BYKdb

Dataset for cluster tadcd of phylum acidobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

316 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2V7VMF7      MDVGQPAGFPGYDMDTFRTGVGYEVGPSMRASMGYERQRVPGAPDRPVIEAEADSVFLKV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      TDDRGPAGSGQVEVAYRDQRSPRAAAAGQRFRGLNYAATLRRAVGVNTLVELGGGRATDV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      SGFEANAFYVSSFARGGLTVALPWELSLHAGRGGLGLEPLPTGRERDRAPARRRPLWLVR
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      GSEPVVRPPPLPARGLPARPARLQHPRLRSRDPRIHRPARDRPVPRQGHRGEGHAVKSLA
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LLLAALVLPGARMVAQEAPRPPATPAPEYVVGPGDILQITVYGNEELSRAPTVQSNGTIG
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LPLLGDVAVTGLSASEIQRKLTALLARDFLVNPQVEVKVKEYQSQFVSVVGEVNNPGRKA
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      -----MEAPNSIQATVPLTATAGPISVTTPAGTGTSSAPFKSATRFENTDPALTYTSGWD
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LRGRTRLFDVLIEAGGFTPRASGEVVITRREGTFDNGGHSLRLQFSGASPAPKDLVNLEV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      RTSTLRPWSVGTAAVASTAGQQVTFTFSGTDLTWIGFRGPQAGIARVSLDGVFIQQLDMY
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A7C2G442      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A7C5ZUU4      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A7C5Z4J3      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A7L5A6M5      ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
A0A7G8BSK5      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      -----------------------------------------------------------M
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A7C2XNI7      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A7C2YQY3      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A7C5V1G5      ------------------------------------------------------------
A0A2V9KCS3      -----------------------------------------------------------M
A0A372IT17      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A7C5ZUA8      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A7C2GJ20      ------------------------------------------------------------
A0A7C4BTL5      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A7C2VB08      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      PLQNGDLITASAKYYVTVEGEVVRPGRYPLEEETTISTAVIAAGGLTRFAKNDVRIRRVS
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      SVAEEVQAEVFKATGLASGNHTLLIEVTGTSNPASTGSYVAVDAFDIAPQVPATVNITSP
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      --------------------------------------------------------MAQE
A0A2V9R9V4      --------------------------------------------------------MSDQ
A0A321LE75      --------------------------------------------------------MSDE
A0A2V8R8U7      -----------------------------------------------------------M
A0A2V8QMP4      -----------------------------------------------------------M
A0A2V8R4S3      -----------------------------------------------------------M
A0A2V8NJ55      ----------------------------------------------------------MM
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      -----------------------------------------------------------M
A0A317I2L9      ----------------------------------------------------------MM
A0A2V8LLF9      -----------------------------------------------------------M
A0A352FRF4      -----------------------------------------------------------M
A0A2V8MKV0      -----------------------------------------------------------M
A0A2V8PYY8      -----------------------------------------------------------M
A0A1Q7YKQ8      ----------------------------------------------------------MV
A0A352F3R7      -----------------------------------------------------------M
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ----------------------------------------------------------MM
A0A2V8MHG6      -----------------------------------------------------------M
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      -----------------------------------------------------------M
A0A1Q7NJH5      -----------------------------------------------------------M
A0A2V8PJY0      -----------------------------------------------------------M
A0A1Q7Y6W9      --------------------------------------------------------MKES
A0A2V8NC68      --------------------------------------------------------MKES
A0A399WK13      -----------------------------------------------------------M
A0A352FLX4      -----------------------------------------------------------M
A0A2V8RTL7      -----------------------------------------------------------M
A0A3E0PCJ6      -----------------------------------------------------------M
A0A3M1S4R8      -----------------------------------------------------------M
A0A7C2G442      -----------------------------------------------------------M
A0A1Q7YFI6      -----------------------------------------------------------M
A0A136KC10      ------------------------------------------------------------
A0A3M2D6Y5      -----------------------------------------------------------M
A0A2V8SEX6      -----------------------------------------------------------M
A0A7C5ZUU4      -----------------------------------------------------------M
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      -----------------------------------------------------------M
A0A2V8MM59      -----------------------------------------------------------M
A0A2V8PFE8      -----------------------------------------------------------M
A0A2V8PWS6      -----------------------------------------------------------M
A0A2V8LCT5      -----------------------------------------------------------M
A0A352FTJ9      -----------------------------------------------------------M
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------MSVPSQ
A0A1F2T595      -------------------------------------------------MSTQIPPEFSQ
A0A2V8JQV5      --------------------------------------------------------MDME
A0A2V9AC41      --------------------------------------------------------MEQV
A0A2V9MAM9      --------------------------------------------------------MLPV
A0A348V070      --------------------------------------------------------MDKI
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      -----------------------------------------------------------M
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      -----------------------------------------------------------M
A0A2V9LPQ3      --------------------------------------------------------MADI
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      --------------------------------------------------------MAFD
A0A3E0PCN7      --------------------------------------------------------MQKN
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          -----------------------------------------------------MPQEHPN
A0A317J121      --------------------------------------------------------MRHL
A0A2V7YW66      --------------------------------------------------------MSPL
A0A2V7Z0V0      --------------------------------------------------------MSPL
A0A2V8GFD4      --------------------------------------------------------MSDN
A0A2V8HSS5      --------------------------------------------------------MSDN
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      --------------------------------------------------------MQSN
A0A2V9JSI3      --------------------------------------------------------MTND
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      --------------------------------------------------MSDIRNFDPS
A0A7C5Z4J3      ----------------------------------------------------MPQEANES
A0A1F2TPT3      --------------------------------------------------------MSDE
A0A2V8JTQ2      -------------------------------------------MSESFELMNQRARDFDP
A0A2V8UZY0      -------------------------------------------MSKYFELMNRLRRD-SP
A0A350UEK1      -------------------------------------------------------MSQQS
A0A350UIQ4      -------------------------------------------------------MPKPT
A0A1H5Z7N3      --------------------------------------------------------MIPV
A0A1G7JVV8      --------------------------------------------------------MPPL
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          --------------------------------------------------------MPPA
A0A7L5A6M5      --------------------------------------------------------MTPD
A0A428MDU2      --------------------------------------------------------MGLE
A0A5B9EBI2      --------------------------------------------------------MGPQ
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ----------------------------------------------------------MA
A0A1Q3QQB6      --------------------------------------------------------MGLQ
A0A3N1K1G7      --------------------------------------------------------MGPK
A0A4V2G466      --------------------------------------------------------MGPQ
A0A6B9YNQ8      --------------------------------------------------------MGLQ
A0A7G8BSK5      --------------------------------------------------------MGPQ
A0A1I6MH75      --------------------------------------------------------MDRQ
E8WVF6          --------------------------------------------------------MSSD
A0A3N5YNR8      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A2U3KC61      --------------------------------------------------MPLQPKRNNS
A0A2V9Y2R7      --------------------------------------------------MDSPIVVRSA
A0A2V9NGH6      -------------------------------------------------MDSAPLIAANT
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      -----------------------------------MYLLFQFSIQLGRQMEPSPVMQI-G
A0A2V9QD92      -------------------------------------------------MEPSPVMQI-G
A0A2V9WPZ6      ----------------------------MACWSALLGRNRMQDCCSGVGMDSGPLVHTNG
A0A2V9ZLH4      -------------------------------------------------MEPGSLIPSNG
A0A2V9RQF1      -------------------------------------------------------MPANA
A0A2V9YDK8      -------------------------------------------------MDSGPLVQTNG
A0A2V9V8F7      CSARMRQTFITNNFLSASEHPRRRLWSLWACWSALLGRNRMQDCCSGVGMDSGPLVHTNG
A0A2V9XGR9      -------------------------------------------------MDSGPLVHTNG
A0A2V9V3Q5      -------------------------------------------------MALGPLVPHND
A0A2V9NWS3      --------------------------------------MVGLNFFLGASMASGPLIPANG
A0A2V9USA9      -------------------------------------------------MDSGPLVPANS
A0A2V9XW18      -------------------------------------------------MDLGPLAPLGT
A0A1H5SQF5      ------------------------------------------------------MPYDPL
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A2V2R0I6      --------------------------------------------------------MADE
