIRS----DAVLRPVAERYDLL---A--
A0A3N5PCI5      V-TFEGAADPQANERG----YL-----ETQHRLLRS----RSLARRVIDALNLW---D--
A0A3M1Q0S9      E-TLSSAEPSWLDYQN----WY-----NTQYQIMQS----DEVLRRAVDLLDLM---N--
A0A2Z5G448      D-LL-NSKAGGNDEST----RL-----LTEARILQS----DSVIFAVIESENLF---A--
A0A3M1VZ38      L-TA--TEPSWLDYQN----WY-----NTQYRIISS----DAVLRYAVKQLDLE---N--
A0A4Q1SD29      D-LIQQQLGGGGNAED----KL-----QTEVEIMQS----ETVAMEVINSLDLY---H--
A0A833M5K2      E-NS-WLENWW--NTE----YY-----PTQYRLLAS----RGLAERVVVNLRLD---Q--
A0A1F2Q9L4      Q-QP-MQIDDWFDAQS----FY-----PTQYRLLQS----RGLAERVVKNLRLA---D--
A0A7V5ZKV2      E-NL-FRVDPW--DME----FY-----PTQYRLLQS----RGLAERVVKNLRLA---E--
A0A7Y8LRQ1      E-NL-FRVDPW--DME----FY-----PTQYRLLQS----RGLAERVVKNLRLA---D--
A0A3M1PY35      D-VV-SAPVGFFDTER----FY-----QTQYLLMRD----PAVLERALDNDGLR---E--
A0A3M1VMP2      D-VV-PMVWNEYEIQR----FY-----QTQYLLLRD----PAVLRDALDRYGVR---E--
A0A1F2T595      DPNVLSFQQVFEQSDG-ADDYY-----ETQYRILQG----RGLARRTIDALDLW---R--
A0A2V9AC41      ILKVQDTRADSIDSGDYNNEFY-----KTQYEILRS----PALAERVIREEGLQ---N--
A0A2V2R525      ASGINGKPVVINNSAS-APDYF-----ETQLEILKG----SGLLRRVVKTLDLE---H--
A0A321LPW6      VQAVQGPSAAAVQDDS--DNFYPLVRIKTYMIELKS----RPLLSDVAARLRLD---Q--
A0A2V9R9V4      NGARINSNGLFIQEED-----YLNVTMNTSEVILKS----LPLLEDVVVQLRLD---Q--
A0A321LE75      NRTLVKSGDVVISTDESDDAYYTSLVMKTKIRTLMS----RPLLEDVVIHLGLD---H--
G2LEI9          KELYSSSGRIAFVPYSVDPDYL-----NTQIRKISS----PSLLVEVVKTLKLD---R--
A0A7V9TW03      LGASRGESYYPDNSYM-EPEFF-----NTQVQILTS----PTLLRRVAKNLDLE---H--
A0A3N5XQP8      VLPYQEIYQVAMDPRS-MESDL-----RTQYSILQS----RTMARGVIKRLNLT---N--
A0A2V9KCS3      TPGTNDMYVQTDIL--------------TQIKILQS----DSLMERVVTKLKLD---K--
A0A7W1JC10      GSKDGPIFI--NSGVP-DPSYF-----SSQLQILTS----SSLLQQVVNTLNLE---S--
A0A3M2BZG9      TIAMGGATNWLEEW-W-NLEYY-----PTQYRLLRS----RGMAERVIQNLHLL---Q--
A0A1Q7N5R7      GPERGPIGA------------------NQLLVASAW----TDLLKSYVVLDAVA---R--
A0A352F549      LGASRGESFYPENGYM-EPEYF-----NTQVQILTS----PTLLRRVAKNLDLE---H--
A0A3B9MLP9      LGASRGGSYYVDNTYM-DPEYF-----NTQVQIISS----PTLLRRVAKTLDLE---H--
A0A3D5SQ87      LGASRGGSYYVDNTYM-DPEYF-----NTQVQIISS----PTLLRRVAKTLDLE---H--
A0A7Y2DUG3      AERTIVIDSR-----N-DINYG-----NTQLKLLRN----RELMEDVVKRYGLY---K--
A0A7Y2D8Q4      PQNTQSVNI--NFG-V-DQNYY-----NTQLELLQN----PELMKTVIIELGLH---R--
A0A2V8NW86      VSEGDSSTVLTEIA--------------TQVRLLQS----ESLIKRVLTKL---------
A0A3M2D491      IQSKDTINI--NFG-Y-DMNYY-----NTQEKLLES----PELIKEAVIKLGLY---R--
A0A7W1CBZ8      LQSKDAINI--NFG-D-NLNYY-----NTQLRLLQN----PELMREVVIILNLH---R--
A0A7W1FC90      LQSKDAINI--NFG-D-DVNYY-----NTQLRLLQN----PDLMQKVVVELNLH---R--
A0A7W1ZXG0      LQSKDAINI--NFG-D-DVNYY-----NTQLRLLQN----PDLMQKVVVELNLH---R--
A0A7W1ZIT3      LQSKDAINI--NFG-D-DVNYY-----NTQLRLLQN----PDLMQKVVVELNLH---R--
A0A353C9L6      VTSKDAINI--NFG-Q-DANYY-----QTQLMLLRN----RDLVKQVVIDLGLY---R--
A0A2V8RQV0      VTSKDSINI--NFG-N-DANYY-----NTQLELLKN----PELMKKVVISLGLY---R--
A0A2V8SJH5      VQSKESINI--NFG-N-DANYY-----NTQLELLQS----HDLMKEVVIRLGLY---K--
A0A136JPP4      PTAKDAINI--NFGLD-ETTYY-----NTQLQLLQN----PDLMKKAVVALGLQ---R--
A0A399WUJ8      PT--DAINI--NLGGD-ETTYY-----NTQLQLLQN----PDLMKKVVLALGLQ---R--
A0A7V9C3X9      VTSKDAINIINNFG-N-DLNYY-----NTQLKLLQN----ADLMKDVVIALELY---R--
A0A7V9ZSX9      VQSKDSINIF-NVA-N-DANYA-----STQLQLLQN----PDLMRAVVEGLGLH---R--
A0A3M1SIV3      IQSKDTINI--NFG-Y-DLNYY-----NTQEKLLES----PELMKEVVVKLGLY---R--
A0A7V1SCI4      IQSKDTINI--NFG-Y-DLNYY-----NTQEKLLES----PELMKEVVVKLGLY---R--
A0A7C5ZUA8      MTSKDTINI--NFG-Q-DINYY-----NTQLQLLRS----PELMKDVVISMGLY---R--
A0A7T9FQE4      VTKKDVINI--NFG-N-DQTYY-----NTQLKLLQN----HDLMKRVVVSLGLH---R--
A0A3E0PHB0      ATDSQSVIL--NFG-Y-DQNYY-----NTQLQLMRS----EDVMRDVVVKMKLY---E--
A0A7T9G4W3      ATDSQSVIL--NFG-Y-DQNYY-----NTQLQLMRS----QDLMRDVVVAMKLY---E--
A0A838UAA0      VTQKDAINI--NFG-N-EQNYT-----NTQLQLLQN----PDLIKKVVIALNLH---H--
A0A7W1HTU2      QQTKDAINI--NFG-S-DLNYN-----NTQLQLLQN----PDLMRDVVVRLGLH---R--
A0A357F267      VTSKDSINI--NFG-N-DANYY-----ATQLQLLQN----ADLMRRVVVDLGLY---R--
A0A7V9ICU8      VTSRDSINI--NFG-N-DANYY-----NTQLQLLTN----PDLMRKVVLRTGLY---R--
A0A7T9JEF9      AAGGDTASSVILTSGN-DPAYF-----GTQLQIIEG----RGLLRRVVKAMKLD---E--
A0A399WNU1      AAGEGTASSIILNPGS-DPTYF-----ATQLQIIEG----PGLIRRVVKNLDLE---H--
A0A3E0PCN7      AVGNDTSSSVILNSGS-DPAYF-----ATQLQILEG----PGLLRRVVRTLGLE---K--
A0A7Y4TLV3      AAGGNATGSIILNPGS-DPGYF-----TTQLQILEG----PGLLRRVVKAMDLE---H--
A0A7W0MGQ3      --QSRQGGAVIVSGTS-DPAYF-----NTQLQILTG----PGLLRRVVKTLDLE---H--
A0A1Q7Y6W9      LGTNR-NGVNINYRIS-DPAYF-----NTQLQILNS----PGLLRRVVKTLDLE---H--
A0A2V8NC68      LGSIKGNSIVLNTPYQ-DPTYF-----NTQLQILSS----AGLLSRVVKTLDLE---H--
A0A352FLX4      --MSKNSNVILNSETN-DPAYF-----NTQLQILTG----PGLLRSVAKTLDLE---H--
A0A2V8MHG6      IGALKGNSIFLNNPSQ-DPTYF-----NTQIQILTS----AGLLGRVAKTLDLE---H--
A0A2V8P7N1      IGALKGNPIFLNNSSQ-DPTYF-----NTQIQILTS----AGLLGRVARTLDLE---H--
A0A2V8M3M6      IGALKGNPIFLNNPSQ-DPTYF-----NTQIQILTS----AGLLGRVARTLDLE---H--
A0A1Q7NJH5      IGALKGNPIFLNYPSQ-DPTYF-----NTQIQILTS----AGLLGRVAKTLDLE---H--
A0A2V8PJY0      IGALKGNPIFLNNPSQ-DPTYF-----NTQIQILTS----AGLLGRVAKTLDLE---H--
A0A7W1BYD3      FGGSKDGTVFINSGVP-DPAYF-----SSQLQILTS----SSLLQRVVSTLNLD---S--
A0A838PIP9      FGGSKEGPVFINSGVP-DPAYF-----SSQLQILTS----SSLLQRVVNTLNLE---N--
A0A399WK13      --DLVTTDRARPISNA-DPSYF-----NTQLQLLWS----ESLLRRVVKEHNLD---A--
A0A7V8YZQ7      --DLVTSDRQRPLTNL-DPSYF-----NTQLRLLES----EMLLRRTIKEHNLD---T--
A0A7V9ICV8      --DLITSDRQRPLPNL-DPSYF-----NTQLQLLGS----DTLLRKVIKEHNLD---S--
A0A136KC10      --DLVTNDRARPISNA-DPSYF-----NTQLQLLWS----ESLLRRVVKEHNLD---A--
A0A7W1IVA5      --DLVVTDRRVPMSNQ-DPSYF-----NTQLQLLVS----ESLLRRVVKELSLD---S--
A0A7W1ZIE3      --DLVVTDRRVPMSNQ-DPSYF-----NTQLQLLVS----ESLLRRVVKELSLD---S--
A0A7T9J551      --ELVTSDRARPISNP-DPAYF-----NTQLQLLRS----DGLLRRVIKENNLE---N--
A0A7V9NLN0      --GLVADDKRPQLSNQ-DPSYF-----NTQLLLLNS----ESLLRRVVKELSLD---S--
A0A7T9G8R2      --DLVTPDRRMPLANS-DPAYF-----NTQLQLLTS----EALLRRVIKELSLD---T--
A0A7Y2D047      --DLITSDRRIPGGAS-DPAYF-----NTQLQLLSS----DTLLRNVVKRLSLD---S--
A0A3M2D6Y5      --QLQVTDRPALLSNP-DPAYF-----NTQLQLLTS----DSLLRRVIKEMNLD---T--
A0A2V8SEX6      --DLVTSDRQRPISNP-DPSYF-----NTQLQLLDS----ENLLRQVVKEHSLD---T--
A0A7C5ZUU4      --DLVTSDRQRPVSNP-DPSYF-----NTQLQLLGS----DALLRRVIKEHNLD---T--
A0A3E0PCJ6      --DLVTPDRRMPVMTS-DPAYF-----NTQLQLLNS----EVLLRRVVKELNLD---T--
A0A2V8RTL7      --DLITNDRQRVLSNP-DPSYF-----NTQLQLLNS----DTLLRRVVKEHNLD---A--
A0A3M1S4R8      --QLQVSDRPTLLPNP-DPAYF-----NTQLQLLTS----DSLLRRVVKEMNLE---T--
A0A7V1SAJ0      --QLQVSDRPTLLPNP-DPAYF-----NTQLQLLTS----DSLLRRVVKEMNLE---T--
A0A7W0N726      --GLVSDDKRPQLSNQ-DPSYF-----NTQLLLLGS----DSLLRRVVKELSLD---S--
A0A7W1HTZ7      --DLITSDRRSSVSSQ-DLSYF-----NTQLQLLNS----ESLLRRVVKELSLD---S--
A0A1Q7YFI6      ---MKNTSYILEQQYQ-DPTYF-----NTQIQILSS----PGLLSRVVKTLDLE---H--
A0A7V9C9Y7      ---LGAASAVIVGGSS-DPAYF-----NTQLQILTG----PGLLRRVVKTLNLE---N--
A0A7W1G8A4      --ANASS-VVINNPTN-DPTYF-----NTQLQILTS----PGLLRRVVKTLDLE---H--
A0A7V9KMZ1      --LVGR--PYVIGPAN-DPTYF-----NTQLQILTS----PGLLRRVVKTLDLE---H--
A0A7W0JTE4      --EIGRT-PYLIGPTN-DPVYF-----NTQLQILTS----PGLLRRVVKTLDLE---H--
A0A0B6WWQ6      LSLSPTGGPVVINRSS-DPTYF-----STQLQILTG----SQLLRRVVRTLDLE---H--
A0A3B9MK99      --LVGKT-PYYFGPTN-DPVYF-----NTQLQILGS----PGLMRRVVKTLDLE---H--
A0A838PA20      --LVGRT-PYVIGPAN-DPTYF-----NTQLQILTS----PGLLRRVVKTLDLE---H--
A0A352EX26      --LVGKT-PYYMGSMN-DPVYF-----NTQLQILGS----QALARRVVKTLDLE---H--
A0A7V9R410      --LVGKT-PYYMPSFN-DPVYF-----NTQLQILGS----QALARRVVKTLDLE---H--
A0A2V8MM59      --YEGKTTQLIYSPVN-DPAYF-----NTQLQILTS----QGLLRRVVKTLDLE---H--
A0A2V8PFE8      --YAGKSVPMIYSPVN-DPAYF-----NTQLQILTS----PGLLRRVVKTLDLE---H--
A0A2V8PWS6      --YAGKSVPMIYSPVN-DPAYF-----NTQLQILTS----PGLLRRVVKTLELE---H--
A0A2V8LCT5      --YAGKTAPMIVSPVN-DPAYF-----NTQLQILTS----QGLLRRVVKTLDLE---H--
A0A352FTJ9      --YAEKAAPMIVNPIN-DPAYF-----NTQLQILTS----PGLLRRVVKTLDLE---H--
A0A1F2S1W5      VLEQN-----EVTDDY-----Y-----ETQYRLLQG----RGLARRTIDALNLW---S--
A0A2N9LQU7      LVSQKLAD--SDSEGGR----L-----QTELTILQC----PPVSMQVIKNLDLG---H--
A0A2P6WFK7      MISQKLGG--SDDINSV----L-----QTEVKVIQS----DTVAMRVIDSLELA---K--
A0A2V8JQV5      VNPSAPSVISTAFEE------I-----QTQIKILKS----DSLIGQAMKRFGLT---H--
A0A2V8U914      IDPAATPNA-SSNDVY-----V-----KTQSEILQQ----DALIEQASDKLNLA---E--
A0A2V8DRT9      VI--------EQDKATNDY--Y-----QTQYRILQS----RSLARRTLDRMGAW------
A0A2V7VYF3      VF--------DQGHSPYDYEFT-----ETQQKLLTS----RSLARKTLDALRMW---Q--
A0A1F2SVH2      AY--------EQNQVTDDY--Y-----QTQYKILQS----RALARRTLDALKLW---D--
A0A2V8AJG9      AF--------EQNQIADDY--Y-----QTQYKILQS----RALARRTIDGLKLW---E--
A0A2V9MAM9      VNPTATAPT-HSEDSY-----I-----ETQAEILRQ----DSLIGRAFNRLPAE---R--
A0A2V8F956      VLDED-----QTRADY-----Y-----QTQYNLLQS----RALALRTIDQLKLW---E--
A0A2V7W309      IA--------SSDQEF-----L-----QTQYELLKS----RGLAMRVIEDHKLL---N--
A0A348V070      LSRLSGGI------------NS-----QSHAMLLKS----RSLAADVIEKMKLH---S--
A0A2Z5G3A3      MMQGGA----ADEDALDENITL-----QTQTNILQS----DSLALRVIEDLHLD---K--
A0A2V7UGP8      VQPVGYDY--MSYNDF-----Y-----QTQYRLLAS----HNVARKAMLKLDLR---N--
A0A239MKT6      LSDSLSGG--MELNTD-----M-----LTHQRILQN----DNTALSVISSLNLM---Q--
A0A2Z5G7H4      MMGG--AE--DASDALDANITL-----QTQADLLES----DTLALQVIEALELE---T--
A0A372IT17      GVLGDTSH--EASDALENSMSI-----ETQAGILES----DTLALHVIRALDLE---S--
A0A841JU67      SVTGDTPT--AAADSLDYSMTL-----ETEAKILES----PTLALQTIKDLKLE---N--
A0A7T9GJJ6      LVLQ------ADDSGR-----I-----RTELLLLKT----YPLLEDVVVRLQLD---K--
A0A7Y4UER8      FTVQ------ADDQDS-----M-----QTMIVELTS----RPLLESVVESLKLD---Q--
A0A2V8IYW3      IRSTVTNR-------------I-----EDRLRSIRE----QVLSRSMLEPIILE-FDL--
A0A7V2HCZ0      VN------ASDNSDAW-----V-----QTQVKILQS----VSLRRRVLQKLREN---G--
A0A2V9AEW6      ID---SNGNYVSQESY-----V-----ETQVKLLQS----ESLIEHVIDKMKLH---K--
A0A2V8WQK6      AN--DSNGSYASPESY-----V-----ETQVKILQS----ESVIEHVIDKLKLQ---K--
A0A2V8XIF4      GDPSGSTASIASPESY-----V-----ETQVRRLQS----ESLLERVIDKLKLR---K--
A0A350UQT3      QANVPSAL---DAESF-----L-----ASQIRLLQS----DSVVRPVAQRFRLLESEQ--
A0A7C3HRX0      QAASISTP---ESEQF-----L-----ASQIRLIQS----DSVVRPVAERFNLLEREK--
A0A2W0BGU4      LNDRYQQL--QTDQDF-----L-----RTQIQVLQS----DNLAWRTIEELRLA---D--
A0A2W0BVQ9      LNDRYQQL--QTDQDF-----L-----RTQVQVLQS----DNLAWRTIEQLGLA---D--
A0A317J121      VSGNDEVS----------QVNI-----QTQIQLLRS----SSFLRRVMERLQLETVPP--
A0A2V9MN96      LENG------GMSEDWDYNVSL-----ETQLSILRS----DALALKVVEALHLD---S--
A0A2V7V2Z1      VAQVD-----AARDDY-----Y-----QTQYKLLQS----RALVRRVIESMSLL---Q--
A0A2V7X2F7      VTEVD-----AAKDDY-----Y-----QTQYRLLQS----RSLARRVVESLNLL---Q--
A0A2V7V2I1      VARVD-----SERDDY-----Y-----QTQYKLLQS----RALVRKVIEEMDLF---Q--
A0A2V7U3M2      VAQVD-----AARDDY-----Y-----QTQYKLLQS----RLLARRVIETMNLL---Q--
A0A2V7UHT0      VAQVD-----AARDDY-----Y-----QTQYKLLQS----RALARRVIESMNLL---Q--
A0A3P0X3W6      ATPNIS-----DVEEF-----L-----TTEIDLLQS----DAVLRPVAKAYHLLPRDK--
A0A7V2MG68      MPATTN-----DADQF-----L-----ATQIKLIQS----DSVLRPVAEKYRLREAEN--
A0A7C6A629      AQSAIN-----DADQF-----L-----ATQVKLIQS----DSVLRPVVERFKLPVEDV--
A0A7V2HBQ5      ARNSPN-----DADQF-----L-----ATQIRLIQS----DSVLRPVADKYKLLEHEG--
A0A2U3JZ71      TRTVAN-----DSDQF-----L-----ATQAKLIQS----DSVLRPVAQQYRLLDTEA--
A0A2V8TTB0      LQNATN-----DADQF-----L-----ATQMKLIQS----DSVLRPVVDKFRLREVEK--
A0A2N9MK30      TQTGLN-----DADQF-----L-----ATQIKLIQS----DAVLRPVADQYHLRDLER--
A0A3D1ASD2      GRAPVN-----DADEY-----L-----ATQINLIKA----DSVVRPVVQKLRLREVDG--
A0A7R8B699      ARAASPN----DADQF-----L-----ATQVKLLQS----DAVLRPIAAKYKLLEHEE--
A0A7S7SGU3      QSQAYSTL---DAESF-----L-----ASQIRLIQS----DSVVRPVAQRYSLLEREK--
A0A7Y8HY45      QAAVTSPA---ESEQF-----L-----ASQVRLIQS----DSVVRPVAEQYNLLEREK--
A0A7C5AXI3      LRTVSN-----DADQF-----L-----ATQVKLIQS----DSVLRPVVEKFGLRDRPG--
A0A7C6E4H7      AQSAIN-----DADQF-----L-----ATQVKLIQS----DSVLRPVVERYKLRVEDV--
A0A2Z5FVL3      NAASPAG---GDTDPNSASMNL-----ETQATVLES----PALAMKVIEDLHLE---D--
A0A2V8GFD4      VVDQN-----KTTLDY-----Y-----QTQYRILQS----RAIARRSIADPFLA---T--
A0A2V8HSS5      VVDQN-----KTTLDY-----Y-----QTQYRILQS----RAIARRSIADPFLA---T--
A0A2V8KP55      YY--------QADSDTYVDYML-----QSYFRILKS----RSLARRVVTELHEE---L--
A0A2V9JSI3      FYRGT-----PSDEAF-----L-----RTQVKVLES----DSLAWQTIQQLGID---Q--
A0A2V9WI32      SDQGTIGADYEDYNIA-----L-----ETQIRILQS----DALAFQVIKNLKLD---N--
A0A2V9KBD6      VDTSLLED--PEDRAA-----I-----DTQISILQT----DALALKVIQDLRLD---Q--
A0A2W0AJ66      PGSSLPED--ADERAA-----I-----NTQIGILES----DGLASQVIHDLHLE------
A0A1Q7RBU1      VHPSLLED--PEDRAA-----I-----DTQIGILQT----DALAMQVINDLHLD---K--
A0A2V9JPV9      VDTSLLED--PEDRAA-----I-----DTQIGILET----DTLAMQVINDLHLD---T--
A0A7V0Y3A1      AS-------------------L-----GTQMDVLKS----KTLREAVYEKLVNKPAPK--
A0A7C5Z4J3      VDNLFRTV--STDPTF-----L-----QTQVDVLKS----GNLAWQTIQQLKLD---L--
A0A1F2TPT3      V---------IDQRRP-----L-----DTELAILRS----RWLAAKTVASLGLI---Q--
A0A2V8JTQ2      ADTSLLDD--PEDRTA-----I-----DTQIRILQT----DALAMQVIKNLQLD---K--
A0A2V8UZY0      VDTSLLED--PEDRAA-----I-----DTQIGILQT----DALAMQVIKDLHLN---K--
A0A350UEK1      LQEVTEGSGPAGNMVD-----L-----QTQIKILQS----DTLVDRVTAQLSNG---T--
A0A350UIQ4      LQEVTEGAGPSGSTID-----I-----QTQIKILQS----DTLLERVHSLMNPGEEVA--
A0A7T9GJN6      VVIESDDI----DYGYGTQVAI-----KSNIRLLNS----RPLLEDVVVAQKLD---L--
A0A7T9GJN7      QVIQIDDS----D-------NI-----NTKRIIFMS----RPMLEDIVILLKLD---Q--
A0A1H5Z7N3      ATGGS-GI--ESSSAH-----L-----PTQVSILKS----DTLLLTVARDLDLA---N--
A0A1G7JVV8      TGNLTGSL--QSED-------L-----ETEVLIISS----ESLMLSVAQEMNLA---N--
A0A1H4T6W9      --QMMGSS--LSQETN-----L-----ENELGIIMS----DSLLLNVARNMNLV---N--
I3ZEU5          --QLMGSV--GSQETN-----L-----ENELGIITS----DSLLLNVARNMNLI---N--
A0A7W7ZGZ3      AQAL--QG--DSTSNK-----M-----AAEVVILQS----DSLMMTVAREMNLC---N--
A0A7G8BSK5      VPG---MN--TDSSQR-----M-----LTEVAILQS----DSLMLTVAREMDLA---N--
A0A428MDU2      VQGY--AS--DTAASK-----M-----LTEVAILQS----DSLMLTVAREMDLS---N--
E8WVF6          FSG---LG--DDPQQK-----M-----MSEIAIITS----DTLLTTVAKEMNLA---N--
A0A1I6MH75      VPG---MG--QDTQTK-----M-----NTEIAIMQS----DTLLLTVARELNLP---N--
A0A7Y9TM87      VSSL--LG--TDSSTR-----L-----QTEVNILKS----DTLLLTVAREMNLP---N--
A0A7W8J1H5      -QS---YG--GDSSSK-----L-----LSEIEILKS----DSLMLTVCRELDLA---N--
A0A7Y9T5K4      VQE---YS--GDSSSK-----L-----LSEIEIIKS----DSLMLTVCREMDLA---N--
A0A852VHP9      ATT---YG--GDPGTK-----L-----LSEIEIIKS----DSLMLSVCREMDLA---N--
A0A7W8IFZ2      VQA---YG--GDASTK-----L-----LSEIEIIKS----DSLMLTVCREMDLA---N--
A0A7W8J9Y9      VAA---YG--GDASTK-----L-----LSEIEIIKS----DSLMLNVCREMDLA---N--
A0A7L5A6M5      ATAAMGGD--EDSQTK-----L-----QSEVSILQS----DSLMASLARELNLV---N--
A0A5B9EBI2      ---V--GA--PDTSNH-----L-----TTQSSILTS----ETLLLTVARELNLN---N--
A0A7Y5RFT3      ---V--GA--TDTSSH-----L-----NTQSSILTS----ETLLLTVARELNLN---N--
A0A239HDF6      PVGL---G--QDTMTQ-----M-----MTETAILQS----DTLLLTVAKDLDLC---N--
A0A4Q0T270      STGI------SDPQTK-----M-----MTEIAILQS----DTLMLTVAREMNLA---N--
A0A1Q3QQB6      VQAL--GG--TDTASK-----M-----LTEIAILRS----DSLMLTVARDMNLA---N--
A0A3N1K1G7      VQGY--AG--DAQSSR-----M-----LTEIAILQS----DSLMLTVARELNLS---N--
A0A4V2G466      VPGM---A--SDSGQR-----M-----LTEVAILQS----DSLMLSVAREMDLA---N--
A0A6B9YNQ8      VSGA---S--TDSSQR-----L-----LTEVAILQS----DSLMLTVAREMDLA---N--
A0A3N6A5T6      VY-QAADQ-GIAMETY-----L-----QTQFKILQG----RTLAERIVKQLQLH---E--
A0A2V8R8U7      V---IINA--PADANF-----W-----GTQLKLLQN----PQLARQVVLSLELQ---K--
A0A7V9Q528      V---VING--PTDPAY-----W-----STQLKLLEN----PELARQVILALDLQ---N--
A0A2V8QMP4      AG-NLIIR--GSDPNY-----W-----NTQLQKLKT----QKLARQVILRLDLQ---N--
A0A2V8R4S3      AG-NLIIR--GSDPNY-----W-----NTQLQKLKT----QKLARQVILRLDLQ---N--
A0A2V8NJ55      L---ILNT--GTDPYY-----W-----NTQLKLLEN----PELARQVAITLDLQ---N--
A0A7V9ZQ50      L---ILNT--GNDQAY-----W-----NTQLKLLEN----PQLTRQVVLALDLQ---N--
A0A2V8Q7I0      F---VLNS--QPDANF-----W-----GTQITLLQS----PALARQVALTLDLQ---H--
A0A2V8S6K4      I---VVNA--GADPAY-----W-----GTQLKLLEN----PSLLRQVIMRLGLQ---N--
A0A317I2L9      L---VIGG--QLDPNF-----W-----GTQLKLLES----PALARQVALTLDLQ---H--
A0A2V8LLF9      L---IISG--QPDPNF-----W-----GTQLRLLQN----PLLARQVIVSLDLQ---H--
A0A352FRF4      GG--GIVI-GQSDPNF-----W-----GTQLNLLHN----EALARQVIVRLDLP---H--
A0A7W1GE99      L---IINA--PSDPAY-----W-----STQLKLIEN----PELARQVILTLDLQ---N--
A0A1Q7YKQ8      NV--VINTGGGDDAQY-----W-----NTQIKLLES----QQLARQVALTLDLQ---N--
A0A0B6WXT1      VQ--VVSV--PNDPNY-----W-----STQIKLLQN----PQLARQVALTLDLP---N--
A0A2V8MKV0      I---VI-T--QRDPNF-----W-----GTQIKMLQN----PSLARQVILTLDLP---H--
A0A2V8PYY8      L---VI-V--QRDPNF-----W-----GTQIKMLQN----AQLARQVILTLDLQ---H--
A0A3B9MEU8      I---VINA--QSDPSF-----W-----GTQLKLLEN----PALARQVVLTLDLQ---H--
A0A352F3R7      I---VITG--QNDPNF-----W-----GTQLKLLEN----PALARQVVLTLDLQ---H--
A0A7W0GRF6      I---VINA--QSDPNF-----W-----GTQLKLLEN----PALARQVVLTLDLQ---N--
A0A7W1H6G6      I---VINA--QSDPNF-----W-----GTQLKLLEN----PALARQVVLTLDLQ---N--
A0A7V9HZC8      I---VINA--QSDPAF-----W-----GTQLKLLEN----PALARQVVLTLDLQ---N--
A0A7W0XCB9      I---VINA--QSDPAF-----W-----GTQLKLLEN----PALARQVVLTLDLQ---N--
A0A3N5YNR8      LNESAERY--LSSEIY-----L-----QTQLEILQS----RALARRVVDRLNLA---N--
A0A7W7ZUJ7      NN-SSSAA--LEDPQA----GI-----NTQVKILQS----DTMSELVIHRMNLD---T--
A0A2V2R0I6      PE-AYDFY--SDSESY-----I-----ETQSKILTS----ETLALQTIRNSGLS---A--
A0A2V8XAR9      AD-SYDYM--MDLENY-----I-----ETQSKILTS----ETLALQTIRNTGLS---A--
A0A2V8VZA0      TD-SYDYM--MDLENY-----I-----ETQSKILTS----ETLALQTIRNNALS---T--
A0A1Q7CB82      TD-SYDYM--MDLENY-----I-----ETQSKILTS----ETLALQTIRNNALS---T--
A0A2V8WIU1      TD-SYDYM--MDLENY-----I-----ETQSKILTS----ETLALQTIRNNALS---T--
A0A1Q6Y9F5      AE-SYEYM--MDLENY-----I-----ETQSKILTS----ETLALLTIRNNALS---T--
A0A2V9EVV8      AE-SYEYM--MDLENY-----I-----ETQSKILTS----ETLALLTIRNNALS---T--
A0A2V8YF91      AD-PYDYT--VDFDNY-----I-----ETQAKILTS----ETLALQTIRNGGLS---D--
A0A2V8XZK2      AD-SYDYM--VDSENY-----I-----ETQAKILTS----ETLVLQTIRDSGLT---A--
A0A2V8ZTX6      GE-SFDYM--VDSENY-----I-----ETQAKILTS----ETLALQTIRNNGLA---L--
A0A2V9BT79      AD-SYDYM--MDSDNY-----I-----ETQSKILTS----ETLALQTIRNNGLA---L--
A0A2V9YHT3      SV-P------IDADDWDYTVAM-----ETQVRIMQS----DSLALKVAHDLG--------
A0A7C2XNI7      SM-YYEMY--WDVENY-----I-----ETQAKILQS----ETLALQTIESLQLY---K--
A0A1Q8B793      AD-PYAYL--LDQENY-----I-----ETQSKILTS----ETLALQTIRSVGLA---G--
A0A2V9BCA0      AD-PYAYL--LDQENY-----I-----ETQSKILTS----ETLALQTIRSVGLA---G--
A0A2V9BWU9      SD-SYEMY--MDMENY-----I-----ETQSKILQS----ETLALQTIQSAGLV---E--
A0A2V9DKX2      SD-SYEMY--MDMENY-----I-----ETQSKILQS----ETLALQTIQSAGLV---E--
A0A7C2YQY3      LFVRLPTD--EEF--------L-----QTQVRILQS----DDLAMQTIRALRLY---D--
A0A845TWB8      LFMQMPTS--DDF--------L-----QTQVRILES----NDLAMQTVRALRLY---E--
A0A2U3KC61      ---DVENN--LP--DFDYQATL-----ETQAAILRS----DVLALKVIKAMHLD---P--
A0A2V9Y2R7      ---DGDGG--SPGEDWDYNVTL-----ETQTAILRS----DALALKVIETMHLD---K--
A0A2V9NGH6      ---DSANA--GP--DYYDPSDL-----DTEVGILKS----DLLAFQVIKQLNLD---K--
A0A2V9PYE6      ---DSPSV--GP--DYYDPSDL-----DTEVGILKS----DLLTFQVIKQLNLD---K--
A0A2V9NL07      ---DPGNS--GM--DYYDPTDL-----DTEVRILHS----DLLALQVIKQLNLD---Q--
A0A2V9QD92      ---DPGNS--GM--DYYDPTDL-----DTEVRILHS----DLLALQVIKQLNLD---Q--
A0A2V9WPZ6      ---DSGSM--SI--DYYDPADL-----DTEVKILQS----DLLALQVIKQLNLD---K--
A0A2V9ZLH4      ---DSASA--S---DYYDPADL-----DTEVKILKS----DLLALQVIKQLNLD---R--
A0A2V9RQF1      ---DSANA--PI--EYYDPADL-----DTEVRILKS----DLLALQVIRQLNLD---K--
A0A2V9YDK8      ---DSGSV--SV--DYFDPADL-----DTEVKILQS----DLLALQVIKQLNLD---K--
A0A2V9V8F7      ---DSGSM--SI--DYYDPADL-----DTEVKILQS----DLLALQVIKQLNLD---K--
A0A2V9XGR9      ---DSGSM--SI--DYYDPADL-----DTEVKILQS----DLLALQVIKQLNLD---K--
A0A2V9V3Q5      ---DSMPV---M--DYYDPTDL-----DTETRILQS----DILALQVIRQLNLD---K--
A0A2V9NWS3      ---DSPSA--AV--DYSDPTEL-----DTEVRILKS----DLLALQVIRQLDLD---K--
A0A2V9USA9      ---NSATF--SL--DYYDPTEL-----DTEVKILQS----DLLALQVIKELNLD---H--
A0A2V9XW18      ---NSATF--SL--DYFDPTEL-----DTEVKILQS----DLLAMQVIRELNLD---R--
A0A1H5SQF5      LSGAGQQL--IGGDQL--SVDL-----LTQQAVIGN----ENIAMKVLEDLGLT---N--
A0A2V8G155      VIDEDQTK--AE---Y-----Y-----QTQYNIIQS----RAIARRALDELKLW---N--
A0A2V8HDM7      VIDEDQTK--AE---Y-----Y-----QTQYNIIQS----RAIGRRALDELKLW---N--
A0A2V8IVN9      VINEEQTK--AD---Y-----Y-----QTQYNILQS----RSLARRTLETLKLW---E--
A0A7W1SCW7      VIDEQGAK--AD---Y-----Y-----HTQYNILQS----RSLARKTLDLLDLW---E--
A0A3E0NV31      LSARGGDQ--SN---------I-----ETQITLLRS----GNLLAKVVERLELT---T--
A0A3N5M5V0      VYEGPERY--LSSEVY-----L-----QTQLEILQS----RALARRVVDRLNLA---N--
A0A7X7XDY5      FV-NEAAP--WQQAEY-----I-----QTQCAILQS----KSLASRVVQALHLD---Q--
A0A2V9L5B5      VS-QEAPT--VDVDSY-----R-----ETQYKILRS----RTLAEKVVNDLHLY---Q--
A0A2V9LK56      IL-QVASA---DVESY-----R-----ETQYRVLES----RSLAESVVKDLELY---R--
A0A2V9L7I0      VT-QAAPT--VDVDSY-----R-----ETQYKVLQS----RTLAEKVVNDLRLY---L--
A0A522PPT0      IA-QAGPS--WDLQSY-----R-----ETQYQILKS----RSLAERVVRDLRLY---R--
A0A7C5V1G5      IA-QAGAS--WDIQSY-----R-----ETQYRILRS----RSLAERVVRDLRLY---Q--
A0A4R1LC91      SG-NGGAG--GDA--LDANITM-----ETEANILQS----DTLALKVIKELHLE---S--
A0A2V9QB26      ---QVTPV--SEGNSSTALTEI-----ATQVRLLQS----ESLIKRVLTKLK-D---R--
A0A2V9VYY4      ---DAENI--APD--YEYEATL-----ETQVAILRS----DALALKVIEGMRLY---Q--
A0A2V9KIE8      VLQISNQD--VDS--Y-----R-----ETQFRVLES----RTLAERVVRDLALY---R--
A0A7C2GJ20      ET-AADLS--SNDAQY-----L-----ETQQNVLRS----RELARRVIEALHLE---R--
A0A7C4BTL5      ---QTTPV--YESGIYATLADI-----QTQIKILQS----STLLERVVEKLKLK---A--
A0A7X8YVF2      ILGGGGSN--YDE--Y-----V-----ETQIKHITS----RTLAARVVETLGLD---R--
A0A7X7YEP0      IF-SWEDW--ADAQSF-----Y-----PTQFRLLQS----RGLAERVVRNLRLW---E--
A0A2V9CBM2      LY-QLETV--SDD--Y-----L-----RTQYDILAS----DSLARRVIDQLRLD---T--
A0A2V8XN17      MY-ELDAV--SDA--Y-----L-----RTQYSILAS----ESLARQVIDQLQLE---A--
A0A2V8WX45      LY-ELEAV--SDA--Y-----L-----RTQYNILAS----ESLSRRVIEQLRLD---T--
A0A1Q6YR79      MY-ELDAV--SDA--Y-----L-----RTQYSILAS----ESLARRVIDQLQLE---T--
A0A1Q7VA32      MY-ELDAV--SDA--Y-----L-----RTQYSILAS----ESLARRVIDQLQLE---T--
A0A2V9EY85      LY-ELDAV--SDA--Y-----L-----RTQYSILAS----ESLARRVIDQLQLE---T--
A0A2V9H8K0      LY-ELDAV--SDA--Y-----L-----RTQYSILAS----DSLARHAIGQLGLE---T--
A0A2V9FFE5      LY-ELDAV--SDA--Y-----L-----RTQYSILAS----ESLARRAIDQLRLE---T--
A0A2V9GM43      LY-ELDAV--SDA--Y-----L-----RTQYSILAS----ESLARRAIDQLHLE---T--
A0A2V8ZHL8      LY-RQVPT--DEA--F-----I-----GTQIQVLES----DNLAQRTIEQLGLA---R--
A0A2V9B240      LY-RQVPT--DDA--F-----I-----GTQIQVLES----DNLAQRTIEQLGLA---R--
A0A2V9CYQ5      LY-QLETV--SDD--Y-----L-----RTQYDILAS----DSLARRVIDQLRLD---T--
A0A2V9BWU8      LY-ELESV--SDS--Y-----L-----KTQYTILAS----DSIARRVIDQLHLD---S--
A0A2V8ZG48      LY-ELESV--SDS--Y-----L-----KTQYSILAS----ESVARQVIDQLHLD---T--
A0A2V8Y334      LY-ELESV--SDS--Y-----L-----KTQYSILAS----ESVVRRVIDQLHID---A--
A0A2V9AY68      LY-ELESV--SDS--Y-----L-----KTQYSILAS----ESVARRVIDQLHLD---S--
A0A1F2RFI7      FVADIDPF--DES--Y-----L-----ETAYKVLQS----RTLARRVIDKLQLD---K--
A0A1F2RZS3      FVAEMNPY--DDS--Y-----L-----ETAYKVLQS----RSLAYRVINKLNLA---H--
A0A845TW47      MF-ELDTV--SDT--Y-----L-----ETQYKIFKS----DTLARRVISQLHLD---T--
A0A845TXC1      LF-ELESV--SDT--Y-----L-----ETQFRILAS----ESLARRVIEQLQLE---K--
A0A1F2USE2      LF-ELDAV--SDT--Y-----L-----ETQYKILGS----ESLARRVINQLRLD---Q--
A0A7C2VB08      LF-ELETV--SDA--Y-----L-----ETQYKVLRS----DALARRVIQQLRLD---R--
A0A2V9C238      LF-ALDTV--SDT--Y-----L-----ETQFKILQS----DTLARRVIEGLRLD---K--
A0A1F2Q9F5      LF-QIESA--SDT--Y-----L-----ETQYRILES----ESLARRVVDQLRLD---Q--
A0A1F2QQH9      LF-QIESA--SDT--Y-----L-----ETQYRILES----ESLARRVVDQLRLD---Q--
A0A1F2QXK7      LF-QIESA--SDT--Y-----L-----ETQYRILES----ESLARRVVDQLRLD---Q--
A0A2V9DEM9      LF-ALDTV--SDT--Y-----L-----ETQFKILQS----DTLARRVIEGLRLD---M--
                                                                            

A0A2V7VMF7      -----R-----PPFKDNP------------------------------------------
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      -----P-----PE--------------AIQA-----------------------------
Q01X01          -----R-----PEYQRSSSLWDRLRPGTSQA-----------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V9IXG5      -----N-----PRFQNQSSDG---------------------------------------
A0A2V9J2P4      -----N-----PRFQNQSSDG---------------------------------------
A0A831T3F4      -----N-----PKFL--DIAE-------------------------------KKSLWEAL
A0A2V8JK38      -----E-----KEFAAPQRGF-------------------------------LAAQAGNL
A0A7W0JWI4      -----N-----QAFLNPQAGR-------------------------------DRSAWQSL
A0A1Q7RLS4      -----H-----PLFKKSVD-----------------------------------------
A0A257VBK0      -----H-----EAFKDVK----------------------------------D-------
A0A7C5TWV7      -----N-----PAFGKD-------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2G6PYV5      -------------FREQE----------------------------------QEDAQPKN
A0A1F2TCR2      -----N-----PAFNGQA----------------------------------PPRRGPLI
A0A7Y9PHF8      ------------------------------------------------------------
A0A7W8J3G9      -----F-----RRFAGGP----------------------------------R-------
A0A1F2V330      -----M------------------------------------------------------
A0A662EE63      -----L-----PEFEGRK----------------------------------P-------
A0A2V8TLH7      -----H-----PMFRKSS----------------------------------D-------
A0A1Q7ZJT1      -----H-----PLFKKSV----------------------------------D-------
A0A2V8VC99      -----H-----PLFKETT----------------------------------D-------
Q01XL7          IASTPT-----TFFTKLR----------------------------------AHI-----
A0A523DUV7      -----K-----PPFRDAK----------------------------------E-------
A0A7W1TTH3      -----H-----PEFMTGA----------------------------------EEPTGLRA
A0A1F2U158      -----V-----AEF-NGT----------------------------------AKP-----
A0A2V8F6S9      -----R-----AEF-NGT----------------------------------ERP-----
A0A7V0UHS9      ------------------------------------------------------------
A0A7D8BEX2      -----K-----PEFF---------------------------------------------
A0A4Q1SCH5      -----F-----QNYAGFS----------------------------------RSQMVF--
A0A7V4SJP8      -----H-----PGFREME----------------------------------NPSE----
A0A372IRG7      -----R-----KPFSD--------------------------------------------
A0A2V8K4L4      -----K-----TGYGTST----------------------------------DRLA----
A0A2V8NCZ3      -----K-----TPYGTSS----------------------------------DRLA----
A0A4Q7YNP3      -----H-----SATTPRL----------------------------------DLASRL--
E8UZE1          -----N-----PVFSGIT------------------------------------------
A0A2V7YW66      -----D-----PAFNPGA----------------------------------AAR-----
A0A2V7Z0V0      -----D-----PAFNPGA----------------------------------A-------
A0A2V9M454      -----------LPNSGQ-------------------------------------------
A0A2V9J4D6      -----D-----PSFTKGP------------------------------------------
A0A2V9L9C5      -----D-----PSFTKGP------------------------------------------
A0A2N9M9N1      TELGVG-----GDLWPVS------------------------------------------
A0A2V9JEC4      -----R-----PEFNPRR------------------------------------------
A0A2V9LPQ3      -----N-----GAFIPQT------------------------------------------
A0A7Y8IYX6      -----K------------------------------------------------------
A0A2V9IVR7      -----N-----PAFAP--------------------------------------------
A0A2V9ILE2      -----N-----PAFAP--------------------------------------------
A0A2V9LGY4      -----N-----PAFAP--------------------------------------------
A0A7T9JJ28      -----D------------------------------------------------------
A0A7T9GE94      -----N-----PEFIPGM------------------------------------------
A0A7Y4X7L5      -----N-----RAFMADN------------------------------------------
G8P0Y7          -----R-----ADFAGRA----------------------------------QTQSN---
A0A2W4RYA1      -----H-----PLLVPER----------------------------------GALAVVR-
A0A2V8EXP2      -----H-----PQFNPKG----------------------------------EAAFSLG-
A0A843SYC7      -----T-----MPFGGKT----------------------------------DDGFSVTR
A0A7V9BJ09      -----VP-FGSGPEPKAR----------------------------------ISPTGMMW
A0A7W1DT80      -----APRLGNGPEPKSR----------------------------------ISPTGLVW
A0A5M8T4U7      -----RLRAGEHATPG--------------------------------------------
A0A7L5A491      -----N------------------------------------------------------
A0A7D8BF18      -----D-----PRF----------------------------------------------
A0A1E3Y9R6      -----A-----ERVPAAS----------------------------------TWSFSPSA
A0A2W4TLP2      -----P-----ERVPPAS----------------------------------SLSFSLSS
A0A7G8BDY8      -----E-----PTFAGRR----------------------------------KYILFGPY
A0A7C4BZ42      -----G-----APYAYPV----------------------------------GRFE----
A0A3R9WF43      -----K-----RPFLGAI------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      -----A-----RKSHSIV----------------------------------RRMLRLSN
A0A523E0N1      -----H-----PLFAPDP----------------------------------DAHL----
A0A1V6HR88      -----D-----PAFNPAR----------------------------------ASL-----
A0A4Q1SDL1      -----N-----RDFQPHF----------------------------------NPIGWVMG
A0A841JWG5      -----S-----RDFQPHF----------------------------------NPIGAVLG
A0A4R1LAZ7      -----K-----KPFSKIF----------------------------------K-------
A0A7G8BMP1      -----R-----KPFSEVF----------------------------------R-------
A0A7X7ZKA6      -----N-----PEFVGK-------------------------------------------
A0A523ECP2      -----H-----PHFGGDK----------------------------------THT-----
A0A2W0C122      -----N-----AEFMRD-------------------------------------------
A0A2W0AUU7      -----N-----AEFMRD-------------------------------------------
A0A2W0BQL1      -----N-----AEFMRD-------------------------------------------
A0A2V8ERZ5      -----V-----PEFNGTK----------------------------------PAPPTAST
A0A7W8J413      -----T-----RPFNKAI------------------------------------------
A0A7W8JCF5      -----I-----RPFNKDI------------------------------------------
A0A7W8IEB1      -----T-----RPFSGDI------------------------------------------
A0A7Y9T3I1      -----I-----RPFDKAI------------------------------------------
A0A3P0XH15      -----K-----QPFAQVF----------------------------------V-------
A0A3E0P0A3      -----H-----RYFGGAV----------------------------------DRSSYVRP
A0A3M1WQW8      -----Q-----PEFAGLA----------------------------------RIR-----
A0A841JVA9      -----H------------------------------------------------------
A0A3N1JHC1      -----------PRVPPSL----------------------------------A-------
A0A7V4XQR5      -----K-----PPFSSVF----------------------------------K-------
C1F294          -----K-----PPYSGVF----------------------------------K-------
A0A2V9KA79      -----V------------------------------------------------------
A0A348UZU3      -----K-----KEFSGGK------------------------------------------
A0A7X9FXC4      -----T-----SEFSGRQ------------------------------------------
A0A7X7ZKL5      -----R-----PEFRAAA----------------------------------APRRSLAG
A0A522PSP1      -----P------------------------------------------------------
A0A7W8E8D3      -----F-----RQYAGPN----------------------------------A-------
G8P085          -----F-----REYAGPN----------------------------------A-------
A0A843SRW6      -----HPDLAVADEGGGG----------------------------------PVSFRRLA
A0A7W8E330      -----T-----PDFVSNW----------------------------------NPISAVMG
A0A4Q1SGQ1      -----T-----HDYFPQR----------------------------------TTGWHLPA
A0A7V2HGP7      ------------------------------------------------------------
A0A7R8B6H7      -----S------------------------------------------------------
A0A2V8GTX0      -----V-----PEFNGKG----------------------------------AKPPLLTQ
Q1ILD9          -----K-----PPFAGDK----------------------------------LYTEGSGT
A0A7G8BJH7      -----TEDFYPPSKTRHE----------------------------------RLLPPWLF
A0A2V8J0X9      -----S-----PLFNGSA----------------------------------PPPRDPLS
A0A7Y5WWH8      -----S-----PLFNGSA----------------------------------PKPRDPLS
A0A7C5SHM3      -----RERILELLSADEQ----------------------------------P-------
A0A7V6D154      -----R------------------------------------------------------
A0A7V1XXZ2      -----N-----PKFNPAA----------------------------------A-------
Q1IJZ6          -----HIGSYWHLFPSGR----------------------------------V-------
A0A2V8TCE6      -----H-----PLLPRKS----------------------------------P-------
A0A522TBE8      -----N-----PAFRAPS----------------------------------H-------
Q1ITG0          -----N-----EAFATKS----------------------------------L-------
A0A7C2ML20      -----S-----SEFTL--------------------------------------------
A0A7T9HIZ6      -----D-----PLFNPGR----------------------------------A-------
A0A7C5AXS9      -----A-----AEEAGGR----------------------------------G-------
A0A7C2RGE3      -----H-----PEFADI-------------------------------------------
A0A7V6D075      -----H-----E------------------------------------------------
A0A3N5PCI5      -----L-----GRAPADG----------------------------------N-------
A0A3M1Q0S9      -----T-----GLPGQDD----------------------------------S-------
A0A2Z5G448      -----K-----KPFSKVF----------------------------------E-------
A0A3M1VZ38      -----R-----PTLLGEQ----------------------------------A-------
A0A4Q1SD29      -----K-----APFDAIF----------------------------------K-------
A0A833M5K2      -----D-----PAFAGAS----------------------------------A-------
A0A1F2Q9L4      -----D-----PVFNPGR----------------------------------S-------
A0A7V5ZKV2      -----D-----PVFNPAR----------------------------------A-------
A0A7Y8LRQ1      -----D-----PVFNPGR----------------------------------A-------
A0A3M1PY35      ------------LLLASL----------------------------------R-------
A0A3M1VMP2      ------------ALAPEL------------------------------------------
A0A1F2T595      -----H-----PSLNQPP-----RLTIRGIL---------------------FWPVGKLA
A0A2V9AC41      -----L-----PLFGGKADKADSQKGLVANL----------------KDGLKERVKGFVP
A0A2V2R525      -----N-----KAFFRPQ---MGQRTTWQRL---------------------LDMVGMGR
A0A321LPW6      -----R-----PEFLAAE----DRRGVWSAI---------------------KSIGGRSA
A0A2V9R9V4      -----N-----PAFL-AS----QKKSVWESL---------------------HEIAGKIQ
A0A321LE75      -----N-----PQFMEVT----RKKSLVEAV---------------------QTIGSKFK
G2LEI9          -----D-----PKFLATG--PTTLSAALLDL---------------------IRSPRGPR
A0A7V9TW03      -----N-----RSFLDGRTENRSTWKSLLSM---------------------FGF-GQKP
A0A3N5XQP8      -----E-----RLLQLRE--KSGVI-------------------------------SETL
A0A2V9KCS3      -----K-----PAALEQP----TKLSAWRKA---------------------LG------
A0A7W1JC10      -----D-----VAFLSPQ--KLSAWQNLLNMCG-------------------LGGKGTGP
A0A3M2BZG9      -----D-----PTFTGRS----------ADL---------------------LP------
A0A1Q7N5R7      -----E-----RRLYLQA--RPRDMAVMATFAVADQYRPGRYHLKVDRTGQHFSLQDEDG
A0A352F549      -----N-----RTFLDGRVENRSTWRSLLTM---------------------FGFSQKQA
A0A3B9MLP9      -----N-----RTFLDSHVDNRSTWQSLMRM---------------------FGLGSNPK
A0A3D5SQ87      -----N-----RTFLDSHVDNRSTWQSLMRM---------------------FGLGSNPK
A0A7Y2DUG3      -----N-----PDLMKNQ--SPGILGTLRTM---------------------FA--GGDQ
A0A7Y2D8Q4      -----Q-----NDLLGNK--RRGVLTTIRSM---------------------FS--GGEI
A0A2V8NW86      ----------------------------RDR---------------------FA--EDPK
A0A3M2D491      -----N-----PELFKGQ--GRGVIASIKSL---------------------FS--GGSD
A0A7W1CBZ8      -----D-----PNLFSGQ--NRGFFSTIRAM---------------------VS--GEKD
A0A7W1FC90      -----D-----PNLFSGQ--NRGFLSTIRSM---------------------IS--SEKE
A0A7W1ZXG0      -----D-----PNLFSGQ--NRGFLSTIRSM---------------------IS--SEKE
A0A7W1ZIT3      -----D-----PNLFSGQ--NRGFLSTIRSM---------------------IS--SEKE
A0A353C9L6      -----E-----PNLFGAS--ERGILASLRSI---------------------FT--GSGQ
A0A2V8RQV0      -----N-----KTLFGGQ--NAGILAGIKSL---------------------FS--RSKA
A0A2V8SJH5      -----E-----ADVFGEE--DRGLLSGVRSM---------------------FS--SRKA
A0A136JPP4      -----E-----PDLFGSS--NRGFFASIKSL---------------------FV--SPKS
A0A399WUJ8      -----D-----PDLLGQS--DRGFFATIKSL---------------------FS--GPAK
A0A7V9C3X9      -----D-----PNLFGQQ--DRGIGSAIRSI---------------------FS--SEKS
A0A7V9ZSX9      -----Q-----PNLLGNQ--NRGILASFRSI---------------------FS--SDKT
A0A3M1SIV3      -----T-----PDLIIRR--NSGITALFKSI---------------------F---ESEK
A0A7V1SCI4      -----N-----PDLITRR--NSGITALFKSI---------------------F---DSEK
A0A7C5ZUA8      -----D-----PNLFGSQ--DRGFLSAIKSL---------------------FS--SEQQ
A0A7T9FQE4      -----E-----ANLFGSS--GMGIWSTIKGL---------------------FG--GSNQ
A0A3E0PHB0      -----K-----DSLYGGK--SRGIFETLGAM---------------------FT--GGPK
A0A7T9G4W3      -----R-----ESLHGSR--QRGILETLGAM---------------------VT--GGGR
A0A838UAA0      -----E-----PTLFGDQ--NRGITAGIRSV---------------------FS--SEPT
A0A7W1HTU2      -----Q-----PNLFDGQ--SKGFFSTLNSM---------------------FF--GGKA
A0A357F267      -----E-----PDLFGDG--DRGFFAAVTSI---------------------FSSTKEEE
A0A7V9ICU8      -----Q-----ANLGGSG--D-GFMSSLTSL---------------------FS--RGGE
A0A7T9JEF9      -----N-----QSFLRPS--DAEKASAVQNV---------------------FRMFGFGS
A0A399WNU1      -----N-----PTFFRPG--KDQDTTVWQNV---------------------ARMFGLYS
A0A3E0PCN7      -----N-----PEFLQPN--QGEQSTVWQNV---------------------LKMFGFYQ
A0A7Y4TLV3      -----N-----TVFFRSG--KGQETTVWQNI---------------------QRMFGLYK
A0A7W0MGQ3      -----D-----DAFLRPQ--SAGS-TTLQNL---------------------LRMVGLGS
A0A1Q7Y6W9      -----N-----QAFVHPQ--SQSNRSTWQSI---------------------LQMIGLSR
A0A2V8NC68      -----N-----QAFLNPQ--SFNKRSTWDSI---------------------KRMFGLSD
A0A352FLX4      -----N-----PDFLRET--SSKNKSTWLDI---------------------RGMLGLKA
A0A2V8MHG6      -----N-----EGFLHPQ--SATRPSVWESL---------------------KGLVGLSK
A0A2V8P7N1      -----N-----QAFLHPQ--SAQDLSFGESL---------------------KGLIGLRK
A0A2V8M3M6      -----N-----QAFLHPQ--SAQDLSFGESL---------------------KGLIGLRK
A0A1Q7NJH5      -----N-----QAFLHPQ--SAQNLSFWESL---------------------KGLIGFKK
A0A2V8PJY0      -----N-----QAFLHPQ--SAQNLSFWESL---------------------KGLIGFKK
A0A7W1BYD3      -----D-----VAFLKP-----QKLSAQQNL---------------------LRMFGLGG
A0A838PIP9      -----D-----VAFINP-----QKLSAQQNL---------------------LRMFGLGG
A0A399WK13      -----N-----KEFQAAA--KASSGSMLGRL---------------------LRSVGLAS
A0A7V8YZQ7      -----N-----KDFQRLK--NEGTTSALRSM---------------------LKSIGLAN
A0A7V9ICV8      -----N-----KEFQEMK--EQGSSAGIRGM---------------------LSAVGLAS
A0A136KC10      -----N-----PEFQALA--RTDSTSTFGRI---------------------LRSVGLAS
A0A7W1IVA5      -----N-----KEFQKAK--SDESVSVWRQM---------------------LKAVGLAS
A0A7W1ZIE3      -----N-----KEFQKAK--SDESVSVWRQM---------------------LKAVGLAS
A0A7T9J551      -----N-----KDFLSAK--EESTGSALNSI---------------------LRTLGLAT
A0A7V9NLN0      -----N-----KDFQKAK--AEEGTSAWRSM---------------------LKAVGMAS
A0A7T9G8R2      -----N-----EAFRKDS--AENSGSALRGM---------------------LVAFGLAS
A0A7Y2D047      -----N-----EEFQKAK--NEGNVSSLRAM---------------------LQAIGLAS
A0A3M2D6Y5      -----N-----KEFQEEK--NQQRASAWRAF---------------------LRSIGLVR
A0A2V8SEX6      -----N-----KEFLTAR--SEG-TGILRAM---------------------LRAVGLAS
A0A7C5ZUU4      -----S-----KE-LQAE--KNN-AGYWQTL---------------------MRTLGLAG
A0A3E0PCJ6      -----N-----EAFRKDS--AEGSGSALRGM---------------------LTALGLAS
A0A2V8RTL7      -----N-----KDFQAAK--NAHGTSAWRSM---------------------MKAVGLAS
A0A3M1S4R8      -----N-----KEFQEER--NRQQASTWRAI---------------------LRSIGLAR
A0A7V1SAJ0      -----N-----KEFQEER--NRQQASTWRAI---------------------LRSIGLAR
A0A7W0N726      -----N-----KDFQKAK--AEQNVSALGSM---------------------LKAIGLAS
A0A7W1HTZ7      -----N-----PEFQKAK--AQESVSAWRSM---------------------LKAVGLTN
A0A1Q7YFI6      -----N-----QAFLNPQ--AAQSRSTWENL---------------------KRMFGFGR
A0A7V9C9Y7      -----D-----PAFNSTR--AAQSRSIWQDL---------------------QRMFGIGG
A0A7W1G8A4      -----N-----QAFLRPQ--TEQNRSLWQNL---------------------LRVVGMGS
A0A7V9KMZ1      -----N-----PDFFKGS--STQKRSTWQIV---------------------LRMTGFGG
A0A7W0JTE4      -----N-----PDFFKGS--SAPKRSTWETV---------------------VRMVGLGG
A0A0B6WWQ6      -----N-----PEFLRPR--AVRDLSPWLNL---------------------RRMLMLGT
A0A3B9MK99      -----N-----PDFFKG---TIQKRSTWQTI---------------------KRMAGFAS
A0A838PA20      -----N-----PDFFKGS--STQKRSTWQTV---------------------MRMVGLGS
A0A352EX26      -----N-----PDFFKG----TQKRTTWQTV---------------------KMMAGFDN
A0A7V9R410      -----N-----PDFFKG----SQKRTTWQTV---------------------KMMAGFSS
A0A2V8MM59      -----N-----KGFLSPQ--SSQPHSTWQTI---------------------MQMSGFAN
A0A2V8PFE8      -----N-----QAFLRPQ--SLRQPSTWKTI---------------------LQMWGVSG
A0A2V8PWS6      -----D-----QAFLRPQ--TLRQRSTWKTI---------------------LQMWGVSG
A0A2V8LCT5      -----N-----QAFLRPQ--TAQPHSTWKTI---------------------LQMLGVGG
A0A352FTJ9      -----N-----QAFLRPT--AAQPHSTWKTI---------------------VKMLGAGA
A0A1F2S1W5      -----H-----PQFTQPA--RPTVRSVIMMP---------------------VNAVARWF
A0A2N9LQU7      -----R-----EEFAGKT--LMASVTAIDPV---------------------KMDPLSR-
A0A2P6WFK7      -----R-----PAFAGK---YAASAKLTNPS---------------------AMPPADR-
A0A2V8JQV5      -----S-----ADPLTRL--TRWRIALGIAK---------------------TSAASAR-
A0A2V8U914      -----R-----PEFQPHS--GFWERLREASP---------------------RAA-----
A0A2V8DRT9      ---------------------DTFDSAKAPK---------------------KMSIRTAV
A0A2V7VYF3      -----H-----PYFGGPT--PNTTSSSSTRG---------------------AIGFTNGI
A0A1F2SVH2      -----H-----PQFNPKP--DDSLTMRK---------------------------IALAP
A0A2V8AJG9      -----H-----PLLKPN---DDNLTVGK---------------------------IAAAP
A0A2V9MAM9      -----R-----GGLVLPG--WSERLLPVFAP---------------------RSPGGNDD
A0A2V8F956      -----T-----PPFRNDK--RFSLKRMMLGA---------------------PALVGQYA
A0A2V7W309      -----D-----RDFYGPG--VEGKTKAEI-------------------------------
A0A348V070      -----H-----PEFIAPK--LPVKLQKEGVQ---------------------PDNPVFK-
A0A2Z5G3A3      -----T-----PDFESKF--NPIDMVLGIFS---------------------PGGASDPP
A0A2V7UGP8      -----D-----PVVNRLV--NR--VRHKGPF---------------------TRLAEIVR
A0A239MKT6      -----E-----PPYNEIP--KGKLHDVYERE---------------------RSLPLKDA
A0A2Z5G7H4      -----T-----RDYQPR------YDALGSIF---------------------RLLSPSGP
A0A372IT17      -----T-----QNFFPAK--KRGLTIPGWIF---------------------FW---RSP
A0A841JU67      -----S-----HDYFPAQ--QSGFQLPGWIF---------------------FW---RRP
A0A7T9GJJ6      -----N-----PRFLDIG--AR--KTVPEAI---------------------ETILSKFG
A0A7Y4UER8      -----R-----PDFLDAT--RK--RTVTEAL---------------------QDIAHRFT
A0A2V8IYW3      -----Y-----PEQRKQV--PM--------------------------------------
A0A7V2HCZ0      -----G-----KDPGPSS--FASQSGAALAT---------------------ALPALTPR
A0A2V9AEW6      -----E-----Q---------PTTAWGIFAS---------------------RVHRLFAF
A0A2V8WQK6      -----E-----R---------PRTGWRGLAS---------------------RVQRIFAF
A0A2V8XIF4      -----E-----R---------PATGWRAFES---------------------RVQRFFDL
A0A350UQT3      -----Q-----LAKEGDQ--AR--------------------------------------
A0A7C3HRX0      -----Q-----LAVPADK--AR--------------------------------------
A0A2W0BGU4      -----N-----RMFADES--RVTESQAHK-------------------------------
A0A2W0BVQ9      -----N-----RMFADES--RVIDAQAHK-------------------------------
A0A317J121      -----P-----PVQNDIF--SRLRRRLTTNT---------------------QDP-----
A0A2V9MN96      -----N-----PRFTGFV--PVANDASRSIG---------------------SANLGPDS
A0A2V7V2Z1      -----D-----PEFGGPR--SAEEIEAVKAA---------------------SPGASAVM
A0A2V7X2F7      -----D-----PEFGGPR--SPEEVKGALAA---------------------PPGSSPVM
A0A2V7V2I1      -----D-----PEFGGPQ--PAEQRAALKAS---------------------APGSSRVM
A0A2V7U3M2      -----D-----PEFGGPR--SPEEMEAVKAA---------------------APGASPVM
A0A2V7UHT0      -----D-----AEYGGPR--SPEEIEAVKAA---------------------APGASQLM
A0A3P0X3W6      -----K-----------------------GK---------------------EFLPAGSV
A0A7V2MG68      -----E-------NWREE--IRGDP----------------------------EAGDSPV
A0A7C6A629      -----D-------KETLP--STDVA-------------------------------NAPV
A0A7V2HBQ5      -----R-------PAAAG--PSVFSPQRIAR---------------------VRPEEAPV
A0A2U3JZ71      -----E-------GSDAT--LSRVP----------------------------GAEDAPV
A0A2V8TTB0      -----D-------ALEQP--SERWQ----------------------------GSDEAPV
A0A2N9MK30      -----K-------ARAGS--DQG------------------------------LLIDAPV
A0A3D1ASD2      -----N-----DLMENTS--EARSA----------------------------AAEDAPV
A0A7R8B699      -----Q-------TKGLS--EDKVK----------------------------ALVAAPV
A0A7S7SGU3      -----Q-------IKQES--DTA-R-----------------------------AKDAPI
A0A7Y8HY45      -----Q-------LDAAG--QKA-Q-----------------------------AQEAPI
A0A7C5AXI3      -----E-------LAGAE--PGK-P----------------------------YSPDAPM
A0A7C6E4H7      -----D-------KTKLP--PAE-------------------------------VANAPV
A0A2Z5FVL3      -----T-----SAFKPHF--TFTGWVNSLFS---------------------PPPPADPA
A0A2V8GFD4      -----N-----AQLSGGG--RQ--MFDLQSL---------------------FNSVVAYV
A0A2V8HSS5      -----N-----AQLSGGG--RQ--MFDLQSL---------------------FNSVVAYV
A0A2V8KP55      -----E-----KEFAAPQ--RGFLAAQAGNL---------------------KKISSVEK
A0A2V9JSI3      -----S-----AEFSPPR--GGKPVSPAIVQ-----------------------------
A0A2V9WI32      -----N-----PAFAE--------------------------------------------
A0A2V9KBD6      -----N-----PMFIGGA---KAVNE----------------------------------
A0A2W0AJ66      -----N-----GKFDGGK--IEPGNE----------------------------------
A0A1Q7RBU1      -----N-----PKFAGRA--EQPVNE----------------------------------
A0A2V9JPV9      -----N-----PNFADRA--AHSGNE----------------------------------
A0A7V0Y3A1      -----T-----PEV----------QDPLAWL---------------------RNLLGLAE
A0A7C5Z4J3      -----E-----PSFTSVL--PGGGAGDEGLS---------------------PARR----
A0A1F2TPT3      -----N-----EPVAGRG--AGNGVGKRDGQ---------------------AGKSGPDG
A0A2V8JTQ2      -----N-----PKFTARG--GRAANQ----------------------------------
A0A2V8UZY0      -----N-----PKFTGRV--EQPDNE----------------------------------
A0A350UEK1      -----T-----PAEPAA---PGRLAAWRQAL---------------------NLPEEAAT
A0A350UIQ4      -----A-----PAEPAST--PSRISAWRRAL---------------------NLPDVPEN
A0A7T9GJN6      -----N-----ARFFDVT--ER--KSIWEAV---------------------RTIVGRVG
A0A7T9GJN7      -----N-----PRFIESL--HK--KSIVDAV---------------------KDIGYRI-
A0A1H5Z7N3      -----N-----PWFLGTQ--KSKQAQPHRNI---------------------DDPVVR--
A0A1G7JVV8      -----N-----PDFMG--------SGPYRNI---------------------NDPIVR--
A0A1H4T6W9      -----N-----PDFMGGK------AARFRDI---------------------NDPVVR--
I3ZEU5          -----N-----PDFMGIR------VGKVRDI---------------------NDPAVR--
A0A7W7ZGZ3      -----N-----AAFLGEK---G--PVPFSSL---------------------DDLATR--
A0A7G8BSK5      -----N-----PDFLDDK---A--PQPRASI---------------------DDPAVR--
A0A428MDU2      -----N-----PEFLEVK---G--PVSHTTL---------------------DDAGVR--
E8WVF6          -----N-----PTFLSVK---G--PIPHSSM---------------------EDPRVR--
A0A1I6MH75      -----N-----SDFLEIK---G--KAPHASL---------------------DSPAVQ--
A0A7Y9TM87      -----N-----PIFLGIK--GN--APTRYSV---------------------DDPRIR--
A0A7W8J1H5      -----N-----ADFLEEK---G--PIEHANL---------------------DDGETR--
A0A7Y9T5K4      -----N-----ADFLEQK--TR--PEPRASL---------------------EDGETR--
A0A852VHP9      -----N-----ADFLEQK--SR--PEPRATL---------------------EDGETR--
A0A7W8IFZ2      -----N-----ADFLEKP--TA--PQPRANL---------------------SDGETR--
A0A7W8J9Y9      -----N-----ADFLEKP--TA--PQPRANL---------------------SDGETR--
A0A7L5A6M5      -----N-----PDFLETR---D--PIQHKSM---------------------DDLAVR--
A0A5B9EBI2      -----E-----PAFLGVR---P--PVPVTSL---------------------DTPMIR--
A0A7Y5RFT3      -----E-----PAFLGVR---G--PVPVTSL---------------------DTPMIR--
A0A239HDF6      -----N-----PAFLGRK--TA--PEPRRDL---------------------NDPQVR--
A0A4Q0T270      -----N-----PEFLGVK---G--KVPHASL---------------------DDPGVR--
A0A1Q3QQB6      -----N-----PDFIGKD---A----PHGNI---------------------DDPAVR--
A0A3N1K1G7      -----N-----SEFLEVK---G--PLPHTNL---------------------DDAAVR--
A0A4V2G466      -----N-----PDFLGGN---A--PSTRASI---------------------DDPDVR--
A0A6B9YNQ8      -----N-----PDFLNGP---A--PKPRASL---------------------DDPAVR--
A0A3N6A5T6      -----N-----PSFNAET--SG--GLLTDSL---------------------AGLIGGTI
A0A2V8R8U7      -----N-----PSFLGGQ--AQ--SSVFASL---------------------KRIFSGER
A0A7V9Q528      -----N-----PAFLGAH--SR---GFVSSV---------------------RRMFSPAP
A0A2V8QMP4      -----S-----PAFFGTN--RG--TGVIAGL---------------------RHIIARGK
A0A2V8R4S3      -----S-----PAFFGTN--RG--TGVIAGL---------------------RHIIARGK