A0A2V8XAR9      --------------------------------------------------------MADD
A0A2V8VZA0      --------------------------------------------------------MADE
A0A1Q7CB82      --------------------------------------------------------MADE
A0A2V8WIU1      --------------------------------------------------------MADE
A0A1Q6Y9F5      --------------------------------------------------------MADE
A0A2V9EVV8      --------------------------------------------------------MADE
A0A2V8YF91      --------------------------------------------------------MTDE
A0A2V8XZK2      --------------------------------------------------------MAEE
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      --------------------------------------------------------MTDE
A0A2V9YHT3      --------------------------------------------------------MDSG
A0A7C2XNI7      -------------------------------------------------------MNSNG
A0A1Q8B793      -------------------------------------------------------MEENG
A0A2V9BCA0      -------------------------------------------------------MEENG
A0A2V9BWU9      --------------------------------------------------------MDES
A0A2V9DKX2      --------------------------------------------------------MDES
A0A7C2YQY3      --------------------------------------------------------MDPK
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A3N5XQP8      ---------------------------------------------------MADLAKQSR
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      --------------------------------------------MNESIDVHQRRGLVQG
A0A2V9LK56      ---------------------------------------------------------MDE
A0A2V9L7I0      ---------------------------------------------------------MDE
A0A522PPT0      ---------------------------------------------------------MDS
A0A7C5V1G5      ---------------------------------------------------------MEE
A0A2V9KCS3      WRCIPTTFSSFRAAPARRPGGARWKRCWAWARASAQAPRSIAVNRDLFRVNHSRADSTSG
A0A372IT17      --------------------------------------------------------MTSP
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ---------------------------------------------------MKMIPSSEQ
A0A1Q7N5R7      --------------------------------------------------------MPDH
A0A2V9QB26      --------------------------------------------------------MTEP
A0A2V9VYY4      --------------------------------------------------MALQPTRNNS
A0A3E0PHB0      --------------------------------------------------------MESN
A0A3M1SIV3      --------------------------------------------------------MEKD
A0A3M2D491      ------------------------------------------------------MNKERD
A0A353C9L6      ------------IDGLKYGRFGVIRSKNRENTADIWYKTRLRKFCRVGDVQGQESSMEQD
A0A2V8RQV0      --------------------------------------------------------MEQE
A0A2V8SJH5      --------------------------------------------------------MEQD
A0A357F267      --------------------------------------------------------MEQD
A0A7C5ZUA8      --------------------------------------------------------MEQE
A0A136JPP4      --------------------------------------------------------MDQD
A0A399WUJ8      --------------------------------------------------------MDQD
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ----------------------------------------------------MKEPSDLS
A0A3B9MLP9      ----------------------------------------------------MKEPSDLA
A0A3D5SQ87      ----------------------------------------------------MKEPSDLA
A0A2V8NW86      ----------------------------------------------------MDKHELPP
A0A7C2GJ20      ------------------------------------------------------MSDSTE
A0A7C4BTL5      --------------------------------------------------------MAPE
A0A2V8ZHL8      ----------------------------------------------------------MP
A0A2V9B240      ----------------------------------------------------------MP
A0A2V9CBM2      --------------------------------------------------------MGEQ
A0A2V8XN17      --------------------------------------------------------MDDQ
A0A2V8WX45      --------------------------------------------------------MEDQ
A0A1Q6YR79      --------------------------------------------------------MDDQ
A0A1Q7VA32      --------------------------------------------------------MDDQ
A0A2V9EY85      --------------------------------------------------------MDDQ
A0A2V9H8K0      --------------------------------------------------------MDDK
A0A2V9FFE5      --------------------------------------------------------MDDR
A0A2V9GM43      --------------------------------------------------------MDDR
A0A2V9CYQ5      --------------------------------------------------------MGEQ
A0A2V9BWU8      --------------------------------------------------------MSEP
A0A2V8ZG48      --------------------------------------------------------MSEQ
A0A2V8Y334      --------------------------------------------------------MGEQ
A0A2V9AY68      --------------------------------------------------------MSEQ
A0A1F2RFI7      --------------------------------------------------------MSEE
A0A1F2RZS3      --------------------------------------------------------MEEN
A0A1F2USE2      ----------------------------------------------MGEEIPDSKREVPD
A0A7C2VB08      --------------------------------------------------------MSEA
A0A2V9C238      --------------------------------------------------------MDPE
A0A1F2Q9F5      --------------------------------------------------------MSDE
A0A1F2QQH9      --------------------------------------------------------MSDE
A0A1F2QXK7      --------------------------------------------------------MSDE
A0A2V9DEM9      --------------------------------------------------------MDPE
A0A7C5TWV7      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A2V8G155      --------------------------------------------------MSDT------
A0A2V8HDM7      --------------------------------------------------MSDT------
A0A2V8DRT9      --------------------------------------------------MADQFQLDPG
A0A2V7VYF3      --------------------------------------------------MSKR------
A0A1F2SVH2      --------------------------------------------------MSEE------
A0A2V8AJG9      --------------------------------------------------MSEQFSSNPG
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      -----------------------------------------------------------M
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      -------------------------------------------MTNPLMKSDPATRRELV
A0A2W0BVQ9      -------------------------------------------MTNPLMKSDPATRRELV
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------MAYSFGYRLRSSSRCPAP
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------MTRYFELTGEPAPDSAA-
A0A1Q7RBU1      ------------------------------------------MSKYFELMNQLGRDSAAV
A0A2V9JPV9      ---------------------------------MSRYFNKDEERRYFELMNQHPRNSLAV
A0A3P0X3W6      ------------------------------------------------------------
A0A2N9MK30      -------------------------------------------------------MNTSL
A0A3D1ASD2      ------------------------------------------------------------
A0A7C5AXI3      ------------------------------------------------------------
A0A7C6E4H7      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A7D8BEX2      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A2U3JZ71      --------------------------------------------------------MVGD
A0A2V8TTB0      ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ---------------------------------------------------MSTQFRDST
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A7L5A491      ------------------------------------------------------------
A0A7D8BF18      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A7G8BDY8      ------------------------------------------------------------
A0A7C4BZ42      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A7G8BMP1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A7C6A629      ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
A0A7G8BJH7      ------------------------------------------------------------
A0A7C5SHM3      ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A7C2ML20      ------------------------------------------------------------
A0A7C5AXS9      ------------------------------------------------------------
A0A7C2RGE3      ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      PETGKTEILEADLKAIRNGKETDLLLXXXEDGDAPMSTAPPVFDPPSERELDLRYYAGLV
A0A2V7YYV7      --------------------------------------------------MELGRYLRVA
A0A2V7Z0J5      --------------------------------------------------MELNRYLRVV
A0A2V7Z3M4      --------------------------------------------------MELNRYLRVV
A0A399Y5V2      ------------------------------------------MTESHATTLELRDYLGIL
Q01X01          -----------------------------------------------------MECARTL
A0A3M2D9H8      --------------------------------------------------MLPRDYLFLA
A0A2V8JK38      PSGSTVSGTDKAKTPGRRAGKDKLVRINHRKYPEIVENLPRNLATQEEDETHLLAYWRVI
A0A2V9IXG5      --------------------------------------MQDLNVSESLPQLDIRYILHVL
A0A2V9J2P4      --------------------------------------MQDLNVSESLPQLDIRYILHVL
A0A1Q7RLS4      --------------------------------------------MEEKREIHLLDYWRTI
A0A2V2R525      ------------MKEDQITKHSSIHDLDSPYNVFPFPPVIQTGERQDQSQASLAFYVQII
A0A321LPW6      RVELERVSTA----RVALDAAPPPR---YPALAGAAGTEYGLGYPEEYGRIHLLEVWRTI
A0A2V9R9V4      KRYPDNLPPEVTFRQLPARQAHDSGAVIYPEIDLP---RYG----EAED-FHLRMLWRIV
A0A321LE75      RTDIERIKPE----EMAFGRPGYPRAVGYPEAYATGSYGYG----EADDRINIRAIWRTV
A0A2V8R8U7      IQDERL--V---------P-AGRGLDNSLADLTQAKPFGRYDRYNSAPAETNVREYLYVI
A0A2V8QMP4      MQDNRL--L---------PLTPETLDRPLRDLAQPSP--VAV---SSNEPVNLRDYLAVV
A0A2V8R4S3      MQDNRL--L---------PLTPETLDRPLRDLAQPSP--VAV---SSNEPVNLRDYLAVV
A0A2V8NJ55      SQDNRL--L---------PLTSTSLDRPLSDLAQ-SK--KYYGV-SATSETHLRDYLAII
A0A2V8Q7I0      --------M---------PAVDRGLEKPQTD----QI--RSYGP-AANEPTQLRDYLFVV
A0A2V8S6K4      SQDNRLLPL---------PTPAGNIDRPLRDLTQPAV--QVTGSYSLPEPTHLRDYLNIV
A0A317I2L9      SQDNRLMPM---------PAVERSLDKPLTDLN--AA--RSYGP-AANEPTQLRDYLFVI
A0A2V8LLF9      THDEHLVPA---------RT-GRDFDSTLADLTQSKPYGKYARYGTTQSETNVKEYFFII
A0A352FRF4      TQDERLVPA---------RP-ARDLDRTLAELTQSKGYGGRYG-GGSPAEVNLKEYLFVV
A0A2V8MKV0      TQDERLIPA---------RA-GRELDRSLADFATAKPYERY---GAAGVETSLRDYLFVI
A0A2V8PYY8      TQDERLIPA---------RA-GRELDRSLADFATAKPYDRY---GATAVETSLRDYLFVI
A0A1Q7YKQ8      SQDNRLLPL---------PQ-ERGLDRPLSSLPHSKSYG-Y---GAAAESTHLRDYLNVV
A0A352F3R7      AQDNRLLPV---------SALDRSIDRPLADLVPAKPYG-----TSGSEPTTLRDYLFVV
A0A0B6WXT1      MQDNRLLPL---------SQTEQQLDRPLHDLTLGQP-------ATFIEQAHLREYWAIV
A0A3B9MEU8      SQDNRLLPV---------SALDRSIDRPLADIAQAKPYG-----VSGADTTTFRDYLSVV
A0A2V8MHG6      KEPTELIEK-----SNGSRDVGGVLERSLTPYTRYDSYEDES-----NGYSRLRDYWRSV