A0A2V8NJ55      -----N-----PTFFEGQ--AS--SGFFASI---------------------RRIFFGDK
A0A7V9ZQ50      -----N-----PAFFEGQ--AK--SGYSDGL---------------------RRLFFGEP
A0A2V8Q7I0      -----N-----PTFFGGQ--SQ--GGIFASI---------------------KRMFAGDK
A0A2V8S6K4      -----N-----PSFLGGQ--SR--PSIFTTL---------------------RRAFSRNK
A0A317I2L9      -----N-----PNFFGGG--SQ--GGFFASL---------------------RRILSGDQ
A0A2V8LLF9      -----N-----SRFLSGQ--AQ--TSIVASL---------------------KRIFSREN
A0A352FRF4      -----N-----PTFFGPQ--GQ--STIFASL---------------------KRIFSRDS
A0A7W1GE99      -----N-----PAFLGGQ--SR---SFLSAL---------------------RRAFRSER
A0A1Q7YKQ8      -----N-----SAFLGNQ--SQ--HGLFTAL---------------------RRIFSSER
A0A0B6WXT1      -----N-----PAFLSGQ--AG--PSLTSSL---------------------RRILSRRK
A0A2V8MKV0      -----N-----PNFLGGR--AN--SGLFNSL---------------------KYLFSRTK
A0A2V8PYY8      -----N-----PNFLGGR--AN--GGLFNSL---------------------KYLFSRTK
A0A3B9MEU8      -----N-----PAFFGGQ--SQ--GGVFASL---------------------RRIFAKPK
A0A352F3R7      -----N-----PAFFGGQ--TQ--GGVFSSL---------------------RRIFSKPK
A0A7W0GRF6      -----N-----PSFFGGQ--TQ--GGLFASL---------------------RRIFSGPK
A0A7W1H6G6      -----N-----PSFFGGQ--TQ--GGIFASL---------------------RRIFSGPK
A0A7V9HZC8      -----N-----PTFFGGQ--SQ--GGIFASL---------------------RKIFSGSK
A0A7W0XCB9      -----N-----PTFFGGQ--SQ--GGIFASL---------------------RRIFSSSR
A0A3N5YNR8      -----D-----PRFSVPV--RE--GVVTSQL---------------------SWLKRTVS
A0A7W7ZUJ7      -----R-----ADF-------------------------------------------AGR
A0A2V2R0I6      -----R-----PEF----------------------------------------STPTGP
A0A2V8XAR9      -----R-----PEF----------------------------------------SSPNGP
A0A2V8VZA0      -----R-----PEF----------------------------------------SSPNGP
A0A1Q7CB82      -----R-----PEF----------------------------------------SSPNGP
A0A2V8WIU1      -----R-----PEF----------------------------------------SSPNGP
A0A1Q6Y9F5      -----R-----PEF----------------------------------------SSPNGP
A0A2V9EVV8      -----R-----PEF----------------------------------------SSPNGP
A0A2V8YF91      -----R-----PEF----------------------------------------SGPGGP
A0A2V8XZK2      -----R-----PEF----------------------------------------SVGGGP
A0A2V8ZTX6      -----R-----PEF----------------------------------------AASGGP
A0A2V9BT79      -----R-----PEF----------------------------------------AESGGI
A0A2V9YHT3      --------------------------------------------------------WDKA
A0A7C2XNI7      -----H-----PEF------------------------------------------AGDE
A0A1Q8B793      -----H-----PDF----------------------------------------SEGGKP
A0A2V9BCA0      -----H-----PDF----------------------------------------SEGGKP
A0A2V9BWU9      -----L-----PEF------------------------------------------GGQP
A0A2V9DKX2      -----L-----PEF------------------------------------------GGQP
A0A7C2YQY3      -----K-----PEF----------------A---------------------VRPLGANG
A0A845TWB8      -----Q-----PEF----------------A---------------------LRKTAAAS
A0A2U3KC61      -----N-----PQ-----------------------------------------AED---
A0A2V9Y2R7      -----D-----PRF--------------------------------------VGSTA---
A0A2V9NGH6      -----R-----PEF--------------------------------------GGSGQ-AQ
A0A2V9PYE6      -----R-----PDF--------------------------------------GGSGP-AQ
A0A2V9NL07      -----M-----PEF--------------------------------------GGHGA-PP
A0A2V9QD92      -----M-----PEF--------------------------------------GGHGA-PP
A0A2V9WPZ6      -----R-----TEF--------------------------------------GGKPD--S
A0A2V9ZLH4      -----R-----VEF--------------------------------------GGKGDMPS
A0A2V9RQF1      -----R-----PEF--------------------------------------GGKGE-SS
A0A2V9YDK8      -----R-----SEL--------------------------------------GRKPD--D
A0A2V9V8F7      -----R-----TEF--------------------------------------GGKPD--S
A0A2V9XGR9      -----R-----TEF--------------------------------------GGKPD--S
A0A2V9V3Q5      -----R-----PEY--------------------------------------GGQSA---
A0A2V9NWS3      -----R-----AEF--------------------------------------GGNGQVPS
A0A2V9USA9      -----S-----GGP--------------------------------------NGRAP---
A0A2V9XW18      -----R-----PEI--------------------------------------AGQAPPIP
A0A1H5SQF5      -----S-----QPF-----------------------------------------LALRP
A0A2V8G155      -----T-----PPF---G--GT--APADSPF---------------------SLRRVIAL
A0A2V8HDM7      -----T-----PPF---G--GT--APADSPF---------------------SLRRVIAL
A0A2V8IVN9      -----S-----GEFVTNK--RG--IVQTLAG---------------------GVASLFGK
A0A7W1SCW7      -----N-----PHL-------G--QPPVNPG---------------------LFTRLFGG
A0A3E0NV31      -----R-----PEF----------------------------------------VRSVDR
A0A3N5M5V0      -----D-----PRFEVPV--RE--GLVTSQL---------------------GSVKKAMS
A0A7X7XDY5      -----D-----PRF---V--DQ--RAGASPS---------------------IKTEEPPA
A0A2V9L5B5      -----S-----PEF----------YRNRGLF---------------------GLYESDPE
A0A2V9LK56      -----L-----PEF----------YRSRRLF---------------------GLFESDPA
A0A2V9L7I0      -----S-----PEF----------YRNQMFF---------------------GLFESDPE
A0A522PPT0      -----Y-----PEF----------YQSRSFL---------------------GLVAKDPE
A0A7C5V1G5      -----Y-----PEF----------YQSRSYF---------------------GLVTKDPK
A0A4R1LC91      -----S-----PDFKPMF--NP--IGWALGL---------------------VSPKGPAD
A0A2V9QB26      -----F-----PED----------------------------------------PKVRTS
A0A2V9VYY4      -----D-----PRF----------------------------------------TAVKQS
A0A2V9KIE8      -----S-----PEF----------YRKSILF---------------------GLMETTPA
A0A7C2GJ20      -----H-----PEF----------------------------------------------
A0A7C4BTL5      -----P-----ADL---------------------------------------KMETGRI
A0A7X8YVF2      -----D-----DLPDPFI--EP--KSTGMLT---------------------RWLSMGSH
A0A7X7YEP0      -----D-----PYF------------------------------------------NPSR
A0A2V9CBM2      -----V-----SEF------NA--PQLFS-W---------------------KWKKKAPT
A0A2V8XN17      -----L-----PEF------NS--PRWWQFW---------------------PSKKKSPP
A0A2V8WX45      -----L-----PEF------NS--PRWWQIW---------------------PKTKKPST
A0A1Q6YR79      -----L-----PEF------NS--PKWWQFW---------------------PRNKKSPA
A0A1Q7VA32      -----L-----PEF------NS--PKWWQFW---------------------PRNKKSPA
A0A2V9EY85      -----L-----PEF------NS--AKWWQLW---------------------PRKKKSPA
A0A2V9H8K0      -----L-----PEF------NS--PRWWRFW---------------------QERRKPST
A0A2V9FFE5      -----L-----REF------NS--RKWWQLW---------------------PETRKPST
A0A2V9GM43      -----L-----REF------NT--RKWWQLW---------------------PETRKPST
A0A2V8ZHL8      -----E-----PGW---------------------------------------------V
A0A2V9B240      -----D-----PAW---------------------------------------------A
A0A2V9CYQ5      -----V-----SEF-------N--APPLLSW---------------------KWKKKAPR
A0A2V9BWU8      -----L-----PEF-------N--APKWWSL---------------------KRFARAPQ
A0A2V8ZG48      -----L-----PEF-------N--RPKWWQF---------------------GKRLSLPR
A0A2V8Y334      -----L-----PEF-------N--SPKWWQF---------------------RKKAFKPR
A0A2V9AY68      -----L-----PEF-------N--KPKWWQL---------------------QERFFTPH
A0A1F2RFI7      -----L-----PEY------DE--KPSWFAK---------------------LLSKSRSE
A0A1F2RZS3      -----S-----PEFAKEQ--ES--SPSWLGT---------------------LWPGGAEQ
A0A845TW47      -----I-----EEF------NP--KN----------------------------------
A0A845TXC1      -----L-----EEF------DP--PKPWWSF---------------------GGQPKAAT
A0A1F2USE2      -----R-----AEF------NP--PQPWWSW---------------------GGKETAAA
A0A7C2VB08      -----V-----PEF------NP--NAS--SA---------------------GTVSAASV
A0A2V9C238      -----L-----EEF------NP--RASQLGD---------------------AKPQNAAA
A0A1F2Q9F5      -----L-----AEF------SR--PGFRLRG---------------------GKRETPAS
A0A1F2QQH9      -----L-----AEF------SR--PGFRLRG---------------------GKRETPAS
A0A1F2QXK7      -----L-----AEF------SR--PGFRLRG---------------------GKRETPAS
A0A2V9DEM9      -----L-----EEF------NP--RASQLGD---------------------AKPQNAAA
                                                                            

A0A2V7VMF7      -------------------------------------------------------EAGAL
A0A2V7YYV7      -------------------------------------------------------RPDDL
A0A2V7Z0J5      -------------------------------------------------------TSDEL
A0A2V7Z3M4      -------------------------------------------------------TSDDL
A0A399Y5V2      -------------------------------------------------------RVTAQ
Q01X01          -------------------------------------------------------PVTRT
A0A3M2D9H8      ------------------------------------------------------------
A0A2V9IXG5      -------------------------------------------------------IAGEL
A0A2V9J2P4      -------------------------------------------------------IAGEL
A0A831T3F4      KTISDKLPTQDQVQV-PQDAVDTTEIRPDKGAISSPAETTRLAP-----------FVDIL
A0A2V8JK38      KKISSVEKTEQASDD----------------------EGDQLRS-----------LIDQY
A0A7W0JWI4      LRMVGLVSTKDDSKNQANHAVPLTVPIAPDTPQEDTAEAKRLAS-----------YVDDI
A0A1Q7RLS4      -------------------------------------------------------SIGAF
A0A257VBK0      -------------------------------------------------------PAAML
A0A7C5TWV7      -------------------------------------------------------PAAML
A0A2V7XDY0      --------------------------------------PAEHRD-----------AGGEF
A0A2G6PYV5      LLDLGTVNE-----------------PREKTQKTKEDQAKEITK-----------IASNL
A0A1F2TCR2      AVRNARASLGKAIRRLITRPI-----QTPAVEPAAPDENAAEAG-----------IISQF
A0A7Y9PHF8      ------------------------------------SKRPRKLP-----------EGVKF
A0A7W8J3G9      --------------------------SQLAFSADTVTLTPSQEA-----------LLRQI
A0A1F2V330      ------------------------------------PDGKISDT-----------DLDRM
A0A662EE63      -------------------------------------------------------GPGIV
A0A2V8TLH7      -------------------------------------------------------PVGVF
A0A1Q7ZJT1      -------------------------------------------------------SIGEF
A0A2V8VC99      -------------------------------------------------------PIGTF
Q01XL7          --------------------------PFAQKEPLEQMKEAVRTA-----------AFTVS
A0A523DUV7      -------------------------------------------------------PGRIF
A0A7W1TTH3      AFASITARVTRPLRQLLQKEQPST--TADATGSAGASESPEEAA-----------LVSAF
A0A1F2U158      --AETPVTKARDAGDRLLRFLART--PTPIAEVPKPDETADESA-----------LVSRF
A0A2V8F6S9      --RPTPFSMLREAEQRIVRLVRPA--KEEPTEAPKVDEAPDESG-----------LVSGF
A0A7V0UHS9      ------------------------------------QADVLPAE-----------AVEMV
A0A7D8BEX2      --------------------------EPARTRHQVLDAPETRDA-----------IIAQM
A0A4Q1SCH5      --------------------------RLEDDQHRPINLTPQQED-----------VLDKF
A0A7V4SJP8      -------------------------------------------------------AWRAL
A0A372IRG7      --------------------------MFAKQPYTGHLTPLQRYQ-----------LIRAF
A0A2V8K4L4      --------------------------AWRKVLHIAPKQALDRNN-----------AIAAA
A0A2V8NCZ3      --------------------------AWRKVFHLSSKPAIDRDR-----------AIRMA
A0A4Q7YNP3      --------------------------IGMLHLPISVGKPISSDD-----------LIEDT
E8UZE1          --------------------------SSATPKPLNSLTDQERYS-----------LIRRF
A0A2V7YW66      --------------------------KDGGRGPTAEDDDAVLGS-----------LAEQV
A0A2V7Z0V0      --------------------------REGAKGGTAEADEAVLGA-----------LADQL
A0A2V9M454      --------------------------TSPADGRVLGTPPAMKNA-----------AVAAF
A0A2V9J4D6      --------------------------QKQRKESIDSAD--VRGR-----------LVKLF
A0A2V9L9C5      --------------------------QKQRKESIDSAD--VRGR-----------LVKLF
A0A2N9M9N1      --------------------------TSRSTVA-------TPAN-----------LIRSF
A0A2V9JEC4      --------------------------TASSKSQLESLPP-LQDR-----------LIRAF
A0A2V9LPQ3      --------------------------PKDASGQRAPEPRMLRDR-----------LVREF
A0A7Y8IYX6      ----------------------------------ARNPPRDQLM-----------IRGDF
A0A2V9IVR7      --------------------------PLKGASPQRGESAEAESP-----------LVGIF
A0A2V9ILE2      --------------------------PLKGASPQRGESAEAESP-----------LVGIF
A0A2V9LGY4      --------------------------PLKGASPQRGESAEAESP-----------LVGIF
A0A7T9JJ28      ------------------------------------EEFKPRGAETLSDSEREVRLVNAF
A0A7T9GE94      --------------------------ARPINSPSEEIEFSDGESDLQAGIQKLQPYIDTL
A0A7Y4X7L5      --------------------------KAP--RPAGKLAISEDDANERAEMERLRDVINGL
G8P0Y7          --------------------------GGIAVSQSPAEESFRLES-----------LIRKL
A0A2W4RYA1      ------EGVASVMRWFRSPEGGVPDPAVGQAGGQEPPETPEQTA-----------VIDAF
A0A2V8EXP2      ------ALVTAPLRWLSAWA---TPPPAIEPGGVSAGETSAQAR-----------AIDRL
A0A843SYC7      TLAGAPALIAATIAQVFSSG---DTPPVAEHGIPDADETADETR-----------AIDAF
A0A7V9BJ09      SLIDGTVALAKRPFAKEAPV---APAA---PAESQAGEDAAQSA-----------RISEF
A0A7W1DT80      GMVDGAVSLAKAPFRKDGPA---PSTETVKPEQVEAGESAAQSA-----------RISQF
A0A5M8T4U7      --------------------------SIAQYKLPVVLSPVERRA-----------LIGYI
A0A7L5A491      -----------------------TPTKKMPAGMTPADASISLSK----------------
A0A7D8BF18      --------------------------MGPSPKPRNLDDPIVRQS-----------VLGSM
A0A1E3Y9R6      VVGTTIAAVRHWFGPAPVLP---AASDGADPAPGAVSPQEAA-------------LTSRV
A0A2W4TLP2      LLGGAVSAVADMFGPGPV------PAAGGEEPAAVESAARAA-------------LTSRI
A0A7G8BDY8      V-------------------------TPDAPAQIDKTSPERQNQ-----------LLGKF
A0A7C4BZ42      --------------------------AWKQALGLGQAEAVTKET-----------AVAAA
A0A3R9WF43      --------------------------VRGEADKPLEDAPRTRER-----------MVKLF
A0A317HKM4      --------------------------AALPPNERLSQVPTVAEI-----------AAARS
A0A2V9CG11      ------------------------------------SQHVPEDE-----------LVHQA
A0A523E0N1      ------------------------------------DQKKVVSN-----------IGRSI
A0A1V6HR88      --------------------------AGSDEGGSAAADQSALAR-----------LAGRL
A0A4Q1SDL1      LFAPKG--------------------IADPPGASLENSPARRTR-----------LLKIF
A0A841JWG5      LFASKD--------------------APEPAGLSLEDSPTRRTR-----------AIHTF
A0A4R1LAZ7      --------------------------QTPYHGQ---LTPLQRYL-----------LLLSY
A0A7G8BMP1      --------------------------DSPYNGH---LTPGQRTA-----------LLKTF
A0A7X7ZKA6      --------------------------PEKRKKPVDPSDHVFREG-----------LVDSF
A0A523ECP2      ------------------------------------ADEQTLED-----------LAEQV
A0A2W0C122      --------------------------ANRQFASLREIAPAPESI-----------AVQAL
A0A2W0AUU7      --------------------------ANRQFASLREAAPDPTDI-----------AGEAV
A0A2W0BQL1      --------------------------ANRQFASLQEAAPDPTDI-----------AGEAV
A0A2V8ERZ5      LLQEAKDKIIGIAK------------PNAPAEAPKVDETADESG-----------LVSAF
A0A7W8J413      --------------------------VASEKGKPLDQAPLTREK-----------LIKRF
A0A7W8JCF5      --------------------------VSSEKDKPLDQAPLTREK-----------LIKRF
A0A7W8IEB1      --------------------------VSSEKDKPLDQAPLTREK-----------LIKRF
A0A7Y9T3I1      --------------------------VASEKDKPLDQAPLTREK-----------LIKRF
A0A3P0XH15      --------------------------RQPYNGK---LTPNQRIE-----------MLSIF
A0A3E0P0A3      --------------------------GEPVTAD---DDAVVVAR-----------LASRV
A0A3M1WQW8      ------------------------------------DATLRDKL-----------MVDRF
A0A841JVA9      --------------------------PEFVQQNDTLSRLRRLVGIPGGSTIPFNDLLNET
A0A3N1JHC1      ------------------------------------SNDAGREG-----------VVRNM
A0A7V4XQR5      --------------------------KTGYHGT---VSPAQKLA-----------LLNMF
C1F294          --------------------------KAGYHGT---VTPSQKLA-----------LLNTF
A0A2V9KA79      ------------------------------------TRGAATSR-----------QIDEM
A0A348UZU3      --------------------------NVTGEDL---KNPVFRQK-----------LVDKF
A0A7X9FXC4      --------------------------PATADDW---NDPVFRRK-----------LIDKF
A0A7X7ZKL5      RVKDAVTFRWLFGGGGKKGG---PGEEAAPASA-----------------------AFAV
A0A522PSP1      --------------------------PADSSST---EVPRS--------------FVAGI
A0A7W8E8D3      --------------------------KQLAIPIGATSLSPAQEE-----------MLSHF
G8P085          --------------------------KQLAIPLGAISLSPAQEE-----------MLSHF
A0A843SRW6      AWVKSPFGSTKATAVDTDPD---EVLPAAAEASGSTETAETEAEAAVAETPEQAAVLDAF
A0A7W8E330      LFTPSGKTD-----------------PQGASLE---DSPRRRER-----------AIRKF
A0A4Q1SGQ1      WLFFWRQPLE----------------PLNIRLE---DAPNRRYV-----------ALKIF
A0A7V2HGP7      --------------------------PDPTAES---GRPSVRMA-----------DRAVN
A0A7R8B6H7      -------------------------ADSGPRED---RYSDLRSLLGIKLATTAEESLEMA
A0A2V8GTX0      VISDLKAKIAAPFRGQTAAP---PPRPAGPVNE---NQ-----------------QADAF
Q1ILD9          WYSHHGLRSL----------------PNEPLSN---IGNARRQQ-----------LLARF
A0A7G8BJH7      FWKRPVE-------------------PLAVPLD---HAPNRRYV-----------VLKIF
A0A2V8J0X9      LARQGRAAASAWLRGLIVKP---PPAAAAPPAP---DEPAHEAG-----------LISAF
A0A7Y5WWH8      LARQARAATSAWVRSLVAKP---EPAPAVAPAP---DESSQEAG-----------LIGAF
A0A7C5SHM3      --------------------------EEDATPP---DDKQ---------------MARWI
A0A7V6D154      --------------------------PEEYGAT---DRE----------------TIQRI
A0A7V1XXZ2      ---T----------------------NDANAPA---SNPDADAQ-----------LIGVI
Q1IJZ6          ---TS---------------------EQGLPLR---NAPRQREA-----------MLKKF
A0A2V8TCE6      ---GLLQRTLAALRRAL---------PRGEAHA---APAEPMGP-----------FIDLV
A0A522TBE8      --------------------------PNLTPSP---DD-----------------VLRQL
Q1ITG0          ---FGRSLQTPV--------------GKDVSSV---DEARKSK------------LLTRF
A0A7C2ML20      --------------------------PSAATEE---ERETQRTL-----------VINRF
A0A7T9HIZ6      ---ALAA-------------------TAAGSAA---ADEAALGA-----------LAGRV
A0A7C5AXS9      ---RVSAWRE----------------ALGLKPP---AEPGPQAR------------VSRA
A0A7C2RGE3      --------------------------TARVADP---DRRRVL-------------LIDRF
A0A7V6D075      --------------------------GQVRSVR---ARSGVRPQ-----------EAPIQ
A0A3N5PCI5      ---AQPAGTFAFLGQWRSWL---GRAVGAATGA---TSSQEKEPGSVRETVAESIAIDRL
A0A3M1Q0S9      ---RENRFFSAIRKLRTTVV---RTLSRTQVPI---EEDDPYAP-----------YVKTL
A0A2Z5G448      ---KQPYVL-----------------GKPLTPA---QR----IP-----------LIRLL
A0A3M1VZ38      ---DEEPSPFSLGGLRAKIL---SVIGRGAPET---GEVDPLRP-----------YIKQL
A0A4Q1SD29      ---TSPYTG-----------------TLTPAQR---HE-----------------IISLF
A0A833M5K2      ------AGA-----------------GEAVTAA---DDEAAIGG-----------LAGGV
A0A1F2Q9L4      ---RLPGGS-----------------GGAVTAS---DDAATLAG-----------LAYGV
A0A7V5ZKV2      ---SLPAGK-----------------APAVSAA---DDQAMLGA-----------LAGKL
A0A7Y8LRQ1      ---SLVGGK-----------------AQGVSAA---DDEAALGA-----------LASRL
A0A3M1PY35      ---PEDEED-----------------LAAWEPP---DD----GD-----------LVEML
A0A3M1VMP2      ---TEPGED-----------------GEEPKPP---TD----DQ-----------IAAYI
A0A1F2T595      SWFEPARPPQAADAAET----------------------RTQTV-----------VINRF
A0A2V9AC41      DKPKVNAPPPDPA--------------------------TAGKR-----------LAGSY
A0A2V2R525      DSGDSSQP-------VDDGVLMTSSVAPATDKEDLAEI-KRLNP-----------FVGAI
A0A321LPW6      LREAGESPPEQASDAAD-----TDKQ-PGPGADA-----NDLAA-----------LIRAL
A0A2V9R9V4      RDDASAPPAVFTATAMK-----SKIEGNRSPEEV-----ERLAP-----------YVGML
A0A321LE75      QEVTSELPVLEPGVQIE-----GGID--RSPEES-----ARLAP-----------FVAVL
G2LEI9          KPPQSETKS-------------AELPEASPTPATTEDELQRYAP-----------QIGRL
A0A7V9TW03      QAPKNQNVGLPNTSTPILA---SNGFSADDPAEV-----ERLTP-----------YVESL
A0A3N5XQP8      RQVMRAVRGVIDRLIDEGGPGGQN---------------DPTEY-----------MIDRL
A0A2V9KCS3      -----------------------------LPQPA-----APSRE-----------QAAGM
A0A7W1JC10      QSRDGEGEPF------------PSSIAPATPKDNLAEA-KRLAP-----------YVGIL
A0A3M2BZG9      ----------------------GAADATTVDDDA-----AELAR-----------QAMRL
A0A1Q7N5R7      TELERGDVGAAIGRTDSLGFRWTPAAADLAPGAEIVFGVTTLRD-----------ASRGL
A0A352F549      EAPKNQN-VLPDVNSSPAFA--SAGFNADDPAEV-----ERLTP-----------YAESL
A0A3B9MLP9      NSAVAENGALPDRGNQP-LT--TSGLSLEDPAEV-----ERLAP-----------YVDSL
A0A3D5SQ87      NSAVAENGALPDRGNQP-LT--TSGLSLEDPAEV-----ERLAP-----------YVDSL
A0A7Y2DUG3      KPEEKDSLKVISDSNIQSE---DPDEIVLSAAEK-----QRVSM-----------YAGML
A0A7Y2D8Q4      EKPKVETLPILAADEFDEFG--ERKQENLTAQEV-----KNAET-----------YAAHF
A0A2V8NW86      VKTSRFSLW----------------RKAVLPELK-----LSDES-----------GAVQA
A0A3M2D491      EPSKTQSLPVLSENNDEGF---SSEEIKLSPEER-----LRVER-----------ITASL
A0A7W1CBZ8      AHNKQSSLPVLTETTADKD---NNRQITLTPEEK-----ERADL-----------YAVTL
A0A7W1FC90      TQSRQSSLPILTETNTDKN---NNGQITLTPEEK-----ERVIR-----------YAGIL
A0A7W1ZXG0      TQSRQSSLPILTETNTDKN---NNGQITLTPEEK-----ERVIR-----------YAGIL
A0A7W1ZIT3      TQSRQSSLPILTETNTEKN---NNGQITLTPEEK-----ERVIR-----------YAGIL
A0A353C9L6      NAEVPSALPVVSEPELLGEE--RP-RTILSPDEE-----KRADQ-----------YAGIL
A0A2V8RQV0      QTEEANALPVISDTEQLNSK--GE-LAKLSPEEE-----ALANQ-----------HVGNL
A0A2V8SJH5      NSGPDNSLPVVSELPAGTDA--SD-NIQLTPEER-----ARVEN-----------YAAML
A0A136JPP4      PETPKGALPVLTGTENAD----PA-AVQLSPEEA-----ARAGQ-----------YAGIL
A0A399WUJ8      AQAPQGTLPVLTGTENAD----PT-AAQLSPEES-----ARANQ-----------YAAAL
A0A7V9C3X9      DVERENSLPVISEASKDST---PE-KLILSPEED-----RRADM-----------YAGRL
A0A7V9ZSX9      AENKDMALPVLTETSAAVTGVAAD-KIPLTPEEQ-----ERAGQ-----------YTGSF
A0A3M1SIV3      DKQEQIVLPVINESDFQKSL--DNLEAKLSPEEK-----EAVEK-----------VTASL
A0A7V1SCI4      DKREQTALPFVNESDFQKSL--DNLEAKLSPEEK-----EAVEK-----------VTASL
A0A7C5ZUA8      TSQTEKSLPVVTDIDESTSP--SS----LTPEEQ-----ARAAR-----------YAAIL
A0A7T9FQE4      PEENAGMLPVVSEDGADGAK--AG-EVQLSPEES-----RRADL-----------YAATL
A0A3E0PHB0      NSEEAGALPVVDSVDGETV----D-QINLTPEQS-----QRADK-----------YTAAL
A0A7T9G4W3      QPEQQGALPVIDSREGDTV----E-QVSLTPEQK-----QRAEA-----------YAGEL
A0A838UAA0      EVKDANSLPVVNEIATADT----D-RIPLTPEEN-----ARAER-----------YAALL
A0A7W1HTU2      DSEKTSSLPVLTETSTDSNQ--SN-QIILTPEEK-----DRAER-----------YAFNF
A0A357F267      KEKEADSLPIVSDTAESPSP--SS-ALELTPEEE-----KRVQI-----------YAAML
A0A7V9ICU8      DADPANTLPIVSSVEQAQTS--LD-M--LTPEEQ-----ARVNS-----------YTGAL
A0A7T9JEF9      PATNPASGVIDQATKSQLQLE-IAAA----DSGGEDES-TKLAP-----------VVSAI
A0A399WNU1      QPVRNQAESA-PPAKNTLDLKTDT------DADLDSQA-EQLAP-----------YVGFI
A0A3E0PCN7      TKSMTPVEFADKETEDALQLSLDS-------NEQPSEP-EKLAP-----------FVNSI
A0A7Y4TLV3      PSQKSDALKAESKSDNTLNLKVDS------TTDLDSQA-EVLAP-----------YVSYI
A0A7W0MGQ3      AARKETKDSE-SK---DIPLV-DSVASPT-SYNDLAEA-KRLAP-----------HVGVL
A0A1Q7Y6W9      SSTQEQNQQA-SQ---DIPLT-TNVASAV-ASEDLAEA-KRLQP-----------YVSML
A0A2V8NC68      KKEREQEQKL--D---DAPLV-DRIAPAT-AREDLKEV-NQLAP-----------YIESL
A0A352FLX4      KTPPQSSTP------DVLPQS-SSSSSST-AAQEQAEA-ERLSD-----------YVDDL
A0A2V8MHG6      SQSKPREP-------EGYVLRPSSAL----SNDDIAQT-NHLQP-----------YVEML
A0A2V8P7N1      SQSKTKEQ-------EGYVLRPNSAL----SNDDIAEA-NHLQP-----------YVEML
A0A2V8M3M6      SQSKTKEQ-------EGYVLRPNSAL----SNDDIAEA-NHLQP-----------YVEML
A0A1Q7NJH5      SQSKTKEQ-------EEYVLRPNSAL----SNDDIAEA-NHLQP-----------YVEML
A0A2V8PJY0      SQSKTKEQ-------EEYVLRPNSAL----SNDDIAEA-NHLQP-----------YVEML
A0A7W1BYD3      KEISAKSQNA-EE--SPFP---SSIAPAT-PKDNLAEA-KRLAP-----------YVGLL
A0A838PIP9      KVVSAKSQNA-EE--APFP---SSIAPAT-PKDNLAEA-KRLAP-----------YVGLL
A0A399WK13      GDKQKQEESV-PI--D---PN-STLA----SADEIAEA-VRLTP-----------FVEVI
A0A7V8YZQ7      DTSKKEVAEV-DG--STSMTN-SSLI----SADEIAEA-VRLAP-----------FVQII
A0A7V9ICV8      SGRRVAAEGS-E----PLESG-NSLV----SSDEIAEA-VRLNP-----------YVEIV
A0A136KC10      GETQKSE----QL--AAIDPN-STLA----SADEIAEA-VRLTP-----------FVEVI
A0A7W1IVA5      TDVKKTSNGV-DE--VSVSAS-ASLA----SSEEIAEA-VRLAP-----------YVNII
A0A7W1ZIE3      TDVKKTSNGV-DE--VSVSAS-ASLA----SSEEIAEA-VRLAP-----------YVNII
A0A7T9J551      SADGKTSSST------QLPSL-DGLA----TTEEIEEA-IKLAP-----------FVDFI
A0A7V9NLN0      DDSKKSVGGI-EE--TSISAS-TSLA----SSEDIAEA-VRLAP-----------YVKML
A0A7T9G8R2      DDSKKEGDLV-EE--APLASN-TELA----TVEEMNEA-VRLAP-----------YVDAI
A0A7Y2D047      SDDSDSKDGI-ED--AGYSSN-SELV----TSEEIAEA-VRLAP-----------YVTLI
A0A3M2D6Y5      -EERRKEDTK-ID---EITPG-MNLA----SVEEMNEA-IRLAP-----------YVEII
A0A2V8SEX6      -DPKKDTAPN-DE--FAASAN-SSLI----SSDEIAEA-VRLAP-----------YVEII
A0A7C5ZUU4      -DGTKKDDSK-DN---ADQID-ASLL----ANDEVADA-MRLAP-----------YVELI
A0A3E0PCJ6      DDSKK-EDVV-EE--VPLASN-TELA----TVEEMNEA-VRLAP-----------FVDAV
A0A2V8RTL7      DKSSNSPDAN-TQ--KSEETN-SSLV----SADEIAEA-LRLSP-----------YVDLI
A0A3M1S4R8      EETKKTRDLE-E-----VLAG-MNLA----TAEEINEA-VRLAP-----------FVEIL
A0A7V1SAJ0      EETKKTKDLE-E-----VVAG-MNLA----TAEEINEA-VRLAP-----------FVEIL
A0A7W0N726      DDSKKSADGI-ED--NSIISS-STLA----SSEEIEEA-IRLAP-----------YVKML
A0A7W1HTZ7      SDNKKKDSAV-DE--VSVASS-TNLA----SSEDIAEA-VRLSP-----------YIEII
A0A1Q7YFI6      PANNQQSV---PQ--NMMPLVDSSLAPAT-IEGDIAEV-NRLAP-----------YVGML
A0A7V9C9Y7      REQKKPGDA--TT--GDVPLV-DSVAPAT-SQGDLAES-RRLAP-----------YVGAI
A0A7W1G8A4      SDSNGAQQK--KTTAEEVPLT-GTVAPAT-SRDDMIEA-KRLAP-----------SVDAI
A0A7V9KMZ1      EQKDDPNTR--PQ--NELPLR-TTIAPAS-SREDLVEA-KQLSR-----------YVDSI
A0A7W0JTE4      SDKEDAKTK--PQ--DELPLR-TSVAPAS-SREDLVEA-KQLAR-----------YVRAI
A0A0B6WWQ6      GQEKSAGQRG-TR--GQMPLP-SEIAPATESQDDFDVA-MRLDP-----------YVRTI
A0A3B9MK99      ADPPDVTAK--PK--DELQLR-PAVAAAT-SQEDLVEA-KRLAP-----------YVGAV
A0A838PA20      EPPEDPKSR--PR--DELPLR-TTVAPAS-SREDLVEA-KQLSR-----------YVGAI
A0A352EX26      NVPKPDQSK--PN--DVLQLR-TTVAPTT-SQEDLVEA-KRLSP-----------YVGAI
A0A7V9R410      DAPGPVASK--PK--DELQLR-APVAAPS-SQEDLVEA-KRLAP-----------YVGAI
A0A2V8MM59      PDPK-AGKQ--SK---ELPLT-TSFAPAT-SSEDLVEA-KRLAP-----------FVGAL
A0A2V8PFE8      PEKKDPSTQ--PK---ELPLT-STVAAAT-SNDDLAEA-KRLAP-----------YVGAL
A0A2V8PWS6      PEKKDPSTQ--PK---ELPLT-STVAAMT-SNDDLAEA-KRLAP-----------FVGAL
A0A2V8LCT5      REKKETKQQ--NN---VLPLT-TSVAPAT-SSEDLVEA-KRLAP-----------YVGML
A0A352FTJ9      -EKKDTVPA--PN---VLPLT-SAMAPAV-SSDDLVEA-KRLAP-----------YVSAL
A0A1F2S1W5      EPPRPVEPPDAAETRVQ-------------------------SR-----------VINRF
A0A2N9LQU7      ------------------------------------------EK-----------LLLKF
A0A2P6WFK7      ------------------------------------------QR-----------LVSAF
A0A2V8JQV5      ------------------------------------------EA-----------AISLA
A0A2V8U914      ------------------------------------------QN-----------AAQYA
A0A2V8DRT9      ASVVAPVFHLFVARKAIEPEQTGETTTQ--------------SR-----------ILNDF
A0A2V7VYF3      LALVRGAFQSKAETIGREKRAPAESAAE--------------SQ-----------AIDAF
A0A1F2SVH2      VVLVAGWFKPAQPL---EPPLPDESKVQ--------------SN-----------TIDRF
A0A2V8AJG9      AAFVSSWFRTAAPV---GMPGSDESKQQ--------------SR-----------VIDRF
A0A2V9MAM9      ------------------------------------------RE-----------AILRV
A0A2V8F956      VSGISRTGDAASDFSGTGGSAARTTESANPGPDETASQ----SD-----------AIDAF
A0A2V7W309      ------------------------------------------DQ-----------ITQAM
A0A348V070      ------------------------------------------ER-----------LIDEF
A0A2Z5G3A3      GASLQQSPGRM-------------------------------SH-----------ALKVF
A0A2V7UGP8      HSPLDEIP----------------------------------ED-----------PDKPY
A0A239MKT6      PYTR--------------------------------------DR-----------VLAIF
A0A2Z5G7H4      ADPLNASLENSPRRR---------------------------TR-----------ALKIF
A0A372IT17      LEPRSVPLEEAPNRR---------------------------YV-----------ALRIF
A0A841JU67      IEPLTIDLEDAPNRR---------------------------YV-----------ALKIF
A0A7T9GJJ6      SRPSATPEIPQMEPLLIEPNMQAARSEEE-------------IA-----------RLSPF
A0A7Y4UER8      GGTFGASVNSTEPNIKKAPTVE--RSAEE-------------SE-----------RLAPY
A0A2V8IYW3      ------------------------------------------ED-----------VVARM
A0A7V2HCZ0      KDPGQAANA---------------------------------AS-----------MVTVL
A0A2V9AEW6      SRTGRLSER---------------------------------EQ-----------MIRQV
A0A2V8WQK6      SKASNLPER---------------------------------EE-----------LIRQI
A0A2V8XIF4      SKTPHLPEK---------------------------------EE-----------LIRQI
A0A350UQT3      ------------------------------------------AQ-----------DAPIV
A0A7C3HRX0      ------------------------------------------AS-----------NAPIL
A0A2W0BGU4      ------------------------------------------MK-----------LIETF
A0A2W0BVQ9      ------------------------------------------MK-----------LIETF
A0A317J121      ------------------------------------------MA-----------LMTSG
A0A2V9MN96      QQI---------------------------------------AS-----------MLSIF
A0A2V7V2Z1      ------------------------------------------ER-----------AIDEF
A0A2V7X2F7      ------------------------------------------EG-----------AIDGV
A0A2V7V2I1      ------------------------------------------EA-----------AIDQF
A0A2V7U3M2      ------------------------------------------ER-----------AIDSF
A0A2V7UHT0      ------------------------------------------EG-----------AIDAF
A0A3P0X3W6      TL----------------------------------------------------------
A0A7V2MG68      LL----------------------------------------------------------
A0A7C6A629      KL----------------------------------------------------------
A0A7V2HBQ5      LL----------------------------------------------------------
A0A2U3JZ71      LL----------------------------------------------------------
A0A2V8TTB0      IL----------------------------------------------------------
A0A2N9MK30      LL----------------------------------------------------------
A0A3D1ASD2      RL----------------------------------------------------------
A0A7R8B699      TL----------------------------------------------------------
A0A7S7SGU3      LL----------------------------------------------------------
A0A7Y8HY45      RL----------------------------------------------------------
A0A7C5AXI3      VL----------------------------------------------------------
A0A7C6E4H7      KL----------------------------------------------------------
A0A2Z5FVL3      GVALSAAPLRR-------------------------------DR-----------LLKQF
A0A2V8GFD4      NGKMTGEAYSKSTAVDETPLE---------------------RR-----------RVDAF
A0A2V8HSS5      NGKMTGEAYSKSTAVDETPLE---------------------RR-----------RVDAF
A0A2V8KP55      TEQASDDE----------------------------------GD-----------QLRSL
A0A2V9JSI3      ------------------------------------------IS-----------LINAF
A0A2V9WI32      ------------------------------------------SS-----------LLDRF
A0A2V9KBD6      ------------------------------------------DR-----------LVKLF
A0A2W0AJ66      ------------------------------------------DS-----------LVRAF
A0A1Q7RBU1      ------------------------------------------DR-----------LVESF
A0A2V9JPV9      ------------------------------------------DR-----------LVKSF
A0A7V0Y3A1      PVK---------------------------------------SV-----------AWDQS
A0A7C5Z4J3      ------------------------------------------AR-----------LIAAF
A0A1F2TPT3      WWSAASLFVSRAFGGFPPPPRAAEPLAGERPAE---------AP-----------QISAF
A0A2V8JTQ2      ------------------------------------------DA-----------LLQSF
A0A2V8UZY0      ------------------------------------------DR-----------LVKSF
A0A350UEK1      GAK---------------------------------------AR-----------AVEMA
A0A350UIQ4      DAR---------------------------------------QH-----------AIAMA
A0A7T9GJN6      QSPRIAKSSSPPNSPAAFSFETQVARSPQE------------TE-----------RLMPY
A0A7T9GJN7      TGRMIGDDTLKLERPKPDPVAILRERGSEE------------SK-----------RLAPY
A0A1H5Z7N3      ------------------------------------------QM-----------VLYTL
A0A1G7JVV8      ------------------------------------------AA-----------VIGKL
A0A1H4T6W9      ------------------------------------------TE-----------VLRRL
I3ZEU5          ------------------------------------------TD-----------VLQRL
A0A7W7ZGZ3      ------------------------------------------EK-----------TLHRL
A0A7G8BSK5      ------------------------------------------QQ-----------TIHTL
A0A428MDU2      ------------------------------------------QS-----------TVHRL
E8WVF6          ------------------------------------------QT-----------IVGIL
A0A1I6MH75      ------------------------------------------AG-----------TIRRL
A0A7Y9TM87      ------------------------------------------QK-----------TIRTL
A0A7W8J1H5      ------------------------------------------QD-----------TVHRI
A0A7Y9T5K4      ------------------------------------------QD-----------TVHRI
A0A852VHP9      ------------------------------------------QD-----------TVHRL
A0A7W8IFZ2      ------------------------------------------QD-----------TVHRL
A0A7W8J9Y9      ------------------------------------------QD-----------TVHRL
A0A7L5A6M5      ------------------------------------------EG-----------VIKTL
A0A5B9EBI2      ------------------------------------------QA-----------TLSRL
A0A7Y5RFT3      ------------------------------------------QA-----------TLGRL
A0A239HDF6      ------------------------------------------QG-----------TLLVL
A0A4Q0T270      ------------------------------------------QG-----------TIHRL
A0A1Q3QQB6      ------------------------------------------QA-----------TVHAL
A0A3N1K1G7      ------------------------------------------QS-----------TVHRL
A0A4V2G466      ------------------------------------------QR-----------TIHQL
A0A6B9YNQ8      ------------------------------------------QA-----------TIHGL
A0A3N6A5T6      ------------ALLKGRQPETPDSAENRLDKD---------EA-----------DLSAD
A0A2V8R8U7      IATP--PAQNPAAEQTVTMDEMKDR--QLTPEE---------LA-----------TLEPY
A0A7V9Q528      ------PPIKDAGIAVLDDAGFDDS-EKLTAEQ---------LE-----------RLEPY
A0A2V8QMP4      PTPT--PQPAAGGVPVLSDAELSAD--QIAPEQ---------AQ-----------ALEPY
A0A2V8R4S3      PTPT--PQPAAGGVPVLSDAELSAD--QIAPEQ---------AQ-----------ALEPY
A0A2V8NJ55      PAPAHVDKVPV----VVNPT-IKNE--QLSPEQ---------LE-----------RLEPY
A0A7V9ZQ50      PAPARVDKMVA----VVESTSVNAD--DLSPDQ---------LQ-----------RLEPY
A0A2V8Q7I0      AKPKISAPGPT-GLDVVRAAQLRDQ--PLSPEE---------LA-----------ALEPY
A0A2V8S6K4      AQTNEQPQPADGGLTVANEAAPGDE-LKLTPEQ---------LK-----------QLEPY
A0A317I2L9      RRTKAKPAEPT-KLELVGESQLRDQ--PLSPEE---------LA-----------ALEPY
A0A2V8LLF9      A-PASSPSTNA-TVEPISEEDLRSR--QFTAEE---------LT-----------QLEPY
A0A352FRF4      V-PKTSPTPAA-GSVPLNEEALNNQ--EFTPEQ---------LA-----------ALEPY
A0A7W1GE99      P----APLMDS-GVPVLSEGELDFG-EKLSVEQ---------LE-----------RLEPY
A0A1Q7YKQ8      T-TNASPATRT-NLPVISPERVTEQ--QLTPEQ---------LT-----------RLEPY
A0A0B6WXT1      K----EENEQG-KLQVVTDSEVDAE--NLTPEQ---------LA-----------KLEPY
A0A2V8MKV0      IAPAPAPAASS-GEQTITQDELIDKVNNLTPEE---------VV-----------RLEPY
A0A2V8PYY8      NAPSPAPATGS-SETTMSEDELKNKISNLTPEE---------LV-----------RLEPY
A0A3B9MEU8      K-ASESPAVSS-GLTVVGESEVTNG--SLTPEQ---------LA-----------ELEPY
A0A352F3R7      K-ATVAPAAPA-GLVVVGESEVTGD--SLTPEQ---------LA-----------ELEPY
A0A7W0GRF6      RNPDASASSAS-ALSVVGETEVADL--ALSPEE---------LA-----------KLEPY
A0A7W1H6G6      RNPDASASSAS-ALSVVGETEVADL--ALSPEE---------LA-----------KLEPY
A0A7V9HZC8      KKPDASPDSAA-ALSVVGENEVADR--ALSAAE---------LA-----------KLEPY
A0A7W0XCB9      NKPYVSPDSAT-ALSVVGENEVANR--ALGAEE---------LA-----------KLEPY
A0A3N5YNR8      NLRPGRSD-----APKTGADESGAGRDKN-------------RD-----------VLDTF
A0A7W7ZUJ7      AQTQSNGGI----AVSQSPAEE--------------------SY-----------RLESL
A0A2V2R0I6      SEAVAIGTL----ANQKRPPE-----------------------------------LGEF
A0A2V8XAR9      SEAMASGSL----ANQKRPPE-----------------------------------LGEF
A0A2V8VZA0      SEAVASGSL----ANQKRPPE-----------------------------------LAEF
A0A1Q7CB82      SEAVASGSL----ANQKRPPE-----------------------------------LAEF
A0A2V8WIU1      SEAVASGSL----ANQKRPPE-----------------------------------LAEF
A0A1Q6Y9F5      SEAVASGSL----ANQKRPPE-----------------------------------LAEF
A0A2V9EVV8      SEAVASGSL----ANQKRPPE-----------------------------------LAEF
A0A2V8YF91      SEAVASGSL----TNQIRPQE-----------------------------------LGQF
A0A2V8XZK2      SEAVASGSL----ANRTRPPE-----------------------------------LAEF
A0A2V8ZTX6      SEAVASGNL----ANQTRPPE-----------------------------------LAEF
A0A2V9BT79      SEAVANGNL----ANQTRPPE-----------------------------------LAAF
A0A2V9YHT3      FAPANAGAIPL--DSKLTPPQE--------------------SA-----------LIGRL
A0A7C2XNI7      AAAPAVTVPTTTGEPQPRPPI-----------------------------------LGAF
A0A1Q8B793      SEAVTTGSL----ANQNRPPE-----------------------------------LAAF
A0A2V9BCA0      SEAVTTGSL----ANQNRPPE-----------------------------------LAAF
A0A2V9BWU9      GKASKPASVPVNAANQARPPA-----------------------------------LGGF
A0A2V9DKX2      GKASKPASVPVNAANQARPPA-----------------------------------LGGF
A0A7C2YQY3      TAPFSPAE--------------------E-------------VM-----------LIGRF
A0A845TWB8      GVPFTAAE--------------------E-------------AN-----------LIDAF
A0A2U3KC61      --------------AMQPDPAR------E-------------AG-----------LLGAF
A0A2V9Y2R7      --------------ASQPNPGA------QGLSELKPNNDEETTA-----------LLAAF
A0A2V9NGH6      STSLELTT-----DILQPDSVK------A-------------SA-----------VLASF
A0A2V9PYE6      STSLGLTT-----DILQPDSVR------T-------------SE-----------ILAHF
A0A2V9NL07      ASSLALTT-----DAFEADSAR------A-------------NA-----------LLGAF
A0A2V9QD92      ASSLALTT-----DAFEADSAR------A-------------NA-----------LLGAF
A0A2V9WPZ6      ASSLNLAP-----DPLQTDSTR------T-------------SA-----------LLSAV
A0A2V9ZLH4      PNALGITT-----DELQINSSR------V-------------TN-----------LLGAF
A0A2V9RQF1      GNSLALTT-----DALQPDSEQ------T-------------TA-----------LLSAF
A0A2V9YDK8      ASSLNLAP-----DPLPTDSAR------T-------------SA-----------LLAGF
A0A2V9V8F7      ASSLNLAP-----DPLQTDSTR------T-------------SA-----------LLSAV
A0A2V9XGR9      ASSLNLAP-----DPLQTDSTR------T-------------SA-----------LLSAV
A0A2V9V3Q5      -PQPNLVA-----DPLQNDSKR------T-------------TA-----------LLGGF
A0A2V9NWS3      PNSVQLTT-----DSLQVDSQR------T-------------TD-----------LLSAF
A0A2V9USA9      -SSLELTP-----DPLQVDSAH------L-------------SS-----------VIGGF
A0A2V9XW18      SPSLDLT------DPLQIDPGR------A-------------SS-----------MIGGF
A0A1H5SQF5      ANATASGQ-----SLLETDPTY------R-------------DS-----------AVNLF
A0A2V8G155      VHTTNAGP-----PPPPPDETAL-----Q-------------SR-----------AVDAF
A0A2V8HDM7      VHTTNAGP-----PPPPPDETAL-----Q-------------SR-----------AVDAF
A0A2V8IVN9      KAPEPGIP--------DAGETSS-----Q-------------SR-----------AVDAF
A0A7W1SCW7      PEAGASTP-----KGADTEETAE-----Q-------------AR-----------AMDRF
A0A3E0NV31      GFFLDAAEAGLDLIKNGFRPRRRGEALSE-------------AG-----------ALRRL
A0A3N5M5V0      GLFSKSDS-----GAAAANRESMPGMAEN-------------RA-----------VIEKV
A0A7X7XDY5      QADSTIDPDLDVALADPDADEA------Y-------------SP-----------HSGIV
A0A2V9L5B5      KIPS-SDP-----GPPDTLTDA------Y-------------RN-----------SVTHF
A0A2V9LK56      RIPSPTED-------LDPSSEA------F-------------NN-----------SIANF
A0A2V9L7I0      KIPSISQP-----GLPDTSSDA------Y-------------VN-----------AIAHF
A0A522PPT0      KIPSASDP-----NPPDPNSDA------Y-------------LN-----------SVTNF
A0A7C5V1G5      HIPSPSDP-----NPPDPNSSA------Y-------------RN-----------SVANF
A0A4R1LC91      PPN----------APLEDSPHK------L-------------SH-----------MLKAF
A0A2V9QB26      RFSLWRKA-----SLPETKPSD------E-------------SG-----------AAQAA
A0A2V9VYY4      SPESAMGE-----PSMQPDPVQ------A-------------AG-----------LLGAF
A0A2V9KIE8      NVPSPTDN-----APPDVNSEA------F-------------TN-----------AVKHF
A0A7C2GJ20      -ADITTRV-----ADPDRQRVL---------------------------------LIDRF
A0A7C4BTL5      SAWRRALN-----LPESPEKDA------R-------------EA-----------ALTMA
A0A7X8YVF2      YAPAAPGA-----AGAWSPEEK------K-------------QA-----------AIDKL
A0A7X7YEP0      AGLTSQGG-----GSATADESL------V-------------AY-----------LAFAV
A0A2V9CBM2      SQTFTVGP-----IPA--DREL------Y-------------QR-----------VLERF
A0A2V8XN17      PQTFTIGP-----VSEARDREL------S-------------QR-----------VLERF
A0A2V8WX45      AQTFAIGP-----VPAGGDREL------S-------------QR-----------VLERF
A0A1Q6YR79      PQTFAIGP-----VPETRDREL------S-------------QR-----------VLERF
A0A1Q7VA32      PQTFAIGP-----VPETRDREL------S-------------QR-----------VLERF
A0A2V9EY85      PQTLAIGP-----VPEAPDREL------S-------------QR-----------VLERF
A0A2V9H8K0      TQTLATGP-----VPEVRDREL------S-------------QR-----------VLERF
A0A2V9FFE5      TQTFTVGP-----LPQVRDREL------S-------------ER-----------VLERF
A0A2V9GM43      TQTFAVGP-----VPQVRDREL------S-------------ER-----------VLERF
A0A2V8ZHL8      LAAGSGND-----GLPAQPQNS------E-------------DK-----------LLRLF
A0A2V9B240      LAVGLGND-----VPPVQLQVW------E-------------DR-----------LLGPF
A0A2V9CYQ5      SQTFTVAP-----IPA--DREL------Y-------------QH-----------VLERF
A0A2V9BWU8      KQAFALGP-----APVAHDSAV------Y-------------QR-----------VLERF
A0A2V8ZG48      KQTFALDP-----VRPGQDPEV------Y-------------QR-----------VLERF
A0A2V8Y334      NQTFALDQ-----ESSARDPEV------Y-------------QR-----------VLERF
A0A2V9AY68      KQTLALDP-----AGRARDPEV------Y-------------QR-----------ALGRF
A0A1F2RFI7      SQQLPAED-----LALDPK---------Y-------------YN-----------VLDNF
A0A1F2RZS3      PEGPLSPE-----EQLDPK---------Y-------------SA-----------VIDNF
A0A845TW47      ----------------RSRESV------D-------------QA-----------VLARF
A0A845TXC1      -QAFRLGA-----A-PESDPDT------R-------------QQ-----------VLLHF
A0A1F2USE2      APTLVVGT-----SEPEQDPAA------Y-------------QG-----------VLRRF
A0A7C2VB08      PDS-------------APGPEA------L-------------EA-----------TLASY
A0A2V9C238      AQSFTAGD-----T--ERDPWA------Y-------------QT-----------ALKRF
A0A1F2Q9F5      PQTFAVGA-----AGVARDPVA------Y-------------QN-----------ALETF
A0A1F2QQH9      PQTFAVGA-----AGVARDPVA------Y-------------QN-----------ALETF
A0A1F2QXK7      PQTFAVGA-----AGVARDPVA------Y-------------QN-----------ALETF
A0A2V9DEM9      PQSFTAGD-----T--ERDPRA------Y-------------QT-----------ALKRF
                                                                            

A0A2V7VMF7      F----VTH------V-GVEP---IPESR---------LVTVAVTHQDAKEAALWANTLAE
A0A2V7YYV7      A------K--------RIKATPQ-PNTT---------ILDIAVDDTNPALARNIANDLVD
A0A2V7Z0J5      V------K--------QVKVTPDATTAL---------VLHINVQDTNRARSRDVANTLVS
A0A2V7Z3M4      A------R--------QIKVTPD-TLAL---------VLHINVQDTNRARARDVANTLVA
A0A399Y5V2      VLGQ----------------------TS---------IIRVRARDASASLARDIANGVSA
Q01X01          AVDEVRKN------L-QIIS---SRGTS---------IIRIVAEAREPQLAADLANTLAQ
A0A3M2D9H8      -------Q------V-RVQQ---VRGAQ---------LIQIVVEDSDPQKAAEIANTLVT
A0A2V9IXG5      G----G-G------I-SLAP---VEDTN---------LLWLEFVADDPRKAADWVNLYVD
A0A2V9J2P4      G----G-G------I-SLAP---VEDTN---------LLWLEFVADDPRKAADWVNLYVD
A0A831T3F4      E----K-N------L-TVEQ---IPD---------TRALTISFMHTDPVIAASVANGIAQ
A0A2V8JK38      L----D-R------I-TVKP---LRQ---------SWLVEVTFQAKDPKLAAQVINAHGR
A0A7W0JWI4      R----A-H------L-LVEP---LIEKKMGYGRDNTRLINISYRHPDPQIAAKIVNTIAD
A0A1Q7RLS4      S------E------MIVVAP---VKETG---------IVEISMEGLNPEEVASWVNTISE
A0A257VBK0      R----G-M------T-KVDN---IRDSA---------LFRITVMAPYKADVAIWANAIAE
A0A7C5TWV7      L----G-R------L-KIEN---VKDTN---------ILELSMTGKDPDKVAEWLNVYVQ
A0A2V7XDY0      M----S-H------V-NVEP---IPESR---------LVLIHVTHRYPKEAALWANTLAD
A0A2G6PYV5      I----G-G------V-EIKE---VKDTN---------LVRISYTDTNPERAMILANTWVK
A0A1F2TCR2      I----G-S------I-NIIP---EQTTR---------LVSIQYRSPDPRFAALAANTIAE
A0A7Y9PHF8      S----D-AAVSLDGL-SVVH---PANSL---------LLNVSYRSADPAQAAAVANAVAH
A0A7W8J3G9      K----D-R------L-SAKQ---VGSTQ---------LISVSYRNPDPQMAATIANAAMT
A0A1F2V330      R----E-S------I-KIT----VEGSD---------SFHLAFEGRGRTQVMNVTNDLSE
A0A662EE63      L----G-G------L-TVKP---VAESN---------VIELSMIGRNPDRVAEWLNVYVE
A0A2V8TLH7      S----S-M------V-QVEL---IKDTG---------IMQITLDGPEPKEVQTWVNSVAE
A0A1Q7ZJT1      S----Q-M------I-VVAP---VKETG---------IVEISMEGLNPEEVASWVNTISE
A0A2V8VC99      S----S-A------I-EVEP---IKDTG---------IVVIGLEGLNPEEVAAWANAIAE
Q01XL7          A----R-G---------------VGATR---------LIELRCQSPSPEVAANFLNTLAA
A0A523DUV7      M----S-R------V-QVVP---IPDTR---------LAQIVVEHEDPREAARWADTLAE
A0A7W1TTH3      L----G-H------V-QIQR---RPISR---------LVNVSFDSRDRELAARAANALAV
A0A1F2U158      L----G-R------V-QVVP---VAESK---------LVDVYFTSADPQFAATAANALAD
A0A2V8F6S9      I----S-R------V-TVAP---ITGSK---------LVDVTFQSSEPKFAATAANALVD
A0A7V0UHS9      K----K-G------I-SIK----VESEH---------TFTIAYDGDEPRQVADVANALAR
A0A7D8BEX2      K----K-S------L-DIAH---VPKSE---------IISISATTHSGSLSANLVNTLIN
A0A4Q1SCH5      Q----L-A------L-KAKQ---EEGTQ---------LVDVSFRDQNPQMAALLLNHVVD
A0A7V4SJP8      A----A-M------T-KVET---VRDSA---------LFKITVSGPYKEDVAKWANMVAE
A0A372IRG7      Q----S-S------E-KVIV---ETGTQ---------IVEIHFQNPDPEVAAKVVNAIVQ
A0A2V8K4L4      A----G-G------I-NVKA---SGTTR---------IIEITSDSTDPQLAADFANTLVD
A0A2V8NCZ3      G----E-D------I-KVKG---SNTTR---------IIEITADSADPRLAADFANTLVD
A0A4Q7YNP3      A----K-H------V-TVKP---LGITR---------LVEITCDSWNAEFAARFCNTLTT
E8UZE1          Q----S-G------L-GVQL---ERGTE---------IVQIRYKSTNPALAATIANTVAA
A0A2V7YW66      R----G-G------L-SVAP---VRSTQ---------LVQLAYTAASPEFAAKAANAFSE
A0A2V7Z0V0      R----G-G------L-AVDP---VRNTQ---------LVQLSFRASSPEFAAKAANAFAE
A0A2V9M454      K----A-R------L-KVER---PKDTR---------MALVSFESTDPREAAAVVNGLVT
A0A2V9J4D6      D----S-Y------L-GVNL---HRNTH---------IVEVSFESTDRDLAARVVNALIN
A0A2V9L9C5      D----S-Y------L-GVNL---HRNTH---------IVEVSFESTDRDLAARVVNALIN
A0A2N9M9N1      K----K-H------L-HIEL---LTESR---------LVEVSFESVDSNLAARVANTLVK
A0A2V9JEC4      K----K-H------L-HVAL---MGNSR---------LITVSFESTDPELAANAANTLAT
A0A2V9LPQ3      Q----R-S------T-TVRL---MPNSH---------MMEVSFESTDPDLSAKVANTLIN
A0A7Y8IYX6      G----A-G------M-QIRR---IDGSQ---------IVKISYISFEPEFSALAANIIAE
A0A2V9IVR7      K----G-G------L-RVEI---MRNSR---------IAAVSFESPDPKLAAQVVNALVY
A0A2V9ILE2      K----G-G------L-RVEI---MRNSR---------IAAVSFESPDPKLAAQVVNALVY
A0A2V9LGY4      K----G-G------L-RVEI---MRNSR---------IAAVSFESPDPKLAAQVVNALVY
A0A7T9JJ28      Q----G-R------F-GVSI---GRQSR---------VATLTFDAYDPALAAEVTNTIAG
A0A7T9GE94      L----G-N------V-EVRP---VRETR---------LIEILYHHPVPDLARKIADTWAE
A0A7Y4X7L5      L----G-N------V-KFTP---VRDTH---------LVDIRFRHTDTEMARKIADKWAE
G8P0Y7          Q----G-N------L-TIQQ---IPDTT---------LVQVGYSDPSPALAAEIANGITA
A0A2W4RYA1      L----R-R------V-SVSP---VRNSR---------LVDVSFESPSAAFSMRVANALAK
A0A2V8EXP2      L----G-G------L-TVTP---IRNSR---------LVDVKFSSLSPMLSSQVANALAR
A0A843SYC7      A----S-H------L-TVAP---IRNSR---------LVDIRYELPDARLATSIVNMLAE
A0A7V9BJ09      L----S-G------L-SILP---DRKSR---------IVEIRYTSTDPAFAARAANAVAA
A0A7W1DT80      L----G-G------L-SIVP---DPKSK---------LVEVRYTSTDPQFAVAAANAVVA
A0A5M8T4U7      R----G-G------L-SVKL---VGGTQ---------MVDIRYRNHDPKLATDVVNTLMD
A0A7L5A491      --------------M-SVVH---PPNTF---------LIDISYRSPDPRLAADVANAVAH
A0A7D8BF18      Q----G-I------V-SISP---LPKTD---------IIRISCSTLDARLSADIVNRLVK
A0A1E3Y9R6      Q----A-G------V-SVVP---VRNSR---------LVDLRFRSPDPEFAARVVNQHAA
A0A2W4TLP2      Q----G-G------I-VVVP---IRNSR---------LVEIKFQSPDPEFAARVVNAHAE
A0A7G8BDY8      R----K-S------L-TVQS---IARTQ---------AVEITFRDANPILAREVVNRLSS
A0A7C4BZ42      A----G-S------L-TIKA---SGTTR---------IVEVLCDSPDPRLAADFANAIVA
A0A3R9WF43      R----K-N------L-KVDS---PPDTR---------LINVTFENPDPTVAALAANSLAK
A0A317HKM4      I----G-G---------------VKDTR---------LVNVGFRSTDPEIAARVANALAR
A0A2V9CG11      E----R-N------L-TVRA---AGNTR---------VLEVLYESPDPKLAADFANTLAS
A0A523E0N1      Q----A-M------A-NVSR---VKKTQ---------LMEVSFVSPDPELSAQLANSLVV
A0A1V6HR88      L----G-G------L-EVKP---VGQTQ---------MVDISYRSTDPALAARIANGVAE
A0A4Q1SDL1      A----A-N------L-KAES---VSGTR---------LIEIDFTNSDPKVAAAVVNHLIQ
A0A841JWG5      E----K-N------L-DVKV---LPGTR---------LIEIDYTSSDPKVAATVVNHLIR
A0A4R1LAZ7      H----G-A------L-KIMV---IPSTD---------VVEIHFSNPDPEVATNVANAIVD
A0A7G8BMP1      S----G-N------L-KIML---VPGTN---------LVEIRYRNPDPKLATSVTNAILD
A0A7X7ZKA6      L----G-R------L-TVRP---VRLTR---------LVDVAFEARDPKLAADCVNELAA
A0A523ECP2      A----G-M------L-QVTQ---IRNTQ---------LMELKFTSTEPKVAADLANALAR
A0A2W0C122      L----S-G------L-SVKT---IKNTR---------VVEVSFTGRYRDLNARIVNTLVD
A0A2W0AUU7      V----S-G------L-SVKT---IKNTR---------VVEVSFTGRNRNLNGRIVNDLID
A0A2W0BQL1      V----S-G------L-SVKT---IKNTR---------VVEVSFTGRNRNLNGRIVNDLID
A0A2V8ERZ5      I----G-R------V-SVDP---VRGSH---------LVDVSFVSEDPKFAAEAVNALIE
A0A7W8J413      E----K-S------L-TVES---PPDTR---------LITITFLNPDPVVAANVANAIAQ
A0A7W8JCF5      A----K-N------L-TVEN---PPDTR---------LITVTFLNPDPAVAANVANAISQ
A0A7W8IEB1      A----K-N------L-TVES---PPDTR---------LITVTFLNPDPAVAANVANAISQ
A0A7Y9T3I1      A----K-S------L-TVES---PPDTR---------LITVTFQNPDPVVAANVANAISQ
A0A3P0XH15      K----G-S------T-KIAT---KPGTQ---------LVEVRFRNQSPAVAASVSNAIVD
A0A3E0P0A3      R----S-G------L-SVQQ---VSGTQ---------LFNLTYSTGDPEIAMMLANGYAE
A0A3M1WQW8      L----S-G------L-RVEL---IRDTR---------IVKVTYESPDPQLAAQIVNALMD
A0A841JVA9      S----K-S------M-KVKQ---LGVTR---------LIEITCDSWDASFAARFCNTLVT
A0A3N1JHC1      V----M-D------A-KAKE---EGMSN---------LIRITLIGPDPHLAADTANELTN
A0A7V4XQR5      K----G-A------T-QVVL---VPETD---------LAEIHFQNQDPKVAQEAANQIVS
C1F294          K----G-A------T-QVVL---VPETD---------LAEIHFQNQNPKVAQEAANEIVN
A0A2V9KA79      R----A-R------I-QIT----VEGND---------AFYVSFEGTGAAQVRDVANRLAE
A0A348UZU3      L----G-R------L-EVKP---IRMTR---------LVEVAFKAHDPALASDCVNALFD
A0A7X9FXC4      L----S-R------L-EVKP---VRMTR---------LVEVDFKAHDPQLAADSVNALFD
A0A7X7ZKL5      Q----G-G------L-SVAP---IPETR---------LVYVSYVSTHAGLAADVVNALVE
A0A522PSP1      T----G-G------I-KTSQ---DPGTY---------LLNVSYRSSSPDQSAAVANALAE
A0A7W8E8D3      K----S-Q------I-NVLQ---VPSTQ---------LVTISFRNPNPQVAALLANRLIE
G8P085          K----S-Q------I-NVLQ---VPSTQ---------LVTISFRNPNPQVAALLANRLIE
A0A843SRW6      L----N-R------L-TVTP---VRNSS---------LVDVKVQSLDPVLAAQLANGLAA
A0A7W8E330      E----K-N------L-QVKV---LTGTR---------LIQVSYADPDPKLSAAIVNRLVQ
A0A4Q1SGQ1      E----H-H------L-KVKA---EPGTR---------LIDVSYADPNPYLATAVVNRLLS
A0A7V2HGP7      L----P-G------L-SVSR---PGNTQ---------VILVTYRSTDPVQAADIANSIAS
A0A7R8B6H7      A----K-T------I-AARP---IAGTR---------LVEISADSSDPVTAATFVNSLSE
A0A2V8GTX0      L----G-R------V-QVVP---VRGSR---------LVDVYFVSADPEFAARAVNVLAE
Q1ILD9          Q----L-G------L-DVTE---VPRTG---------IVQLRFRSSDPELAAAVVNELAE
A0A7G8BJH7      A----S-H------L-KVET---VTGTR---------LINVSYSSPDPRLAAEVVNHLTS
A0A2V8J0X9      L----G-G------L-SIRP---EPNSR---------LVKIVYSHSDPKFAALAANTVAD
A0A7Y5WWH8      L----G-G------L-AIRP---EPNSR---------LVKVVYSHSDPRFAALAANTLAD
A0A7C5SHM3      R----E-R------L-KVEQ---LEYSS---------VVGVSFRHSSPELAADVVNAVVH
A0A7V6D154      L----G-SPIKLRQL-KVKH---PPNTF---------LIEISYRSTDPELAAQVANAIAQ
A0A7V1XXZ2      K----G-G------M-RVQV---LPRTR---------VVEIRYESPDPKMAAQVVNTVIE
Q1IJZ6          G----K-A------L-TVTP---IPDTR---------LIQIAFEDPDPNFAAQVLNTLIG
A0A2V8TCE6      L----A-G------L-SIEP---VKDSN---------LVEVVYLSPDPRFCAQLANAVAD
A0A522TBE8      S----N-G------V-SVSR---PPASL---------LLNVSYQTQSATLAAQIANAIAN
Q1ITG0          S----K-A------L-RVEA---VPKTQ---------VIEIRFRSTDPALAAKVVNTLTS
A0A7C2ML20      L----A-G------L-QVKKPTDIYGQR---------VIGVSYTSTNARLSADVLNALFE
A0A7T9HIZ6      L----G-G------L-AVNP---VRNTQ---------MVDITFVSTSPELAARVANGVAE
A0A7C5AXS9      L----G-N------L-KAQV---LPQTR---------LVEVKFDSTDPEAAAKFLNVLAA
A0A7C2RGE3      L----E-N------L-KVEL---VRNTR---------VVAVTYSAHDPQLAARAVNELFA
A0A7V6D075      L----K-N------L-RVTH---PPNTY---------LIRISYRSTDPYLAAAVANEIAQ
A0A3N5PCI5      L----A-N------L-RILP---VRDTR---------IIEVRYESPDPELAARVVNTLAT
A0A3M1Q0S9      R----G-G------L-SVEP---IRDSQ---------LVTISFVHPDRVFAARVANALAE
A0A2Z5G448      R----S-N------L-QVVV---IPNTD---------LVEIHYRDPDPNQASRIAQAVVD
A0A3M1VZ38      R----A-G------L-SVDP---VRDSH---------LVEISFVHPDPRIAAEVANAIAY
A0A4Q1SD29      L----G-S------T-KVQV---LPNTE---------MVEISFRNPDPKVAMEGANGIVD
A0A833M5K2      L----G-G------L-EINP---LRGTQ---------LVEVSYRSRSPELASRVANGVVD
A0A1F2Q9L4      L----G-G------L-EVNP---IRNTR---------LVEVSYVATTPELAARIANGVAD
A0A7V5ZKV2      L----G-G------L-EVNP---IRNTR---------LVEVSYRAPTPELAARVANGVAE
A0A7Y8LRQ1      L----A-G------L-EVNP---VRNTR---------LVEVSYRAPTAELAARVANGVAE
A0A3M1PY35      G----A-G------L-DVAP---LEKSN---------VVRVSYRHRDPEIAARIVNAVVR
A0A3M1VMP2      R----D-N------L-DTEQ---LEYSS---------VVRVSFTHPSPEIAANVVNAVVD
A0A1F2T595      L----A-N------L-GVSA---VRYSR---------LVDVSFRSADPGLAAKVANEHSK
A0A2V9AC41      L----S-K------L-HISP---VGGTS---------LVKVRFTTPDPALSARLANAHAN
A0A2V2R525      Q----S-G------L-EVEQ---VGKTR---------LVEIRYTHRDPHVAAKVVNAIAD
A0A321LPW6      D----K-N------L-SVEP---IRDTR---------VIKVVFTHTDPKLAAEVVNAVTQ
A0A2V9R9V4      E----E-S------L-RVRP---ILDTR---------AMTLTFKHTDPVIAAGVANAIAQ
A0A321LE75      S----G-N------L-SPEP---LEDTR---------LLVINYSHTDPKLAATISNTVAA
G2LEI9          A----S-G------L-QAYN---VPRTR---------LVRITFQHHDPETTKAVVNTVAE
A0A7V9TW03      Q----G-M------V-DVEQ---VKKTY---------LIDLRATHTDPAVATKVVNAMAD
A0A3N5XQP8      L----S-D------L-QINP---VLESR---------LMDVSFSSPSPKFAAMVANAWVE
A0A2V9KCS3      A----AAS------V-SVRS---VNETR---------IVEILCDSTDPKFAADFANTLVS
A0A7W1JC10      R----G-G------L-EVNR---VKDTR---------HIDIRFKHLDPQVATKIVNTLAA
A0A3M2BZG9      Q----S-G------L-VVNP---IRDTQ---------LVELTYRSDKPELAARIANGYAQ
A0A1Q7N5R7      S----D-G------L-RVSP---DLSGN---------FLRIALTGPSATGVTGVVNAVAD
A0A352F549      Q----G-L------V-DVEQ---VKKTY---------LIDLRATHTDPVVATKVVNAMAD
A0A3B9MLP9      Q----G-M------L-DVAQ---LKKTR---------LIDIRASHTDPGVAAKVVNAVAD
A0A3D5SQ87      Q----G-M------L-DVAQ---LKKTR---------LIDIRASHTDPGVAAKVVNAVAD
A0A7Y2DUG3      L----G-G------V-SVAQ---EQRTN---------IVNITVVNKNPVLAATVANGLAT
A0A7Y2D8Q4      A----R-K------L-SVEQ---VSRTN---------LVKIMVQDENPNLAAELATAVAK
A0A2V8NW86      A----AES------L-KARA---SGLTR---------VVEASYDSTDPRFAAAFLNTLVQ
A0A3M2D491      A----G-S------V-DAIQ---EERTN---------LFSVKVVHTNPELAARLANAIVG
A0A7W1CBZ8      L----N-G------L-RVDQ---VERTN---------IFHVSVQSPYPLLAAEVSDMVGE
A0A7W1FC90      L----G-G------L-RVVQ---IERTN---------IINIFVQNTNAELAAKTADMVSA
A0A7W1ZXG0      L----G-G------L-RVVQ---IERTN---------IINIFVQNTNAELAAKTADMVSA
A0A7W1ZIT3      L----G-G------L-RVVQ---IERTN---------IINIFVQNTNAELAAKTADMVSA
A0A353C9L6      F----S-G------L-TVDQ---VERTN---------LVNVRVKSTNQALAPKVADKIAE
A0A2V8RQV0      I----G-R------L-QIVP---QERTN---------LVNVTIQNEDPALAGKVTDEIAA
A0A2V8SJH5      A----G-R------V-TVQP---KERTN---------LVNVSVTTPKAELSARVADKVEE
A0A136JPP4      S----G-G------L-HVEQ---TERTS---------LFTLTINSTNPQIAANVANKVGE
A0A399WUJ8      S----G-G------L-RVDQ---TERTS---------LFTVSVSSTNPQLAAAVSDKVAE
A0A7V9C3X9      L----G-G------L-TVEQ---REKTN---------LVNVSIRSTNPVLAAKVADKVAE
A0A7V9ZSX9      L----S-G------L-DVDQ---VERTN---------LVNITVKSTNPGLAAKVADKVAE
A0A3M1SIV3      L----P-G------V-DVVQ---EERTN---------LFSINVANSNPELAAILANTIAE
A0A7V1SCI4      L----P-G------V-DVIQ---EERTN---------LFSINVTNSNPELVAILANTIAE
A0A7C5ZUA8      L----G-G------L-SVEQ---VEKTN---------LVDISVRSTNPELAAKVSLKVAE
A0A7T9FQE4      V----G-G------L-RVEQ---VERTN---------IVNISVTSTKPEIAAKVADKVAE
A0A3E0PHB0      V----N-S------L-VVEK---VEGTN---------LVKLTMNGSDPELIRRVADTLTE
A0A7T9G4W3      S----G-M------L-SVEK---VETTN---------LVNLTLRGSEPELIQQVADTLAE
A0A838UAA0      G----GNN------L-KVEI---VPDTL---------LVTVSVQTTNAAVAAKVSDALVE
A0A7W1HTU2      L----S-N------L-EIEK---VKDTN---------LVNVSVKSPKPELAAAVANKVAD
A0A357F267      R----G-G------L-SVEQ---RERTN---------LVNVSIRSTNPDLAARVADKVAE
A0A7V9ICU8      A----S-R------L-SVNQ---RERTN---------IVMITASHTNPQIAAVVADKVAE
A0A7T9JEF9      K----Q-N------L-SVNP---VKDNR--IASKETRLIQIDYKHFNPEVAAGVVNTIAD
A0A399WNU1      K----R-N------L-EVSP---VKDSR--TATKETRLIRIEYRHYDPVIATKLVNAIAD
A0A3E0PCN7      R----G-N------L-SVNP---VRDNR--TAAQETRLIEVQFTHFRPEVAAKIVNTLGE
A0A7Y4TLV3      K----G-G------L-LVNP---VKDNR--TMNRETRLIKVEYTHYDPLLATKIVNTVAD
A0A7W0MGQ3      Q----A-S------L-DVNP---VRETR--VQSRDTRLIDVRFKHPDPQVAAKVVNAIVE
A0A1Q7Y6W9      Q----G-G------L-KVDP---VKETR--LLIKETRLIDISFTHQDPQVAAKIINALAD
A0A2V8NC68      Q----G-G------L-SVKE---V---------NETRIIELRYRHLDPEVATKIVNTIAD
A0A352FLX4      Q----E-T------L-KVEP---VKETR--LTVRETRLIDISYRHSDPHLAAKIVNTVAQ
A0A2V8MHG6      Q----S-Q------L-SVKQ---LSDTR---------IIEIRFKHQDPEIAEKINNTIAD
A0A2V8P7N1      Q----S-Q------V-SVKQ---LSDTR---------IIEIRFKHQDSEIAEKINNTIAD
A0A2V8M3M6      Q----S-Q------V-SVKQ---LSDTR---------IIEIRFKHQDSEIAEKINNTIAD
A0A1Q7NJH5      Q----S-Q------V-SVKP---LSDTR---------IIEIRFKHQDSEIAGKINNAIAD
A0A2V8PJY0      Q----S-Q------V-SVKP---LSDTR---------IIEIRFKHQDSEIAGKINNAIAD
A0A7W1BYD3      Q----G-G------L-EIYR---VKDSR---------LIDLRFRHLDPRVAAKVVNALAA
A0A838PIP9      Y----G-G------L-EVNR---VKDSR---------LIDVRFKHLDPRVTAKIVNTLAA
A0A399WK13      R----R-N------L-SVDP---VRESR--ATVKDTRLIEISYSDTDPDLAAFVANAIAE
A0A7V8YZQ7      R----N-N------M-DVQP---VRESR--VTTKETRLIQITFLNTDPELAAYVVNGIGE
A0A7V9ICV8      R----T-S------L-NVDP---VRETR--ATVKDTRLIRISFQHTSPELAAFVVNGIGE
A0A136KC10      R----R-S------L-SVDP---VRESR--ATVKDTRLIEISFNSTDPALAAFVANAIAE
A0A7W1IVA5      K----K-N------L-GVEP---VRETR--TTNKDTRLIEVSFRHTNPELASFIVNGIGE
A0A7W1ZIE3      K----K-N------L-SVEP---VRETR--TTNKDTRLIEVSFRHTNPELASFIVNGIGE
A0A7T9J551      K----R-N------L-DVEP---VRETR--SSVRDTRLIDITFRHTSAEVAAFVSNAIAG
A0A7V9NLN0      K----D-N------V-GVEP---IRESR--VTNKDTRLIQVTYRHTNPELAALVVNGLGE
A0A7T9G8R2      K----R-D------L-IVDP---VRESR--ATVKDTRLISISYRNTDPNLSAYVVNGIAE
A0A7Y2D047      N----R-S------L-SVDP---VRESR--ATVKDTRLIAVSFRHTDPDLAAYVVNGIAE
A0A3M2D6Y5      K----K-K------L-QVEP---VRESR--ATFKDTRLIEVRFQHTNPELAALVVNGIAE
A0A2V8SEX6      R----K-N------M-SVEP---VRESR--ATVKDTRLIEISFRHTNPQLAAFVVNSIGE
A0A7C5ZUU4      K----P-N------L-SIEP---IRESR--ATFKDTRLIELSFRHTDPKFAAFLVNAIGE
A0A3E0PCJ6      Q----R-D------L-IVDP---VRESR--ATVKDTRLISISYRNQDPNVAAFVVNGIAE
A0A2V8RTL7      K----E-D------L-IVEP---VRESR--ATVKDTRLIEISYRNTNPELAAFVVNAIGE
A0A3M1S4R8      K----K-N------L-RVDP---VRVSQ--ATFKDTRLIEISFQHTNPELAALIVNGIAE
A0A7V1SAJ0      K----K-N------L-RVDP---VRVSQ--ATFKDTRLIEISFQHTNPELAALIVNGIAE
A0A7W0N726      K----D-V------M-VIEP---IRESR--VTSKDTRLIQVSYRHTNRELAALVVNGLGE
A0A7W1HTZ7      K----K-N------L-VVEP---VRESR--TTNKDTRLIEIAYRHTDPKLAAFVVNGISE
A0A1Q7YFI6      Q----G-G------L-SIKE---ITDTR---------LIEIHYTHPDPQVAAKIVNSIAD
A0A7V9C9Y7      Q----A-N------L-QVDP---VKESR--LQNRDTRLIDINFKHSDPQVAAKVVNAIAD
A0A7W1G8A4      R----R-G------L-KIEP---VKETRTGSWVKDTRLIDISFTHADPQIAAKIVNAVAD
A0A7V9KMZ1      L----L-A------L-KVVP---VKETR--GYYKETRLIDVNFTHTDPQFAAKVVNAIAE
A0A7W0JTE4      L----L-G------L-KVEP---VKETR--GYFKETRLIDIRFTHYDPQVAAKVVNAIAE
A0A0B6WWQ6      A----S-S------L-KVDP---VKEVR--LPVKETRLIDISFRHPDPYVAATVVNTIAE
A0A3B9MK99      L----G-G------L-RVEP---VKESR--GLFKETRLIDLSYTHIDPEVASKVVNAIAE
A0A838PA20      L----G-N------L-RVNP---VKETR--GYYKETRLIDVSFTHTDPQVAAKVVNAIAE
A0A352EX26      L----G-G------L-RVDP---VKESR--GLYKETRLIDIGYTHTDPEVASKVCNAIAD
A0A7V9R410      L----G-G------L-RVDP---VKESR--GTFKETRLIDISYTHTDPEVASKVCNAIAD
A0A2V8MM59      Q----G-G------L-KVEP---VRESRA-GYYKETRLIDITYQHGDPEVAARVANCVAE
A0A2V8PFE8      Q----G-G------L-KVEP---VRESRA-GYYKETRLIDIVFQHGDPEVSAKITNAVAD
A0A2V8PWS6      Q----G-G------L-KVEP---VRESRA-GYYKETRLIDIAFQHGDPEIAARITNAVAE
A0A2V8LCT5      L----G-G------L-RVDP---VRENRA-GYYKETRLIDIDYQHGDPEIAAKVVNCVAE
A0A352FTJ9      A----A-G------L-RVEP---VRENRA-GYNKETRLIDIDYQHGDPEVAARVVNAVAQ
A0A1F2S1W5      L----A-A------L-DVSA---VRYSR---------LVDVSFRSNDPALAARVSNALAD
A0A2N9LQU7      H----D-A------E-KLEV---LPKTR---------VIEIRFQNVNPKLASDVVNGIVD
A0A2P6WFK7      K----Q-S------L-SVRV---LPNTQ---------IVEVLFRCTDPKLATDVANAVVE
A0A2V8JQV5      A----A-T------L-QVEA---LQQAH---------IIQITADSTDPKIAAEFLNTLTD
A0A2V8U914      ADVARK-H------L-KIEP---ARDSQ---------IIRVAFDAHDPQLAADFANTLAR
A0A2V8DRT9      L----S-N------L-TISP---IRNSR---------LVEIEFASPYPYVAANVANSLSK
A0A2V7VYF3      L----G-G------L-VINP---VKNSR---------LVDVVYRSPDPVFATTIVNELAH
A0A1F2SVH2      L----R-A------L-TVAP---VRNSR---------LVDVRFDSPDAAFSATVANALAR
A0A2V8AJG9      L----K-D------L-TVSP---IRNSR---------LVDVKFESPSAALSAQVANGLAK
A0A2V9MAM9      K----D-R------L-RIEP---SKQGR---------IIRILCDATDPQLAADFANALAQ
A0A2V8F956      E----N-A------L-TIAP---VRNSR---------LVDLKFDLPDGALAATIVNALAK
A0A2V7W309      AGGLLG-G------V-NIAP---KHGTN---------LIVITYTGSSPKLAQKIAEAWGD
A0A348V070      I----E-S------L-NVSP---LTGTK---------LIQVSFNHRNPELAAEVLNTLLD
A0A2Z5G3A3      S----K-N------L-TVTP---VVGTR---------LIQISYVSSDRKLAESVVNALAQ
A0A2V7UGP8      IQFVLS-G------L-DINP---LKNTH---------LVEISFVSVDPELSSRIANAVAN
A0A239MKT6      H----K-G------L-QVEV---LKSTR---------LLAVSYTDTDRNRASKIANYVVQ
A0A2Z5G7H4      D----A-N------L-NVKV---VSGTR---------LIEVRFLSSDPVLAAKVVNQLMD
A0A372IT17      A----R-H------L-TVQP---VTGTR---------LIEIRYSDPDPALAARVVNRLVQ
A0A841JU67      A----S-H------L-KITP---ETGTR---------LIEIRYSDPEPRLAAEIVNRLIQ
A0A7T9GJJ6      VGILQN-N------L-QVEQ---ISDTS---------AIELKFIHTNPAVAATVANGVAR
A0A7Y4UER8      VNALKG-R------L-AATV---VKDTR---------IIELSFTHNDPRLAADVVNAVAK
A0A2V8IYW3      R----T-E------V-DVDP---PVKDD---------TFKISYVSGDPVVAMKVVARLAS
A0A7V2HCZ0      P----P-A------TSTIRT---FGAAR---------IMEIQVESPDPKFAAAFANTMAR
A0A2V9AEW6      E----R-N------L-TVQS---SGSSR---------LLEVLYESPDPKQAADFANTLVS
A0A2V8WQK6      K----R-N------L-TVRT---SGNSR---------LLEVLYESPDPQRAADFANTLVS
A0A2V8XIF4      Q----R-N------L-TVRE---SGNSR---------LLEILYESPDPKLAADFTNTLVS
A0A350UQT3      L----R-N------L-KVAR---PPNTY---------LLQVSYRSPDPQLAADVANQVAQ
A0A7C3HRX0      L----K-N------L-RVSR---PVNTT---------LLQLSYRSDDPRLAADVANSLAQ
A0A2W0BGU4      K----R-Q------L-SVEL---VPGSR---------VVLVGFESRDPELAARIANTQVE
A0A2W0BVQ9      K----R-Q------L-SVEL---VPGSR---------VVLVGFESRDPELAARIANTQVE
A0A317J121      LNVALA-T------F-DARP---INGTR---------IIEITCDSTSPDIAANFVNTLAN
A0A2V9MN96      R----S-G------L-TVQV---MPRTR---------VIEITYIHPDPQLAAEVTNALVK
A0A2V7V2Z1      L----G-K------L-KVVP---IKSSR---------LVMVSYESFRPEMAAAAANGLSK
A0A2V7X2F7      L----G-R------L-RINA---GKGTR---------LVGVGSEAFRPDLAMNVANKLSQ
A0A2V7V2I1      L----S-R------V-KVQP---VRNSR---------LVLVGFEAYRPELAAQAANKLSQ
A0A2V7U3M2      L----R-K------L-RVLP---VKNSR---------LVLVAYESYVPEMAAAAANWLSQ
A0A2V7UHT0      L----R-R------L-RVLP---VRNSR---------LVTVTYESYRPDMAAAAANRLSQ
A0A3P0X3W6      -----P-G------L-TITH---PASSL---------LLKITYRSKDPRKAADVANAVAH
A0A7V2MG68      -----K-K------L-KVTR---PPNTY---------LILISYRSKDKKLAAAVANGIAQ
A0A7C6A629      -----K-N------L-KVTR---PPNTY---------LLLVSYRSPDPRLAAEVANAIAN
A0A7V2HBQ5      -----K-N------L-RITR---PPNTY---------ILLVNYRSTDPELAARAANAIAQ
A0A2U3JZ71      -----K-N------L-KVSR---PPNTY---------LLLISYRSTDPRLAADVANGVAR
A0A2V8TTB0      -----K-Y------L-KITR---PPNTY---------LLLISYRSPNRQLAADVANAIAL
A0A2N9MK30      -----K-Q------L-KVTR---PVNTY---------LLLISYRSPDRRLAADVANAIAR
A0A3D1ASD2      -----K-R------L-EVIR---PPNTY---------LLQITYQSANPRLAAEVANGVAN
A0A7R8B699      -----K-K------L-TVTR---PPATY---------LLEVAYRSSDADLAANVANAVAK
A0A7S7SGU3      -----K-Q------L-KVTR---PPNTY---------LLQISYRSTDPQLAADVANQIAQ
A0A7Y8HY45      -----K-N------L-RVTR---PPNTT---------LLQVSYRSTDPRLAADVANQVAQ
A0A7C5AXI3      -----K-R------L-KVSR---PPNTY---------LLLISYRNTDPQLAAAVANAIAA
A0A7C6E4H7      -----P-N------L-KVTR---PPNTY---------LVLVSYRSPDPRLAAEVANAIAN
A0A2Z5FVL3      Q----E-N------L-EVKI---IPGTR---------VIEVAFSSSDPNLAARVVNQLVA
A0A2V8GFD4      L----G-A------L-SIVP---VRNSR---------LVDIVYSSPDPKFATAAANAIAK
A0A2V8HSS5      L----G-A------L-SIVP---VRNSR---------LVDIVYSSPDPKFATAAANAIAK
A0A2V8KP55      IDQYLD-R------I-TVKP---LRQSW---------LVEVTFQAKDPKLAAQVINVHGR
A0A2V9JSI3      R----D-H------L-RVEW---VRNSR---------MLEVSFEARDPRLAAAVANALVS
A0A2V9WI32      R----R-G------L-KLNV---VPRTR---------IVEIHYSHPDARLAAQIANILIN
A0A2V9KBD6      H----K-S------L-DISK---VKGTR---------LIQIRFRSPDPQLAADVVNGLAK
A0A2W0AJ66      H----K-N------L-AISN---VRGTR---------LIEIKFRATDPRLAADVVNYVTK
A0A1Q7RBU1      H----K-N------L-TISK---VKGTR---------LIEIQFRNTDPRLAADVVNELAR
A0A2V9JPV9      H----K-N------L-TISK---VKGTR---------LLEIKFRNTDPRLAADVVNQLTK
A0A7V0Y3A1      VAMAAG-T------L-RAQA---GRESN---------VLTIQADSPNPLAAADFANMLIE
A0A7C5Z4J3      K----K-S------L-HIDL---VPGSR---------MIQVSFESTDPNLAAEAANALVS
A0A1F2TPT3      L----G-G------L-SLAP---TANG----------VLDIKYRSSDPVLAARFANAHAQ
A0A2V8JTQ2      H----K-G------L-EISK---VKGTR---------LIEIQFRSTDPQLAADVVNGLAK
A0A2V8UZY0      H----K-S------L-RISK---VKGTR---------LIEIKFRSTDPRLSADVVNSLAK
A0A350UEK1      A----D-T------L-KVRA---SGQTR---------IVEVLVDSTDPAVAASFANRLTA
A0A350UIQ4      A----D-S------L-KVRA---SGQTR---------IVEVLVDSTDPAIAAQFANLLTS
A0A7T9GJN6      VDLLQN-Q------L-FAEP---IEDSR---------MLTISIEHTDPQLAATIANTMAK
A0A7T9GJN7      VGILKS-K------L-NVEA---IEESN---------VLRIYFDHTDPLIASDVVNTAAN
A0A1H5Z7N3      R----A-D------V-NVSV---IAKTD---------LIHISCQTFSADLSAEIVNKLIR
A0A1G7JVV8      S----N-A------F-KVAS---IPRTQ---------MIRITVTANKAQLAADLVNHLIN
A0A1H4T6W9      G----G-A------V-VATV---IPRTA---------MVRITCTASKPQLAADIVNQVIN
I3ZEU5          G----N-S------V-NASI---IPRTA---------MIKITCTASRPQLAADIVNQVIN
A0A7W7ZGZ3      H----S-E------L-KIQL---VPKTD---------IIRLNYSSLDRKLSADIVNRVIA
A0A7G8BSK5      K----A-G------L-HIAQ---VQKTD---------IIRISYQSLSAKLATDIVNKVIA
A0A428MDU2      Q----S-N------L-HITL---VPKTD---------IIRISYTCLSAKLSADIVNTVIA
E8WVF6          Q----K-N------L-KVTL---VPKTD---------IIRIAYSSLDPKLSADVVNKVIA
A0A1I6MH75      N----G-H------L-KVSL---IPKTE---------IIAISYTSLNAKLSADIANKVVS
A0A7Y9TM87      Q----A-N------L-TVQL---IPKTD---------IIRLTYSSLSPKLSADIINKLIA
A0A7W8J1H5      Q----S-N------L-HVSI---VPKTD---------IISISYRSLNPKLSADIVNKVIS
A0A7Y9T5K4      Q----S-N------L-HVTV---VPKTD---------IIRISYSSFSAKLSADIVNKVIS
A0A852VHP9      Q----S-N------L-HITI---VAKTD---------IIRISYSSLNAKLSADIVNKVIS
A0A7W8IFZ2      Q----S-N------L-HVTI---VAKTD---------IIRISYSSLNAKLSSDIVNKVIS
A0A7W8J9Y9      Q----S-N------L-HVTI---VAKTD---------IIRISYSSLNAKLSSDIVNKIIS
A0A7L5A6M5      K----G-N------L-TVAL---VPKTD---------IIKISYSSLNAKLSADIVNKLIA
A0A5B9EBI2      K----A-N------L-TVSI---VARTN---------LITINYRSLDAHLSANIINTLIK
A0A7Y5RFT3      K----A-N------L-TVSI---VARTN---------LITINYRSLDPHLSANIINTLIK
A0A239HDF6      S----S-N------L-KIAM---QPRTN---------ILRLSYSSLDGKLSAEIVNTVIS
A0A4Q0T270      Q----S-S------L-RIQL---VPKTE---------IMRISYSSLSPKLSADIVNKVVS
A0A1Q3QQB6      Q----S-G------L-RIVL---VPKTE---------IINISYSSLNPKLAADIVNKVIS
A0A3N1K1G7      Q----S-N------L-HITL---VPKTD---------IIRISYSSRSPKLSADVVNKVIS
A0A4V2G466      L----G-G------L-RIAQ---VQKTE---------LIRISFQSLSPKLASDIVNKIIS
A0A6B9YNQ8      L----A-N------L-VISQ---VQKTE---------IIRISYRSLSPKLAADIVNKIIS
A0A3N6A5T6      VDRFLG-S------L-QVQP---IRGSR---------LVEVSYASHDARLAATIVNTLAD
A0A2V8R8U7      EDAIIA-N------E-TIEP---IIGTS---------LVTIRYQHTDPALAQRIANTLAD
A0A7V9Q528      EDTLRA-N------L-TVAP---VEKTN---------LVKILFTHPDPEIAMKVADTLAA
A0A2V8QMP4      EDAMRA-G------L-NIDA---VEKTN---------LVEIHFQHTDPEIAASVANTLAT
A0A2V8R4S3      EDAMRA-G------L-NIDA---VEKTN---------LVEIHFQHTDPEIAASVANTLAT
A0A2V8NJ55      EDALRA-S------L-TVEP---VEKTN---------LVTIRFRHSNPVIAMKVADTFAQ
A0A7V9ZQ50      EDTVRG-N------L-TVEP---VERTN---------LVNIRFRHSNPEIAMKVSDTLAR
A0A2V8Q7I0      EDTIIA-N------E-DIDG---IVHTN---------LFTIKYKHHDPEMAQKIANTLAE
A0A2V8S6K4      EDALAG-N------L-TVDP---VERTS---------LVDIHFKHTDPELARQVADTLAA
A0A317I2L9      EDAIIG-N------E-QVDG---IVNTN---------LFVIKYKHHDPDIAQKVANTLAE
A0A2V8LLF9      EDAIAA-G------E-TVEA---VEKTS---------LVTIHFQHTDPELAQKIANTLAD
A0A352FRF4      EDTITA-N------E-IIEP---QPQTN---------LVIIRYRHTDPALAQKIADTLAE
A0A7W1GE99      EDTLRA-N------L-VVDP---TEKTS---------LVDIRYQHPNPEIAMRVADALAA
A0A1Q7YKQ8      EDALAG-N------L-TVEP---VMTTN---------LVMLKFTHSDPVLAQKIVNTFAD
A0A0B6WXT1      EEAILA-G------I-TVEP---VEKTN---------LVNIKFQHSDPEMAAKVANTIAD
A0A2V8MKV0      EDAITA-N------E-EVDT---VEKTN---------LVSIRYHHSDPALAQKVANTLVD
A0A2V8PYY8      EDAIIA-N------E-DVGI---VEKTN---------LVTITYHHNDPALAQKVANTLVD
A0A3B9MEU8      EDAIIA-G------E-TIEP---VPTTN---------LVKIKFMHSDPELAQKIANTLAE
A0A352F3R7      EDGIIA-G------E-AVEA---VTNTN---------LVKIRFVHSDPELAQKIANTLAE
A0A7W0GRF6      EDAIIA-G------E-TIEP---IQKTN---------LVKIKFAHSDPELAQKVANTVAE
A0A7W1H6G6      EDAIIA-G------E-TIEP---IQKTN---------LVKIKFAHSDPELAQKVANTVAE
A0A7V9HZC8      EDAIIA-G------E-TIEP---ILATN---------LVKIKFAHSDPELAQKIANTLAE
A0A7W0XCB9      EDAIIA-G------E-TIEP---IPMTN---------LVKIKFAHSDPELAQKIANTLAE
A0A3N5YNR8      R----D-R------L-EVAQ---VPNSR---------LVEIRWVSPDPTLAAAVSDTLAE
A0A7W7ZUJ7      IRKLQG-N------L-TIQQ---IPDTT---------LVQVGYSDPSPALAAEIANGITA
A0A2V2R0I6      L----G-S------L-SVKR---VPNSR---------LMDVSFESTDPQLGARIVNAHIN
A0A2V8XAR9      L----G-S------L-SVKR---VPNSR---------LMDVSFESTDPQLAARIVNAHIA
A0A2V8VZA0      L----G-S------L-SVKR---VPNSR---------LMDVSFESTDPQLAARIVNAHIA
A0A1Q7CB82      L----G-S------L-SVKR---VPNSR---------LMDVSFESTDPQLAARIVNAHIA
A0A2V8WIU1      L----G-S------L-SVKR---VPNSR---------LMDVSFESTDPQLAARIVNAHIA
A0A1Q6Y9F5      L----G-S------L-SVKR---VPNSR---------LMDVSFESTDPQLAARIVNAHIA
A0A2V9EVV8      L----G-S------L-SVKR---VPNSR---------LMDVSFESTDPRLAARIVNAHIA
A0A2V8YF91      L----G-S------L-SVKR---VPNSR---------LMDVSFESTDPRLAARIANAHIA
A0A2V8XZK2      L----G-S------L-SVRR---VPNSR---------LMDVSFESTNPQLAARIVNAHIA
A0A2V8ZTX6      L----G-N------L-SVKR---VPNSR---------LMDVSFESTDPRLAARTVNAHIA
A0A2V9BT79      L----G-N------L-SVRR---VPNSR---------LMDVSFESTDPRLAARTVNAHIA
A0A2V9YHT3      R----G-S------L-QVSS---IPNTR---------MIELRFSDPAPRETARVLNVFMD
A0A7C2XNI7      L----A-R------L-EIKR---VPNSR---------LLEVQFESTDPQLAARVVNTHLH
A0A1Q8B793      L----G-S------L-TVKR---VPNST---------LLDVAFESTDPRLAARVVNAHIE
A0A2V9BCA0      L----G-S------L-TVKR---VPNST---------LLDVAFESTDPRLAARVVNAHIE
A0A2V9BWU9      L----G-S------L-RVKR---VPNSR---------LLDVTFEAGDPKLAARVVNVHLE
A0A2V9DKX2      L----G-S------L-RVKR---VLNSR---------LLDVTFEAGDAKLAARVVNAHLE
A0A7C2YQY3      K----G-G------L-NVQL---IRTSR---------LVEVRFESADPKVCSDVPNTLAQ
A0A845TWB8      K----S-R------L-RVEA---VRGSR---------LVDVHIESTDPKLAADMANTLAD
A0A2U3KC61      R----G-G------L-SVQI---IPNSR---------LVQISYTHPNPRLAEAIVNKLVD
A0A2V9Y2R7      H----S-G------L-SVRV---IPRTR---------LLELRYIHQDPVLARDIVNKLAK
A0A2V9NGH6      K----S-D------L-KVLL---KPNTR---------IIEIRYRSTDKDSAARVVNTLIN
A0A2V9PYE6      K----S-D------L-KVSL---KTNTR---------IIEIRYRSTDKGLAARVVNALIN
A0A2V9NL07      K----G-G------L-HVVL---EPNTR---------IIDIHYRSPNKELAARVVNTLAN
A0A2V9QD92      K----G-G------L-HVVL---EPNTR---------IIDLHYRSPNKELAARVVNTLAN
A0A2V9WPZ6      K----G-S------L-RVSL---VPNSR---------IIELHYRSPNQELAATVVNTLAT
A0A2V9ZLH4      K----G-N------L-KVTL---QPNTR---------IIEIHYTSPNKELAATIVNTLVN
A0A2V9RQF1      K----G-N------L-RVAL---QPDSR---------VVDIHFRSPDRQLAAHVVNALTS
A0A2V9YDK8      K----G-N------L-RVSL---LPNSR---------IIELHYRSPDKNLAANIVNTLAA
A0A2V9V8F7      K----G-S------L-RVSL---VPNSR---------IIELHYRSPNKELAATVVNTLAT
A0A2V9XGR9      K----G-S------L-RVSL---VPNSR---------IIELHYRSPNKELAATVVNTLAT
A0A2V9V3Q5      K----G-N------L-KVSL---IPNTR---------IIEIHYRSTDPTLAASVVNTLAA
A0A2V9NWS3      K----G-K------L-RVAL---EPNTR---------IVDIHFRSPDRELAAHVVNTLIS
A0A2V9USA9      K----G-S------L-RVAL---SPNTR---------IIEVHYRSGDPQMAANVVNTLMQ
A0A2V9XW18      K----G-N------L-RVTL---SPNTR---------IIEVHYRSADPQMAANVVNTLMQ
A0A1H5SQF5      Q----S-R------L-KITL---VKGTR---------LVNVTYTDADPKQAARVANAVVE
A0A2V8G155      L----A-R------L-DVTP---VRNSR---------LVDIKYRLGDPALAQKIVNAVAH
A0A2V8HDM7      L----A-R------L-DVTP---VRNSR---------LVDIKYRLDDPALAQKIVNAVAH
A0A2V8IVN9      L----K-R------L-TVSP---VRNSR---------IVDVKFEAKDPDVAERVVNALAK
A0A7W1SCW7      L----A-N------L-TVSP---IRSSR---------LVDLKFRSPDPDLATRVVNSLAR
A0A3E0NV31      Q----E-N------L-SIAP---VGNTQ---------LVRVSYSSPDPDLSTDVAGAIAL
A0A3N5M5V0      L----S-R------L-EVTQ---VPNSR---------LVEVGWVSPDPSLASAVSDTLAE
A0A7X7XDY5      Q----G-G------L-QVEP---VRDSH---------LIRLSYVSPYPELASQVTNTAAD
A0A2V9L5B5      L----A-S------V-DVNP---VRRSN---------LVEVTFDSYSRTVAALAANKLAD
A0A2V9LK56      M----N-S------M-SVGP---VRRSN---------LVEISFYSNDPKLAARIANRLAD
A0A2V9L7I0      R----K-S------V-DVSP---VRRSN---------LVELTFDSYSPEVAAQAANKLAR
A0A522PPT0      M----R-A------V-VVNP---IERSN---------LVEVAFYSQDAAVAARVANQLGE
A0A7C5V1G5      M----G-L------L-NVNP---IERSN---------LVEVTFYSRDPALAARIANQLGE
A0A4R1LC91      S----H-N------L-TVKP---VSGSR---------LIQITYLSSNPHTAAAVVNALSA
A0A2V9QB26      A----R-S------L-NARV---SGLTR---------VVEASYDSTDPRFAAAFLNTLVQ
A0A2V9VYY4      R----G-G------L-SVQP---VPSTR---------LIQVSYTHSDPRFATEITNALVK
A0A2V9KIE8      L----D-A------V-EISP---VRRSN---------LVEVSFGSHDPRVAAQVANRLAQ
A0A7C2GJ20      L----A-N------L-KVEL---VRNTR---------VVAVTYSAHDPQLAARAVNELFT
A0A7C4BTL5      A----G-G------V-KVKA---AGQTR---------IIEVTVDSTDPNIAATFANTLAN
A0A7X8YVF2      L----R-N------L-TVTP---ERNTR---------VVELSYLSRDPERAARIVNTICA
A0A7X7YEP0      Q----G-G------L-EVNP---IRNTR---------LVELGFVARAPEVAARMANAYAE
A0A2V9CBM2      R----D-H------L-TIAP---INRSR---------LVAVRFDSHNPDLAARVANNLAA
A0A2V8XN17      Q----D-R------L-TIDP---VNRSR---------LVAVRFDSRDPELAARVVNTLAS
A0A2V8WX45      Q----D-Q------L-TVDP---VNRSR---------LVTVRFDSRDPELAARVVNTLAA
A0A1Q6YR79      Q----D-R------L-TIDP---VNRSR---------LVTVRFDSRDPELAARVVNTLAS
A0A1Q7VA32      Q----D-R------L-TIDP---VNRSR---------LVTVRFDSRDPELAARVVNTLAS
A0A2V9EY85      Q----D-R------L-TIDP---VNRSR---------LVAVRFDSRDPELAARVVNTLAS
A0A2V9H8K0      L----D-R------L-TIDP---VNRSR---------LVAVRFDSHDPELAARVVNTLAA
A0A2V9FFE5      L----D-R------L-TIDP---VNRSR---------LVAIRFDSHDPELAARVVNTLAA
A0A2V9GM43      L----D-R------L-TIDP---VNRSR---------LVAVRFDSHDPELAARVVNTLAA
A0A2V8ZHL8      K----S-R------L-HVQR---VRDSH---------VVNISFEGPDSSLSAKIANSLAS
A0A2V9B240      K----R-R------L-HVQR---VRDSH---------VVNISFESPDPGLSAKIANSLAN
A0A2V9CYQ5      R----N-H------L-TIAP---INRSR---------LVAVRFDSQNPDLAARVANALAA
A0A2V9BWU8      Q----D-R------L-SIEP---VSRSR---------LVTVRFDSGNAQLSARIANALAE
A0A2V8ZG48      Q----G-R------L-TVDP---VSRSR---------LVNVRFDSNDAQLSARIVNTLAE
A0A2V8Y334      Q----D-R------L-TVDP---VSRSR---------LVTVRFDSNSAELSARIVNTLAE
A0A2V9AY68      Q----D-R------L-TVEP---VSRSR---------LVTVSFDSNNARLSASIVNTLAE
A0A1F2RFI7      Q----D-R------L-TVNP---VRRSR---------LVEISFDSYDPALSARTANALAA
A0A1F2RZS3      L----G-R------L-QIVP---IRRSQ---------LVEITYESYEPSQSARVTNTIAA
A0A845TW47      E----D-R------L-GIEP---VKRSR---------LVEVTFDSYDPQLAARAVNVLAE
A0A845TXC1      Q----E-A------L-SIDP---VKRSR---------LVGVSFESTDPERAARIVNTLAA
A0A1F2USE2      Q----D-R------L-AVAP---VKYSR---------LVEVHFESEDPALAAQATNTLAA
A0A7C2VB08      H----R-R------L-TIAP---VKRSR---------LVEISFQSHDPELAAAVVNALAD
A0A2V9C238      R----D-R------L-SVDP---IKRSR---------LVEISFESRDAELAARVLNALAS
A0A1F2Q9F5      S----R-R------L-AVAP---IKRSR---------LVGVSFESEDPALAARVVNTLAA
A0A1F2QQH9      S----R-R------L-AVAP---IKRSR---------LVGVSFESEDPALAARVVNTLAA
A0A1F2QXK7      S----R-R------L-AVAP---IKRSR---------LVGVSFESEDPALAARVVNTLAA
A0A2V9DEM9      R----D-R------L-SVDP---IKRSR---------LVEISFESRDAELAARVLNALAS
                                                                            

A0A2V7VMF7      VYVEQTL-ASRVEAAKKAYDWLQERLGETQKGMREAQDKL---AKTYQGQDGFVP-----
A0A2V7YYV7      KLIGELK------------------------DIQTSHLQV--------------------
A0A2V7Z0J5      EFIKEVN------------------------QIQQAETQS--------------------
A0A2V7Z3M4      EFVSEVK------------------------QIQQAETQS--------------------
A0A399Y5V2      TY----I-DLRRKSALDS---FAQQANDLQQKVDEATAEL--------------------
Q01X01          TFIEQSI-EARQRSAQQT---FASLSGDLKEIRNRA---L--------------------
A0A3M2D9H8      VFLEQNA-KIQSNRFSASEESLQAQIQQVEAQIADLQKQL----AQSSEQSS--------
A0A2V9IXG5      LYVEEND-RQQGEAVKQSRDVLKRQLYEIKSMLASQQTQM----NQYAESSNLPV-----
A0A2V9J2P4      LYVEEND-RQQGEAVKQSRDVLKRQLYEIKSMLASQQTQM----NQYAESSNLPV-----
A0A831T3F4      DFIRRSF-QSKTEKFTNTSAWLDRSTRELKAKVEQAEQAL----ANYSREHN-IF-----
A0A2V8JK38      HFVEQNI-ENRFQTTQQVSELLSQQIVNLKGGLEKAEERL----QKYGQDND-IL-----
A0A7W0JWI4      VLALSNL-ERKAETNTSTGDFLQKRVGELQSQIRSGEEQL----INYAKNNQ-IL-----
A0A1Q7RLS4      VYVERNL-DQVVEATSKAVKALLSEIAPLKEKLEDTQRTS----FEFAEKANLYV-----
A0A257VBK0      AYQDRML-KDALDFIAKANEVMLAEAKKMQDQYARQQTTM----TTSLAASG-SY-----
A0A7C5TWV7      EYIAINI-EDNLNRTRKVYQVISEKLNPLRQQLEQSEQKL----ISFKEKEE-SF-----
A0A2V7XDY0      VYIEDTI-STRVEAARKAYEWLQERLGATQKSMREAQDRL----FKSYQSQD-LF-----
A0A2G6PYV5      AYIAHSL-NMTYDKNLEAYNFLEEKSNEYRQRIMELYSQL----GEQQKNSE-DL-----
A0A1F2TCR2      EYATQNL-DLHLDNVLGKLAWLDDELKKQQQKVTDSEAAM----MQYREQKD-AL-----
A0A7Y9PHF8      NFLTHSL-ETRSDSSIEQAAFMEKQLNQLKVKMTNAEQAL----AGYEKELG-VI-----
A0A7W8J3G9      AYMKVSF-DNQYTSVKQVRTWVYTQMEDLHNRALLMQNKL----TEFQEKNN-IL-----
A0A1F2V330      RFIRRLA-NMREQQVNEGAGLLNAELETLRSQLNEQEERL----KIYKESAV-NE-----
A0A662EE63      QYIAANI-EDGIDKTRKIYKVIQSRLDPLRLQVEAGQRKL----MSFQEGHD-SL-----
A0A2V8TLH7      AYVDRNL-DLSIEATGRAVKALLSEIAPMREKLQDTQRSS----FELAEKEN-LY-----
A0A1Q7ZJT1      VYVERNL-DQVVEATSRAVKALLSEIAPLKEKLEDTQRTS----FEFAEKAN-LY-----
A0A2V8VC99      VYVDRNR-DQAVEATAKAVRALLSEIAPLREKLKDSQQST----FEFAERAN-LY-----
Q01XL7          EHISQNL-AIRSSATQRTSQWMDSQMEEAKSRLQTAGEKL----RDFVRQSG-MD-----
A0A523DUV7      SYIEQNL-ASKIEATRNVYSWLQERLAAAEGDVKSSENSL----YEYTKQQD-LF-----
A0A7W1TTH3      AYVDANL-SLKRRSLEGMIAQYEKEIQNQKDSIDTLERAL----FTARQEGT-G------
A0A1F2U158      EYVASNL-EVKMQGTQSMLDWLEKEVATQQSKVEQSERDL----AEYRDREN-AM-----
A0A2V8F6S9      EYVDSNL-EIKQAGTQNMIEWLDKELAKQLQKVQESERAM----ANYRERQN-AL-----
A0A7V0UHS9      MFVDRAS-AKSDARVEDAKTIIQQQLDALKARLEEQDRQV----RQYKQNAA-HE-----
A0A7D8BEX2      DYISNSL-EVRFGSTRRVSQWLIGQLNELKGQVQSDQEKL----VDLESKLG-LL-----
A0A4Q1SCH5      AYLRQSF-NSRYGSVAQVRDWLSAQMDDLQKHAADAQQKL----AKFQEDNN-LV-----
A0A7V4SJP8      VYRDKTL-RDALEVIRRANEAMLEEARKMQEEYVRQQGLV----ASTLQASG-SY-----
A0A372IRG7      AYMERDL-RSRFEGTTRVSNWLSQQLSTLKSQVQSSQQEL----SDYQKKNN-LV-----
A0A2V8K4L4      EFIQKNL-DDRWKTTERTGEWLTKQLDDLKIKLERSEDTL----QSYALAVG-LQFTASS
A0A2V8NCZ3      EFIEKNL-DDRWKTTERTGEWLTKQMDDLKIRLEKSEDTL----QSYAVAVG-LQFTGAA
A0A4Q7YNP3      QFKEADL-ETRSSESEKTSRWLAQQAADIKLLAEESQHKL----EAATGGNG-LV-----
E8UZE1          KYIQRNF-ETKYNTTHETSAWLQDQLETLRHQVDADQKNF----EEFQERTG-LL-----
A0A2V7YW66      AFIDMGV-EDRYATAGKASTFLGTQIETLKKEVQDKETQL----QAFSRRTD-IV-----
A0A2V7Z0V0      SYIDMGV-EDRFATAGKASTFLSSQIEKLKEEIQDKETQL----QAFSRRSD-IV-----
A0A2V9M454      NYIEHNF-KSKYDATRQATGWMEQRLDELKLKVEKSEEAM----VTYERQNN-IA-----
A0A2V9J4D6      NYIEYNF-HTKYDATRQASGWMEQQLDELKAKVEKSQEAL----VNYERANS-IV-----
A0A2V9L9C5      NYIEYNF-HTKYDATRQASGWMEQQLDELKAKVEKSQEAL----VNYERANS-IV-----
A0A2N9M9N1      NYVEANF-RSKYETTRQASAWMEQQLDELKAKVEKAQQAL----VDYEREYS-IT-----
A0A2V9JEC4      NFVEANF-QGAYDTTREATKWMEQQLDELKTKVERSQQAL----VDYEKAND-IA-----
A0A2V9LPQ3      HYIEYNF-RKRYDATRQASGFMEQQLEELKAKVEKSQEAL----VGYERQNS-IV-----
A0A7Y8IYX6      EFMRLHF-ERKIDTTRKANEFLETQLAALRKKVEQAEADL----IEYARRNK-IL-----
A0A2V9IVR7      NYQEYNY-HKNYEATRKASGWMEQQLDELKAKVERSQQAL----VDYERDNK-II-----
A0A2V9ILE2      NYQEYNY-HKNYEATRKASGWMEQQLDELKAKVERSQQAL----VDYERDNK-II-----
A0A2V9LGY4      NYQEYNY-HKNYEATRKASGWMEQQLDELKAKVERSQQAL----VDYERDNK-II-----
A0A7T9JJ28      EYITWST-ESRLQGIGTTRDFLGKRVGDAEAELRQSEAEL----QRYIAEHR-LI-----
A0A7T9GE94      AFIQNTL-DERFKANKDSGKFLERTISNYKLRVKQAEEQL----LNYRKANK-VI-----
A0A7Y4X7L5      VFILNDT-MDRRRANRQSADFLNINIAEYKLKLRNADEKL----FNYTRDHK-VV-----
G8P0Y7          AYIEQNV-KSRYDSTMQAADWLSKQLADMQIKMETAQAKL----VQYQKEHA-IV-----
A0A2W4RYA1      AYVQETL-DYRLSASRDANDWLMARLAEQRKAVEEAEAAL----QRYREQNN-AL-----
A0A2V8EXP2      AYIDQNL-EFKFLSSKEASDWLGERLAEQRQKVEVSEQAV----QRYREQTE-SV-----
A0A843SYC7      NYIEQSL-EFKFMASKEASDWLGDRLGEQRQQLEQSEAKL----QQYREQND-AI-----
A0A7V9BJ09      AYIQTSL-EFKLNTSKEAGDFLSDRLGEQRKAVETSERAL----QDFKEQNG-AV-----
A0A7W1DT80      SYIKDSL-DFKVNTSKEAGDFLSERLAEQRKALDASEAAL----QKFKEQNG-TV-----
A0A5M8T4U7      TFIHENL-RSKFDQTKQTSAWLEKQLEDLKEQAADAQIRL----ANFQKQHN-IV-----
A0A7L5A491      SYISHGM-ETRAHSSVEQTAFMEKQIAELKKNMDNSAIAL----EAYQRRLG-II-----
A0A7D8BF18      DYITRSF-QSRQEAEQRVTEFFSHQLDDLKKQVEASQGNM----IDLQKQLG-VL-----
A0A1E3Y9R6      QYIEQSL-EFRLAATTQTNAWLTSQLEEQRRLVEESERRL----QDYKEQNN-AT-----
A0A2W4TLP2      QYIEQSL-QFRLEATSQTNAWLNTQLEEQRRLVEESERKL----QQYKEQHN-TV-----
A0A7G8BDY8      AYAQRNF-VTRFNNTMKASDWLSGQLDQLKSRVEESQVKL----AKFQKETG-IF-----
A0A7C4BZ42      EFIEESL-DARWRTTEKTGEYLTRQLQDLKIKLEKSEDEL----QQYASAVG-LQLTASD
A0A3R9WF43      TFIDDYL-ERRHRSTSQASYWLQKELDDLKKQVRDSEQRL----ADYERTTG-LAGVQVS
A0A317HKM4      AYVRWNV-EYRSKMTGEASAWLSRQVEEQRKLLEASETAL----QAYRRDHG-ADALVRT
A0A2V9CG11      EFIEETQ-GMRLKAFQRTAEHLTVKLDEMKAKLEQSEAQL----QDYARTSG-LT-----
A0A523E0N1      QYRQFNI-DSESGLARDTSSFIDEEIGELRNDIQEKERLL----RDYSRENQ-IV-----
A0A1V6HR88      TYIDWGI-ESRSNLAGKTSVFLGAQIETLKQEIQDKENQA----LAYSKRAD-IV-----
A0A4Q1SDL1      ALTDYAF-QTRVNSTSEAATWLTGQLGDLRKQSEEEQEKL----AALEKQTG-IY-----
A0A841JWG5      GLTDYTF-QTKMASTSEAAGWLTGQLADLRKQSEDEQEKL----AALQKQTG-IF-----
A0A4R1LAZ7      AYLERDL-KSRFEGTTRVSSWLAQQLTALKGQVEDSQKAL----AKFQRDNN-LI-----
A0A7G8BMP1      AYMERDL-RARYEGTNRVSSWLSQQLSALKKQVEDSQQQV----AQYQRANN-LI-----
A0A7X7ZKA6      AFIDLNI-NMKYAATEQATTFLSEQIKGLQTEIEQKENQL----QGFEAEAN-IV-----
A0A523ECP2      QYMTFSM-EKETTLARDTAGFIREQVEKIQVEIQEREQRL----QEYSQRQD-LM-----
A0A2W0C122      VFIDDNI-RSRYEAANRAAKFLSAQLTELRATVEESQQKL----VAYEREHN-IL-----
A0A2W0AUU7      AFIDDNI-RSRYEAANHAAKFLSTQLNELRAKVEESQQKL----VAYEREHN-IV-----
A0A2W0BQL1      AFIDDNI-RSRYEAANHAAKFLSTQLNELRAKVEESQQKL----VAYEREHN-IV-----
A0A2V8ERZ5      EYVNQNL-ELKLQSTQGMLDWLDKELDNQQKRVEGSEKGL----AEYREKEN-AL-----
A0A7W8J413      KFIDSAM-DRRHNSTIQSSYWLRKQLEDLKKQVEDSEQKL----ADYQRESG-LAGVQLA
A0A7W8JCF5      KFIDSAM-DRRHKSTIQSSYWLRKELDDLKKQVEDSEQKL----ADYQRESG-LAGVQIS
A0A7W8IEB1      KFIDSAM-DRRHKSTIQSSYWLRKELDDLKKQVEDSEQKL----ADYQRESG-LAGVQIS
A0A7Y9T3I1      KFIESAM-DRRHNSTIQSSFWLRKQLDDLKKQVEESEQKL----ADYQRQSG-LAGVQLS
A0A3P0XH15      RYMDRSR-RARYEGTTRISEWLAKQLEPLKNQVTESQDAL----STYQKQNN-LI-----
A0A3E0P0A3      AFIETGK-ASSRADAAQASSDIQAEISSLEAEIQELEADL----VSYTQSSD-IV-----
A0A3M1WQW8      QLIEYTL-MARFESTRQAREWLNKRLTELREKLEQLQEEL----VRYSREHE-II-----
A0A841JVA9      EYQSEDL-ESRGSEAKRTSDWLMRQASDIRQKAEDGQRRL----VAATGGDG-LV-----
A0A3N1JHC1      QYIQQGQ-NARLAAASETGVFLTQQLEGAKKKLQESGEAL----QEYARASG-IV-----
A0A7V4XQR5      AYQDWTL-RAHFETMTRISDWLSQQIISLRESVNKSQNEL----LQYQREHN-LL-----
C1F294          AYQDWTL-RAHFETMTRISDWLSQQIISLRESVNKSQNDL----VQYQREHN-LL-----
A0A2V9KA79      EFIHEVS-AADESRVEEAAGLVGARVEQLRKQMQEQQDRI----TRYKQATL-SE-----
A0A348UZU3      SFVDMNI-EARYETTEQATEFLSEQIAELKKEISQKEQEL----QNYGQEKD-IV-----
A0A7X9FXC4      SFVDMNI-DIKYEATEQATEFLSQQIDDLKKEISQKEQEL----QNYGQEKD-IV-----
A0A7X7ZKL5      EFVSFSV-ETRYEATKQTSEFLTEQVALLREDLKRKEEDL----QKYGTEKN-LL-----
A0A522PSP1      AFIEHEY-KTRNSALVSLTQYMREQVKELSERMKESQLAL----NAFERENS-II-----
A0A7W8E8D3      AYLRQTF-DSRYGSVTQVTKWLSSEMDSLRERASEAQKKL----ADFQEKNN-ILMLGGG
G8P085          AYLRQTF-DSRYGSVTQVTKWLSSEMDSLRERAAEAQKKL----ADFQEKNN-ILMLGGG
A0A843SRW6      AYIAQTE-DRKQTASRQASVWLSEQLQAQRKQVEDSEVAL----QRYRESND-AM-----
A0A7W8E330      GLTDFSF-ESKNASSSEASEFLQSQLADLRKQSEADQAKL----ASLQKGTD-MF-----
A0A4Q1SGQ1      ALTEYTY-QARFQATAQASDWLAGQLKGLRAQTQALEDRA----SRLQRDTG-IY-----
A0A7V2HGP7      SYIEHTY-RLRFQSAVNVSSFMEKQIEELKQKMDRSGAAL----ASYEAALQ-MV-----
A0A7R8B6H7      EFITGTL-RARTSGVLTTSKWVDQQVVVLRNELALAEAKL----QSFVRGND-GV-----
A0A2V8GTX0      EYVNENL-DFRLQNTDKTLQWLTEEVAKQQSVVQASERML----AEYRENQN-AI-----
Q1ILD9          AYTEHNF-QVAYESTIKASDWLAKQLVELKTGIQSSEQQI----ADYQKTHK-II-----
A0A7G8BJH7      ALMDYSF-QARFTATAQASNWLTTQLDDLRKQTEDLQAKA----ITLQRDTG-MF-----
A0A2V8J0X9      EYTQQNI-DLRLQNTEKTLQWLGEELKRQEQQLAASEGAL----TEYRERNN-AL-----
A0A7Y5WWH8      EYAQQNI-DMRLQNTEKTLQWLSEELKRQEQQLAQSETAL----TEYREKNN-AL-----
A0A7C5SHM3      AYQDFFVEEIGLAPRRRALEVIEDGIDEANAELREIEGQL----EQATRTHD-AA-----
A0A7V6D154      SYLQRTY-EMRYRAAEGLARYMEKQIEELRAKMERSSNAL----AAYEKELG-II-----
A0A7V1XXZ2      TFKEENF-RAKYDATLQTSEWLNKQLSELQLKVETSQEAL----VRYQRENN-VL-----
Q1IJZ6          QYTQDVL-TRRNASTTQASEWMSAQIKDLNQQVEAAQQKL----INYEKESG-LI-----
A0A2V8TCE6      AYIEFAL-SSQFDTTEQASDFLSRRVGELRDEVEDLEKRL----QSYRESRR-IL-----
A0A522TBE8      SFLNLEY-NSRAQALNQSTAYMSGQLDNLRAQTEQAQQNL----VSYESRAN-IL-----
Q1ITG0          SYMHHNF-MTRFEATMQASAWLQQRLTELKNNVEESQRKL----AEYQSKAN-II-----
A0A7C2ML20      TFIDYQR-EANTQAVEFAQDWLTRQLAELESKVNKSKETL----LRYHENVD-LV-----
A0A7T9HIZ6      TYIDWGI-ETRSALAGKASVFYGSQVEAIKQEIQDKENQL----VAYSRRND-IV-----
A0A7C5AXS9      EFIEQNL-EVRWETTQKTGEWLTRQLQELKIKLERAEDEL----QRYARTAG-LM-----
A0A7C2RGE3      QYGEYML-EARSDSTRKATEWLQEQLTLLRDRAEKAQEEL----VRYSRENE-IV-----
A0A7V6D075      SYLRHVY-EIRLRSSQRMTEFMEQQLEQLKAKMERSSRAL----SEFERELN-VI-----
A0A3N5PCI5      TYITHNL-EVQSQASKEATTWLAEQLAEQRRKVEVSELAL----QKYREREN-SL-----
A0A3M1Q0S9      AYIRFSL-AAKLDIAAQSEAFLVDQVRSLKEDINRRRLEL----HEYAMRHN-IV-----
A0A2Z5G448      QYLELDL-RSRYEGTLRISNWLSGQLTELKAHAADAQRKI----AQFQRANN-LI-----
A0A3M1VZ38      GYLRFTL-DRKTRIAKQSKDWFVERVAELKREVSDLELAL----QDYAAQHQ-IV-----
A0A4Q1SD29      AYLDRDL-RAKFQGTTRVSNWLSQQLTSVKKQVEDAQQDL----AKFQRENN-LV-----
A0A833M5K2      AYIDWGI-ETRASLAGKASTFFGQQIESLKQEIADKDAQL----QAYGRRTD-IV-----
A0A1F2Q9L4      TYIDWGV-ETRFATVGKASTFLTSQIEALKQEIQDKEAQL----QAYSRRSD-IV-----
A0A7V5ZKV2      AFIDWGI-ETRYATVGKASSFLASQIETLKGEIQDKEAQL----QAYSRRTD-IV-----
A0A7Y8LRQ1      AFIDWGI-ETRYATVGKASSFLASQIEALKGEIQDKEAQL----QAYSRRTD-IV-----
A0A3M1PY35      AYRDFFV-ESGTDARRGASEFLDRRIEDAQAELLELERRL----AEERRRLG-PV-----
A0A3M1VMP2      AYRDFFV-RTGVDARRGAADFLERAIQEAQAEVLELEAKL----AQARRQAP-PT-----
A0A1F2T595      QYIEQSL-EFRTTTTREASDFLTQQLAEQRKKVEASERAL----QEYRERTD-SV-----
A0A2V9AC41      SYVRYGV-DLRSQTNEEASEFLKQRLTELKERVEQSETAL----NSYRKDKG-II-----
A0A2V2R525      TFVQANL-EKMTETNSGAGAFLKKRIYELQEQIKNGEERL----INYAKDNQ-II-----
A0A321LPW6      SFIARSF-STKAEKYNNAASWLDRSTRELQAKVQKAEQSV----ADYTRDHN-IY-----
A0A2V9R9V4      RFVETSF-DKKIEKFTSASEWLDRSTRELKSKIERSEQAL----ADYTKTNN-IY-----
A0A321LE75      AFINRSF-SNKTEKFTKTSDWLNTMVRERRAEVQKAEEEL----ANYTREHN-LF-----
G2LEI9          VFARRNV-SDRLQQGSSQKEFLSSTAARLQQEILEEERKL----TEYLRTRK-IV-----
A0A7V9TW03      AFALWNL-EVKTKTNTVAGSYLQKRIAELQSQIRSGEEQL----VNYAQSHE-IL-----
A0A3N5XQP8      EYIEQNF-QSKLKTTEMATKFLAEELKELRVKVEQSERDL----NDYARTKG-IF-----
A0A2V9KCS3      EYMEQSL-ESRWKNAQRTGDWLTRQLEDQRINLEKSEDRL----QGYARSSG-LM-----
A0A7W1JC10      VFVRSNM-EIKTVASESAGDFLQKRIAELKQQIRGDEQRQ----ADYARSNG-II-----
A0A3M2BZG9      AFIDWGI-ETRTSTVSRASTLLTSQIEELSREIEKLRTKL----ASSAAEAN-LV-----
A0A1Q7N5R7      RFVAVAT-DLKRAKLTELGRLLREQLQAAEAGMHRAESALEAFRVRTITLPG-DP-----
A0A352F549      AFALWNM-EVKTKTNTVAGSYLQKRIAELQSQIRSGEEQL----VNYAQSHE-IL-----
A0A3B9MLP9      AFALWNI-EVKTKTNTLAGTYLQKRIGELQSQIRNGEEQL----VNYAQSHE-IL-----
A0A3D5SQ87      AFALWNI-EVKTKTNTLAGTYLQKRIGELQSQIRNGEEQL----VNYAQSHE-IL-----
A0A7Y2DUG3      VFMEQNI-QLETRRATEMYQKLDKSIADLKATITADEQSL----VAFMGRRG-MV-----
A0A7Y2D8Q4      VFMTQDI-ELATGGQKKAFNELTQSIAELKDNIAVREREY----IQKIQSSG-LP-----
A0A2V8NW86      ELMESNM-EARMKSSEYTSQWLSRQLEDMRIKLEHSEDAL----QSYARSTG-LI-----
A0A3M2D491      VYIDRAA-RREVEGTRKSLEDLTKSIEELKENIAQLEQQR----IEEMKSSG-LP-----
A0A7W1CBZ8      VFIRQDI-ERETEGGKRSLEDLSKSIEELKANINSQEQER----INYMKSSG-LP-----
A0A7W1FC90      TFIKEDT-ERETEGGKRALEDLSKSTEELKANINSQEQER----INYMRSSG-LP-----
A0A7W1ZXG0      TFIKEDT-ERETEGSKKALEDLSKSTEELKANINSQEQER----INYMRSSG-LP-----
A0A7W1ZIT3      TFIKEDT-ERETEGSKKALEDLSKSTEELKANINSQEQER----INYMRSSN-LP-----
A0A353C9L6      VFKLRDA-ERETQGAKNSAADLAKSIEELQNTIAQQEIDL----IAEMRSSG-LP-----
A0A2V8RQV0      IFIEEDK-ERETQGERKAIEDLTKSIEELKLTIQDQESQL----MAQMRESD-LP-----
A0A2V8SJH5      VFIDKDA-QRETEGSRRTYEDISKSIEELGKTISEQEADL----ISYMRSSG-LP-----
A0A136JPP4      VFIEEDA-KRELETTQSAYDELTKSIADLKVTIADQENKL----TEYMRSSN-LP-----
A0A399WUJ8      VFIEEDA-KRELEGTQSAYDELTKSIADLKVTIADQENKL----TEYMRSSN-LP-----
A0A7V9C3X9      TFKKQDA-ERETQGATQAQEDLAKSIDGLTQTIRDQEAEQ----ISFMRDSN-LP-----
A0A7V9ZSX9      TFIEQDI-ERETKGAKDIYDELSKSIEDLKSTISSKEVEL----INVMSKGD-LP-----
A0A3M1SIV3      VYIERTI-RRETEGMQKSLEDITKSIDQLQENIAELENQR----IAQMRESG-LP-----
A0A7V1SCI4      AYIERTI-KRETEGMQKSLEDITKSIDQLQENIAELENQR----IAQMRESG-LP-----
A0A7C5ZUA8      LFRDRDA-ERETAGARKAVEDLDKSIEELNKTIAAQELEL----IDEMRKSN-LP-----
A0A7T9FQE4      LFIKEDI-ERETSGALKAYEDLANSIEDLKATIIKQENDY----IEEMRSAN-LP-----
A0A3E0PHB0      VYKDRSI-MLATKTQVEAHKELQNSIEKLKKTIEDGEQNY----IGALRESN-LP-----
A0A7T9G4W3      MYKVQST-ELATKNEKQALADLKDSIIELKKTISDQEVEF----IGKLRESN-LP-----
A0A838UAA0      TFIEDNA-ERELEGAQSAYDQLSASIEDIKLTIIRLQNEQ----MAEQQGSG-LP-----
A0A7W1HTU2      VFIEQDI-KRETEGAKKSLEELSKSIDDLKNTIANQEQER----INYLRNTG-MP-----
A0A357F267      VFRDQDA-ERETQGAKNASEDLGRSIDELRETIAQQEIEL----IEYMRSSG-LP-----
A0A7V9ICU8      VFKEEDA-ERETQGAKQAADDLARSIEELQVTIRDQEAQL----IEEMRASG-LP-----
A0A7T9JEF9      TYVIQNL-EQKVQTNASASKFLQKRVAELQSQIRAGEQNL----LNYSRNNQ-IL-----
A0A399WNU1      TYVLQNL-EQKVQSNASASDFLQKRVAELQAKIRTGEESL----INYAKSNQ-IL-----
A0A3E0PCN7      TYVRQNL-EQKVQTNASAGEFIQKRVAELQSKIRAGEQNL----LSYSRNNE-IL-----
A0A7Y4TLV3      VYVLQNL-EQKVETNASASDFLQKRVAELQSQIRSGEEHL----INYAKSNQ-IL-----
A0A7W0MGQ3      AYRLSNM-ERRNETSNQTTEFLQRRIAELQSQIRNDEERL----LSYSKSRA-IL-----
A0A1Q7Y6W9      TFVLSNQ-EKRNESNNTTGGYLQRRIADLQGEIRSDEERL----INYANQHQ-IL-----
A0A2V8NC68      TFIQSNL-EKKTETSSSAGDFLQKRIADLQSEIRSGEEQL----INYAKNHQ-IL-----
A0A352FLX4      IFIDQNR-EKKTETSGSTGTYLLKRIAELQSNIRGKEEEL----INYGKNHQ-IL-----
A0A2V8MHG6      TFVVSNL-ERKTETTNSAGDFLQRRIADLQSEIRSDEEQL----INYAKNHQ-IL-----
A0A2V8P7N1      TFVVSNL-ERKTETTNSAGDFLQRRIDDLQSEIRSDEEQL----INYAKNHQ-IL-----
A0A2V8M3M6      TFVVSNL-ERKTETTNSAGDFLQRRIDDLQSEIRSDEEQL----INYAKNHQ-IL-----
A0A1Q7NJH5      TFVVSNL-ERKNETTNNAGDFLQRRIADLQSEIRSDEEQL----INYAKNHQ-IL-----
A0A2V8PJY0      TFVVSNL-ERKNETTNNAGDFLQRRIADLQSEIRSDEEQL----INYAKNHQ-IL-----
A0A7W1BYD3      VFVLSNV-ETKTAATEAAGDFIQRRVAELQQQIRADEKQL----ADYAQSNG-VI-----
A0A838PIP9      VFVRSNV-ETKAAASEAAGDFIQRRIAELQQQIRSDEKQL----ADYAQSNR-II-----
A0A399WK13      TFTNQNQ-EKRTGTSRKTNDFLQERIASLQSDIRRDEEKL----VEMTQNAG-IL-----
A0A7V8YZQ7      TFTNVNQ-EKRSGTSRKTNDFLQKRITDLTSEIRSDEIKL----VDLKKQEG-IL-----
A0A7V9ICV8      TFANFNQ-ERRTGTSRKTSDFLQTRIADLQSEIRNDEGRL----VQLKQSEG-IL-----
A0A136KC10      TFVNQNQ-EKRTGTSRKTNDFLQERIASLQSDIRRDEEKL----VEMTQNAG-IL-----
A0A7W1IVA5      VFSKANQ-EKRTGTSSKTSDFLQERIATLQSEVKNGEVKL----FNLTKDAD-IL-----
A0A7W1ZIE3      VFSKANQ-EKRTGTSSKTSDFLQERIATLQSEVKNGEVKL----FNLTKDAD-IL-----
A0A7T9J551      TFTTLNQ-EKRSGTSRKTNDFLQERIANLQADVQRDEEKL----VDLTQNAG-IL-----
A0A7V9NLN0      IFTKANQ-EKRTGTSTKTNDFLKERIASLQSEIKSGENKL----YELTKTAG-IL-----
A0A7T9G8R2      VFSRVNQ-EKRTGINRKTNDFLKERIADLQSEIKAGEERL----VDLKKNAG-IL-----
A0A7Y2D047      VYTSSNQ-EKRTGTNRKTNSFLQERIANLEGEIKAGETRL----VNLKARAG-IL-----
A0A3M2D6Y5      IFAKQNQ-EKRTGTSKRTNDFLSERIASLQAEIKRDEMRL----AELKNSAG-IL-----
A0A2V8SEX6      TFVTANQ-NKRSGTNRKTSDFLQRRITDLQSEIRSDELEL----AELQKNIG-IL-----
A0A7C5ZUU4      TFVKANW-EKRSGVSRKTNDFLQQRIAELQAEIRNDELKL----VELKKTAG-IL-----
A0A3E0PCJ6      VFTRVND-EKRTGVNSKTNEFLKKRIGELQSEIRQGEERL----VDLKKNAG-IL-----
A0A2V8RTL7      TFVNANQ-EKRSGTSRKTSDFLQKRINDLQTDIRGDEIKL----VELKQSEG-IL-----
A0A3M1S4R8      VFVKQNQ-EKRTGTNKRTNDFLAERIATLQSEIKRDEMRL----AELKNNAG-IL-----
A0A7V1SAJ0      VFVRQNQ-EKRTGTNKRTNDFLAERIATLQSEIKRDEMRL----AELKNNAG-IL-----
A0A7W0N726      IFTKSNQ-EKRTGTSTKTNDFLKERIASLQSEIKASENKV----FEFNKSSE-IL-----
A0A7W1HTZ7      IFALENQ-EKRTGTSSKTNDFLQKRIANLQSEIKNGEIKL----VELTRDFG-IL-----
A0A1Q7YFI6      TYIISNL-EQKTKNTNSAADFLQRRIAEIQSEIRNGEERL----INYAKNNQ-IL-----
A0A7V9C9Y7      AFVVQNK-ERRTTNTVTTGEFLDRRIAELQSKIRNGEERL----QAYARGNE-IL-----
A0A7W1G8A4      AFALLNL-EKKTETNASAGDFLQKRVADLQAQIRSGGERL----VNYAKNNQ-II-----
A0A7V9KMZ1      TYVFSNL-EKKTETNTSTGDFLQKRVAELQQQIRTDEERL----VNYAKNNQ-IL-----
A0A7W0JTE4      TYVFSNL-EKKTETNTSTGDFLQKRIAELQQQIRSDEERL----VNYAKNNQ-II-----
A0A0B6WWQ6      TYKLSNL-EKRTSARATTSQFLQRRIAELQAQIRAGEAQL----LAYSKSHQ-IL-----
A0A3B9MK99      TYVYNNL-EKKSDTNMGTADFLQKRIAELQQQIRSDEERL----VNYARNNK-II-----
A0A838PA20      TYVFSNL-EKKTETNTSTGDFLQKRVAELQQQIREDEERL----VNYARNNQ-II-----
A0A352EX26      TYVFNNL-EKKTESNASTGDVLQKRIAELQQAIRSDEERL----VNYAKNNQ-II-----
A0A7V9R410      TYVFNNL-EKKTESNASTGDVLQKRIAELQQAIRSDEERL----VNYAKNNQ-II-----
A0A2V8MM59      TFVHSNL-EKTNQTNTSTSEFLSKRVAELQDKIRSDEEKL----VSYAKSNQ-IL-----
A0A2V8PFE8      TFVRANL-EKKNETNTSTGEFLSKRVAELQQQIRADEEKL----VSYAKNNQ-IL-----
A0A2V8PWS6      TFVRANL-EKKNETNTSTGEFLSKRVAELQQQIRADEEKL----VSYAKSNQ-IL-----
A0A2V8LCT5      TFVRSNL-EKKNETNTSTSEFLSKRVTELQSQIRSDEEKL----VVYAKSNQ-IL-----
A0A352FTJ9      TFVRSNL-EKKNETNTTTSEFLSKRVEELQAQIRAAEEKL----MAYAKSNQ-ML-----
A0A1F2S1W5      QYIKQSV-ELRSNTTKEASEFLVQQLAEQRNKVEASEQAL----QAYRERTGSVS-----
A0A2N9LQU7      AYLQRNF-DVKYQGAVQVSEWLSKQMEELKLNAARAEQRL----AEFQKQNN-IL-----
A0A2P6WFK7      KYMQHTL-QTRYEGTVQVSNWLSKQMDDLQTRATQSQQRL----SEFQMKNN-MI-----
A0A2V8JQV5      EFINQKL-RSRLQTNERTAEWLQLQLQELKVNLEKSEQEL----QDFGRATGLMF-----
A0A2V8U914      TFIEQSV-NGRRRAAQEIQEWLGPRIQELRSKLQTSEAAL----DEYTRESGLVL-----
A0A2V8DRT9      AYIELNL-EYKFTASRDASDWLGERMGEQRKTVDASERAL----QVYREQHDAVS-----
A0A2V7VYF3      QYIQQNV-ELRFHASKDASDWLGQQLAEQRKKVEVSELAI----QRFREDNDAVS-----
A0A1F2SVH2      AYIEQHL-EFKFLSSKEASDWLGERLAEQRKQVEASEQAV----QRYREQTDSVS-----
A0A2V8AJG9      AYIEQNL-EFKFMSSKEASDWLGERLSEQRKQVEASEQAL----QRYREQTDSVS-----
A0A2V9MAM9      VFIEQSV-EARWNGASQIREWLNPQLEELKGKLVKSEGEL----QAYLRSSGLIF-----
A0A2V8F956      NYISQSL-EFKFMASKDASDWLGQQLLEQRKQVEGAEKKL----QQYREQNDSIS-----
A0A2V7W309      SFMRMTI-AKKLDSVRQATEFLSQQIATVQANLEESRQDL----LSYGKSKG-II-----
A0A348V070      SYIEMLI-KRKYTASEQATEFLSTQISALRKDIEEAEKKL----AELGTAQG-IL-----
A0A2Z5G3A3      DLTNFSF-ETRYKATAQTSQWLTSQMADLRKQSEALQAKV----ADLQKEAG-VY-----
A0A2V7UGP8      SYMEFNQ-SARYDTSAQASEFIGTQTTELKKQVSDLEAKL----NQYGKENE-II-----
A0A239MKT6      AYLQDNT-ENRYQATSMASTWLTTQLEDLKRKIEENHRQV----AAFQQKSG-IV-----
A0A2Z5G7H4      GLVEYNF-QTRFTATNQASEWLTGQLSDLKKQAEALQARV----IALQRQSG-VV-----
A0A372IT17      ALADYTF-QSRLAQTSESSSWLAGQMSGLKKQAEALQTKA----IGLQSEAG-MY-----
A0A841JU67      GLIDYGY-QARVHATAQASKSLANELQDLRQQTAKLQSKA----NRLQREAG-IY-----
A0A7T9GJJ6      VFVENSF-NNKTEKFTNSANWLDRTTRGLLTQVQQAEQAL----ANYSSNHN-IF-----
A0A7Y4UER8      NYIDQSH-TRKLETFTDTSEWLTKSTNELRARMQQAEQKL----ADYTRNNG-IF-----
A0A2V8IYW3      MFIDGNV-RDRRVVAEGTNQFLESQLEDAKLRLIDREKKL----EEYRRRY--IG-----
A0A7V2HCZ0      EYIDSNL-EARWGAAQRTSDWLNKQLLDMRAKLEQSEAQL----QNYSKNSG-MV-----
A0A2V9AEW6      EFTELSQ-EAHWKSAQGTAEWLTNHLDEMKTQLEASEAQL----QDYARITG-LS-----
A0A2V8WQK6      QYVELSQ-EERWRSAQGTAEWLTSHLGKMKGELEASEAQL----QDYARASG-LS-----
A0A2V8XIF4      EFVELSQ-EERWKSAQGTAEFLTNHLDQMKAQLEASETQL----QEYARTSG-LS-----
A0A350UQT3      SYIEHTY-NIRIRSSQSLSRFMERQIEELRVKMEDSSGRL----AQMERELN-VI-----
A0A7C3HRX0      SYIEHTY-NIRIRSSASISRFMERQIEELRAKMEASSERL----ARLEREMN-VI-----
A0A2W0BGU4      NYSDYNF-RQKYDATRQAAGKMEEQLDELKAKVEKSQRAL----VEYERQNA-IL-----
A0A2W0BVQ9      NYSDRNF-RQKYDATRQAAGKMEEQLDELKAKVEKSQRAL----VEYERQNA-IL-----
A0A317J121      EYIEQNS-QGRAQNLQQTSQWLSGQLEETRNKLQEAQQHL----QEFVQSSGNLF-----
A0A2V9MN96      TFVEENF-RTKYESTSQTADWLSKELSDLQLKVQASEEKL----VRYEKQKG-IV-----
A0A2V7V2Z1      LYIEQTL-EFRYQTSSEAAQWLGQQIEEQKGKVEQAERAL----QQVKEQEG-IV-----
A0A2V7X2F7      LYIEQTL-EYRYQTSSEAGVWLGGQIDQQRQKVEQATQEL----QKLKEREG-IV-----
A0A2V7V2I1      LYIQQTM-EFRYQTSADAGLWLGSQIEEQRHKVEQAELAL----QKLKEKDG-IV-----
A0A2V7U3M2      LYIKQTL-EFRYETSSEAAQWLGQQIEEQKAKVEAADLAL----QKVKEQEG-IV-----
A0A2V7UHT0      LYIQQTL-EFRYQTSSEAAQWLGQQIEEQKTKVEEADRAL----QKVKEQEG-IV-----
A0A3P0X3W6      SYIDEAM-DMRLHSSMNLSGFMAKQLDDLKANMDKSAEAL----TTYQRQLG-VI-----
A0A7V2MG68      SYLEHIY-NIRYRAASGLSEFMERQLEELKAKMERSSEAL----IRFEKELN-VI-----
A0A7C6A629      SYVEHTY-NIRFRSTMGLSSFMEKQLEELKAKMERSSAAL----AQFERELN-VI-----
A0A7V2HBQ5      SYLEHTY-NIRIRSSASLSAFMEKQLDELRAKMERSSAAL----AQFERVLN-VI-----
A0A2U3JZ71      SYLEHTY-NIRFKSSASLSAFMEKQLEELKAKMERSSGAL----VQFERELN-VI-----
A0A2V8TTB0      SYLAHTY-RIRYKATAGLSEFMERQLEELRAKMEKSSAAL----AQFERELN-VI-----
A0A2N9MK30      SFVEHTY-DIRFRSSASLSTFMEKQLEELRAKMERSDTAL----AQFEKELN-VI-----
A0A3D1ASD2      SFLQHSF-EIRFKSSESVSQFMTKELEELKAKMERSSDAL----AKFQRDLS-VV-----
A0A7R8B699      SYLEHTY-RIRLTSSSTLSSFMSQQLDELKAKMEQSGQRL----AAFERELN-VI-----
A0A7S7SGU3      SYIEHTY-NIRIRSSVSLSKFMERQIEELRAKMESSSGRL----AQMERELN-VI-----
A0A7Y8HY45      SYIEHTY-NIRIRSSASISKFMERQIEELRAKMESSSERL----ARLEREMN-VI-----
A0A7C5AXI3      SYLEHTY-NIRFRSSASLSAFMEKQLEELKAKMERSSAAL----AQFEKELN-VI-----
A0A7C6E4H7      SYIQHTY-NIRYRASVGLSSFMEQQLEELKAKMERSSAAL----AQFERELN-VI-----
A0A2Z5FVL3      SLVNYSF-QSRRTVDTEASKFLESQLAEMKADSDALEQKA----VKLQKQTG-VV-----
A0A2V8GFD4      AYIEQNL-EYRFTASKEASDWLAARMAEQRSAVEASERAL----QQYREQYD-AI-----
A0A2V8HSS5      AYIEQNL-EYRFTASKEASDWLAARMAEQRSAVEASERAL----QQYREQYD-AI-----
A0A2V8KP55      QFVEQNI-ENRFQTTQQVSELLSQQIVNLKGGLEKAEERL----QKYGQDND-IL-----
A0A2V9JSI3      NYAEYNF-RKRYDATRQASGWMEQQLDELKAKVEKSQQAM----VDYERQNA-IV-----
A0A2V9WI32      TFIEQNF-KTKFESTMQTSAWLSVQLSDLQMKVETSQEKL----VRYQKEHD-IL-----
A0A2V9KBD6      DYVDHYY-QSQFQVSEQISAFLTNQLKELQARVEDSQQKL----MEYQKQNG-IL-----
A0A2W0AJ66      AYVDRNY-SSQLYASNQLSQFLLNQLTDLKAKVEESQQKL----VDYQNRNG-IF-----
A0A1Q7RBU1      AYVDQYY-KSLFQVSTQISEFLANQLKELQAKVEESQQKL----VDYQKENG-IF-----
A0A2V9JPV9      AYVDRYY-RNQFEASTQMSEFLASQLKELQAKVEESQQKV----VDYTKEIG-IF-----
A0A7V0Y3A1      EYMASNQ-QQRWESYQKEGAWLTRAQQETKADLEKAERRL----ADFARTSG-LT-----