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      KEPAELIEK-----SNGSRDVGGVMERSLAPYTRYDSYADES-----NGYHRLRDYWRSV
A0A1Q7NJH5      KEPTELIEK-----SNGSRDVGGPWDRSLAPYTRYDSYADDS-----NGYSRLRDYWRSI
A0A2V8PJY0      KEPTELIEK-----SNGSRDVGGPWDRSLAPYTRYDSYADDS-----NGYSRLRDYWRSI
A0A1Q7Y6W9      RELITRVKE-----ANELEVAGETFSPSPSAYKGYDSAAEDE--------VHLLDYWRSI
A0A2V8NC68      SRPTETTAL-----VHGNGNSGEPLM-QPSFRQDYRYMGEDSFQTSGGGYARLREYWCSI
A0A399WK13      KETRNIITT---TSPEP-VELQRPPDP-AIPTTGRYPGYSATPQGEGFQ---LIDYWRAV
A0A352FLX4      NQSTNLSRTNTVPIGDEHIGLERTNGG-HVLPGVMQGAYSYEREERGSR---LLDYWRIV
A0A2V8RTL7      KEIRELVPT---KPNDTVVELERPFETHVIPGTGRYPAYRDVYGPEGFQ---IVDYWRAI
A0A3E0PCJ6      RESRDIVRN---PRTES-AEVERPFEAVAPITNYGYARYRNEDLREHSP---LFEYWRII
A0A3M1S4R8      RESRELIST---RSAGR-EELEPRWQ--SPSYYPSYKSFSEGSAK-------IFEYWNAI
A0A7C2G442      RESRELIST---RSAGR-EELEPKWQ--SPSYYPSYKSFSEGSAK-------IFEYWNVV
A0A1Q7YFI6      EKETQLVKA---SVEPR-VVELQANGN-GAGLPYGSYAYGSSEPQEESGFSRLQAYWQSV
A0A136KC10      ------------------MEMERPADP-TIAATGRYPGYPQTGQAEGFQ---LIDYWRAI
A0A3M2D6Y5      RKTNELIVR---EAQEN-TEVEFRSQP-FV-SSGNYYSAATRDSAGSLK---LREYWNAI
A0A2V8SEX6      KETREIIQK---PLNEP-VELERHFEP-QIVPAGRYPSYRE-NVAEGFQ---LLDYWKAI
A0A7C5ZUU4      KESREILKK---PVSEP-VDLEKVLET-PL-PIGRYPAYREFYEPDGFQ---FLEYWRAI
A0A0B6WWQ6      ----MMKGD---P-EKE-PQSLIRLDA-SAPYPKLYADYDHRWEREERTQQIVAGYWRAV
A0A3B9MK99      ---------------------------------------------------------MCI
A0A352EX26      NPSNELIRK---E-PAD-TAIGRPADS-NGIPHSYNYGVDPNA-ESEVH---LLDYWRAV
A0A2V8MM59      NEGTKLARV---E-TEP-QDLDRRLDD-HGP-RPYAYGYGTNGFDGEVN---LLDYWRAV
A0A2V8PFE8      NQATKLVKR---E-DEP-GEIDRRFDG-SANYRGPVYGYGPESSEGEVH---LLDYWRAI
A0A2V8PWS6      NQGTKLVKR---E-DEP-GEMDRRFDD-AANYRGGVYGYGPEGSEGEVH---LLDYWRAI
A0A2V8LCT5      NEATKLVRR---D-DQP-REIDRRTGD-TTSYRTA-YGYNMDAGENEVH---LLDYWRAI
A0A352FTJ9      NEATKLVKQ---D-E-S-RPVERRSDE-SQPYR-G-YGYGADAGDGEVH---LLDYWRAI
A0A257VBK0      --------------------------------MADSDPPQVQAEFSAAQDVDLLHWVQIL
A0A2G6PYV5      --------------------------------------MQDNQPFDQQADFNIFHYIGLL
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      FERKSPESSVLGLDAAPDAGLAPQPSAATGGSGYGYGYGYSGSMPSGDSELSFIHYLQVL
A0A1F2T595      KAPASQGSGSESPVFNAVPSNGSGGSGYGSGSYGGYSGYGYGTSVTSDSELTLVHYLQIL
A0A2V8JQV5      FSEHDLTNKGN---------GEPSQDPVRKVSKSGKPQQSPAYSGPMTSPAGVFDYWRVF
A0A2V9AC41      NQPSPYFIKRT-------------------ARVEQGTIDLNEFAVVDDQVHPLREYWLTI
A0A2V9MAM9      SKLSKAPQRPS--------HSLSRAEFQRLARPSPEALAAGTSAEIETGSLSIIEYLRVL
A0A348V070      TPTTPTTGARQ---------------------------------TQQNLLEQILYYWHAV
A0A2V9M454      MNGDELVPLNS---------GPVTPPPNRNGSGP----HSYIDLEQVDAFGQLRATWDIL
A0A2V9IVR7      MENDPIESREL---------APVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRML
A0A2V9ILE2      MENDPIESREL---------APVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRML
A0A2V9LGY4      MENDPIESREL---------APVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRAYWRML
A0A2V9J4D6      THRSRFTPSSA---------SLRPGSSNAPPSFA--PLPSCASAGG------------KS
A0A2V9L9C5      -MREEFGKSGT---------LVGRAINDSPEPIH--PIISITSAGEFE--RPSVLRAIAV
A0A2N9M9N1      ----MAENDKL---------IPVSAVSSDRLGYSGYPVTDLDPAGSEA--YSFQSYWEIL
A0A2V9JEC4      PRNTDHEQTAS---------ARSETALSERPAIGEYVVPQLEDAEGGA--SAFRVYWHVL
A0A2V9LPQ3      QKLTTTEPAPL---------ARRRAASSESIGFG--LLPT--DFDGFS--SVLRVYWEIV
A0A2Z5G3A3      --------------------------------MKTLPSPQSIYTPIPETPLTISDMGALV
A0A2V7UGP8      ------------------------------------------MDVLSQKEINLVDYWNVL
A0A239MKT6      NNDASIASDLN-------------------------------DAEQGSSDLTLESVWEFL
A0A3E0PCN7      KQLALRPKEEG-----------QETIVYGDYEGDYFDSSYYGGAPAPSERQQLMAAIGVL
A0A2V8IYW3      --------------------------------------------MIPGHKYTPQDVLDAV
G2LEI9          NNVMLAPTAAE-----------LDLATPTVQDRMRRRGSYQYTLPQEDAGQPIRQAFLTI
A0A317J121      NHDQPEPGNNR-----------------LPALPNSYFVQPGELTIEPASSSPGIDYWHLL
A0A2V7YW66      SPVPFEEEPEG--------------------------------AAEPASELNFGEYLGIA
A0A2V7Z0V0      TPVPLDDEPEV--------------------------------APEPESELNLTEYLGML
A0A2V8GFD4      EQHQHHEIRID------MPADSAFASARDAVEKDGVERLPPGSGEMVDGTLSGFDYLRIL
A0A2V8HSS5      EQHQHHEIRID------MPADSAFASARDAVEKDGVERLPPGSGEVVDGTLSGFDYLRIL
A0A2V8KP55      ----------------------------------------------EEDETHLLAYWRVI
A0A399WNU1      FQVVKRNSRQD-----------PESLDFYDQDDLYPESYYGDSIQEPTEKQQLFNLLSIL
A0A2V9JSI3      NALAPIEHVPF------------------ERVGYRKPSVVTVEAEEFDSPLDLRHYWNNL
A0A2V9WI32      ------MGESLMDSGIVRRRSDTSTLEQLPTEIQFPADPARSYAPLPEEGFLLREYGRIL
A0A2V8IVN9      VKLRFEEAANP--------EDAVLRAPGEAAGGGYASYPDIVGGSGEGGEPHLLDYVRVL
A0A7C5Z4J3      ASETVLPERAE----------------------MYHRTVLDLQRDWTDSFVYLRSYCKIL
A0A1F2TPT3      PRSNPPAEATP-------PDDIRLSMEGTAEPALRRYENDALWQGLEGEDRHFQYYLAVL
A0A2V8JTQ2      VQLPRVALSSG--------------------PNPANHYLPRVG---APDEVFAAGMWRII
A0A2V8UZY0      LAVSACDIGPEEPENLEVHGTRAAPRFVRSLPNHPPHPVARASDERASDEMFAAGLWRII
A0A350UEK1      PPP---GDARDHDSRLPARFEIVEAGVPHRLEGPQVNYYGSPAPEEDPDSGGLLDYWRIL
A0A350UIQ4      PPSNPQGDSASANSRLPVKFEIVDA--PPANSDP---YYGGPQFDSDEEEGGLLEYWRIL
A0A1H5Z7N3      RAQTSQASESE-----------------------VVMPQAMQDRAS--GDTTLSDAWLTI
A0A1G7JVV8      TNQ---PSDRV-----------------------VPETNAGFSAIT--AESALSEALNVL
A0A1H4T6W9      MNQ---PVTH------------------------DPANPAGFTSTA--ADSALSEALAVI
I3ZEU5          TNQ---PVPT------------------------DPASPTGFTTTS--ADSALSEALAVI
A0A7L5A6M5      ASQ-DATAVGA-----------------------PRPTFSFSAPES--TDTTLSEALVVL
A0A428MDU2      NPQQPGP--GA-----------------------PETNPTGFSTTV--TDTTLSEALITL
A0A5B9EBI2      NPQ-QPL---P-----------------------PTTDYRAAASAP--TDASLSEAILVL
A0A239HDF6      --------------------------------------MPGSIPQA--ADASLADALLTL
A0A4Q0T270      DDG-PGT--GT-----------------------PHAPLGGLSTSG--SETTLAEALTTL
A0A1Q3QQB6      NTQ-PSADGDT-----------------------SELNSPRFGSAV--TDTALSDAILTL
A0A3N1K1G7      ETP-PVA--GA-----------------------PDLSPSAFSSTA--TDTTLSEAIITL
A0A4V2G466      SAQTPSHTGGA-----------------------SETTPPAFSTAT--TDTTLSETLITL
A0A6B9YNQ8      SAQTPPQAGGA-----------------------SDTSPLAFGTAA--TDTTLSETLVTL
A0A7G8BSK5      SAQ-TPPNTMG-----------------------VSDTPPAFSTAV--TDTTLSEALITL
A0A1I6MH75      TTE-TTSPTGV-----------------------PHTPGGGFAAATAATETTLSDALMTL
E8WVF6          NPY-SNPGPGM-----------------------SQAQQPTFVAPS--NDTTLSEALITL
A0A3N5YNR8      -----------------MGDLIRREYSSIPDPSIRIQRNTEYQWASDDDSLDIRRYFQVL
A0A3N6A5T6      -------------MADLMIPGTEGLPTQIRPSPSPNWAHQKPKAPSKVEVPHLRDYWNVV
A0A1F2Q9L4      -MVARRPAAPD----------------------------KIGFEVEPESEFHISQWLGVV
A0A2U3KC61      DALEALEPIDP----------------LPVKGPQSVYPHFAQPQNS------ILHYWQIL
A0A2V9Y2R7      DNLPGQRSLEI----------------LDQTPPSCQIPYSYNSYSASGHAINLLHYWHVL
A0A2V9NGH6      RVLRELPSAHP----------------VEFRRQFGFGIYNPATFQDSV----VHEYLRVL
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      NQVREM-GPAS----------------MQIGRNI-AAIHPAMAAQDSI----LREYLRVL
A0A2V9QD92      NQVREM-GPAS----------------MQIGRNI-AAIHPAMAAQDSI----LREYLRVL
A0A2V9WPZ6      QMIREVQAPYP----------------VEFSRQLLTGIYPNAPAQDSV----LREYLRVL
A0A2V9ZLH4      QPVRELQAIAP----------------VEFSQQVGPGVYPPLPTNDSV----LREYLRIL
A0A2V9RQF1      QGLRESPDPLP----------------VEVNRTTQHYAYPVLPSQDSV----LREYLRVL
A0A2V9YDK8      QTIREVQPVYP----------------VEFGRQMLTGIYPTLHPQDSA----LREYLRVL
A0A2V9V8F7      HMIREVQAPYP----------------VEFSRQLLTGIYPNAPAQDSV----LREYLRVL
A0A2V9XGR9      QMIREVQAPYP----------------VEFSRQLLTGIYPNAPAQDSV----LREYLRVL
A0A2V9V3Q5      G-FREIQPAEP----------------TELIKPIGPGLYTVLPSQESA----LREYLRVL
A0A2V9NWS3      QMLREISSLSS----------------FDLNR-QLAAYYPNAPIQDSV----VREYMRVL
A0A2V9USA9      GVVREI-PLTS----------------PEFGRAAVPQVYPVLPSQESA----AGEYIRVL
A0A2V9XW18      PTIREIQPSQN----------------VDLVRPQDPRFYPPLASHESG----AREYLRTL
A0A1H5SQF5      QDVTSRSASTH-------------------------------RRSAFRREMHLSDALVIL
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      -----MKPSEFPLDKTDRRRNELSRGAEQRPTVYKYVESPSTEVGASPGYDSLLDYWHIL
A0A2V8XIF4      -----MQASQFSIEKSKRRPNGLSANGKQRPVLYAYLDSPAAEGAATPGYDNLLEYWHLL
A0A2V2R0I6      HKLVRRESGSN------------VPVEIVP----PANRLPA--WELSPREPHLYDYLLVL
A0A2V8XAR9      NKLVPRENGSN------------GPVELVP----LPARLPS--WELSPREPHLYDYLLVL
A0A2V8VZA0      NKLVPRENGSS------------GAVEVVS----LSNRVPS--FELSPREPHLYDYLLIL
A0A1Q7CB82      NKLVPRENGSS------------GAVEVVS----LSSRVPS--FELSPREPHLYDYLLIL
A0A2V8WIU1      NKLVPRENGSS------------GAVEVVS----LSSRVPS--FELSPREPHLYDYLLIL
A0A1Q6Y9F5      NKLVPRENGSN------------GAVELVS----LQSRVPS--FELSPREPHLYDYLLIL
A0A2V9EVV8      NKLVPRENGSN------------GAVELVS----LQSRVPS--FELSPREPHLYDYLLIL
A0A2V8YF91      NKLVSRGNGSN------------GAIELAP----VTPRFVS--FDLSPREPHLYDYLLIL
A0A2V8XZK2      NKLVPRENGSN------------GAVELVP----NTPRFAS--FELSPREPHLYDYLLIL
A0A2V8ZTX6      ------------------------HVELAP----LPNRFAS--FDLSPREPHLYDYLLIL
A0A2V9BT79      NKLVPHENGSN------------GNVELVP----IPGRFAS--FDLSPREPHLYDYLLIL
A0A2V9YHT3      KLIRAEDAGNG------------KSSLDF-----PPPLLPAGYFPATLPQPALLDYWHIL
A0A7C2XNI7      KLVPREPLERA------------GTLAPAETTGGTPFVHPG--WDAERRQIHLLDYLVIL
A0A1Q8B793      SKLAAHDNGAN------------GAVEIIQ----APLRMPV--FDLSPHEPHLYDYLLIL
A0A2V9BCA0      SKLAAHDNGAN------------GAVEIIQ----APLRMPV--FDLSPHEPHLYDYLLIL
A0A2V9BWU9      TALMQRDRRAG------------SSFEVIT----AHPQFSS--WETPPREPHLLDYWRIL
A0A2V9DKX2      TALIQRDRRAG------------SSFEVIT----AHPQLSS--WETPPREPHLLDYWRIL
A0A7C2YQY3      NALERRASPVT-----------------LLAEPFSWRSVPAGSFDPVSTGLPLREYLRIL
A0A3E0NV31      -----------------MDRESYFNEDLRRHGGGGVGPGARRGDNDPSEGIKVRQLIESI
A0A3N5M5V0      -----------------MGDLIRREPSSFADPTIRMQRTGNYQWGPDEDSLDVRRYFQIL
A0A3N5XQP8      QGMQERGGGPR----------------------------LFEPSPSSRDRSTVRFYWEAI
A0A2Z5G7H4      ---------------------------------------MGPRADVRERPITLGDLRHIF
A0A2V9L5B5      DQDSSGESQHA------IEPAFSRSLQESEV-----------LDVSPEEVPHLLDYWQVV
A0A2V9LK56      IQNSNGFQGAS------LAPRTTA-LPDSRV-----------LDIGPEKVPSLFDYWQII
A0A2V9L7I0      SENLQRDPVRA------LARTATQPLEKPEI-----------LDVSPEEVPDLIDYWQLI
A0A522PPT0      NEITPINQTGN------VERLNGHYLREEDV-----------LDVLPEESPRLLDYWHVM
A0A7C5V1G5      HGITPVNQTRS------VERLDGSYLHEEKI-----------LDVSPEEAPRLLDYWNII
A0A2V9KCS3      ALMDQIVHLPKGPQRELIRRTNGGVPASGSLPYGDSPVDQ--EYGADAVSGGLLYYWHMI
A0A372IT17      THI--------------LER----------------------DAMAVYDEWTVADLLSIL
A0A4R1LC91      ---MKALTGSQ----------------------------ANFAQNSLDGELTIKGLWALL
A0A3M2BZG9      PLPRPAVRDDF------LAYDAAPATATPVPPMPG-----------DAGELDVAKYLGAL
A0A1Q7N5R7      TSLRRTPPPP-------LTAADLSRAGTAVEKFSP----------NGDEGPDWHRYLTVV
A0A2V9QB26      MDKHALPPASH---DLVLRKSEGSPGHGEAGSYLY-------GHRDELEPGGFVEDWRIL
A0A2V9VYY4      DDFEALAPIDP------LPVNGHQPLHTYFGEPHN----------------ALLHYWHVL