A0A7C5Z4J3      NYREYNF-HSRYDATREASGYMREQLDELKAKVEQSQQAL----VNYERANS-IV-----
A0A1F2TPT3      EYINENL-EMRVAAVREVTGWLTARLAEQKEKLDASEQAL----EHFREQNQ-LI-----
A0A2V8JTQ2      EYVDQYY-RSQFQVSTQFSDFLANQLKELQARVEDSQRKL----VDYQKENG-LF-----
A0A2V8UZY0      EYVDHYY-RSQFQVNAQISSFLANQLKELQSKVEESQQRL----LAYQKQSG-LF-----
A0A350UEK1      EYVEQSM-EARWQSSQRTGEWLTRQMDDLRIKLERSEDAL----QSYAQRNK-LV-----
A0A350UIQ4      EYVDQSM-EARWQSSQRTGEWLTKQLDDMRIKLERSEDAL----QNYAQRNN-LL-----
A0A7T9GJN6      IFIEHSY-RNKTRKYSNTSAWLVARTRELQAKVQEAEANL----ADYTSANN-IF-----
A0A7T9GJN7      NFIQRNF-ERKTSRYSDTSSWLDRSTRELKSKVQQSEEAL----ADYTRRNG-IF-----
A0A1H5Z7N3      EYIFRSL-ESSAEAQKRVSDFLSTQLGDLKQQVETSQEQM----IDLQKKIG-IL-----
A0A1G7JVV8      AYQQRSF-ESRFASTQRVSQWLQGQLDDLKQQVEASQEQL----MDLQKKIG-VL-----
A0A1H4T6W9      AYQQRSF-ETRFESTKRISQWLSGQLDDLRQQVETSQEQL----IDLQKRLG-VL-----
I3ZEU5          AYQQRSF-ETRFESTKRVSQWLSGQLDDLRQQVETSQEQL----IDLQKRLG-VL-----
A0A7W7ZGZ3      DYIQRSY-ETRYLSTQRVSQWLSGQLDDLKHQVETSQEQM----LDLQRRLG-ML-----
A0A7G8BSK5      AYIQRSY-ETRFSSSQRISNWLSGQLDDLKQQVQASQERM----LDVQKRLG-IL-----
A0A428MDU2      TYVHRSY-QTRFDSTQRVSQWLSGQLDDLKQQVQTSQERM----MDLQRRLG-ML-----
E8WVF6          DYQQRSY-ETRFDSTKRVSQWLSGQLDDLKRQVETSQEQV----LDLGKKLG-TL-----
A0A1I6MH75      DYIQRSF-ETRFQSQQRVSAWLQNQLDGLKQEVETSQEQM----MDLQKRLG-TL-----
A0A7Y9TM87      DYIQHSY-ETRFESTQRVSQWLSGQLDDLKQQVETSEEKM----IDVQKRLG-IV-----
A0A7W8J1H5      DYMQHTY-QTRFESSQRASVWLSGTLEGLKQEVEASQEQM----MDMQRRLG-IL-----
A0A7Y9T5K4      DYVQRSY-QTRYESSQRASVWLSGTLEGLKQEVEASQEQM----MDMQRRLG-IL-----
A0A852VHP9      DYVQRSY-QVRYESSQRASVWLSGTLEGLKQEVEASQEQM----MDMQRRLG-IL-----
A0A7W8IFZ2      DYVQRSY-QTRYESSQRASVWLSGTLDGLRQEVEASQEQM----LDMQRRLG-IL-----
A0A7W8J9Y9      DYVQRSY-QVRYESSQRASVWLSGTLEGLRQEVESSQEQT----MDMQRRLG-IL-----
A0A7L5A6M5      DYIQRSY-ESRFASTQRVSQWLSGQLDDLKQKVETSQQRM----LDLQRKLG-VL-----
A0A5B9EBI2      DYIQRSY-QTRFNSAQHASQWLTGQLDDLKQQVETSQEQL----LELQRRLG-SV-----
A0A7Y5RFT3      DYIQRSY-QTRFNSAQHASQWLTGQLDDLKQQVETSQEQL----LELQRRLG-SV-----
A0A239HDF6      EYIQRSY-ETRFASTQRVSKWLSKQLEDLKADVEASQEKM----INLQRRLG-IL-----
A0A4Q0T270      DYIQRSY-ETRFASTQRVSQWLSGQLDDLKAQVELSQEQM----MDLQKRLG-VL-----
A0A1Q3QQB6      AYIQRSY-ETRFASTQRVSRWLSSQLDDLKQQVETSQEQM----MDLQRKLG-IV-----
A0A3N1K1G7      TYIQRSF-ETRFASTQRVSQWLQGQLDDLKQSVETSQEQM----MELQKRLG-IL-----
A0A4V2G466      AYIQRSY-ETRFSSSQKVSTWLSGQLDDLKQQVQASQEQM----LDVQRRLG-IL-----
A0A6B9YNQ8      AYIQRSY-ETRFASSQRVSNWLSGQLDDLKQQVQSSQERM----LDVQKRLG-IL-----
A0A3N6A5T6      QFIEMNF-ESRYQATTKATEFLQKQMHELKVKVEKSEEQL----VAYARAHNILS-----
A0A2V8R8U7      VFVQNNR-ERLDIGTSKAVESLAQEIAKYQDKVNKEQDAR----FAFAKAKD-LP-----
A0A7V9Q528      VFILRDN-IRATQGATKAEEKLAREIADLQLKIRQGEEAR----INYMKNNN-LP-----
A0A2V8QMP4      IFRDNDI-QEETTGSQKAEDVLANEIIDLQARIQANEQKR----INYRKEND-LP-----
A0A2V8R4S3      IFRDNDI-QEETTGSQKAEDVLANEIIDLQARIQANEQKR----INYRKEND-LP-----
A0A2V8NJ55      VFIYNDL-QRTTSGTQTATEKLANQIAELQLKIKADEEKL----LNYKEKND-IP-----
A0A7V9ZQ50      VFIYNDL-KRTTSGSDSAAVTLANQIADLQLKIRQDEERL----LNFKRGNN-IP-----
A0A2V8Q7I0      VFASNNI-DSQTVNSKDAGDLLEREISEMQGKVRTKTERL----FNYAREYS-LP-----
A0A2V8S6K4      VFIENDR-ARESKGTEDMKVATARQITDLQAQIAE---------LEKKRTDA-LV-----
A0A317I2L9      VFANNNL-ERSTTNSSKQETMLAKEIGELQFKVKHDQEVL----FNYARENN-LN-----
A0A2V8LLF9      VFVQNNL-DRITAGTSKAEIDLTNQIAKVQDKIKKEEQDR----FSFAKAHN-LP-----
A0A352FRF4      VFVANNL-NLQESGTSKQSQDLGQEIAKYQGQVKQKQADV----FNYAKQYE-LP-----
A0A7W1GE99      VFILRDN-MRETQGMTKAAEALAREIADLQTKIRENEAAR----LSYMIGSN-LP-----
A0A1Q7YKQ8      TFAYNNF-ERETQGTAKATELLAQKIAELQLEIRRQDEER----VNYIKLKN-LP-----
A0A0B6WXT1      VFIYNNL-ERETQGAQRASVLLAKQIAELQLKIRQGEEAR----INYLRSHN-LP-----
A0A2V8MKV0      VFANNNK-ESLESGTRKSAAQLGSQIGTYDELVKKERDDR----IAYAKQYG-LP-----
A0A2V8PYY8      VFANNNL-ERLESGTKKSAEQLANQIATYERKVKEERDAR----VAYAKQYN-LP-----
A0A3B9MEU8      VFRNNNL-ERSTAGSSKAEDQLAKEIAKLQTQIKHDQEAQ----FNYAKNHN-LP-----
A0A352F3R7      VFVNNNL-QRATAGSSKAEDVLAKEIASYQTKIKQEQEAQ----FNYAKNHN-LP-----
A0A7W0GRF6      VFVNNNL-ARATLGSTKAEDVLAREIASLQTKIKTDQEKQ----FNYAKAHN-LP-----
A0A7W1H6G6      VFVNNNL-ARATLGSTKAEDVLAREIASLQTKIKTDQEKQ----FNYAKAHN-LP-----
A0A7V9HZC8      VFVNNNL-ARATLGSTKAEDLLAREIANLQTKIKTDQEKQ----FNYAKAHN-LP-----
A0A7W0XCB9      VFVNNNL-ARATLGSTKAEDILAREIASLQTKIKSDQERQ----FNYAKAHN-LP-----
A0A3N5YNR8      EFIEQNL-QTKFEANTRATEFLKKQLQDMKGKVEKSEQEL----VQYARENN-IV-----
A0A7W7ZUJ7      AYIEQNV-KSRYDSTMQAADWLSKQLADMQIKMQTAQAKL----VQYQKEHA-IV-----
A0A2V2R0I6      NFIEQNF-RSRFEATSQASSWLTDQLSELKVKVQKSEDAR----IAYERQNQ-IW-----
A0A2V8XAR9      SYIEQNF-RSKYEATTQASTWLADQLSELKIKVQKSEDAR----IAYERQNQ-IW-----
A0A2V8VZA0      SYIEQNF-RSKYEATTQASSWLADQLGELKIRVQRSEDAR----IAYERQNQ-IW-----
A0A1Q7CB82      SYIEQNF-RSKYEATTQASSWLADQLGELKIRVQRSEDAR----IAYERQNQ-IW-----
A0A2V8WIU1      SYIEQNF-RSKYEATTQASSWLADQLGELKIRVQRSEDAR----IAYERQNQ-IW-----
A0A1Q6Y9F5      SYIEQNF-RSKYEATTQASTWLADQLGELKIRVQKSEDAR----IAYERQNQ-IW-----
A0A2V9EVV8      SYIEQNF-RSKYEATTQASTWLADQLGELKIRVQKSEDTR----IAYERQNQ-IW-----
A0A2V8YF91      TYVEQNY-RSKYESTTQASNWLADQLSELKVKVQKSEDAR----IAYERQNQ-IW-----
A0A2V8XZK2      TYVEQNF-RSKYESTTHASDWLADQLNDFKIKVQRSEDAR----IAYERQNQ-IW-----
A0A2V8ZTX6      TYVEQNY-RSKYEATSQASDWLADQLRDFKIKVQKSEDAR----IAYERQNQ-IW-----
A0A2V9BT79      TYIEQNY-RSKYEATSQASDWLADQLRDFKIKVQKSEDAR----IAYERQNQ-IW-----
A0A2V9YHT3      DYIQENI-RAKYDSTMQATDWLTRQLSELRMKVESSQEKL----VKYEKDND-IL-----
A0A7C2XNI7      NYVEHNF-RARYESTTKASDWLAAQLDELKIRVEKAEDAR----LAYERENR-IW-----
A0A1Q8B793      NFIEHNF-RSRYEATTQASSWLAGQLNELKIRVEKSEDAR----IAYERQNQ-IW-----
A0A2V9BCA0      NFIEHNF-RSRYEATTQASSWLADQLNELKIRVEKSEDAR----IAYERQNQ-IW-----
A0A2V9BWU9      NYIEQNF-RSKYLATTTASNWLKDQLNELQFKVEKSEDAR----IAYERQNQ-IW-----
A0A2V9DKX2      NYIEQNF-RSKYLATTTASNWLKDQLRELQFKVEKSEDAR----IAYERQNQ-IW-----
A0A7C2YQY3      LYIENNF-RKKYESTMQAQEWMSGQLQELKAKMEKAHQSL----VNYERENQ-IY-----
A0A845TWB8      LYVENNF-RKKSESTMQATEWMSGQLREMKTKMEQSHEAL----VKYERDNQ-IF-----
A0A2U3KC61      TFKEENT-NAKYESVNETSEWLKAKLDDLRRKVQTSEEIL----VRYQKDHS-IL-----
A0A2V9Y2R7      TYIEENF-RKRYESTTQTSEWLSGQLADLQLKVETSEGKL----VRYQKEHS-IL-----
A0A2V9NGH6      TYIEQNF-KTKFESTMQASDWLSKQLIDLQIKVETSQEKL----VRYQKQHQ-IL-----
A0A2V9PYE6      TYIEQNF-KTKFESTMQASDWLSKQLIDLQMKVETSQEKL----VRYQKQHQ-IL-----
A0A2V9NL07      TYIEQNF-KTRFESTMQASDWLSRQLVDLQMKVETSQEKL----VKYQKDHQ-IL-----
A0A2V9QD92      TYIEQNF-KTRFESTMQASDWLSRQLVDLQMKVETSQEKL----VKYQKDHQ-IL-----
A0A2V9WPZ6      TYVEQNF-KTKFESTMQAADWLSKQLVDLQMKVETSQEKL----VKYQKQHE-IL-----
A0A2V9ZLH4      TYIEQNF-KTKFESTMQASDWLSKQLVDLQMKVETSQQKL----VKYQKEHS-IL-----
A0A2V9RQF1      TYIEQNF-KTRFESTMQASDWLSKQLVDLQLKVETSQEKL----VKYQKEHG-IL-----
A0A2V9YDK8      TYVEQNF-KTKFESTMQAADWLSKQLVDLQMKVETSQEKL----VKYQKQHE-IL-----
A0A2V9V8F7      TYVEQNF-KTKFESTMQAADWLSKQLVDLQMKVETSQEKL----VKYQKQHE-IL-----
A0A2V9XGR9      TYVEQNF-KTKFESTMQAADWLSKQLVDLQMKVETSQEKL----VKYQKQHE-IL-----
A0A2V9V3Q5      TYVEQNF-KTKFESTMQASDWLSKQLVDLQMKVETSQEKL----VRYQKEHE-IL-----
A0A2V9NWS3      TYIEQNF-KTRFESTMQTSDWLSKQLVDLQMKVETSQEKL----VKYQKEHE-IL-----
A0A2V9USA9      TYVENNF-KSRFESTMQASDWLNKQLVDLQMKVETSQEKL----VRYQKEHE-IL-----
A0A2V9XW18      TYVENNF-KARFESTMQASDWLSKQLVDLQMKVETSQEKL----VRYQKEHE-IL-----
A0A1H5SQF5      AYLISST-QQRYDATSKTSAWLTNQLSDLKNKVAESQRRV----DDFRQKVG-II-----
A0A2V8G155      AYIEQTM-EFKFTASKQAGDWLEERLAEQRKVVEQAEARL----QAYREEHD-AI-----
A0A2V8HDM7      AYIEQTM-EFKFTASKQAGDWLEERLAEQRKVVEQAEARL----QAYREEHD-AI-----
A0A2V8IVN9      GYIDQNL-EFKFMSTKEASDWLGERLGEERKQVEAAEARL----QQYREQND-AI-----
A0A7W1SCW7      NYIEQNL-EYRFVASKEASDWLSERLAEHRKQVEQAESAL----QHYREQTD-AI-----
A0A3E0NV31      TFIETTL-QTRYDATRRAVKFLEDQLAELENEIEDSQDQL----LAFARSRD-L------
A0A3N5M5V0      EFIEQNL-QTKFEANTRATAFLKKQLQDMKGNVEKSEGDL----YRYARENN-IL-----
A0A7X7XDY5      EFIQLNF-EARYNAALQATEFLKRQLTSLKARLEKSEENL----INYSREKG-IM-----
A0A2V9L5B5      DYVEQNL-EVKWDAAEKASQWLQGKNAEIKAKLEKAEDEL----QAYAQANS-IV-----
A0A2V9LK56      DYIEQNL-QVKWDAALKASEWLSGRLDELKGKLEKSDNAL----QEYAKKNS-IL-----
A0A2V9L7I0      DYIEQNL-EVKWDAAAEASKWLEGKIVEIKAKLEKAEDAL----QAYAEANS-IV-----
A0A522PPT0      DYIDQNL-QVKWNEALKASEWLSGRLVELKAKLKASEDAL----QAYAAKNS-IL-----
A0A7C5V1G5      DYIDENL-QVKWNEALKASEWLSGRLVELKAKLKKSEDAL----QEYAAKNS-IL-----
A0A4R1LC91      ALIDYTF-QTRFNATNQASGWLSNQLADLRKQSEDLQARV----VELQKKAG-IV-----
A0A2V9QB26      EFMDSNM-EARLKSSEYTSQWLSRQLEDMRIKLEHSEDAL----QSYARSTG-LI-----
A0A2V9VYY4      TFIEENF-RTKYNSASQTSEWLGKELADLQLKVQTSEEKL----VRYQKDHG-IL-----
A0A2V9KIE8      DYIDSNL-QVKWDETIKASDWLQGQLVGLKAKLEKSDDQL----QAYAQEHS-IL-----
A0A7C2GJ20      QYGEYML-EARSDSTRKATEWLQEQLALLRERAEKAQEEL----VRYSRENE-IV-----
A0A7C4BTL5      EFIDQNM-EARWLMAQRTGDWLGRQLDEMRIKLEKSEDAL----QDYARKAG-LV-----
A0A7X8YVF2      EYIQYNF-QAKFDATTRATDFLQKQLVDLKVKVEKSDNEL----IDYARKHS-IV-----
A0A7X7YEP0      AFIDWGV-ENRYKSTGRASSFLASQIEALKQEIQDKDAQL----QAFSRRTD-IV-----
A0A2V9CBM2      DYVEQGL-DERWAAAQRASDWLSRQLLSVKAKLEKSEDQL----QAYARHNG-LV-----
A0A2V8XN17      DYVDQSL-EARWQATQRAAEWLSQQLVGVKAKLEKSEDEL----QSYARRNG-LV-----
A0A2V8WX45      DYVDQSL-EARWQATQKAAEWLTQQLVGVKAKLEKSEDEL----QTYARRNG-LV-----
A0A1Q6YR79      DYVDQSL-EARWQATQRAAEWLSQQLVGVKAKLEKSEDDL----QSYARRNG-LV-----
A0A1Q7VA32      DYVDQSL-EARWQATQRAAEWLSQQLVGVKAKLEKSEDDL----QSYARRNG-LV-----
A0A2V9EY85      DYVDQSL-EARWQATQRAAEWLSQQLVGVKAKLEKSEDEL----QGYARRNG-LV-----
A0A2V9H8K0      DYVDQNL-EARWQATQKAAEWLSQQLVGVKAKLEKSEDEL----QSYARHNG-LV-----
A0A2V9FFE5      DYVDQSL-EARWQATQKAAEWLSQQLVGVKAKLEKSEDAL----QGYARHNG-LV-----
A0A2V9GM43      DYVDQSL-EARWQATQKAAEWLSQQLVGVKAKLEKSEDAL----QSYARRNG-LV-----
A0A2V8ZHL8      NFIEYNF-RQKYDATRQASGWMEQQLDELKAKVEKSQQAL----VDYERQNA-IV-----
A0A2V9B240      NYIEYNF-RQKYDATRQASGWLEQQLDELKAKVEKSQQAL----VDYERQNL-IV-----
A0A2V9CYQ5      DYVEQGL-DERWAAAQRASDWLSRQLLSEKAKLEKSEDQL----QAYAHRNG-LV-----
A0A2V9BWU8      DYIDQSL-EARWLATQKATDWLSQQLVGVKAKLEKSEEQL----QDYARHNG-LV-----
A0A2V8ZG48      DYIDQNL-DSRWKATQKATDWLSQQLVGVKAKLEKSEEQL----QDYAQRNG-LV-----
A0A2V8Y334      DYIDKNL-EARWKATQKAADWLSQQLVGVKAKLEKSEEQL----QDYARHNG-LV-----
A0A2V9AY68      DYIDENL-EARWMATQKATDWLSQQLVGVKAKLEKSEEQL----QDYARHNG-LV-----
A0A1F2RFI7      NFIDQNL-EAKWDATQKASDWLSQQLVGLKGRLEKSEEDM----QRYAKDNA-IL-----
A0A1F2RZS3      NYIDMNL-EAKWDATQKASEWLSQQLVGLKGKLEKSEEDL----QRYAKENS-IL-----
A0A845TW47      NYIEQNL-EVRWEATQKASEWLAQQLAGMKGKLEKSEDEL----QAYVRENG-LL-----
A0A845TXC1      NYIEQSL-EARWKATQKATEWLSQQLLGLKSRLEKSEDEL----QKYARENG-LL-----
A0A1F2USE2      NYIEQNL-EARWEASQKASEWLSQQLTGLKAKLEQSEEEL----QTYAHEQG-LL-----
A0A7C2VB08      NYIDQSL-EVRWQATQKASEWLGQQLDGLKVKLERSEEEL----QRYARENG-LL-----
A0A2V9C238      HYIEQSL-EVRWEATQKASEWLSQQLLELKARLEKSENEM----QSYARENG-LL-----
A0A1F2Q9F5      NYVEQNF-ERRWEATQKASEWLSEQLLEIKANLEKSEEQL----QAYARQNG-LL-----
A0A1F2QQH9      NYVEQNF-ERRWEATQKASEWLSEQLLEIKANLEKSEEQL----QAYARQNG-LL-----
A0A1F2QXK7      NYVEQNF-ERRWEATQKASEWLSEQLLEIKANLEKSEEQL----QAYARQNG-LL-----
A0A2V9DEM9      HYIEQSL-EVRWEATQKASEWLSQQLLELKARLEKSENEL----QSYARENG-LL-----
                                                                            

A0A2V7VMF7      --EGSG----------------------GS----------AAASSIGKLNEDYVAAQARR
A0A2V7YYV7      ----------------------------PN------------------------------
A0A2V7Z0J5      ----------------------------TN------------------------------
A0A2V7Z3M4      ----------------------------PN------------------------------
A0A399Y5V2      ----------------------------QQ------------------------------
Q01X01          ----------------------------QT------------------------------
A0A3M2D9H8      ----------------------------EK--------------RLQDVTNIISGLQAE-
A0A2V9IXG5      --TPEM----------------------AS----------VEFEMVSRYRADYEDAKAKR
A0A2V9J2P4      --TPEM----------------------AS----------VEFEMVSRYRADYEDAKAKR
A0A831T3F4      --STEGS---------------------EN----------LSASKLASLHDQVTRAETDR
A0A2V8JK38      --FTEDG---------------------RN----------TVTEKLRQLQEEYTRAQAER
A0A7W0JWI4      --TLDAS---------------------QN----------TVIERLVGLNRQLLEAENER
A0A1Q7RLS4      --PENQ----------------------QK----------ITNDRLSTLQSELTEAQVKK
A0A257VBK0      --FPQN-Q--------------------KE----------ILDTKIASINERLTQVGVKE
A0A7C5TWV7      --LVGDQD--------------------KN----------VITEQVNTLTTEYAKAKAER
A0A2V7XDY0      --VPEG-S--------------------TS----------AVTSSITKLTADLIEAQARR
A0A2G6PYV5      --IVGRAK--------------------SA----------VEEQALVKLNEEIAVANRSF
A0A1F2TCR2      --SLDS-S--------------------QN----------TVLPRLNSLNDSVTRARLAR
A0A7Y9PHF8      --DPDE-K--------------------TS----------MLSARLQQLNTEYTEAENER
A0A7W8J3G9      --ATSE-S--------------------SN----------TTIDALRTISDDLTKARADR
A0A1F2V330      --LPDRLA--------------------TN------------LSLFAATQAQLRSSSGLK
A0A662EE63      --GFADEQ--------------------KS----------VITEQVDLLTKEYAQAKAER
A0A2V8TLH7      --VPEN-Q--------------------QK----------ITNDRLSALQADYTETQVKA
A0A1Q7ZJT1      --VPEN-Q--------------------QK----------ITNDRLSTLQSELTEAQVKK
A0A2V8VC99      --VPEN-Q--------------------QK----------ITNDRLSTLQAGLTETQVKK
Q01XL7          --FFPE-Q--------------------ST----------LADSKMKVLQGDLAAIQADR
A0A523DUV7      --VPSG-G--------------------QS----------IAASTMTRLNEEATEAKTRR
A0A7W1TTH3      ----PV-N--------------------AN----------VLGVAMATFSDRATRGRQEA
A0A1F2U158      --SLDE-K--------------------NN----------IVLSRLNALNDAVLRARTTR
A0A2V8F6S9      --SLDD-K--------------------QN----------LVGARLNKLNDDAMMARSRK
A0A7V0UHS9      --LPEHVD--------------------AN-----IRVVDELQSQQLAVASKIADDEARR
A0A7D8BEX2      --ALDPRN--------------------PA---------YLNAGALATLSRASSDATLQR
A0A4Q1SCH5      --GTDP-T--------------------DN----------TVIDRLKLINEQLTQAEGDR
A0A7V4SJP8      --FPEN-Q--------------------KE----------ILDKRIEALELKLNEVAVRE
A0A372IRG7      --GLGPTG--------------------TS----------LVTDDLRTINDQLAEARADR
A0A2V8K4L4      KGKDGD-Q--------------------EN----------VASASVRLVQEELLKARADR
A0A2V8NCZ3      -SKDGE-Q--------------------EN----------VVSTSVRLLQEELLKARAER
A0A4Q7YNP3      --LSQE-S--------------------TT----------VGEDKLRELQAELVRAQADR
E8UZE1          --QTGE-G--------------------HN----------AIVDRLSQLNSDLSKAQADR
A0A2V7YW66      --TLDP-A--------------------TN----------VILKRLEVLNGSLMEAKRVR
A0A2V7Z0V0      --TMDP-A--------------------AN----------VTLKRLEALNTQYIEAKKMR
A0A2V9M454      --NIGD-K--------------------QT----------AEEARFEDMSKELSQAQSDR
A0A2V9J4D6      --NVND-K--------------------QS----------VAEQRLSELSSDLTRAQSDR
A0A2V9L9C5      --NVND-K--------------------QS----------VAEQRLSELSSDLTRAQSDR
A0A2N9M9N1      --NLGD-K--------------------EN----------VVQQRLAQLSTDLTAAQVER
A0A2V9JEC4      --SIGD-K--------------------EN----------VVQLRLEDLSKDLTTAQTDR
A0A2V9LPQ3      --NVSD-R--------------------QN----------VVEQRLSDLSRDLTTAESDR
A0A7Y8IYX6      --DTDSNQ--------------------VN----------VIRQRFGLLSADLARAQASY
A0A2V9IVR7      --NISD-K--------------------EN----------VEEKKLGDLSKELTDAQAEV
A0A2V9ILE2      --NISD-K--------------------EN----------VEEKKLGDLSKELTDAQAEV
A0A2V9LGY4      --NISD-K--------------------EN----------VEEKKLGDLSKELTDAQAEV
A0A7T9JJ28      --SLDE-R--------------------GN----------ITIARAEQLNRQLADTENDR
A0A7T9GE94      --DYGD-K--------------------EN----------TVVARLGALNQLLLQAENER
A0A7Y4X7L5      --TFDS-K--------------------EN----------PVQSRLAALNQMLLNAEQDR
G8P0Y7          --GTDD-K--------------------QN----------LTTEKLDELNRELTSAQADR
A0A2W4RYA1      --SLQD-S--------------------QN----------IVAQKLTDVNTEVTRARTER
A0A2V8EXP2      --AFED-R--------------------QN----------IVVQKLADLNAAVTRAKTER
A0A843SYC7      --SLED-R--------------------EN----------IVVQKLTDLNGAVTQARTER
A0A7V9BJ09      --AMAEGT--------------------SS----------IAVQRLTDLNGALIKARTER
A0A7W1DT80      --SIADGT--------------------SS----------IAVQRLTDLNGALIKARTER
A0A5M8T4U7      --GTDE-N--------------------SN----------LTIQKLGQTSSDLESAEADR
A0A7L5A491      --NPDE-K--------------------TS----------MLASRLLQLNTQYTDAANDR
A0A7D8BF18      --GFDP-N--------------------LN----------QVTNNLADLNKAANAAELSR
A0A1E3Y9R6      --SVDD-K--------------------QN----------IIVQKLNALNEQFVQARIAR
A0A2W4TLP2      --SVDD-K--------------------QN----------IVVQKLNALNEQLVQARIER
A0A7G8BDY8      --GTDE-N--------------------DN----------LVLSKLDDLSKELTDAEADR
A0A7C4BZ42      --SKDGGK--------------------EN----------VAEERFRALQSELLKAQAER
A0A3R9WF43      GSTSGDGT--------------------SS---VSVNSHNTVLDRLFTLNQEMTSAEANR
A0A317HKM4      N-QLGEER--------------------QN----------IVVQKLGDLQAAVTRARADT
A0A2V9CG11      --FTSE-K--------------------DN----------VSDARLVELQSELTKAQAER
A0A523E0N1      --IAEDEN--------------------NS----------IVMQRLETLNEQLAQAEVQR
A0A1V6HR88      --TLDT-G--------------------GN----------VVLSRLQALNADYTRAVSER
A0A4Q1SDL1      --SFGTDN--------------------QG----REQVYSDVLDRLQQSTAALSVASQNR
A0A841JWG5      --SYGTDN--------------------QG----REQVYSDVLDQLQQSTAALSAADSNR
A0A4R1LAZ7      --GIDSEG--------------------GN----------LVTDSLRTVNQQLAQAEADR
A0A7G8BMP1      --GLNADG--------------------QT----------LVTSNLQTVNQQLAEAQADR
A0A7X7ZKA6      --ALSD-N--------------------ET----------TVIDRLSQLNKALTEAQIER
A0A523ECP2      --MVDE-K--------------------EL----------LVMRQLQDLNGAVAVARTAR
A0A2W0C122      --MVDD-K--------------------QN----------VVTSKLNELNKQLTAAEEDR
A0A2W0AUU7      --MVDE-K--------------------QN----------VVTSKLDELNKQLTAAEEDR
A0A2W0BQL1      --MVDE-K--------------------QN----------VVTSKLDELNKQLTAAEEDR
A0A2V8ERZ5      --SLDD-K--------------------QN----------IVLSRLNQLNDAVTRARTER
A0A7W8J413      --GGGPGD--------------------N-GANAGTTQHSTVTDRLYGLNQELTAAESNR
A0A7W8JCF5      --ANGGGD--------------------SAGGAAGISPHSTVTDRLYTLNQELTAAESNR
A0A7W8IEB1      ANGGGGDN--------------------A-GGAAGISPHSTVTDRLYTLNQELTAAESNR
A0A7Y9T3I1      --GGGPGD--------------------N-AASVGVSPHSTVTDRLFGLNQELTTAESNR
A0A3P0XH15      --GVDSNG--------------------SG--------QDLTIEDMRVANQQLSEAQADR
A0A3E0P0A3      --APNE-E--------------------TN----------VTLQRLTAANSAFLEAQRRR
A0A3M1WQW8      --QLDE-N--------------------QT----------IAIERLTDLNRRLVEAEAER
A0A841JVA9      --LSQG-T--------------------DT----------VGEDRLRKMQSELVKAQADR
A0A3N1JHC1      --LTSETQ--------------------EP----------VAAEHLREIQQGLAQAEVDR
A0A7V4XQR5      --SIGQQG--------------------GS----------LVDSDLETINSQLAQAEADR
C1F294          --SVGQQG--------------------SS----------LVDANLETINSQLAQAEADR
A0A2V9KA79      --LPENLG--------------------NN-----YKLLETIQARLQTVGERISNDAARR
A0A348UZU3      --ILSD-K--------------------ET----------TMLDKISELNKALTEAQIER
A0A7X9FXC4      --ILSD-K--------------------ET----------TMLDKLSEVNKALTEAQIDR
A0A7X7ZKL5      --YLSD-N--------------------ES----------AVVNNFASVNTALTAAQIDR
A0A522PSP1      --NPEN-T--------------------SG----------LLTQQLSSLQQELGQEQSKQ
A0A7W8E8D3      --SSGSSK--------------------DGGGESPTPSASTVTDRLSQLNNRLTVAQGDR
G8P085          --SSGSSK--------------------DGGGESPSPSASTVTDRLTQLNNRLTVAQGDR
A0A843SRW6      --SLEE-P--------------------NN----------IVVQKLTELNATVTKAKTDR
A0A7W8E330      --SLGTDS--------------------NG----HEQLYSSVLDKLQQSTAALSAANQSR
A0A4Q1SGQ1      --GDDA-G--------------------HN----------IVLDRLTTLNQRLAAAETNR
A0A7V2HGP7      --NPED-A--------------------TT----------MFSSRLLQLNTELTNAQIER
A0A7R8B6H7      --FASP-Q--------------------DT----------LAEARLHQLKEQQVAIQAER
A0A2V8GTX0      --SLED-R--------------------QN----------IIVSRLNQVNDAASHARTNR
Q1ILD9          --GTDE-N--------------------NN----------LTLATLDDVSKQYTDAQADR
A0A7G8BJH7      --GDDE-S--------------------HN----------VVLARLESLNEALAAAESNR
A0A2V8J0X9      --SLED-R--------------------QN----------IVVSRLNQLNDKVTTSRNER
A0A7Y5WWH8      --SLED-R--------------------QN----------IVVSRLNQLNDKVTTSRNDR
A0A7C5SHM3      --LVAS-D--------------------RD----------MRRTRLERLDATLTEAKSRR
A0A7V6D154      --DSEQ-R--------------------TG----------MLAARLLELNTAYTRAQAER
A0A7V1XXZ2      --GIDD-K--------------------QN----------ITTSKLDELNRQLTQAETDR
Q1IJZ6          --AITATD--------------------PKNPAAAPVLHIPALDRLTALNQDLVTAEASR
A0A2V8TCE6      --PSAG-A--------------------EN----------IALKGVSDIDAIYLQARARR
A0A522TBE8      --DPDS-K--------------------DN----------IMVARLTELNSDLTKAKSQR
Q1ITG0          --GTDE-T--------------------DN----------LAVSDLTDVSKQLTDAESDR
A0A7C2ML20      --TTGEGE--------------------EN----------PALKQLDKLYEQLAEAKAQH
A0A7T9HIZ6      --TLDS-G--------------------GN----------VVLSRLESLNQDLAKAASER
A0A7C5AXS9      --FTAE-K--------------------DN----------VAEEKLRQLQEELSKAQADR
A0A7C2RGE3      --QLSE-N--------------------QT----------ITVERLADLNRRLVEAETDR
A0A7V6D075      --NPEE-K--------------------TT----------ILSARLLELNKQYTEAQAER
A0A3N5PCI5      --SLEA-G--------------------QN----------IVVQRLNSLNASVTQAKTDL
A0A3M1Q0S9      --TGD--A--------------------NE----------VSLQNLQDLRNRRVEAEADL
A0A2Z5G448      --GMDAEG--------------------GN----------LVSDSLRLVNEQLIQAEADR
A0A3M1VZ38      --LGQ--G--------------------ED----------VTRRNLSNIQERYTQAKIKL
A0A4Q1SD29      --AMDATG--------------------GD----------LVTERLRTVNEQLAEAEADR
A0A833M5K2      --SLDP-Q--------------------AN----------VTLRRLEALNQDYVRAVSDR
A0A1F2Q9L4      --ALDP-S--------------------SN----------VTLQRLEGLNKDYVGAMSER
A0A7V5ZKV2      --ALDP-G--------------------SN----------VTMQRLEALNRDYVQAVSER
A0A7Y8LRQ1      --ALDP-G--------------------SN----------VTMQRLEALNRDYVQAVSER
A0A3M1PY35      --LARG-S--------------------DE----------MGSERLVALDQALTEAKRER
A0A3M1VMP2      --VPER-E--------------------DE----------PGSTRLSRLEQTLTEVKAER
A0A1F2T595      --SL-EER--------------------QN----------IVVQKLQELNAAVTRANTAR
A0A2V9AC41      --SV-DEK--------------------EN----------VVIDRLLDLNRSLTKAEAER
A0A2V2R525      --SL-EPS--------------------QN----------TVVERLNSLNRSLLTAENDR
A0A321LPW6      --ST-EGK--------------------ET----------LTTDKLSRLHDQVMRAETDR
A0A2V9R9V4      --ST-DGK--------------------AT----------LVAEKLSRLHDLATRAETDR
A0A321LE75      --ST-DGK--------------------EA----------PAVNKLAQLYTQVTTAEVQR
G2LEI9          --SL-KPE--------------------DN----------PEVARLTGLNQALLEAEKER
A0A7V9TW03      --SLD-AS--------------------QN----------TVVERLAGLNKELLEAENDR
A0A3N5XQP8      --TTE-GS--------------------QN----------EVTQKLNDLNTEITRAQANL
A0A2V9KCS3      --FTA-EK--------------------DN----------VAEARLRQLQEELSKAQGDR
A0A7W1JC10      --SLD-AA--------------------EN----------TVVARLSGLNNELLAAENDL
A0A3M2BZG9      --LD--PD--------------------GE----------AIIERKKSLETTLNRAVIDR
A0A1Q7N5R7      --GVAAAG--------------------AP----------PRGSPLGEFFSLRIEQDQMR
A0A352F549      --SLD-AS--------------------QN----------TVVERLAGLNKELLEAENDR
A0A3B9MLP9      --SLD-AS--------------------QN----------TVVERLAGLNKELLVAENER
A0A3D5SQ87      --SLD-AS--------------------QN----------TVVERLAGLNKELLVAENGR
A0A7Y2DUG3      --LAGGEN--------------------NE----------VGRNRLNTLSSQWLEAMDTR
A0A7Y2D8Q4      --LGEGKT--------------------ND----------LRAEVLSRLSGQLLDAIDER
A0A2V8NW86      --FTS-EK--------------------TN----------ISEEKLRQLQGELSKTQADR
A0A3M2D491      --LAE-KG--------------------QE----------LAASILEQKSTEWLKAEAER
A0A7W1CBZ8      --LQQGKG--------------------ND----------LLAARLEDLSGKWLSSEDER
A0A7W1FC90      --LREGKG--------------------ND----------LLADRLRDLSGKWLSAEDDR
A0A7W1ZXG0      --LREGKG--------------------ND----------LLADRLRDLSGKWLSAEDDR
A0A7W1ZIT3      --LREGKG--------------------ND----------LLADRLRDLSGKWLSSEDER
A0A353C9L6      --LQE-RG--------------------QD----------LSASRLSSLSETWLKAMESR
A0A2V8RQV0      --LLE-KG--------------------QD----------LAAQRLGAMSEAYMKAMETR
A0A2V8SJH5      --LQE-KG--------------------QD----------LSAARLQSMSETWLKAMEGR
A0A136JPP4      --LQE-KG--------------------SD----------LAASRLQTLSEQWLSAADDR
A0A399WUJ8      --LQE-KG--------------------AD----------LAASRLQTLSEQWLSAADDR
A0A7V9C3X9      --LQE-KG--------------------QD----------LAASRLQSMSETWLKAMEGR
A0A7V9ZSX9      --LGE-KG--------------------GE----------LSASILQNLSGQWLGAIDER
A0A3M1SIV3      --LAE-KG--------------------QE----------LTAGILRSKSEEWLKAEADR
A0A7V1SCI4      --LAE-KG--------------------QD----------LTAGILKSKSEEWLKAEAER
A0A7C5ZUA8      --LQE-KG--------------------QD----------LAASRLAALSETWLKAMEAR
A0A7T9FQE4      --LQE-RG--------------------GD----------LRANNLEALLGQWRTAYDDA
A0A3E0PHB0      --VGDGKG--------------------AE----------LSASRLSTVSSQYLTAIDER
A0A7T9G4W3      --VGDGKT--------------------TE----------LSASRLGTVSSQLLEAIDAR
A0A838UAA0      --LAE-SG--------------------EA----------LRAQNLGALQAQYTTAKFET
A0A7W1HTU2      --LA--KG--------------------QD----------FLADRLQTISGQLLTAEDDR
A0A357F267      --LQE-KG--------------------QD----------LAATRLGSMSETWLRALEAR
A0A7V9ICU8      --LQD-KG--------------------QD----------LAAGRLASMSETWLRAMEAR
A0A7T9JEF9      --SL-DAS--------------------QN----------TVVQRLADLNTKLSAAELER
A0A399WNU1      --SL-DAN--------------------QN----------TVVQRLSDLNTKLSQAENDR
A0A3E0PCN7      --SL-DPD--------------------QN----------IVVQRLSDLNGKLNQAEMER
A0A7Y4TLV3      --SL-DSN--------------------QN----------TVVQRLSDLNNRLSQAENDR
A0A7W0MGQ3      --SL-SPD--------------------QN----------TVVDRLSKLNNQLVEAENQR
A0A1Q7Y6W9      --SL-DPG--------------------QN----------TVVERLAGLNRQLLEAENQR
A0A2V8NC68      --SL-DAS--------------------QN----------TVVDRLVGLNRQLLEAENDR
A0A352FLX4      --SL-DAN--------------------QN----------TVVERLEGLSKQLLIAENER
A0A2V8MHG6      --SL-DAS--------------------QN----------TVVDRLAGLNKQLLEAENER
A0A2V8P7N1      --SL-DAS--------------------QN----------TVVDRLAGLNKQLLEAENER
A0A2V8M3M6      --SL-DAS--------------------QN----------TVVDRLAGLNKQLLEAENER
A0A1Q7NJH5      --SL-DAS--------------------QN----------TVVDRLAGLNKQLLEAENDR
A0A2V8PJY0      --SL-DAS--------------------QN----------TVVDRLAGLNKQLLEAENDR
A0A7W1BYD3      --SL-DPA--------------------EN----------TVVARLAGLNAELLAAENDR
A0A838PIP9      --SL-DPS--------------------EN----------TVVARLAGLNAELLAAENDS
A0A399WK13      --KT-SDD--------------------ST----------IVMDRLSGLNKAMLEAENAR
A0A7V8YZQ7      --KT-DGE--------------------QT----------IVIDRLSGLNKQLLESENLR
A0A7V9ICV8      --KT-DGE--------------------AT----------IVIDRLSGLNRQLLEAENRR
A0A136KC10      --KT-SDD--------------------ST----------IVMDRLSGLNKSMLEAENAR
A0A7W1IVA5      --KT-DEG--------------------QT----------IALDRLSGLNKDLLSAENER
A0A7W1ZIE3      --KT-DEG--------------------QT----------IALDRLSGLNKDLLSAENER
A0A7T9J551      --KT-EGE--------------------QT----------IVIDRLSGLNKQLLEAENQR
A0A7V9NLN0      --KT-DEQ--------------------QT----------IVVERLSGLNKQLLDAENER
A0A7T9G8R2      --KA-DEN--------------------TT----------IVIQRLSGLNKQLLEAEEQR
A0A7Y2D047      --EK-DDN--------------------VT----------IVIERLSGLNKQLLDSEESR
A0A3M2D6Y5      --KK-DEG--------------------QT----------IVIDRLAGLNRQLLEAENAR
A0A2V8SEX6      --KT-DGE--------------------QT----------IVLERLAGLNKNLLEAENKR
A0A7C5ZUU4      --KT-EGE--------------------QT----------IVLDRLSGLNRDLLEAENAR
A0A3E0PCJ6      --KT-DEN--------------------TT----------IVTQRLMGLNEQLLEAEEQR
A0A2V8RTL7      --KT-DGD--------------------QT----------IVIDRLSGLNKQLLEAENAR
A0A3M1S4R8      --KK-DEG--------------------QT----------IVIDRLAGLNKQLLEAENIR
A0A7V1SAJ0      --KK-DEG--------------------QT----------IVIDRLAGLNKQLLEAENIR
A0A7W0N726      --KT-DDQ--------------------QT----------VDLERLSGLNKQLLEAENER
A0A7W1HTZ7      --KT-DND--------------------QT----------IVIDRLAGLNKQLLDAENDR
A0A1Q7YFI6      --SL-DGS--------------------QN----------TVVERLAGLNRQLLEAENER
A0A7V9C9Y7      --SIANDT--------------------QN----------IVVARLAALNTQLIEAENDR
A0A7W1G8A4      --SL-DAS--------------------QN----------TVVERLAGLNGQLLEAENAR
A0A7V9KMZ1      --SL-DAS--------------------QN----------TVVERLAGLNRQLLEAENER
A0A7W0JTE4      --SL-DAT--------------------QN----------MVVERLAGLNRQLLEAENDR
A0A0B6WWQ6      --SL-DPS--------------------QN----------TVVERLAGLNRQLLDAENER
A0A3B9MK99      --SL-DAN--------------------QN----------TVVERLGGLNKQLLEAENAR
A0A838PA20      --SL-DAS--------------------QN----------TVVARLAGLSSQLLEAENDR
A0A352EX26      --SL-DAN--------------------QN----------TVVERLAGLNKQLLEAENER
A0A7V9R410      --SL-DAN--------------------QN----------TVVERLAGLNKQLLEAENDR
A0A2V8MM59      --SL-DAN--------------------QN----------TVVERLSGLNKQLLEAENDR
A0A2V8PFE8      --SL-DAS--------------------QN----------TVVERLAGLNKQLLEAENDR
A0A2V8PWS6      --SL-DAS--------------------QN----------TVVERLAGLNKQLLEAENDR
A0A2V8LCT5      --SL-DAS--------------------QN----------TVVERLAGLNKQLLEAENDR
A0A352FTJ9      --SL-DAN--------------------QN----------TVVERLAGLNKQLLEAENDR
A0A1F2S1W5      --FEER----------------------QN----------VVVQRLADLNAAVTKANTVR
A0A2N9LQU7      --GTDE-----N----------------NN----------IVIDRLRHLNSQLADAEGDR
A0A2P6WFK7      --GADE-----N----------------DN----------ITVDRLKLLNQQLTEAEADR
A0A2V8JQV5      --TSEK-----D----------------SS----------VAEEKLHHLEADLSEALADR
A0A2V8U914      --APGD----------------------DT----------LAADKLRGVQDELSKAQSDL
A0A2V8DRT9      --LEER----------------------QN----------IVVQKLADLNAAVTRAKTER
A0A2V7VYF3      --LEDR----------------------QN----------IVVQKLADLNGAVTSAKNER
A0A1F2SVH2      --LEEK----------------------QN----------IVVQKLSELNAAVTRAKTER
A0A2V8AJG9      --LEDK----------------------QN----------IVVQKLADLNAAVTRAKTER
A0A2V9MAM9      --GAGQ----------------------ET----------LAENRLHLIESELSKAQADR
A0A2V8F956      --MKDR----------------------EN----------IVVQKLTELTGAVTQAKTER
A0A2V7W309      --SVDE-----G----------------SN----------VTLQKLGKLNTDVTSAQGDM
A0A348V070      --PLSS-----A----------------EA----------PLIQKITEVNTALTAATLDR
A0A2Z5G3A3      --TVGDGGPDGKTQA-------------YS----------SDINRLELATTALSGAESNR
A0A2V7UGP8      --GLDD-----K----------------EN----------ITNQKLGQLNQDVLEAQVES
A0A239MKT6      --SEGMSAPAPSAGGGARGNIGAMAPSVDS----------TAFQRLSALNEELTRAEVAR
A0A2Z5G7H4      --SLGV----QDAQGRDQA---------YS----------VIVDRLQQATATLSQATSNR
A0A372IT17      --------------GDNGS---------HD----------VVLAQLENLNQALSQAELNR
A0A841JU67      --------------GDDAP---------HN----------IVLERLDALNQRLVAAESNR
A0A7T9GJJ6      --STDE------------N---------NS----------LTAEKLASIYSQALKAETDR
A0A7Y4UER8      --QSDG------------K---------TD----------ITVNKLADMYAQTMKAETER
A0A2V8IYW3      --ELPS-----QLQSNLQV---------IQ----------TTQIQLQSLSESLNRDRDRR
A0A7V2HCZ0      --LANE----------QGQ---------DN----------VAQDKLRQLQTELGRAEAER
A0A2V9AEW6      --FTSE------------K---------ES----------LAEARLKEIQDELSKAQADR
A0A2V8WQK6      --LTSE------------K---------EN----------PVVNRLKELQDELSKAQADR
A0A2V8XIF4      --ITAE------------K---------EN----------PAENRLKELLDELSKAEADR
A0A350UQT3      --NPEE------------K---------TN----------ILSARLLQLNTEYTRAQAER
A0A7C3HRX0      --NPEE------------K---------TN----------ILSARLLQLNTEYTKAQAER
A0A2W0BGU4      --SIGE------------K---------QN----------VVEQRLGEISTNFTQSQNDR
A0A2W0BVQ9      --SIGE------------K---------QN----------VVQQRLGEISTNFTQSQNDR
A0A317J121      --VLQD----------------------NT----------LDNSKLRQLQGELSAIQADR
A0A2V9MN96      --GIDE------------K---------QN----------IVTAKLDELNKELTGAQTDR
A0A2V7V2Z1      --NIEE------------R---------RT----------LLDQKLKELGTSLTTLRTER
A0A2V7X2F7      --NIEE------------R---------RT----------LLAQKLQQLGTALTETRTVR
A0A2V7V2I1      --NIEE------------R---------RT----------LVEQRLRELGTSLTALKTQR
A0A2V7U3M2      --NIEE------------R---------RT----------LLEQKLKELGTALTTLRTDR
A0A2V7UHT0      --NIEE------------R---------RT----------LLDQKLKELGTALTTLRTER
A0A3P0X3W6      --DPEQ------------Q---------TS----------ILSARVAQLNSEYTEAENDR
A0A7V2MG68      --NPEE------------K---------TN----------ILSARLVQLNTEYTNAQTDR
A0A7C6A629      --NPQE------------K---------TS----------ILSARLLQLNTEFTNAQADR
A0A7V2HBQ5      --NPEE------------K---------TS----------ILSARLLQLNTEYTNAQAER
A0A2U3JZ71      --SPEE------------K---------TS----------ILSARLLQLNTEYTNAQADR
A0A2V8TTB0      --NPEE------------K---------TS----------ILSARLLQLNTEYTNAQGDR
A0A2N9MK30      --NPEE------------K---------TN----------ILSARLLQLNTDYTNAETER
A0A3D1ASD2      --NPEE------------K---------TS----------ILSARLQQLNTEYTNAQTDR
A0A7R8B699      --SPEE------------K---------TS----------ILSARLLQLNTEYTNAQADR
A0A7S7SGU3      --NPEE------------K---------TN----------ILSSRLLQLNTEYTKAQSDR
A0A7Y8HY45      --NPEE------------K---------TN----------ILSARLLQLNSEYTKAQAER
A0A7C5AXI3      --NPEE------------R---------TN----------ILSSRLLQLNTEYTNAQADR
A0A7C6E4H7      --NPEE------------K---------TS----------ILSARLLQLNTEYTNAQADR
A0A2Z5FVL3      --QVAG---SGDGDGQGQA---------YS----------STLDQLQKATAAVSQAHTNV
A0A2V8GFD4      --SLED------------R---------QN----------IVVQRLEDLNGAVTKAHTER
A0A2V8HSS5      --SLED------------R---------QN----------IVVQRLEDLNGAVTKAHTER
A0A2V8KP55      --FTED------------G---------RN----------TVTEKLRQLQEEYTRAQAER
A0A2V9JSI3      --NIND-----K----------------QS----------VEEQRLAQLSNDYTNAQNVR
A0A2V9WI32      --GIDE-----K----------------QN----------IVTSKLDELNKELTAAEGDR
A0A2V9KBD6      --GLDN-----Q----------------QN----------IVTTKLADLNKELTASEADR
A0A2W0AJ66      --GLDD-----K----------------QN----------IVTAKLDDLNKELTAAEADR
A0A1Q7RBU1      --GLDD-----K----------------QN----------IVTAKLDDLNRELTAAEAER
A0A2V9JPV9      --GLGD-----K----------------QN----------IVTAKLDDLNKELTSAEADR
A0A7V0Y3A1      --FTGE------------N---------NN----------VAEGRLEQLHGALAEATAKR
A0A7C5Z4J3      --DATG-----K----------------VN----------VEEQRLADLSQDLTAAQNDL
A0A1F2TPT3      --TAEG----------------------SP----------IVMARLNELSASITRAQTGL
A0A2V8JTQ2      --GLDD-----K----------------QN----------IVTTKLTDLNRELTAAEVDR
A0A2V8UZY0      --GLDN-----K----------------QN----------LVTAKLDDLNRGLTAAEADR
A0A350UEK1      --FTGK-----D----------------TN----------VDEEKLKQIQDQLTAVQGDR
A0A350UIQ4      --FTGN-----D----------------TN----------VDEVKLKQIQDQLTAVQGDR
A0A7T9GJN6      --SSDN------------S---------EN----------LTIEKLSKVHGLVMQAETDR
A0A7T9GJN7      --SIEG------------K---------ET----------LTTEKLTTLHGQAVRAETDR
A0A1H5Z7N3      --G--F-----D---PTHN---------E------------ITTSLEDLNRAVGQAQISR
A0A1G7JVV8      --GLGA-----DASKPVTT---------Q------------VTAAVEALSTAAIAAKVQR
A0A1H4T6W9      --GLGF-----DATKPPTT---------Q------------LAVSVDALSTASVGAKVQR
I3ZEU5          --GLGF-----DATKPPTT---------Q------------LAVSVDALSTASVSAKVQR
A0A7W7ZGZ3      --G--L-----D---PTKN---------Q------------NTTTLEDLSVAVAQAKIQR
A0A7G8BSK5      --G--M-----D---PTRS---------Q------------INASLEQLSTAANEARIAR
A0A428MDU2      --G--F-----D---PSHN---------Q------------ISTSLEDLSKAAGDARIAR
E8WVF6          --G--F-----D---STHN---------Q------------IASSLEDLAKASGTAKLAR
A0A1I6MH75      --G--F-----D---PKDN---------Q------------TTSTLEDLSKASGAAHIAR
A0A7Y9TM87      --G--M-----D---PTHS---------Q------------ITMGLEDLLKASDQARIVR
A0A7W8J1H5      --G--F-----D---PNHN---------Q------------ISASLDDLARAAGAAKLAR
A0A7Y9T5K4      --G--F-----D---PTHN---------Q------------ISTSLDDLARAAGTAKLAR
A0A852VHP9      --G--F-----D---PNHN---------Q------------ISASIDDLAKAAGGAKLAR
A0A7W8IFZ2      --G--F-----D---PNHN---------Q------------INESLDDLSRAAGAAKLAR
A0A7W8J9Y9      --G--F-----D---PNHN---------Q------------INESLDDLARASGAAKLAR
A0A7L5A6M5      --G--V-----D---SSHD---------E------------IAAAIEDLQKAAGVARLQR
A0A5B9EBI2      --GVSI-----D---PTHS---------QS----------EITSLIDSLTKAAGDARINR
A0A7Y5RFT3      --GVSI-----D---PTHS---------QS----------EITSLIDSLTKAAGDARINR
A0A239HDF6      --G--F-----D---PTHN---------Q------------ISTSLDDLAKASGQAKLAR
A0A4Q0T270      --G--F-----D---PKDN---------Q------------ISSSLEDLSKASGTAKIAR
A0A1Q3QQB6      --G--F-----D---PNHN---------Q------------ISSSLEDLSKAAGEAKIAR
A0A3N1K1G7      --G--F-----D---PSHN---------Q------------ISSSLEDLSKAAGEARIAR
A0A4V2G466      --G--F-----D---PNHS---------Q------------ITASLEQLSTASNDAHIVR
A0A6B9YNQ8      --G--F-----D---PNHS---------Q------------ITSSLEQLSTASNQARIAR
A0A3N6A5T6      --LAGS-----SSKEGDRS---------QN----------IIMQKLADLNQEMTKVEAQM
A0A2V8R8U7      --LGPE-----------SG---------PN----------IEAVRDATYSSQLLAAENER
A0A7V9Q528      --LGSV-----------QG---------QN----------FTADRLGTYSGQLLAAEKTR
A0A2V8QMP4      --LGTK-----------QG---------QD----------LNALQLSTYSSQMQTAEAA-
A0A2V8R4S3      --LGTK-----------QG---------QD----------LNALQLSTYSSQMQTAEAAR
A0A2V8NJ55      --ISTA-----------QG---------VD----------ITNVRVGSYSSQLIEAENKR
A0A7V9ZQ50      --ISTA-----------KG---------VN----------LTNEQVGTYSEQLLKAEEER
A0A2V8Q7I0      --LTED-----------VM---------LN----------TEAQRLADLTKQLFESENKR
A0A2V8S6K4      --QSGS-----AVNPEAKG---------AN----------VTVERVAMLSTEWLNAQNEV
A0A317I2L9      --PTGN-----------QN---------LD----------VEGQRLNSLSGQLLDAENQR
A0A2V8LLF9      --IDNT-----------PG---------TN----------LEAMRLQTYSAQLLAAEDNR
A0A352FRF4      --LTDA-----------PA---------SN----------LRQQRVSTYSSQLLEAENQK
A0A7W1GE99      --LNAG-----------KG---------QD----------LNAERLGMLSSQLLTAENEL
A0A1Q7YKQ8      --PSKS-----------PG---------AD----------LAADRLAQLSKQLLEAENNR
A0A0B6WXT1      --LGQA-----------KG---------QN----------LTLERLATLSGQLLEAENER
A0A2V8MKV0      --LTPT-----------EN----------N----------VPIQREQTYNKQLLDAQNEY
A0A2V8PYY8      --LTPT-----------EN----------N----------VAAQSEQAYNKQLHDAENER
A0A3B9MEU8      --LTAE-----------AG---------GN----------LEAARLATLSGQLLQAENDR
A0A352F3R7      --LTID-----------AS---------SN----------LEVARLSTLSSQLLQAENDR
A0A7W0GRF6      --LTTD-----------PN---------GN----------LEAKRLATLSSQLLDAESDR
A0A7W1H6G6      --LTTD-----------PN---------GN----------LEAKRLATLSSQLLDAESDR
A0A7V9HZC8      --LTSD-----------AS---------SN----------LEAKKLATLSSQLLEAENDR
A0A7W0XCB9      --LTTD-----------PN---------GN----------LEAKRLATLSSQLLDAENDR
A0A3N5YNR8      --NIGP-----D------R---------GS----------IVLQTLEDLNRQMTTVEGEL
A0A7W7ZUJ7      --GTDD-----K----------------QN----------LTTEKLDELNRELTSAQADR
A0A2V2R0I6      --TLDD-----K----------------QN----------IATQRLGDVNRELTQAQSER
A0A2V8XAR9      --TLDD-----K----------------QN----------ITTQRLSDINKQLTDAQSER
A0A2V8VZA0      --TLDD-----K----------------QN----------ITTQRLSDINKQLTDAQSER
A0A1Q7CB82      --TLDD-----K----------------QN----------ITTQRLSDINKQLTDAQSER
A0A2V8WIU1      --TLDD-----K----------------QN----------ITTQRLSDINKQLTDAQSER
A0A1Q6Y9F5      --TLDD-----K----------------QN----------ITTQRLSDINKQLTDAQSER
A0A2V9EVV8      --TLDD-----K----------------QN----------ITTQRLSDINKQLTDAQSER
A0A2V8YF91      --TLDD-----K----------------QN----------ITTQRLSDINRQLTEAQSER
A0A2V8XZK2      --TLDD-----K----------------QN----------MTTQRLGDINRQFTDAQSER
A0A2V8ZTX6      --TLDD-----K----------------QN----------MTTQRLSDINKQFTDAQAER
A0A2V9BT79      --TLDD-----K----------------QN----------MTTQRLSDINKQYTDAQAER
A0A2V9YHT3      --GIDE-----K----------------QN----------IITAKLNDLNKAYTDATNDR
A0A7C2XNI7      --TIDE-----K----------------QN----------ITTQKLADLNTELTQAQADR
A0A1Q8B793      --TIDD-----K----------------QS----------ITTQRLGEINKELTEAQSDR
A0A2V9BCA0      --TIDD-----K----------------QS----------ITTQRLGEINKELTEAQSDR
A0A2V9BWU9      --NIDE-----K----------------QN----------ITQQKLSDLNKELTQAQGER
A0A2V9DKX2      --NIDE-----K----------------QN----------ITQQKLSDLNKELTQAQGER
A0A7C2YQY3      --AISE-----G----------------QN----------VTMQKLGQLNHELTLAQSER
A0A845TWB8      --ALNE-----G----------------QN----------VTITKLGELNHEVTEAEAER
A0A2U3KC61      --GVDE-----K----------------QN----------IVTAKLNELNNELTVAQTDR
A0A2V9Y2R7      --GIDE-----K----------------QN----------IVTAKLDELNKELTEAQTDR
A0A2V9NGH6      --GIDE-----K----------------QN----------IITAKLDELNRELTTAESGR
A0A2V9PYE6      --GIDE-----K----------------QN----------IITAKLDELNKELTAAESGR
A0A2V9NL07      --GIDE-----K----------------QN----------ITTAKLDELNKELTAAESAR
A0A2V9QD92      --GIDE-----K----------------QN----------ITTAKLDELNKELTAAESAR
A0A2V9WPZ6      --GIDE-----K----------------QN----------ITTAKLDELNKELTAAESER
A0A2V9ZLH4      --GIDE-----K----------------QN----------IITEKLDELNKELTAAESDR
A0A2V9RQF1      --GIDE-----K----------------QN----------IITSKLDELNKELTAAESDR
A0A2V9YDK8      --GIDE-----K----------------QN----------ITTAKLDELNKELTSAESER
A0A2V9V8F7      --GIDE-----K----------------QN----------ITTAKLDELNKELTAAESGR
A0A2V9XGR9      --GIDE-----K----------------QN----------ITTAKLDELNKELTAAESGR
A0A2V9V3Q5      --GIDE-----K----------------QN----------IITQKLDELNKELTSAESER
A0A2V9NWS3      --GIDE-----K----------------QN----------ITTSKLDELNKELTSAESDR
A0A2V9USA9      --GMDE-----K----------------QN----------ITTAKLDELNKELTSAESER
A0A2V9XW18      --GADE-----K----------------QN----------ITMAKLDELNKELTAAESER
A0A1H5SQF5      --GAPTMSSAGSPQVGSDL---------GS----------VELARLNDLNAQLTAAETVR
A0A2V8G155      --VPAE-----D------R---------QN----------IVVQRLADLNTALTRAKTER
A0A2V8HDM7      --VPAE-----D------R---------QN----------IVVQKLADLNTALTRAKTER
A0A2V8IVN9      --SLKD-----R----------------EN----------IVVQKLSDLNSAVTQAKTER
A0A7W1SCW7      --PLQH-----R----------------EN----------IVVQKLTDLNAAVTHAKTER
A0A3E0NV31      ---------------DVDG---------ES----------ASSRRVGDLARLQTEAEAEA
A0A3N5M5V0      --NIND-----R----------------GS----------IVLQTLEDLNRQMTTVEGEL
A0A7X7XDY5      --VSAN-----Q----------------QD----------VVLQKLNELSTALTEAQTDR
A0A2V9L5B5      --YI------------TEK---------QN----------MATARLEELLEAYTKAQSER
A0A2V9LK56      --FV------------DDR---------KN----------LANERLGQLQQEYTKAQADR
A0A2V9L7I0      --YI------------TEK---------QN----------MGNARLEELLQEYTKAQAQR
A0A522PPT0      --FIQN-----A--VNAQA---------QS----------MANARLEQLEEEYTRAQADR
A0A7C5V1G5      --FIQN-----A--VNSQA---------ES----------MANARLDQLVQEYTKAQADR
A0A4R1LC91      --TLGD-----DGTGRTPA---------YS----------SVLDRLEQATTALTQAQSSR
A0A2V9QB26      --FTSE-----K----------------TK----------ISEEKLQQLQGELSKTQTDR
A0A2V9VYY4      --GVDE-----K----------------QN----------IVTEKLGELNKELTEAETDR
A0A2V9KIE8      --FITE-----K----------------QN----------LVNDRLQQLEQEYTKAQAAR
A0A7C2GJ20      --QLSE-----N----------------QT----------ITVERLADLNRRLIEAETDR
A0A7C4BTL5      --F------------TGEK---------QN----------ISEEKLRQLQTALAAAQMDR
A0A7X8YVF2      --SL------------GEK---------QD----------VITQALGDINAKLTEARALR
A0A7X7YEP0      --ALDA-----G----------------SN----------VALQRLQALNGDLTSAMSQR
A0A2V9CBM2      --FLQT-----D---NGTT---------QN----------IANERLQQLQQELTKAQAEL
A0A2V8XN17      --FLET-----D---KGAS---------QN----------VANERLQQLQEQLTKAQSER
A0A2V8WX45      --FLET-----D---KGAS---------QN----------VANERLQQLQEQLTKAQAER
A0A1Q6YR79      --FLET-----D---KGAS---------QN----------VANERLQQLQEQLTRAQSER
A0A1Q7VA32      --FLET-----D---KGAS---------QN----------VANERLQQLQEQLTRAQSER
A0A2V9EY85      --FLET-----D---KGAS---------QN----------VANERLQQLQEQLTKAQSER
A0A2V9H8K0      --FLET-----D---KGAS---------QS----------VANERLQQLQEQLTKTQAER
A0A2V9FFE5      --FLET-----D---KGAS---------QN----------VANERLQQLQEQLTKAQSER
A0A2V9GM43      --FLET-----D---KGAS---------QN----------VANERLRQLQEQLTKAQSER
A0A2V8ZHL8      --NISD-----K----------------ES----------VVEQRLADLSRDLTNAQSDR
A0A2V9B240      --NISD-----K----------------ES----------VVEQRLADLSRDLTNAEGDR
A0A2V9CYQ5      --FLQT-----D---NGTT---------QN----------IANERLQQLQQELTKAQAEL
A0A2V9BWU8      --FLEN-----D---KGAS---------QN----------VANERLQALQEELTKAQADG
A0A2V8ZG48      --FLET-----D---KGTS---------EN----------VANERLQQLQEELTKTQAER
A0A2V8Y334      --FLET-----D---KGAS---------EN----------VANERLQQLQEELTKAQTER
A0A2V9AY68      --FLES-----D---KGVS---------EN----------VANERLQQLQQELTKAQAQR
A0A1F2RFI7      --FLDE-----K----------------QS----------LTTEKLKQLQEEATRAQADL
A0A1F2RZS3      --FLDE-----K----------------QS----------MNAQKLQQLQEEATRAQSDL
A0A845TW47      --FLET-----E---KGGR---------EN----------IADERLRQLQEELTHAQSVR
A0A845TXC1      --FLES-----E---KGKV---------EN----------IFDERLRQLQEELTRAQAAR
A0A1F2USE2      --FLQN-----Q---RGEN---------EN----------IVNQRLRQLQEQLTQAEADR
A0A7C2VB08      --FLET-----S---EGQP---------EH----------ILDERLRQLQEELTRAQAER
A0A2V9C238      --FLEK-----E---KG-A---------EN----------IVNERLRQLQEELTRAQAAR
A0A1F2Q9F5      --FLEN-----E---AGQP---------EN----------IVNERLLQLQAELTRAQAER
A0A1F2QQH9      --FLEN-----E---AGQP---------EN----------IVNERLLQLQAELTRAQAER
A0A1F2QXK7      --FLEN-----E---AGQP---------EN----------IVNERLLQLQAELTRAQAER
A0A2V9DEM9      --FLER-----E---KGVP---------EN----------IVNERLRQLQEELTRAQAAR
                                                                            

A0A2V7VMF7      IGIEAALKQFAEMRKARKNLDTI----------------------------------PQV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V9IXG5      EEEEQKLAKLETYIADSSKLTNI----------------------------------PEL
A0A2V9J2P4      EEEEQKLAKLETYIADSSKLTNI----------------------------------PEL
A0A831T3F4      ILKQSLYEE-VKAGRVAQLPQ---------------------------------------
A0A2V8JK38      -IQKQSYERMVRTGSADALPQ---------------------------------------
A0A7W0JWI4      KLAETTYRAALAPGAASALAE---------------------------------------
A0A1Q7RLS4      GEIEGLLKQIDANRQNGGAYENI----------------------------------PQI
A0A257VBK0      SEVAAIASQLEAWRTSGGDPL-------SI---------------------------PAV
A0A7C5TWV7      IKLETKIAALQGVDVTSLSRA-------TL---------------------------PDV
A0A2V7XDY0      IGLEAALKQIAQLKAANQPLD-------AV---------------------------PQF
A0A2G6PYV5      IEKRNNLQALQASTP-----S-------QA---------------------------IEV
A0A1F2TCR2      LQKGQVYEQVRAVKPDSDEAD-------NL---------------------------SII
A0A7Y9PHF8      IRKEADYRALQSGSI-----A-------AI---------------------------GAS
A0A7W8J3G9      IVREAQLRAAESGQP-----E-------VV---------------------------AAI
A0A1F2V330      ANDQARLAAVQQEITELEKEG-------VL---------------------------DAA
A0A662EE63      IDVETKLNALNQLRARHVSEV-------AF---------------------------PEV
A0A2V8TLH7      AELESVLKRVDEVRQNGGSYE-------VI---------------------------PQI
A0A1Q7ZJT1      GEIEGLLKQIDANRQNGGAYE-------NI---------------------------PQI
A0A2V8VC99      GELEGLLKQIDSVRLSHGSYE-------NI---------------------------QQI
Q01XL7          IAKQARWEMAKNTPI-----D-------SL---------------------------PDV
A0A523DUV7      IEIESALAQVDKLKQSGGALD-------AM---------------------------PQI
A0A7W1TTH3      MDKRARYEELSAVAG--SEIDIDDPKVMSV---------------------------PAV
A0A1F2U158      IEKESVNNQIKSLGT--TPVD-------SI---------------------------PAI
A0A2V8F6S9      LQKELLYNQVKAMAA-GQPLD-------SV---------------------------PAI
A0A7V0UHS9      ISIEKEMRELEAQGA--LDQP-------VF---------------------------SEK
A0A7D8BEX2      IVAEARYRYLNESDP--NLIE-------SE---------------------------QAV
A0A4Q1SCH5      IVKEAQYRAAETGDP-----A-------VL---------------------------AAL
A0A7V4SJP8      SETSAVVGQIRRSLARGEDAA-------SL---------------------------PST
A0A372IRG7      IVKEARYRMAQTRNP-----D-------LL---------------------------VSV
A0A2V8K4L4      MIAQSKYELLASSPP-----E-------AL---------------------------PQV
A0A2V8NCZ3      MVTQSRFELIQSSPP-----E-------AL---------------------------PQV
A0A4Q7YNP3      IQKESQSEIAAVALS-----T-------TL---------------------------PSV
E8UZE1          IMKEVTFRESMVSDA-----D-------QI---------------------------VPT
A0A2V7YW66      IEKEAKYHETITGPK-----E-------NV---------------------------ADS
A0A2V7Z0V0      IEREAQYHETQSGPR-----E-------SM---------------------------SDS
A0A2V9M454      ISKESLYKMVVSNEA-------------QV---------------------------GFI
A0A2V9J4D6      AEKESLHQLVKSNEA-------------QI---------------------------ALL
A0A2V9L9C5      AEKESLHQLVKSNEA-------------QI---------------------------ALL
A0A2N9M9N1      ANKQSVYDSARHNNA-------------EA---------------------------AVL
A0A2V9JEC4      AQKESLWESVQEDNS-------------LA---------------------------EVA
A0A2V9LPQ3      AQKESLYQMVKSNPE-------------QI---------------------------AML
A0A7Y8IYX6      IARQAELQQIQGITP-----E-------EF---------------------------PES
A0A2V9IVR7      VRAESLYNVARNNE------N-------QM---------------------------ASL
A0A2V9ILE2      VRAESLYNVARNNE------N-------QM---------------------------ASL
A0A2V9LGY4      VRAESLYNVARNNE------N-------QM---------------------------ASL
A0A7T9JJ28      RAAEALYIRSKEVPA-----D-------EL---------------------------PPV
A0A7T9GE94      KNAQLVYDLSKNVDD----VT-------TL---------------------------PEI
A0A7Y4X7L5      KGSQAAYELSRSLKD----PT-------TI---------------------------PEI
G8P0Y7          IQKESLYNVAKRGDP-----S-------TL---------------------------SVI
A0A2W4RYA1      MRQESLYRQLQDALARSADLD-------GF---------------------------PAV
A0A2V8EXP2      IQKEATYNQMKALQTERAGLD-------TF---------------------------PAI
A0A843SYC7      FQKEALFRQLESLRGDSAMLD-------TF---------------------------PAI
A0A7V9BJ09      INKEALYNQLKSMQV-TGAIE-------TF---------------------------PAV
A0A7W1DT80      INKEALYNQLTSMQA-AGTIE-------TF---------------------------PAV
A0A5M8T4U7      IMRESRMREFASQDT-----D-------MA---------------------------ALT
A0A7L5A491      IRKEASYRALESGSQ-----A-------AA---------------------------IEV
A0A7D8BF18      IEAETRYKVIAGTDP-SSTTQ-------EM---------------------------DAS
A0A1E3Y9R6      MNAEVQVNAMAERRARGESLE-------SF---------------------------PPV
A0A2W4TLP2      MNREVQVNAIRELRASGESLE-------TY---------------------------PAI
A0A7G8BDY8      IVKEAKYRVAQSGNP-----E-------LI---------------------------GTI
A0A7C4BZ42      MAAQSKYEMANASPA-----E-------AL---------------------------PQV
A0A3R9WF43      ISSEAVYHLVKTQNPEVVLGL-------GS---------------------------MSI
A0A317HKM4      IEKDAQIKQMSALEADHKPLD-------TL---------------------------PAI
A0A2V9CG11      IAKQAKFEQVKSTPV-----E-------SL---------------------------PEM
A0A523E0N1      TAAEARYANLASADP-----F-------SL---------------------------SEV
A0A1V6HR88      IGKGAALKELEVATP-----Q-------IA---------------------------AEI
A0A4Q1SDL1      ILKEAVYKAVESGNA-----E-------LI---------------------------SEL
A0A841JWG5      ILKEAVYKAVKSGNA-----E-------LI---------------------------SEL
A0A4R1LAZ7      IVKEARYRLAQTRNP-----E-------LL---------------------------VSV
A0A7G8BMP1      IVKEARYRLAQTRNP-----E-------LL---------------------------VSV
A0A7X7ZKA6      SQKEATWNGLKNVSP-----D-------YV---------------------------PEA
A0A523ECP2      AGAEANYTSLRAADR-----Q-------TL---------------------------PAV
A0A2W0C122      MEKEASYQAIAAGSL-----D-------RI---------------------------GEN
A0A2W0AUU7      MEKDASYQAIAAGSL-----D-------RL---------------------------SES
A0A2W0BQL1      MEKDASYQAIAAGSL-----D-------RL---------------------------SES
A0A2V8ERZ5      VQKESLYNQVKAIAN-GTAPD-------AI---------------------------PAI
A0A7W8J413      IAAETTFHLVQSQDP--EVVI-------GL---------------------------GAA
A0A7W8JCF5      ISTETVFHLVQSQDP--EVVL-------GL---------------------------GSM
A0A7W8IEB1      ISTETVFHLVQSQDP--EVVL-------GL---------------------------GSM
A0A7Y9T3I1      ISAETVFHLVQSQDP--EVVL-------GL---------------------------GSM
A0A3P0XH15      VVKEARYRMAMTRNP-----E-------LL---------------------------LSV
A0A3E0P0A3      IEAQAEYNELSNRPA-----D-------DL---------------------------AET
A0A3M1WQW8      IRAETLYRLSQEADV-----D-------TL---------------------------PPV
A0A841JVA9      MEKEAQVSVVRSSPA-------------GV---------------------------PGG
A0A3N1JHC1      ANRQSAVEMARNASV-----D-------SL---------------------------PQV
A0A7V4XQR5      IVKEARYKMALTRNP-----D-------LL---------------------------VSV
C1F294          IVKEARYKMALTRNP-----D-------LL---------------------------VSV
A0A2V9KA79      VAAANEMRELQRQGA-----T-------EN---------------------------RAV
A0A348UZU3      VRKESYYNGIKNASP-----D-------FI---------------------------PEA
A0A7X9FXC4      VRKEAYYNEIKNANP-----D-------YI---------------------------PEA
A0A7X7ZKL5      YAKESAYLELKKLNA-----D-------SL---------------------------PES
A0A522PSP1      RTLEANLALANEGSL-----D-------AL---------------------------LVS
A0A7W8E8D3      IVKEAQMRAAENGNT-----A-------VL---------------------------AAM
G8P085          IVKEAQMRAAENGNT-----A-------VL---------------------------AAM
A0A843SRW6      IGKEEIYRRVQAVKNDPELLN-------SI---------------------------PQI
A0A7W8E330      IVKEAVYKAVRTGNA-----E-------LI---------------------------SEL
A0A4Q1SGQ1      ILMQAIAQAAESGDP-----E-------LL---------------------------PAL
A0A7V2HGP7      VRKEAAYNAVKNGSL-----E-------SA---------------------------QAS
A0A7R8B6H7      MAKQAKFEANSAGGV-----G-------SI---------------------------AEL
A0A2V8GTX0      IQKEALYNQVAATKDR----E-------GL---------------------------SQI
Q1ILD9          IMKEAKYRLAKSGNP-----E-------LI---------------------------GML
A0A7G8BJH7      ILKEAVYRAARSGDP-----E-------LI---------------------------SGL
A0A2V8J0X9      LSKEAIYNQLRRADPSSDAID-------NF---------------------------PIV
A0A7Y5WWH8      LSKEAIYHQLRGADPASDGVD-------NF---------------------------PVV
A0A7C5SHM3      ASAEAQLHAYEQSEP-----M-------AL---------------------------EVV
A0A7V6D154      IQKEAAYEAIRQGGI-----D-------AL---------------------------ASM
A0A7V1XXZ2      IQKESALRMAETGNP-----E-------FY---------------------------SAR
Q1IJZ6          VTREALYRLARSGDL-----D-------RL---------------------------TSL
A0A2V8TCE6      IATESEWTAARGTDP-----S-------SL---------------------------PAV
A0A522TBE8      MQMQAAVRVIDSGAA-----A-------GW---------------------------TNP
Q1ITG0          IMKEAKYRLAQTGNP-----E-------LI---------------------------GTI
A0A7C2ML20      LHAEFLYRATREGNP-----E-------AL---------------------------AEP
A0A7T9HIZ6      IGKGARLAELQAATE-----E-------SA---------------------------AEI
A0A7C5AXS9      VAKQARYEQARAAPP-----E-------TL---------------------------PEI
A0A7C2RGE3      IRAETLYRLSREGEI-----D-------AL---------------------------PPV
A0A7V6D075      IRKQSALEALRSGDV-----D-------AV---------------------------ALA
A0A3N5PCI5      IAVESLYRQLAASQRDQGALD-------TF---------------------------PLI
A0A3M1Q0S9      EDKRARYQVLTSASP-----D-------SI---------------------------DEV
A0A2Z5G448      IVKEARYHLAETRNP-----E-------LL---------------------------VSV
A0A3M1VZ38      AEARARLDTVRSTRP-----E-------SL---------------------------QEV
A0A4Q1SD29      IVKEARYRMAMTRNP-----D-------LL---------------------------VSV
A0A833M5K2      ISREARLRELESAAS-----S-------AA---------------------------VDL
A0A1F2Q9L4      IGKEAHYKELANTPD-----D-------MV---------------------------ADT
A0A7V5ZKV2      ISKESRYKELTSGPK-----E-------TV---------------------------ADS
A0A7Y8LRQ1      ISKEAHYKELMAGPK-----E-------TV---------------------------ADS
A0A3M1PY35      AAAEARVEALDGAEP-----L-------SI---------------------------EAV
A0A3M1VMP2      AAAEARLAAYQEATP-----S-------GI---------------------------PEV
A0A1F2T595      IQKEAVYNQVRTVLEDPAAMD-------T-------------------------------
A0A2V9AC41      IGLEAQMHSIHGRNYDEVPLV-------R-------------------------------
A0A2V2R525      TLAEAAYRAALEPGAAEALAA-------S-------------------------------
A0A321LPW6      LLKGSLYEELNMGRLDRLSEA-------F-------------------------------
A0A2V9R9V4      ILKESLYEQVRQGRVAQIPEA-------F-------------------------------
A0A321LE75      KLKESLYQQVKGGNIDVATEA-------F-------------------------------
G2LEI9          LRAEERYQASLTQPIDSLDEM-------Q-------------------------------
A0A7V9TW03      GLAEAAFRTSQLPGATEANAE-------V-------------------------------
A0A3N5XQP8      IAEQSQYDQARAASATRVPTN-------L-------------------------------
A0A2V9KCS3      VAKQSRYEVALSSSLEALPEV-------L-------------------------------
A0A7W1JC10      KLAEAEYKVGLAPDAADVLAT-------T-------------------------------
A0A3M2BZG9      LDKQAIWDELRNLTDAEVANS-------L-------------------------------
A0A1Q7N5R7      RDADALEHVLISMRDPGALAD-------A-------------------------------
A0A352F549      GLAEAAFRTSKLPGATEASAE-------V-------------------------------
A0A3B9MLP9      SLAEAAYRASLAPGVTEANAE-------T-------------------------------
A0A3D5SQ87      SLAEAAYRASLAPGVTEANAE-------T-------------------------------
A0A7Y2DUG3      RKIEANYNTALKAKNVGALP-----------PDII----------------------NND
A0A7Y2D8Q4      RKLEAQYSAARTSKNPYGLYD-------S-----S----------------------GSQ
A0A2V8NW86      ITAQSRWQGTTTSPPDALPDV-------L-------------------------------
A0A3M2D491      RAIEQQYRTAVEVAKKGEILS-------V----AS----------------------DNK
A0A7W1CBZ8      RKLSGLYEAAQRASARGDILS-------V----VG----------------------DNK
A0A7W1FC90      RKLSGLYEAAQRASARGDILS-------V----VG----------------------DNK
A0A7W1ZXG0      RKLSGLYEAAQRASTRGDILS-------V----VG----------------------DNK
A0A7W1ZIT3      RKLSGLYEAAQRASARGDILS-------V----VG----------------------DNK
A0A353C9L6      RQLEGRYNAALTANSRGEGMN-------I--PDLY----------------------ENK
A0A2V8RQV0      RQLEATLNAAESANARGEAVN-------I--PSIG----------------------ENK
A0A2V8SJH5      RQLEARYTAAAQAGARGEGMN-------I--PDLS----------------------ESK
A0A136JPP4      RKLEARYNGAVQASSRGEGRN-------I--PDLY----------------------ENK
A0A399WUJ8      RKLEARYNGAVTASSRGQGQN-------I--PDLY----------------------ENK
A0A7V9C3X9      RQLEGRYNAAIQANSRGEGMN-------I--PDLY----------------------ENK
A0A7V9ZSX9      RKIEANYNAAVSANARGEGDN-------I--RELT----------------------ESR
A0A3M1SIV3      RKLEQMYEAALQAANRGEIFS-------IVSRETP----------------------NSE
A0A7V1SCI4      RKLEQMYEAALQAANRGEIFS-------IVSPEIP----------------------NSE
A0A7C5ZUA8      RQLESRYNAAVAANARGEGAS-------I--PEIT----------------------ESK
A0A7T9FQE4      NKIQTLYTAAL--NASGKGDI-------L--SVVG----------------------DNK
A0A3E0PHB0      RKLEAEYSAAVQAKNP---YA-------L--SDAS----------------------GGV
A0A7T9G4W3      RKLEAEYAAALQAKNP---YA-------L--SDSS----------------------GSL
A0A838UAA0      EKIAAQYNAAIQAVQTGDILA-------V----VG----------------------DNK
A0A7W1HTU2      RKLQGLYEAAVRASQQGDILA-------V----VG----------------------DNK
A0A357F267      RQLESRYNAAVSARARGEGMN-------L--PDLY----------------------ENK
A0A7V9ICU8      RQLEGRYNAAVAASRKGEGMN-------I--PDLY----------------------ENK
A0A7T9JEF9      INAEAALRAAQQNPLRTTTAE-------T-------------------------------
A0A399WNU1      ITAEAAYKAALNNPLAGTTAQ-------A-------------------------------
A0A3E0PCN7      INAEAALSAAQQDPMRGVTVA-------S-------------------------------
A0A7Y4TLV3      ITAEAAYREAAQNPMSGAGAE-------S-------------------------------
A0A7W0MGQ3      KNAKAALDSYLQQPDAVAGLV-------E-------------------------------
A0A1Q7Y6W9      KLAQAVYEA-SLQPGASEARA-------E-------------------------------
A0A2V8NC68      KMAEASYRA-ALRPDAASAMV-------E-------------------------------
A0A352FLX4      KMAESAYKA-SLQPGAAEALA-------E-------------------------------
A0A2V8MHG6      KAAEAAYRA-TLAPGALEAQA-------E-------------------------------
A0A2V8P7N1      KAAEAAYRA-VLAPGALEAQA-------E-------------------------------
A0A2V8M3M6      KAAEAAYRA-VLAPGALEAQA-------E-------------------------------
A0A1Q7NJH5      KAAEAAYRA-VLAPGALEAQA-------E-------------------------------
A0A2V8PJY0      KAAEAAYRA-VLAPGALEAQA-------E-------------------------------
A0A7W1BYD3      KLAEAEYRV-SLEADAAEVLA-------T-------------------------------
A0A838PIP9      KLAEAEYRV-SLATDAAEVLA-------T-------------------------------
A0A399WK13      KNAEANYFEIAKSPERLSAMA-------E-------------------------------
A0A7V8YZQ7      KNAEADYFTIKDSPKQLRSLA-------E-------------------------------
A0A7V9ICV8      KIAEAEFNSVKDSPDRINSMA-------E-------------------------------
A0A136KC10      KNAEANYFEVAKSPERLAAMA-------E-------------------------------
A0A7W1IVA5      KNAEAEYTQVSKNAESLNARA-------E-------------------------------
A0A7W1ZIE3      KNAEAEYTQVSKNAESLNARA-------E-------------------------------
A0A7T9J551      KNAEANYLAVANSPDKVNALA-------E-------------------------------
A0A7V9NLN0      KNAQAKYETVSKSPEAINSLA-------E-------------------------------
A0A7T9G8R2      KNAEAQYNSVNTSPARLAALA-------E-------------------------------
A0A7Y2D047      KEAESQYNAVKNSPERINALV-------E-------------------------------
A0A3M2D6Y5      KIAEAEYNAVKDSPDRLKALV-------E-------------------------------
A0A2V8SEX6      KNAEAQYVAIKDSPEAINALA-------E-------------------------------
A0A7C5ZUU4      KLAEAKYNSVLSSPDNARALT-------E-------------------------------
A0A3E0PCJ6      KNAEAQFNAVRDSPSRLSALA-------E-------------------------------
A0A2V8RTL7      KLAEAKYFAIKDSPESLNALA-------E-------------------------------
A0A3M1S4R8      KIAEAEYMAVKDSPEKLRALA-------E-------------------------------
A0A7V1SAJ0      KIAEAEYMAIKDSPEKLRALA-------E-------------------------------
A0A7W0N726      KIAEAKFKTVENSPERINSLV-------E-------------------------------
A0A7W1HTZ7      KNAEAKYLAVNRSPESINAQV-------E-------------------------------
A0A1Q7YFI6      KLAEAAYRA-AQAPGAAEALA-------R-------------------------------
A0A7V9C9Y7      KRAEAVYNTITNRPDAVSAQA-------L-------------------------------
A0A7W1G8A4      GDAEAAYRA-ALAPGAASALA-------Q-------------------------------
A0A7V9KMZ1      KSAEAAYNA-ARAPGAAAALV-------D-------------------------------
A0A7W0JTE4      KTAEAAYNA-AKVPGAASALA-------E-------------------------------
A0A0B6WWQ6      KLAEAAYLA-SLEPGAAEAMV-------E-------------------------------
A0A3B9MK99      IEAESKFNA-AKVGGAATALA-------E-------------------------------
A0A838PA20      KRAEADYHG-AKYEGAASALV-------D-------------------------------
A0A352EX26      KTAEAAFNA-AKAPGAASALA-------E-------------------------------
A0A7V9R410      KTAEANFNA-AKAPGAASALA-------E-------------------------------
A0A2V8MM59      KLAEAEYNA-AKAPGAANALA-------E-------------------------------
A0A2V8PFE8      KMAEAEYNA-AKAPGAATALA-------E-------------------------------
A0A2V8PWS6      KMAEAEYNA-AKTPGAATALA-------E-------------------------------
A0A2V8LCT5      KMAEAEFNA-AKAPGAASALA-------E-------------------------------
A0A352FTJ9      KMAEAEFNA-AKAPGAASALA-------E-------------------------------
A0A1F2S1W5      IQKEATYNQVKAVLENPAAID-------TV---------------------------PAI
A0A2N9LQU7      IIKEARYRLAS--TGNPELV-------------------------------------AAV
A0A2P6WFK7      IVKEARHRLAA--TRNPELL-------------------------------------GTV
A0A2V8JQV5      VEKQSKYEIAK--SAPVESL-------------------------------------PQI
A0A2V8U914      IAKQVQFDLIAKNPAEITTEN---------------------------------------
A0A2V8DRT9      IQKESAYEQIKAVQSDREALD-------TI---------------------------PAI
A0A2V7VYF3      ITKEAGYNRLRTMADDRSALD-------AF---------------------------PAI
A0A1F2SVH2      IEKEAAYNQIRTVQNDRATLD-------TI---------------------------PAI
A0A2V8AJG9      IQKEAAHNQLRGLQHDRNALD-------TF---------------------------PAI
A0A2V9MAM9      IAKTPAYQLAD--KEHPELL----------------------------------------
A0A2V8F956      FQREALYRQVESLRGNPAMLD-------TF---------------------------PAI
A0A2V7W309      YDKQARYNSIQ--STAPETV---------------------------------------A
A0A348V070      VNKFSAYNQLK--ALRPEEL-------------------------------------PES
A0A2Z5G3A3      ILTGAVEQIVK--TGDPELI-------------------------------------SGL
A0A2V7UGP8      SRKEARYRGLL--TTPPGSI-------------------------------------KEV
A0A239MKT6      IQREALYHIIQ--TNDVDLV----------------------------------------
A0A2Z5G7H4      ILKGAVYKIVQ--SGNAELI-------------------------------------SGL
A0A372IT17      ILKEAIDHTAQ--SGDPELI-------------------------------------SGL
A0A841JU67      LLTDAIDRISQ--TGDPELI-------------------------------------STL
A0A7T9GJJ6      ILKQSVYEEVA--RGRVAQL-------------------------------------PEA
A0A7Y4UER8      MLKESVYEQVK--QGRIAEL-------------------------------------PDT
A0A2V8IYW3      LVLERGLADMRADPATAAATA---------------------------------------
A0A7V2HCZ0      VAKQSIYEVAT--SAAVDTV-------------------------------------PQV
A0A2V9AEW6      IANQAKYAEAA--GKSADSL-------------------------------------PEI
A0A2V8WQK6      IAKQAKSEEAR--SKPADSV-------------------------------------PEM
A0A2V8XIF4      IAKQAKFEEAQ--SKPADSL-------------------------------------PEM
A0A350UQT3      VAAEAGYEQTR--SGSLESA-------------------------------------QVS
A0A7C3HRX0      VAAEAAYNSTR--NGDMEAA-------------------------------------QVS
A0A2W0BGU4      IQKEALYNQVQ---TNPDQV-------------------------------------PAI
A0A2W0BVQ9      IQKEALYNQIQ---ANPDQV-------------------------------------PAI
A0A317J121      IAKQAKYELVA--KTSPEAL-------------------------------------PGV
A0A2V9MN96      MQKEANYGLAE--AGDPSGF-------------------------------------AKL
A0A2V7V2Z1      LEREALYNQMR-GAANPEEL-------------------------------------PEV
A0A2V7X2F7      LEKEALYRQMR-GADVPEDL-------------------------------------PEV
A0A2V7V2I1      IEKEALYRQMK-EAPNSEEL-------------------------------------PEV
A0A2V7U3M2      LEKEALYNQMR-NAANPEEL-------------------------------------PDV
A0A2V7UHT0      LEKEALYRQMR-GASNPEEL-------------------------------------PEV
A0A3P0X3W6      IRKQTAYQGVK--SGNASAI-------------------------------------DIS
A0A7V2MG68      VRAEAAYNSMR--SGALDAA-------------------------------------YAS
A0A7C6A629      VRKEAAYNSVR--SGSLEAA-------------------------------------EAS
A0A7V2HBQ5      VRRESVRRSVA--TGAPAAA-------------------------------------QAS
A0A2U3JZ71      VRKEAAYKSVA--GGSLEAA-------------------------------------QVS
A0A2V8TTB0      VKKEAAYNSIQ--SGSLAAA-------------------------------------QVS
A0A2N9MK30      VKKEAAYKSVS--TGSLESA-------------------------------------QAS
A0A3D1ASD2      VRKEAGFNAMQ--SGQMEAA-------------------------------------LIS
A0A7R8B699      VRKESAFESMK--NGSLEAA-------------------------------------QVS
A0A7S7SGU3      VAIEAAFNSTR--AGSLESA-------------------------------------QVS
A0A7Y8HY45      VAAEAAFASTR--SGDLESV-------------------------------------QVS
A0A7C5AXI3      VRKESAYQSMQ--AGSIEAA-------------------------------------LVS
A0A7C6E4H7      VRKEAAYNSVR--SGSIEAA-------------------------------------QAS
A0A2Z5FVL3      ILKGAIYEVVK--SGDPETI-------------------------------------MGL
A0A2V8GFD4      LQKQALFEQLQAARGDAAALD-------RF---------------------------PTV
A0A2V8HSS5      LQKQALFEQLQAARGDAAALD-------RF---------------------------PTV
A0A2V8KP55      IQKQSYERMVR--TGSADAL-------------------------------------PQI
A0A2V9JSI3      LDKESLFELAS--SNEAEA--------------------------------------AVL
A0A2V9WI32      IQKESAYKLAS--AGNPEIF-------------------------------------AKA
A0A2V9KBD6      VQKEVSYRLAR--SGQPELL-------------------------------------AKL
A0A2W0AJ66      MQKEATYRLTP--SSQPELI-------------------------------------AKS
A0A1Q7RBU1      VQKEVNYRLAS--SGRPELI-------------------------------------AKL
A0A2V9JPV9      VQKEIDYRLAR--SGEPELI-------------------------------------AKL
A0A7V0Y3A1      IEIQAKYQASQ-SDTDRESL-------------------------------------PEV
A0A7C5Z4J3      AQEESLYLLVK---SNPEKV-------------------------------------GML
A0A1F2TPT3      FDKEASYNRALALRANPDKLD-------QL---------------------------PQM
A0A2V8JTQ2      VQKDVNYQLAR--SGQPDLV-------------------------------------ARL
A0A2V8UZY0      IQKEVNYRLAV--SGRPELI-------------------------------------AKL
A0A350UEK1      VSKQSRWEMAS--SAPAETL-------------------------------------PDV
A0A350UIQ4      VSKQSRWEMAS--SAPAASL-------------------------------------PDV
A0A7T9GJN6      LLKQSLYEEVR--QGRVDQL-------------------------------------PEA
A0A7T9GJN7      MLKQSLYEDVL--KGRVAQL-------------------------------------PEA
A0A1H5Z7N3      IMAEVRYHTLS--GMDPNQID------------------DSVASTQVGSSGNLTSGAPGA
A0A1G7JVV8      ILAESRYRVLA--SSDPALME---------------------SNLQ----AS-----GAG
A0A1H4T6W9      ILAESRYRVLA--NSDPDLLE---------------------SNLD----VA-----GG-
I3ZEU5          ILAESRYRVLA--SSDPDLLE---------------------SNLD----VA-----GG-
A0A7W7ZGZ3      ILAESRYRAMT--QMDPNSIE---------------------DSID----PS-----KGA
A0A7G8BSK5      IMAESRYRMLS--GMDPNSIE---------------------GSIE----IT-----PGA
A0A428MDU2      IVAESRYRMLA--GMDPNTME---------------------GSIE----TT-----PGT
E8WVF6          IIAESRYRMLN--GMDPNAIE---------------------GSIDAGTTAT-----TGG
A0A1I6MH75      ILAESRYRMLS--GMDPGTID---------------------GTID----MN-----PGT
A0A7Y9TM87      IMAEARYRTLE--NMGANAVE-------PSGGSGGGAASPGVGGGD----SS-----SGT
A0A7W8J1H5      IIAEARYRVVS--GMDPNTIE---------------------GTIE----LT-----PGT
A0A7Y9T5K4      IIAEARYRVVS--GMDPNTLE---------------------GTIE----LT-----PGT
A0A852VHP9      IIAEARYRVVS--GMDPNTME---------------------GTIE----LT-----PGT
A0A7W8IFZ2      IIAEARYRVVS--GMDPNTIE---------------------GTIE----LT-----PGT
A0A7W8J9Y9      IIAEARYRVVS--GMDPNTIE---------------------GTIE----LT-----PGT
A0A7L5A6M5      IVSEARYRLLA--GMDPDAME---------------------GSID----IPMNPGINNL
A0A5B9EBI2      IIAESRYRALA--QADPASME---------------------GLID----AT-----PSI
A0A7Y5RFT3      IIAESRYRALA--QADPASME---------------------GLID----AT-----PSI
A0A239HDF6      IIAESRYRMLS--GMEPDAIE---------------------GSID----AG-----PGL
A0A4Q0T270      IVAESRYRMLS--GMDPDSID---------------------NSIE----TT-----PGT
A0A1Q3QQB6      IIAESRYRVLS--GMDPDSVE---------------------SSID----AA-----PGA
A0A3N1K1G7      IIAESRYRILS--GMDPNTIE---------------------GSIE----TT-----PGT
A0A4V2G466      IMAESRYRMLS--GMDPNTIE---------------------GSLE----AS------GA
A0A6B9YNQ8      IMAESQYRMLS--TMDPNSIE---------------------GAVS----TG-----QGI
A0A3N6A5T6      IERSAEFDAVK----NATVQD---------------------F--------------PDA
A0A2V8R8U7      RTFLAIYEAAKN---APDPFA---------------------N--------------PEV
A0A7V9Q528      KELHASYEASQQ---EQDVWS---------------------I--------------PEV
A0A2V8QMP4      ------YTSAEQTKNTSGIWA---------------------I--------------PQV
A0A2V8R4S3      KQAEADYKSAVETRNTSGIWA---------------------V--------------PQV
A0A2V8NJ55      KQAQATYDAARN---SSDPWS---------------------I--------------PEI
A0A7V9ZQ50      KRAQAAYDAART---SPDVWS---------------------V--------------PEV
A0A2V8Q7I0      KNAEAVYKSAST---ATDKFS---------------------I--------------PEV
A0A2V8S6K4      TKLQSEYDAAQKAQAASDIFS---------------------I--------------PKV
A0A317I2L9      KTAQAIYNSAKN---ASDPFT---------------------V--------------PEV
A0A2V8LLF9      RSQEAIYDAAR---DANDPFN---------------------A--------------PEI
A0A352FRF4      RSLQSAYEAAK---TSPDPFA---------------------N--------------PEV
A0A7W1GE99      KNFTAAFKAAQTTMDTKDIWS---------------------I--------------PEV
A0A1Q7YKQ8      KNLQSLYEAAA---HQSNPMA---------------------V--------------PDV
A0A0B6WXT1      KNLQSAYEAAQ---RETDIWS---------------------V--------------PEV
A0A2V8MKV0      RKLKADYDEAK---ASTELLS---------------------N--------------PEV
A0A2V8PYY8      RKLKADYEEAK---GAADLIS---------------------N--------------PEV
A0A3B9MEU8      KMIQAQLEAAR---KEPDPFS---------------------V--------------PDV
A0A352F3R7      KLIQAQLEAAR---REKDPFS---------------------I--------------PDV
A0A7W0GRF6      KNLQAQYEAAR---KETDSFS---------------------I--------------PDV
A0A7W1H6G6      KNLQAQYEAAR---KETDSFS---------------------I--------------PDV
A0A7V9HZC8      KNLQAQYEAAK---RETDSFS---------------------I--------------PDV
A0A7W0XCB9      KNLQAQYEAAR---KESDSFS---------------------I--------------PDV
A0A3N5YNR8      IGKTADYQAVR--DATPENF-------------------------------------PQS
A0A7W7ZUJ7      IQKESLYNVAK--RGDPSTL-------------------------------------SVI
A0A2V2R0I6      MKREALFEFAK--AGNLDAV-------------------------------------PQM
A0A2V8XAR9      MKKESLYEFAK--SGNLDAV-------------------------------------PQV
A0A2V8VZA0      MKKESLYQFAK--AGNLDAV-------------------------------------PEV
A0A1Q7CB82      MKKESLYQFAK--AGNLDAV-------------------------------------PEV
A0A2V8WIU1      MKKESLYQFAK--AGNLDAV-------------------------------------PEV
A0A1Q6Y9F5      MKKESLYQFAK--AGNLDAV-------------------------------------PEV
A0A2V9EVV8      LKKESLYQFAK--AGNLDAV-------------------------------------PEV
A0A2V8YF91      MKKESLYQFAK--SGNLDAV-------------------------------------PQV
A0A2V8XZK2      MKKESLYEFAK--AGDLDAV-------------------------------------PQV
A0A2V8ZTX6      MRKESLYEFAK--AGNLDAV-------------------------------------PQV
A0A2V9BT79      MKKESLYEFAK--AGNLDAV-------------------------------------PQL
A0A2V9YHT3      IHKQATYRLTL--NSSPELL-------------------------------------SQA
A0A7C2XNI7      MRKEASYRLAR--EGNVDGL-------------------------------------PEV
A0A1Q8B793      MKKEALYQLAQ--SGSLDAL-------------------------------------PAV
A0A2V9BCA0      MKKEALYQLAQ--SGSLDAL-------------------------------------PAV
A0A2V9BWU9      MRSEALYQLVG--TGHIDAL-------------------------------------PPV
A0A2V9DKX2      MRSEALYQLVG--TGHIDAL-------------------------------------PPV
A0A7C2YQY3      IARESQFQQVK--SRRLDDL-------------------------------------SAI
A0A845TWB8      IAKESQSQLVA--SRRLDDI-------------------------------------PAV
A0A2U3KC61      IQKESNYNLAM--AGDPAEFA---------------------KPSR-----------EGT
A0A2V9Y2R7      IQKEANYKSAM--VGDPTAFA---------------------KIQA-----------GGT
A0A2V9NGH6      MEKESIYGLVQ--ATDSDAAA---------------------AAAI-----------SAD
A0A2V9PYE6      MEKESIYGLVQ--ATDSDAAA---------------------AAAT-----------SAD
A0A2V9NL07      MEKESVFRLSD--SVDTESAA---------------------AVAN-----------SGS
A0A2V9QD92      MEKESVFRLSD--SVDTESAA---------------------AVAN-----------SGS
A0A2V9WPZ6      MEKESVYRLIQ--SGDPDVVA---------------------SVPV-----------GGD
A0A2V9ZLH4      MQRESLYRLTR--SGDPDVIA---------------------TATA-----------TGG
A0A2V9RQF1      MQKESVYRLVQ--SGDPDTAA---------------------SAAL-----------SAA
A0A2V9YDK8      MEKESVYRLIQ--SGDPDVIA---------------------STTS-----------VAG
A0A2V9V8F7      MEKESVYRLIQ--SGDPDVVA---------------------SAPV-----------GGD
A0A2V9XGR9      MEKESVYRLIQ--SGDPDVVA---------------------SAPV-----------GGD
A0A2V9V3Q5      MEKEAIYRMTQ--TGDPDAVA---------------------SAVT-----------SAP
A0A2V9NWS3      MAKESFYTLVQ--AADADTAA---------------------AAAL-----------SSA
A0A2V9USA9      MDKEAFYRLVE--SGDPDAIA---------------------SSAG-----------GIE
A0A2V9XW18      MDKEALYRLVD--SGDPDAIL---------------------SSAN-----------ALE
A0A1H5SQF5      IAAEAAYRMTQ--SRDADVV-------------------------------------LGI
A0A2V8G155      IQKQAAYDQIRNARDVPGSVD---------------------TF-------------PLI
A0A2V8HDM7      IQKQSAYDQIRNARDVPGSVD---------------------TF-------------PLI
A0A2V8IVN9      LQKEALYSQLNSLRSGRGAAL---------------------DTF------------PAI
A0A7W1SCW7      FQKQALYNQLESLRRSDSAAL---------------------DSF------------PAI
A0A3E0NV31      ARLRSYVDTLR--AGRTEGV-------------------------------------PDT
A0A3N5M5V0      IGKTAEFQAVR--DATPEDF-------------------------------------PQS
A0A7X7XDY5      IRRESLYLTIRGIKDPLTNF-------------------------------------PSS
A0A2V9L5B5      FEKQSLYSLVE--AGKIQDL-------------------------------------PGV
A0A2V9LK56      FQTESLYNLVK--PDAAKDV-------------------------------------PGT
A0A2V9L7I0      FEKQSLYSLVE--AGKVQDL-------------------------------------PAV
A0A522PPT0      AQKEAQYSLVH--TGKVQDL-------------------------------------PGV
A0A7C5V1G5      AQKEALYSLVQ--EGKVQDL-------------------------------------PGV
A0A4R1LC91      IEKGALYQAIK--SGNGELI-------------------------------------SGL
A0A2V9QB26      ITAQSRWEITA--ASPPDAL-------------------------------------PDF
A0A2V9VYY4      IQKEADYKLAM--NGDPEMFM---------------------KTSP-----------DGR
A0A2V9KIE8      FHAEASYTLVK--STKNMDL-------------------------------------PSV
A0A7C2GJ20      IRAETLYRLSR--EGEVEAL-------------------------------------PPV
A0A7C4BTL5      VAKQSRYEMAK--NSPPETL-------------------------------------PDV
A0A7X8YVF2      MAKESVYRTIA--QTTPDDF-------------------------------------PQA
A0A7X7YEP0      IQAESRFRELT--ESAPETV-------------------------------------AGT
A0A2V9CBM2      YEKESLYRLVQ--TSDYGSL-------------------------------------PGV
A0A2V8XN17      YEKEALYRLVQ--TGELGAL-------------------------------------PGV
A0A2V8WX45      YEKEALYRLVQ--TGEYESL-------------------------------------PGV
A0A1Q6YR79      YEKEALYRLVQ--TGEFGAL-------------------------------------PGV
A0A1Q7VA32      YEKEALYRLVQ--TGEFGAL-------------------------------------PGV
A0A2V9EY85      YEKEALYRLVQ--NGEFGAL-------------------------------------PGV
A0A2V9H8K0      YEKEALYRLVQ--AGESGAL-------------------------------------PGV
A0A2V9FFE5      YEKEALYRLVQ--TGESGAL-------------------------------------PGV
A0A2V9GM43      YEKEALYRLVQ--TGESGAL-------------------------------------PGV
A0A2V8ZHL8      VQKESLYELVK--SNE-SQV-------------------------------------AFV
A0A2V9B240      VQKESLYELVR--SNE-SQV-------------------------------------AFV
A0A2V9CYQ5      YEKEALHRLVQ--TSDYGSL-------------------------------------PGV
A0A2V9BWU8      YQKESVYRLVQ--SGNYGSL-------------------------------------PGV
A0A2V8ZG48      YEKEAVYRLVQ--AGDYGSL-------------------------------------PGV
A0A2V8Y334      YQKEALYRLVQ--AGDYGSL-------------------------------------PGV
A0A2V9AY68      YEKESVYRLVQ--AGDYESL-------------------------------------PGV
A0A1F2RFI7      FQKESLYNQVR--TGDLSSV-------------------------------------PGI
A0A1F2RZS3      IQKESLYNQIR--DGDFSSV-------------------------------------PGI
A0A845TW47      YEKESLARLAE--AGDAAAL-------------------------------------PGL
A0A845TXC1      FEKESFYRLVQ--TGDYVSL-------------------------------------PGI
A0A1F2USE2      YQKEALYQLLA--QGDYASL-------------------------------------PGI
A0A7C2VB08      FERESRYRLVE--AGHFSAL-------------------------------------PG-
A0A2V9C238      YEKESLYRLVQ--AADYASL-------------------------------------PGM
A0A1F2Q9F5      IAKESLYRLTQ--AGEYGAL-------------------------------------PGI
A0A1F2QQH9      IAKESLYRLTQ--AGEYGAL-------------------------------------PGI
A0A1F2QXK7      IAKESLYRLTQ--AGEYGAL-------------------------------------PGI
A0A2V9DEM9      YEKESLYRLVQ--AADYASL-------------------------------------PGM
                                                                            

A0A2V7VMF7      ATD--------------PVVAGLNAQIATFTVE----LSRLKEK-YKEGHPEVQKVNKQV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      -------------------------------------RDAELAD----------------
Q01X01          -------------------------------------ESDLNAY----------------
A0A3M2D9H8      -------------------INQLQADIVRLESD----HETVLGV-NALGQPARVTPTLTV
A0A2V9IXG5      VSS--------------PSFRSYYIQWVEANNA----LEKLRLDGKGEEHPTLVAKRTEL
A0A2V9J2P4      VSS--------------PSFRSYYIQWVEANNA----LEKLRLDGKGEEHPTLVAKRTEL
A0A831T3F4      -------------AFADPKIAELEKKLGELTVM----AAQIEVK-YGPENPRFIEIQQQM
A0A2V8JK38      -------------ITGSSLISQFVGRLSDLKRQ----DAELTVT-FAPDYPSRRRIRSQI
A0A7W0JWI4      -------------EKAAQQIADSKAKLAGLRQR----QAQLLVK-NTAEWPEVKEINQEI
A0A1Q7RLS4      SGD--------------TVVRDLYREKAGLERE----YERLLVT-YKDKHVRVLEKQKEI
A0A257VBK0      AQDPS--------------VQDLAKQYNELNRD----LGKLQAK-FTPKHPEVLKKQEEI
A0A7C5TWV7      LQDPT--------------IQQLKRQLDDLEVE----LADKLRT-YKSGHPVIKELRSRI
A0A2V7XDY0      AADPT--------------IMILNTQVSAANNE----LTRLRQQ-YKEGHPEIQKLLLQL
A0A2G6PYV5      NQNVA--------------IKDLSSQISRKKLE----YEANLSK-YKPQLPKMVALNAEI
A0A1F2TCR2      ATSPG--------------VVTAKSRLADLNSQ----RLTLSSR-YMDTHPDIQKLDAQI
A0A7Y9PHF8      SQAVN--------------LSKLEDAVHAAEQK----MALVKTV-YGPEYSEYRRANNEL
A0A7W8J3G9      FPSAT--------------MTVLESQRAVLTGQ----ITQLSSK-FDMNYPPLQDAHLAL
A0A1F2V330      PPKEK---------------TPAETNLEERRLH----LKQLRSV-FTEQYPEVVSTEREI
A0A662EE63      LEDAT--------------ISNLMQRRGEVEVE----LLDKLGT-YKEGHPAIKELRVRL
A0A2V8TLH7      SGDAV--------------VQDVYREKAILERD----LEKLSVT-YKDKHVRVLEKQSEI
A0A1Q7ZJT1      SGDTV--------------VRDLYREKAGLERE----YERLLVT-YKDKHVRVLEKQKEI
A0A2V8VC99      SGDPV--------------VQELYREKVGLERE----YERLLVT-YKDKHIRVQEKQKEI
Q01XL7          LSDPT--------------LLGLKSRIVDLRRE----MAQLTAT-LTPEHYKVQKIQAQI
A0A523DUV7      AADPL--------------VQRLNLSKAELEVE----RVQLKNR-YKEGHPKVKKVVTQI
A0A7W1TTH3      VSDPV--------------IASHQAELTGLTRKRQLARTAGGTT-RGESHPEIVAINNDI
A0A1F2U158      AQNAQ--------------VQLHKAQLSELQRQ----KAQLSER-YGEKHPDIINVNARL
A0A2V8F6S9      AQNPT--------------VVGAKNKVQELQRT----LTELSAR-YGEKHPSIQKARTDL
A0A7V0UHS9      TPNEA--------------------RLDELRIR----REELRTR-YTSKHPEILKIESEI
A0A7D8BEX2      LGGEQSQNSL---------LKNLRASQADALAN----YASLTAQ-FGKNYPAVKEAKAKV
A0A4Q1SCH5      MPDQN--------------LQSLQTTEASLYAQ----EAQLATK-FGSSYPPLVETREQL
A0A7V4SJP8      LGDPG--------------VQEMTRLYNEMARE----LSRLSVK-YTPQHPEVKALKTRL
A0A372IRG7      SGGV---------------LGSLRSQEADLMVQ----KAQLQSK-FGPEYPKLREIDRQL
A0A2V8K4L4      LDDSS--------------LREYESKLVDLKRQ----RAELSPS-FTPDHPRMQKLEAQI
A0A2V8NCZ3      LDDPS--------------LREYESKLVDLRRQ----GAELGSS-FTPAHPRMQKLEAQI
A0A4Q7YNP3      MDSPE--------------YRRYQEKLADLKGK----VAQLVPP-LTEENPKVIHLRSEI
E8UZE1          TTFPG--------------LTSLRAQKITLESQ----YASLSSK-YGDSYPRVAQIKSEL
A0A2V7YW66      LSGGM--------------VTELRKEVLNLQRD----YDTKLKT-YKPDFPEMVTLKAEI
A0A2V7Z0V0      LTTGV--------------VSDQRGQILKLERE----YETKLKT-YKPDFPDMVTLKADI
A0A2V9M454      QTNSL--------------LPGLEAKELDLKEQ----YSEALAH-YGPTYPKVLSLQDQI
A0A2V9J4D6      AQDHL--------------LETLEQKVADVKTE----YIDARTT-YGPNFPKVVRLQQQI
A0A2V9L9C5      AQDHL--------------LETLEQKVADVKTE----YIDARTT-YGPNFPKVVRLQQQI
A0A2N9M9N1      AEDAL--------------LGQLESKNAELHTE----YAAATSQ-YGPNFYKVKQLGNQI
A0A2V9JEC4      SNDAL--------------LQHLEQNYADLKTQ----YAASLAQ-AGPNFYKAVQIRKQL
A0A2V9LPQ3      AQNDL--------------LQKLQEKSADLKAQ----YVDALGQ-FGPNFPKVVRLRGQV
A0A7Y8IYX6      LRSPA--------------ITSLETTVIQNEQD----LSRLLTQ-FGENWPQVIQKRKDL
A0A2V9IVR7      VGNDL--------------LSRLEERYAELKSQ----YVEAREQ-YGPNFPKVVRLRDQA
A0A2V9ILE2      VGNDL--------------LSRLEEKYAELKSQ----YVEAREQ-YGPNFPKVVRLRDQA
A0A2V9LGY4      VGNDL--------------LSRLEERYAELKSQ----YVEAREQ-YGPNFPKVVRLRDQA
A0A7T9JJ28      INDPT--------------VQALSRELSRQKQE----LANLSAR-YQSNYPAVKQVQEQV
A0A7T9GE94      QRDPL--------------VQDLNKKLTDLKQQ----REQLLVE-FTPEWPEVKKVTQQL
A0A7Y4X7L5      QKDTL--------------VQEIGRRLSELRQN----REKLLVE-YTEEWPEVKTVNQQI
G8P0Y7          LQDPI--------------LSALRQRQSELQTR----YAQLDTW-AGQSYPQMREITSQL
A0A2W4RYA1      LNNQL--------------VQQQKLELAALNQK----KAQLSET-FGDRHPEIVAINRAI
A0A2V8EXP2      LSNQF--------------IQQQKGELAELQRQ----QAQLSEK-LGPRHPDMVKIGLAI
A0A843SYC7      LTNGF--------------IQQQKTELAQLQSQ----YAQLGDK-FGERHPEMVKLRSAI
A0A7V9BJ09      LANDY--------------IQGLKTNLAQLQRE----QAQLGER-YLENHPEMTKVKSAV
A0A7W1DT80      LANDY--------------IQGLKTNLGQVQRE----QAQLSER-YGQNHPEMTKVNSAV
A0A5M8T4U7      GDNPQ--------------VAALRTQLADLQTQ----RDQLALE-VGPRHPKMQAMNAQI
A0A7L5A491      STQAAD-------------LAKLTDTMHVAQQK----METIKAI-YGPNYIEYKRAANEL
A0A7D8BF18      RTSPA--------------VISLRTQLNTARAR----MAELTAN-LGPNHPQVLAVKDQI
A0A1E3Y9R6      LASPV--------------VQKLRADIVAKESE----RARLGTQ-YGPAYPAMRDLASQI
A0A2W4TLP2      MNSPV--------------VQALRADIAAKEAE----RARLGTQ-YGPAYPAMRELATQI
A0A7G8BDY8      VPDSV--------------LPVLRSQEADLKNQ----LALASTE-FGPHYPKVIQLQNQM
A0A7C4BZ42      LDDAT--------------LREYQSKLVDLKRQ----LAELNTT-LMPANPKVQRVQAQI
A0A3R9WF43      ASGNGSSSGALTADGGVDLLRSLRTQEASLRRE----YASYATK-YGEKNPRLLQLQEQI
A0A317HKM4      AANPF--------------IQTLKGELTTSERE----LGQASKE-LGEHHPTIIKLREAV
A0A2V9CG11      LDDPT--------------LREYRLRLTDLQRQ----FVELTAT-LTPAHYKVQRVQAQI
A0A523E0N1      RTSGP--------------VRDLERRYLDLSER----YSELRTT-FGPDWPEIKRVKGAL
A0A1V6HR88      LPDPV--------------VAQLRGEVVEMERE----YASRLAT-FKPEWPAMVELKGRI
A0A4Q1SDL1      GGTSTADTAPAVTNALSL-IQNLRLQQANIETE----IASGEKH-YGSAYPHMVELRASL
A0A841JWG5      SGNSAAGTGPAVNTALNL-IQNLRLQQSTLETE----IASAEKH-YGPAYPRMAELRASL
A0A4R1LAZ7      APTTV--------------LASLREQQAALLVQ----AAQLESK-YGPDWPRVREIRSQL
A0A7G8BMP1      APGTT--------------LTALRQQQSELLVQ----YAQLKSK-YGSDWPKVKEAEKQL
A0A7X7ZKA6      IANPL--------------IQRLREEYVRLKRE----TQKMEER-FQPDYPELQRMKVEM
A0A523ECP2      LANPT--------------VQGLVQQRGVLEGQ----VAELTAK-FKDDWPDLRRAREGL
A0A2W0C122      KSGEA--------------LQSLRLREAELKNE----YAQATTT-YGPNHPKVIELTNRI
A0A2W0AUU7      KSGDA--------------LQSLYLREAELKNE----YAQATTT-YGPNHPKVLELTNRI
A0A2W0BQL1      KSGDA--------------LQSLYLREAELKNE----YAQATTT-YGPNHPKVLELTNRI
A0A2V8ERZ5      ATNAG--------------VASAKAKLSDLQRE----KAKLLER-YQDKHPQVINAVAAL
A0A7W8J413      GAGGGGGAGALPGDGGIQLIRSLRTQEAELAQE----YAGEAVK-YGANNPRLVQTQQQL
A0A7W8JCF5      SAAGGTGGGSLTPDGGIQLIRSLRTEEAALEQE----YAGAAVK-YGANNPRLAQTQQQL
A0A7W8IEB1      SASGGNGGGSLTPDGGIQLIRSLRTEEAALEQE----YAGAAVK-YGANNPRLAQTQQQL
A0A7Y9T3I1      SVSGG-GGGALTADGGIQLVRSLRTQEAELAQE----YAGAAVK-YGANNPRLAQTQQQL
A0A3P0XH15      APSAT--------------LSQLQQQAAALTVQ----QAQLQSK-FGPEWPRVKEVQGSL
A0A3E0P0A3      LSGGL--------------VSSQRAELIRLQRE----YDTKLET-YRPDFPTMVELKTQI
A0A3M1WQW8      MSNPI--------------VQTLRQRLADDRRR----LVKLQQQ-YTDEWPEIQSLKGEI
A0A841JVA9      LESAA--------------YAAAQAKLADLEAR----VAAIVPP-LTEANPKVIHLRAEI
A0A3N1JHC1      ADDPT--------------MRDDRAKLTELHRQ----LAEMSTT-MTPSNYKVQKVESQI
A0A7V4XQR5      APNTV--------------LTSLRSQQANLLVQ----QADLQSR-FGPRYPKLEEVRQQL
C1F294          APNTV--------------LTSLRSQEANLLVQ----QADLQSR-FGPRYPKLEEVRQQL
A0A2V9KA79      VEE----------------ASAVQKKLEDLRLE----LKGLQARGYTENHPEVIRLRRQI
A0A348UZU3      MNNPL--------------IQRLREEYLKLSRE----YAKMEEK-FQPEYPEMQRLKAEL
A0A7X9FXC4      ISNPL--------------IQRLREDYLKLSRE----YAKMQEQ-FQPDYPEMQRLKAEL
A0A7X7ZKL5      VNNPT--------------IQALRTTYTQVKSD----YEEKGKI-YRPDYPEMVQLKARL
A0A522PSP1      DRGDS--------------LATLVQAQQQTQLQ----LDALSSK-YGPGNYLFQQKQREL
A0A7W8E8D3      FPSSN--------------LTALQAQQGTLYGQ----YVQLSTK-FGQNYPPLAEVKTQM
G8P085          FPSAN--------------LAALQSQQATLYGQ----YVQLSTK-FGQNYPPLAQVKDQM
A0A843SRW6      LSNTY--------------VQQLKAELILLQRE----ELQLSNQ-LGDRNPELIKLRSVL
A0A7W8E330      SGTSGAAASAPVANSLVL-IQNLRLQQSTLQQQ----IADGELK-YGTAYPRMAEYHAQL
A0A4Q1SGQ1      SGGGGSGMPGYGPQLAV--IQELRMREAALEAE----IAENDAR-YGPAHPHTAELQAEL
A0A7V2HGP7      PQGES--------------ARRLAERLDEARQK----FEILKTS-QGSRHPEYQRAAAEV
A0A7R8B6H7      QNDIV--------------LQSLESEKAKIKLR----WNELGTK-LTPQHQRMVTLQAQL
A0A2V8GTX0      ASNPF--------------VQQLKTRIVELQRD----RVRLEER-YGEKHPDVQRVNGQI
Q1ILD9          VPDSV--------------LPVLRTQEADIQNQ----LSQATAI-YGPNYPRVVELKKQL
A0A7G8BJH7      SGNASVGAVASMANSLSL-IQNLRTQEATAKAE----LDEDKIR-YGSAYPRIAEVQAEL
A0A2V8J0X9      GTNSA--------------VVDAKNALATLTAQ----KANYAGR-YGPEHPRMMEVKDQI
A0A7Y5WWH8      GTNSG--------------VVEAKNALTTLIAQ----KAAFAGR-YGPEHPRMVEIGDQI
A0A7C5SHM3      RSNLQ--------------VLKYHEQLASIQAE----IADMEGK-VGPSWPRLRELHTAE
A0A7V6D154      LGGAP--------------YQRLWETYNEARKR----FAEIRAH-FGPNHPEYKISESQL
A0A7V1XXZ2      DQYSL--------------FEKLRNQLAELKSQ----AAQLNTQ-FGPSYPKVVALNNQI
Q1IJZ6          GAESLTSPTDQAQAAMFTNLQALRQRQSQLKQQ----MASAVQI-YGARNPHLVDVDKQL
A0A2V8TCE6      VENPT--------------VQRLQHEVNDLEIQ----RAELLRT-FKPGWPQVEVLTRKL
A0A522TBE8      TLTQE--------------VQTLRGRLQTDQNQ----LQVLGQI-YGTSHPRYRQQSTVV
Q1ITG0          LPDSV--------------LPVLRSQEADLRNQ----LAQYSTK-FGSNYPKVIQLNNQL
A0A7C2ML20      VDDPV--------------VEGLKQERVKLEAE----LSQLLLT-YQPTAPPVKQAEQKL
A0A7T9HIZ6      LDDTF--------------VVQLRTELISMERD----YSTRLNT-YKPEWPAMVELKTKI
A0A7C5AXS9      LEDST--------------LASQSSRLTDLRRE----LAELETT-LTASHPKVRKVQAQI
A0A7C2RGE3      LADPQ--------------VQALNARLAELRQE----LAQLNVE-YQPTHPRVARVREQI
A0A7V6D075      GYGED--------------LRALRRRLNEARQE----LAELRTH-LGPNHPQYRKVAAQI
A0A3N5PCI5      RSNGV--------------VQEIRGRLANLQRE----RMQLASN-LGAKHPEMVRVNSAI
A0A3M1Q0S9      RQHPT--------------IAQLSAEVARLERD----YANKRVL-LGERHPDVQQIATEL
A0A2Z5G448      APTTT--------------LVSLRTQQAELLVQ----SAELKSK-YGFDYPRVREVEKQL
A0A3M1VZ38      LENPV--------------VRELRSRVSALESE----YREKLVQ-LGEKHPEVQTVKAKL
A0A4Q1SD29      APGTV--------------LGSLRTQQAALLVQ----AAQLKAK-FGPNYPKVVEVNNQL
A0A833M5K2      LDDEL--------------VNRQRGELSALERE----YASKLEN-FKPEWPAMIELNARI
A0A1F2Q9L4      VSGGL--------------VTQLRGEQLKLERD----YATKLNT-YKPEWPAMQELKAQI
A0A7V5ZKV2      LSGGL--------------VSQLRQELLKMERD----YATRLQT-YKPEWPAMQELKGQI
A0A7Y8LRQ1      VSGGL--------------VSQLRQELLKMERE----YATKLNT-YKPEWPAMQELKGQI
A0A3M1PY35      RSDPL--------------VVRLREELASREQR----LEELRTR-FGPDWPEVRELSRAI
A0A3M1VMP2      NANPQ--------------VQRYRQDLAELRRE----LAELEGK-VGPNWPRLVELRAAV
A0A1F2T595      ----------VPAILSNTFVQQQKAALADLQRQ----RAQMSEK-LGPNHPEMVKINVAL
A0A2V9AC41      ---------------DSLVIGGLKGELAKSEAD----YASLAKE-FKAGYPPLDNLKVRM
A0A2V2R525      ------------------NQSTAAAKLSDLRQR----LAQLKAE-YTDKWPEIKVVQEQI
A0A321LPW6      ---------------SDPKISELTKIRGELAAT----YAQLSVR-YGPENPRVAESKKQM
A0A2V9R9V4      ---------------ADTKTVELQRKLGELATT----AAELSVT-YGPKYPKMAEINQQM
A0A321LE75      ---------------TDSKLTGLQARLNELEVK----ARELDVK-FGADHPRVVEIRNQM
G2LEI9          ---------------SDPELQKLRGKISELKQR----RLELLGT-YTELHPDVVQIDQVL
A0A7V9TW03      ---------------SDKQIAELKSRLGELRQK----RAQLLLT-DTEESPEVKDATQQI
A0A3N5XQP8      ---------------RSSVTEQIEARLSALRQD----YARLTSQ-FGPEWPEVIQAQRQI
A0A2V9KCS3      ---------------DDASLQDYRQKLTELRRQ----LAELGAT-YTSTHPKVERVDAQI
A0A7W1JC10      ---------------NSTQTAAAEAQLASLRQR----RAQLLAE-NTEEWWEVKEVSQQV
A0A3M2BZG9      ---------------ISSQITQLRSEVDKLERQ----YRKALQT-FRDDWPSVTKLKEE-
A0A1Q7N5R7      ---LAPIGAVQRSADLTQALHELTTK----RAE----QRALAYR-YTPDHPTLQRVTSEI
A0A352F549      ---------------SDKQIAELKTRLGELRQK----RAQLLLT-DTEESPEVKDATQQI
A0A3B9MLP9      ---------------SDKQVAEFKTRLAELKQK----RAQLALT-DTEESPEVKDVNQQI
A0A3D5SQ87      ---------------SDKQVAEFKTRLAELKQK----RAQLALT-DTEESPEVKDVNQQI
A0A7Y2DUG3      AIIEARKRIEEEKSKLRELLRDYDKQIAEAETK----RKELLVR-YTEEYSEVKEAKAKI
A0A7Y2D8Q4      VASELRSVNRERVAKLDDELRQIDTQIKDAETE----LVKLRVK-YTDEYVKVKEAKAEI
A0A2V8NW86      ---------------NDSSLRSLQEKLTELRRQ----KAELITI-YTEKHNKVKQVEAQI
A0A3M2D491      FIITAREQQLKLKKDSEARLEDIEGQIEKAEKE----KAALLAR-YTEEHPSVKQIEAQI
A0A7W1CBZ8      AIQDARSQNLRRTADLEKRIENIDEQIQNAETE----KAALSVK-YQPEFPEVKKIDVRI
A0A7W1FC90      AIQDARSQNLRRTADLEKRIENIDEQIQNAEAE----KAALSVK-YQPEYPEVKKVEIRI
A0A7W1ZXG0      AIQDARSQNLRRTADLEKRIENIDEQIQNAEAE----KAALSVK-YQPEYPEVKKVEIRI
A0A7W1ZIT3      AIQDARSQNLRRTADLEKRIENIDEQIQNAETE----KATLLVK-YQPEYPDVKKVETRI
A0A353C9L6      IFQDTIRLNTERKAKLQDQIRDIEKQIQETEAE----KAELLVK-YTPEYPEVGKKEAKI
A0A2V8RQV0      IFQDTMRLNTERKAKLQDQIRDIEKQIQQTEVE----KSELLVK-YTEAYPEVGKKDAKI
A0A2V8SJH5      IFQDTIRLNTERKAKLQDQIRDIEKKIQDSEVE----KAELLVK-YTPEYSKVKVVEERI
A0A136JPP4      VYQDTVRLNTERKAKLQDQIREIEKQIKDAETE----KAELLVK-YTPEYVKVKQVEEKI
A0A399WUJ8      VYQDTVRLNTERKAKLQDQIRDIEKQIKDAETE----KAELLVK-YTPEYVKVKQVEEKI
A0A7V9C3X9      IFQDTMRLNTERKAKLQDAIRTIEKEVQETEAE----KAELLVK-YTPEYSKVREKEEKI
A0A7V9ZSX9      IYQETMRINAERKAKLQDTIREIDKQISTAENE----KAQLLVK-YTPEYYKVKEKEQQI
A0A3M1SIV3      FISTLRANIIAKKNSLDARLSEIDNKIKAAESE----RAALLAR-YTPENPKVKQIEATI
A0A7V1SCI4      FISTLRGNIIAKKNSLDARLSEIDNKIKAAESE----RAALLAR-YTPENPKVKQIEATI
A0A7C5ZUA8      IYQDAVRLSTERRSKLQDDIRSLERQIQSAETE----KAELLVK-YTEEYPEVKKLNERI
A0A7T9FQE4      AIQDARSQNLKRRADLEKRIEDMDKQINAAREK----RQTLLAK-YTEEYREVQAVDAQI
A0A3E0PHB0      LASQLRQTKTERKAKFDEQVRALDEKVKTAESE----LAKLRVK-YTEQHWKVKEAISLI
A0A7T9G4W3      LASQLRETKSERKAKFDEQIRSIDEKIKGAESE----LAKLRVK-YTNEHWRVKEGVSLV
A0A838UAA0      SIQDARNQNLRRKEELEKRIEEIDRKINEVFEK----RESLLTK-YTPEYREVVALNAQI
A0A7W1HTU2      AIQDARSQNLTRKSDLEKRVEGIDKQIQEAETQ----RQELLVK-YTSEYPGVKIIDAKI
A0A357F267      IFQDTMRLNTERKAKLQDQIRDIDKQIQQAETE----KAELLVK-YTPEYFEVKKKVERI
A0A7V9ICU8      IFQDTMRLNTERKAKLQDQIRDIEKQIQEADAE----KRSLAVK-YTDEHPQIKALNARI
A0A7T9JEF9      --KDAR-------------TTALEGQLSTLNQE----LAQLKVE-FTEEWPAVKEVRRKI
A0A399WNU1      --KDAR-------------TAGLESQLTTLRQQ----LAQLKVD-YTDEWPEVQKVEKQI
A0A3E0PCN7      --KDAR-------------TTSLEQELSTLRLQ----LEQLKVE-FTEEWPAVKEVRRKI
A0A7Y4TLV3      --KDAR-------------TSSLEGQLTGLRQQ----LEQLKVE-FTDEWPEVKKVQRQI
A0A7W0MGQ3      --GTAR-------------YSDAEVKLSELQRQ----RAQLLVE-YTEEWPDVKQIDQQI
A0A1Q7Y6W9      --DANKQ------------IQQYEANLVELRRK----RAELLVE-NTEEHPDVQQVEQQI
A0A2V8NC68      ----AKS------------SSDADAKLNELKRK----RAQLLLE-YTEKYPEVKDLDEEI
A0A352FLX4      --GGINE---KDVPSATRITTDSELKLAELKQK----RAELLVE-NTEKWPAVREIDKQI
A0A2V8MHG6      --ATNN-S-----------SATTEAKLAELKQH----RAQLLQE-YTEKYPEVRDLDQQI
A0A2V8P7N1      --ATSNKS-----------SATPEAKLAELKQH----RAQLLLE-YTEKYPEVKDVDQQI
A0A2V8M3M6      --ATSNKS-----------SATPEAKLAELKQH----RAQLLLE-YTEKYPEVKDVDQQI
A0A1Q7NJH5      --ATSNKS-----------SAATEAKLAELKQR----RAQLLLE-YTEKYPEVKDVEQQI
A0A2V8PJY0      --ATSNKS-----------SAATEAKLAELKQR----RAQLLLE-YTEKYPEVKDVEQQI
A0A7W1BYD3      --SNSAQ------------TAAAEAQLAGLRQK----RAQLLFE-NTEEWWEVKEVDQQI
A0A838PIP9      --NSSSR------------TAAAEAQLAGLRQK----RAQLLAE-NTEEWWEVKEVDQQI
A0A399WK13      --AEMARFITEQQNNIRQFQSDTLKKISDLRQA----RALKLQE-YQEGAPEIKEIDAQI
A0A7V8YZQ7      --AESARFITERQNFLLTLRNETQKTTAGLEAQ----RRKLLQE-FQESASEIKELDVQL
A0A7V9ICV8      --AESARYITERENNVLMVRNETQRKIAELRSD----RAKLLEE-FLPGAPEVRELDSQI
A0A136KC10      --AEMARFITEQQNNIRAFQSDTLKKISDLRQA----RALKLQE-YQEGAPEIKEIDAQI
A0A7W1IVA5      --ELTARYTSERENTIRGLVNDTQKKVADLKAQ----RARLLEE-YMPTAPEVKEIDTQI
A0A7W1ZIE3      --ELTARYTSERENTIRGLVNDTQKKVADLKAQ----RARLLEE-YMPTAPEVKEIDTQI
A0A7T9J551      --EQSARFITEQENNIRVFRADILKKMADLRQL----RASKLQE-FQEGAPEIREIDAQL
A0A7V9NLN0      --GELVRYYTERENSTRALINDNRKKIAELKAE----RSKFLVE-YQESALEVKDFDVQI
A0A7T9G8R2      --EQMMRYITERENDIRRFVNDTQKEITALRAK----RQKMLIE-YVEQAPEIREIDREM
A0A7Y2D047      --ERMAQYIADRETAIRRLENETRKEIGQLKAQ----RKKLLVE-YVEAAPEIEEIDKQI
A0A3M2D6Y5      --EKLQRYITERENDMRALNNEATKRIAELEAE----KARLLVE-YQESALEVQEINRKI
A0A2V8SEX6      --QDNQRIIQDRKLAIIAYRNDTQKKISDFRSQ----RAKLLQE-YKESAPEIVEIDTQI
A0A7C5ZUU4      --ERMARYITEQENSLRELRNETQKKIAELKAN----RAKLLEE-YKESAPEIREIDTQI
A0A3E0PCJ6      --EQMARYITERENDIRRFVNDTQKEITALRAK----RQKMLVE-YVERAPEIQEIDREI
A0A2V8RTL7      --QDSQRYITERENSVLQLRTDVRKKINDLNAE----KARKLED-YKETAPEIIEIDKQI
A0A3M1S4R8      --EKLQRFITERENDMRSLNNETAKKIAELEAE----KAKLLIE-YQESAIEVQEINRKM
A0A7V1SAJ0      --EKLQRFITERENDMRSLNNETAKKIAELEAE----KAKLLIE-YQESAIEVQEINRKI
A0A7W0N726      --EQMVRYFTERENNTRALNTGTQRTIAALNVD----KAKLLEE-YQPTAPEVKELEVQL
A0A7W1HTZ7      --DKMARYITERENNIRALIIDTQKKIAEKKAT----REKLLVE-YLPAAQEIRELDNEI
A0A1Q7YFI6      --ENRNK--------------QAEEQLLELRKK----RAELLVE-NTEDWPEVKEIDRQI
A0A7V9C9Y7      --GGNAQ------------LNEVESELSKLRQR----RAELLFD-YTEEWPQVKAVDEQI
A0A7W1G8A4      --RDATE------------IKDGEKRLAALREK----LAQLLVE-NTQAWPEVKEVKQQI
A0A7V9KMZ1      --ADEKR------------IADTESNLAGLRQK----RAQLLVD-ATEEAPEVKEVTQQI
A0A7W0JTE4      --IDAKH------------VPEIEAKLADLSQK----RAQLLVD-ATSEAPEVKEINQQI
A0A0B6WWQ6      --KEDGI------------SVAALNKLTELRQR----RAQLLVE-ATEEMPEVKEVNEQI
A0A3B9MK99      --VDAKQ------------VNETEGKLADLRQK----RALLMVD-ATEEAPEVKEVDQQI
A0A838PA20      --ADEKR------------IGDLESRLADLRQK----RAQLLVE-ATEEAPEVKEVTQQI
A0A352EX26      --GDNKQ------------AGDGENKLADLRQK----RALLMVD-ATEEAPEVKEVDQQI
A0A7V9R410      --GDNKQ------------AGETESKLADLRQK----RALLMVD-ATEEAPEVKEVDQQI
A0A2V8MM59      --AGAKD------------IADSESKLSDLKQK----RAQLLVD-ATEEAPEVKEIQQQI
A0A2V8PFE8      ---GAKD------------INESESKLADLKQK----RAQLLVD-ATEEAPEVKEVDQQI
A0A2V8PWS6      --AGAKD------------INESESKLADLKQK----RAQLLVD-ATEEAPEVKEVDQQI
A0A2V8LCT5      --AG-KD------------IELSESKLAELKQK----RAELLVT-ATEEAPEVKEVDQQI
A0A352FTJ9      --AGAKE------------IEATDSELTKLRQK----RAQLLIE-ATEEAPEVKEIDQQI
A0A1F2S1W5      LSN--------------AFVQQQKTELAQLLRQ----RAQLSEK-LGPNHPDMIKVNTAI
A0A2N9LQU7      VPS--------------TTLQALRMQEADLKSQ----YAQLDAK-FGSGFPRVQELQAQL
A0A2P6WFK7      DPN----------------LQTLRTQEADLKAQ----LAQVSAK-YGNGYPKLRELQTQL
A0A2V8JQV5      LDD--------------GTLRDLQSKLTELRSQ----TAELRVS-LTPAHYRVQRLEAQM
A0A2V8U914      -----------------PGIRDYETKLTDLRRQ----LADLESI-LQPESYKVVRVKAQI
A0A2V8DRT9      LSN--------------VFIQQQKTELAELQRQ----ESQLSEK-LGQRHPDMLKAKLNV
A0A2V7VYF3      LSN--------------SFVQQLKSELADAQHK----QAQFSET-LGDKHPDMIKARSAV
A0A1F2SVH2      LSN--------------GFIQQQKNVLADLQRQ----QAQLSDK-LGPNHPDMVRLSSAV
A0A2V8AJG9      LSN--------------TFIQQQKGEIAELQRQ----QAQLSEK-LGPRHPDMLKVSNAI
A0A2V9MAM9      VDN--------------AVIRDYQVKLTELRKQ----LADLDSV-LTPENYKVVRLKAQI
A0A2V8F956      LAN--------------TFIQQQKTELAQLQSQ----SAQLGDK-LGPNHPDMVKIRSAI
A0A2V7W309      QQD--------------ATVIHLNEELSRLQRD----FNAKRAQ-YTEAHPVMQDLAQQI
A0A348V070      PSN--------------PAIARLREQYALLSRE----YARRLAT-LKPEYPEMQKLKSEI
A0A2Z5G3A3      AGSPMLGAASSGVASSLSLIQGLRSQEAVLQGQ----MAEYSSK-FSPDYPKLVDMKSNL
A0A2V7UGP8      TQS--------------NLIQQLRQKTAELERE----YTQKSKQ-FKPDWPDMVRLQAEW
A0A239MKT6      LNSASSLGAGLAGGNEMRVLGTLREQASAIKIR----MASESVK-FGSQYPAVLELQNQL
A0A2Z5G7H4      SANGIVSGSPTLSTSL-GLIQSLRMQEAALQGQ----IAQDTSK-FGPSYPRLMDSRANL
A0A372IT17      TASAGAEETGGLQHSL-ELIETLRSRESTAKAE----LAQDETR-YGAAWPGMQERQAQL
A0A841JU67      AGGSSAEGAPALNNSL-ATLQTLRSREASVRAE----IAENDAR-YGPAHPRIAELHSEL
A0A7T9GJJ6      FSD--------------TRTGQYQTDLSKLQLK----AAELNAR-YGPENPKVVEVQQQI
A0A7Y4UER8      FAD--------------QNSSKLKEELNRLEVQ----DAELSVK-FGTENPRVAEVREKI
A0A2V8IYW3      -----------------DPSDRTPDPLDAARTE----LATLGRR-LLPTHPDVIAAKRRV
A0A7V2HCZ0      IDD--------------GRLSGYQTKIAELKRE----LAEKSAA-LTAAHPTVIRLQAQL
A0A2V9AEW6      LED--------------PTMRDYRQKLTELQRQ----YAELSAT-LTPEHYKVLRVQAQI
A0A2V8WQK6      LED--------------PTMREYRQKLTELQRQ----YAELSAT-LTPEHYKVKRVQAQI
A0A2V8XIF4      LED--------------PTMREYRQKLTELQRQ----YAELSAT-LTPEHYKVQRVQAQI
A0A350UQT3      GQG--------------EAIRRLLERQNEAAER----FAEVKAH-FGVNHPEFRKAQAQL
A0A7C3HRX0      GQG--------------EQLKRLIDRRNEAYER----FSDIRTH-FGPNHPEHRRALAAT
A0A2W0BGU4      ANN--------------EVMQKLEENYANLRGQ----YVEALNQ-YGPNYPKVLRLDKQV
A0A2W0BVQ9      ANN--------------EVMQKLEENYANLRGQ----YVEALNQ-YGPNYPKVLRLDKQV
A0A317J121      LED--------------INVRGYQTRIADLRRE----AAVLKTT-LTPDNPKVKKIEVQI
A0A2V9MN96      SAD--------------NLLEKLRVQQAELETQ----YAQATTQ-FGPSYPEVIQLRSQL