A0A3E0PHB0      DRLLQIPEIQERRSKKSLQTAPQDYPPAYSPF---------YDDEALGDSRSIREYFNIV
A0A3M1SIV3      ERLLPLPKELE------ANKNAITYQEEGPRYFAS----YAYGDDILEKKFNPRDYLLVI
A0A3M2D491      ERLLPLPKEIQ------EYELTSRYYPSYGG-----------STELVEQRFDPREYLIII
A0A353C9L6      QRLTPLPKSAD------LRANASEYGSSYSSF---------YDEEVIEGKRTVQQYFRIV
A0A2V8RQV0      QRLTTLPHLGE------LRHSKHEYAGSYSGA---------YSDEVIEGRRTVQQYFNIV
A0A2V8SJH5      QRLTPLPKSLD------LRASKTEYPATYAGF---------YDDEVSEGRRSIQQYFNVV
A0A357F267      QRLTHLPKAVD------LRANGGDYGSGYSSF---------YDEEIADGRRSLQQYFNIV
A0A7C5ZUA8      QRLTPISKTAE------SPLAPAGYASAYPAF---------YDEEAGESKVSIRQYVNII
A0A136JPP4      QRLTPLPKGLE------LNQPAGDLTTSYAAY---------YDHESQSGKRTLRQYVRVV
A0A399WUJ8      QRLTPLPRGLD------LNQPHGELPAAYTAY---------YDHESQSGQRTLRQYVRVI
A0A2V9KIE8      MGKSEILPGDR------LNRIAPVSMEQVRGQ-------EF-LEVGHEEAPHLMDYWHLI
A0A352F549      KALEIILKNSA------LEQSNGSSHNGHGNPPIV----AYGEEASPEGEMHLRDYWKTI
A0A3B9MLP9      KALDIILKNSS------LEPTNGSLRNGYATPPIV----AYGEEASPEGEMHLRDYWQTI
A0A3D5SQ87      KALDIILKNSS------LEPTNGSLRNGYATPPIV----AYGEEASPEGEMHLRDYWQTI
A0A2V8NW86      TSHELVPRKST------EAYPGHGEAGSYLHGRRD-----------EFEHGGFVEDWRIL
A0A7C2GJ20      KPSLPATPPER------SSLQAPGAMSGHVMKFYP--ASAF-REESGERDVHLLDYWRVI
A0A7C4BTL5      ESKDLTLRPAP------IEAPAPSVSQTRVYEQDG--------FEEGDERGGVLEYWRMV
A0A2V8ZHL8      PGVKDMPDNEA------LSLRGAKLPVLESPQSPAFPVLGI-DVQDFESFSYLQAYWNIV
A0A2V9B240      HKVKDMPDNQA------LSLRGPRLPVPESPHLPAFPVLGT-DVQEFESFSYLQTYWNII
A0A2V9CBM2      NQSEPYSHAHR------LARK-RGSLEASVVELAD----SY-EIIGPEEGIDLRACGHIV
A0A2V8XN17      NQVELYGRGHR------LDRRGPGAPDSRVIELPD----SY-EILESGEALDLRSYGRIL
A0A2V8WX45      KQVELYGRGHR------LDRRGPGALDGRVVELPD----SY-EILESDEGLDLRAYGRIL
A0A1Q6YR79      NQVELYSRGHR------LDRRGPGALDGRVLELPD----SY-EILEPGEALDLRSYGRIL
A0A1Q7VA32      NQVELYSRGHR------LDRRGPGALDGRVLELPD----SY-EILEPGEALDLRSYGRIL
A0A2V9EY85      NQVELYGRSHR------LDRRGPGALDSRIIELPD----SY-EILEPGEALDLRSYGRIL
A0A2V9H8K0      NQVELYGRDQR------LERRGPDALNTRVIEMPD----SY-EILESAEALDLRSYGRIL
A0A2V9FFE5      DQVELYGRRHQ------LERRGPDALNTRIVELPD----SY-EILESGEALDLRSYGRIL
A0A2V9GM43      DQVELYGRRHQ------LERRGPDALNTRIVELPD----SY-EILESGEALDLRSYGRIL
A0A2V9CYQ5      NQSEPYRHAHR------LVRRTGNGLEASVVELAD----SY-EILGPEEGIDLRACGHII
A0A2V9BWU8      NKLEPFAQGPR------SGHGGLRFMDNRVVDLSD----SY-EIIEAEEPVDLRAYGRIL
A0A2V8ZG48      NKVELYARDAR------FERARLGFLDHRIVDLSD----SY-EILEPDEPLDLRAYGRIL
A0A2V8Y334      QNVELYSRGPR------FERGGRAFLDHRVLDLSD----AY-EIVEPEEPLDFRAYARIL
A0A2V9AY68      NKVELYARRPR------FERGGSVLLDNRVLDLSD----SY-EILEPDEPLDLRAYGRIL
A0A1F2RFI7      MSLEKIPPLKG------E-------VPATTTVAAY----TI-SQEEEAATPSFLDYWRVL
A0A1F2RZS3      NSLERVSRGQI------D-------APASVPVSSY----PV-EVLEEQDSFPLLEYWRVL
A0A1F2USE2      GRIERYEPSPP------M-------LARPEPPVPV----AY-ETVETEEAPDLLAYWRVV
A0A7C2VB08      HPLVPHRPPGP------I-------VP--GPLPAP----RA-TDSQRETPVDLLAYWRVL
A0A2V9C238      NKIKLYEPAVR------K-------WERLRPTPAV----RA-EPLEMKESADLLAYWRVL
A0A1F2Q9F5      KSVERYEPAAR------T-------LERRRPGVPA----PL-QTLEMEPAADLLSYWRIL
A0A1F2QQH9      KSVERYEPAAR------T-------LERRRPGVPA----PL-QTLEMEPAADLLSYWRIL
A0A1F2QXK7      KSVERYEPAAR------A-------LERRRPGVPA----PL-QTLEMEPAADLLSYWRIL
A0A2V9DEM9      NKIKLYEPAVR------K-------WERLRPTAAV----RA-EPVEMKESADLLAYWRVL
A0A7C5TWV7      ------------MKQAAPMGPAGPPAGWGMPPAQWPMQEGPWFEEETEREFSLVEYTDLL
A0A2V7XDY0      ----------------------------------MPSPVPAPAGGSSESPIDFRYYGNLL
A0A2V8G155      --------------------KEGLRMMGAPAPG----DYALNDAALPPASPHVVNSLMVV
A0A2V8HDM7      --------------------KEGLRVVGAPAPG----DYALNDAALPPASPHVVNSLMVV
A0A2V8DRT9      DLDNQKKNLAP---------RPRRAVRAASGKP--------AAAEHALEEVHLSDYVKIM
A0A2V7VYF3      ----------IGHDETAEDTRPQAESYWNDDRD---------ADNAAPEEAHLLEHLRVL
A0A1F2SVH2      --------------------SPRIAMAGEDARAQTSPVYGYGSNVLGDTEVHLLDYVKVL
A0A2V8AJG9      PAAAGRLEMAPGLDSIDAGAAPPISAAAPNGRG---PAYGYGSNVIGDGEVHLLDYVKVL
A0A2N9LQU7      ------MQNIPEQQLARVTARGRISGPVPLP------------PALRNPDVSLGEIWLKI
A0A2P6WFK7      RPAACQESHMPEIEQDSLATMRESGLKRFGN------------DSVTERELSVTEISRTI
A0A2V8U914      --------------------------------------------------------MRVL
A0A2V7W309      ------------------------------------------MDLNTQQEVHLSQYWNVI
A0A2W0BGU4      DYEIAPHPTPEPITIAPRYYPDPNA------------------SPEAGSLALYWN---IL
A0A2W0BVQ9      DYEIAPHATPEPITISPRYYPAPNS------------------GPEAGSLALYWN---IL
A0A2V9MN96      -------------------------------------------PYRIGGQHPLLSYWRIL
A0A2V7V2Z1      TWPPGPSRSERRRGSPAVSPSASSG------------------YEGEPQEAHLWEYIYVI
A0A2V7X2F7      --------------MASPSQPPPSE------------------PAG---EDHLWDYLAVV
A0A2V7V2I1      -----------------MSTTAPAG------------------QAGVPEETHLWEYLHVV
A0A2V7U3M2      -----------MEGTSPVTPTPPTS------------------SESEAQETHLWEYIYIV
A0A2V7UHT0      ---MWPRRTVLSKELSSVTPIPPAG------------------SEGEPQEAHLWEYIYVV
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      MDLSRPEPRLPP-KVPSPRVQRVVG------------------APDEALASTLWR---II
A0A2W0AJ66      QTLVQTPPNLKP-GLPNRYTQKVVE------------------ALEETFLGNLWR---VV
A0A1Q7RBU1      Q-----LTRAAP-NLPNRYPQRLID------------------APEQMSTAGLWR---II
A0A2V9JPV9      QPPSRGVPRSTP-NLSNRYPQRVID------------------APEQVSAAGLWR---II
A0A3P0X3W6      --MSSVYNNKPR-ILPASAPPSQIA-------HYTGPQAAAEPDELLPMQHYMW----LL
A0A2N9MK30      QELTIVEERGPR-SLPVAAGFGPAQ-----PASW---DLEPE-EQTLPLSHYLW----VL
A0A3D1ASD2      ----MSEMRLDRSNLPALPSTYSVS--------HITAEPEAR-ETTVPLTHYVW----VL
A0A7C5AXI3      ----MAEQKLDR-NLPAVSETYSVS--IPQPVVF--PEPVQE-EPALPLSHYLW----IL
A0A7C6E4H7      ------MSDPSR-LLPSGSGPVAAPGYPPAPVGWYGPEMEFE-EPGTPLSHYLW----IL
A0A1F2TCR2      ------------------MFDTHDLQQAPAIAIEAPPQLPMPPVAQSQQPLHVLDRLSAV
A0A350UQT3      --------------------------------------------------------VSRI
A0A7C3HRX0      ------------------------------------------------------------
A0A1F2V330      -----------------------------------------MPSDGTGKEISVLALLDIV
A0A662EE63      --------------MRHRDIDMDRWMPADQGAMPPGGPAMGGWVDDQGHEIDVMEYARLL
A0A2V8TLH7      -------------------------------------MSENLPIVEEQREVHLLDYWRTI
A0A1Q7ZJT1      -------------------------------------MPDSLNPLEEKREIHLLDYWRTI
A0A2V8VC99      -------------------------------------MPETLAPLEEKRDVHLLDYWRII
A0A348UZU3      -----------------------------------MSENYVDPQSLETAEIDLRKYIDIF
Q01XL7          --------------MNDHYEPESNGSGPHGLPVGPDVRMLPSPSDGWVPEPTKISYWKIA
A0A2V8ERZ5      --------MLPSSPPDAPAPSTTAVTAGSPSHAGSSHGQGSAPHYAPEQDVHLLDRLAVI
A0A2V8GTX0      --------MFTPGGLSTTGP---AAGSPPPVPVHQPQARKTAGLFSPDPNIHLFDRLAII
A0A2V8J0X9      --------MFDTQEVRAQLP---AEVSPSALIALPSSTSQST---------HVLDRLNAV
A0A523DUV7      ----MDPQDSHHQEH-------------------------TNLIAGLSGEFDLKYGLRLL
A0A1F2U158      ----MSESSPAHPTPASAPTSSGAPRAP------------QPLTYAVDKDVHILDRLAVV
A0A2V8F6S9      ----MADSTPSGSRPASSASNSNGGVAP-------------PLTYGTDGDVHILDRLAVL
A0A7D8BEX2      ----MPQSATNNTSPQGLQEAF------------------DVQTDQAADLPSLARIWVGL
A0A4Q1SCH5      ----MNQPAAASPLQAQPAAF-------------------SSPGVGDSEGISFREIFRAI
A0A372IRG7      ----MQGSAIAPQGQQELHPP-------------------GGVPPHESPAFTPADFRKII
A0A2V8K4L4      ----------MRNHDDSSNLPVPFTPPPGNQLSTPLQARFMPEPQEEASREGVVAYWRMV
A0A2V8NCZ3      ----------MKDQDDSSNLPVPFKSARGSQLPTPVPARFTAE--DDSSREGVVAYWRMV
A0A4Q7YNP3      ---------MGNTFNTNGIDRRPVGIVARDESGETFPKSWTANDRVEQRTSLFAEYLRIL
E8UZE1          --------------------------------MKNPGIPDEVAARSSFSAVGLPEIYRLL
A0A2U3JZ71      KEMVENNLTPALPAPLEALPGRNLPVPMEVYRTSNLMP----EVEAAPSSVPLSHYLWIL
A0A2V8TTB0      MKKFENNL-PAVP---------------EVYRAAAPVPVIDAEFEPQAPQVPLAHYLWIL
A0A1V6HR88      --------------------------------------------------------MKVF
A0A3E0P0A3      --MNLRQRTVAPRESD------------------------EAFAGSGDDLKLIAEYGSIL
A0A2V8EXP2      DSLQHRLTMASADAENAGAARAADSGPAAAAPPPTAYGYGSNVVGDDQ--VHLLDYVKVL
A0A2W4RYA1      ---MPDINLDDLDDASRRGAAGDGQPPAGATVPSRAGAQHAHGLDEDHGDVHLRDYVRIL
G8P0Y7          --MSTGRMRGEFAEPVRHDSPRLASL--------------QEMYRPPAREHSISDYWHIL
A0A5M8T4U7      --MAIEPQSEHQLDRVMIN---------------------PATIAAPSESLSLMDVWRVV
A0A7L5A491      --MESRPSFANNALTPSQRLRERLYLPEPLDQLPS-----PLEVEAPEQVLSIGHYAWLL
A0A7D8BF18      --MESHGL--------------------------------PLTAVDQASENALSDAWITI
A0A1E3Y9R6      ----MAHLPNA-G---------------------------GRQASAKGGGWHPTDYLRVL
A0A2W4TLP2      ----MAHLPPAHG---------------------------GRAARRGGSSWHPTDYLRVL
A0A7G8BDY8      --MSFLTQNRPASRTSGVVFNAPIPE--------------GPGIPSGPSEIGLSDLVRIL
A0A7C4BZ42      ----MNRFPGNNPKHLPGGGGPPMVPDRPVEVMQPAYY--QPAYDDAASGGGLLEYWRLA
A0A3R9WF43      --MDRSPPKVSITKKEHRSFLAEMQTRA------------HLAPVNASEYESLSGLLRVL
A0A317HKM4      --MSLDSHRPARSDPDSDDARGT-----------------GSPDTWGTDTLQIRDYARIV
A0A2V9CG11      --MESPP---------------------------------NREVATAGGYDSFLDYWRIL
A0A523E0N1      --MSTERLPPDY----------------------------SDYAPEIYPRASLREIYFVL
A0A4R1LAZ7      --MEGPRTTTRVSPAGDMQAELPVN---------------------ERSILTPGDVRKIF
A0A7G8BMP1      --MQGQAITPR-------PSELPLALAP------------AAGNTLEHSVLTPGDVRKII
A0A523ECP2      --MELKKSEQGSNANWAPPPTPTSEPE-------------RVDFHPPESETHLRDYWYII
A0A2W0C122      --MDARELIKSNPAELSAQNTPASQGI-------------HYGWARLVPLNPVQRVVRLL
A0A2W0AUU7      --MDARGLMKWNSTDISTQQSSASQNL-------------HRASSRRVPLNPMQVVFRLL
A0A2W0BQL1      --MDARGLMKWNSTDISTQQSSASQNL-------------HRASSRRVPLNPMQVVFRLL
A0A4Q1SDL1      ----------------------------------MNNYLLEAPPTHVEPGLTLGDLSKII
A0A3P0XH15      ----MEGPAVQPERQVAA----------------------GPQLAPEQAIITPSDIRKIL
A0A3M1WQW8      ----MSERDERTHLPAPADTGAMDRNVVTRLYPIGYGH--ERYGTAVERDVHLLDYWRII
A0A3N1JHC1      ----MRTPAGKLRAIAPAETPGPRLPSAGTLDP-------FRSSTVYGTPEEQIDYLLLL
C1F294          ----MDTLDPQRQSGSAIASA-------------------DEKTVAPQSTINLSDLRKLF
A0A2V9KA79      -----------------------------------------MQNGTANTSASLTNLVAIF
A0A522PSP1      --MNFNITERSDAVLRSAGPEEATRLAPDNQKGT------WGFPTEPAISLALSRYWGAI
G8P085          ----MRVQTTQPDTEGKLDQR-------------------SLTEADSASALSLGDIAQML
A0A7C6A629      ----MSDPSHMLPPGSGGLPAAPAYPPAPAGWY-------GPEMEFEEPGTPLSHYLWIL
A0A4Q1SGQ1      --MNEKALLAGRPLEW------------------------TDLLTRPRREWTMLDLWQVM
Q1ILD9          --MSATNLATRKDLLPQNGKGAR-----------------WQPSESDGQKIDFDGLFRII
A0A7G8BJH7      ----MAVAPVRIAQVPDLRAIREDE-------------------------MTLGGATAVL
A0A7C5SHM3      ----MQDRPSEMSPEQSAAGD-----------------------------WSLKAVQRLL
Q1IJZ6          ----MDSLFRKSELPPLGVSEQS-----------------TTNAGLEDEDLSLRQVIRIL
A0A2V8TCE6      ----MTSPREAE--------------------------------------SEIREFWSIL
A0A522TBE8      ----MPKAVQQPSPIPPPQPVAGRAGAPAPWWQATEEAG-PQAERPAGSGTPWVYYGRLL
Q1ITG0          ----MEKFSQIENVQGASRT--------------------SWADVQEDREADLLHVLYVL
A0A7C2ML20      ----MSGLIGGADQQPGLNPPGL-----------------LAGLSQEKMSDVWRRYWRVV
A0A7C5AXS9      ----MKQLPEPGKPEEARLPVRYEYVEVP-----------APETGAEPEGPTLLDYWRIL