A0A2V7V2Z1      MRS--------------PLVQSLRIELAGLERQ----QAQLLER-YMDQHPEVVKVRNQI
A0A2V7X2F7      RKD--------------SVVQQLRMDLSTLEQK----QTQLLEQ-YLDQHPEVIKVRRQI
A0A2V7V2I1      MRN--------------PLIGSLRVELASLQRQ----SVQLQER-YLDQHPEVVKNRNQI
A0A2V7U3M2      MRS--------------PLVQALRIELATLERS----QAQLLER-YMDQHPEVVKVRNQI
A0A2V7UHT0      MRN--------------PLVQSVRIELASLERA----QAQLLER-YMDQHPEVVKVRNQI
A0A3P0X3W6      TQA--------------EQLTRLQQQMQDAEQA----MAIVQTH-YGPNNANYKVAANTL
A0A7V2MG68      TQA--------------ESLKKLTESHNEAQQK----FADIKVR-FGQNHPEYRRALSQV
A0A7C6A629      TQG--------------EALKKLTERLSEAEEK----FAQAKTH-YGANHPGYRQAAAQV
A0A7V2HBQ5      QQG--------------EDLRRINDRLNEASER----FAQVKAQ-FGPNHPEFRKTAAQV
A0A2U3JZ71      TQG--------------EALKRLSERLDEEQQK----FAEIKAH-YGPNHPEYRKASLQL
A0A2V8TTB0      SQG--------------EALKKLTENLNEAKER----FAEVRNH-YGINHPEYRKAQTKV
A0A2N9MK30      TQG--------------DALKTIAERLEQAQEK----FAEVKTH-YGPNHPEFHKAQTQL
A0A3D1ASD2      SQG--------------QSLKKLTEAYDEAQSR----LADVKLH-YGINHPEYRKAQGQV
A0A7R8B699      SQG--------------EALQRLSERLNEAKQR----HSMTRTT-WGPNSPEFRKSASDV
A0A7S7SGU3      TQG--------------EAIRRLMERLNESSER----FAEVKSH-FGPNHPEYRKSQAQV
A0A7Y8HY45      GQG--------------EQLKRLVDRRNEIGER----FSEIKTH-FGPNHPEYRRAQASA
A0A7C5AXI3      SQG--------------ESLRRLVERRDEAEQK----FAEVRTH-FGSNHPEYKKAQAQL
A0A7C6E4H7      PQG--------------EGLKKLTERLYEAEEK----FAQIRTH-FGTNHPEYRKAAAQV
A0A2Z5FVL3      PSNTALAGAASGMSNDLAVISSLRTREATLNGQ----INELLAK-FGPAYPKVDELKADL
A0A2V8GFD4      LSN--------------GFIQQLKGEIAALQRQ----HAEMADN-LGERHPTMIKLKASL
A0A2V8HSS5      LSN--------------GFIQQLKGEIAALQRQ----QAEMADN-LGERHPTMIKLKASL
A0A2V8KP55      TGS--------------SLISQFVGRLSDLKRQ----DAELTVT-FAPDYPSRRRIRSQI
A0A2V9JSI3      MQS--------------EVLGRLEEKYAELKAQ----LVDASGQ-YGPNYPKVVRLQDQV
A0A2V9WI32      EPS--------------SLINQLRTQESDLRMK----YAEATTQ-FGSSYPKVMQLGNQL
A0A2V9KBD6      EPG--------------SLLTTLRAQQDDLERQ----NAQASVQ-LGPTNPKMAELSSQL
A0A2W0AJ66      EPD--------------NLVTKLRAQEADLQMQ----LAQASVQ-LGPTHPKIRELSNQL
A0A1Q7RBU1      EPD--------------NLITKLRAQQADLENQ----MAQASVQ-LGPAHPKMGELSNQL
A0A2V9JPV9      GPD--------------NLITKLRAQQADLENQ----MAQASVQ-LGPANPKISELSKQL
A0A7V0Y3A1      LDS--------------GPMASYQVELAKLRQE----KAQLATT-LTPNNNRIRAIQNQI
A0A7C5Z4J3      AQD--------------RLLQNMDEKYADLKAA----YADALAR-YGPKFPEVIRLGHQI
A0A1F2TPT3      LNN--------------AALQQLRLELERLRRD----RATAART-LRAQHPSMLKLEETI
A0A2V8JTQ2      EPD--------------NLLTRLRAQQADLENQ----IAQASVQ-LGPAHPKMAELSKQL
A0A2V8UZY0      EPD--------------NLITRLRAQLADLENQ----IAQASVQ-LGPAHPKMVELSKQL
A0A350UEK1      LND--------------TLMRGYQEKISDLRRQ----QQELLET-FTPENQRVKRVAAQV
A0A350UIQ4      LND--------------SSMRGYQEKLSDLRRQ----QEDLLEV-FTPETSRVKRVNAQI
A0A7T9GJN6      FAD--------------ARTAALKARLGELQIQ----SAQYAGR-IGPDNPRVIDLKKQI
A0A7T9GJN7      FAD--------------PKTAELMAELGRLRVE----AAELGIR-FGPENPKVAEVRSKI
A0A1H5Z7N3      GD---------------QQLATLRTQMETTKAD----LAKLNVA-MGDRNPQIRALRAQV
A0A1G7JVV8      QE---------------SELSKLRDDAAQTKAQ----IAQSSVS-LGPKNPQILALQAHL
A0A1H4T6W9      -Q---------------SELSKLRSDAAETQAS----IAELSIT-LGPKNPKIVALQAHQ
I3ZEU5          -Q---------------SELSKLRSDAAETQAS----IAELSIT-LGAKNPKIIALRAHQ
A0A7W7ZGZ3      AP---------------PALTSLRTAISTAKAT----LADLEAN-LGPNHPQVKAQKAQI
A0A7G8BSK5      SGQL-------------SALSTLRTQLATARAS----YAQMESD-LGLNHPQAKAQKAQI
A0A428MDU2      AP---------------GELNLLRGQVASAKAN----YAQMEST-LGPNHPQAQALKAQI
E8WVF6          AT---------------NGLANLRSNLATARAT----YAELTAT-LGPNHPQVKAARAQI
A0A1I6MH75      MP---------------VQFAQLRSQIALAKAN----YAQLMTT-LGPNNPKALELSNEI
A0A7Y9TM87      AS---------------VGLQSLRLQLSTLRAT----YAEALAT-LGPNNPVAQSEKAQI
A0A7W8J1H5      AP---------------GELNLLRGQLAGAKAS----YATLESS-LGPNHPQAKAVKAQI
A0A7Y9T5K4      AP---------------AELNLLRGQLAGAKAN----YATMESS-LGPNHPQSKALKAQI
A0A852VHP9      AP---------------GELTQLRSQLAATKAN----YATMESS-LGPNHPQSKALKATI
A0A7W8IFZ2      AP---------------GELTQLRAQLAGAKAS----YATLESS-LGPNHPQSKASKAQI
A0A7W8J9Y9      AP---------------GELTQLRAQLAGAKAN----YATLESS-LGPNHPQSKALKAQI
A0A7L5A6M5      PP---------------PALTSLRQSLATAKSN----YAMLEGT-LGVNHPQALASRAQI
A0A5B9EBI2      QP---------------APLNALRSQLATARAH----YAELTSQ-LGPNHPQVKAAKAQM
A0A7Y5RFT3      QP---------------GPLNSLRSELATARAH----YAELTSQ-LGPNHPQVKAAKAQM
A0A239HDF6      PP---------------SGLNALRTQLSTARST----YAEQEAT-LGPNHPQAKSTKAQI
A0A4Q0T270      AP---------------GEFSALRGQVAFARSN----LAQLLTT-YGANHPLVKAQSNEL
A0A1Q3QQB6      AP---------------QELTQLRTQLATARAS----YAQMQAT-LGPNHPQAKALRAQI
A0A3N1K1G7      AP---------------GELNTLRAQIAVARAS----YAQLEAT-MGPNHPQAKAQKAQI
A0A4V2G466      AP---------------SQLNALRAQLATARAT----LAQMESD-LGPNHPQAKAQKAQI
A0A6B9YNQ8      AP---------------SQINTLRAQLATARAS----LAQIESD-LGPNHPTVKAQKAQI
A0A3N6A5T6      LVT--------------DNIRQLETTLADLEQK----LANMTSH-YGPVWPEVVQLKREV
A0A2V8R8U7      QKD--------------ERILRLRGKISDLKDK----LTFLRQK-YTDEWPDVKQASAQI
A0A7V9Q528      QSD--------------KNIQRLREKIGNLEEQ----KAALLEQ-YTSEWPAVKKIDAQV
A0A2V8QMP4      QSN--------------PTVVKLRDKIGELEEQ----KAALLVN-YTPEWPAVQKIEKQL
A0A2V8R4S3      QSN--------------PSVLKLREKMGELEEQ----KAALLVN-YTPEWPAVQKIEKQL
A0A2V8NJ55      QDD--------------KSVQRLRDRISDLEEK----RASLLRT-YTEEWPAVQATNDEI
A0A7V9ZQ50      QAD--------------KSVQRLRDKIVDLEEK----RSALLSR-YTQEWHEVKTVDEQI
A0A2V8Q7I0      QKS--------------GRVTALRDRISALREK----RETLKVT-YTDKWPEVLKLDAAI
A0A2V8S6K4      QDN--------------KQIQDLQIKLAALNEQ----RVALLKQ-YTENWPAVQKVEAQI
A0A317I2L9      IKS--------------TRIVALRERISAIKER----RDALLVT-YTPEWPEVRKLEASL
A0A2V8LLF9      QSD--------------QRIQKLRDKIGDLEDK----RNSLLEI-YTPEWPEVKKIEAQL
A0A352FRF4      QKD--------------ERIMKLREKISELKDK----ETGLLQK-YTKEWPEVQQVEAQI
A0A7W1GE99      VES--------------KSVQRLRDKISDLEER----RSALMVQ-YTAEWPEVKKVDEQI
A0A1Q7YKQ8      ADS--------------KRIQQLREKLDQLKQK----RSELLVI-YTVEWPEVKRVDEQI
A0A0B6WXT1      QSD--------------QRIQKLRDRIGELEEK----RAALLVQ-YTPEWPEVKKVDEQI
A0A2V8MKV0      QKN--------------ESVLKLRDKLSELQAQ----RAALRQT-YTDEWPDIKKLDAQI
A0A2V8PYY8      QKN--------------ESVMKIRDKLTELQSQ----RAALLQT-YTTEWPDVKKLDAQI
A0A3B9MEU8      NSS--------------ARVEKLRDRISALKEK----RDALLIV-YTPEWPEVKKIDAQL
A0A352F3R7      NAS--------------ARVDKLRDRISALKEK----RDALLIV-YTSEWPEVKKIDAQL
A0A7W0GRF6      QTS--------------ARVEKLRDRISALNET----REALLMV-YTPEWPEVKKIDAKI
A0A7W1H6G6      QTS--------------ARVEKLRDRISALNET----REALLMV-YTPEWPEVKKIDAKI
A0A7V9HZC8      QTS--------------ARVEKLRERVSVLKER----REALLMV-YTPEWPEVKKIDAQI
A0A7W0XCB9      QTS--------------ARVEKLRDRISTLKER----REALLMV-YTSEWPEVKKIDAQI
A0A3N5YNR8      LRT--------------PSISLLEERLFGLQQN----LASLSAQ-FGSEWPAVIQVRQQI
A0A7W7ZUJ7      LQD--------------PILSALRQRQSELQTR----YAQLDTW-AGQSYPQMREITSQL
A0A2V2R0I6      QNN--------------SFLNELIRKRNELNAE----YNDAVSQ-YGPNFPRVQRLQAQL
A0A2V8XAR9      QSD--------------AGLAELLRKRNDLSSQ----HSDALSQ-YGPNFPKVQRLQAQL
A0A2V8VZA0      QNN--------------SALGDLLKKRSDAASQ----YNDALAQ-YGPNFPKVQRLQAQL
A0A1Q7CB82      QNN--------------SALGDLLKKRSDAASQ----YNDALAQ-YGPNFPKVQRLQAQL
A0A2V8WIU1      QNN--------------SALGDLLKKRSDAASQ----YNDALAQ-YGPNFPKVQRLQAQL
A0A1Q6Y9F5      QNN--------------SALGDLFKKRSDAASQ----YTDALAQ-YGPNFPKVQRLQAQI
A0A2V9EVV8      QNN--------------SALGDLFKKRSDAASQ----YTDALAQ-YGPNFPKVQRLQAQI
A0A2V8YF91      QTN--------------TALTELLKKRSDTSAE----YANALTQ-YGPNFPKVLRLQAQL
A0A2V8XZK2      QSN--------------AALTDLLKKQRDSSAE----YTDALAQ-YGPNFPKVQRLKTEL
A0A2V8ZTX6      ESN--------------TALADLLKKKGETSAD----YADALTQ-YGPNFPKVLRLKAQL
A0A2V9BT79      DSN--------------SALTELLKKRGETSAD----YADALQQ-YGPNFPKVLRLKAQL
A0A2V9YHT3      DPN--------------TLIEQLRTREADLKTQ----YAQVSTQ-FGPAYPKVVEVGNQL
A0A7C2XNI7      RES--------------QVLQELVARRTELLVQ----YREAEAQ-FGPNYPKVQRLKVQL
A0A1Q8B793      RDS--------------ELLQDIYKKRNDAYTQ----YTSALNQ-FGPNFPRVQRLQEQL
A0A2V9BCA0      RDS--------------ELLQDIYKKRNDAYTQ----YTSALNQ-FGPNFPRVQRLQEQL
A0A2V9BWU9      RDS--------------LLLQDLQKKQSELNTQ----YVEALNQ-YGPSFPKVVRLQAQL
A0A2V9DKX2      RDS--------------LLLQDLQKKQSELNTQ----YIEALNQ-YGPSFPKVMRLQAQL
A0A7C2YQY3      SSS--------------PYIQELQSRLNKLNDE----YAEVRTT-FGPKYPKVQRLEQQI
A0A845TWB8      AQS--------------LLIQDLDRRLSMLKGE----NADARST-LGPNHPRVQRLEQQI
A0A2U3KC61      ----------S------SMLEKLREKEADLNTQ----YAQATTQ-FGSGYPKVVELKNQL
A0A2V9Y2R7      ----------S------SLVDKLREKEADLNVQ----HAQATTQ-FGSAYPKVVELRNQL
A0A2V9NGH6      HSTRNASLS-S------SLLEKLREQQADFRIQ----VSQLSTQ-FGPAYPKVAQLNSQL
A0A2V9PYE6      HSTRIASLS-S------SLLEKLREQQADLRIQ----VSQLSTQ-FGPAYPKVAQLNSQL
A0A2V9NL07      AKG---SGSTS------GLLDKLQAAKADLKIQ----IAQVSTQ-FGPAYPKLAELNNQL
A0A2V9QD92      AKG---SGSTS------GLLDKLQAAKADLKIQ----IAQVSTQ-FGPAYPKLAELNNQL
A0A2V9WPZ6      SNSGNNPNSGS------PLLDSLRGKQADLKIL----VAELSTQ-FGASYPKVAQLNNQL
A0A2V9ZLH4      TEG--NASSGS------TLLDKLRSQEADVKIQ----VAELSTQ-FGPSYPKVAQLNNQL
A0A2V9RQF1      GTAGTNSST-S------GLLEKLREQQADIRIQ----TAQLSTQ-FGPSYPRLAQLNNQL
A0A2V9YDK8      SNGGTGANSGS------SLLDNLRSKQADLKIQ----VAELSTQ-FGSSYPKVAQLSNQL
A0A2V9V8F7      SNSGNNPNSGS------PLLDSLRGKQADLKIL----VAELSTQ-FGASYPKVAQLNNQL
A0A2V9XGR9      SNSGNNPNSGS------PLLDSLRGKQADLKIL----VAELSTQ-FGASYPKVAQLNNQL
A0A2V9V3Q5      VATLAGTGS-S------PLLDKLHQQQADLKIQ----VAELSTQ-FGPAYPKVAQLNSQL
A0A2V9NWS3      TGSGLSSAS-S------NLLEKLREQQADLKIQ----VAQLATQ-FGPAYPKLTQLNGQL
A0A2V9USA9      TGSA--QSA-S------ALLESLRAKQAELHIQ----TADLNTQ-FGPSYPKLAQLNNQL
A0A2V9XW18      EAGAGGQSS-S------ALLGGLRSKEADLKIQ----AADLSTQ-FGPSYPRLNQLNNQL
A0A1H5SQF5      DSSQLNGAPGALASLDTVRLHQLRTQTGQLEVQ----ISAETQK-YGPRNPAILSLKSEL
A0A2V8G155      LTN--------------GFIQQQKSQLSELQRE----YAQLSEK-LGDKHPEIIKVKSAI
A0A2V8HDM7      LTN--------------SFIQQQKSQLSELQRE----YAQLSEK-LGDKHPEIIKVKSAV
A0A2V8IVN9      LSN--------------TFIQQQKSELLQLQSQ----YTQLSEK-FGDKHPDIIKVKSAI
A0A7W1SCW7      LSN--------------AYIQQQKAELAQLQSQ----YTQLSDK-LGERHPEIIKVRSAI
A0A3E0NV31      AKT--------------QELRALEAQIARQEQE----LAALSAR-YGPEWPSVRQTRSEL
A0A3N5M5V0      LRT--------------PSISLLEERLFGLQQN----LASLSAQ-FGNEWPAVVQVRQQI
A0A7X7XDY5      LRN--------------ALIEDLERKLSGLNQE----LAKQSSK-FKDDWPAIQELKNQI
A0A2V9L5B5      LSN--------------RLVQDLEIRLADTKKE----YAQVTTW-VKPDYPKAQQVEKQI
A0A2V9LK56      LSN--------------KLIQDLEFKIADLERE----YAQLTAV-VKPDYPSAVRLKKQI
A0A2V9L7I0      LSN--------------RLIQDLEERLADVQKE----YALVTTW-VKPEYPKALQVKKQI
A0A522PPT0      LDN--------------RLIQTLEQNLSDLRRQ----YSELTAT-VKPGYPKAMALKKQI
A0A7C5V1G5      LSN--------------NLIQNLEVNLSELKRQ----YAELTTT-VKPAYPKAVALKKQI
A0A4R1LC91      VGNSITAGASPGVNSSLNLIQNLRLQEATLQGQ----IGELSAK-FGSAYPKIEELQGNL
A0A2V9QB26      LND--------------SALRSLQEKLTELRRQ----HAELITI-YTEKHNKVKQVEAQI
A0A2V9VYY4      GGS--------------GLLDKLREKEADLETQ----YAMATTQ-FGSGYPRVTELNNQL
A0A2V9KIE8      LSD--------------KFIQELEGRLAELERQ----YAEMTSM-VKPEYPKAVQLKKQI
A0A7C2GJ20      LAD--------------PQVQALNARLAELRQE----LAQLNVE-YQPTHPRVARVREQI
A0A7C4BTL5      LND--------------PTLQDYQAKITDLRRQ----EAELAAT-YKPEYSRVKRVQAQL
A0A7X8YVF2      LRT--------------PLIEKIEAALLNDEQE----LARLSAQ-LGPAMPQVRQLESRV
A0A7X7YEP0      LAG--------------GLIDQMRGELARLERD----YANKLTT-FKPEWPAMKELKAQI
A0A2V9CBM2      FEN--------------RMLQDLTVRLTDLKRE----YAQLSTT-FGSDYPRVKEIQSQI
A0A2V8XN17      FEN--------------KLIQDLSERLAELKRE----HAQLSTT-FSPDYPRVKEIQSQI
A0A2V8WX45      FEN--------------KLIQDLSERLAELKRE----HAQLSTT-FNADYPRVKEIQSQI
A0A1Q6YR79      FEN--------------KLIQDLSERLAELKRE----HAQLSTT-FSPDYPRVKEIQSQV
A0A1Q7VA32      FEN--------------KLIQDLSERLAELKRE----HAQLSTT-FSPDYPRVKEIQSQV
A0A2V9EY85      FEN--------------KLIQDLSERLAELKRE----HAQLSTT-FSPDYPRVKEIQSQI
A0A2V9H8K0      FEN--------------KLIQDLSARLAELKRE----HAQLSTT-FNPDYPRVKEIQSQI
A0A2V9FFE5      FEN--------------KLIQDLSERLAELKRE----HAQLSTT-FNPDYPRVKEIQSQI
A0A2V9GM43      FEN--------------KLIQDLSERLAELKRE----HAQLSTT-FNPDYPRVKEIQSQI
A0A2V8ZHL8      AQN--------------DLLQRLEEKFADLKAQ----YVDALEQ-YGPKHPKVERFRSQV
A0A2V9B240      AQN--------------EILQRLEEKFADLKAQ----YVDALEQ-YGPKHPKVERLRSQV
A0A2V9CYQ5      FEN--------------RMLQDLTVRLTDLKRE----YAQLSTT-FGSDYPRVKEIQSQI
A0A2V9BWU8      VEN--------------KLIQDLSERLAELKRE----LAQLSTK-FNAEYPRVKEIQSQI
A0A2V8ZG48      VEN--------------KLIQDLSERLAELKRQ----FADLSTK-FNPEYPRVKEIQSQI
A0A2V8Y334      VEN--------------KLIQDLSERLADLKRE----LAQLSTK-FNAEYPRVKEIQSQI
A0A2V9AY68      VEN--------------KLVQDLSERLAELKRE----LAQLSTK-FNPEYPRVKEIQSQI
A0A1F2RFI7      LEN--------------KLYQDLSIKLADLRRE----YSELTAT-FTPEYPRVKRLKNQI
A0A1F2RZS3      LEN--------------KLYQDLSLKLNDLRRE----YSDLSAT-FTEEYPRVQRLKSQI
A0A845TW47      ADN--------------KLLQDLTERLADLERE----RAQLSST-FTPEYPKVRQVQSQI
A0A845TXC1      AEN--------------KLIQDLAVRLADLRRE----HALLSTT-FNPEYPKVKQLQSQI
A0A1F2USE2      HDN--------------TVMETLTVKLAELQRE----HAQLTTT-FTAKYPRVEQLENQI
A0A7C2VB08      GES--------------KVIEDLLVRLADLRRE----RAELATL-FTGEYPRVRQLDNQI
A0A2V9C238      AEN--------------KLVADLAVRLADLQRE----QAQLATT-FTADYPKVRQIQSQI
A0A1F2Q9F5      FEN--------------KLMQDLTVQLAELRRQ----HAQAATT-FSPDYPTVKQLQNQI
A0A1F2QQH9      FEN--------------KLMQDLTVQLAELRRQ----HAQAATT-FSPDYPTVKQLQNQI
A0A1F2QXK7      FEN--------------KLMQDLTVQLAELRRQ----HAQAATT-FSPDYPTVKQLQNQI
A0A2V9DEM9      AEN--------------KLVADLAVRLADLQRE----QAQLATT-FTADYPKVRQIQSQI
                                                                            

A0A2V7VMF7      VQ----IQKA--------------------------KEERAAQ-----------------
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------AISKTRG-----------------
Q01X01          ------------------------------------GRGKRAA-----------------
A0A3M2D9H8      DQQIELTQKR--------------------------------------------------
A0A2V9IXG5      DN----LRKQ--------------------------LRNELVK-----------------
A0A2V9J2P4      DN----LRKQ--------------------------LRNELVK-----------------
A0A831T3F4      VA----LQKQ--------------------------IDSSRRM-----------------
A0A2V8JK38      EE----IQKQ--------------------------IEGERGR-----------------
A0A7W0JWI4      AV----LERE--------------------------IKDAHNR-----------------
A0A1Q7RLS4      EE----TTQK--------------------------IASEVDR-----------------
A0A257VBK0      RG----LKER--------------------------ISQQAET-----------------
A0A7C5TWV7      SS----IKLR--------------------------IKQQIQT-----------------
A0A2V7XDY0      DQ----AQKT--------------------------KERQGTQ-----------------
A0A2G6PYV5      KS----MEKR--------------------------LANEQKK-----------------
A0A1F2TCR2      AI----AKKD--------------------------LIAQRQR-----------------
A0A7Y9PHF8      NE----VTRQ--------------------------YRAMSVE-----------------
A0A7W8J3G9      DK----INSD--------------------------FAHELAL-----------------
A0A1F2V330      KE----LEKA--------------------------VAAAPPK-------PTVAEPSAAR
A0A662EE63      EG----IDQA--------------------------IERQIQT-----------------
A0A2V8TLH7      DK----TNQK--------------------------LASEVDR-----------------
A0A1Q7ZJT1      EE----TTQK--------------------------IASEVDR-----------------
A0A2V8VC99      DE----ISRK--------------------------IASEVDR-----------------
Q01XL7          SE----LQQT--------------------------LDKEKTG-----------------
A0A523DUV7      EQ----LQDA--------------------------VRTQAEK-----------------
A0A7W1TTH3      NA----VKNS--------------------------IVRRITL-----------------
A0A1F2U158      GD----EQRQ--------------------------LDLETAK-----------------
A0A2V8F6S9      AE----GQKQ--------------------------YEFEVAR-----------------
A0A7V0UHS9      RE----LEAS--------------------------LKDAPGK--------LRMEANPVY
A0A7D8BEX2      DT----LSQQ--------------------------IKTEEDR-----------------
A0A4Q1SCH5      AS----VRDQ--------------------------IRKNVGN-----------------
A0A7V4SJP8      SR----QGQA--------------------------------------------------
A0A372IRG7      GS----VRSD--------------------------IQTEITN-----------------
A0A2V8K4L4      TE----LETA--------------------------LEAARQK-----------------
A0A2V8NCZ3      AE----META--------------------------LEDARQK-----------------
A0A4Q7YNP3      RE----VEAG--------------------------MEAARNA-----------------
E8UZE1          AE----VNRT--------------------------ITTELRR-----------------
A0A2V7YW66      EK----SQQH--------------------------INDVVKE-----------------
A0A2V7Z0V0      EK----ARQH--------------------------LNEVLGE-----------------
A0A2V9M454      KD----LQAL--------------------------VVRERKR-----------------
A0A2V9J4D6      DE----VQLL--------------------------IQQERHR-----------------
A0A2V9L9C5      DE----VQLL--------------------------IQQERHR-----------------
A0A2N9M9N1      NE----VEEL--------------------------IDRERKR-----------------
A0A2V9JEC4      AE----VESL--------------------------INRQRMR-----------------
A0A2V9LPQ3      AQ----MQSL--------------------------IEQEQKR-----------------
A0A7Y8IYX6      AV----AREQ--------------------------LLQEKRA-----------------
A0A2V9IVR7      EE----IRSS--------------------------LEAERKR-----------------
A0A2V9ILE2      EE----IRSS--------------------------LEAERKR-----------------
A0A2V9LGY4      EE----IRSS--------------------------LEAERKR-----------------
A0A7T9JJ28      RQ----LETQ--------------------------LNEAKIR-----------------
A0A7T9GE94      SQ----VEGE--------------------------LRAAHQR-----------------
A0A7Y4X7L5      AQ----LEGE--------------------------LRAAHQR-----------------
G8P0Y7          DQ----LNKS--------------------------INEQVKN-----------------
A0A2W4RYA1      EL----AQQK--------------------------LDTEIQK-----------------
A0A2V8EXP2      NA----AEER--------------------------IQGEIAK-----------------
A0A843SYC7      QV----TQTK--------------------------VKGEIAK-----------------
A0A7V9BJ09      ET----ANAK--------------------------LTNEIGK-----------------
A0A7W1DT80      EA----ANAK--------------------------LKVEIGK-----------------
A0A5M8T4U7      AK----VKVD--------------------------LDHEVSL-----------------
A0A7L5A491      AE----ATRE--------------------------YNDTKTS-----------------
A0A7D8BF18      AE----LTRE--------------------------LTEEQNR-----------------
A0A1E3Y9R6      EA----ANRD--------------------------LDLEIDK-----------------
A0A2W4TLP2      ER----ARRD--------------------------LETEVSK-----------------
A0A7G8BDY8      AQ----LEKA--------------------------LHKEVAD-----------------
A0A7C4BZ42      EE----IEGA--------------------------LRREQSN-----------------
A0A3R9WF43      NA----VDAQ--------------------------MQTEMAR-----------------
A0A317HKM4      QN----ADRK--------------------------LQAEIAA-----------------
A0A2V9CG11      AE----LQSA--------------------------VKNQRTL-----------------
A0A523E0N1      DE----TKRD--------------------------LDVVATE-----------------
A0A1V6HR88      DQ----ARGN--------------------------LIPAARE-----------------
A0A4Q1SDL1      DK----VNQA--------------------------ISDEVSR-----------------
A0A841JWG5      DK----TNQS--------------------------IADEVTR-----------------
A0A4R1LAZ7      SQ----VQRD--------------------------IDSEINS-----------------
A0A7G8BMP1      AA----VQVN--------------------------IDTEINN-----------------
A0A7X7ZKA6      ES----ARKS--------------------------LDDETQN-----------------
A0A523ECP2      TD----IKSR--------------------------IEIERNV-----------------
A0A2W0C122      NA----INLS--------------------------IQTELKR-----------------
A0A2W0AUU7      KA----MDTS--------------------------IQTELKR-----------------
A0A2W0BQL1      KA----MDTS--------------------------IQTELKR-----------------
A0A2V8ERZ5      QD----AQRQ--------------------------LDLEIAR-----------------
A0A7W8J413      DA----IRAQ--------------------------MHAELQR-----------------
A0A7W8JCF5      DA----VKQQ--------------------------LHAELQR-----------------
A0A7W8IEB1      DA----VKQQ--------------------------LHAELQR-----------------
A0A7Y9T3I1      DA----VRQQ--------------------------MHAELAR-----------------
A0A3P0XH15      VQ----VRKA--------------------------IDVEINN-----------------
A0A3E0P0A3      DE----ARRQ--------------------------LNQLIEE-----------------
A0A3M1WQW8      AE----TEQQ--------------------------LAEIEKQ-----------------
A0A841JVA9      KE----AQDG--------------------------LEKERTA-----------------
A0A3N1JHC1      KE----LEEE--------------------------MQRHRFT-----------------
A0A7V4XQR5      KQ----VRSD--------------------------IDKEITN-----------------
C1F294          KQ----VRSD--------------------------INKEITN-----------------
A0A2V9KA79      QE----FEAS--------------------------ASAQAPVEGPVSARRPAGEPSPFF
A0A348UZU3      DT----AREL--------------------------LKNETQR-----------------
A0A7X9FXC4      ES----ARGL--------------------------LKNETEG-----------------
A0A7X7ZKL5      DA----TRNT--------------------------LQEEIRK-----------------
A0A522PSP1      TQ----IDNS--------------------------IRKGQQH-----------------
A0A7W8E8D3      QK----TDAE--------------------------LERQSSI-----------------
G8P085          QK----TDAE--------------------------LERQSSI-----------------
A0A843SRW6      RM----AEGR--------------------------LASEVDK-----------------
A0A7W8E330      DH----VNSA--------------------------LNDEVAR-----------------
A0A4Q1SGQ1      TG----VQRS--------------------------IRAEAER-----------------
A0A7V2HGP7      AQ----LEKS--------------------------IEASRQG-----------------
A0A7R8B6H7      DD----IQTQ--------------------------IDTRRAG-----------------
A0A2V8GTX0      QD----AQRQ--------------------------LDAEIER-----------------
Q1ILD9          AQ----VNAS--------------------------LAKETRD-----------------
A0A7G8BJH7      NG----IEKE--------------------------IQDEVHR-----------------
A0A2V8J0X9      EN----AKRR--------------------------LVAERTK-----------------
A0A7Y5WWH8      EN----AKRR--------------------------LVAERTK-----------------
A0A7C5SHM3      QE----TRRN--------------------------LQAEAEK-----------------
A0A7V6D154      AE----LERQ--------------------------LEEARQQ-----------------
A0A7V1XXZ2      AQ----VESD--------------------------LSNEQQK-----------------
Q1IJZ6          SD----VDSQ--------------------------IKGELKL-----------------
A0A2V8TCE6      EG----ARQQ--------------------------LSSETEA-----------------
A0A522TBE8      RR----DEEA--------------------------VQQAQAR-----------------
Q1ITG0          AQ----TDAS--------------------------LKKEIRD-----------------
A0A7C2ML20      AS----LETR--------------------------MKRAEIE-----------------
A0A7T9HIZ6      ET----ARRN--------------------------LKQAARD-----------------
A0A7C5AXS9      TA----LENS--------------------------FERQRRN-----------------
A0A7C2RGE3      AE----AERQ--------------------------LALAKRR-----------------
A0A7V6D075      EE----------------------------------LESQIQA-----------------
A0A3N5PCI5      EA----AERE--------------------------LDSEVAK-----------------
A0A3M1Q0S9      AA----GRER--------------------------LASETER-----------------
A0A2Z5G448      TA----VQTD--------------------------IDAEISN-----------------
A0A3M1VZ38      DS----SREH--------------------------LQEQIAA-----------------
A0A4Q1SD29      EK----VQSD--------------------------IDQEINS-----------------
A0A833M5K2      AQ----ARRN--------------------------LDAVSRD-----------------
A0A1F2Q9L4      DK----GRQH--------------------------LGNVTKE-----------------
A0A7V5ZKV2      ER----ARQH--------------------------LASVVDE-----------------
A0A7Y8LRQ1      ER----ARQH--------------------------LATVVDE-----------------
A0A3M1PY35      AE----ARVR--------------------------LAERAAA-----------------
A0A3M1VMP2      KE----TERN--------------------------LENEMEA-----------------
A0A1F2T595      RG----AETR-------LQNE-------------------IAQ-----------------
A0A2V9AC41      EE----TRRR-------LQAE-------------------IQN-----------------
A0A2V2R525      AE----IEKQ-------DVEN---------------KTNSKSL-----------------
A0A321LPW6      AE----IDNQ-------IRAS-------------------RAS-----------------
A0A2V9R9V4      AA----IRDQ-------IAAG-------------------RVQ-----------------
A0A321LE75      VT----IQEQ-------INRS-------------------RGD-----------------
G2LEI9          AQ----AENE-------LKEA-------------------KAN-----------------
A0A7V9TW03      AT----LEKQ-------LADTRGSARQVIT------------------------------
A0A3N5XQP8      TQ----GEQE-------LKQERER------------------------------------
A0A2V9KCS3      AS----VQSA-------LERERVNILKRI-------------------------------
A0A7W1JC10      AE----LEKQ-------IKEARAKAMTTFK------------------------------
A0A3M2BZG9      ------LEGK-------RAKLTALVSAEVNQRRDLA------------------------
A0A1Q7N5R7      ET----L-----------------------------ERTTIPA-----------------
A0A352F549      AT----LEKQ-------LADTRGSAKQIIT------------------------------
A0A3B9MLP9      AI----LEKQ-------LDETRGSARKIIT------------------------------
A0A3D5SQ87      AI----LEKQ-------LDETRGSARKIIT------------------------------
A0A7Y2DUG3      EQ----LKES-------RKKAETTGESRIKTESAKIETSSKVD-----------------
A0A7Y2D8Q4      AK----LKAT-------RERTYKTRSARLSADSKKLESEVQKD-----------------
A0A2V8NW86      AS----LEAA-------LQKERTAIVDRI-------------------------------
A0A3M2D491      QQ----LRET-------KEKVKNEVEKKLELESKLLEQRAQKE-----------------
A0A7W1CBZ8      ER----LKEN-------REKIKNEVSQKIKTEGVKLEKNAERE-----------------
A0A7W1FC90      EK----LKEN-------REKIKNEVSRKIETEGVKLAKNAERE-----------------
A0A7W1ZXG0      EK----LKEN-------REKIKNEVSRKIETEGVKLAKNAERE-----------------
A0A7W1ZIT3      GT----LKEN-------REKIKNEVSRKIETEGAKLEKNAERE-----------------
A0A353C9L6      AS----LKET-------KDKTEREVSGIIDRDQKKIEKDAVTG-----------------
A0A2V8RQV0      AS----LRET-------KEKTEKEVSKIIDTDQKKIEKEAVSG-----------------
A0A2V8SJH5      AS----LKAT-------KDRTESEVSTIIDKDQKKIEKDAVNG-----------------
A0A136JPP4      AS----LKTT-------KQQTETEVSQIIDRDQKKIEKDAVSG-----------------
A0A399WUJ8      VS----LKNT-------KQQTESEVSQIIDRDQKKIEKDAVSG-----------------
A0A7V9C3X9      AS----LKAA-------KDKTESEVSGIIERDQTKIEKDAVGG-----------------
A0A7V9ZSX9      AK----LQEN-------REKTEKEVTQLIDTDEKKIKANAISG-----------------
A0A3M1SIV3      QK----LQEG-------KEKIRQEESAQIEQESKQAEERAKKE-----------------
A0A7V1SCI4      QK----LQEG-------KEKIRQEESAQIEQESKQAEERAKKE-----------------
A0A7C5ZUA8      AS----LRST-------KERMESEVSQIIERDKKSLEKDAVSG-----------------
A0A7T9FQE4      RE----LEAQ-------KAEVSREVSSKITEEGKKLEADAERE-----------------
A0A3E0PHB0      AS----LKEQ-------KNQLEDESKQIIEDESKTLEKAVQKE-----------------
A0A7T9G4W3      ES----LKRQ-------KTDLEAESKKIIEEESKTLEREVQKE-----------------
A0A838UAA0      SE----LENQ-------KIRINREVSERIKVEGKELVKNAESE-----------------
A0A7W1HTU2      ES----LKDS-------RNRIQKEVSEKITSEGTKLTKSAERE-----------------
A0A357F267      AA----LQET-------RAKTETEVTQIIDRDQKKIEVDAING-----------------
A0A7V9ICU8      DS----LSST-------KSKTENDVSQIIDRDQRRIEQDAVGG-----------------
A0A7T9JEF9      AA----IENE-------LQSS---------------RKRTAAV-----------------
A0A399WNU1      AG----IEKE-------LQSN---------------RKRSADT-----------------
A0A3E0PCN7      AA----VENE-------LKGT---------------RKLSADV-----------------
A0A7Y4TLV3      LA----IEKE-------LQLS---------------RKRSTDT-----------------
A0A7W0MGQ3      AV----LEKR-------VRES---------------RNRGTTT-----------------
A0A1Q7Y6W9      AE----IERQ-------LKEA---------------KSHAANI-----------------
A0A2V8NC68      AL----LEKQ-------TKEG---------------KTHATSV-----------------
A0A352FLX4      AA----IEKV-------MGDA---------------RRRATGV-----------------
A0A2V8MHG6      AM----LEKQ-------AEQS---------------RAHTESV-----------------
A0A2V8P7N1      AM----LEKQ-------VDQS---------------RRHTESM-----------------
A0A2V8M3M6      AM----LEKQ-------VDQS---------------RRHTESV-----------------
A0A1Q7NJH5      AM----LEKQ-------VDQV---------------RTHTESV-----------------
A0A2V8PJY0      AM----LEKQ-------VDQV---------------RTHTESV-----------------
A0A7W1BYD3      AY----IEKQ-------VKEV---------------REKAMAT-----------------
A0A838PIP9      AE----MEKQ-------IKEE---------------RVKAMTT-----------------
A0A399WK13      TS----YQNS-------IDNAVQKFQNDLD----KYRDSTKKT-----------------
A0A7V8YZQ7      AS----LEES-------LNKAAQKSNQDIQ----KFREDAAET-----------------
A0A7V9ICV8      QS----LNSS-------LDQLIDKNNRDLA----DYRSRTGKV-----------------
A0A136KC10      TS----YQNS-------IDNAVQKFQGDLE----KYREATKKT-----------------
A0A7W1IVA5      DT----LESE-------VKKAITGNEEDLA----AFRKQKSAE-----------------
A0A7W1ZIE3      DT----LESE-------VKKAITGNEEDLA----TFRKQKSAE-----------------
A0A7T9J551      KS----YEDS-------IDRAAAKFNADLA----EYRKRTSKG-----------------
A0A7V9NLN0      ET----LQNE-------IQTVTQNEKEDLN----NFRKRTRDD-----------------
A0A7T9G8R2      AT----LEGE-------IEDFREKNQKSLE----TYRKTVSDT-----------------
A0A7Y2D047      ET----LDEE-------IGKVKQKNEEGLE----AYRKRTAKT-----------------
A0A3M2D6Y5      DA----LKRT-------VEVAQEKNRKDLE----EYRSRTAKE-----------------
A0A2V8SEX6      RS----LEDS-------LTKLVDENTTEVQ----KLQERASKL-----------------
A0A7C5ZUU4      KS----LEDS-------IAREVQKNKAELD----DFRKRSTQV-----------------
A0A3E0PCJ6      AT----LMNE-------IADFRDKNDKALQ----QYRKTVGET-----------------
A0A2V8RTL7      AS----LEDS-------LEKLLEKNNKDIQ----AYKERSATI-----------------
A0A3M1S4R8      EA----LKST-------VEKAQEKNREELE----KYRARTAKE-----------------
A0A7V1SAJ0      EA----LKNT-------VEKAQEKNREELE----KYRARTAQE-----------------
A0A7W0N726      ET----LKRE-------MSGIKDDEEKDLD----NFRKQARND-----------------
A0A7W1HTZ7      KT----LQDE-------INKATRANQEDLD----NFRRRTAQD-----------------
A0A1Q7YFI6      AI----LEAQ-------VNQS---------------HSEDVST-----------------
A0A7V9C9Y7      AL----LERR-------AEQV---------------RGRATNI-----------------
A0A7W1G8A4      AV----LEKQ-------VSDM---------------RSNAMSV-----------------
A0A7V9KMZ1      QE----LENQ-------VKDL---------------RSRKSTT-----------------
A0A7W0JTE4      AE----LDSQ-------IKDM---------------RSRKSTT-----------------
A0A0B6WWQ6      AE----LERQ-------INEA---------------RARAKDV-----------------
A0A3B9MK99      AE----LERQ-------VKDV---------------RSRKSVT-----------------
A0A838PA20      RE----LESQ-------VKDL---------------RSRKSTT-----------------
A0A352EX26      AE----LERQ-------VNDS---------------RNRKTNT-----------------
A0A7V9R410      AE----LERQ-------AKDV---------------RSRKTNT-----------------
A0A2V8MM59      AE----LQKH-------LGET---------------RSRSTSV-----------------
A0A2V8PFE8      AE----LQKH-------LHES---------------RARNTNT-----------------
A0A2V8PWS6      VE----LQKH-------LNES---------------RARNTNT-----------------
A0A2V8LCT5      DV----IQKH-------LVET---------------RSRSTAT-----------------
A0A352FTJ9      DV----LQKH-------LADT---------------RARGTAT-----------------
A0A1F2S1W5      QL----AETR--------------------------LQAEVAQ-----------------
A0A2N9LQU7      AR----LDQN--------------------------IADELTN-----------------
A0A2P6WFK7      SK----LNAA--------------------------IADEVAN-----------------
A0A2V8JQV5      GE----LETA--------------------------FERERAN-----------------
A0A2V8U914      VQ----LEAA--------------------------IARESRR-----------------
A0A2V8DRT9      QN----AEAR--------------------------IQAEINK-----------------
A0A2V7VYF3      DT----ALAK--------------------------LNTEIDK-----------------
A0A1F2SVH2      RE----AESK--------------------------IQGEIAK-----------------
A0A2V8AJG9      QL----AESK--------------------------LQGEIAK-----------------
A0A2V9MAM9      TA----LESA--------------------------LAKEREE-----------------
A0A2V8F956      RL----TQAK--------------------------LDGEIGK-----------------
A0A2V7W309      EKTKLARAAA--------------------------VREAYSR-----------------
A0A348V070      EA----TYDS--------------------------LTREKEN-----------------
A0A2Z5G3A3      QV----IQAA--------------------------IASEVAR-----------------
A0A2V7UGP8      DSARKTMAEE--------------------------SQKIFDD-----------------
A0A239MKT6      NS----IDAQ--------------------------VHEQMVR-----------------
A0A2Z5G7H4      SG----MESA--------------------------IEDEVHR-----------------
A0A372IT17      TE----IQKS--------------------------IHDEVRR-----------------
A0A841JU67      DG----VQES--------------------------IHEEIVR-----------------
A0A7T9GJJ6      RE----LQTL--------------------------ITGNVKN-----------------
A0A7Y4UER8      KI----LKDQ--------------------------IASTRST-----------------
A0A2V8IYW3      AQ----LEAERVAMPKASDAPASAAAPQVADNVVVRRMRETQT-----------------
A0A7V2HCZ0      NE----MEAT--------------------------LKRERDN-----------------
A0A2V9AEW6      DE----LKAQ--------------------------IEKERGN-----------------
A0A2V8WQK6      TE----LRSE--------------------------MQKERAN-----------------
A0A2V8XIF4      ND----LKAE--------------------------MQRERNN-----------------
A0A350UQT3      RE----IQSQ--------------------------VDATRDN-----------------
A0A7C3HRX0      NE----LDRQ--------------------------IAEMRAS-----------------
A0A2W0BGU4      KE----ASAL--------------------------IAAERGR-----------------
A0A2W0BVQ9      KE----ASAL--------------------------IAAERGR-----------------
A0A317J121      NE----LQIT--------------------------LNKEVTA-----------------
A0A2V9MN96      NQ----VRNS--------------------------IATEQKN-----------------
A0A2V7V2Z1      QE----TRKK--------------------------IAAESQR-----------------
A0A2V7X2F7      ED----TRKR--------------------------LSAEGQR-----------------
A0A2V7V2I1      TE----TREK--------------------------IASEAQR-----------------
A0A2V7U3M2      QE----TRKK--------------------------IAAESQR-----------------
A0A2V7UHT0      QE----TRKK--------------------------IAAESQR-----------------
A0A3P0X3W6      AE----VTRE--------------------------YQAARDN-----------------
A0A7V2MG68      EE----TRRQ--------------------------LQSTRDS-----------------
A0A7C6A629      AE----LKSQ--------------------------LNQTVRS-----------------
A0A7V2HBQ5      SE----IRRA--------------------------LDAMQRD-----------------
A0A2U3JZ71      AE----LERQ--------------------------LQSGKEN-----------------
A0A2V8TTB0      QE----LETQ--------------------------IADTGAS-----------------
A0A2N9MK30      DQ----VQAQ--------------------------FDATRGS-----------------
A0A3D1ASD2      AE----LDRQ--------------------------LQTAKTS-----------------
A0A7R8B699      SE----LQRQ--------------------------FDETRHS-----------------
A0A7S7SGU3      KE----IQEQ--------------------------VDATRQN-----------------
A0A7Y8HY45      NE----LDRQ--------------------------IGEMRAS-----------------
A0A7C5AXI3      NE----VKRL--------------------------LAETTQD-----------------
A0A7C6E4H7      AQ----LKQQ--------------------------LDETLRT-----------------
A0A2Z5FVL3      TA----IQNS--------------------------IKEEIQR-----------------
A0A2V8GFD4      QS----ADAK--------------------------LQAEIAK-----------------
A0A2V8HSS5      QS----ADAK--------------------------LQAEIAK-----------------
A0A2V8KP55      EE----IQKQ--------------------------IEGERGR-----------------
A0A2V9JSI3      NE----IQGF--------------------------IERERKR-----------------
A0A2V9WI32      KQ----VEAS--------------------------IQAEDER-----------------
A0A2V9KBD6      SQ----VRSS--------------------------IDAEVKR-----------------
A0A2W0AJ66      AQ----TRRS--------------------------IRSEVKR-----------------
A0A1Q7RBU1      AQ----AQRS--------------------------VDAEVRR-----------------
A0A2V9JPV9      AQ----ARQS--------------------------VDVEVRR-----------------
A0A7V0Y3A1      DE----LEKQ--------------------------RNAERSN-----------------
A0A7C5Z4J3      NE----IQSL--------------------------IKQYRTL-----------------
A0A1F2TPT3      QA----TQAK--------------------------LDVERSR-----------------
A0A2V8JTQ2      AQ----VRRS--------------------------VDAEVKG-----------------
A0A2V8UZY0      DQ----ARRS--------------------------VDAEVNR-----------------
A0A350UEK1      AS----LEKS--------------------------LEVERAQ-----------------
A0A350UIQ4      SS----LEKS--------------------------LANERDQ-----------------
A0A7T9GJN6      AA----IEKQ--------------------------ISESQST-----------------
A0A7T9GJN7      KS----LQDQ--------------------------INEARGT-----------------
A0A1H5Z7N3      DT----LNQE--------------------------IRAEQDR-----------------
A0A1G7JVV8      RE----VDRE--------------------------IKTEETR-----------------
A0A1H4T6W9      RE----IQRE--------------------------LRSEENR-----------------
I3ZEU5          RE----VQRE--------------------------VQAEENR-----------------
A0A7W7ZGZ3      IS----LEKE--------------------------QDKEQAR-----------------
A0A7G8BSK5      EE----LTKE--------------------------INTEQQR-----------------
A0A428MDU2      DE----LEKE--------------------------IDAEQKR-----------------
E8WVF6          DE----FQHA--------------------------VEAEQNR-----------------
A0A1I6MH75      KE----LDAQ--------------------------LAAEQKR-----------------
A0A7Y9TM87      DE----LNKQ--------------------------IELEQQR-----------------
A0A7W8J1H5      DE----YIKE--------------------------IDEEQNR-----------------
A0A7Y9T5K4      DE----YVKE--------------------------IDEEQNR-----------------
A0A852VHP9      DE----YTKE--------------------------IDAEQNR-----------------
A0A7W8IFZ2      DE----LAKE--------------------------IDEEQNR-----------------
A0A7W8J9Y9      DE----FVKE--------------------------INEEQNR-----------------
A0A7L5A6M5      DE----LSKE--------------------------VTAEQNR-----------------
A0A5B9EBI2      DE----LATE--------------------------INTEQGR-----------------
A0A7Y5RFT3      DE----LATE--------------------------INTEQGR-----------------
A0A239HDF6      DE----LARQ--------------------------VAAEQNR-----------------
A0A4Q0T270      AE----LEKQ--------------------------LKAEQER-----------------
A0A1Q3QQB6      DE----LSKE--------------------------VTKEQNR-----------------
A0A3N1K1G7      DE----LAKE--------------------------IDAEQSR-----------------
A0A4V2G466      AA----LSTE--------------------------INTEQQR-----------------
A0A6B9YNQ8      DE----LSKE--------------------------ISTEQQR-----------------
A0A3N6A5T6      NE----VNTQ--------------------------LVREKKR-----------------
A0A2V8R8U7      DE----LEKE--------------------------LKKAPQE-----------------
A0A7V9Q528      AQ----VKKD--------------------------LDKAPRE-----------------
A0A2V8QMP4      KS----LHEQ--------------------------LDKMPDE-----------------
A0A2V8R4S3      KS----LHEQ--------------------------LDKMPDE-----------------
A0A2V8NJ55      KQ----VKSE--------------------------LDKKPAE-----------------
A0A7V9ZQ50      KQ----VKAA--------------------------LDQAPRE-----------------
A0A2V8Q7I0      KP----LEAE--------------------------LDRAADE-----------------
A0A2V8S6K4      KQ----TEDA--------------------------QQKIAKA-----------------
A0A317I2L9      KP----LEAE--------------------------LQAAAAE-----------------
A0A2V8LLF9      EP----LKKQ--------------------------LIAAPKE-----------------
A0A352FRF4      AQ----LEVE--------------------------LKKAPTE-----------------
A0A7W1GE99      AR----LKQD--------------------------LDKTPRE-----------------
A0A1Q7YKQ8      KT----IEEA--------------------------LTKAPGE-----------------
A0A0B6WXT1      KR----LKQD--------------------------LDKAPYE-----------------
A0A2V8MKV0      KP----LEQA--------------------------LEAAKRQ-----------------
A0A2V8PYY8      KP----LEQA--------------------------LEAAKRQ-----------------
A0A3B9MEU8      KG----LEAE--------------------------LAKAPPE-----------------
A0A352F3R7      KG----LEAE--------------------------LAKAPPE-----------------
A0A7W0GRF6      KP----IEAE--------------------------LAKAPTE-----------------
A0A7W1H6G6      KP----IEAE--------------------------LAKAPTE-----------------
A0A7V9HZC8      KP----IEAE--------------------------LAKAPTE-----------------
A0A7W0XCB9      RP----IEAE--------------------------LAKAPTE-----------------
A0A3N5YNR8      QE----VEKQ--------------------------LQREKKE-----------------
A0A7W7ZUJ7      DQ----LNKS--------------------------INEQVKN-----------------
A0A2V2R0I6      KD----LDAT--------------------------IEKEKQN-----------------
A0A2V8XAR9      KD----LDAN--------------------------IEKEKKK-----------------
A0A2V8VZA0      KE----FDQT--------------------------IEKEKQK-----------------
A0A1Q7CB82      KE----FDQT--------------------------IEKEKQK-----------------
A0A2V8WIU1      KE----FDQT--------------------------IEKEKQK-----------------
A0A1Q6Y9F5      KE----FDQT--------------------------IEKEKQN-----------------
A0A2V9EVV8      KE----FDQT--------------------------IEKEKQK-----------------
A0A2V8YF91      KE----IDEN--------------------------IQGEKRG-----------------
A0A2V8XZK2      KD----IEDS--------------------------IEKEKRK-----------------
A0A2V8ZTX6      KD----IDDN--------------------------IEKEKQK-----------------
A0A2V9BT79      KD----IDDN--------------------------IEKEKRK-----------------
A0A2V9YHT3      KQ----VQET--------------------------IQGETRR-----------------
A0A7C2XNI7      DE----LDST--------------------------IAREKKN-----------------
A0A1Q8B793      KE----FDGL--------------------------IDAEKKN-----------------
A0A2V9BCA0      KE----FDGL--------------------------IDAEKKN-----------------
A0A2V9BWU9      KE----IEHL--------------------------IAREKAN-----------------
A0A2V9DKX2      KE----IEHL--------------------------IAREKAN-----------------
A0A7C2YQY3      AD----AKAQ--------------------------MEREKQQ-----------------
A0A845TWB8      TE----IKSQ--------------------------LEHEKLQ-----------------
A0A2U3KC61      KQ----VRTE--------------------------IVAEETR-----------------
A0A2V9Y2R7      QE----VRSG--------------------------ISVEQTR-----------------
A0A2V9NGH6      QE----VESQ--------------------------IQLEMKK-----------------
A0A2V9PYE6      QE----VESQ--------------------------IQLEMKK-----------------
A0A2V9NL07      QE----IDSQ--------------------------IQGETKK-----------------
A0A2V9QD92      QE----IDSQ--------------------------IQGETKK-----------------
A0A2V9WPZ6      KE----IDIQ--------------------------IQGEMKK-----------------
A0A2V9ZLH4      KE----IDVQ--------------------------IQSEIRK-----------------
A0A2V9RQF1      KE----VEAQ--------------------------TQVEMKK-----------------
A0A2V9YDK8      KE----IVAQ--------------------------IQAETKK-----------------
A0A2V9V8F7      KE----IDIQ--------------------------IQGEMKK-----------------
A0A2V9XGR9      KE----IDIQ--------------------------IQGEMKK-----------------
A0A2V9V3Q5      KE----IENQ--------------------------IQVETRK-----------------
A0A2V9NWS3      KE----VDAQ--------------------------LQAEMKK-----------------
A0A2V9USA9      KE----IDTQ--------------------------IQGEMKK-----------------
A0A2V9XW18      KE----IDSQ--------------------------IQGEMKK-----------------
A0A1H5SQF5      AE----LQRQ--------------------------TNEEISR-----------------
A0A2V8G155      QI----SQAK--------------------------LSGEISK-----------------
A0A2V8HDM7      QI----SQAK--------------------------LSGEISK-----------------
A0A2V8IVN9      QL----AQAR--------------------------LDGEIGK-----------------
A0A7W1SCW7      EL----AQTK--------------------------LDGEVGK-----------------
A0A3E0NV31      AE----LRRD--------------------------LSAAGGR-----------------
A0A3N5M5V0      RE----VEQQ--------------------------LVREKRE-----------------
A0A7X7XDY5      TE----TSSQ--------------------------LNREKQT-----------------
A0A2V9L5B5      DA----LQAE--------------------------LDKQKKA-----------------
A0A2V9LK56      DL----LQSI--------------------------LGKDKRT-----------------
A0A2V9L7I0      DA----LQAE--------------------------IDRQKKA-----------------
A0A522PPT0      ET----LQAN--------------------------LDHQKQA-----------------
A0A7C5V1G5      DT----LQAN--------------------------LNRQKQA-----------------
A0A4R1LC91      HS----IQKA--------------------------IQAETHR-----------------
A0A2V9QB26      AL----LEAA--------------------------LQKEQAA-----------------
A0A2V9VYY4      KQ----VRAA--------------------------IEAEKTK-----------------
A0A2V9KIE8      DV----LEAR--------------------------ITAQKQA-----------------
A0A7C2GJ20      AE----AERQ--------------------------LALAKRR-----------------
A0A7C4BTL5      AA----VESA--------------------------LQRERQA-----------------
A0A7X8YVF2      RR----AREQ--------------------------LRHERGL-----------------
A0A7X7YEP0      DKTRTNLDSV--------------------------IQETVGK-----------------
A0A2V9CBM2      TD----VEAS--------------------------LQQERKR-----------------
A0A2V8XN17      DE----IEAS--------------------------LRDERQR-----------------
A0A2V8WX45      DE----IEGS--------------------------LQVERKR-----------------
A0A1Q6YR79      DE----IESS--------------------------LREERQR-----------------
A0A1Q7VA32      DE----IESS--------------------------LREERQR-----------------
A0A2V9EY85      DE----IESS--------------------------LREERQR-----------------
A0A2V9H8K0      DE----IAAS--------------------------LREERQR-----------------
A0A2V9FFE5      DE----IAAS--------------------------LREERQR-----------------
A0A2V9GM43      DE----IAAS--------------------------LREERQR-----------------
A0A2V8ZHL8      DE----VQSL--------------------------IDTERKR-----------------
A0A2V9B240      DE----IQSL--------------------------IDTERKR-----------------
A0A2V9CYQ5      TD----VEAS--------------------------LQQERKR-----------------
A0A2V9BWU8      DE----IEAT--------------------------LREERQR-----------------
A0A2V8ZG48      NE----IEAT--------------------------LKEERQR-----------------
A0A2V8Y334      DE----IEGT--------------------------LKEERQR-----------------
A0A2V9AY68      DE----IEAA--------------------------LKDERKR-----------------
A0A1F2RFI7      EE----IERT--------------------------VQRERGA-----------------
A0A1F2RZS3      DQ----TAAA--------------------------LDRERQA-----------------
A0A845TW47      EQ----IEAV--------------------------LKRERLR-----------------
A0A845TXC1      DE----VEGI--------------------------LTKEWQH-----------------
A0A1F2USE2      QE----VQGL--------------------------LGQEQDK-----------------
A0A7C2VB08      GE----LEQL--------------------------LAAERAR-----------------
A0A2V9C238      NE----LDAA--------------------------LARERGR-----------------
A0A1F2Q9F5      DE----IERL--------------------------LAQERAR-----------------
A0A1F2QQH9      DE----IERL--------------------------LAQERAR-----------------
A0A1F2QXK7      DE----IERL--------------------------LAQERAR-----------------
A0A2V9DEM9      NE----LDAT--------------------------LARERGR-----------------
                                                                            

A0A2V7VMF7      ----IA----DGLQAEFAQLQKRESELRDAIDAQKADAARQSQKKTEVEV-LKKEAQSAA
A0A2V7YYV7      ----------SRLSDVL-------------------------------------------
A0A2V7Z0J5      ----------ARSGDTF-------------------------------------------
A0A2V7Z3M4      ----------TRTADDF-------------------------------------------
A0A399Y5V2      ---------------------------------------------------EKTSDTGSQ
Q01X01          ---------------------------------------------------GRAEGDGNR
A0A3M2D9H8      ----SRLDELKSLLNIYQQIYVNLSFSPASQSSQNGTNNQLQAALVLYQQ----------
A0A2V9IXG5      ----YA----DGMRVSVSVLRNREQASQKSYSEKMAERRVTSRHMAEMSS-FIKSKENWA
A0A2V9J2P4      ----YA----DGMRVSVSVLRNREQASQKSYSEKMAERRVTSRHMAEMSS-FIKSKENWA
A0A831T3F4      --------LEEKLKADYERAVRDERLLRASLEQAKSEAVQQNQAAIQYNI-LKQELETTK
A0A2V8JK38      --------IVKTFEVEYSAATERERLLSVALEQQRDAVNKMNREIIQYNI-LKREADSSK
A0A7W0JWI4      ----STFTLLTNLETRYRQVLSREEALRAAFNRQRAETVTQNEAAINYRI-IQQEIETNK
A0A1Q7RLS4      ----II----NGLRSQYDLLKDREAKLIKATDETRTESLQVNRKASGYEM-VRGEATETK
A0A257VBK0      ----VL----GSYRNQLSALRGERANLAQEVDGARREGLQFVEGLSRGEG-LNTSSAAIK
A0A7C5TWV7      ----IV----KGLRTDYRIRKAREASLYRALQQLRDQAINLSKQNLEYEK-LQHEYEQNK
A0A2V7XDY0      ----II----AALRADYEQLQKRESELRGAIDTEKAQAASQSRKAAELDA-IKKEAESAK
A0A2G6PYV5      ----LYNRLIQSISKDVQDRKNELAYLEAQRKKQNQKIVLADLKTKEQNASLDSKIQVLE
A0A1F2TCR2      ----VI----ETAKTDYEAAVAEERSFASSLEDQKRVAMDLDRKSTDYSM-LQRQADGDR
A0A7Y9PHF8      ----VG----QRMQVEYEVALHREDMLHAALTQGKSEADSLSAQEFRYRQ-LKDEAEEDK
A0A7W8J3G9      ----IR----SRVKQDYDTALTVENILQGQYDGQLSKAYALNRQEATYGV-LLSESKSAR
A0A1F2V330      MHYVQIRAEKESLEQRLTSYGQEERALESEMGRLQRRVQSTPQHEIAITE-LTRGYEATK
A0A662EE63      ----LR----LGMETRFDMVKRREQSLFENIQGLRNQTIELSKTSLEYDR-LEETYLQNR
A0A2V8TLH7      ----II----SNLRTQYALLKDRESKLAVAINETRSESLRVNQKASNYEL-MRTEALDTK
A0A1Q7ZJT1      ----II----NGLRSQYDLLKDREAKLIKATDETRTESLQVNRKASGYEM-VRGEATETK
A0A2V8VC99      ----II----NGLRAQYELLKDREAKLIKVSDDTRAESLQVNRKASSYEM-VRGEEAETK
Q01XL7          ----LL----KRLDNDYQEALRREKLLSGAYNAQTHAVGAQADKASQYAM-LKRDAEMAQ
A0A523DUV7      ----LV----AGMRADYQQLRRRERELLASINSQRKESIEDSRKTVQLEM-LQREALSNK
A0A7W1TTH3      ----LA----QTARQEYQNAMNDASRYQNLLTQKEQEIAKAGISAVQPGF-IENDITTSK
A0A1F2U158      ----AL----QTVRNEYERAVLEERTFAANLEEAKKDVQDLGRKSVSYNV-LEREARSNR
A0A2V8F6S9      ----AA----TTIKNDYESAVLEEQTIARGLESAKADAQNLSRLGVDYNV-MQRDAQTNR
A0A7V0UHS9      LRYVQLKSELEGVEQRIRSYAREQKSIMDQINAYRRRIESAPQHERALDA-MTREMLVGE
A0A7D8BEX2      ----IL----SQSKLAYSAATANEAMTKTALAEQQKDAFQSRDEMVRYAI-LQREYESHR
A0A4Q1SCH5      ----IT----AHLKQDLDASRQAESLMHQEYQDAVSQAYALNRKQADYAV-LAAEGAASR
A0A7V4SJP8      ----IL----ESYQAQLGALYSEKANLTAELEGVKRQGLQFVEGASRGEA-LTTSGAAIK
A0A372IRG7      ----LT----QRFQTEYDAAVKTEGLLQQRLDDTKQQAFHENESAAQFEI-LQHGAESAS
A0A2V8K4L4      ----VV----TRLRNDYAAAESHEKLLNDEFAKQLDTVSSQAANEVHYNI-LKREVDTNR
A0A2V8NCZ3      ----VV----TRLNNDYAAAQSHEKLLNDEFAKQLNTMSSQTAKEIHYNI-LKREVETNR
A0A4Q7YNP3      ----NS----NRLKNELETARHREMLLMTAYHMQEANVSSDLGKAAQVSL-LRREVESEQ
E8UZE1          ----GR----NQLELEYKLASENENKLRAATEAQKQQIFSMNEDALHYSI-LQGQVASGR
A0A2V7YW66      ----LTEKARNAAAASYQTALRQEQSLDGELTTLKGQAIDQNSAAVGFTN-LKVEIQTRR
A0A2V7Z0V0      ----QVDKAKSNSLAAYQTAQRQEQELEGELNALKRDVINQSSAAVEYTN-LKVEIQTRR
A0A2V9M454      ----VV----DNLHNDYLAAVEREKFLATAVAQQKVQVDRVNQLLIQHNL-LKREFESNQ
A0A2V9J4D6      ----VV----ERIQRDYEAAVEREKLLEATVAQQKFEVGKLNQLLIQHNI-LKRDSDTNQ
A0A2V9L9C5      ----VV----ERIQRDYEAAVEREKLLEATVAQQKFEVGKLNQLLIQHNI-LKRDSDTNQ
A0A2N9M9N1      ----IM----ERIESDYRTAVRREQLLSQDVSAQRTEVEKLNQLLIKYTI-LKGDFETNQ
A0A2V9JEC4      ----LV----KQTKDAYDTAVRRETLLSRTVAEQRKDVERLNQLLIQHNI-LKGEFETNQ
A0A2V9LPQ3      ----TV----ERIQNDYRAASTRVSLVSTSVVQQKAEVGRLNQLLIQHNI-LQREFQTNQ
A0A7Y8IYX6      ----AIARAKRDAQIRLSSIQHEYEMLNQTLKEQQLLVDRLSEAGVQFNN-LKRELDASQ
A0A2V9IVR7      ----IV----ERYHGEYVAAQQREAMISEALARQKVELEKLNQLLIQQNI-LKHEFETNQ
A0A2V9ILE2      ----IV----ERYHGEYVAAQQREAMISEALARQKVELEKLNQLLIQQNI-LKHEFQTNQ
A0A2V9LGY4      ----IV----ERYHGEYVAAQQREAMISEALARQKVELEKLNQLLIQQNI-LKHEFQTNQ
A0A7T9JJ28      ----IV----KNIETQYQVARKREEDLRLSFGQSKGEAIQQNRESTELGL-LRQKIETNR
A0A7T9GE94      ----IS----STIENLYRTAAQREDSLRKSFNVQLGETMNQNEGAIMAKM-LQQEIDTNR
A0A7Y4X7L5      ----IL----STIENLYKSAAQKESGLRTAYKQQESVTLDQSQDSIMAKM-LQAEVDTNR
G8P0Y7          ----SV----SRIHNDYQTAVNREQMLQEALGEQMGIADQLNQNAIEYKI-LKQEADSNR
A0A2W4RYA1      ----VV----ASITAQYEAAVAHENNLLAALAQQEREAQQLNAKAVEYRV-LERNAQSAR
A0A2V8EXP2      ----VV----QAVRNEYLSAQTQEQSLINVLDQQKREALALNRKGIDYSA-LQRDALSNR
A0A843SYC7      ----VV----QGVKNEYLAVLAKENSLAAALDAQKRDALAMNRKAIDYSV-LDREVQSGR
A0A7V9BJ09      ----VV----EGVNSEYRAALGQEQSLQGAMQSQKNEAIQGNRMDIAHAV-LKREADSNR
A0A7W1DT80      ----VV----QGVNSEYRAAMAQEQSLQSALNSQRGEAIGQNRTDIAYQV-LKREADSNR
A0A5M8T4U7      ----AH----RQIQDEYQGALRTEQLLRQRLDAQKEEAFRLNEDVGQYAI-LRHEAELNR
A0A7L5A491      ----IA----KRMQVDYEEAKSRESMLLAELTRAKSESDAVNSNTIDYQQ-LKNEAEANK
A0A7D8BF18      ----VL----VDAKAAYIAAKAEEDHTKAALEAQQDEAFRLRDALVNYTL-KQREFDANR
A0A1E3Y9R6      ----VA----AALQAEFQTARAREAALQQSLAGQQRESLGLDRQMLDYSA-LEREAQSNR
A0A2W4TLP2      ----VA----AAIEADFETALARERALQQSLDQQQRESLGLDRRMLEYAA-LEREALSNR
A0A7G8BDY8      ----IQ----ERFRTDYEASAVAEKQLRASFDQQKQKAYDMSEGLSEYGI-LKREVESGS
A0A7C4BZ42      ----VV----RRLGNDYQSALRREQLLLAETNVQSRLVSVQAAKSVHYNI-LKREVDTNR
A0A3R9WF43      ----IT----KRAENAYQYAKDNENSIKGQFEKQQHEAIQLADNTVQLQV-LAQEAYSNR
A0A317HKM4      ----AA----HTIRNDFEAAQSREQALEAALDRSKREVQALNAKAVEYSA-LEREAASNR
A0A2V9CG11      ----IL----RRIGSEYSAARQREEFLAKAYADQEMIAADQSSKAIRYRT-LKGEVDSSR
A0A523E0N1      ----QAAKVVGTAKGEFQEARDRENSLRKSLNAQKSQVRKLAHAASDYGH-IKAELANQR
A0A1V6HR88      ----ALAKAREAARAEYQGAQRREAALAAEINSLKVENREVNSASIEYNN-LRLEIDTRR
A0A4Q1SDL1      ----VQ----ARAKSDYEIAQKTENDSRAQYEANRQAADALKDKAIDYSI-LREEATQSR
A0A841JWG5      ----VS----ERAKTDYDVAQQTENEVRARYEANRRAADQLKDKTIDYSI-LREEATQSR
A0A4R1LAZ7      ----LT----QRFQEEYNAASNTEALMRKRLDATKQEAFRENESSAEFEI-LKHGAESAS
A0A7G8BMP1      ----LT----NRFEEEYNTSVKTENLLHQRLEEIKQEAYHNNESAAEFEI-LKHGADSAS
A0A7X7ZKA6      ----LV----KGAYSEYQTALNRERSLEAEFGGQKTEAFKMNSSAVLYNG-LKVEIQNKK
A0A523ECP2      ----LAVEVVAKARVEYRAAVEREHLLLAEVESQKKEAQELSKLTTNYTQ-IKAGIDNQR
A0A2W0C122      ----LQ----ARAELEYQVASRREQKLRAAFEAQKVEANRLNVSAIQYGL-LRRESEANR
A0A2W0AUU7      ----LQ----GRAELEYQVAARREQKLRAAFEAQKIEANKLNESAIQYGL-LKRESEANR
A0A2W0BQL1      ----LQ----GRAELEYQVAARREQKLRAAFEAQKIEANKLNESAIQYGL-LKRESEANR
A0A2V8ERZ5      ----AV----QSVKNEYETAVLQEQTLARNLDGAKSEAQDLNRKGIGYGV-MEREAKSNR
A0A7W8J413      ----IS----KRAENSYIYAKNNEETIRQQFVKQQSAANEMADSTVHLQV-LAQEAASNR
A0A7W8JCF5      ----IS----KRAENSYLYAKQNEDTIRQQFVKQQSNANEMADATVHLQV-LAQEAYSNR
A0A7W8IEB1      ----IS----KRAENSYLYAKQNEDTIRQQFVKQQSNANEMADATVHLQV-LAQEAYSNR
A0A7Y9T3I1      ----IS----KRAENSYLYAKQNEDTIRQQFVKQQSAANEMADSTVHLQV-LAQEANSNR
A0A3P0XH15      ----MQ----QRFQVEYETALSTENLMRKRLEDAKQQAYQQNRSSAEYQI-LRHGADSAS
A0A3E0P0A3      ----NSRQAVTAARARYQQALQTERSLEREYEAMKEETRRYQSASTALQN-LTGDIAAKR
A0A3M1WQW8      ----IL----AKIEADYKAARTREENLRAELMAQRAETLRQNERAINLSI-KQQQVEASA
A0A841JVA9      ----GI----QRLQSEYSAAKHREELLEMAYNRQESSVSSDLQKGSQVNL-LRREVESEQ
A0A3N1JHC1      ----IV----KRLSVEDDTAARRQQLLKQQYDRQLAVVTDQGSKQVRFNM-LKHEVDVNE
A0A7V4XQR5      ----LT----QRFKAEYDAAVQTQNLLEARLEKTKQQAFKQNESSAQFEI-LKHKAQTSS
C1F294          ----LT----QRFKAEYDAAVQTQNLLEARLENTKQQAFKQNESSAQFEI-LKHKAQTSS
A0A2V9KA79      LRYLQLKSEVEAIDQRLNSSKQEQRDLTAQLETYRSRVQSTPTHAGALAD-MTRDLESTR
A0A348UZU3      ----LI----RAAYADYQAALKKEASLKELFEQQKEEAFRLNSNAILYNS-LKIELENKK
A0A7X9FXC4      ----LV----KAAYSEYQAARKKENSLQDLFERQKDEAFRLNSSAILYNS-LKIEIENKK
A0A7X7ZKL5      ----AV----GTAEADYRAALKKEGSLQGLLDEQRGDVTKMNKNAIFYHT-LRTEVENMR
A0A522PSP1      ----IL----AQIKAQARAQAVQVKLTERQLADVKAQLEEFNRKGVEFQI-LKHQADTDK
A0A7W8E8D3      ----VK----NRLKQEYDTAVAIQNSLQQQYDEQTDKAYALNRKAAEFAV-LYAEGSSSR
G8P085          ----VK----NRLKQEYDTAVAIQSSLQQQYDEQTDKAYALNRKAAEFAV-LYAEGSSSR
A0A843SRW6      ----IV----LSLQSEYESSLAQEQSLVAALEAQKAEALALNRKGIDYGA-LQREATSNR
A0A7W8E330      ----VA----SRAKNDYEIALSNENQIRAENEANHRAADNLKDKAVDYTI-QRDEANQSR
A0A4Q1SGQ1      ----MG----HRARVDLDIAQNTENAARDAFEKQRSTADAMSNRTVAYQL-ARQEADSSR
A0A7V2HGP7      ----IL----KRVESEFREAVQRESMLAAAVASAKAEMDASNKRLLEYQN-LKREADSDK
A0A7R8B6H7      ----IA----AKLRTEFEAVQRNEALLGEAYRKQTNRAIGETAKTATYNS-LKREAEQAR
A0A2V8GTX0      ----SV----AAIKADYQAALDEEKQLSADLEGQKAQATDLNRKSIDYSV-LQREAESNR
Q1ILD9          ----IE----ARFSSEYEASLNTENKIKGNFDQHQQEALSKSQNFSEYSR-LRREVDTSR
A0A7G8BJH7      ----IG----ERARTDYEIASRAETSARDAFEGQKKVVNALNDKAIAYGL-AKQEADESR
A0A2V8J0X9      ----VL----ESLKNDYNAAFAQERSFSSQLEEQKGASMDLDRKSGDYKL-LQRKADSDR
A0A7Y5WWH8      ----VL----ESIKNDYAAAVAQERSFSAQLEDQKSASMDLDRKGGDYKL-LQRKADSDR
A0A7C5SHM3      ----LYHQALSGARADVVAAREQEQRLRDLYEREKQLANAKQYQASEVES-LRRQYDQKK
A0A7V6D154      ----AL----HNAEVAYRQALEQERRLGETLRETKAEFDRLNARSFEYQT-LKREAEGDK
A0A7V1XXZ2      ----LL----GRVRGEYNQAVQRERMLRSALEGQKQEANKLNERAIQYQA-LKREAEGSR
Q1IJZ6          ----IV----DRTELDLELARQSEDALRQAYEKQEQEANKINDSQIRLAV-LQQEADSTR
A0A2V8TCE6      ----IARRIVSAEQAKYRAALDEEERLGKLLEEQKSEAQRTGRDSIEYAT-LQAEVERKR
A0A522TBE8      ----LA----GAARAQFVAARLQEMLLEQAVAQQKQAMDQFERRAITYRS-LQAAAQNYT
Q1ITG0          ----IE----ERFRTEYESAKRTEDQLRASVENRKKEAFSQSAKFSQYDI-LKNEVASGR
A0A7C2ML20      ----ARRALLSKVAKEYKNADNRLQTLTGELERQKKEIQQHNREALQFSL-LKRQSEVDE
A0A7T9HIZ6      ----ALEKARESARADYQTAQRREGSLTAEINQLKAENRTINSAAIEYNN-LKVEISTRR
A0A7C5AXS9      ----VL----ERIRNEFEAAERRERLLARDYEAQSKVVSDQAARAVHYNI-LKREVDTQR
A0A7C2RGE3      ----IV----ANIEAEYRAAVRRENDLRAALERQRAETLRQNERAIELSL-RKREVEVTT
A0A7V6D075      ----MRAQLARQIELEFRQALTREEMLAQAVTETKQEFDRLNARSFEYQT-LKREAESDK
A0A3N5PCI5      ----TV----ESVRQEYLAALSREKELTAELDAQKSRALALNRQGIEYGV-LLREVESNR
A0A3M1Q0S9      ----IARQVREAAKIDYEQARRRAEGLRRLYEETEQRVSELQQAFVEYEA-RKAEIDRKQ
A0A2Z5G448      ----LLKRFEE----EYNAAVNTEALLKGRLEQVKQEAFRVSDSSADFEI-LKHEAQSTT
A0A3M1VZ38      ----IAASAIDSAQAAFEQARREEQQLAQLLADATREASEADRAMIEYEA-RSLELERKK
A0A4Q1SD29      ----LTKRFTE----EYDASVNTESLMRARLEATKQEAYRENESAAQFDI-LKHGAESAS
A0A833M5K2      ----ALARAREAARAEYQTAARREHSLEAALAGVKAENRELNSAAVEYSN-LQIEISTKR
A0A1F2Q9L4      ----MVGKARDSARAEYQGALRREEALVAELTRQKSDAMQLNSAAVEYNN-LKVEVSTRR
A0A7V5ZKV2      ----TVSASLESARAEYQTALRREQALAAELARFKAEAMQLNSAAVEYNN-LKVEVSTRR
A0A7Y8LRQ1      ----TVSASQESARAEYQTALRREQALAAELARQKAEAMQLNSAAVEYNN-LKVEVSTRR
A0A3M1PY35      ----VFEEAVGAARADLELARTREARLQALFQQELAATDALQRRAQDYDR-LYREYEQKR
A0A3M1VMP2      ----IYRQALESARAELALRRESEARLQRLIEEEQARAAQLQLATGELEA-LRSLYKQKR
A0A1F2T595      ----IA----QAIRSEYEAALAEERSLSASLNQQKIEAQSLNRAGIEYGA-LERDATANR
A0A2V9AC41      ----EV----KRIEVTYTAAKNNETGLRATMEDQKKTTLNLKDAAVQYAM-LAREVDMNK
A0A2V2R525      ----AV----KGLETKFREAQRREQEIRDAFEKARSETITQNSAAVNYRI-LQQEIQTNQ
A0A321LPW6      ----LE----ARLRADYERSARDEVSLKGALDRAKTEAARQNQDAIQYGI-LKQDVDTAK
A0A2V9R9V4      ----LE----EKLKADYERVVRDENALKAALEEAKAGAAQENQRAIQYSL-LKQDVDTAK
A0A321LE75      ----LE----ARLKAEYERAIRDETALKESLERAKIDAAQQNQDAITFNI-LRQNVETAK
G2LEI9          ----TL----VRIKTAYENAKRREEELRARVEKQRNEVVTQNGDGVMQRM-MQDNIDNKK
A0A7V9TW03      ----------TNLEVNYRKALEREKTLRDSFNKQRAETVAQNQAAINYNI-LKQEIETNK
A0A3N5XQP8      ----AL----EEAQGRYRASLQQYSQLSRVMDRQRQLAYRLNSDLVQFNT-LKREADTNR
A0A2V9KCS3      -------------RNEQEAAVRRESLLAAEYGSQAKLVSEQSGKTIHYNI-LRREVDTNR
A0A7W1JC10      ----------TNLTARYRKAQAREKALRESFNRQRSETVTQNVAAINYRI-IQQEVDTKK
A0A3M2BZG9      -------------RTAYQEALRKEQNVEEELRKLTDEISAYSSSALDYTT-AKLELETKQ
A0A1Q7N5R7      ----LA----KALATELES---REAVLGTQITAGGRELRGIPQRAIEEAR-LRRDATIAE
A0A352F549      ----------TNLEVNYRKAVEREKTLRDSFNKQRGETVAQNQAAINYNI-LKQEIETNK
A0A3B9MLP9      ----------VSLDSNYRQALDREKTLRDSFNKQRAETVAQNQAAINYNI-LKQEIETNK
A0A3D5SQ87      ----------VSLDSNYRQALDREKTLRDSFNKQRAETVAQNQAAINYNI-LKQEIETNK
A0A7Y2DUG3      ----AL----SGLRAQLAAARNREAKLLGEYTNEVSDANFQGQAARQLTT-LKREIETNR
A0A7Y2D8Q4      ----IT----SGLAAKLQSARKREGQLRASYEKELTTANFQGVEETKLTT-LKREIETKR
A0A2V8NW86      -------------RNDYETALRREKLLSAEYRNQSRLVTDQDEKSIQYGI-LKREVDSNR
A0A3M2D491      ----LL----TALSAQLNAAKQKEEQARASYLAEVERSNQQGQAGMRLKT-LTQAIDTNR
A0A7W1CBZ8      ----VL----NGLQAQLQAAQKREAELRSAYMTEVASANVAGQAETRLTT-LSREIETNR
A0A7W1FC90      ----VL----NGLQAQLQAAQKREGELRSAYMTEVASANVAGQAETRLTT-LSREIETSR
A0A7W1ZXG0      ----VL----NGLQAQLQAAQKREGELRSAYMTEVASANVAGQAETRLTT-LSREIETSR
A0A7W1ZIT3      ----VL----NGLQAQLQAAQKRESELRSAYMTEVASANVAGQAETRLTT-LSREIETSR
A0A353C9L6      ----AL----VSLRAQLDSKRREEAQALDAYEKEAALANVQGQAQTKLTT-LKREIETKR
A0A2V8RQV0      ----AL----VSLRAQLNAARTQEAQAQAAYEQESGTANVQGQAQTKMIT-LKREIETNR
A0A2V8SJH5      ----AL----VTLRSQLSAAQKQEAQSLAAYEQEASQANVQGQAQTELIT-KKRAIETNR
A0A136JPP4      ----AL----VSLRSQVDAARRREDQLLNAYEVEAERANVQGQAATTLTT-LKRALETNR
A0A399WUJ8      ----AL----VSLRSQLDAAKRREDQLLNAYEVEAERANVQGQATTTLTT-LKRALETNR
A0A7V9C3X9      ----AL----VSLKSQVDAKRKEEGQALSAYEQEASMANVQGQAQTRLTT-LKRSIETSR
A0A7V9ZSX9      ----AL----VGLRSQLESAATRENQLRATYLNEMSKANIQGQAETRLTT-LKREIETQR
A0A3M1SIV3      ----IL----TGLAAQLNSARKREAKAKESYLREVEKANQQGQAAMSLTD-LTQKIETSR
A0A7V1SCI4      ----IL----TGLAAQLNSARKREAQAKESYLREVEKANQQGQAAMSLTD-LTQKIETSR
A0A7C5ZUA8      ----AL----VSLRSQLESKRREEAQALAAYEKEAALANLQGQAETRLTT-LKRGIETNR
A0A7T9FQE4      ----VM----ASLRAQLAAAQQREGRARAAFEAAAAKANFEGQVETKLIG-SKREIESNR
A0A3E0PHB0      ----IT----SALAAKLNTARRREAQLAAAYEQESAKANQQGQKETMLTT-ARREIENNR
A0A7T9G4W3      ----IT----SALAARLNTARRREAQLSAAYEQEAARANQQGQQETMLTT-AKREIENNR
A0A838UAA0      ----ML----ATLRSQLGAAQAREQRALAFYTQAASKANFEGQAETRLTT-LKRELETSR
A0A7W1HTU2      ----VL----ASLQAQLQASQRREGQLRSAYNNEISSANLQGQAEIRLTT-LSREIDTNR
A0A357F267      ----AL----VSLKAQLDAKRKEEAQAQAAYDAEAARANIQGQAETKLTT-LKRGIETNR
A0A7V9ICU8      ----AL----VSLRSQLESKRREEAQALTTYEREAALANVQGQAQTRLTT-LRREIDTKR
A0A7T9JEF9      ----QL----SELEQRFREASAKEGELRRNFESQRGAVLDQNQAAINYRI-IEQEIATNK
A0A399WNU1      ----QI----ASLLQTYREAASRENELRSNFDAQRSAVLNQNEAAINYRI-IQQEIDTNK
A0A3E0PCN7      ----QL----SDLQRQFREASSRENELRRNFEAQRNAVLNQNEAAINYNI-IRQEIATNK
A0A7Y4TLV3      ----QI----AALEQTYREAASRERELRVNFEAQRNTVLNQNEAAINYRI-IQQEIDTNK
A0A7W0MGQ3      ----FM----TSLEAAYSRAFAYEQSLRESFNQQRSEVLSQNESAINYRI-IQQQIDTSK
A0A1Q7Y6W9      ----LT----TNLKTNYLQAKAQEDSLRDAFNKQRSETLVQNEAAVNYNI-IKQGIETNK
A0A2V8NC68      ----AI----TNLETSYRQAMAREQALRADFEKQRGETLTQNEAAVNYRI-LQQEIDTNK
A0A352FLX4      ----VT----TNLATRYRQALATEELLRKAYDQQRAETLTQNEAAVSYRI-IQQEIETNK
A0A2V8MHG6      ----VK----TNLETRYRQALQKEEALRQAFEKQRAETLTQNEAAVNYRI-IQQQIETNK
A0A2V8P7N1      ----VK----TNLETSYRQALQKEEALRQAFDKQRAETLTQNEAAVNYRI-IQQQIETNK
A0A2V8M3M6      ----VK----TNLETSYRQALQKEEALRQAFDKQRAETLTQNEAAVNYRI-IQQQIETNK
A0A1Q7NJH5      ----VK----TNLETSYRQALQKEEALRQAFAKQRAETLTQNEAAVNYRI-IQQQVETNK
A0A2V8PJY0      ----VK----TNLETSYRQALQKEEALRQAFAKQRAETLTQNEAAVNYRI-IQQQVETNK
A0A7W1BYD3      ----FK----IHLTTRYRKAQAREQSLREDFNQQRSETVSQNVAAINYRI-MQQGIATKN
A0A838PIP9      ----FK----TNLTTRYRKAQAREQALRQSFNKQREETVTQNVAAINYRI-MQQEIATKN
A0A399WK13      ----LL----YNLQTKYLQAKANEDKIRADFNKQFGEATGQNQSAVSLAL-LKQTIDTNK
A0A7V8YZQ7      ----LI----NNLRTKYLRAKEQEDKIRSAFDAQYNEAQGQNTGAVLLKL-LEQNIETNQ
A0A7V9ICV8      ----LV----DVLRTKYLQAREQENKIRAAFNAQYNEAQAQNSGAVVIKL-LEQNIETNK
A0A136KC10      ----LL----YNLQTKYLQAKANEDKIRADFNKQFGEATGQNQSAVSLAL-LKQTIDTNK
A0A7W1IVA5      ----LL----NNLRTKYLSAKNKEDQIRASFDQQYNQAQGQNQSAVTLSL-LKQDIDTKK
A0A7W1ZIE3      ----LL----NNLRTKYLSAKNKEDQIRASFDQQYNQAQGQNQSAVTLSL-LKQDIDTKK
A0A7T9J551      ----ML----ENLRTKYLQAKSQEDKIRADFEKQYNEAQAQNQSAVNIKL-LQQNIDTNK
A0A7V9NLN0      ----IL----NNLRTSYLKAKDQEDKIQADFDVQYNKAQGQNQSGVAIRL-LEQDIETKK
A0A7T9G8R2      ----IL----ENLRTRYLQTKEREDKVRSAFNEQYNEAQGQNQSAVAITL-LEQDIETKK
A0A7Y2D047      ----IV----SNLRTRYLQARDQENKVRSAFNSQYNEAQGENQSAVAIRL-LEQDIETKR
A0A3M2D6Y5      ----IL----TNLQTKYEQAKAQEDKIRKAFDEQYRRAEGENRAAIDIRL-LEQNLETNR
A0A2V8SEX6      ----LV----DNLRTKYLQTKNEEDKIRAAYDEQYNAAQVQNGGAVRLKL-LEQTIETNR
A0A7C5ZUU4      ----LL----DSLRTDYVQAKDREDKIRKAYNEQYNLAQGQNVGAVQIRL-LEQNIETNK
A0A3E0PCJ6      ----IL----ENLKTRYLQTKEREDKVRSAFNAQYNEAQGQNQSEVTIKL-LEQDIETKK
A0A2V8RTL7      ----LL----ENYKTQYQQAKDQETKIRSAYDVQYNEAQGQNSGAVMIKL-LEQTIETNR
A0A3M1S4R8      ----IL----TNLQTRYEQAKAQEDKIRRAFEEQYRKAEGENRAAIDIKL-LEQNIETNR
A0A7V1SAJ0      ----IL----TNLQTRYEQAKAQEDKIRRAFEEQYRKAEGENRAAIDIKL-LEQNIETNR
A0A7W0N726      ----IL----NNLRTSYERAKSQEDKIRVSFDAQKNRALAQGQSGVAIRL-LEQDIETKK
A0A7W1HTZ7      ----LL----EGLKTDYLKTKAQEDSIRAAYNAQYDQAQGQNQSGVSLRL-LQQEIETKN
A0A1Q7YFI6      ----LK----TNLETRYHQALAREESLRQAFDQQRAQTLTQNEAAVNYRI-IQQEVETNK
A0A7V9C9Y7      ----LL----TNAETDLRKARAREAAARADFERQKSATVNLNEAAIQYRI-IEQEIATYR
A0A7W1G8A4      ----IT----TNLETRYRQALNREKALRDSFSRQRGETVAQNEAAINYRI-IQQEIATNK
A0A7V9KMZ1      ----LL----TNLETRYRQTLAREESLKKAFDKQRSETLTQNEAAINYRI-IQQEIETNK
A0A7W0JTE4      ----IL----TNLETNYRQTLAREQALRKSFEQQRSETVTQNQAAINYRI-IQQEIETNK
A0A0B6WWQ6      ----ML----TNLRTRYRQALAREEALRQAFDEQRGETLTQNEAAINYRI-IQQEIETNK
A0A3B9MK99      ----LL----TNLETDYRQTLAREQALRKAFEQQRGETLSQNEAAINYRI-IQQEIDTNK
A0A838PA20      ----LL----TNLETRYRQTSAREEALRKAFDKQRSETLTQNEAAINYRI-IQQEIETNK
A0A352EX26      ----LL----TNLETQYRQTLGREQALRAAFQQSRSETVTQNEAAINYRI-IQQEIDTNK
A0A7V9R410      ----LL----TNLETQYRQTLGREQALRAAFQQSRSETVTQNEAAINYRI-IQQEIDTNK
A0A2V8MM59      ----LL----TNLETRYRQTLAREQALRKSFDQQRAETLTQNEAAINYRI-TQQEIDTNK
A0A2V8PFE8      ----LL----TNLETKYRQSLAREESLRKSFNQQKGETVTQNEAAINYRI-LQQEIETNK
A0A2V8PWS6      ----LL----TNLETKYRQALAREDSLRKSFNQQKGETVTQNEAAINYRI-LQQEIETNK
A0A2V8LCT5      ----LL----TNLETKYRQAAEREDSLRKSFNQQKGETLSQNEAAINYRI-LQQQIETNR
A0A352FTJ9      ----LL----KNLETKYRQAADREEALRKSFNQQKGETVTQNEAAINYRI-LQQEIETNK
A0A1F2S1W5      ----VL----QAMRNDYEAALTEERTLANELNRQKIEAQQLNRTSIDYSA-LQRDAAANR
A0A2N9LQU7      ----VG----QRLHDEFLAAQNSESLLRDQFEHQRQEAFNLNASAVQFAT-LKHEVESSQ
A0A2P6WFK7      ----VG----RRMETEYQSAAKTEAALRNQFNKQKEEAFKLNEHAVQYLV-LKHDVENSR
A0A2V8JQV5      ----IL----RGIANQYEDAKRREELLAQEYDAQTRVVSDQADKVAHYAR-LKREADSNR
A0A2V8U914      ----VR----QSVQNDYVAAQRRQTGLASVYARQSALVSKMTAKMTHYNT-LKHEVDTNR
A0A2V8DRT9      ----VV----HALSNDYQAALAQEQSLMHALDQQKNDALALNRKGIEYGA-LQRDAASNR
A0A2V7VYF3      ----VV----ESVHNEYLTALAREQDLVAALNAQKNEALGQNRKAIAYGA-LQRDAASNR
A0A1F2SVH2      ----VV----QAMRNDYRQTVAQEQSLMSALEQQKSEALSLNRKGIEYGV-LARNAASNR
A0A2V8AJG9      ----VV----QSVKNEYQAALIQEQTLTGALDQQKRDALALSRKGIDYGA-LQRDNATNR
A0A2V9MAM9      ----TR----QRLRNDYLTARRREALLSSAYQQQTHLASDLRKKMIHYDT-LNREVATTR
A0A2V8F956      ----VV----QGVKNEYLAALAKENSLTGALNAQKGDA-----------------VQSSR
A0A2V7W309      ----AL----EEARAQVSAASSREGSVRSAYEQQRTEAQRLNVDAAKYFD-LRMAVDSKQ
A0A348V070      ----LI----KTAYAEYQGALAKEQNLQKLLDDLKAQAYKANSTAILYNS-LKIETDNKK
A0A2Z5G3A3      ----MG----ARAENDFKVAKTAEAQSQMSYKALKKRADALNDKTIEYEL-TRQEATDSR
A0A2V7UGP8      ----TL----KTAKMEYEEASAHEKTVRGALEGQKSEAIKQKQYGVEYSN-LKAAVDSKR
A0A239MKT6      ----LN----SETRSSYLLAKADEDGIRKRATDQRQQVLELGNSLTALTF-LQQEENTSR
A0A2Z5G7H4      ----VA----ERSKNDYEIARREEDESRTEFATEKHQADSLNDKAIEYAI-VRQEADDSR
A0A372IT17      ----VG----ERAHADYEIAQRAEDTAREEFEKQKTLAAQMNDRRIAWTL-ARQEADESR
A0A841JU67      ----VG----QRAHAGFEVAKAAEDSARDDFDKQQDLADQISSKAVGYQL-ARQEAEGNR
A0A7T9GJJ6      ----LE----EKLRADYERSVRDENLIKQSLERAKSEAAQQNQASIQFNI-LKQNVETTK
A0A7Y4UER8      ----LE----NKLKADYERAVRDERSLKAALETAKSDAVQQNQAGITFNI-LKEEVETSK
A0A2V8IYW3      ----EI----DKLDRQIAGKEADSVRLRGTIAEYQRRVETAPTRESEMAE-LTRDYETLK
A0A7V2HCZ0      ----VI----SRIRNDYDASVRREKMLAEAYRKQMAVVTDNSTKSIYYGI-LKREVETNR
A0A2V9AEW6      ----VL----GRMRNEYEAALRREKLLTEAHDAQQKVVADQSSKAIHYDT-LKRDVDSNR
A0A2V8WQK6      ----VL----RGLGNEYAAAVRRERLLSKAQAEQEKIAADQSDKVIHYDT-LKRDVDSNR
A0A2V8XIF4      ----VL----RRIGNEYTAAVRRERLLVEVHANQEKVVADQSSKAIHYDT-LRRDVDSNR
A0A350UQT3      ----AI----RRMQVEYEQAQAREKMLERSVNETKAEYDTLNFRSFEYQR-AKREAEADK
A0A7C3HRX0      ----IA----RRMEVQFREVSAREQMLARSVAETKAEYDALNMRGFDYQR-AKREAEADK
A0A2W0BGU4      ----IA----QRIRNDYFAAARREQLLGATLAEQKKESGNFNRLLIEHDL-LKGDFEANQ
A0A2W0BVQ9      ----IA----QRIRNEYFAAARREQLLGATLAEQKKESGNFNRLLIEHDL-LKGDFEANQ
A0A317J121      ----EI----QRIKNDYDVALRREKLLSADYTKQASQVSAEATKASQYSG-LKREVETLQ
A0A2V9MN96      ----LL----SKVRDEYMAAIQRETLLTSAFDHQKQEANQLNESGIEYTA-LRRDADSNR
A0A2V7V2Z1      ----VI----RAAENDYKAYAAQEASVASALEAAKAEALDLSRRSVQYDT-AKREAEAGK
A0A2V7X2F7      ----VI----RSAENDYKAAAAQEASLAAALESTKEEIQELGARSGHYDS-VKREVEASR
A0A2V7V2I1      ----VI----RAAENDYRAAVAQEHGVADALEMAKREALELSRRGVQYDS-LKRELDASK
A0A2V7U3M2      ----VI----RAAENDYKAAAAQEASVSSALEAAKAEALDLSRRSVQYDN-AKREADAGK
A0A2V7UHT0      ----VI----RAAENDYKAAAAQEASVSSALEAAKEEALDLSRRSVQYDN-AKREADAGK
A0A3P0X3W6      ----TG----RRIQTDFAQADTREKMLAATLAAAKAQSDALSLKSLEYQQ-LKRDADANK
A0A7V2MG68      ----IS----RRVEIEYGKAREREELLARAVKETKEEFDRLNARSFEYQT-LKREAEGDK
A0A7C6A629      ----IL----RRAEVEYREAMNREAMLKKAVDEAKAEFDRLNARSFEYQA-LKGEAEADK
A0A7V2HBQ5      ----IV----GRVQVEYEQALSRELMLQKAVAEVKAEFDRINSRSFEYQA-LKREAEADK
A0A2U3JZ71      ----IG----QRVEVEYREALNRESMLRKTVSETKAEFDALNARSFEYQS-LKREAEADK
A0A2V8TTB0      ----IA----QRVEIEYREAVNREAMLEKAVAETKAEFDRLNARSFEYQT-LKREAESDK
A0A2N9MK30      ----VM----RRVEVEFREGVNREEMLKKAVTETKAEFDRLNARSFEYES-LKHEAEADK
A0A3D1ASD2      ----IT----EQVAIEYRTATQREQMLKQELARTKSESDALNARSFGYEE-LKREAEADK
A0A7R8B699      ----IG----KRIEVEYRTALSREHMLKQAVAGTKAEFDSLNGRSFQYQQ-AKREAENDK
A0A7S7SGU3      ----AI----KRVEVQYNEAKAREQMLQKSVAETKSEYDTLNLRSFEYQR-AKREADADK
A0A7Y8HY45      ----IA----RRVEVQFKEALAREQMLARGVAETKAEYDAINLRSFDYQR-AKREADADK
A0A7C5AXI3      ----IK----RRVEIEYQEALRRESMLQKAVQETKAEFDNLNARSFEYQA-LKREAEADK
A0A7C6E4H7      ----IV----RRAEVEYREALNREAMLKKAVDQTKAEFDRLNARSFEYQA-LKREAEADK
A0A2Z5FVL3      ----MR----DRARNEYVVAQQVESGAKQLYDAEKQRADEMNDKAVQYSM-ARQQADQSR
A0A2V8GFD4      ----IA----ESVRTEYLAAAAQERSLQAALDQQKHEAQELNRRAIDYGV-LQRDAATNR
A0A2V8HSS5      ----IA----ESVRTEYLAAAAQERSLQAALDQQKHEAQELNRRAIDYGV-LQRDAATNR
A0A2V8KP55      ----IV----KTFEVEYSAATERERLLSVALEQQRDAVNKMNREIIQYNI-LKREADSSK
A0A2V9JSI3      ----IA----GRVRNDYRAAMGREKLLAAALAREKEAVGRLNQVLIQHNL-LKREFETTQ
A0A2V9WI32      ----IA----SRVQNEYLSALQREKLLGAALDVQKQEANHLNESAIEYNL-LKRDAESNR
A0A2V9KBD6      ----IG----DRLTYEYHSAAERERMLRAALEKQKQVADDLDAHAVQSEI-LKHEFETNR
A0A2W0AJ66      ----TR----ERMTNEYRMALERERMLRNALETQKQAADTLNANAIQYNI-LKRDVDTNR
A0A1Q7RBU1      ----IG----EHITYEYKSAVGRERMLRSALEAQKQAADKLNANAIQNNI-LKHEFETNR
A0A2V9JPV9      ----IG----ERITYEYKSAVGRERMLRYALEAQKQAADELNANAIQYDI-LKHEFETNR
A0A7V0Y3A1      ----II----GRIKIEYDAAIQREKQLQNDFNAQARSLHSQSELLIQHDI-LKREAEGLR
A0A7C5Z4J3      ----AV----ERIVHNYQAAFGRVKLLSASVAREKMEVGKLNQLMIQHNL-LKHEFETNQ
A0A1F2TPT3      ----VL----EAMREDLGVSRAAEANLGKELESLKIEATAQNRKNVELSI-LTREVASNR
A0A2V8JTQ2      ----IG----ERITYEYQTAAERERMLRDALEAQKQVVDHLNASAVQSDI-LKREFETNR
A0A2V8UZY0      ----IG----KRITYEYQSAVGRERILQDALEAQKQTADKLYANAVQSEI-LKHEFETNR
A0A350UEK1      ----IL----RRIRNEYEEAMRKERLLQTDYDRQTRLVTALGEKAIQYNI-LKREVETNR
A0A350UIQ4      ----IL----RRIRNEYEEAMRKERLLQADYDKQTRLVTVQGEKAIQYNI-LKREVETNR
A0A7T9GJN6      ----LQ----EKLKADYERALRDETALREAFNRARADAVQQNQAAIKFSI-LKQEVETAK
A0A7T9GJN7      ----LE----EKLKADYERALRDERSLRAALDRAKGEAVQQNQAAIQFSI-LKQDVDTAK
A0A1H5Z7N3      ----IL----AQARQNYIASRTNEQQTRGALEAEKSTAYQLRDQMVQYTL-RQREYETNR
A0A1G7JVV8      ----MV----TEAKQALVAAQANEAQTEGALEDQKNQSYRLRDDLVEYTL-RQRDYETNR
A0A1H4T6W9      ----LL----TEAKQALVAAKANEDQTSSALEEQKQESYRLRDDLVEYTL-RQRDYEANR
I3ZEU5          ----LL----TEAKQALVAARANEDQTTSALEQQKQESYRLRDDLVEYTL-RQRDYEANR
A0A7W7ZGZ3      ----LL----AQAKENFVIAKASEDRIDASLDAQKQDAYKMRNDLVEYTL-RAREFESNR
A0A7G8BSK5      ----LV----LQAKQVYLAARTNEDETRATLDSEKNDAYKLRDDMVEYTI-RQREFESNR
A0A428MDU2      ----LL----LQAKQNYVVARTNEDQTSAALEKQKSDAYKLRDDLVEYTV-RQRDFESNR
E8WVF6          ----LL----TQAKETYLIAKANETQTTAALEAEKQDAYSLRDAQVEYTL-RLREFESNR
A0A1I6MH75      ----LL----IQTREAYLATKANEQQTSAALEQQKTDAYKLRDDLVEYTL-KAREYETTR
A0A7Y9TM87      ----MV----QASREAYQIALSSENKTTGTLDAAKDEAYKLRDDLVEYTL-RQREYEANR
A0A7W8J1H5      ----LI----TQAKQNYVIAKANEDQTTAALEAQKTDAYKLRDQLVEYTL-RQREYEANR
A0A7Y9T5K4      ----LI----VQAKQNYVVAKANEDQTTAALEAQKTDAYKLRDQLVEYTL-RQREYEANR
A0A852VHP9      ----LI----VQAKQFYVVAKANEDQTTAALETEKTDAYKLRDQLVEYTL-RQREYEANR
A0A7W8IFZ2      ----LI----VQAKQNFVVAKANEDQTTAALEAQKTDAYKLRDQLVEYTL-RQREYEANR
A0A7W8J9Y9      ----LI----VQAKQNFVVAKANEDQTTAALEAQKTEAYKLRDQLVEYTL-RQREYEANR
A0A7L5A6M5      ----LL----EQAKQNFELAKSNQTQTESVLEAQKTAAYKMRDDLVEYTL-RQREFESDR
A0A5B9EBI2      ----LL----NQAKQTYLAAKATEEQTQAALEAQKADAYKLRDELVEYTL-RQREFESGR
A0A7Y5RFT3      ----LL----NQAKQPYLAAKATEQQTQAALEAQKADAYKLRDELVEYTL-RQREFESGR
A0A239HDF6      ----LL----LQSKENYLIAQANEEKTNAALDAQKADAYKLRDDLVEYTL-RQREFESNR
A0A4Q0T270      ----LL----TQARENFNAAKANEEQTTAALEKQKADAYKMRDDLIEYTI-KQREFESSR
A0A1Q3QQB6      ----LL----LQAKENFVVARANEVQTKAALEQQKTDAYKLRDDLIEYTL-RQREFESNR
A0A3N1K1G7      ----LL----LQAKQNYVIARANEDQTAAVLEAQKTDAYKLRDDLVEYTL-RQREFESNR
A0A4V2G466      ----LV----LQAKENFLAARTNQEETAAALEKEKSDAYKLRDDLVEYTI-RQREFESSR
A0A6B9YNQ8      ----LV----LQAKQTYLAALKDEQDTTAALEAEKNQAYKMRDDLVEYTI-RQREFESDR
A0A3N6A5T6      ----AI----QRARAQYQVAVDRRNRLQTALVAQKEMADQLNENSIQYNI-LQREVETNK
A0A2V8R8U7      ----VL----ASMKSRADAAEAHERSLEKAYSVQHGKTVSQTRNVIDLAI-KTQELTTDA
A0A7V9Q528      ----IL----TSLKSRYEAAKGNEDKVRQDFNRELAAADEQSRDLISMSN-LVQQLETNK
A0A2V8QMP4      ----II----AGLENRYEAAVKNERSATGSYFAARAKANDQSVADTKLAD-LDQQIATDR
A0A2V8R4S3      ----II----AGLENRYEAAIKNERSATGSYFAARAKANDQSVADTKLAD-LDQQIATDR
A0A2V8NJ55      ----II----NSLKLRYETALATEQKIKTDYEHERGAAQAQGKAALDIGG-LTQELETYR
A0A7V9ZQ50      ----II----TGLKLTFDAAYAKERKLRQDYGRSLGAAQQQGEAEIEVGS-LTQRIETNK
A0A2V8Q7I0      ----II----ARLKSEYQESYAHENSVRAMYNSQHGTATQQTRNQIEMAQ-YKQELETDK
A0A2V8S6K4      ----IV----IGMGASLDGAKKRAASLQAAYYKERSAAQAQGIQVIGLSN-VEQQLTTSK
A0A317I2L9      ----AI----QGLKAQYEAALAHEQSIKSMYNAQRGVTSQQTRAQIDMVS-YTQTLETNK
A0A2V8LLF9      ----VL----AGLKSRRDSAIAHEKSLVGAYSRQHGTTIQQTKDQIDMAI-ITQALTTDQ
A0A352FRF4      ----VL----ASMKAKSDAATTQLADLKTAYTKESGLTAQQTKNIIELAS-MRADLASDQ
A0A7W1GE99      ----IV----NSIRARYEASIDKVNKLRQEYSRELADSNQMSIAEMGMSH-LNQQLETNK
A0A1Q7YKQ8      ----VL----ATMKSKYDAAVTTENSLRASYNQQHSEFSQQTQDQIQLTM-IEQEIETNR
A0A0B6WXT1      ----VI----KAMRSRYEAALARENKLKQAYYQEAAAANEQNQAEIELSR-ITQELETNK
A0A2V8MKV0      ----IL----VSMESRYKAAEATERSLAQAYSQAHGVTAAQLDHELELAA-MTQKLTSDE
A0A2V8PYY8      ----IL----ASMESRYKAAEATEKSLAQAYSQAHGVSTAQIQHELELAA-MTQNLTSDE
A0A3B9MEU8      ----IV----TSIQRRYEAAVSRENLLKRSYEQQKGTTTQQTRDQIDLMA-ITQELETNK
A0A352F3R7      ----IV----TSIQRRYEAAVSRENLLRRSYEQQKGTTTQQTRDQIDLIA-LTQGLETDK
A0A7W0GRF6      ----IV----SSMKRRYEAAVAKENSLKRSYEQQKGTTTQQVRDQIDLIA-ITQDLETNK
A0A7W1H6G6      ----IV----SSMKRRYEAAVAKENSLKRSYEQQKGTTTQQVRDQIDLIA-ITQDLETNK
A0A7V9HZC8      ----IV----SSMKRRYEAAVAKENSLKRSYEQQKGTTTQQVRDQIDLIA-ISQELETNK
A0A7W0XCB9      ----IV----SSMKRRYEAAVAKQNSLKRSYEQQKGTTTQQVRDQIDLIA-ISQELETNK
A0A3N5YNR8      ----TI----NRVQSEYRVAVNRRQMLLGALNRQKSEANQLNQDSIQYNI-LQREVDTNR
A0A7W7ZUJ7      ----SV----SRIHNDYQTAVNREQMLQEALGEQMGIADQLNQNAIEYKV-LKQEADSNR
A0A2V2R0I6      ----IL----NGLEADYREARQHENLLMRELEDQKAQANAMAEKLVEYNI-LKREAEANK
A0A2V8XAR9      ----IV----DVLESDYREARQRESMLTQALDQQKAAANQMAEKLVEYNI-LKREAEANK
A0A2V8VZA0      ----IL----DVLESDYHEAQQRETLLTQALDQQKAETNQMAGRLVEYNI-LKREAEANK
A0A1Q7CB82      ----IL----DVLESDYHEAQQRETLLTQALDQQKAETNQMAGRLVEYNI-LKREAEANK
A0A2V8WIU1      ----IL----DVLESDYHEAQQRETLLTQALDQQKAETNQMAGRLVEYNI-LKREAEANK
A0A1Q6Y9F5      ----IL----NVLESDYHEAQQREALLTRALDQQKADTNQMAGKLVEYNI-LKREAEANK
A0A2V9EVV8      ----IL----DVLESDYHEAQQREALLTRALDQQKADTNQMAGKLVEYNI-LKREAEANK
A0A2V8YF91      ----IL----DALESDYREARQRETLLTDALDQAKAEANQMAERLVEYNI-LKREAEANK
A0A2V8XZK2      ----VL----EVLESDYREARQRETLLSEALDQAKVEANQMSEKLVEYNI-LKREAEANK
A0A2V8ZTX6      ----IL----DVLESEYREARQRETLMGQALDQAKAETNQMAEKMVEYNI-LKREAEANK
A0A2V9BT79      ----IL----EVLESDYREARQRETLLADALNEAKAETNQMAEKMVEYNI-LKREAEANK
A0A2V9YHT3      ----IG----GRLQSEYQAATQRETLLQEALNQQKREANRLNERAIQYTL-LKRDLDTNQ
A0A7C2XNI7      ----IV----DRIESEYRAARQRELLLSQALEQQKAEANALAEKLVQYNI-LKREAEANK
A0A1Q8B793      ----IV----TSIENEYRAARQRELLLLKALDQQKAEANQMAERLVQYNI-LKREAEANK
A0A2V9BCA0      ----IV----TSIENEYRAARQRELLLLKALDQQKAEANQMAERLVQYNI-LKREAEANK
A0A2V9BWU9      ----II----NRIEAEYHTARQRENLLSQALDKQKGESNAMAEKLVQFNI-LKREAEANK
A0A2V9DKX2      ----IV----NRIEAEYHTARQRETLLSQALDKQKGESNAMAEKLVQFNI-LKHEAEANK
A0A7C2YQY3      ----IG----NRIENEYQAALRREQLLRKAVEGQKAEANVMNAKLVEYSL-LKREYETNQ
A0A845TWB8      ----VA----NRIESEYQAALRKEQLLRKSLDAQKTEANILNSRLVEYSL-LKREYETNQ
A0A2U3KC61      ----MQ----HGVRDEYLAAVQRENLLTTAFNQQTQQANQLNESAIEYSV-LKRDAEANR
A0A2V9Y2R7      ----MQ----HRIRDEYLAAAQRERLLTSAFEQQKQRANLLNESAIEYSV-LKRDAESNR
A0A2V9NGH6      ----VI----ARVRSDYLASVHREEMLRAAMEKQKQEANQLNESAIEYTL-LKRDVDTNR
A0A2V9PYE6      ----VI----ARVRSDYLASVHREEMLHAAMEKQKQEANQLNESAIDYTL-LKRDVDTNR
A0A2V9NL07      ----VG----GRLRGDYLAALQRENMLRSALEEQKQQENKLNESAIEFSL-LKRDFETNR
A0A2V9QD92      ----VG----GRLRGDYLAALQRENMLRSALEEQKQQENKLNESAIEFSL-LKRDFETNR
A0A2V9WPZ6      ----MG----GRVRGQYMASLHREGLLRDALEKQKQQANKLNESAIEYSL-LKRDVETNR
A0A2V9ZLH4      ----IA----GKVRNQYLAAVQRESMLHDAMEKQKQEANKLNESAIEYSL-LKRDVETNR
A0A2V9RQF1      ----IT----SRVRSDYLASLQRENMLRDALDRQKQQANRLNESAIDYSL-LKRDVETNR
A0A2V9YDK8      ----IA----GHVRSQYMASLQRENMLRAALEKQKQEANKLNQSAIEYSF-LKRDVETSR
A0A2V9V8F7      ----MG----GRVRGQYMASLHREGLLRDALEKQKQQANKLNESAIEYSL-LKRDVETNR
A0A2V9XGR9      ----MS----GRVRGQYMASLHREGLLRDALEKQKQQANKLNESAIEYSL-LKRDVETNR
A0A2V9V3Q5      ----AV----DHLRGQYQTALQRETMLRAALEKQKQEANRLNENAIDYTL-LKRDVDSNR
A0A2V9NWS3      ----VV----ARVRSDYLAALQRETMLRGALTKQKQEANKLNESAIEFTL-LKRDVETNR
A0A2V9USA9      ----IA----SKVRGQYMTALQRENMLRDALEKQKQEANKLNESAIQYNI-LKRDSESYR
A0A2V9XW18      ----IV----AKVRGQYNAALQRENMLHTALDKQKQEANKLNESAIEYTL-LKRDVDTNR
A0A1H5SQF5      ----VG----NQAARNLDLARKTEDGLLQSVDREKLRLGHMTTSADQLLL-LEQEETSNR
A0A2V8G155      ----VV----DSVKTDYLAAVAQERSLTAALEQQKTEALVMNRKAIEYGV-LERDAKSSR
A0A2V8HDM7      ----VV----DSVKTDYLAAVAQERSLTAALEQQKTEALVMNRKAIEYGV-LERDAKSSR
A0A2V8IVN9      ----VV----QSVKNEYLGSLAKENSFIAALNQQKGEALTMNRKAIDYGV-LDRDVQSSK
A0A7W1SCW7      ----VV----QSVRNEYQAALAQENSLIAALNQQKAEAQVMNRKAIDYSV-LERDVESSR
A0A3E0NV31      ----AA----DAVLQQYRAAQRRADSFAAQIRAERRSSDRESEAAVQLEI-LERKTQTNK
A0A3N5M5V0      ----TI----RRAQSEYKVAVNRQQMLRRALQKQKAEANQLNQDSIQYNI-LQREVDTNR
A0A7X7XDY5      ----AM----KAIITEYETAAKREKLLQEALDEQKIQANLLKESLIQYNI-LQREVETNK
A0A2V9L5B5      ----VV----DNIVDEYRSATAKEQYFAQAVDDQKREVNEIAARSIQYNI-LKREVDSNR
A0A2V9LK56      ----LV----QNLVDAYSSAVNREKYLEQALKGQEKQVNDIAEKTIQYNI-LKREADSNK
A0A2V9L7I0      ----VT----ENIVDEYRSAAAKEKYFAQAVEDQKREVNRIADKSIQFNI-LKREVDTNK
A0A522PPT0      ----LT----QNIAQQYDAAVVREKYLNSLVSQQESLVDVVSQKTIQYNI-LKREVDTNR
A0A7C5V1G5      ----LT----KNIAQEYQAAEARERYLNDLIKKQEKLVDVVSQKTIQYNI-LKRDVETNQ
A0A4R1LC91      ----VA----ERAQNDYLVAQGVENSTQKVFDEEKKQADAMNDKSIEYAI-ARQEADQSR
A0A2V9QB26      ----IV----DRIRNDYKTALRREKLLSAAYRNQSRLVTDQDEKSIQYGI-LKREVDSNR
A0A2V9VYY4      ----LQ----QKMRDDYLAALQRENLLDSAFNKQKQEANKLNESAIEYTV-LKRDAETNR
A0A2V9KIE8      ----LV----ENIVEEYHAAESNEKLLAQAVVQQKAEVNDIAQKTIQYNI-LKREADTNK
A0A7C2GJ20      ----IL----ANIEAEYKAAVRRERDLRAALEQQRAETLRQNERAIELSL-RKREVEVTT
A0A7C4BTL5      ----IV----NRIRNEFEEAAQRERMLARDYAEQTRVVTAEAERSIQYNI-LKREVETNR
A0A7X8YVF2      ----AI----ANARAEYETALDTENRLARAFDGQKKLADQMSEAGIHYNI-LKREAETNK
A0A7X7YEP0      ----AR----EQARAEYQTAQRREQSLQAELARQKAEAMKVNAEAVEYNN-LLVEVSTRR
A0A2V9CBM2      ----AA----DQITNEYFAASSRESLLRHELAEQQKQIDRIAEKSVQYNI-LKREVDTNK
A0A2V8XN17      ----AA----DRIANDYSAAVRRENLVQQALDNQQKQVSLIAEKSVQYNI-LKREVDTNK
A0A2V8WX45      ----AA----DRIANDYSAAVRRENLVQQALGEQQEQVSLIAEKSVQYNI-LKREVDTNK
A0A1Q6YR79      ----AA----DRIANDYSAAVRREDLVHQAVDGQQKQVSLIAEKSVQYNI-LKREVDTNK
A0A1Q7VA32      ----AA----DRIANDYSAAVRREDLVHQAVDGQQKQVSLIAEKSVQYNI-LKREVDTNK
A0A2V9EY85      ----AA----DRIANDYSAAVRREDLVHQAVDGQLKQVNLIAEKSVQYNI-LKREVDTNK
A0A2V9H8K0      ----AT----DRIVNDYSAAVRRENLVQQALNDQQKQINLIAEKSVQYNI-LKREADTNK
A0A2V9FFE5      ----AA----DRMVNDYSAAVRRENLVQQALDDQQKQVNLIAEKSVQYNI-LKREVDTNK
A0A2V9GM43      ----AA----DRMVNDYSAAVRRENLVQQALDDQQKQVNLIAEKSVQYNI-LKREVDTNK
A0A2V8ZHL8      ----IV----ERLRNDYMAALGREKLLAAAVAKEKADVGALSQLLIQHNL-LKREFDSNQ
A0A2V9B240      ----VV----ERLRNDYEAALGREKLLAAAVAKEKVGVGALSQLLIQHNL-LKREFDTNQ
A0A2V9CYQ5      ----AA----DQITNQYLAASSRESLLRHELAEQQKQIDLIAEKSVQYNI-RKREVDANK
A0A2V9BWU8      ----AA----DKITNEYSAAVRREELVKQALDDQQKQVNVIAEKAVQYNI-LKREVETNR
A0A2V8ZG48      ----VA----DKIVNEYLAAVRRESLVKQALDEQQKQVNLIAEKAVQYNI-LKREVDTNR
A0A2V8Y334      ----AA----DKITNEYFAALRRESLVKEALDGQQKQVNLIAEKAVQYNI-LKREVETNK
A0A2V9AY68      ----AA----DKITNEYFAALRREGLVKGALDTQQNQVNVIAEKAVQYNI-LKREVETNK
A0A1F2RFI7      ----FA----KRVTDDYRAALNRKRLLDQAVEQQTKEINQIAEKSIPYNI-LKREADTNK
A0A1F2RZS3      ----FA----QRVANDYKAAANRKRLLDQAVAQQTSDFNAMAEKSIQYNI-LKREADTNK
A0A845TW47      ----AA----ERVKNEYAAAVRREALVRQAWEQQQHA---VAERTVQYTI-LRREVGANR
A0A845TXC1      ----TA----ERITNEYIAAEKREGFVRAAFEQQEKQANQIAERSVQYNI-LKREADTNK
A0A1F2USE2      ----AA----ERIRKEYGAAQQRQEFLRQAFQKQEEQANLIAEKSVQYSI-LQREVETNQ
A0A7C2VB08      ----MA----ERVGNEYRAALAREQMLVRAFAEQQQRRNQVAERSVQYNI-LKREVETNR
A0A2V9C238      ----VA----GRITNDYLAAVRRENLVAQAFAEQQKQANLIAGRSVQYNI-LKREVETNQ
A0A1F2Q9F5      ----AA----ERLANDYQAAMRRETLLRRAFADQQAQAGRVAEKSVQYNI-LKREVDTNK
A0A1F2QQH9      ----AA----ERLANDYQAAMRRETLLRRAFADQQAQAGRVAEKSVQYNI-LKREVDTNK
A0A1F2QXK7      ----AA----ERLANDYQAAMRRETLLRRAFADQQAQAGRVAEKSVQYNI-LKREVDTNK
A0A2V9DEM9      ----VA----GRIINDYLAAVRRENLVAQAFAEQQKQANLIAGRSVQYNI-LKREVETNQ
                                                                            

A0A2V7VMF7      SLYDVLLQKLNESD--------------IAA---SIRTNNA----SVVERAS--PPLA--
A0A2V7YYV7      ---------------------------------------------VPVSPAV--VPDR--
A0A2V7Z0J5      ---------------------------------------------VVLSPAV--LPKN--
A0A2V7Z3M4      ---------------------------------------------VVLSPAV--LPSK--
A0A399Y5V2      ALVATLTNRREQAAAVQSFWKTALDKLQIQS---NLQTSSA----ETVAPAT--LPTA--
Q01X01          EFYDAMARRANEAS--------------VAS---TLRQSNV----RLVDPAQ--PATH--
A0A3M2D9H8      -IYANLLSNYEAIR--------------LAR---LQSTPEV----VQVEEAR--VPSR--
A0A2V9IXG5      SAFAAVEQKLRDLS--------------LQE---GFVTSNI----KVVEHAG-----AGY
A0A2V9J2P4      SAFAAVEQKLRDLS--------------LQE---GFVTSNI----KVVEHAG-----AGY
A0A831T3F4      ALYTDFLDKTNQAN--------------VQV---AEQHSNI----RVIESAQ--VPTV--
A0A2V8JK38      DIYNGLLTRLKEAG--------------ISG---GLRASNI----RVVDQAE--VPKG--
A0A7W0JWI4      GLLNGLLQRYKEND--------------VVL---AGLRKNI----HVIDYAV--TPNQ--
A0A1Q7RLS4      RIYDLISARVKEID--------------LSS---SLLSNNL----RILDKAP--VPKV--
A0A257VBK0      KYMDLLYDKMSELN--------------VSS---SLMSS---NV-RMVEPAQ--PPMA--
A0A7C5TWV7      TFYEQMLQRSKETD--------------ISA---SAALN---NV-RVIDPAE--PPKH--
A0A2V7XDY0      GLYDVLLQKLNETD--------------IAA---SIRSN---NV-SVVERAS--APTS--
A0A2G6PYV5      QNSLVIDKRKEYLE--------------LAL---GLKEIGRTDK-VIVEHAR--LPHS--
A0A1F2TCR2      KMYDTLLQEQKSLQ--------------VIS---NSRSN---NV-QLMDRAE--VPAA--
A0A7Y9PHF8      HLYNELFRKVQEAG--------------ING---GYQGN---AI-RIADEAR--PQLH--
A0A7W8J3G9      DLYDALERGLQQAG--------------ISA---GLSAV---NS-MLVDRAR--APYV--
A0A1F2V330      TRYNALLAKQQEAG--------------LAS---RPERMNKTVAFRIVEPAS--LPKG--
A0A662EE63      RFLDDMLARSNEAD--------------LSA---TAWMN---NI-RVIEKAT--PPSG--
A0A2V8TLH7      RIYDLISARVKEID--------------LSA---SLLSN---NL-RVLDRAP--LPQM--
A0A1Q7ZJT1      RIYDLISARVKEID--------------LSS---SLLSN---NL-RILDKAP--VPKV--
A0A2V8VC99      RIYDLISIRVKEID--------------LSS---SLMSN---NL-SILDKAP--VPKV--
Q01XL7          QVYNGLLQQANQAA--------------LIA---LVPAS---NI-RVVDAAV--ADNI--
A0A523DUV7      SLYEAILQKIKETD--------------VAS---SLREN---NV-SIVERAS--ISAV--
A0A7W1TTH3      ALLSNLTTEMQQTK--------------VAY---NSTEN---NV-RTMDRAE--VPVA--
A0A1F2U158      TVYESLLQRENELR--------------VSS---NSRAN---NV-RVVERAE--VPAG--
A0A2V8F6S9      TIYDTLLARQKELT--------------VSS---NSRQN---NV-RVIDHAE--LPRG--
A0A7V0UHS9      SQLHALLDKQLDAS--------------ISE---GLGKSKSGVAFAVVEPAS--VPSH--
A0A7D8BEX2      TLYEGLVQRLEEAS--------------VDS---GLQSA---QI-DVVDLGV--PPSR--
A0A4Q1SCH5      DLYDTLQYKIQQAS--------------VNA---GLDSI---NT-MIVDRAR--LQRF--
A0A7V4SJP8      KYMDLLYDKMKELN--------------VSS---ALLSS---NV-RLVNAAL--PPTA--
A0A372IRG7      ELYDALQMKLKEAG--------------ITA---GLNSN---NI-DVIDTAM--IPPY--
A0A2V8K4L4      QLYESMLSKVKESS--------------IAS---AMRAS---NF-RIVDLAK--PAGA--
A0A2V8NCZ3      QLYESMLARVKESS--------------IAS---AMRAS---NF-RIVDLAK--PANL--
A0A4Q7YNP3      QLYQTLLQRAKEAG--------------FAS---AMQAS---TV-RLVDAAH--KPKM--
E8UZE1          ALYQDLTRKLQEAQ--------------ITS---GLSSD---TI-SVIDPAL--TPNI--
A0A2V7YW66      DLLNELMHKQSETE--------------VAV---RLQDTRQSNI-RIIDKAL--VPGG--
A0A2V7Z0V0      DLLDELMRKQSETE--------------VAV---RLQDTRQSNI-RIIDKAT--VPGG--
A0A2V9M454      QLYDNLLQHLKDGN--------------VSA---GLRAT---NI-RIIDEAT--IPSF--
A0A2V9J4D6      QLYDNLLQRLKDAT--------------VTA---GLRAT---NI-HVVDKAV--PPAT--
A0A2V9L9C5      QLYDNLLQRLKDAT--------------VTA---GLRAT---NI-HVVDKAV--PPAT--
A0A2N9M9N1      QLYDELLKRLKDAT--------------VSV---SLRAT---SV-RLADAAL--VPAT--
A0A2V9JEC4      QLYNDLLRRLKDAT--------------LSV---SLRAA---SV-RVADRAR--VPAV--
A0A2V9LPQ3      QLYDDLLQRLKDAT--------------VSA---GLRAT---NI-HIVDTAS--PPAV--
A0A7Y8IYX6      QLYQGLLQRLNETG--------------VSP---GLEFE---NI-RIVDRAQ--PGRV--
A0A2V9IVR7      QLYEGLLQRLKDAT--------------LSS-------------------------GA--
A0A2V9ILE2      QLYEGLLQRLKDAT--------------LSS---GLRAT---NI-HIVDQAR--VPGA--
A0A2V9LGY4      QLYEGLLQRLKDAT--------------LSS---GLRAT---NI-HIVDQAR--VPGA--
A0A7T9JJ28      KNFEDLQQRLRQAE--------------VES---DYRPS---NI-RIVQAAE--VPIA--
A0A7T9GE94      QMLERLMQSQQGVE--------------LSG---AGLLK--NNI-RIAEMSS--MPRS--
A0A7Y4X7L5      NMLNTLQARQAEVE--------------VSA---AALVT--TNM-FVRNYAP--QP-A--
G8P0Y7          QIYDGLLQQLKEAS--------------LAA---GLTSS---NT-RVVDRAR--LPRY--
A0A2W4RYA1      QLYDSLLQRAQETG--------------VSG---ELRTS---GI-RIVDPAV--LPRT--
A0A2V8EXP2      QIFESLLQRTKETG--------------ISG---ELKTS---NI-RVIDVAE--TPRR--
A0A843SYC7      QLYDSLLQRAKETG--------------VST---ELKTS---NI-RVVDRAE--RPLN--
A0A7V9BJ09      EVYESLLQQTKETG--------------ITG---ERRAT---NV-RVIDPAE--VPRG--
A0A7W1DT80      EVYESLLNQTKETG--------------ITG---ERRAT---NV-RVIDPAE--LPRG--
A0A5M8T4U7      DLYDTLQMRLKEAS--------------VTA---GLSAT---NI-SVVDPAQ--VPII--
A0A7L5A491      TLYNELFRKVKEAG--------------MNG---SFQGS---AS-RIADEAR--PQIH--
A0A7D8BF18      TLYDNLSQRLRTAG--------------VQA---GLEST---EI-DIVDVAM--PPIG--
A0A1E3Y9R6      QLYENLLARAKETG--------------AAG---EYRGT---AI-QVLDPAT--VPSA--
A0A2W4TLP2      QLYENLMARAKETG--------------AAA---DYRGT---SI-QVLDRAE--VPRV--
A0A7G8BDY8      DLYEDLLKKLKEAG--------------VVA---SLKAA---TI-DVIDPAT--LPTR--
A0A7C4BZ42      SMYESMLQKVKEAG--------------IAS---AMRAS---TY-RVVDAAQ--APSA--
A0A3R9WF43      ALYQNLFSKLQEAS--------------LSS---GVRAT---RI-DVVNEAR--PAGT--
A0A317HKM4      EVLDKLLQRSTEAR--------------LAR---ELEST---NI-RIVDSAE--IPTV--
A0A2V9CG11      QLYEAMLERVKQAE--------------LAT---AMRAS---NV-LVIDHAE--VPRL--
A0A523E0N1      QILKRLLRRRSETA--------------ITA---ELGEKQPVRV-KFIERAE--APTV--
A0A1V6HR88      QLLDEMLRKQSETD--------------VSS---RLQATRESNV-RIVDRAL--VPGG--
A0A4Q1SDL1      GLYEDLLRKLKEAG--------------VLE---GLKAS---DI-TVVDPGR--VPAK--
A0A841JWG5      NLYEDLLRKLKEAG--------------VLQ---GLKAS---DI-TVVDPGR--VPAK--
A0A4R1LAZ7      DLYDALQIKLKEAG--------------IMA---GLNSN---NI-DVIDRAS--IPAL--
A0A7G8BMP1      DLYDALQTKLKEAG--------------ITA---GLNSN---NI-DVVDRAA--EPAR--
A0A7X7ZKA6      TLLDSLLRRESETG--------------VEA---RLKGLRTSNI-RVVDRAR--VPVR--
A0A523ECP2      SMLRQLLRRQSETG--------------LSA---ELFEREPVNV-RIVEAAL--VPKV--
A0A2W0C122      QLYDNLEERMKEAG--------------VAA---GLRST---NV-RLIDPAE--ATEL--
A0A2W0AUU7      QLYDTLEERMKEAG--------------VTA---GLRST---NI-RLIDPAG--ATGL--
A0A2W0BQL1      QLYDTLEERMKEAG--------------VTA---GLRST---NI-RLIDPAG--ATGL--
A0A2V8ERZ5      EVYQSLLTREKELR--------------VSA---NSRTN---NV-RLVDRAE--TPRG--
A0A7W8J413      TLYENLFSKLQTAS--------------LAS---GVRAT---RI-DIADQAR--PAGT--
A0A7W8JCF5      ALYESLFSKLQTAN--------------LAS---GVRAT---RI-DIADQAR--PAGT--
A0A7W8IEB1      ALYESLFSKLQTAN--------------LAS---GVRAT---RI-DIADQAR--PAGT--
A0A7Y9T3I1      TLYENLFSKLQTAS--------------LAS---GVRAT---RI-DIADQAR--PAGT--
A0A3P0XH15      DLYDALQTRLKEAG--------------ITA---GLNAT---QI-DIVDRAV--TPAL--
A0A3E0P0A3      ETLDRLRRSQSQAN--------------ISA---SSGNQ---AIVTQTERAV--LPTS--
A0A3M1WQW8      ELYRSLLQKMNDVD--------------LLS---TLTTT---NI-QILDRAQ--VPTT--
A0A841JVA9      QLYQTLLQRAKEAG--------------FAS---AMQAS---TI-RVIDEAR--PPRI--
A0A3N1JHC1      QVYQSMLQKAKEAG--------------VIA---ALRAA---NA-RVVSPAK--ASLI--
A0A7V4XQR5      ELYDALQLRLEEAG--------------ITA---GLNSN---SL-EVVDKAN--LPVI--
C1F294          ELYDALQLRLEEAG--------------ITA---GLNSN---SL-EVVDHAN--LPVI--
A0A2V9KA79      TQYQSLLDKQQQAT--------------LAS---KRGKVETNVLWRIADPAR--LPSA--
A0A348UZU3      NLLESLLKRQSETG--------------VSA---RLKGLRTSNI-RIVDRAD--IPLR--
A0A7X9FXC4      SLLESLLKRQSETG--------------VSA---RLRGLRTSNI-RVIDRAD--LPIN--
A0A7X7ZKL5      TLLSTLVAKQNEIQ--------------VSS---QLGGLRTSNI-KVVDHAL--VPPG--
A0A522PSP1      LVYDDLLERLDAAD--------------VSA---GYHST---AL-RIIDPAR--PNSA--
A0A7W8E8D3      ELYNTLQYKLQQAG--------------VDA---GLQSV---NT-MRVDTAR--APLI--
G8P085          ELYNTLQYKLQQAG--------------VDA---GLQSV---NT-MRVDTAR--APLI--
A0A843SRW6      QIFETLLQRARETG--------------ISG---GLATT--SNI-QVVDSAN--IPRA--
A0A7W8E330      TLYEDLLKKLKETG--------------VLK---GLKGG---DL-SIVDPAR--VPAN--
A0A4Q1SGQ1      NVYEGLLAKLKQAG--------------VLE---GLRST---NL-TVVAPAQVPPTHR--
A0A7V2HGP7      RLYEQLVQRIKEGG--------------INA---GFQNN---LV-RLADPAR--PNPV--
A0A7R8B6H7      EALSAMLQQQRQTG--------------ILA---VLPTN---NI-RIVDAAS--APLI--
A0A2V8GTX0      QVYESLLQREKELR--------------VVS---NSRAN---NV-RLLDRSE--VPES--
Q1ILD9          DIYDDLLRKLREAG--------------VMA---SLKAA---NI-DVVDAAP--VPIK--
A0A7G8BJH7      DVYEGLLAKLKQAG--------------VLE---GLRST---NI-TVVNPARVPPPNR--
A0A2V8J0X9      QVYQSLLSQQKELA--------------VVA---NSRAN---NV-QVLDRAD--VPPF--
A0A7Y5WWH8      QVYQSLLSQQKELA--------------VVA---NSRAN---NV-QVLDRAD--VPTL--
A0A7C5SHM3      ANLERLLARREEVA--------------RSS---DLREILERQV-AIIGPAT--VPES--
A0A7V6D154      QLYDELMRRIKEAT--------------INA---SFQNA---AV-RIADPAR--PANR--
A0A7V1XXZ2      ELYDSLLRRSKEAA--------------VVA---SLRSG---NI-RTVDSAR--VPQV--
Q1IJZ6          QLYETLYGRLEVSK--------------LDE---GIKST---NV-AVISAGL--PPAK--
A0A2V8TCE6      AVLNALLQRQNETA--------------VSS---QLRDMNAGNA-RIVDRAI--PPTA--
A0A522TBE8      KLYYDLLQRIAESK--------------LAA---GFHTT---NA-RVVSPAR--PDFR--
Q1ITG0          SLYEDLLRKLNEAG--------------IAA---GLKST---NV-DVIDPSA--VPQL--
A0A7C2ML20      KLFQMLSERLREAG--------------LMR---SLTPN--TNI-RIIDRAE--VPLL--
A0A7T9HIZ6      ALLDDLLRQQSSTD--------------VTS---RLQATRESNV-RVVDRAL--VPGG--
A0A7C5AXS9      SLYEAMLQRVKEYG--------------IAS---AMQAS---NV-RVVDKAK--PPHF--
A0A7C2RGE3      QLYEGLLEKLNDVK--------------LLS---TLTTT---NI-QILDKAE--VPLR--
A0A7V6D075      ALYEELIRKIREAG--------------INA---SFQNS---SI-RIADVAR--PPVE--
A0A3N5PCI5      QIYQNLLQRSNETA--------------VSK---DIQGP---DI-QVVDAAE--VPRR--
A0A3M1Q0S9      ATLRELLDRKNQMT--------------LSA---SLAEDRALNI-RVIEKAT--PPRM--
A0A2Z5G448      DLYDALQMKLKEAS--------------VTA---GLNSN---NV-NLVDKAE--VPAF--
A0A3M1VZ38      ATLNELIAKENEME--------------QSA---NLGDT-AHNV-QIIDEAV--PPEI--
A0A4Q1SD29      ELYDALQMRLKEAG--------------ITA---GLSAT---NI-DVIDRAN--IPPF--
A0A833M5K2      QLLDELLRRQSETD--------------VTS---RLQATRESNV-RVVDKAL--VPGA--
A0A1F2Q9L4      TLLDELVRKQSETE--------------VAS---RLQGTHDSNI-VVVDRAL--VPGG--
A0A7V5ZKV2      ALLDDLLRKQSETE--------------VAS---RLQGTRDSNV-MVVDRAL--VPGG--
A0A7Y8LRQ1      ALLDDLLRKQSETE--------------VAS---RLQGTRDSNV-MIVDRAL--VPGG--
A0A3M1PY35      QVLDRLLARREEIG--------------IAK---DLRSILERQV-SVVAPAT--PPER--
A0A3M1VMP2      EALDRLLARREEVA--------------VTR---DLQSILERQV-HVVDRAK--PPKS--
A0A1F2T595      QMFEALLKRTQETG--------------VTEE---LRTGNI----RVVDPAE--MPTG--
A0A2V9AC41      QLYDGVLQRLKEIG--------------VAAE---IRSSNI----YLMGKAE--PPGG--
A0A2V2R525      ELLNGLWQRYKEND--------------VILA---GTPNNI----RVADYAN--TPER--
A0A321LPW6      SLYTEFLQKTNQAN--------------LELA---QQSSAL----HVIEPAE--VPTF--
A0A2V9R9V4      SLYTEFLQKTNQAY--------------LEVA---QQQSNI----RIISPAR--VPKE--
A0A321LE75      TLYTDFLQKQSQAR--------------VQVA---EQHNNM----RVIEPAQ--PPGG--
G2LEI9          KMLQALQATTKDTE--------------INLR---MDLNNI----TVVDRAG--TPGA--
A0A7V9TW03      GLLAGLMQRSKEND--------------VT---MAGTPNNI----HVVDYAA--IPKV--
A0A3N5XQP8      QLYEGLLARLKQAG--------------VE---AGFRSNNI----QIVDRAR--TPLN--
A0A2V9KCS3      QLYDSMLQRVKEYG--------------IA---SAMHASNM----RVVDPAK--APRL--
A0A7W1JC10      SLLNGLLQRANENV--------------IAIAGLTGTPNNI----HVLDYAL--VPGN--
A0A3M2BZG9      RLFNDLLKKQSEAE--------------VASSFHDAKESNV----RVVDYAI--VPSA--
A0A1Q7N5R7      NLFTSVQQRYSEAR--------------LA--EASSTAD-V----RVLDAAV--APRR--
A0A352F549      GLLAGLMQRSKEND--------------VT--MA-GTPNNI----HVVDYAA--IPKG--
A0A3B9MLP9      GLLEGLMQRSKEND--------------VT--MA-GTPNNI----HVVDYAA--VPKG--
A0A3D5SQ87      GLLEGLMQRSKEND--------------VT--MA-GTPNNI----HVVDYAA--VPKG--
A0A7Y2DUG3      RLLDTYIQRHKEQE--------------LL--INQTTPDNI----KVSSKAV--VPSG--
A0A7Y2D8Q4      ALLDTYLQRQKEQE--------------LA--LNTSRPDNI----KISAEAQ--TPVL--
A0A2V8NW86      GIYEAMLQRVKEAN--------------IA---SAVRATNV----RIIDAAE--PPKR--
A0A3M2D491      ELLNTYIQRQKELE--------------LA--ISSSRPDNI----SIATEAT--KPDA--
A0A7W1CBZ8      GLLDTYIQRQKELE--------------LT--ISSSRPDNI----SISSRAQ--TPTI--
A0A7W1FC90      GLLDTYIQRQKELE--------------LT--ISSSTPDNI----LISSRAQ--TPVE--
A0A7W1ZXG0      GLLDTYIQRQKELE--------------LT--ISSSTPDNI----LISSRAQ--TPME--
A0A7W1ZIT3      GLLDTYIQRQKELE--------------LT--ISSSTPDNI----LISSRAQ--TPVE--
A0A353C9L6      NLLDTYTQRLKEKE--------------LE--VESGAPDNI----KIAANA---GGAY--
A0A2V8RQV0      NLLDTYTQRLKEQE--------------LS--RANDAPENI----KIAANA---GPAI--
A0A2V8SJH5      NLLDTYTQRQKEQE--------------LA--IASGRPENI----KIAANAV--TPGG--
A0A136JPP4      GLLDTYTQRQKEQE--------------LA--LASGKPNNI----KISERAE--APTY--
A0A399WUJ8      GLLDTYTQRQKEQE--------------LS--LAAGKPNNI----KISNRAV--VPTS--
A0A7V9C3X9      NLLDIYTQRLKEQE--------------LT--IANSSPDNI----KIAARAV--TPGG--
A0A7V9ZSX9      SLLDNYTQRQKEQE--------------LA--ISGSRPDNI----KVTAHAI--TPTS--
A0A3M1SIV3      SLLNTYVQRQKELE--------------SA--ISSSRPDNV----AVSTKAS--KPDS--
A0A7V1SCI4      SLLNTYIQRQKELE--------------SA--ISSSRPDNV----AVSTKAS--KPES--
A0A7C5ZUA8      NLLDTYTQRKKEQE--------------LA--IANTQPDNI----KIPAPAE--VPTV--
A0A7T9FQE4      SLLDTYVQRQKEQE--------------LA--IASGRPNNI----KIQSNAV--TPTA--
A0A3E0PHB0      GILDRLLQREREME--------------LS--INTSAPDNI----KVSGKAQ--V--N--
A0A7T9G4W3      GILDRLLQREREME--------------LS--IDASAPDNI----KVTGNAQ--A--N--
A0A838UAA0      GLLDTYTQRQKEQE--------------LA--ISGGRPNNI----KISNRAM--EPGG--
A0A7W1HTU2      TLLDAYIQSQKQQE--------------LA--ITSSKPDNL----KISNYAQ--TPLA--
A0A357F267      NLLDTYTQRQKEAE--------------LA--IASGRPDNI----KIAARAI--TPKS--
A0A7V9ICU8      NLLDTYTQRLKEQE--------------LA--IESGRPDNI----KIAANAV--VPST--
A0A7T9JEF9      SLLDNLLQKSRETE--------------VILN---GTPNNV----NVVDRAA--PPSS--
A0A399WNU1      SLLNSLLQKARETE--------------VVLN---GTPNNV----HVVDRAL--VPGA--
A0A3E0PCN7      TLLDSLLQRARETE--------------VILN---GTPNNV----NLVDRAQ--PPSA--
A0A7Y4TLV3      ALLTSLLQRSRETE--------------VILN---RTPNNV----HVADRAL--VPDS--
A0A7W0MGQ3      NLLNGLLQRSAENN--------------MLAA---GTPNNI----HIIDYSL--VPEL--
A0A1Q7Y6W9      QLLDGLLQQERTND--------------VVGE---GTPNNI----HIVDYAL--VPDG--
A0A2V8NC68      SLLDGLLQRAKEND--------------VVLA---GTPNNI----HVLDYSP--QPKV--
A0A352FLX4      TLLDGLLQRTKEND--------------VVMA---GTPNNI----RVVDYAI--AGKK--
A0A2V8MHG6      SLLDGLLQRSKENE--------------VILA---GTPNNV----HVVDHAA--IPKT--
A0A2V8P7N1      SLLDGLLQRSKENE--------------VILA---GTPNNV----HVVDHAA--IPKN--
A0A2V8M3M6      SLLDGLLQRSKENE--------------VILA---GTPNNV----HVVDHAA--IPKN--
A0A1Q7NJH5      SLLDGLLQRSKENE--------------VILA---GTPNNV----HVVDHAA--IPKT--
A0A2V8PJY0      SLLDGLLQRSKENE--------------VILA---GTPNNV----HVVDHAA--IPKT--
A0A7W1BYD3      TLLSGLLQRANENV--------------IAMAGLTGTPNNI----HVLDYAL--VPGG--
A0A838PIP9      NLLSGLLQRANENV--------------IAIAGLTGTPNNI----HVLDYAL--VPGG--
A0A399WK13      GFLENLRKQVSSND--------------VAAQ---GSDNNI----TVTEPAV--PSNI--
A0A7V8YZQ7      KFLDDLRKQQSSND--------------VASQ---GSDNNI----SVAGFAI--PNAI--
A0A7V9ICV8      GFLDNLRKQQSSND--------------VASQ---GSDNNI----SVAAFAI--PPDA--
A0A136KC10      GFLENLQKQVSSND--------------VAAQ---GSDNNI----SVTEPAV--PSNI--
A0A7W1IVA5      GFLKELTAQQSGND--------------VIAR---GTGNNI----SIAEIAI--PPEQ--
A0A7W1ZIE3      GFLKELTAQQSGND--------------VIAR---GTGNNI----SIAEIAI--PPEQ--
A0A7T9J551      GFLDNLRKQVSGND--------------VAAQ---GSDNNI----SVIEIAI--PSET--
A0A7V9NLN0      GFLENISKSQREND--------------VKAV---GTDNNI----SIAEIAI--PPKN--
A0A7T9G8R2      GFYKNLENQQKGND--------------LAGA---GTENNI----SVAEIAI--PPDR--
A0A7Y2D047      GFLENLTKKQKEND--------------VVAA---GTKNNI----SIAEIAI--PPER--
A0A3M2D6Y5      GFLKNLIEQQSSND--------------VIAR---GTENNI----SVVDPAI--PPDT--
A0A2V8SEX6      GFLDNIRKQQSSND--------------VASQ---GSDNNI----SVAGFAI--PPEH--
A0A7C5ZUU4      GFLDNLRKQQSGND--------------IASQ---GSDNNI----SIADYAI--PNET--
A0A3E0PCJ6      GFYANLENQQKGND--------------LAGA---GTENNI----SVAEIAI--PPER--
A0A2V8RTL7      GFLDNLRKQQSGND--------------VASQ---GSDNNI----SVASFGI--PPEA--
A0A3M1S4R8      GFLKNLIEQQSSND--------------VVAQ---GTTNNI----SVVDLAI--PPDT--
A0A7V1SAJ0      GFLKNLIEQQSSND--------------VVAQ---GTTNNI----SVVDLAI--PPDT--
A0A7W0N726      GFLENITKSQREND--------------VKAI---GTDNNI----SVAEIAI--PPKN--
A0A7W1HTZ7      GFLENLIKQQREND--------------VIAV---GTDNNI----SVAEIAI--PPEI--
A0A1Q7YFI6      QLLDGLLQTAKGND--------------VVMS---GTPNNV----HVLDYAP--IPKS--
A0A7V9C9Y7      NLLNGLLQRSKEND--------------VILA---GTPNNI----LVVDYGL--APDA--
A0A7W1G8A4      TLLDGLLQRSKEND--------------VILA---GTPNNI----YVLDYAL--VPDV--
A0A7V9KMZ1      SLLTNLLQSSKEND--------------VVMA---GKPNNI----SIIDYAI--APDS--
A0A7W0JTE4      SLLTNLLQNSKEND--------------VVMA---GKPNNI----SIVDYAI--APDR--
A0A0B6WWQ6      SLLDNLLQRAKENG--------------MAMA---GVANNI----HIVEYAF--PPNR--
A0A3B9MK99      TLLDSLLQRSKEND--------------VIMA---SKPNNI----SIVDYAV--TPDG--
A0A838PA20      SLLANLLQRSKEND--------------VVMA---GKPNNI----SIIDYAI--APDG--
A0A352EX26      TLLDSLLQRSKEND--------------VIMA---SKPNNI----SVVDYAI--TPAG--
A0A7V9R410      TLLDSLLQRSKEND--------------VIMA---SKPNNI----SVVDYAV--TPGG--
A0A2V8MM59      GLLDSLLQRSKEND--------------VVLA---GRPNNI----SIVDYAI--QPDG--
A0A2V8PFE8      GLLDNLLQRSKEND--------------VVLA---GRPNNI----SIVDYAI--TPDF--
A0A2V8PWS6      GLLDNLLQRSKEND--------------VVLA---GRPNNI----SVVDYAI--TPDF--
A0A2V8LCT5      GLLDNLLQRSKEND--------------VVLA---GRPNNI----SVVDYAI--VPDF--