A0A7C2RGE3      ----MAESGERPFLPPTPSERSSLHAPGAPSGHVMKFYPASAFEEGGERDIHLLDYWRVI
A0A3N5PCI5      ----MSDTQQPPSEHDAVTSRAE-----------------PQ--------WQLEDVFAVL
A0A3M1Q0S9      ----MTESSEQRE-------------------------------------FNLRDYWQIV
A0A2Z5G448      ----MQGPDPASERQQGTSVAGK-----------------PAGSDRQDFILTPADFRKIL
A0A3M1VZ38      ----MIQQDPQN-QE-----------------------------------FNLRSYWQIL
A0A4Q1SD29      ----MQGWSAPP-QEPQKVASSP-----------------AVGSVQEHTVFTPADLRKVV
A0A6N9FGE2      ------------------------------------------------------------
A0A3M1PY35      ----MAASEPYR-REPPTGGE-----------------------------WDLDALRRVL
A0A3M1VMP2      ----MPAMTVPG-VGP--GGD-----------------------------WDLAAVRKVL
                                                                            

A0A2V7VMF7      WRSRV-FIVALGLVGLGLGFVVALLQTPQYRAGAM--IQIEPPAPTFM------------
A0A2V7YYV7      RHRLW-MIIACPILAALSAGIVSFALPPVYEAHAA--LLVLPSN-LGT------------
A0A2V7Z0J5      RHRLW-MIVACPLLAAVTAGVVSFALPPVYEAKVD--LAVKPAQLLPS------------
A0A2V7Z3M4      RHRLW-MIVACPLLAAVTAGIVSFAVPPVYEAKVD--LAVRPAQLLPS------------
A0A399Y5V2      RRRKW-FIILPTVVILVAAITASLLTTPIYEASAD--VLIQSNKRSSV------------
Q01X01          YRRKA-TVLWITFFAVIAAALISVAQPRMYESQAS--IQVQGVNENFL------------
A0A3M2D9H8      KRWAW-LLGVGVLIGLIGGLIYSLVQEPVYQATTK--VMVLGAPQSNLSDILNQNTELL-
A0A2V8JK38      VTRRW-TVVAVFATIVLLTLIWTLKQKPMYAATIT--IQIERETPSLV------------
A0A2V9IXG5      WTGKW-VILACMLVALALAAVNNNFQKVSYRAQAQ--IQIDAPPFLPS------------
A0A2V9J2P4      WTGKW-VILACMLVAMALAAVNNNFQKVSYRAQAQ--IQIDAPPFLPS------------
A0A1Q7RLS4      WRGRW-TILSIFVVVFTLVAIGTFTQKPVYRASVT--VEITPQSRKVSPVAEVAE-----
A0A2V2R525      RKHFL-MIIALTALCTLTTAVYMARKPDVYGAAVR--VQIDVESNPA---SGINGKPVV-
A0A321LPW6      RKRRW-LIAATVVIVTSIVTVEMFRIKTAYQASAM--IEIGKDVQA----VQGPSAAAV-
A0A2V9R9V4      RKRRW-LIIGIASIITTLVTIDVFRTKPLYEATTT--IEIGRDNGA----RINSNGLFI-
A0A321LE75      RKRLW-LISLIALIVTTIVTLEMFRTKSMYKASTT--IEIEKENRT----LVKSGDVVI-
A0A2V8R8U7      LKRKW-LILSLVLVVTSLVTIQAYRQPSIYEGGTT--IRIESKPAPV---LATGQV--I-
A0A2V8QMP4      LKRKW-LILSLMVVITSLVAIQMYRLPSIYEAQAT--IQIEQKKGGV---LQTAGAGNL-
A0A2V8R4S3      LKRKW-LILSLMVVITSLVAIQMYRLPSIYEAQAT--IQIEQKKGGV---LQTAGAGNL-
A0A2V8NJ55      LKRKW-LILSLVVVVTSLVTIQMYRQPPIYEAETT--IQIE-QKKNI---LQTKEL--I-
A0A2V8Q7I0      LKRKW-LILSLCLVVTSLVAVQMFRQPSIFQAETT--IRIE-RKQNV---LVSKDF--V-
A0A2V8S6K4      LKRKW-LILSLVTVVTTLVAIQMYRLPSIYEAKTT--IQIEPKRNAL---IKTKDI--V-
A0A317I2L9      LKRKW-LILSLCLVVTSLVAVQMFRQPSIYEAETT--IRIEQRKSNI---LQSDKL--V-
A0A2V8LLF9      LKRKW-LIMSLLLVVTSLATIQAYREPSIYQASTM--IRIEGRPQSV---LSTGNLIIS-
A0A352FRF4      LKRKW-LIMSLVLIITSLATIQAYREPSIYEGATT--IKIEQKTPSI---LQSGNGGGI-
A0A2V8MKV0      LKRKW-LILSVALVITSMAAIQQYRQPSIYDGIAQ--LKIEEKPPNI---LSSSQIVIT-
A0A2V8PYY8      LKRKW-LILGVVLVITSMAAVQQYRQPSIYDGIAQ--LKIEEKPPNI---LSSSQLVIV-
A0A1Q7YKQ8      LKRKW-LILTLMLVVTSLVAIQMYRLPPIYQAEAT--IQIEPKHDSI---LKAGNNVVI-
A0A352F3R7      LKRKW-LILSLVLVITSLVTIQSFRAPSIYEGETT--IRIEQRPMSV---LQTKE--IV-
A0A0B6WXT1      YKRRW-LILSLALAVTSLVAIYMYRQPNVYEAMVT--IDIEPRR-SV---LQTKGDVQV-
A0A3B9MEU8      LKRKW-LILSLVLVITSLVTIQSFRAPSIYEGETT--IRIEQKPMSV---LQTKE--IV-
A0A2V8MHG6      RKHLW-LVMGIVVLVSGVTAMYMARQRDIYESLAR--VQVDSETANNPAIGALKGNSIF-
A0A2V8P7N1      ----------------------------------K--VQVDSETANNPAIGALKGNPIF-
A0A2V8M3M6      RKHFW-LIIAILILVTGITAIYMARQPDVYESLSK--VQVDSETANNPAIGALKGNPIF-
A0A1Q7NJH5      RKHVW-LVIGIVVVVTGLTAVYMARQPDVYESASR--VQVDSETANNPAIGALKGNPIF-
A0A2V8PJY0      RKHVW-LVIGIVVLLTGLTAVYMARQPDVYESASR--VQVDSETANNPAIGALKGNPIF-
A0A1Q7Y6W9      RKRLW-LVISITVLMTTLAAIYMARKPDIYTAQAR--VQVDLEN-INPALGTNR-NGVN-
A0A2V8NC68      RKHIW-LVMGIILLITMLATIYMARQPDVFEARAR--VQVDLEI-NNPALGSIKGNSIV-
A0A399WK13      RKRLW-LVVGIAVVMTTLATIYIARKPNVYRAKAV--VQVDNEQVNPDL-VTTDRARPI-
A0A352FLX4      SKHLW-LILGISVLIPTLVAIYVVRKPDIYESQAR--IQVDLENANPLLGGMSKNSNVI-
A0A2V8RTL7      RKRLW-LVVGIAVLITTLAAIYMARKPNIYLASSV--VQVDLEQTNPDL-ITNDRQRVL-
A0A3E0PCJ6      RKRLW-LVLGITVLLTTVTAIYMARKPNVYMASAT--VQVDLEQANQDL-VTPDRRMPV-
A0A3M1S4R8      RKRLW-LIVGLVVLVTTLTAIYVARQPNVYEARAR--VQVDLEQGNPQL-QVSDRPTLL-
A0A7C2G442      RKRLW-LIVGLVVLVTTLTAIYVARQPNVYEARAR--VQVDLEQGNPQL-QVSDRPTLL-
A0A1Q7YFI6      RKHLW-LIIGIVVLITMIAAVYMARQADIYEAKSR--VQVDLEVNNPGI-GAMKNTSYI-
A0A136KC10      RKRLW-LVAGIAVVMTTLATIYIARKPNVYRAKAV--VQVDNEQVNPDL-VTNDRARPI-
A0A3M2D6Y5      RKRLW-LIVSIAILVTTLTAIYVARKPNIYEAKAR--IQVDLEQNNPQL-QVTDRPALL-
A0A2V8SEX6      RKRLW-LVAGIAVLVTTLVAIYMARKPDIFSATAR--IQVDLEQVNQDL-VTSDRQRPI-
A0A7C5ZUU4      RKRLW-LIAGICVLVTTLVAIYMARKPNIYLAKAT--IQVDLEQINPDL-VTSDRQRPV-
A0A0B6WWQ6      RRYLW-LVIGLVALAAAATAIYMARQPDLYLARAR--VEIGSEEDSALS-LSPTGGPVV-
A0A3B9MK99      RDR----VISVLVLITTISVIHVARKPDIYQASAR--VQVGLENNAD---LVGKT-PYY-
A0A352EX26      RKRLW-LVIGIVILITTLAVINAAQKPDIYSANAR--VQVDLENNGA---LVGKT-PYY-
A0A2V8MM59      RKRLW-LVIGVAALITAMAVIYAARKPDVYEAASQ--VRVDLENNPM---YEGKTTQLI-
A0A2V8PFE8      RKRLW-LVLGVAALITALSTVYVARKPDVYEAKSQ--VQVDLENNPM---YAGKSVPMI-
A0A2V8PWS6      RKRLW-LVLGVAALITALSTIYVARKADVYEASSR--AQVDLENNPM---YAGKSVPMI-
A0A2V8LCT5      RKRLW-LVIGVAALLTTLALVYVARKPDIYEAKSQ--VQVDLENNPM---YAGKTAPMI-
A0A352FTJ9      RKRLW-LVIGVAVLMTTLAIIYVARKPDIYESSSR--VQVDLENNPM---YAEKAAPMI-
A0A257VBK0      WDQRF-WIAGVTAAVVILVALYTFLATPIYSATAT--VYVQTYSRQPM------------
A0A2G6PYV5      RKHFF-LTLSLLILGLGLAYLAWLVKPPLYKSSVL--IKMNHLS---M-DVIGFTEKL--
A0A2V8F956      ------MAITTFLLVVGSVTVYTFTATPIFEAKTR--LLIEAEN---R-NVVSFKAVL--
A0A1F2S1W5      YRRRY-VAATAFLVVVLSVALYTFTAVRIYEGTVR--ILIERDD---P-NVVSFQEVL--
A0A1F2T595      YRRRY-AAITVFLATVVTVALFTFTATRVYEGSVR--ILIERDD---P-NVLSFQQVF--
A0A2V8JQV5      LNRKG-TVLIAAVLGTAIGLLISFPRTPIYQARTT--LEIQGLN---D-NLLNTREVNPS
A0A2V9AC41      KRHRW-LIVMTALAILACAMLYLFTRIPLYTAEAT--VLIERKA---P-QILKVQDTRAD
A0A2V9MAM9      RRHSL-LLAVITAATVGAAFLVSIAQPRLYQSVAS--VEVQGLN---E-NFLNLRDVNPT
A0A348V070      LRWKW-TGLTVAVLIVALTLVYILISPHIYTASGT--IWIDETQ-----SVLPFEELSRL
A0A2V9M454      LKHQW-LILVTAFVLTLLVTVYSYKMKPVYRATAR--VDVEAEE---P-LLQSLNDLFR-
A0A2V9IVR7      VRHGW-TILTVAFVVTMLVALISFRLQPVYQATAR--VEIEAAT---P-EIRTLSDLFE-
A0A2V9ILE2      VRHGW-TILTVAFVVTMLVALISFRLQPVYQATAR--VEIEAAT---P-EIRTLSDLFE-
A0A2V9LGY4      VRHGW-TILTVAFVVTMLVALISFRLQPVYQATAR--VEIEAAT---P-EIRTLSDLFE-
A0A2V9J4D6      FRWRW--------LSWISVTIYTFKAERVYQATAR--LDIEAET---P-MNLSAESLYRN
A0A2V9L9C5      LRKRWWEVLSVAMVVLISVTIYTFKAERVYQATAR--LDIEAET---P-MNLSAESLYRN
A0A2N9M9N1      -RKRRSTVFAAAFLVTLLVTVVVYRMKPIYRATAR--MEVQAET---P-ALQTLNELGP-
A0A2V9JEC4      -KRRWPTVITVASAVTLLATLISLKMQPVYKATAR--LEVKGEM---P-QLQTINEIDR-
A0A2V9LPQ3      YRRRWQIVAITVAAVTIMA-IYSFKVNPIYRATAH--VEIEAEA---P-LTMSVSDRFR-
A0A2Z5G3A3      VRRRA-IIAGVTFAFLAIASLYCLLSTRRYMATGT--IQIQKDS---S-DALRLESMMQ-
A0A2V7UGP8      KRRRW-VVFTAVVVLVITVTLGSFLIPPSYQAICT--LQIEREQ---P-NVLTFQQVQPV
A0A239MKT6      RRRKI-WIALGIVLGFLSGLAVYLHTPPLYTATAI--VELNKDSSSGL-GLQELSGLSDS
A0A3E0PCN7      RKYWL-MIVAITLLGSLAAVVYVAQKPDYYTATVR--IQVNNEN-----NPAVGNDTSSS
A0A2V8IYW3      NRRKW-LLICPVLVFGIAAFLITRSLPNLYQSETT--ILVVPQRVPES------------
G2LEI9          LRYKF-TVILCVVLTMTVTGLALSRMQPVYEASSH--IEVAPEK-----ELYSSSGRIAF
A0A317J121      RKYLI-LLSLFAVAGAAAGFFSVAFLNPVYQSRAL--LEVQAPT----------------
A0A2V7YW66      RRHWK-LAAVCCLLGLAGAAVHYAITPKAFQATAT--IQIERRN------LTPLGNG---
A0A2V7Z0V0      RRHWR-LAAVCCALGLAGAGIHYAITPKAYQASTI--IQIERRN------LTPLGN----
A0A2V8GFD4      YKRRW-LCLAVFVLTLGSVVMYTFTATPIYEARTQ--ILIETEN---P-NVVSFQEVV--
A0A2V8HSS5      YKRRW-LCLAVFVLTLGSVVMYTFTATPIYEARTQ--ILIETEN---P-NVVSFQEVV--
A0A2V8KP55      VTRRW-TVVAVFATIVLLTLIWTLKQKPMYAATIT--IQIERET---P-SLVNLRDYYQA
A0A399WNU1      KKHWL-LVLSITLIGTFLVIVYEAQKPDFYEASVR--VQVNNES-----NPAAGEGTASS
A0A2V9JSI3      VKRRW-TVVTVAFVVSTVVAMVNFRMPPVYEARVS--VEVEGEA---P-EVQSISNFY--
A0A2V9WI32      KKRKW-VVISTWLIIAILATVYALHMTPVYDATGR--IAINREN---S-VNLGFKDSDQG
A0A2V8IVN9      YKRRW-IAGTAFTVVMLLVTVYTFTVTPIYQATTK--LLIESDS---P-NVVSFKEVI--
A0A7C5Z4J3      SKRRW-TILSVAIVVTTLAAIYSFKQKPVYRATAE--LEVDSEV---P-ELQSVDNLF--
A0A1F2TPT3      YKRRW-IAITALLVVLTFAINRNFTAVPVYEASVR--VLLDAER---L-NLVNVEDVIDQ
A0A2V8JTQ2      RDRKW-TIAAFALVVVGIVVTASLLMEPQYKAVGR--VVVVFHRDNDS-GVLGFRGADTS
A0A2V8UZY0      QDRKW-TITAFALVVVAIVLTASYYMKPRYEAVGR--VVVVFHRENDS-GVLGFKGVDTS
A0A350UEK1      RRRKG-TLIIGAVAGLLIGIASTLPRTPIYQAKTT--LEIQSFN---Q-NFMNMGNLQEV
A0A350UIQ4      RRRKG-TLVIGATVGLLLGIAVTLPQTPIYQAKTT--LEIQSFN---Q-NFMNMGNLQEV
A0A1H5Z7N3      RKRKY-WILAAALIGILLALYQSATQPRLFEAYGN--IEIRSGAS-NEYKIGAATGG---
A0A1G7JVV8      RKRKW-VLIIAAILGILYGVYQAATQPIVYVATGR--IQVAKPNG-QASLGVATGNLT--
A0A1H4T6W9      RKRRW-ILIACAIVGILYGYYLASTQPIIFTATGR--IQVHEANS-TAT------QMM--
I3ZEU5          RKRKW-ILVACAVIAILYGYYTASTQPIIYTATGR--IQIHEANS-AAT------QLM--
A0A7L5A6M5      RKRRW-VLIVAIILGVLGGLYRGFTEPRLYVATGR--IQVHSSSSASEYKMNVATAAM--
A0A428MDU2      RKRRW-ILITSVVLGIAYGVYKAETQPKLFEAFGR--IEVRSGSS-NEYRVSAVQGY---
A0A5B9EBI2      RKRRW-VLLIAIAVGLAYGMYRSVSQPRLYIATGR--IEVRSGSS-NEYRLTT---V---
A0A239HDF6      RKRRW-VLIVAFVLGAAFGLYRAFFQPRIFEAYGR--IQVRTGSA-DQYKLTSPVGL---
A0A4Q0T270      RKRKW-VLILAVLIGFAYGYWKASSQPRLFEAYAR--IQVRSGSS-NEYKVSASTGI---
A0A1Q3QQB6      KKRRK-ILILAILLGLGYGIYKAQTQPKLYEAVGR--IQVRSGSS-NEYRLSAVQAL---
A0A3N1K1G7      RKRRW-ILIVAVLLGLIYGVYKAETQPKLYEAYGR--IQVRSGSS-NEYRVTAVQGY---
A0A4V2G466      RKRKR-ILLVFVLLGLIYGIYRAETQPRIYEAFGR--IQVRSGSS-NEFRVSAVPGM---
A0A6B9YNQ8      RKRKR-VLLAFVLAGLLYGIYAAETQPRIYEAFGR--IQVRSGSS-NEYRVSSVSGA---
A0A7G8BSK5      RKRKR-ILLVFVLLGLAYGIYRAEMQPRIFEAFGR--IQVRSGSS-NEYRMSNVPGM---
A0A1I6MH75      RKRKW-VLVACVLLGMVYGSYDAITQPRLYESHSR--IQVRSGAS-NEYRVSAVPGM---
E8WVF6          RKRRM-VLIIAVVLGTLFGFYKSVTQIKPYEAYGR--LEVNTGAS-NQFKLSPFSGL---
A0A3N5YNR8      LKRKW-LIGLVVGAVLLLVGLQSFTTTPLYRATAR--VQIDPES---A-SILPYQPLNES
A0A3N6A5T6      LKRKW-LVLTVLVTVVVGTAVQTMTTTKVYRSTAR--VRIDPES---T-NILPYEDVYQA
A0A1F2Q9L4      RRRRL-LLILVAGLVAAISIVLYFMTPRQYRATTV--LQIERRP---T-SAAAMQQPMQI
A0A2U3KC61      RKRKW-AVLATFAIVFALSVIKTLRETRLYQATSK--VAIFEEN---P-NVLGFKDV---
A0A2V9Y2R7      RKRKW-AVLVTLIVVWVLSAVATMKQTRLYEAVSQ--LAIFPEN---L-NALGLKDG---
A0A2V9NGH6      IKRKW-VVISSVVMIFVVVAIATLKATPVYDATGS--IAINKLD---P-ALISFKDS---
A0A2V9PYE6      ------------------------------------------MD---P-ALISFKDS---
A0A2V9NL07      IKRKW-IVVGTLAAIFGASLVATLRITPIYDAVGS--IAINKPD---P-MLQNLRDP---
A0A2V9QD92      IKRKW-IVVGTLAAIFGASLVATLRITPIYDAVGS--IAINKPD---P-MLQNLRDP---
A0A2V9WPZ6      IKRKW-TILFCLAGIFIMVAISSLKMTPVYEASGS--IAVNKAD---P-GLVNFKDS---
A0A2V9ZLH4      IKRKF-VALSCVVVIFLLVLIATLRMTPIYDAAGS--IAINKLD---P-SFINFKDS---
A0A2V9RQF1      IKRKW-IVISSVTVIFGVVAIATLKSIPIYDASGS--IAINKSD---P-ALLNIKDS---
A0A2V9YDK8      IKRKW-TIILCFSGIFIAVAIASLKMTPIYEASGS--IAVNKTD---P-GLVNFKDS---
A0A2V9V8F7      IKRKW-TVLFCLAGIFIMVAISSLKMTPVYEASGS--IAVNKAD---P-GLVNFKDS---
A0A2V9XGR9      IKRKW-TILFCLAGIFIMVAISSLKMTPVYEASGS--IAVNKAD---P-GLVNFKDS---