A0A352FTJ9      GLLDNLLQRSKEND--------------VVLA---GRPNNI----SVVDYAI--VPDF--
A0A1F2S1W5      QMFEALLKRTQETG--------------VSE---ELKTGNI----RVVDLAE--NPTG--
A0A2N9LQU7      ELSDTLQLKLKEAG--------------LMA---GLASADI----SIVSRGM--VAAR--
A0A2P6WFK7      DLYDTLQLKLKMAG--------------VTA---GLSSGYI----SIIDRAE--IPAT--
A0A2V8JQV5      QLYEAMLQKVKEYN--------------IAS---AVTANNV----NIVDPAR--PPGG--
A0A2V8U914      QFYEAMLQKVNEAG--------------LAS---AVRQSNI----RLVAPAE--PAFR--
A0A2V8DRT9      QIFESLLQRTKETG--------------ISG---ELKVSNI----RIVDAAE--LPQV--
A0A2V7VYF3      QMFEALLQRTKETG--------------LSE---ELRATNV----RIVDAAE--VPRS--
A0A1F2SVH2      QIFESLMQRTKETG--------------ISG---ELKTSNI----RVVDAAE--TPRG--
A0A2V8AJG9      QVFESLLQRAKETG--------------VST---ELKTSNI----RVVDAAE--VPRR--
A0A2V9MAM9      QFYEAMLQKVNDAG--------------VAT---AIRPSNI----RVVGPAQ--PALQ--
A0A2V8F956      QIFDSLMQRAKETG--------------VSA---ELKTSNI----RVVDRAQ--TPTE--
A0A2V7W309      TLLAALQKQLNETQ--------------VTARLRGSASSNV----HWVDHAE--TPGS--
A0A348V070      ALLEALSKRQSETD--------------LASRLKDLQALNV----WIVDRAS--PPVN--
A0A2Z5G3A3      TLYVSLLGRLKEAG--------------LLE---GLRSTNV----SVVDPGR--SPAK--
A0A2V7UGP8      EILNKLMQRETETG--------------SLSQLKNAGTGNV----WVVDAAE--IPDR--
A0A239MKT6      GLYQDLYTRLQEAS--------------ISA---GVRSTDM----VIVDPAR--PPSL--
A0A2Z5G7H4      GLYEDLLKRLKEAG--------------VLE---GLRSSNI----TVVDPGR--IPST--
A0A372IT17      RLYDQLFGKLKQAG--------------VLE---GLHTSSF----SIVNPAR--IPPGNH
A0A841JU67      GVYQGLLTKLKEAG--------------VLE---GLHSTNL----TIVSPGR--IPPTHR
A0A7T9GJJ6      SLYNDFLQKTNQAN--------------IQR---AEQYNDM----RIIDPAR--VPGG--
A0A7Y4UER8      RLYADFLNKMQQTN--------------LQK---VEQQKNM----RIIEPAE--VPGS--
A0A2V8IYW3      KGYESLLAKKEDSN--------------IAA---NLEKQQVGEQFKVLDPAR--VPER--
A0A7V2HCZ0      RLYEELLQKMKEVG--------------IGS---ALPGSTV----RILDPAD--VPMA--
A0A2V9AEW6      RLYETMLQRVKEAS--------------LAA---AMRDSNV----MVIDRAR--PPKL--
A0A2V8WQK6      RLYEVMLQRVKEAS--------------LAT---AMRDSNV----LVVDRAK--PPLL--
A0A2V8XIF4      RLYEVMLQRVKEAS--------------LAT---AMRDSNV----LVVDRAK--PPLL--
A0A350UQT3      NLYDELVRKIREAG--------------INA---GFQNNMV----RIADAAR--PAWK--
A0A7C3HRX0      QLYEELVRKIREAG--------------INA---GFQNNAV----RVADPAR--APWK--
A0A2W0BGU4      QLYQRLLQRVKDAT--------------VIA---GLSSTNI----HIVDPAL--APII--
A0A2W0BVQ9      QLYQRLLQRVKDAT--------------VIA---GLSSTNI----HIVDPAL--APII--
A0A317J121      QTYSAMLLQANESN--------------INS-SVPLGMGTI----RLVDPST--PPAK--
A0A2V9MN96      QLYQSLLQRLKEAS--------------VTA---GLRSSNI----RVIDVAR--LPTG--
A0A2V7V2Z1      EVLNSLLSRHKQTD--------------VAQ---ELKNSNI----RIVDPAS--VPRG--
A0A2V7X2F7      AVLNSLTERHKETD--------------VAQ---ELKASNI----RIVDPAV--MPNG--
A0A2V7V2I1      EVLNSLMARHKQTD--------------VAQ---ELKASNI----RIVDAAA--VPGS--
A0A2V7U3M2      EVLNSLLSRHKQTD--------------VAQ---ELKNSNI----RIVDAAS--VPRS--
A0A2V7UHT0      EVLNSLLSRHKQTD--------------VAQ---ELKNSNI----RIVDGAS--VPRG--
A0A3P0X3W6      TLYNELFQKIKEAG--------------INS---GFQNSSI----RIADEAR--PQNA--
A0A7V2MG68      KLYDELVRKIKEAG--------------INA---SFQNSSI----RIADAAR--PGLK--
A0A7C6A629      KLYEELVRKIKEAG--------------INA---GFQNSSI----RLADPAR--PALK--
A0A7V2HBQ5      KLYEELVRKIKEAG--------------INA---GFQNSAV----RLADLAR--PALL--
A0A2U3JZ71      TLYEELVRKIREAS--------------INS---GFQNSAI----RIADLAR--PAFK--
A0A2V8TTB0      KLYEELVRKIKEAG--------------INA---SFQNSSI----RVADPAR--PGLK--
A0A2N9MK30      KLYEELITKIREAE--------------INA---GFQSNTV----RIADNAR--PGLS--
A0A3D1ASD2      KLYDELIRKIKEAS--------------INA---NFQTSNV----RIADSAR--PPLK--
A0A7R8B699      RIYDELLRKIKEAE--------------INS---GIQNNNI----RIADLAK--PGAK--
A0A7S7SGU3      NLYDELVRKIREAG--------------INA---GFQNNMV----RIADLAR--PAWK--
A0A7Y8HY45      QLYEELVRKIREAG--------------INA---GFQNNTV----RVADPAR--APWR--
A0A7C5AXI3      ALYEELVRKIKEAG--------------INA---SFQNSSI----RIADPAR--PAVK--
A0A7C6E4H7      KLYEELVRKIKEAG--------------INA---GFQNSSI----RLADPAR--PALK--
A0A2Z5FVL3      SLYEKLQSRMKEAG--------------VLE---GFHSSNI----TVVSPAL--APSA--
A0A2V8GFD4      QIFDALLQRSKETG--------------ISG---ELRTSNV----RVVDAAE--EPPW--
A0A2V8HSS5      QIFDALLQRSKETG--------------ISG---ELRTSNV----RVVDAAE--EPPW--
A0A2V8KP55      DIYNGLLTRLKEAG--------------ISG---GLRASNI----RVVDQAE--VPKG--
A0A2V9JSI3      QLYENLLQHLKDAT--------------VSA---GLRATNI----HVVDPAL--PPAA--
A0A2V9WI32      QLYEGLLQKLKEAG--------------VSA---GLRSSNI----RIVDVAR--VPTS--
A0A2V9KBD6      KLYEDLLQKQKELG--------------ITA---SLKSSNI----WIVDPAR--APKL--
A0A2W0AJ66      KLYEDLLEKQKELG--------------ISA---TLKLSGL----RVIDPAQ--PPKR--
A0A1Q7RBU1      KLYEDLLQKQKEMA--------------ISA---SLKSSNI----WIVDPAR--PPKL--
A0A2V9JPV9      KLYEDLLQKQKEVG--------------ISA---SLKSSNI----WIVDPAR--PPKR--
A0A7V0Y3A1      RLYETTLQKGREAS--------------IAA---ASRASNA----RVVDPAE--PAYV--
A0A7C5Z4J3      ALYDNLLTKVKDAA--------------VSS---GLRASNV----RLVDRAF--APPQ--
A0A1F2TPT3      QIYDMFMQRARETG--------------VAK---DINPSRI----RILDAAT--VPSS--
A0A2V8JTQ2      KLYEDLLQKQKEVG--------------ISA---SLKSSNI----WIVDPAR--PPKL--
A0A2V8UZY0      KLYEDLLQKQKEVG--------------ISA---SLKSSNI----WIVDPAR--PPKL--
A0A350UEK1      QLYESMLQRVKEAG--------------LAS---ALRASNV----RVVDEAQ--PPER--
A0A350UIQ4      QLYESMLQRVKEAG--------------LAS---ALKASNV----RIVDPAK--APER--
A0A7T9GJN6      ALYTEFLNKTSQAN--------------IQV---AEQHSNI----NIIDPAI--VPRS--
A0A7T9GJN7      SLYTDFLQKTKQAD--------------LQL---AEQHNNL----RVIEPAE--TPTS--
A0A1H5Z7N3      QLYDGLLQRLRSAA--------------VEA---GLESTEI----EIVDNAV--PPVY--
A0A1G7JVV8      ALYEALLAKLRSAS--------------VQA---GLDALEI----DVVDPAF--KPIG--
A0A1H4T6W9      TLYESLLSKLRAAS--------------VQA---GLDSLEI----DIVDQAL--KPAA--
I3ZEU5          TLYESLLSKLRAAS--------------IQA---GLDSLEI----DIVDQAL--KPAG--
A0A7W7ZGZ3      TLYEGLLQRLRTAG--------------VEA---GLESLEI----DIVDPAV--PAAA--
A0A7G8BSK5      NLYEGLLQRLRTAG--------------VEA---GLESLEI----DVVDPAM--LPAT--
A0A428MDU2      TLYEGLLQRLRTAG--------------VQA---GLESLEI----DVVDQAL--PPAS--
E8WVF6          TLYEGLLQKLRTAG--------------VEA---GLESSEI----DIIDQAV--PPSD--
A0A1I6MH75      TLYDGLVSRLRTAS--------------VQA---GLESTEI----DVVDLAM--IPAS--
A0A7Y9TM87      TLYDGLRQRLRTAS--------------VQA---GLESLEI----DIVDQAL--PPAS--
A0A7W8J1H5      TLYDGLQQRLRTAS--------------VQS---GLESLEV----DVVDQAL--PPAE--
A0A7Y9T5K4      TLYDSLQQRLRTAS--------------VQS---GLESLEV----DVVDQAL--PPAE--
A0A852VHP9      TLYDSLKSRLRTAS--------------VQS---GLESLDV----DVVDQAL--PPAE--
A0A7W8IFZ2      TLYDSLKSRLRTAS--------------VQS---GLESLDV----DVVDQAL--PPAQ--
A0A7W8J9Y9      TLYDSLKSRLRTAS--------------VQS---GLESLDV----DVVDQAL--PPAQ--
A0A7L5A6M5      TLYEGLLQRLRSAG--------------VEA---GLESMEV----DIVDQAI--PPAR--
A0A5B9EBI2      QLYDSLLQRLRAAG--------------IQA---GLESLEI----DVVDQAL--IPAA--
A0A7Y5RFT3      QLYDSLLQRLRAAG--------------IQA---GLESLEI----DVVDQAL--IPAA--
A0A239HDF6      TLYEGLLQRLRTAG--------------IQA---GLESLEI----DIVDQAV--PPAS--
A0A4Q0T270      TLYEGLLERLRTAG--------------VQA---GLESLEI----DVVDQAL--LPAY--
A0A1Q3QQB6      TLYEGLLQRLRTAG--------------VEA---GLESLEI----DVVDQAL--PPAK--
A0A3N1K1G7      TLYEGLLQRLRTAG--------------VQA---GLESLEI----DVVDQAL--PPAN--
A0A4V2G466      HLYESLLERLRTAG--------------IEA---GLESLEI----DVVDPAL--LPAT--
A0A6B9YNQ8      NLYEGLLQRLRTAG--------------VEA---GLESLEI----DVVDPAL--LPAN--
A0A3N6A5T6      QLYEGLLQRLKEAG--------------VAA-GLK--SSNI----NVVDRGE--TPRR--
A0A2V8R8U7      QYLNTLMQKRRELA--------------AGG-ADR--GTDV----SVSNYSR--TPQL--
A0A7V9Q528      QFYNTLYQRHKELQ--------------ITS-SDK--SNNV----TVATPAA--RPRA--
A0A2V8QMP4      QNLNLYMQRANELK--------------VTAPDRA--SGNV----TMVEEAR--TPRE--
A0A2V8R4S3      QNLNLYMQRANELK--------------VTAPDRA--SGNV----TMVEEAR--TPRE--
A0A2V8NJ55      QLFQTLSQKQNEID--------------LAG-NDQ--GNNV----TVATPAR--LPRG--
A0A7V9ZQ50      QIFNTLFQRQKELE--------------ITS-SDS--VNNV----TIATLAR--LPKG--
A0A2V8Q7I0      QYLNTLMARKRDVQ--------------TSN-TDR--ANEV----SIENYSR--IPRS--
A0A2V8S6K4      QMLSTLLQRRQELE--------------TADIEGQ--SNNV----IIQTPAR--TPQL--
A0A317I2L9      QYLNTLQQRLREIQ--------------ASS-GDR--GNEV----SVENYSR--VPKA--
A0A2V8LLF9      QYLNTLTQRLRELT--------------ATS-GSG-TASEV----SIANYSR--LPHE--
A0A352FRF4      QYLNTLFQKRRELN--------------AVS-GET--GTNV----SVSNPSR--LPRA--
A0A7W1GE99      QFYNTLYQKQKELQ--------------ITS-SDR--SNNV----SVATPAR--LPRS--
A0A1Q7YKQ8      QYLTTLLQRQRELE--------------NEQ-TGRMQTNNV----SVSQYSR--EPRA--
A0A0B6WXT1      QFYNTLFQRQKELE--------------ITS-NDR--ANNI----TVATPAR--VPRE--
A0A2V8MKV0      QYLNTLNQKERELK--------------ATG-SDK--GTNV----SVVSYSR--LPHE--
A0A2V8PYY8      QYLNTLNQKERELK--------------ATG-TDK--GTNV----SVVSYSR--LPHE--
A0A3B9MEU8      QYLNTLLQRERELT--------------VAS-GDR--SNEV----SIPTPSR--LPKT--
A0A352F3R7      QYLNTLLQRQRELQ--------------VTS-GDR--SNEV----NIATYSR--LPKE--
A0A7W0GRF6      QYLNILVQRQRDLL--------------VTS-TDR--SNEV----SIATYSR--LKTT--
A0A7W1H6G6      QYLNILVQRQRDLL--------------VTS-TDR--SNEV----SIATYSR--LKTT--
A0A7V9HZC8      QYLNTLVQRQRELQ--------------VTS-TDR--TNEV----SIATYSR--LKTS--
A0A7W0XCB9      QYLNTLVQRQRELQ--------------VTS-SDR--SNEV----TIATYSR--LKTT--
A0A3N5YNR8      QLYEGLLQRLKETG--------------ISA---GMRASNI----HVVDHAE--VPET--
A0A7W7ZUJ7      QIYDGLLQQLKEAS--------------LAA---GLTSSNT----RVVDRAR--LPRY--
A0A2V2R0I6      TLYDGLMNKLKEVG--------------IAE---SLKSSNI----RVVDPAM--IPSY--
A0A2V8XAR9      ALYEGLMTKLKETA--------------ISL---GLRSSNI----RIVDPAM--IPST--
A0A2V8VZA0      TLYEGLMTKLKETA--------------ISQ---GLRSSNI----RVVDPAM--IPST--
A0A1Q7CB82      TLYEGLMTKLKETA--------------ISQ---GLRSSNI----RVVDPAM--IPST--
A0A2V8WIU1      TLYEGLMTKLKETA--------------ISQ---GLRSSNI----RVVDPAM--IPST--
A0A1Q6Y9F5      TLYEGLMTKLKETA--------------ISQ---GLRSSNI----RVVDPAM--IPST--
A0A2V9EVV8      TLYEGLMTKLKETA--------------ISQ---GLRSSNI----RVVDPAM--IPST--
A0A2V8YF91      ALYEGLTTKMKETA--------------ISA---GLRSSNI----RIIDPAM--VPTS--
A0A2V8XZK2      ALYEGLMTKMKETA--------------ISA---GLRSSNI----RIVDPAM--VPTS--
A0A2V8ZTX6      ALYEGLMTKMKETA--------------ISG---ALRSSNT-------------------
A0A2V9BT79      ALYEGLMTKMKETA--------------ISG---ALRSSNI----RVVDPAM--VPAT--
A0A2V9YHT3      QLYDGLLQRLKEAG--------------ISA---ALKSSNI----RIVDSAR--PPVL--
A0A7C2XNI7      ELYDGLLQKLKEAG--------------ISA---GLRSSNI----RIVDPAL--VPPA--
A0A1Q8B793      ALYEGLLTKLKEAG--------------ISA---GLRSSNI----RVVDPAM--IPSS--
A0A2V9BCA0      ALYEGLLTKLKEAG--------------ISA---GLRSSNI----RVVDPAM--IPSS--
A0A2V9BWU9      QLYEGLLQKMKEAS--------------ISA---GLRSSNI----RVVDPAM--VPSA--
A0A2V9DKX2      QLYDGLLQKMKEAS--------------ISA---GLRSSNI----RVVDPAM--VPSA--
A0A7C2YQY3      QLYDGLLNRLKEAG--------------VSA---GMRSNNI----HIVDRAR--PPLA--
A0A845TWB8      QLYESLLQRLKEAG--------------ISS---GLRSNNI----LVVDRAR--QPQV--
A0A2U3KC61      QLYQDLLQRFSEAS--------------VSE---TLKSSNI----RVVDFAR--TPTS--
A0A2V9Y2R7      QLYLSLLQKLKEAG--------------VTA---GLRSSNI----RVVDVAR--TPMF--
A0A2V9NGH6      TLYEGLLEKLKEAG--------------VTA---GLRSNNI----RPVDLAR--VPIE--
A0A2V9PYE6      TLYEGLLEKLKEAG--------------VTA---GLRSNNI----RPVDLAR--VPIE--
A0A2V9NL07      TLYEGLLQKLKEAG--------------VTA---GLRSNNI----RQVDIAR--TPAG--
A0A2V9QD92      TLYEGLLQKLKEAG--------------VTA---GLRSNNI----RQVDIAR--TPAG--
A0A2V9WPZ6      QLYEGLLEKLKEAG--------------VTA---GLHSSNV----KIVNAAR--VPMA--
A0A2V9ZLH4      QLYEGLLEKLKEAG--------------VTA---GLRSNNV----KIVDAAR--VPQA--
A0A2V9RQF1      TLYEGLLEKLKEAG--------------VTA---GLRSNNI----RNVDIAR--APRS--
A0A2V9YDK8      QLYEGLLEKLKEAG--------------VTA---GLRSSNV----KIVNAAR--VPMA--
A0A2V9V8F7      QLYEGLLEKLKEAG--------------VTA---GLHSSNV----KIVNAAR--VPMA--
A0A2V9XGR9      QLYEGLLEKLKEAG--------------VTA---GLHSSNV----KIVNAAR--VPMA--
A0A2V9V3Q5      QLYEGLLEKLKQAG--------------VTA---GLKSNNF----RIVDPAR--SPNA--
A0A2V9NWS3      ALYEGLLEKLKEAG--------------VSA---GLRSNNI----RNVDAAR--VPSE--
A0A2V9USA9      QLYEGLLQRMKEAG--------------VSA---GLKSNNF----RIVDTAR--VPNG--
A0A2V9XW18      QLYEGLLQKLKEAG--------------VSA---GLKSNNF----RIVDSAR--PPTG--
A0A1H5SQF5      TLYQDLYGKLEAAN--------------ILA---GAKSSNV----TIVNPAR--VPSG--
A0A2V8G155      QIYESLMQRAKETG--------------VSA---ELKTSNI----SVIDRAE--TPRT--
A0A2V8HDM7      QIYESLMQRAKETG--------------VSA---ELKTSNI----SVIDRAE--TPRT--
A0A2V8IVN9      QIYESLLQRAKETG--------------VST---ELKTSNI----RVVDPAE--RPRK--
A0A7W1SCW7      QIYESLLQRAKETG--------------VSS---ELKTSNI----RIVDRAE--QPRA--
A0A3E0NV31      QLYDGILQRLRETD--------------IVA---ELQKEGI----RISIPAT--RPNS--
A0A3N5M5V0      QLYEGLLQRLKETG--------------ISA---GMRTSNI----HIVDHAQ--VPTA--
A0A7X7XDY5      NVYEGMLSRLKEAS--------------VAA---GLKSSNI----RIVERAE--TPTA--
A0A2V9L5B5      QLYEGLLQRMKEAQ--------------ASA---GLRASNI----RVVDAAE--APKY--
A0A2V9LK56      DLYNGLLQRMKEAQ--------------VSA---GLRASNI----RIVDAAE--VPRR--
A0A2V9L7I0      QLYEGLLQRMKEAQ--------------VSS---GLNASNV----RIVDAAE--IPKG--
A0A522PPT0      SLYDGVLQRMKEAQ--------------VAA---GLNASNI----MVVDPAQ--VPKG--
A0A7C5V1G5      SLYDGVLQRMKEAQ--------------VAA---GLNASNI----MVVDPAE--VPKS--
A0A4R1LC91      TLYETLLNHLKEAG--------------VLE---GLRSTNI----TVVDPGR--VPAK--
A0A2V9QB26      ETYQAMLQRVKEAN--------------IAS---AVRPSNV----RIIDAAE--PPEH--
A0A2V9VYY4      QLYQDLLQRLKEAG--------------VSA---GLRSSNI----RIVDIAR--VPTQ--
A0A2V9KIE8      QLYESLLQRLKEAQ--------------VSE---GLKASNI----RIVDQAE--TPKL--
A0A7C2GJ20      QLYEGLLEKLNDVK--------------LLS---TLTTTNV----QILDKAE--VPLR--
A0A7C4BTL5      QLYEAMLQRVKESS--------------ILS---ALRASNV----RVVDPAK--PPKT--
A0A7X8YVF2      ELYDGLLQRMKEAG--------------VAA---GLKSSNI----RIVDRAE--TPKL--
A0A7X7YEP0      QLLNELVRRQSETE--------------VASRLQGIRDSNV----TVVDRAL--PPGA--
A0A2V9CBM2      QVYDGLLQQLKSAG--------------LAA---SLKASNI----LIVDPAE--PPAK--
A0A2V8XN17      QLYEGLLQQLKEAG--------------VSA---GLKASNI----RLVDSAE--PPAK--
A0A2V8WX45      QLYEGLLQRLKEAG--------------VSA---SLKASNI----RIVDSAE--PPAR--
A0A1Q6YR79      QLYEGLLQQLKEAG--------------VSA---GLKASNI----RLVDSAE--PPAK--
A0A1Q7VA32      QLYEGLLQQLKEAG--------------VSA---GLKASNI----RLVDSAE--PPAK--
A0A2V9EY85      QLYEGLLQQLKEAG--------------VSA---GLKASNI----RLVDSAE--PPAK--
A0A2V9H8K0      QLYEGLLLQLKEAG--------------VSA---SLKASNI----RLVDSAQ--PPAK--
A0A2V9FFE5      QLYEGLLLQLKEAG--------------VSA---SLKASNI----RLVDSAQ--PPAK--
A0A2V9GM43      QLYEGLLLQLKEAG--------------VSA---SLKASNI----RLVDSAQ--PPAK--
A0A2V8ZHL8      QLYDSLLQRLKDAT--------------VSA---GLRATNI----HVVDPAR--PPRV--
A0A2V9B240      QLYDSLLQRLKDAT--------------VSA---GLRATNI----HVVDLAR--PPKV--
A0A2V9CYQ5      QVYEGLLQQLKSAG--------------LAA---SLKASNI----LIVDPAE--PPTK--
A0A2V9BWU8      QLYEGLLQRLKEAG--------------VSA---SLKASNI----RVVDSAE--PPAR--
A0A2V8ZG48      QLYEGLLQRLKEAG--------------VSA---SLKASNI----RIVDSAV--PPAK--
A0A2V8Y334      QLYEGLLQRLKEAG--------------VSA---SLKASNI----RIVDPAD--PPAK--
A0A2V9AY68      QLYEGLLQRLKEAG--------------VSA---SLKASNI----RIVDSAE--APAK--
A0A1F2RFI7      QLYEGLLQRLKEAS--------------VSA---GLRASNI----RVVDQAE--VPEM--
A0A1F2RZS3      QLYDGLLQRLKEAS--------------VSA---GLRASNV----RVVDPAE--VPTL--
A0A845TW47      ELYEGLLSRLKEAG--------------VSA---GLKSSNI----RIVDAAQ--APKK--
A0A845TXC1      QLFDGLLQRLKEAG--------------VSA---GLKASNV----RIVDPAE--PPRK--
A0A1F2USE2      QLYEGLLQRLKEAG--------------VSA---GLKASNI----RIVDSAR--PPEK--
A0A7C2VB08      QLYEALLQRLKEAG--------------VSS---GIKSSNI----RVVDRAT--PPRR--
A0A2V9C238      QLYEGLLQRLKEAG--------------VSA---GLKASNI----RIVDAAE--PPKK--
A0A1F2Q9F5      QLYEGLLQRLKEAG--------------MSA---GMKASHV----RVVDPAQ--PPDK--
A0A1F2QQH9      QLYEGLLQRLKEAG--------------MSA---GMKASHV----RVVDPAQ--PPDK--
A0A1F2QXK7      QLYEGLLQRLKEAG--------------MSA---GMKASHV----RVVDPAQ--PPDK--
A0A2V9DEM9      QLYEGLLQRLKEAG--------------VSA---GLKASNI----RIVDAAE--PPKK--
                                                                            

A0A2V7VMF7      PVWPNKRKMAGVGILVGVALGLGLVL-LRDFLS-NTV----RDPEEIERYLHLDLLSAVP
A0A2V7YYV7      PVSPTKALNISIAFGAGLLLAVGLAY-LLERLD-QSI----KTNEDLTERLGLLPVGHIG
A0A2V7Z0J5      PVSPNKALNVAVAFVAGLLLALGLAL-LFDYLD-QSI----KSDAELTDRVGLISLGHVP
A0A2V7Z3M4      PVSPNKVLNVAIALMAGLLLALGVAF-LLDYLD-QSI----KSDQELTERLGLVPHGHIA
A0A399Y5V2      PVEPKLSRKVIFALTIGILLGAGIAF-LVEYLD-DSL----RSKQDAEKAFGAPILGMIP
Q01X01          HHKPNVPLNLLFGLFGGLALATGYVM-LQEQTN-SAL----RSPGDAGAYLTLPELGAIP
A0A3M2D9H8      PVRPQTATNVLLGGILGLILAGGIVF-LIEYLD-DSI----RNGETVTKNLDLPVLGYIS
A0A2V9IXG5      RVATRGANFVILATLGGMILGMALVV-LGEVIN-PRV----KTVEEIQTSLSVPALGFLP
A0A2V9J2P4      RVATRGANFVILATLGGMILGMALVV-LGEVIN-PRV----KTVEEIQTSLSVPALGFLP
A0A831T3F4      PIGPKRLRAILIGLFLSLAVGVGLAF-FFEYLD-NTI----KTVEDVTRYVQLPTLGVIP
A0A2V8JK38      AVTPNHKLNLAWGIFFGLIFGVGSAV-FQEYID-RSI----KSPDDVTRHLGLLALGTVP
A0A7W0JWI4      PVGPMRLQIVMLALVLSLAFGVCLAF-FLEYLN-DTV----RSIDDVERILHLPALVAIP
A0A1Q7RLS4      PVRPRTVLNLAIGMLLGILLGVGAIF-FLDYMD-NTV----RTSDDVEQYLRLNLLAIVP
A0A257VBK0      PVKPNKRMNLLMGLLFGLMLSVGSIV-AWQYLD-TSV----KSVEDLETRMGVALLTMVP
A0A7C5TWV7      PYKPNPPRILSLSLILGLFLGVGLAF-GLDFID-QTL----RRPEEAERYLGLETLAAVP
A0A2V7XDY0      PIRPNKKRIAAVAGFLGLLLGVGLVI-ARDYLD-NTI----KDPEEIERYLHIDLLAAVP
A0A2G6PYV5      PYAPSLKRHLFSGFIIAAGLAGLLIF-LIEITD-RKI----HNTEVLEMVTVLPTLATIP
A0A1F2TCR2      PFTPNPRKDWFTAIMAGLLVGVGLAF-GIEYLD-DTV----KTPEDITKVLGLPLLGLVP
A0A7Y9PHF8      PVFPNRLVFTFLGMLSSLVISLIVIL-IVDMMD-KTL----RDPMQAQLAIGMPVIGILP
A0A7W8J3G9      PVEPKKKVIVGFGFMLGLFCGLGAAF-LRDLIT-DTA----KSEEQLENALGAHVLAAVP
A0A1F2V330      PSTPRRSRLLLVGLFVGLALGLAVAF-VAEQMD-TTF----GNIVEFQTFTNLPAIAVLP
A0A662EE63      PFSPNLRRAVALGGVLGLFLGIGLVL-GLDFLD-HTL----RTPDQVERYLGLEVLAALP
A0A2V8TLH7      PIRPRPILNLLIGVMLGLLLGVGTVF-FLDYMD-NTV----RTSEDVERYLKLNILAVVP
A0A1Q7ZJT1      PVRPRTVLNLAIGMLLGILLGVGAIF-FLDYMD-NTV----RTSDDVEQYLRLNLLAIVP
A0A2V8VC99      PVRPRTVLNMAIGVLFGLLLGVGTVF-FMDYMD-NTV----RTSEDVEQYLRLNLLAIIP
Q01XL7          PSSPTPMRDIPTWSLFGGALCYGLLW-FREVLRRKRLTQLFESPGHTRTILGVPELGVIP
A0A523DUV7      PIRPQPTKNLAIALVLGVLSGCGLIL-LRDYLD-NTL----KEQEDIERHLRVDCLAIVP
A0A7W1TTH3      SYTPNVANNLLMALLAGVVLALAVAF-GLEYLD-DTI----KTPEDITRKLRVPFLGLVP
A0A1F2U158      PLTPTGRRTWLLSFAVGLVAAISVAY-GLDYMN-DTI----KTPEDVTRMLKMTFLGLIP
A0A2V8F6S9      PMAPTGRRTWLLSLAVGLAIAVAVAY-GLDYMN-DTI----KTPEDVTRRLKLPFLGLVP
A0A7V0UHS9      PFSPRRERIILMGICAGFGLGLILAF-FMEQSD-TTF----GNIDDFQTFTNMPLIGVIP
A0A7D8BEX2      ARLPSPWMLFVGAVFVLLLLGAIAAV-TIDLLK-ATF----ETLEEIEQGLHLPGLCLLP
A0A4Q1SCH5      PVEPKKALILASGLILGCVAGIGAAL-LRESMG-GEI----QSISQVESNVGLANLATVP
A0A7V4SJP8      PVRPRKAMNLLLGLMLGLMLSAGSVV-AYQYLD-TSV----KDVDVLEARLGLNLLTLVP
A0A372IRG7      PVLPQKRQDATFGFLGGLIVGLILAV-FLESMD-DTL----RTSDDAEAVSLLPALAVIP
A0A2V8K4L4      PYKPNLMNNAMLGSMAGIFLGVVLVL-LKEQAD-RSI----QQPGDSSLYLGISELGVIP
A0A2V8NCZ3      PYKPSPVNNAILGLMAGIFVGVVLVL-LREQAD-RSI----QQPGDSALYLGVSELGVIP
A0A4Q7YNP3      PFSPRRGTSTMAGLLLGSLFGIGFAF-YKDRNS-DIL----RVPGEVERYLNLNELGVIP
E8UZE1          PSEPRRALNMEAGALLGLVVAFAVVF-LIENAN-ATI----RTGEDIYRYSGLPLLSIVP
A0A2V7YW66      PFRPSLRQDVTYGLLLGLLAGLGLAV-LIELMD-RTV----KSPEEVERRLGLPPLAVIH
A0A2V7Z0V0      PFQPSLRKDGSYGLLLGLLFGVGCAV-LIEVLD-RTV----KAPEEIERKLGLPTLAVIQ
A0A2V9M454      PVRPNRPRNIEFALAAGLILGIALAF-TREALD-NSI----KNAQEIEKLTSLPTLSIVP
A0A2V9J4D6      PVRPKKALNVALGLLAGIILGTAFAF-LEEQLEQKTV----KTMEDVQRLVGLPSLGLIP
A0A2V9L9C5      PVRPKKALNVALGLLAGIILGTAFAF-LEEQLEQKTV----KTMEDVQRLVGLPSLGLIP
A0A2N9M9N1      PIRPDKRVDIAVGLLVGLILGVTLAF-IREGLD-RTV----KTAEDIENQIAIPTLAVIP
A0A2V9JEC4      PVRPDTRRNFPLFAFAGLVIGVTLAF-AQEALN-NSI----RTPDDLEGSFSIRALTIVP
A0A2V9LPQ3      PVRPNKLLNLMLGLVAGGLLGLVLAF-AEEGLERRSI----RTPDDVERLLGIPALAIIP
A0A7Y8IYX6      PYQPKKLWNISLLLLLGLSAGMGLAL-LLEYLD-RSL----KNAIDLE-VLGLPMLGWIP
A0A2V9IVR7      PVRPRKLFNVTIGLLVGLILGVALAF-VQEALD-DSI----KSIGQVERYLSTNALAVIP
A0A2V9ILE2      PVRPRKLFNVTIGLLVGLILGVALAF-VQEALD-DSI----KSIGQVERYLSTNALAVIP
A0A2V9LGY4      PVRPRKLFNVTIGLLVGLILGVALAF-VQEALD-DSI----KSIGQVERYLSTNALAVIP
A0A7T9JJ28      PVKPNKILNIGLSLLIGLGLGVGLAF-FLEYLN-NTI----SSADDVERILQLPSLGAIP
A0A7T9GE94      PVAPKRLQNILLSGLLALVAGVGLVL-FLDYIN-NKL----ESVEDIDRYLRLPALGVIP
A0A7Y4X7L5      IVAPNRMQNILLSLLLSLLGGVALVL-FLDYIN-NKI----DSVEDIDRYLRLPALGVIP
G8P0Y7          PTKPNIPRNLEFALLVGLVVGIALAF-GLEALD-ATV----RTPEQAETTSGLPVLGVIP
A0A2W4RYA1      PSSPRKVLNLSLGFVVAVLGALGLAF-FFEYFD-NRL----RTPEEMQAVLGLTSLAMLP
A0A2V8EXP2      PASPNVVANLLLALFGGLTLAVGIAF-FFEYLD-NRI----KTPDEIKAHLGLPFLGLVP
A0A843SYC7      PVSPQKGLNLLLALFGGSLAACGLVF-FFEYID-SRI----KNPEEIRIHLGLPHLGLLP
A0A7V9BJ09      PISPNVRADMTFAFVAGLVLAVGLAF-GFEYLD-NRI----KTPQELKAHLGIPFLGMVP
A0A7W1DT80      PISPNLRADMTFALVAGLVLAIGLAF-GFEYLD-NRI----KSPQELKAHLGIPFLGMVP
A0A5M8T4U7      PIAPRKTMSMLFGLIGGFVGGLVMAF-IIESID-DRM----QTSEEVESVSTLASLATIP
A0A7L5A491      PVFPNKMVFIFLGFLFSSVVSLIVVI-VSDMFD-KSL----RDPDQARRALGTEIIGVLP
A0A7D8BF18      PSLRPKSTIMMIDALGMLIIGVVLAF-VLDSLD-MGL----RTVSEVESVSGLPSLALIP
A0A1E3Y9R6      PVLPRTPRDLLLAALAGGLLALGLAF-GFEYFD-SRI----KLPEEIKTHLNLPFLGMIP
A0A2W4TLP2      PVLPRTQRDLMLAALAGLVLAFGLAF-GVEHFD-SRI----KLPEEIKTHLGLPFLGMIP
A0A7G8BDY8      PVEPNIPLTLALSIFLGLGSGVGLAF-LAENLD-NTI----RSTEDIEFLTTIPVFGWVP
A0A7C4BZ42      PYRPRPGRMAFFGLLGGLVLGFGFVI-LRERAD-RTL----QQPGDLTLYLNLPELGVIP
A0A3R9WF43      PSSPDYPKYLTLVAGIGIFLGISSAF-VRESLD-ESI----RTPLDIEAASHLSILAYIP
A0A317HKM4      PSLPRQTHNLMLAFAGSSSLALVLVF-VLEVFN-TRV----TSVEDVKRHLRIPVLGLMP
A0A2V9CG11      PYKPNLPMNAALGMFGGFFLALGLVL-FRERLD-RRI----QSPGDAHVYLNISELGVIT
A0A523E0N1      PFAPGSNRRFALLLALGVILGAGTAY-LLDHWD-DAI----HTVDDVKQHVPLPYLGMIP
A0A1V6HR88      PFRPSLRRNVTFAGGAGLVLGFGLVL-LLHYMD-RTL----KSSEEVERLFGVPVLAVIP
A0A4Q1SDL1      PKKPNVPLYLLIAAFGGLVLGLAGAL-IAEAMD-RRI----QTVEQLDR-LGVPLVAILP
A0A841JWG5      PKKPNVPLYMAIAAAAGLLLGFAGTL-VAEAVD-HRI----QTIEQVERLLGAPLVGILP
A0A4R1LAZ7      PISPVKRVDLGVGLAAGLLVGISLSL-LLESLD-DTI----QTSEDAETVSGLTTLAVIP
A0A7G8BMP1      PISPAKKRDLLFGLLGGLLLGTIAAL-FLESLD-DTI----RTSDDAEAISGLPSLAVIP
A0A7X7ZKA6      PSSPNKRRNLVLALLLGLGGGVGLAF-LFDFLD-NSV----KTSEDVERYAGLPTLGVVP
A0A523ECP2      PTGPRLSRSLLLGSVVGIALALGLAL-FLDYWE-TSI----YTIEDLRRHVPLPYMGMVP
A0A2W0C122      PVSPYLPRSSYLGLFLGFLLSAAVIG-FRESMD-RAL----RDPADVESFTAMPSLAIIP
A0A2W0AUU7      PVSPNLRRTSCIGLFLGFLLSAAAIG-IREGMD-RAL----RDPAEVESFTAMPSLAIIP
A0A2W0BQL1      PVSPNLRRTSYIGLFLGFLLSAAAIG-IREGMD-RAL----RDPAEVESFTAMPSLAIIP
A0A2V8ERZ5      PITAGGRRTVLMSLMIGLVLAVAVAL-GLDYMN-DTI----KTPEDVTRRLKLPFLGLVP
A0A7W8J413      PAIPNYLKYLSLIAGVGMFFGISSAF-LRESLD-ETV----RRPRDFQLIGGLRMLGYVP
A0A7W8JCF5      PAIPNYLKYLSLIAGVGIFFGISSAF-LRESLD-ETV----RRPRDLQRIAGLRMLGYVP
A0A7W8IEB1      PAIPNYLKYLSLIAGVGIFFGISSAF-LRESLD-ETV----RRPRDLQRIAGLRMLGYVP
A0A7Y9T3I1      PAVPNYLKYLSLIAGIGMFFGISSAF-LRESLD-ETV----RRPRDLQGVAGLRMLGYVP
A0A3P0XH15      PVFPVKRNDAAIGLAAGLVLGLALAL-FAETID-DTI----RTSDDAESVVGLPSLAVIP
A0A3E0P0A3      PVSPSLRRHLPFGVALGLLCGVALVL-LIDFLD-RSI----KSPEELERRLGLPVLGVVP
A0A3M1WQW8      PARPRKLFTTGVSGLVGLLLGIVLAL-FVEYLD-NTV----KSTEDVDRLLGLPSLGVVP
A0A841JVA9      SIYPNRIATGITSFIVGALLGAAIAF-FKDRNT-TVL----REPGESKKFLHVEELGVIP
A0A3N1JHC1      PTSPKLSICIFLAVLLGGVFSLLYIL-ISERRD-NSV----RNPGESEQYVERPELAVIP
A0A7V4XQR5      PVSPQKKRTVVFGFLAGLIAGIAISL-LLESLD-DTL----RTSEEVESIGHLPALAIVP
C1F294          PVTPQKKRTVVFGFLGGLIAGIAISL-LLESLD-DTL----RTSEEVESIGHLPALAIVP
A0A2V9KA79      PVTPGRVRILLLGLAAGLCLGLGLAV-LAENLD-TTF----ENAEQFQSFFDFPVLCIIP
A0A348UZU3      PDSPRKFRNLLLALFLGLFGGLGLAL-GMEYLD-NTV----KSAEDVERYSGWPTLGVVP
A0A7X9FXC4      PSSPKKMRNLLLALFLGLFGGVGLAF-VLEYLD-NTV----KSAEEVGRYTGLPTLGVVP
A0A7X7ZKL5      PFTPDVKRNLLVALLLGLVGGVGLVF-LVESLD-NTV----KGPEDVEKLVGLPSLGVIP
A0A522PSP1      PVYPRTKQTLMLALILSGMLGVLGAV-AADGMD-RTL----RDPRAVPSELGAGLLGSLP
A0A7W8E8D3      PVEPKKLVILSFGLVLGLFAGVGSAF-LREALS-DKL----QSVDQIERALGYQLLAIIP
G8P085          PVEPKKLVILSFGLVLGLFAGVGSAF-LREALS-DKL----QSVDQIERALGYQLLAIIP
A0A843SRW6      PVWPRKQRSLLLAALSGAVLAVGFAF-FVDYLD-TRL----RSPEDFKKHLGLPFLGLVP
A0A7W8E330      PSKPNVLLLLAASIAIGLLFAFGGML-IAEGLD-RSI----HSTAQVEQ-MGLPLIGILP
A0A4Q1SGQ1      PSSPRMLLVYACALIGGLFLGCTGGW-TAERFD-HSV----RSLEQLEEEVGSPLLGILP
A0A7V2HGP7      PVSPNTRNNVLVAALLALFLGVAGLI-AVDAMD-NTV----RDPEVVSRSLGTDVVGSLP
A0A7R8B6H7      AFKPRASVLVGWGLVSGFMIAVIFAF-ARDKVR-QRV----HAPGFVGDILDLPEIAIIP
A0A2V8GTX0      PFTPNTRRAWLMAILFGLGFGIAAAF-AIDYLD-DTV----KTPEDVTWRLHLNFLGLVP
Q1ILD9          PVEPAMKLAMALGLIGGLFMGFAGVV-VAEAVD-QSL----KTPDDVELITSLPVIGVIP
A0A7G8BJH7      PKSPNVLLYYAAAIVGGFIFGAGAAF-LRDLSD-TKV----RSLEELERLTGNPLLGLIP
A0A2V8J0X9      PVSPNPRRDWMTAILAGLSIALGLAF-GMEYLD-DSV----KTPEDITKRLRLPLLGLVP
A0A7Y5WWH8      PISPNPRRDWITAILAGLAVAFGLAF-GIEYLD-DTV----KTPEDITRRLKLALLGLVP
A0A7C5SHM3      PAVPRVKLNLALGLVFGIFLGIGAAF-LAEAMD-NKI----RGGAHLAELTGLPLLGSIP
A0A7V6D154      PVLPNIPLNVGLAFLISALVAVGVVL-VWDRLD-NSV----RDPEQVMATLGVPVIGSLP
A0A7V1XXZ2      PSKPNVPRNIALGMFLGLMAGVGLAV-VLDILD-NTV----RTPEEAQQLTSLPSLGLVP
Q1IJZ6          PSHPDPLVNGIVGLGGGLFVGLILAF-VVETLD-DSV----ATTTDAEELTGIAVLGVIP
A0A2V8TCE6      PCKPRPGVELPLGLFVGLLLGMGAAF-GMESWD-NTL----RTQEEIERFLGTPTLARIP
A0A522TBE8      PVAPRPKLTAAVALLLSLLAGVGFVL-ARDALD-QSV----ASAEQVELLFRVPVLGLLP
Q1ITG0          PVLPNVPLFIALGLFGGAFLGVCSAF-VKESID-QTI----SSPEDAEEMAGISTIGLIP
A0A7C2ML20      PSNSR-RSPLVHGALLGLILGIGFAF-FLEFLD-DKV----KTVEDVESFVRLPNLGVIP
A0A7T9HIZ6      PFRPSLRRNLSLGGGVGLLLGLGLAF-LLHYMD-RTV----KTSEQVERELGIPVLAVVP
A0A7C5AXS9      PYKPNYPLNSALGLMLGLMLGVGFVL-IRERAD-RTI----QAPGEVSLWLDAPELGVIP
A0A7C2RGE3      PARPRKLFNIGLSVIVGLLLGIGLAL-FVEYLD-NTV----KSTEDVDRLLGLPVLGLVP
A0A7V6D075      PVAPNIPLNVGLALVLATLFGCGAAI-FADMLD-STV----RDSEQARRILGVEVLGTLP
A0A3N5PCI5      PVRPDTRSTLMIGLLLSGILAVAIAF-IREAFD-SRL----QTPSAV-RALGIPFLGMLP
A0A3M1Q0S9      IFKPKKKLNVALGFLFGLFLGIGAAF-VMEYVD-NTI----KTPDDVRDVLQLPVLGMIP
A0A2Z5G448      AVAPKKRTNYGFGALIGLFIGIAAAL-FLETLD-DTI----RTSEDAEAISSLPSLAVVP
A0A3M1VZ38      IYRPKKKLNILLGFLLGLCLGIGGAV-LAEYID-NTI----KSPDDVRDILDLPLLGMVP
A0A4Q1SD29      PVLPAKRSDVMFGLLGGLIVGMALAF-FMEGLD-DTV----RTSDDAEQIAHLPTLAVIP
A0A833M5K2      PFRPSLTRNLTLGVGGGSLLGLALVF-LLHYMD-RTL----KTRDEVERRLELPVLAVVP
A0A1F2Q9L4      PYRPSLRRNLGLGLVLGLALGLGFVF-FLEYLD-RSV----KTAEDVDRILSLPVLAVIP
A0A7V5ZKV2      PYRPSLRRSLTLGLLLGLGLGLGAVF-LAEYLD-RTI----KSPDDLDRILALPVLAVIP
A0A7Y8LRQ1      PYRPSLRRSLMLGVLLGLGLGLGAVF-LAEHLD-RTL----KSPDDIERVLGLPVLAVIP
A0A3M1PY35      PAVPRYRLDLALSALLGLFLGIGAAF-AAEARD-NKV----RSVEQLGELGGLPVLGSVP
A0A3M1VMP2      PSAPRVKLNLALGLLLGLLLGVGGAF-GAEALD-VKL----RTASQMREITGLPLLGSIP
A0A1F2T595      PVSPNIINNLLLALFGGMVLAVGLAF-TLEYAD-DRI----KNPDELKKLLGLPFLGMIP
A0A2V9AC41      PSYPDKNGILLRGLFLGLLMGVGLAF-LFDQLD-NTI----KSPEEAERFIQLPTLGVVP
A0A2V2R525      PIGPQRTRGVGLAFAFSLAFGIGLAL-LRELSN-NTV----RTMSDVTRSIRLPTIAVVP
A0A321LPW6      PVDAKRLQGVLIALFVSLCAGLIFAF-LLEYLD-NTI----KTVDDVARFVRLPALGVIP
A0A2V9R9V4      PVSPNRQRTILIGLLLSLSGGIGLAW-LLERFD-DSI----RSVDDVNRYTQLPALAVIP
A0A321LE75      PIGPNRMRGILIGLFLSLVAGIGLAF-VLEYFD-NTI----KSVEDVNRYAQLPALGIIP
G2LEI9          PISPRVSYTLSVAFFLSLFGGVGLAF-AREYLN-TRI----KSVEDVDRLLNLPTLGLIP
A0A7V9TW03      PVGPRRMQAVTLAMVLAIAFGIALAL-FLEYLD-DTV----KDSRDVETGLRLPSLAIIP
A0A3N5XQP8      TWWPRRTMNLALAFLGGLFLGLGLAV-TLHLLD-NRV----HSPEDV-LALHIPALGIVP
A0A2V9KCS3      PYKPNLLQHAGVGFIAGLLLGTVFVV-IQEQAD-RSL----QSPGDGPTYLNLPELGVIP
A0A7W1JC10      PVEPSRLPSVVTAFILSLAFGVGLAL-FLNYLD-DSL----HSTSEAEKILSLPVLGAIP
A0A3M2BZG9      PFRPVLRKDLTTALLLGLLAGVGLIL-LIEFFD-RTI----KSPEELEKITGLPTLTVIP
A0A1Q7N5R7      PVKDSASRLIALGFLAGLGFGVVGAV-LVDRLD-RRV----RYPDQVTNGMGLRILGALP
A0A352F549      PVGPRRMQAVTLAMMLATAFGIALAL-FLEYLD-DTV----KDSRDIESGLRLPSLAVIP
A0A3B9MLP9      PIGPRRMEAVFLALVLALVFGVALAL-FLEYLD-DTI----KSPGDIESGLRLPSLAIIP
A0A3D5SQ87      PIGPRRMEAVFLALVLALVFGVALAL-FLEYLD-DTI----KSPGDIESGLRLPSLAIIP
A0A7Y2DUG3      PFGPERNRNIFLAFLVSLLGGIGLAF-LLDYLD-DSI----RTSDDISRNLGLPTLALIP
A0A7Y2D8Q4      PIGPQRTRNIVIAFLVSLVGGIGLTF-LLDYLD-DSI----RSSDDVGRHVGLPTLALIP
A0A2V8NW86      PYKPSLPVNAAVGLLSGLCIGVAFLV-TRGRAD-RTL----RAPGEAQLWLNVPELQVIP
A0A3M2D491      PIGPQRNRNILLAFLASLFVGIGLAF-LFDYLD-DSV----RTVDDVTKHLGLPTLAIIP
A0A7W1CBZ8      PIGPNRTRNIFLAFLISLAAGIGLAF-LLDYLD-DSI----KTSDDIGRHLGLPTLALIP
A0A7W1FC90      PIGPNRNRNILVAFLISLAAGIGLAF-LLDYLD-DSI----KTSDDIGRHLGLPTLALIP
A0A7W1ZXG0      PIGPNRNRNILVAFLISLAAGIGLAF-LLDYLD-DSI----KTSDDIGRHLGLPTLALIP
A0A7W1ZIT3      PIGPNRNRNIFIAFLISLAAGIGLAF-LLDYLD-DSI----KTSDDIGRHLGLPTLALIP
A0A353C9L6      PVGPQRSRNILVAFLLSLAAGLGLAF-LLDYLD-DSV----KTSEDIGRHVGLPTLALIP
A0A2V8RQV0      LVGPPRGRNIFVAFLFSLAAGIGLAF-LMDYLD-DSV----RTSEDIGRHLGLPTLGLIP
A0A2V8SJH5      PIGPARTRNILVAFLVSFGVGIGLAF-LLDYLD-DSV----KTSDDIGRHLGLPTLALIP
A0A136JPP4      PVGPNRARNIFIALLASLGAGIGLAF-LLDYLD-DSI----RTSDDISRALGLPTLAMIP
A0A399WUJ8      PDGPKRARNIFIALLASLGAGIGLAF-LLDYLD-DSV----RTSDDVSRALGLPTLAMIP
A0A7V9C3X9      PIGPQRTRNIFVAFLISLAAGIGLAF-LMDYLD-DSV----KTSDDIGRHLGLPTLALIP
A0A7V9ZSX9      PIGPQRTRNIMVAFLMSLAAGIGLAF-LMDYLD-DSV----RTADDIGRHLGLPTLALIP
A0A3M1SIV3      PIGPPRNRNILISLIVSLFLGIGLAF-LLDYLD-DSV----RDVDDITRHLNLPTLALIP
A0A7V1SCI4      PIGPPRNRNILISFIISLFLGIGLAF-LLDYLD-DSV----RDVDDITRHLNLPTLALIP
A0A7C5ZUA8      PEGPQRGRNVLIAFLVSLFAGVGLAF-LLDYLD-DSV----KTSEDISRQLGLPTLALIP
A0A7T9FQE4      PIGPQRTQNILVAMLIAFAAGVGLAF-LLDYLD-DSV----KSSDDISRHLGLPTLALIP
A0A3E0PHB0      RTGPQRTRNILIALFISLAGGIGLTF-LLDYLD-DSI----KSSDDIGRSLGLPTLGLIP
A0A7T9G4W3      LVGPARSRNILIALFISLVGGIGLTF-LLDYLD-DSI----KSSDDIGRSLGLPTLGLIP
A0A838UAA0      PVGPQRLRNIFVAFLMSLAAGIGLAF-LLDYLD-DSV----RTSEDVSRHLGLPTLALIP
A0A7W1HTU2      PIGPNRTRNIFVAFLISLAAGIGLAF-LLDYLD-DSI----KTSDDVGRYLGLPTLALIP
A0A357F267      PIGPQRNRNIFVAFMLSLAAGIGLAF-LLDYLD-DSV----KESEDIGRHLGLPTLALIP
A0A7V9ICU8      PTGPNRGRNIFVAFMLSFAAGIGLAF-LFDYMD-DSV----KSSEDISRQLGLPTLALIP
A0A7T9JEF9      PQGPNRSRVVFIAFFASLFGGIGLAF-IRNWLD-DTV----RVDDDFELRDGVPVLGMVP
A0A399WNU1      PSGPQRTKNVVIAFFASLFGGIAIAF-GLNWLD-DTI----RVPVASQAQLGAPIVGMIP
A0A3E0PCN7      PQGPNRSRAVLMAFVASLIGGIGLAF-VLNWLD-DTV----RADDNFELHEGVSVLGMVP
A0A7Y4TLV3      PSGPQRTKNVLIAFIASLLGGIGLAF-ALNWLD-DTI----RASDDFEASFGVPVIGLIP
A0A7W0MGQ3      PVGPKRTQSVMLAFFFSLVFGVGLAL-FLDYLD-DTI----GSAEDVEKMLHLPALAAIP
A0A1Q7Y6W9      PVGPNRTRVVMLALVLSFGFGIGFAL-FLDYLD-DTV----RTADDVEKVLRLPALGVIP
A0A2V8NC68      PVGPHRMQGILLASLFSLVFGVALAR-YLDYLD-DSV----RTVEDIERTLRLPSLAVIP
A0A352FLX4      PVAPRRVLTVALAFLFSIGCGIGLAF-IIEYLD-DSV----RSMEDVENLLRLPAIALIP
A0A2V8MHG6      PIGPKRMQAIALAALFALILGIALAR-YLDYMD-DSV----RTSEDVENFLRLPALTVIP
A0A2V8P7N1      PIGPKRMQAIVLAALFALIVGIALAR-YLDYMD-DSV----RTSDDVENFLRLPALTVIP
A0A2V8M3M6      PIGPKRMQAIVLAALFALIVGIALAR-YLDYMD-DSV----RTSDDVENFLRLPALTVIP
A0A1Q7NJH5      PIGPKRMQAIVLAALFALIAGIALAH-YLDYMD-DSV----RTSEDVENFLRLPALTVIP
A0A2V8PJY0      PIGPKRMQAIVLAALFALIAGIALAH-YLDYMD-DSV----RTSEDVENFLRLPALTVIP
A0A7W1BYD3      PVEPNRLPSVGAAFLLSLAFGVGLAL-FLHYLD-DSV----HSTGEVERILRLPVLGAIP
A0A838PIP9      PVEPNRLPNVGAAFLLSLAFGVGLAL-FLNYLD-DSV----HTTGDVERILRLPVLGAIP
A0A399WK13      PVSPRRLTTVLGALFLSTLFGVGLAL-FLEYLD-DTV----RSTEEVESLLQLPALAAIP
A0A7V8YZQ7      PVAPRRLMTVAAALFLSTLFGMGLAL-FLEYLD-DTI----RTTEEIETFLQLPALAAIP
A0A7V9ICV8      PVGPRRLMTVAAALFLSTLFGFGLAL-FLDYLD-DTI----TSTDEVENFLQLPALAAIP
A0A136KC10      PVSPRRLATVLGALFLSTLFGMGLAL-FLEYLD-DTV----HSTEEVESLLHLPALAAIP
A0A7W1IVA5      PVAPRRLMTVVGALFLSTLFGMGLAL-FLEYLD-DTI----RTIEEVETYLQLPALAAIP
A0A7W1ZIE3      PVAPRRLMTVVGALFLSTLFGMGLAL-FLEYLD-DTI----RTIEEVETYLQLPALAAIP
A0A7T9J551      AVSPRRLMTVSLALLLSTVFGMGLAL-FLEYLD-DTI----RSVEEIESYLQLPALAAIP
A0A7V9NLN0      PVAPRRLTTVLGALFLSTLFGMGLAI-FLDYLD-DSI----RTTEEIESLLQLPALAAIP
A0A7T9G8R2      PVSPRRLTTVFVVMILSLMFGSGLAL-FLEYLD-DTI----KTTEEAESYLQLPALAAIP
A0A7Y2D047      PISPRRVTTVGAAMLLSLLFGAGLAL-FLEYLD-DSI----KTTEEVEDYLGLPALAAIP
A0A3M2D6Y5      PVSPRRLLTVMMAFFLSIVFGVGLSL-FLEYLD-DSV----KTVEDVETYLGLPALAVIP
A0A2V8SEX6      AVSPSRLMTVFAALFLSTLFGMGLAL-FLEYLD-DTI----RSTEEIETYLQLPALAAIP
A0A7C5ZUU4      PVSPRRLMTVFAAFFLSLLFGVGLAL-FLEYLD-DTI----SSTEEIETYLQLPALAAIP
A0A3E0PCJ6      PVSPRRLTTVAVVMMLSLLFGAGLAL-FLEYLD-DSI----KTTEEAETYLQLPALAAIP
A0A2V8RTL7      PVAPRRLMTVVAALLLSSLFGMGLAL-FLEYLD-DTI----NTTEEVENLLQLPALTAIP
A0A3M1S4R8      PVSPRRLLTVMMALFLSTCFGVGLAF-FLEYLD-DTI----KTAEDVENYLGLPVLVVIP
A0A7V1SAJ0      PVSPRRLLTVMVALFLSTCFGIGLAF-FLEHLD-DTI----KTAEDVENYLGLPVLVVIP
A0A7W0N726      PVAPRRLTTVLGALFLSTLFGMGLAI-FLDYLD-DSI----RTTEEIESLLQLPALAAIP
A0A7W1HTZ7      PVAPRRVMTVLAALFLSTLFGMGLAL-FLEYLD-DTI----RTTEEVENYLQLPALAAIP
A0A1Q7YFI6      PVGPRRMQGVALGFLFSLVIGIALAR-YLDYLD-DTL----HSAAEVDEMLRLPTLAVIP
A0A7V9C9Y7      PVGPKRMQSIFLAFVLSIALGVALAL-FLEYLD-DTI----RSVEDVEKMLHLPALAVIP
A0A7W1G8A4      PTGPQRLRSVLLALFSSLAAGVGLAI-FLEYLN-DSV----RSTDDLERLLHLPALAVIP
A0A7V9KMZ1      PIGPNRMRIVFIALFLSAGLGIGLAL-FLEYLD-DTV----HSTDEVERLLHLPALAVIP
A0A7W0JTE4      PVGPHRLRTVLIALFLSMGLGVGFAL-FLEYLD-DTV----RSTDEVERLLHLPALAMIP
A0A0B6WWQ6      PIGPARLQAVGLAIVLGLAVGIGLAI-FLDYLD-DSL----QSAEEVERELHLPALAAIP
A0A3B9MK99      PIGPNRSSTVSMALFLSLGLGVGLAL-LLEYFD-DTL----RSSEEVERLLQLPALGVIP
A0A838PA20      PIGPNRMRTVFIALFLSTGLGVGFAL-FLEYLD-DTV----HSTDEVERLLHLPALAVIP
A0A352EX26      PVGPNRMRTVALALFLSLGLGVGLAL-FLEYLD-DTV----HSTDEVERLLHLPALAVIP
A0A7V9R410      PIGPNRSRTVTLALFLSLGLGIGLAL-FLEYLD-DTV----RSTDEVERLLHLPALAVIP
A0A2V8MM59      PVGPARMRSVMLALVLSLALGVGLAL-FLEYLD-DSV----HSTDDVERLLGLPALAVIP
A0A2V8PFE8      PVGPARMRSVMLAFVLALALGVGLAL-FLEYLD-DSI----HSTDDVEKFLRLPALAVIP
A0A2V8PWS6      PVGPARMRSVMLAFVLALALGVGLAL-FLEYLD-DSI----HSTDDVEKFLRLPALAVIP
A0A2V8LCT5      PVGPGRMRTVMLAFVLSLGLGIALAL-FLEYLD-DTV----HSTEDVEKFLRLPALAVIP
A0A352FTJ9      PVGPARLRTVMLAFLLALGFGAALAL-FLEYLD-DTV----HSTDDVERFLRLPALAVIP
A0A1F2S1W5      PISPNIFNSLLMALLGGLTLAVGLAF-GLEYAD-DRI----KNPDEMKKHLGLPFLGMVP
A0A2N9LQU7      PAFPKKSLMLPLGFLISVFGGLVFVF-VLESFD-DSL----RTSEEVEAASSIPALATIP
A0A2P6WFK7      PVEPRIKRNLALGLFGGVIAGLLLAF-GVEALD-DTL----SNSEELETCLALPVLCTIP
A0A2V8JQV5      AYKPDVYMYAMLGLATGVFLGLMLIV-RQEQAD-RSI----HAPAEAPVYLNVPELGVVL
A0A2V8U914      PYKPNLPLNLSIGLFAGLVLAVGSVM-LTEQTN-SRL----RAPGEASFYLNLPELGTIP
A0A2V8DRT9      PASPDKPLNVLLAILGGSIMAVGLAF-FFEYCD-NRI----KSPAEIKAHLGLPFIGMIP
A0A2V7VYF3      PAGPNTRTDFLLAVLVGGVVAVGFVF-GLEYLD-NRI----KSPDEITAHLRMPCLGLVP
A0A1F2SVH2      PVRPNTRNNLLLALFGGATLAVGLAF-FFEYLD-NRI----KSPDEIKQHLGLPFLGMVP
A0A2V8AJG9      PASPNVPTNLLLAFFGGGTLALGLAF-FFEYLD-NRI----KTPDEVKAHLGLPFLGMVP
A0A2V9MAM9      PYKPNFLLNVAIGLFGGLVLAIGCVTVVNQAEA-GRS----REPGDVEARLNLVELGAIP
A0A2V8F956      PVSPQKGLNLLLALFGGSLLACGLVF-FFEHID-SRI----KTPDEVTAHLQLPHLGLLP
A0A2V7W309      RINLSMKKNLQTAFPLGLFLGFAAIF-FLEYMD-RSI----KTPEELERVTKFASLGVIP
A0A348V070      PSFPNRRKTFIIGVLLALIGGAGTSL-FINYLV-ATV----KSSRDIAQATGWPTIGTIP
A0A2Z5G3A3      PTKPNIPLFLGGGLASGLFLGFCAAL-LFDTTD-TKI----QDLDELELMLGGVPIGILP
A0A2V7UGP8      IFRPNKKMNILLSLFVGLALGVGMAF-FLEYLD-NSI----KSTSDVEKYVQLPTLGTIP
A0A239MKT6      NSSPNASRLLATGTAAGLLLGLLIGI-ALHLRD-RFL----YTIEDFQAAWSAPVIGVVP
A0A2Z5G7H4      PKQPNIPVYLAIAAGVGLFLGVCGAF-ISDSID-DKI----QTIEEIERDLELVPLGILP
A0A372IT17      PKSPNLPLYYAAALGAGLFLGCAGAI-TCEFTD-RSI----TSLTEVERLTGAPLFSVIP
A0A841JU67      PKSPNLPLCYAAAVVGGLFFGCVGAV-FSELSD-HTV----RSLDGLERLTGSQLLGVLP
A0A7T9GJJ6      PTGPNRLRSIMLGIMLSLVAGVGLAL-LIEFLD-NTV----KSIEDVARATQLPTLALIP
A0A7Y4UER8      PIGPKRMRTILLGLLVSLVFGIGLAF-FLEYLD-NTV----KSVDDIQRFAQLPTLAIIP
A0A2V8IYW3      PFSPKRLQLNLTAIGIGLMLGMAVSA-LLEYRD-TSL----RTESQLLEALKIPVLAVLP
A0A7V2HCZ0      PYKPNHISNMAIGLALGLILGCLVVF-TSDQVN-HSL----KAPGEASYYLKLPELGVIP
A0A2V9AEW6      PYRPSLPMNSAIGLLGGMFLGLGFVL-LRERLD-RRI----SAPGEAQIYLDLPELGVIP
A0A2V8WQK6      PYRPSLPVNSAIGLFSGVFLGFGFVL-LRERID-RRI----SAPGDAQVYLDLPELGVLP
A0A2V8XIF4      PYRPSFPMNSAIGLFSGLFLGFGFVI-LRDRLD-RRI----TAPGDAQAYLDLPELGVIP
A0A350UQT3      PVFPKLTLNLLLAFLFSSLLAVGAAI-LVDTLD-NTI----RDPEQVSRTLKTHIIGTLP
A0A7C3HRX0      PVFPKMWLNLLIAFLFSSVLACSAAL-LADSLD-TTI----RDPEQVTQTLRTHIAGTLP
A0A2W0BGU4      PVRPRTRLNIVLGLLVGMIFGSMLAF-IQDSLD-NSL----KSPEEVEMLIATRALALIP
A0A2W0BVQ9      PVRPRTRLNIVLGLLVGMIFGSMLAF-IQDSLD-NSL----KSPEEVEMLIATRALALIP
A0A317J121      PYKPRPALNIAFGTMAGLFLSVGIAF-LWERMD-KSV----RTPGHSRTLLNVPELGVIP
A0A2V9MN96      PAKPDVRRNIFLGFLLGLAGGVALAF-LQESMD-TTV----GSLEELSAITALPMLGVIP
A0A2V7V2Z1      PVRPRTTRDILYGVFLGLALGIGLAF-FLDYLD-NTI----KTPEDVRKQLAAPLLAVIP
A0A2V7X2F7      PVRPNRQRDILTGALLGLVLAFGAAF-FLEYLD-NTL----KTPDDVRNHLGAPLLGVVP
A0A2V7V2I1      PVRPNRPSDIAMGLFLGLALGVMAAF-FLEYLD-NSI----KTPEEVRLHLGVPLLGVIP
A0A2V7U3M2      PVRPQKTRDIAMGVALGLFLGIGLAF-FLDYLD-NTI----KTPEDVRKQLGAPLLAVIP
A0A2V7UHT0      PVRPQKTRDIAMGLALGLFLGIGLAF-FLDYLD-NTI----KTPEDVRKQLGAPLLAVIP
A0A3P0X3W6      PVFPKKGIFIFIGFFLSGVIAVAATL-LSDMMD-KSV----RDPEQARRSLQVEVLGILP
A0A7V2MG68      PVFPQVGINVLVAFLLSGLLAVGYAL-VADTMD-DTI----RDPEQASRSLRVPVVGSLP
A0A7C6A629      PVFPDLKLNLALAFLLSSLLAIGAAI-LSDAMD-KTI----RDPEQVARTLNTEVVGSLP
A0A7V2HBQ5      PVYPNIPLNVAIAFLLSALAAVAAAI-VSDAVD-TTI----RDPEQVCRSLNVEVVGTLP
A0A2U3JZ71      AVFPNIKLNVLLAFLLSTLLAIGTAI-CADLLN-NAV----RDPEQVARTLSTEVIGTLP
A0A2V8TTB0      PVFPLTWLNVLLAFLFATFLGVGAAV-LTDVLD-NTI----RDPDQVARLMNTNVVGSLP
A0A2N9MK30      PVFPNVPLNVGLALLFAAILAVGAAV-LSDTLD-NTI----RNTEQVARIVKAEVIGGLP
A0A3D1ASD2      PVFPRTRLNVLIAFLFSTILAIGAAV-MSDVLD-NTL----KDPEQIARTLKTQVIGTLP
A0A7R8B699      PVFPNIRLNLFLSLLVALVIGVAGAI-LADLLD-NTI----TDPEQAARVLNTDIVGGLP
A0A7S7SGU3      PVFPKLSLNLLLALLFSTLLAIGVAI-LTDTMD-NTI----RDPEQVTRTLKTHIIGTLP
A0A7Y8HY45      PVFPKLWLNLLIAFLFSAVMAVGLAL-ASDSMD-TTI----RDPEQVAQTLRIQMVGTLP
A0A7C5AXI3      PVFPNMKLNVLLAFLFSTLIAVGMAV-LSDVLD-NTL----RDPEQVARVLRTEVVGTLP
A0A7C6E4H7      PVFPNLKLNLALAFLLSSLLAVGAAI-LSDSLD-KTV----RDPEQVARTLNTEVVGSLP
A0A2Z5FVL3      PSRPNIPLYLAGSLATGLLFGCIMAV-VVDLMD-SKI----ADIHGLESLMGEAPFGILP
A0A2V8GFD4      PAYPRKRTNVTYGLLAAVLLAGMFGF-VIEALD-TCL----KTPDDIKVQLGLPFLGLVP
A0A2V8HSS5      PAYPRKRTNVTYGLLAAVLLAGMFGF-VIEALD-TCL----KTPDDIKVQLGLPFLGLVP
A0A2V8KP55      AVTPNHKLNLAWGIFFGLIFGVGSAV-FQEYID-RSI----KSPDDVTRHLGLLALGTVP
A0A2V9JSI3      PIRPKKTQNIAMGLLGGLALGVMLAL-FADVLD-NSV----KSVEDIERLTGMPTLAVIP
A0A2V9WI32      PSAPNIPRDIVLGLALGLFGGIGLAF-VLESLD-NTV----RTPEEAQIISALPSLGIIP
A0A2V9KBD6      PSEPNLVRNVALSLAFGLFGGMCLAFGLEKINE-KTI----RTVEQVQLLSPLPVLGALP
A0A2W0AJ66      PSEPNVPRNFGLSVGFGLVGGVLLAFGLAKMHE-P-I----STLEQAQILSPLPALGVVP
A0A1Q7RBU1      PAEPKILRNLALSLLFGIFGGVLLAFGLTKMNE-K-I----STLEQALALSPLPSLGVVP
A0A2V9JPV9      PAEPNILRNFALSLLFGIFGGVLLAFGLTKMNE-T-I----STLEQAIALSPLPSLGVVP
A0A7V0Y3A1      PHWPNLPLNLALGSMGSLFLGAAFVI-VRTRTD-VSV----QGPGALTPYLHLRELGVIP
A0A7C5Z4J3      PIRPKKARNIAVGLMVGLVLGTTLAF-LNEALD-TSI----KTAEDIERSIAEPVLSVIP
A0A1F2TPT3      PVGPDKGRSILGAVFAGLGLALVLAF-GFEYLD-NRI----KLPEEIGQRLGLPVLGFLP
A0A2V8JTQ2      PAEPNILRNLALSLLFGICGGVWLSFGLAKIEE-KTI----NTVEQAQSLSSLPALGVLP
A0A2V8UZY0      PVEPDIRRNFALSLLFGIFGGVLLAFGLAKVNE-KTI----ITLEQARLLSPLPALGVLP
A0A350UEK1      PYKPSLPLNAVLGLLAGGFLAVGFVV-TTEKAD-RAL----REPSDIPFYLGARELGVVP
A0A350UIQ4      PYKPRLPLNALLGLLAGGFLAVAFVV-TTEKAD-RAL----REPSDVPFYLGVRELGVVP
A0A7T9GJN6      PVRPNRLRSILLGLALSLAFGVAVAL-VIEYLD-NTV----KTTEDVTRFVQLPTLAVIP
A0A7T9GJN7      PVGPMRFRTILIGLLVSLVAGMGLAF-FLEYLD-NTV----KSVEDIGRIAQLPTLAVIP
A0A1H5Z7N3      PTLKPRSTILMIDLVVALIVGLIVAF-VLDSLD-TGL----RDVMEIERITGLPSLAVIP
A0A1G7JVV8      PTMTPRSSILSRDLILSLVFGIMLAF-ALESLD-TGI----RSVSEVEHITQLPSLSIIP
A0A1H4T6W9      PSITPRSTILLRTLLISLVAGLMIAF-TMESLD-TGI----RSVAEVEQITQLPSLSVIP
I3ZEU5          PSMTPRSTILLRTVLIGLVAGLMIAF-TMESLD-TGI----RSVAEVEQITQLPSLAVIP
A0A7W7ZGZ3      PTLKPKSTIMITAFIVSALAGIMIAF-ILESLD-TGL----KSIADVEAATQLPSLAIVP
A0A7G8BSK5      PTLKPKSTVILTYLFFGFLAGVILAF-LLESLD-TGL----RTVAEIENIIELPSLAVIP
A0A428MDU2      PMLRPQSTIIMTSFVFGLLGGIVLAF-LMESLD-TGL----RSVAEIESITELPSLAVIP
E8WVF6          PQSTPQSTIILTYFAVSLVLGTLLAF-LLESLD-TGL----RSVAEIEAITELPSLSIIP
A0A1I6MH75      PRLQPYSSVVLTACIFALLVGIILAF-TLESLD-TGL----RSIAEIESVIELPSLAIIP
A0A7Y9TM87      PTLQPKSTIVIVALLVSLIIGASIAF-LMESLD-TGL----RSIAEIEAITELPSLAIIP
A0A7W8J1H5      PQLRPQSTVILTALVFGLLAGIVAAF-LMESLD-TGL----RSIAEIESITELPSLAIIP
A0A7Y9T5K4      PVLRPQSTVIITALVFAMLAGIVVAF-LMESLD-TGL----RSIAEIESITELPSLAIIP
A0A852VHP9      PVLRPQSTVIITALVFALLAGIVVAF-LMESLD-TGL----RSIAEIESITELPSLAIIP
A0A7W8IFZ2      PVLRPQSTVILTALIFALLAGIVVAF-LMESLD-TGL----RSIAEIESITELPSLAIIP
A0A7W8J9Y9      PVLRPQSTVIITALIFSLLAGIVVAF-LMESLD-TGL----RSIAEIESITELPSLAIIP
A0A7L5A6M5      PTMRSKSFDLLLASLVALIIGVLLAF-LLENLD-TGL----RSIAEIEAITELPSLAIIP
A0A5B9EBI2      PTLQSATTIIIVTLLFSLFGGIVIAF-LLESLD-TGL----RTIAEVEGITELPALAIIP
A0A7Y5RFT3      PTLQSATTIIIVTLLFSLFGGIVIAF-LLESLD-TGL----RTIAEVEGITELPALAIIP
A0A239HDF6      PMLRPKSTLVLTTLAVAMILGVLIAF-LLDTLD-TGI----RSVTELEAITEMPSLAVIP
A0A4Q0T270      PTLQPYSSIITTNVLFALIVGIVVAF-VLDSLD-TGL----RSIAEIESVIELPSLAVIP
A0A1Q3QQB6      PTLKRRSTVVLTGMVFGLLGGIIIAF-IVESLD-TGL----SSVAEIESLIELPSLAVIP
A0A3N1K1G7      PVLRPQSTIILTMLFVGLIAGIIIAF-LMESLD-TGL----RSIAEIESITELPSLAIIP
A0A4V2G466      PTLKPKSTVVLTYLFMGLVAGVMLSF-LLESLD-TGL----RSVAEVESIIELPSLAIIP
A0A6B9YNQ8      PTLKRKTTVVLTYLVLGFIAGVMMAF-LLESLD-TGL----QSVADVEAFLELPSLAIIP
A0A3N6A5T6      VYRPRTAINLALGLILGLMLGVSMAF-FIDYLD-NTI----KTPDDIEKTLDLPSLGVIP
A0A2V8R8U7      -VGPQRMRNIMIAFVLALVAGIGLAF-LIDYLD-DTV----KSLDDIDRYIHLPALALIP
A0A7V9Q528      PVGPQRGRNILIALILSLGAGVGLAF-LLDYLD-DTL----KSVEDVDRYVHLPTLALIP
A0A2V8QMP4      PIGPPRVRNIIIALLLSIAVGIGLAF-LLDYLD-DTL----KSIEDVDRHLHLPTLALIP
A0A2V8R4S3      PIGPPRVRNIIIALLLSIAVGIGLAF-LLDYLD-DTL----KSIEDVDRHLHLPTLALIP
A0A2V8NJ55      PVGPARSRNIIVAFLLSLGVGIGLAF-LLDYLD-DTV----KSIEDVDRYIHLPALALIP
A0A7V9ZQ50      PIGPSRMRNIVVAFLLSLAIGIGLAF-LLDYLD-DTL----KSVEDVDRYIHLPALALIP
A0A2V8Q7I0      PIGPARLRNVMIAFVLSLVAGIGLAF-LLDFLD-DTV----KSVDDIDRYVHLPALALIP
A0A2V8S6K4      -VGPPRVRNIIIALLLALGAGIGLAF-LLDYLD-DTL----KSIEDVDRHVHLPTLALIP
A0A317I2L9      PIGPARIRNVMIAFLLSLVAGIGLAF-LLDFLD-DTV----KSIEDIDRYVHLPALALIP
A0A2V8LLF9      PVGPARLRTIILALVMSLLVGIGLAF-LLDFLD-DTL----KSVDDVDRYLHLPALALIP
A0A352FRF4      PVGPARLKTILIALILSLVAGIGLAF-LLDFLD-DTI----KSVDDVDRYINLPALALIP
A0A7W1GE99      PVGPQRGRNILIAFILSLGAGVGLAF-LLDYLD-DTL----NSVEDVDRHIQLPTLALIP
A0A1Q7YKQ8      PVGPPRLRNILIAFLLSLGAGIGLAF-LLDYLD-DTL----KSVEDVDRYLHLPALALIP
A0A0B6WXT1      PVGPKRLRNILIALLVALGAGIGLAF-LLDYLD-DTL----KSAEDVERYLHLPTLALIP
A0A2V8MKV0      PTGPPRTRNILLALALALLAGIGLAF-LLDFLD-DTV----KSLDDVDRYIHLPTLALIP
A0A2V8PYY8      PVGPQRTRNILVALALAFLAGIGLAF-LLDFLD-DTV----KSLDDVDRYIHLPTLALIP
A0A3B9MEU8      PVGPQRLRNIFVALLLSLGAGIGLAF-LLDFLD-DTL----KSVDDVDRYLHLPALALIP
A0A352F3R7      PIGPQRLRNIFIAFLLSLGAGIGLAF-LLDFLD-DTV----KTVDDIDRYLHLPALALIP
A0A7W0GRF6      PIGPQRFRNILVAFLLSLGAGIGLAF-LLDFLD-DSV----KSIEDVDRYIHLPALALIP
A0A7W1H6G6      PIGPQRFRNILVAFLLSLGAGIGLAF-LLDFLD-DSV----KSIEDVDRYIHLPALALIP
A0A7V9HZC8      PIGPPRLRNILIAFLLSLVAGVGLAF-LLDFLD-DTV----KSIEDVDRYIHLPALALIP
A0A7W0XCB9      PVGPPRLRNILIAFLLSLVAGIGLAF-LLDFLD-DTV----KSIEDVDRYIHLPALALIP
A0A3N5YNR8      PYSPQRAGDLALGLGVGLFLAIGLAF-LMEYLD-NTL----KTPEDMEQSLGLPSLGVIP
A0A7W7ZUJ7      PTKPNIPRNLEFALLVGLVVGIALAF-GLEALD-ATV----RTPEQAETTSGLPVLGVIP
A0A2V2R0I6      PSRPAKARNLALAFLVGLVGGVGLAL-LREYLD-NTV----KSPDDVENLARLPSLAVVP
A0A2V8XAR9      PSRPAKARNITLAFLVGLVGGIGLAL-MREYLD-NTV----KSPDDVETLARLPSLAVVP
A0A2V8VZA0      PARPAKTRNVALAFLVGLVGGMGLAL-MREYLD-NTV----KSPDDVETLSGLPSLAVVP
A0A1Q7CB82      PARPAKTRNVALAFLVGLVGGMGLAL-MREYLD-NTV----KSPDDVETLSGLPSLAVVP
A0A2V8WIU1      PARPAKTRNVALAFLVGLVGGMGLAL-MREYLD-NTV----KSPDDVETLSGLPSLAVVP
A0A1Q6Y9F5      PARPAKTRNIALAFLVGLVGGIGLAL-MREYLD-NTV----KSPDDVETLSRLPSLAVVP
A0A2V9EVV8      PARPAKTRNIALAFLVGLVGGIGLAL-MREYLD-NTV----KSPDDVETLSRLPSLAVVP
A0A2V8YF91      PARPAKTKNITLAFLVGLVGGIGLAL-LREYLD-NTV----KSPDDIEALARLPSLAVVP
A0A2V8XZK2      PARPAKARNIMLAFLVGLIGGIGLAL-MREYLD-NTV----KTPDDIESLARLPSLAVVP
A0A2V8ZTX6      -------KNIILSFLVGLVGGIGLAL-LREYLD-NTV----KTPDDIETLARLPSLAVVP
A0A2V9BT79      PARPAKGKNIMLSFLAGLVGGIGLAL-LREYLD-NTV----KTPDDIETLARLPSLAVVP
A0A2V9YHT3      PSQPDVPRNLLLGLAAGLIAGVVLAF-GAEVMD-STI----RTPEQVQIVSALPSLGIVP
A0A7C2XNI7      PARPQKARNVLLALLVGLVGGVGLAF-LREYLD-NTV----KTPDDIEHLARLPSLAVVP
A0A1Q8B793      PARPAKMRNISLAFLVGLVGGIGLAL-LREYMD-NTV----KTPDDVEMLARLPSLAVVP
A0A2V9BCA0      PARPAKMRNISLAFLVGLVGGIGLAL-LREYMD-NTV----KTPDDVEMLARLPSLAVVP
A0A2V9BWU9      PSRPQKTRNILLAFLIGLVGGVGLAL-LREYLD-NTV----KTPGDIEMLTRLPSLAVVP
A0A2V9DKX2      PSRPQKTRNILLAFLIGLVGGVGLAL-LREYLD-NTV----KTPGDIEMLTRLPSLAVVP
A0A7C2YQY3      PIRPRKSLNIALSAVVGLILGGALAL-FNEYLD-NSV----KVPEEVEQLIGLPALGVIP
A0A845TWB8      PDRPKKLINILMGLMVGLVLGAVMAI-FNEYLD-NSV----KVPEDVERLVNLPVLGIIP
A0A2U3KC61      PITPNVPRNIELGLLLGLACGIGLAF-VLESLD-TSI----RNMEELSAISTLPALGTIP
A0A2V9Y2R7      PVKPDVPRNIKLGFILGLCLGVGLAF-VLESCD-NTV----RNMEQVSAISTLPALGMIP
A0A2V9NGH6      PAEPDVPRNLSFALVLGLTTGVSLAF-LLEGID-NTV----RTPEQAQAISGLPSLGIIP
A0A2V9PYE6      PAEPDVPRNLSFALVLGLTTGVSLAF-LLEGID-NTV----RTPEQAQAISGLPSLGIIP
A0A2V9NL07      PAEPNIPRNLGFALALGLTSGIGLAF-LLEGID-NTV----RTPEQAQLISGLPSLGMIP
A0A2V9QD92      PAEPNIPRNLGFALAFGLTSGIGLAF-LLEGID-NTV----RTPEQAQLISGLPSLGMIP
A0A2V9WPZ6      PSEPNIPRNLAFGLLLGLTSGIGLAF-LLENLD-NTV----RTPEQAQIISSLPSLGS-R
A0A2V9ZLH4      PSEPNIPRNLAFALLLGLTSGVGLAF-LLENLD-NTV----RTPEQAQMISALPALGMIP
A0A2V9RQF1      PAEPNVPRNLSFALALGITTGIGLAF-LLEGID-NTV----RTPEQAEAISGLPSLGMIP
A0A2V9YDK8      PSEPNIPRNLAFALVLGLTSGVGLAF-LLENLD-NTV----RTPEQAQIISGLPSLGMIP
A0A2V9V8F7      PSEPNIPRNLAFGLLLGLTSGIGLAF-LLENLD-NTV----RTPEQAQLISSLPSLGMIP
A0A2V9XGR9      PSEPNIPRNLAFGLLLGLTSGIGLAF-LLENLD-NTV----RTPEQAQIISSLPSLGMIP
A0A2V9V3Q5      PVEPNIPRNLLFALVLGVSSGVGLAF-LLEGMD-NTV----RTTEQAQMISALPSLGMIP
A0A2V9NWS3      PVEPNVPRNLAFALALGLSTGIGLAF-LLEGVD-NTV----RTPEQAQAISALPSLGIIP
A0A2V9USA9      PIEPNIPRNLGFALVLGLMSGVGLAF-LLEGLD-NTV----RTTEQAQTISGLAPLGMIP
A0A2V9XW18      PIEPNVPRNLLFAAVLGLASGMGLAF-LIEALD-NTV----RTTEQAQMIAGVASLGMIP
A0A1H5SQF5      PSRPQPVQNIALGFLAGLATGLFLAF-ATAYHN-DVL----STPEEVASLTSLPLLGLVP
A0A2V8G155      PVEPRVQYMLTLGGCGAFLFALCLAF-FFEHFD-NRI----KTPEEIQTHLRLASLGLVP
A0A2V8HDM7      PVEPRVQYMLTLGGCGAFLFALCLAF-FFEHFD-NRI----KTPEEIQTHLRLASLGLVP
A0A2V8IVN9      PSSPQYALNLLLGLLGGTMLGVGLAF-FFEYLD-SHI----KTPDEIRAHLGMPALGMLP
A0A7W1SCW7      PVAPRTSLNLAGALVGGVMLALGLAF-FFEYVD-SSI----KSPEEVKAYLGLPTLGMVP
A0A3E0NV31      QYAPNKTRSTLFALGIGLALGIAAAL-GLEFLD-QTV----KSSDHITESIGLPVLGTVP
A0A3N5M5V0      PYSPQRAADLALGFGVGLLIAVGLAF-LMEYLD-NTL----KTPEDMEQSLGLPSLGVIP
A0A7X7XDY5      PFKPNPVRNLLLGMLIGLLLGVGLAF-FIEYMD-NTV----KTPDQVEQLTTLPSLGVIP
A0A2V9L5B5      PAKPRVLLNLVLGLILGLGLGVGMAF-FQEYLD-KTL----KTPDEVERLLRLPSLGVLP
A0A2V9LK56      PVRPRVILNLALGIIFGLGLGVAGVI-LLEYLD-NTL----KSPSQVESLLRLPSLGVIL
A0A2V9L7I0      PAKPRVLLNLILGLVVGLALGVGVAF-LQEHLD-KTL----KTPDEVERLLHLPSLGVLP
A0A522PPT0      PAKPRVILNLAVGFILGLSLGVGLAF-LQEYLD-NTL----KTPDEVEFLLRLPSLGLIP
A0A7C5V1G5      PAKPRVVLNLAFGCILGLSLGVGLAF-LQEFLD-NTL----KTPDEVESLLRLPSLGMIP
A0A4R1LC91      PAKPNVPLVLAGSLLGGLFLGCCGAL-LADVMD-NKI----QDVSELEGYIGGLPIGILP
A0A2V9QB26      PYKPNLPMNAAVGLLSGLCIGVAFVV-TRGRAD-RTF----RAPGEAQLWLNVPELQVIP
A0A2V9VYY4      PISPNVHRSLVLGFLLALGLGVGLAL-VRETFD-STV----RSMEEVRAVSTLPALGTIP
A0A2V9KIE8      PVKPRVILNLALGFAFGLALGIGLAF-FQEYLD-NTV----KSPDEVEELVRLPSLAVLP
A0A7C2GJ20      PARPRKLFNIGLSVLVGLVLGVGLAL-FVEYLD-NTV----KSAEDVDRLLGLPVLGLVP
A0A7C4BTL5      PYKPDVPMNAGVGLLAGLGLGVAFVI-IRERAD-RTL----QEPGDAPFYLNVPELGVIP
A0A7X8YVF2      PHAPNIPRTLALALLLGGMGGVGLAF-FLDYLD-NSL----KTPEEIEERVGLPSLGLIP
A0A7X7YEP0      PYRPSLQRNLSIGLVLGLGLGLGLVF-LLEYLD-RSI----KAPEDVERVLSLPTLAVIP
A0A2V9CBM2      PAKPKILLNLVLASILGLALGVGEAF-LQERLD-DTV----TGADDVERLCGLSVLALIP
A0A2V8XN17      PVKPRTLLNLSVALFLGLALGICAAL-FQERMD-DTL----KGDDDVERLLGLPSLALIP
A0A2V8WX45      PVKPRIALNLMVAAFLGLGLGVCAAF-FQERMD-NTL----KGDDDVERLFGLPSLALIP
A0A1Q6YR79      PFKPRTLLNLSVAVFLGLALGICAAL-FQERMD-DTL----KGDDDVERLLGLPSLALIP
A0A1Q7VA32      PFKPRTLLNLSVAVFLGLALGICAAL-FQERMD-DTL----KGDDDVERLLGLPSLALIP
A0A2V9EY85      PFKPRTLLNLSVAVFLGLALGICAAL-FQERMD-DTL----KGDDDVERLLGLPSLALIP
A0A2V9H8K0      PVTPRTLLNLAVAMFLGLGLGICTAL-FQERMD-DTL----KGDDDVERLFGLPSLALIP
A0A2V9FFE5      PVKPKILLNLAVAMFLGLGLGIGTAL-FQERMD-NTL----KGDDDVERLFGLPSLALIP
A0A2V9GM43      PVKPKILLNLAVAMFLGLGLGIGTAL-FQERMD-NTL----KGDDDVERLFGLPSLALIP
A0A2V8ZHL8      PVRPQKLLNIAIGLVVGLILGVTLAF-VKEALD-TSI----KSIEEAERVVNAPALAVVP
A0A2V9B240      PVRPQKLFNIAVSLVVGLILGVTLAF-VKEALD-SSI----KSIEEAERVVNAPALAVVP
A0A2V9CYQ5      PAKPKILLNLLVASILGLALGVGEAF-LQEHLD-DTV----RGADDVERLFGLSVLGLIP
A0A2V9BWU8      PAKPRIPLNLAVAALLGLGLGISTAF-LQERLD-DTL----KGADDVERLFGLSALALIP
A0A2V8ZG48      PAKPKIPLNLAVATLLGLGLGISAAF-LQERLD-DTL----KGADDVERLFGLPALALIP
A0A2V8Y334      PAKPRIPLNLAVGVLLGLGLGISTAF-LQERLD-DTL----KGADDVERLFGLPALALIP
A0A2V9AY68      PAKPKIPLNLAVASLLGLGLGISAAF-LQERLD-DTL----KGADDVERLFGLSALALIP
A0A1F2RFI7      PAKPQKLVNLALALIFGLGLGVGMAF-FQEYLD-NTL----KTPEDVQRFLHLPTLGIIP
A0A1F2RZS3      PSKPRKLMNLALALMVGLSLGIGMAF-FQEYLD-NTL----KTPEDVQRYLRLPTLGVIP
A0A845TW47      PAKPNLLVNLGLGLLLGLGFGVGAAF-LLEHLD-NTL----KSAEDVERFLQVPALALIP
A0A845TXC1