A0A2V9V3Q5      LKRKW-IIIACVVGIFAAVAIASLRQTPVFDAVGR--IAINKAD---S-NLVTFKDS---
A0A2V9NWS3      IKRKW-VIISCLAIIFGAVSVVTMRSTRIYDATGS--IAINKSD---P-ALLNFKDS---
A0A2V9USA9      AKRKW-VIFSCVAAIFAVVAIASLKMTPIYEANGS--IAINKPD---S-T-LNFQNS---
A0A2V9XW18      IKRKW-IVIICLVTIFSVVAIATLKTTPVYEAGGT--IAINKPD---T-T-LNFQNS---
A0A1H5SQF5      RKKLW-LIVGCVVVGVGLAVLLTSLMQRRFSSTVT--IEVHKEGGTSL-SLEDLSGAGQQ
A0A2V9AEW6      ----M-TLLGFAVVGLLASIMISLVQTPIYRVRTS--LEIQGTN---FQEMKGID---SN
A0A2V8WQK6      IRHRM-TVLRFAVAGLLGAIVVSLVQTPIYRVRTS--LEIQGPN---FPEMKGAN--DSN
A0A2V8XIF4      AQHKM-TLLAFGVCGLVAAILFSFIQTPTYRVRTS--LEIQSTN---FVEIKGGDPSGST
A0A2V2R0I6      RKHQW-LILSFMLAVVTIVAIATFRMQPVYTATAR--IEIDREN---S-NILPFQGPEAY
A0A2V8XAR9      RKHQW-LILSFMLAVVTIVTISTFRMQPVYNATAR--IEIDREN---A-NILPFPGADSY
A0A2V8VZA0      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTR--VEIDREN---A-NILPFQGTDSY
A0A1Q7CB82      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTR--VEIDREN---A-NILPFQGTDSY
A0A2V8WIU1      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTR--VEIDREN---A-NILPFQGTDSY
A0A1Q6Y9F5      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATAR--IEIDREN---A-NILPFQGAESY
A0A2V9EVV8      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVGTAR--IEIDREN---A-NILPFQGAESY
A0A2V8YF91      RKHLW-LIVSFMLTVVTIVAIANFRMKPVYVATAR--IEIDREN---A-NLLPFQGADPY
A0A2V8XZK2      RKHQW-LILSFMLAVVTIVAIATFRMQPVYVATAR--VEIDREN---A-NILPFQGADSY
A0A2V8ZTX6      RKHQW-LILSFMLAVVTIVSIATFRMQPVYVAIAR--IEIDREN---A-NILPFPGGESF
A0A2V9BT79      RKHQW-LIVSFMLSVVTIVSIATFRMQPVYVATAR--IEIDKEN---A-NILPFQGADSY
A0A2V9YHT3      VKRKA-VVLITLAVVFALVAFRTYRTTPLYESTGR--VAIYHES---Q-TLTGFKDSVP-
A0A7C2XNI7      RKHMW-LSLAFLLAVVTVVTIATFKMQPVYVAVAR--VAVDRED---P-NLLPFQNSMYY
A0A1Q8B793      RKHQW-LILTFLLTVVTIVSIATFRMKSVYVAPAR--IEVDREN---A-NFLPFQPADPY
A0A2V9BCA0      RKHQW-LILTFLLTVVTIVSIATFRMKSVYVAPAR--IEVDREN---A-NFLPFQPADPY
A0A2V9BWU9      RKYQW-SILSFLLTVVTFVTIATLRMHPVYEATAR--VEIDNEN---T-NFLPFK-SDSY
A0A2V9DKX2      RKYQW-SILSFLLTVVTFVTIATLRMHPVYEATAR--VEIDNEN---T-NFLPFK-SDSY
A0A7C2YQY3      RKHRW-IILTVVAVMVTVVSVVSFQMQPVYQASSR--LEINGEA---P-DLTNLRELFVR
A0A3E0NV31      RVRIF-TVVLVWLLTVVVMVVHVWTQTPLYRSTAT--LEIEPKQ-----NLLPYQDLSAR
A0A3N5M5V0      RKRKW-LIVAVVTTVLVLVAVQSFTTTPLYRATAR--IQIDPES---E-NILPYKDVYEG
A0A3N5XQP8      IKYRR-FVLLVLFLVVALVALETFTATPLYRASVR--VEVDAEP---A-KVLPYQEIY-Q
A0A2Z5G7H4      RRRRR-VMVSCVGGCVALAVLVCVFCTRRYQAFGE--IQVQKDS---S-DALGLDSMMGG
A0A2V9L5B5      LKRRW-TVLVCLLVVFTTVAIGTLKKRPVYEGKVL--LEINPEE---P-QVLNFREVSQE
A0A2V9LK56      LKHRW-LLISTLLIVFSIVAVGTLKQKPSFQGSIL--VEIDPDP---P-SVVNFKEILQV
A0A2V9L7I0      LKRRW-TVLVCLLAVFTTVAIGTLKQRPVYVGKVL--LEINPEE---P-QVLSFKEVTQA
A0A522PPT0      LKRRW-AVLTCLLIVFTTVAIGTFKQKPIYAGKIL--IEINPEE---P-QVLSFQQIAQA
A0A7C5V1G5      LKRRW-TVLTCLLVVFSTVAIATFKEKPVYAGRIL--IEINPEE---P-QVLSFQQIAQA
A0A2V9KCS3      LRRKW-TVLIIGFVGTLSGFLVSLPQTPVYRSRTS--VEIQALN---D-NLMNTRQIDPT
A0A372IT17      RRRRR-IVLGMVFALLLLVTLYCLLITPLYQATGE--IEIQREP---SGAFGLDNGVLGD
A0A4R1LC91      RRRRS-VVYGTTLVLFGAAILYCLLSTRRYEVTGE--VQVQKTP---ADSLGLDVSGNGG
A0A3M2BZG9      QRRWP-LILIFCALAAAYSLVRYSLTTKMYQATAV--IQIERRQ---LATIAMGGATNWL
A0A1Q7N5R7      WRYRW-WILAATALGTIGGAAASRFLPPRYVAQAT--IWIQTSGGNGP-ERGPIGANQLL
A0A2V9QB26      CRHTG-ILAGITLMGALAGVLLSIWQSPVYRARTA--LEIQNIN---E-DFLNIKQVTPV
A0A2V9VYY4      TKRKW-VVLPTFAIVFALSAIATLSETRLYQATSK--VAIFPEVPNVL-GFKDAENIAPD
A0A3E0PHB0      YKRLP-LILAATIIVTAAVAFYMFRLSDQYAAAAT--MIVEPPK---P-KATDSQSVILN
A0A3M1SIV3      HKRLP-LIIALVLVITTLTALYMYRQPSIYQATAI--LLIEPPK---P-KIQSKDTININ
A0A3M2D491      YKRLP-MIIALVVIVTSLVAFYMYRQPSIYEARAV--LLIEPRR---P-KIQSKDTININ
A0A353C9L6      YKRLP-LIIAIVTIVTAAAAIYMYRQPTVYQATTD--MIIEPRR---P-KVTSKDAININ
A0A2V8RQV0      YKRLP-LILALTILVTAAAAFYMYRQASVYQASTQ--LVIEPRK---P-KVTSKDSININ
A0A2V8SJH5      KKRLP-IILAITLLATVAAALYMYKQPSLYQATTE--MVIEPRK---P-KVQSKESININ
A0A357F267      YKRLP-MILTLAIIVTAATAFYMYRQKSVYQATTE--MLIEPRK---P-KVTSKDSININ
A0A7C5ZUA8      TKRLP-LILVLTILTTAITAFYMYRQPSIYRARTQ--MVIEPRK---P-KMTSKDTININ
A0A136JPP4      TKRLP-MIGAIAVVVTAAAAFYSFRQPSIYSASTE--MLIEPRK---A-APTAKDAININ
A0A399WUJ8      TKRLP-LIGAIAIVVTAAAAFYSFRQPSIYSASTE--MLIEPRK---A-APT--DAININ
A0A2V9KIE8      LKRRW-TVLTALLAVFLTVAIGTFKQKPGYSGTAL--LEINPEP---P-NVLNFKEVLQI
A0A352F549      RKRLW-LIIGLALIVGSVTALRQARQPDIYQARAR--VQVGTQTYSPALGASRGESFYPE
A0A3B9MLP9      RKRLW-LIIGLALIVSTIAALKQARQPDIYQARAR--VQVDTETYSPALGASRGGSYYVD
A0A3D5SQ87      RKRLW-LIIGLALIVSTIAALKQARQPDIYQARAR--VQVDTETYSPALGASRGGSYYVD
A0A2V8NW86      CRQKD-ILAWITFLGALAGVLLTIWQSPVYRARTA--LEIQNIN---E-DFLNIKQVNPV
A0A7C2GJ20      KKRRW-IVLSVLLVIVTIVTIRMYQLPVVYEATGR--IIINPQL---PLRVTREKETAAD
A0A7C4BTL5      SRRKG-TVILVAALGGLAGVLVTMPQTPVYQARTT--IEIQEMN---E-NFLNMKQTTPV
A0A2V8ZHL8      NKRRW-TIATVAFIATLLVAIASFKMTPIYEATAR--LDIEADT---A-QIQSFNDLY-R
A0A2V9B240      NKRRW-TIVTVAFIVTLLVAIASFKMVSIYEATAH--LDIEADT---P-QIQSLNDLY-R
A0A2V9CBM2      RRRLS-TILAVFFVVFVVIAIATLKQKPTYRAQVV--LEIQKEN---P-DIPTIQELY-Q
A0A2V8XN17      RKRLP-TILVVFFILFTGILIATLKQKPVYRAQVL--LEIQKEN---P-DIPTIKEMY-E
A0A2V8WX45      HKRLP-TILIVFFILFTTILVVTLKQRSVYRAQVL--LEIQKEN---P-DIPTIKELY-E
A0A1Q6YR79      RKRLP-TILVVFFILFTGILIATLKQKPVYRAQVL--LEIQKEN---P-DIPTIKEMY-E
A0A1Q7VA32      RKRLP-TILVVFFILFTGILIATLKQKPVYRAQVL--LEIQKEN---P-DIPTIKEMY-E
A0A2V9EY85      RKRLP-AILVVFFILFTAILIYTLKQKPVYRAQVL--LEIQKEN---P-DIPTIKELY-E
A0A2V9H8K0      RKRLP-TILIVFFILFTAILIATLKQRPVYRAQVL--LEIQKEN---P-DIPTIKELY-E
A0A2V9FFE5      RKRLP-SILVVFFILFTVILIATLKQRPVYRAQAL--LEIQKEN---P-DIPTIKELY-E
A0A2V9GM43      RKRLP-SILVVFFILFTVILIATLKQRPVYRAQAL--LEIQKEN---P-DIPTIKELY-E
A0A2V9CYQ5      RRRLS-TILTVFFVVFVGIAIATLKQKPTYRAQVM--LEIQKEN---P-DIPTIQELY-Q
A0A2V9BWU8      RKRFA-TVAIVFFLVFAGSLIATLKEKPVYRAQVL--LEIQKEN---A-DIPTIKDLY-E
A0A2V8ZG48      RKRLP-TILIVFFLVFTVGLIATLKEKPIYRAQLL--LEIQKEN---P-DIPTIKDLY-E
A0A2V8Y334      RKRFS-TVLIVFFLVFAVTLIATLKEKPLYRAQVL--LEIQKEN---P-DIPTIKDLY-E
A0A2V9AY68      RKRFS-TILIVFFLVFAATLIVTLKEKPVYQAQVL--LEIQKEN---P-DIPTIKDLY-E
A0A1F2RFI7      RKRRW-TVLGLLLLVVVTVMIGTLKQKPVYRAKAV--LQIDKES---S-NIFSFKDFVAD
A0A1F2RZS3      QKRRW-TILSILLLVVVTVMIGTLKQRPIYEAKTV--IQIDRES---P-NILSFQGFVAE
A0A1F2USE2      QKRRW-TILTIFFVFLTLVLLWTLKQKPIYGATVL--LEIEKEN---P-GLATVQELF-E
A0A7C2VB08      RKRRW-TVLTLFSVVWLLVLIGTLKMRPVFEARGL--IEIEKEN---P-NFLTVKELF-E
A0A2V9C238      RKRRW-TILTVFFVLFTVVLLGTLKQKPIYRAKAL--LEVAKEN---P-NILTVQELF-A
A0A1F2Q9F5      RKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKAL--LEIEREG---P-NILTVQELF-Q
A0A1F2QQH9      RKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKAL--LEIEREG---P-NILTVQELF-Q
A0A1F2QXK7      RKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKAL--LEIEREG---P-NILTVQELF-Q
A0A2V9DEM9      RKRRW-TILTVFFVLFTVVLLGTLKQKPIYRAKAL--LEVAKEN---P-NILTVQELF-A
A0A7C5TWV7      WRQRW-LIAAVVLICILAGGAWAFTTTKMYRARTR--IAFEQAPQ---------------
A0A2V7XDY0      WKNRI-LLATAAVLGLALGLVIAFAQTPEYRASVM--VQIDPPTP--T-FMSVQ------
A0A2V8G155      YRRRW-TVVTAFVLATAGATVYTFSQPRLYEARTR--LLIETENP--N-VVNFK------
A0A2V8HDM7      YRRRW-TVVTAFVLATAGATVYTFSQPRLYEARTR--LLIETENP--N-VVNFK------
A0A2V8DRT9      YRRRW-PAGTAFMLVVLVVLVYTFTATPIYKARVQ--LLIEDEKS--N-VVSFK------
A0A2V7VYF3      YKRRW-TAVTTFVLVVLAMMLRTLNGIPVYEARVQ--LLIDVEAP--K-VLNFK------
A0A1F2SVH2      YKRRW-TALTAFLIVVLSVSVYTFTATPVFEARVQ--ILIEKEAT--N-VVTFK------
A0A2V8AJG9      YKRRW-TAITAFLVVFLSVTIYTFTATPIYEAKVQ--ILIEKENT--N-VVTFK------
A0A2N9LQU7      WKRRV-AASLFASGIFLAVILYTFLKKPVYESVAQ--IRVDSSQQ--G-SLGLE------
A0A2P6WFK7      FKHKL-LILLTALTVFGIITLRTLTMTPVYESAVR--LQVDPSRS--S-SLGLD------
A0A2V8U914      YRRRV-TLLSVTLAGVFIAALLSMAQPRLYRSVAS--LEVQGVNE--N-FLNLR------
A0A2V7W309      RKRWK-VAAAIVLVVMIGTFLASYFSKPLYQSWIQ--IEVEEESQNVT-IEDLF------
A0A2W0BGU4      LRRRW-SILAVVFLATLTATLASLKMKPVYKATAR--IEVEADTPQTQ-MLNDR------
A0A2W0BVQ9      LRRRW-SILAVVFLATLTATLASLKMKPIYKATAR--IEVEADTPQTQ-MLNDR------
A0A2V9MN96      KKRKW-TIVATFAIILVLAIIATLRMPRLYEAASR--IAIYPENS--N-VLGLK------
A0A2V7V2Z1      LRRRR-LVLAVFLGVAALATFRSLLTRPVYEASAQ--ILIERDTP--S-VLTFK------
A0A2V7X2F7      LRHRK-FALAIFLTATAVATIRTLLTRPVYMATAQ--ILIEREKS--N-VLSFK------
A0A2V7V2I1      LRRRR-LVLAVFLTVAAAATVRTLLTRPVYEADVQ--ILIERENP--N-VLTFK------
A0A2V7U3M2      LRRRR-LVLAVFVAVTALATLRALLTRPVYEASAQ--ILIERDTP--N-VLTFK------
A0A2V7UHT0      LRRRR-LVLAIFLGVAALATLRALLTRPVYEASAQ--ILIERDTP--N-VLTFK------
A0A2Z5FVL3      ---------------------MCILMTRRYTAVAE--IQVQKPNSDSL-TLDSN------
A0A2V9KBD6      RPHKW-ITAGFTLAVVAIVTVASLVMKPQYDAVGRMVVVFHRDND-SG-VLGFK------
A0A2W0AJ66      RSRKK-IIAAFAVMVVSTVMTASFLMKPRYDAVGR--VLFFREDEGAG-VLGFK------
A0A1Q7RBU1      RNRKW-TIAVFALVVVAIVVTASLLMKPQYEAVGR--VVFHREND-SG-VLGFK------
A0A2V9JPV9      RNRKW-VIALFALVVVAIVATASFLMKPQYEAVGR--VVFHREND-SG-VLGFK------
A0A3P0X3W6      RRAWW-KIALFVVTCTALTAVACFLMTPVYEATVR--LAVDSKVP-AS-VIGQD------
A0A2N9MK30      RRHRW-KILSFIGVSAIATLIVSARLTPMYEATVT--VDVDRKVP-TA-VVGQD------
A0A3D1ASD2      RRHKW-KILGFVLACCIATLLVSTRLTPIYAATAT--VDVDRQMP-TN-VLGQD------
A0A7C5AXI3      KRHRW-RILAFVAASVAATIIVSSRLTPVYESTAT--VDIDRQTP-TG-VIGQE------
A0A7C6E4H7      KRHRW-KILAFVATCVIATLVISSRITPLYESTAT--IDIDRRMP-TG-VLGPE------
A0A1F2TCR2      FKHRR-VAGAAFVIVVMAMMVQTYSTIPLYLATAR--VMIEDERS-IA-VANLN------
A0A350UQT3      DEEMW-KIGAFILVVLIATAVISLRLTPVYESTAT--LYVDRQEA-KG-IVGQE------
A0A7C3HRX0      RRHAL-RIILFVAALTAATGIITLRLTPVYEATAT--LYVDRQEA-RG-IVGQD------
A0A1F2V330      MRRKL-FVLIPAAVLIVAVGIYTVYQPPLYRAQAL--LGVEPGAR-NY-VQTMD------
A0A662EE63      WSRRW-LVLAVLLSTVVLTTAWSVTRPKLYRAATK--LIVEPTSS-IN------------
A0A2V8TLH7      SRGRW-TILSVFVVIVTLVAIGTFTQKPVYRARAT--VEITSQAS-KV-APVAD------
A0A1Q7ZJT1      WRGRW-TILSIFVVVFTLVAIGTFTQKPVYRASVT--VEITPQSR-KV-SPVAE------
A0A2V8VC99      WRGRW-TILTIFVVVVTLVAIGTLTQKPVYRAQAT--IEISPQSR-KV-SPVAD------
A0A348UZU3      YRRRW-TVISLTLIAVALSLIISFVTRPVYKARGT--VMIEKEPN-IL-SFEDI------
Q01XL7          WGHKF-ILLLCIFAGALGGTAYVILKTPEYAAAST--VELIGFNQ-SF--MNMS------
A0A2V8ERZ5      YRYRR-ICAATFVLVSAALIIQGYSTVQMYQAQAR--LLIEDERS-TA-VPGLQ------
A0A2V8GTX0      IKHWK-ACAAIAVLVIAGMMYQTFTTVPLYRAQAR--IQIDEEQT-TA-QVDFK------
A0A2V8J0X9      FKHRR-LSGTAFVLVVTAMMVQTYSTIPVYEAWSR--VQIQDERT-TQ-VGTLN------
A0A523DUV7      WVGKS-WILVIALLGLGVGFLATFLQVPIYSARAL--VQIDPPGQ-NI--SQLS------
A0A1F2U158      YRYKR-IALSVFLLTALALMIQGYSGEQVFQAKAQ--VLIEDERS-TA-MPGIA------
A0A2V8F6S9      YRYRR-IAITVFVLTTAALMIQGYSTTPMFEARAQ--IEIDAERA-TA-LPGIT------
A0A7D8BEX2      LRRRR-IVLAAFLVGLLIGTAL-LFKPRNYLSVGL--LRIEPSRS-SM--FQLS------
A0A4Q1SCH5      LKGKW-FILASTVLCGAIALIYITVTKPVYEADGI--VRIDPNRS-GT--LGLT------
A0A372IRG7      IKRKW-VILFCVLVGVGIAFYHIFTTIPQYEAISR--MSIDFSRS-TN--IGIE------
A0A2V8K4L4      MRHKW-IVVLVAFLGTVAGILFTLPQTPIYQSSTS--LEVQGLNE-NF--LNLE------
A0A2V8NCZ3      MRHKW-IVILVAFLGATAGILITLPQTPIYQSTTL--VEVQGLNE-NF--LNMQ------
A0A4Q7YNP3      SRHRW-MIFASAIAGILLSFLLSFASLPYYRARTS--LDIQSLNS-DF--MNMR------
E8UZE1          KRRKW-LVLLIFLVFVAASALYTLRLPKRYEALCK--IDIDLSTP-KS-VLALD------
A0A2U3JZ71      RRNWW-KMLLFVSCAVAATLMVSARLIPVYESTST--IDIDRQMP-SA-IIGQE------
A0A2V8TTB0      RKHGW-TIAGFVVAAVLGTLIVSLRLTPVYESTVT--VDIDRQMP-TG-VLGPE------
A0A1V6HR88      TARWR-LIALTTLLAIAGGVLAYLVTPKEYRATTT--ILIERRLS-IP------------
A0A3E0P0A3      LRGWK-VLIAFAVLGLALGIARYLSAPVVYSATSQ--IQIERRAP-NL-LGGQM------
A0A2V8EXP2      HKRRV-AALTAFLLVFVSTAVYTFTAKPIYESKVQ--ILIEKENA-NV--VTFK------
A0A2W4RYA1      YKRRW-LMASAFLTVMVAVALYTFTATPLYEARTR--LLIDSD-P-NI--VSFE------
G8P0Y7          LKRKW-IVIVSVAIVLITTALISLHTTPIYEAVTK--ITISPPTS-NP--LNFK------
A0A5M8T4U7      MKQRF-VILAVTIISFAAATVYSFRTKSVYESGGR--LQINPNVP-KV-GLQGY------
A0A7L5A491      RRHAW-KIAIAVTVCTTLAGVAAYTMTPVFESTAR--VAIDMKTP-AS-VLGEP------
A0A7D8BF18      RKRLW-VILLLSVLGAGWGYYKAVTQPRIYEASGT--IEIRSGST-NE------------
A0A1E3Y9R6      YKRRW-VAIPGFLLVFVSGAIGSIRTVPVYEARTQ--IIIEKDAR-RN--TSIN------
A0A2W4TLP2      YKRRW-VAIPGFLLVFLSGAIGSIRTVPVYEARTQ--LIIEKDAR-RA--TSIN------
A0A7G8BDY8      RRRIR-IIIAAVVIVFVLGSLYCVVKTRRYEATSD--LAIYPEGS-DA--LDMG-----D
A0A7C4BZ42      IRNRW-TLATAGVLGALLGFLYTVPQTPIYQASTT--VEVQGLNE-NF--LNMG------
A0A3R9WF43      RRRWR-SAVLVAVVIALLGTVAVLLMTPRYSATAT--IEVNREDH-EE-ASGPR------
A0A317HKM4      YRRRW-IIFLIVVAGLIGGALYNWTAPRIFEAGAT--LQIEGDTN-IL-ALDRP------
A0A2V9CG11      IRHKK-MLLLVTLAGLIAAILIGLVQTPVYRARTS--LEIQDFNE-NF--LDLK------
A0A523E0N1      LKHRW-PFVAVILATWMFAFISKYTETPYYRATAL--IQIDWGKI-NV-VQDVM------
A0A4R1LAZ7      IRRKW-LLLAFALIGLGAGVLFLLMSVPLYEATAR--IDIDPGRS-TN--IGIN-----D
A0A7G8BMP1      IKRKW-VILVCLLFGLLVAGYFAFLSTPLYEAVAE--VDIDLGRS-TN--IGIS-----D
A0A523ECP2      LKRRW-VILAVFISVLSYTAVKALMRQPVYSATTI--LQIDRGRI-NL-VQDVM------
A0A2W0C122      HKHVW-IILGCTSLSVSVSVLYAMRQPRLYRATTN--IAIDRDSN-AT--VPLN-----K
A0A2W0AUU7      HKHLW-TIAACTSLALSISLLYAVHQPRLYRATAN--IAIDRDSN-AG--VSLN-----K
A0A2W0BQL1      HKHLW-TIAACTSLALSISLLYAVHQPRLYRATAN--IAIDRDSN-AG--VSLN-----K
A0A4Q1SDL1      RRRRR-TVYSIFGAILLLAILYCIFATRRYMATGI--VQLQKDTD-SG--LSMS-----D
A0A3P0XH15      IKRKW-LILAGIVVGLAFAAVYILTTIPQYEAIAL--IDINEGQQ-SN--IGIS-----E
A0A3M1WQW8      KKRKW-IVLGVLMMVVTVVAIRMYRARPIYQASGK--VIINQQTP-VP-LANRQ------
A0A3N1JHC1      RRHRF-AVMMIFALCLLGGLLYAFFVPKSYKAQTV--LEITGINQ-DF--MNTR------
C1F294          LKRKW-IILICVLAGIGVALYHVETATPQYEAVSS--VSIDMNKS-TG--VELT------
A0A2V9KA79      KRRLW-LVLATTFVGTLCGGGASVLLPVRYRAQVL--LAAESAPT-RD-YLRLGGYGDAI
A0A522PSP1      RRHAL-RIAIFVAATFLFTGIILLRLPRKYESTCV--IRLDPSVP-VS-VVNNQ------
G8P085          GRHKW-FILACIVIGTVVAVVYVKSVTPIYEATAS--IRIDPGRI-GS--LGLA-----D
A0A7C6A629      KRHRW-KILAFVATSVIATLIVSSRVTPVYESTAT--IDIDRRMP-TG-ILGPE------
A0A4Q1SGQ1      RRRRR-WVLWPTGAALLLATLYWLLATPRFQANGE--IEVQRESA-AA--FGLDNSVNGE
Q1ILD9          VRRRK-LLAAGVLLGILLATAYCILKTRRYEGEAT--VYVHPEGS-DV--LGSM------
A0A7G8BJH7      KKRWA-IFLCIFAVFLAATTLYCLFATRRYEATGQ--IQIQKDSS-GA--FGLEGSVMGD
A0A7C5SHM3      MQRRW-LVVAIAAQVFIVTGLVTFLRTPLYDASAR--ILIERSTP-KV--LESD-----D
Q1IJZ6          RKRKN-LILGAAGACLACALLLSFVMRSYYNSSAT--IEIQKDQD-AS--LGSA-----L
A0A2V8TCE6      VRRQW-AIYTVAGLVLGLTALRLLMVQSTYKAKAL--VEIQRSSP-DV--LAFR-----D
A0A522TBE8      QRNLW-RLVTFVCVVTAVATLIALTRPKQYAAVTT--LQVDALGA-QV--VGDE-----H
Q1ITG0          RRHLQ-MIIGVTAFGVLVAILFCLFMKPRYEGMAD--LNVHPEES-AA--LDMG-----A
A0A7C2ML20      WRRRW-EVLGVFVTILIISGVMAYRTKPVYTATGT--ISIEPARQ-QV-IIGVQ-----D
A0A7C5AXS9      KRHKG-TLALFALSGVAAAILFSLPQTPVYQAKMT--LEILNLNE-NV--LNRR-----Q
A0A7C2RGE3      KKRRW-IVLSVMLVVVTIVTIRMSQLPVVYESTGR--IIINPQMP-LR--VTRE-----K
A0A3N5PCI5      YKRRW-IALFTFLIAAAGVVTYTMSVTPIYEAHTQ--LLLQ-QRA-SI--VTFE-----G
A0A3M1Q0S9      VRRRW-LIVTCVLVATVAALVSSLLATPVYRATCT--LAIERTGV-RV--LR-E-----T
A0A2Z5G448      IKRQF-IILACLATGLILGAVITFFTTPVFESTAR--IDINPDRS-TN--LGIS-----D
A0A3M1VZ38      VRRRW-LIGTCVLVTTVAAAVSSFLATPIYKATTT--ISIERRGV-RL--LNT------S
A0A4Q1SD29      FKRKW-IILACLLLGLGIGLYFALATIPQYEATAR--VHIDFSRS-AN--IGIE-----D
A0A6N9FGE2      -----------------MALVHAYTATPVYRATAR--LLIEPQGP-NV--VTFQ-----E
A0A3M1PY35      WQRRW-LVAAIALEVLLVGAVVTFLRTPLYEASAR--LIIEKTMP-RV--LDSE-----D
A0A3M1VMP2      WQRRW-LVAAIAAEVFLLTALVTFLRTPVYTASAR--LLIERTTP-RV--LDTE-----D
                                                                            

A0A2V7VMF7      -TVTDALAGMGNYWQNADFYNTQFRVLKSKTLGSRVVERLKLD--------D-------R
A0A2V7YYV7      ------SDPNVIPLTPDQILRTYALLLTQRKLLDEVIADLRL------------------
A0A2V7Z0J5      ------TDPNAPSISATTILATYALFMTEPPLLNKVIADLGL------------------
A0A2V7Z3M4      ------TDPNAPSVSSATILATYALFMTEPPLLNKVISDLRL------------------
A0A399Y5V2      -----IADVAMPAEDPARELQTQIQVITSRPVAEETAKRLQLN--------V-------P
Q01X01          -NLRDIFPTAAPSADSAVYVQTQAEMLQQDALLERVVKKLRLE--------D-------R
A0A3M2D9H8      -------------------SQTFTELLVTRPVLEAASERLGYY-----------------
A0A2V8JK38      --NLRDYYQADSDTYVDYMLQSYFRILKSRSLARRVVTELHEE--------L-------E
A0A2V9IXG5      -PGADFNAQSSYYLNIDRYFKTEKQKLTSRRMHLLFAGRLKQQ----------------N
A0A2V9J2P4      -PGADFNAQSSYYLNIDRYFKTEKQKLTSRRMHLLFAGRLKQQ----------------N
A0A1Q7RLS4      -----TGMAQYGWYAEERYFNTQYEIIKSRDVARRVFDRLDLY--------N-------H
A0A2V2R525      -----INNSASAPDY----FETQLEILKGSGLLRRVVKTLDLE--------H-------N
A0A321LPW6      -----QDDS--DNFYPLVRIKTYMIELKSRPLLSDVAARLRLD--------Q-------R
A0A2V9R9V4      -----QEED-----YLNVTMNTSEVILKSLPLLEDVVVQLRLD--------Q-------N
A0A321LE75      -----STDESDDAYYTSLVMKTKIRTLMSRPLLEDVVIHLGLD--------H-------N
A0A2V8R8U7      ------INAPADANF----WGTQLKLLQNPQLARQVVLSLELQ--------K-------N
A0A2V8QMP4      ------IIRGSDPNY----WNTQLQKLKTQKLARQVILRLDLQ--------N-------S
A0A2V8R4S3      ------IIRGSDPNY----WNTQLQKLKTQKLARQVILRLDLQ--------N-------S
A0A2V8NJ55      ------LNTGTDPYY----WNTQLKLLENPELARQVAITLDLQ--------N-------N
A0A2V8Q7I0      ------LNSQPDANF----WGTQITLLQSPALARQVALTLDLQ--------H-------N
A0A2V8S6K4      ------VNAGADPAY----WGTQLKLLENPSLLRQVIMRLGLQ--------N-------N
A0A317I2L9      ------IGGQLDPNF----WGTQLKLLESPALARQVALTLDLQ--------H-------N
A0A2V8LLF9      --------GQPDPNF----WGTQLRLLQNPLLARQVIVSLDLQ--------H-------N
A0A352FRF4      ------VIGQSDPNF----WGTQLNLLHNEALARQVIVRLDLP--------H-------N
A0A2V8MKV0      ---------QRDPNF----WGTQIKMLQNPSLARQVILTLDLP--------H-------N
A0A2V8PYY8      ---------QRDPNF----WGTQIKMLQNAQLARQVILTLDLQ--------H-------N
A0A1Q7YKQ8      -----NTGGGDDAQY----WNTQIKLLESQQLARQVALTLDLQ--------N-------N
A0A352F3R7      ------ITGQNDPNF----WGTQLKLLENPALARQVVLTLDLQ--------H-------N
A0A0B6WXT1      ------VSVPNDPNY----WSTQIKLLQNPQLARQVALTLDLP--------N-------N
A0A3B9MEU8      ------INAQSDPSF----WGTQLKLLENPALARQVVLTLDLQ--------H-------N
A0A2V8MHG6      -----LNNPSQDPTY----FNTQIQILTSAGLLGRVAKTLDLE--------H-------N
A0A2V8P7N1      -----LNNSSQDPTY----FNTQIQILTSAGLLGRVARTLDLE--------H-------N
A0A2V8M3M6      -----LNNPSQDPTY----FNTQIQILTSAGLLGRVARTLDLE--------H-------N
A0A1Q7NJH5      -----LNYPSQDPTY----FNTQIQILTSAGLLGRVAKTLDLE--------H-------N
A0A2V8PJY0      -----LNNPSQDPTY----FNTQIQILTSAGLLGRVAKTLDLE--------H-------N
A0A1Q7Y6W9      -----INYRISDPAY----FNTQLQILNSPGLLRRVVKTLDLE--------H-------N
A0A2V8NC68      -----LNTPYQDPTY----FNTQLQILSSAGLLSRVVKTLDLE--------H-------N
A0A399WK13      -----SNA---DPSY----FNTQLQLLWSESLLRRVVKEHNLD--------A-------N
A0A352FLX4      -----LNSETNDPAY----FNTQLQILTGPGLLRSVAKTLDLE--------H-------N
A0A2V8RTL7      -----SNP---DPSY----FNTQLQLLNSDTLLRRVVKEHNLD--------A-------N
A0A3E0PCJ6      -----MTS---DPAY----FNTQLQLLNSEVLLRRVVKELNLD--------T-------N
A0A3M1S4R8      -----PNP---DPAY----FNTQLQLLTSDSLLRRVVKEMNLE--------T-------N
A0A7C2G442      -----PNP---DPAY----FNTQLQLLTSDSLLRRVVKEMNLE--------T-------N
A0A1Q7YFI6      -----LEQQYQDPTY----FNTQIQILSSPGLLSRVVKTLDLE--------H-------N
A0A136KC10      -----SNA---DPSY----FNTQLQLLWSESLLRRVVKEHNLD--------A-------N
A0A3M2D6Y5      -----SNP---DPAY----FNTQLQLLTSDSLLRRVIKEMNLD--------T-------N
A0A2V8SEX6      -----SNP---DPSY----FNTQLQLLDSENLLRQVVKEHSLD--------T-------N
A0A7C5ZUU4      -----SNP---DPSY----FNTQLQLLGSDALLRRVIKEHNLD--------T-------S
A0A0B6WWQ6      -----INRS-SDPTY----FSTQLQILTGSQLLRRVVRTLDLE--------H-------N
A0A3B9MK99      -----FGPT-NDPVY----FNTQLQILGSPGLMRRVVKTLDLE--------H-------N
A0A352EX26      -----MGSM-NDPVY----FNTQLQILGSQALARRVVKTLDLE--------H-------N
A0A2V8MM59      -----YSPV-NDPAY----FNTQLQILTSQGLLRRVVKTLDLE--------H-------N
A0A2V8PFE8      -----YSPV-NDPAY----FNTQLQILTSPGLLRRVVKTLDLE--------H-------N
A0A2V8PWS6      -----YSPV-NDPAY----FNTQLQILTSPGLLRRVVKTLELE--------H-------D
A0A2V8LCT5      -----VSPV-NDPAY----FNTQLQILTSQGLLRRVVKTLDLE--------H-------N
A0A352FTJ9      -----VNPI-NDPAY----FNTQLQILTSPGLLRRVVKTLDLE--------H-------N
A0A257VBK0      --SGFNPTGASSWMEEQKFYNSQQQIMTSSVVMQDVVDKLKLQ--------S-------H
A0A2G6PYV5      -----QWNPYREEY-----FKTEFRIIKSLPVAEEVARTLGVK-----------------
A0A2V8F956      -----DEDQTRADY-----YQTQYNLLQSRALALRTIDQLKLW--------E-------T
A0A1F2S1W5      -----EQNEVTDDY-----YETQYRLLQGRGLARRTIDALNLW--------S-------H
A0A1F2T595      -----EQSDGADDY-----YETQYRILQGRGLARRTIDALDLW--------R-------H
A0A2V8JQV5      APSVISTAFEE--------IQTQIKILKSDSLIGQAMKRFGLT--------HSADPLTRL
A0A2V9AC41      SI---DSGDYNNEF-----YKTQYEILRSPALAERVIREEGLQ--------N-------L
A0A2V9MAM9      AT---APTHSEDSY-----IETQAEILRQDSLIGRAFNRLPAE--------R-------R
A0A348V070      SGGIN--------------SQSHAMLLKSRSLAADVIEKMKLH--------S-------H
A0A2V9M454      ------TEQADDSF-----LASQISILQSDNLAWETIQQLGLA--------R-------L
A0A2V9IVR7      ------AMPADDMF-----LQTQVNVLQSDNLAWQTIEQLRLG--------E-------N
A0A2V9ILE2      ------AMPADDMF-----LQTQVNVLQSDNLAWQTIEQLRLG--------E-------N
A0A2V9LGY4      ------AMPADDMF-----LQTQVNVLQSDNLAWQTIEQLRLG--------E-------N
A0A2V9J4D6      -----ESTPADETF-----LLTQTQVLRSDNLAWETIQQLKLA--------D-------D
A0A2V9L9C5      -----ESTPADETF-----LLTQTQVLRSDNLAWETIQQLKLA--------D-------D
A0A2N9M9N1      ------SGATDAAF-----LQTQVDLLQNNNLSWQTMQELGLA--------NGNTELGVG
A0A2V9JEC4      ------HAPVDSTF-----LQTQVDLLQNDSLMWQTIHRLDLE--------S-------R
A0A2V9LPQ3      ------SMPADEAF-----LKTQALVIGSDHLAWETIGQLGLA--------E-------N
A0A2Z5G3A3      -----GGAADEDALDENITLQTQTNILQSDSLALRVIEDLHLD--------K-------T
A0A2V7UGP8      G----YDYMSYNDF-----YQTQYRLLASHNVARKAMLKLDLR--------N-------D
A0A239MKT6      LSGGMELNTD---------MLTHQRILQNDNTALSVISSLNLM--------Q-------E
A0A3E0PCN7      VI---LNSGSDPAY-----FATQLQILEGPGLLRRVVRTLGLE--------K-------N
A0A2V8IYW3      -----YIRSTVTNR-----IEDRLRSIREQVLSRSMLEPIILEFDLYPEQRK-------Q
G2LEI9          -----VPYSVDPDY-----LNTQIRKISSPSLLVEVVKTLKLD--------R-------D
A0A317J121      VTLFKNSGVSGNDEVSQVNIQTQIQLLRSSSFLRRVMERLQLE--------T-------V
A0A2V7YW66      -----GQNPWLENYWNMEFYPTQYELLQSRGLAERVVKSLDLM--------E-------D
A0A2V7Z0V0      -----TQNPWLENYWNMEFYPTQYELLQSRGLAERVVKSLDLM--------E-------D
A0A2V8GFD4      -----DQNKTTLDY-----YQTQYRILQSRAIARRSIADPFLA--------T-------N
A0A2V8HSS5      -----DQNKTTLDY-----YQTQYRILQSRAIARRSIADPFLA--------T-------N
A0A2V8KP55      ---------DSDTYVDYM-LQSYFRILKSRSLARRVVTELHEE--------L-------E
A0A399WNU1      II---LNPGSDPTY-----FATQLQIIEGPGLIRRVVKNLDLE--------H-------N
A0A2V9JSI3      -----RGTPSDEAF-----LRTQVKVLESDSLAWQTIQQLGID--------Q-------S
A0A2V9WI32      -----TIGADYEDYNIA--LETQIRILQSDALAFQVIKNLKLD--------N-------N
A0A2V8IVN9      -----NEEQTKADY-----YQTQYNILQSRSLARRTLETLKLW--------E-------S
A0A7C5Z4J3      -----RTVSTDPTF-----LQTQVDVLKSGNLAWQTIQQLKLD--------L-------E
A0A1F2TPT3      RRP----------------LDTELAILRSRWLAAKTVASLGLI--------Q-------N
A0A2V8JTQ2      LLDDPEDRTA---------IDTQIRILQTDALAMQVIKNLQLD--------K-------N
A0A2V8UZY0      LLEDPEDRAA---------IDTQIGILQTDALAMQVIKDLHLN--------K-------N
A0A350UEK1      TEGSGPAGNMVD-------LQTQIKILQSDTLVDRVTAQLSNG-----------------
A0A350UIQ4      TEGAGPSGSTID-------IQTQIKILQSDTLLERVHSLMNPG--------E-------E
A0A1H5Z7N3      -----SGIESSSAH-----LPTQVSILKSDTLLLTVARDLDLA--------N-------N
A0A1G7JVV8      -----GSLQSED-------LETEVLIISSESLMLSVAQEMNLA--------N-------N
A0A1H4T6W9      -----GSSLSQETN-----LENELGIIMSDSLLLNVARNMNLV--------N-------N
I3ZEU5          -----GSVGSQETN-----LENELGIITSDSLLLNVARNMNLI--------N-------N
A0A7L5A6M5      -----GGDEDSQTK-----LQSEVSILQSDSLMASLARELNLV--------N-------N
A0A428MDU2      ------ASDTAASK-----MLTEVAILQSDSLMLTVAREMDLS--------N-------N
A0A5B9EBI2      ------GAPDTSNH-----LTTQSSILTSETLLLTVARELNLN--------N-------E
A0A239HDF6      -------GQDTMTQ-----MMTETAILQSDTLLLTVAKDLDLC--------N-------N
A0A4Q0T270      --------SDPQTK-----MMTEIAILQSDTLMLTVAREMNLA--------N-------N
A0A1Q3QQB6      ------GGTDTASK-----MLTEIAILRSDSLMLTVARDMNLA--------N-------N
A0A3N1K1G7      ------AGDAQSSR-----MLTEIAILQSDSLMLTVARELNLS--------N-------N
A0A4V2G466      -------ASDSGQR-----MLTEVAILQSDSLMLSVAREMDLA--------N-------N
A0A6B9YNQ8      -------STDSSQR-----LLTEVAILQSDSLMLTVAREMDLA--------N-------N
A0A7G8BSK5      -------NTDSSQR-----MLTEVAILQSDSLMLTVAREMDLA--------N-------N
A0A1I6MH75      -------GQDTQTK-----MNTEIAIMQSDTLLLTVARELNLP--------N-------N
E8WVF6          -------GDDPQQK-----MMSEIAIITSDTLLTTVAKEMNLA--------N-------N
A0A3N5YNR8      A----ERYLSSEIY-----LQTQLEILQSRALARRVVDRLNLA--------N-------D
A0A3N6A5T6      A----DQGIAMETY-----LQTQFKILQGRTLAERIVKQLQLH--------E-------N
A0A1F2Q9L4      -----DDWFDAQSF-----YPTQYRLLQSRGLAERVVKNLRLA--------D-------D
A0A2U3KC61      -----ENNLP--DFDYQATLETQAAILRSDVLALKVIKAMHLD--------P-------N
A0A2V9Y2R7      -----DGGSPGEDWDYNVTLETQTAILRSDALALKVIETMHLD--------K-------D
A0A2V9NGH6      -----ANAGP--DYYDPSDLDTEVGILKSDLLAFQVIKQLNLD--------K-------R
A0A2V9PYE6      -----PSVGP--DYYDPSDLDTEVGILKSDLLTFQVIKQLNLD--------K-------R
A0A2V9NL07      -----GNSGM--DYYDPTDLDTEVRILHSDLLALQVIKQLNLD--------Q-------M
A0A2V9QD92      -----GNSGM--DYYDPTDLDTEVRILHSDLLALQVIKQLNLD--------Q-------M
A0A2V9WPZ6      -----GSMSI--DYYDPADLDTEVKILQSDLLALQVIKQLNLD--------K-------R
A0A2V9ZLH4      -----ASAS---DYYDPADLDTEVKILKSDLLALQVIKQLNLD--------R-------R
A0A2V9RQF1      -----ANAPI--EYYDPADLDTEVRILKSDLLALQVIRQLNLD--------K-------R
A0A2V9YDK8      -----GSVSV--DYFDPADLDTEVKILQSDLLALQVIKQLNLD--------K-------R
A0A2V9V8F7      -----GSMSI--DYYDPADLDTEVKILQSDLLALQVIKQLNLD--------K-------R
A0A2V9XGR9      -----GSMSI--DYYDPADLDTEVKILQSDLLALQVIKQLNLD--------K-------R
A0A2V9V3Q5      -----MPV-M--DYYDPTDLDTETRILQSDILALQVIRQLNLD--------K-------R
A0A2V9NWS3      -----PSAAV--DYSDPTELDTEVRILKSDLLALQVIRQLDLD--------K-------R
A0A2V9USA9      -----ATFSL--DYYDPTELDTEVKILQSDLLALQVIKELNLD--------H-------S
A0A2V9XW18      -----ATFSL--DYFDPTELDTEVKILQSDLLAMQVIRELNLD--------R-------R
A0A1H5SQF5      LIGGDQLSVD---------LLTQQAVIGNENIAMKVLEDLGLT--------N-------S
A0A2V9AEW6      -----GNYVSQESY-----VETQVKLLQSESLIEHVIDKMKLH--------K-------E
A0A2V8WQK6      -----GSYASPESY-----VETQVKILQSESVIEHVIDKLKLQ--------K-------E
A0A2V8XIF4      -----ASIASPESY-----VETQVRRLQSESLLERVIDKLKLR--------K-------E
A0A2V2R0I6      -----DFYSDSESY-----IETQSKILTSETLALQTIRNSGLS--------A-------R
A0A2V8XAR9      -----DYMMDLENY-----IETQSKILTSETLALQTIRNTGLS--------A-------R
A0A2V8VZA0      -----DYMMDLENY-----IETQSKILTSETLALQTIRNNALS--------T-------R
A0A1Q7CB82      -----DYMMDLENY-----IETQSKILTSETLALQTIRNNALS--------T-------R
A0A2V8WIU1      -----DYMMDLENY-----IETQSKILTSETLALQTIRNNALS--------T-------R
A0A1Q6Y9F5      -----EYMMDLENY-----IETQSKILTSETLALLTIRNNALS--------T-------R
A0A2V9EVV8      -----EYMMDLENY-----IETQSKILTSETLALLTIRNNALS--------T-------R
A0A2V8YF91      -----DYTVDFDNY-----IETQAKILTSETLALQTIRNGGLS--------D-------R
A0A2V8XZK2      -----DYMVDSENY-----IETQAKILTSETLVLQTIRDSGLT--------A-------R
A0A2V8ZTX6      -----DYMVDSENY-----IETQAKILTSETLALQTIRNNGLA--------L-------R
A0A2V9BT79      -----DYMMDSDNY-----IETQSKILTSETLALQTIRNNGLA--------L-------R
A0A2V9YHT3      --------IDADDWDYTVAMETQVRIMQSDSLALKVAHDLG-------------------
A0A7C2XNI7      -----EMYWDVENY-----IETQAKILQSETLALQTIESLQLY--------K-------H
A0A1Q8B793      -----AYLLDQENY-----IETQSKILTSETLALQTIRSVGLA--------G-------H
A0A2V9BCA0      -----AYLLDQENY-----IETQSKILTSETLALQTIRSVGLA--------G-------H
A0A2V9BWU9      -----EMYMDMENY-----IETQSKILQSETLALQTIQSAGLV--------E-------L
A0A2V9DKX2      -----EMYMDMENY-----IETQSKILQSETLALQTIQSAGLV--------E-------L
A0A7C2YQY3      LP-------TDEEF-----LQTQVRILQSDDLAMQTIRALRLY--------D-------K
A0A3E0NV31      GG--------DQSN-----IETQITLLRSGNLLAKVVERLELT--------T-------R
A0A3N5M5V0      PE----RYLSSEVY-----LQTQLEILQSRALARRVVDRLNLA--------N-------D
A0A3N5XQP8      VA---MDPRSMESD-----LRTQYSILQSRTMARGVIKRLNLT--------N-------E
A0A2Z5G7H4      AEDA-SDALDANIT-----LQTQADLLESDTLALQVIEALELE--------T-------T
A0A2V9L5B5      -----APTVDVDSY-----RETQYKILRSRTLAEKVVNDLHLY--------Q-------S
A0A2V9LK56      -----ASA-DVESY-----RETQYRVLESRSLAESVVKDLELY--------R-------L
A0A2V9L7I0      -----APTVDVDSY-----RETQYKVLQSRTLAEKVVNDLRLY--------L-------S
A0A522PPT0      -----GPSWDLQSY-----RETQYQILKSRSLAERVVRDLRLY--------R-------Y
A0A7C5V1G5      -----GASWDIQSY-----RETQYRILRSRSLAERVVRDLRLY--------Q-------Y
A0A2V9KCS3      PG---TNDMYVQTD-----ILTQIKILQSDSLMERVVTKLKLD--------K-------K
A0A372IT17      TSHEASDALENSMS-----IETQAGILESDTLALHVIRALDLE--------S-------T
A0A4R1LC91      AG---GDALDANIT-----METEANILQSDTLALKVIKELHLE--------S-------S
A0A3M2BZG9      EE---W---WNLEY-----YPTQYRLLRSRGMAERVIQNLHLL--------Q-------D
A0A1Q7N5R7      VA---S---AWTDL-----LKS-YVVLDAVARERRLYLQARPR--------D-------M
A0A2V9QB26      SE---GNSSTALTE-----IATQVRLLQSESLIKRVLTKLK-------------------
A0A2V9VYY4      YE---Y-----EAT-----LETQVAILRSDALALKVIEGMRLY--------Q-------D
A0A3E0PHB0      FG---Y---D-QNY-----YNTQLQLMRSEDVMRDVVVKMKLY--------E-------K
A0A3M1SIV3      FG---Y---D-LNY-----YNTQEKLLESPELMKEVVVKLGLY--------R-------T
A0A3M2D491      FG---Y---D-MNY-----YNTQEKLLESPELIKEAVIKLGLY--------R-------N
A0A353C9L6      FG---Q---D-ANY-----YQTQLMLLRNRDLVKQVVIDLGLY--------R-------E
A0A2V8RQV0      FG---N---D-ANY-----YNTQLELLKNPELMKKVVISLGLY--------R-------N
A0A2V8SJH5      FG---N---D-ANY-----YNTQLELLQSHDLMKEVVIRLGLY--------K-------E
A0A357F267      FG---N---D-ANY-----YATQLQLLQNADLMRRVVVDLGLY--------R-------E
A0A7C5ZUA8      FG---Q---D-INY-----YNTQLQLLRSPELMKDVVISMGLY--------R-------D
A0A136JPP4      FG---L---DETTY-----YNTQLQLLQNPDLMKKAVVALGLQ--------R-------E
A0A399WUJ8      LG---G---DETTY-----YNTQLQLLQNPDLMKKVVLALGLQ--------R-------D
A0A2V9KIE8      SN---Q---DVDSY-----RETQFRVLESRTLAERVVRDLALY--------R-------S
A0A352F549      NG---Y---MEPEY-----FNTQVQILTSPTLLRRVAKNLDLE--------H-------N
A0A3B9MLP9      NT---Y---MDPEY-----FNTQVQIISSPTLLRRVAKTLDLE--------H-------N
A0A3D5SQ87      NT---Y---MDPEY-----FNTQVQIISSPTLLRRVAKTLDLE--------H-------N
A0A2V8NW86      SE---GDSSTVLTE-----IATQVRLLQSESLIKRVLTKLRDR--------F-------A
A0A7C2GJ20      LS---S---NDAQY-----LETQQNVLRSRELARRVIEALHLE--------R-------H
A0A7C4BTL5      YE---SGIYATLAD-----IQTQIKILQSSTLLERVVEKLKLK--------A-------P
A0A2V8ZHL8      QV---P---TDEAF-----IGTQIQVLESDNLAQRTIEQLGLA--------R-------E
A0A2V9B240      QV---P---TDDAF-----IGTQIQVLESDNLAQRTIEQLGLA--------R-------D
A0A2V9CBM2      LE---T---VSDDY-----LRTQYDILASDSLARRVIDQLRLD--------T-------V
A0A2V8XN17      LD---A---VSDAY-----LRTQYSILASESLARQVIDQLQLE--------A-------L
A0A2V8WX45      LE---A---VSDAY-----LRTQYNILASESLSRRVIEQLRLD--------T-------L
A0A1Q6YR79      LD---A---VSDAY-----LRTQYSILASESLARRVIDQLQLE--------T-------L
A0A1Q7VA32      LD---A---VSDAY-----LRTQYSILASESLARRVIDQLQLE--------T-------L
A0A2V9EY85      LD---A---VSDAY-----LRTQYSILASESLARRVIDQLQLE--------T-------L
A0A2V9H8K0      LD---A---VSDAY-----LRTQYSILASDSLARHAIGQLGLE--------T-------L
A0A2V9FFE5      LD---A---VSDAY-----LRTQYSILASESLARRAIDQLRLE--------T-------L
A0A2V9GM43      LD---A---VSDAY-----LRTQYSILASESLARRAIDQLHLE--------T-------L
A0A2V9CYQ5      LE---T---VSDDY-----LRTQYDILASDSLARRVIDQLRLD--------T-------V
A0A2V9BWU8      LE---S---VSDSY-----LKTQYTILASDSIARRVIDQLHLD--------S-------L
A0A2V8ZG48      LE---S---VSDSY-----LKTQYSILASESVARQVIDQLHLD--------T-------L
A0A2V8Y334      LE---S---VSDSY-----LKTQYSILASESVVRRVIDQLHID--------A-------L
A0A2V9AY68      LE---S---VSDSY-----LKTQYSILASESVARRVIDQLHLD--------S-------L
A0A1F2RFI7      ID---P---FDESY-----LETAYKVLQSRTLARRVIDKLQLD--------K-------L
A0A1F2RZS3      MN---P---YDDSY-----LETAYKVLQSRSLAYRVINKLNLA--------H-------S
A0A1F2USE2      LD---A---VSDTY-----LETQYKILGSESLARRVINQLRLD--------Q-------R
A0A7C2VB08      LE---T---VSDAY-----LETQYKVLRSDALARRVIQQLRLD--------R-------V
A0A2V9C238      LD---T---VSDTY-----LETQFKILQSDTLARRVIEGLRLD--------K-------L
A0A1F2Q9F5      IE---S---ASDTY-----LETQYRILESESLARRVVDQLRLD--------Q-------L
A0A1F2QQH9      IE---S---ASDTY-----LETQYRILESESLARRVVDQLRLD--------Q-------L
A0A1F2QXK7      IE---S---ASDTY-----LETQYRILESESLARRVVDQLRLD--------Q-------L
A0A2V9DEM9      LD---T---VSDTY-----LETQFKILQSDTLARRVIEGLRLD--------M-------L
A0A7C5TWV7      -IIKSQIYGGPSWWELQQYTKDQMLVLQTHRLAERVAEKLGLN--------A-------N
A0A2V7XDY0      ------EALGGGYWQNADFYNTQFRVLRSSALGEKVLDRLKLK--------D--------
A0A2V8G155      --AVIDEDQTKAE---Y--YQTQYNIIQSRAIARRALDELKLW--------N-------T
A0A2V8HDM7      --AVIDEDQTKAE---Y--YQTQYNIIQSRAIGRRALDELKLW--------N-------T
A0A2V8DRT9      --EVIEQDKATND---Y--YQTQYRILQSRSLARRTLDRMGAW-----------------
A0A2V7VYF3      --DVFDQGHSPYD---YEFTETQQKLLTSRSLARKTLDALRMW--------Q-------H
A0A1F2SVH2      --EAYEQNQVTDD---Y--YQTQYKILQSRALARRTLDALKLW--------D-------H
A0A2V8AJG9      --EAFEQNQIADD---Y--YQTQYKILQSRALARRTIDGLKLW--------E-------H
A0A2N9LQU7      --DLVSQKLADSDSEGG-RLQTELTILQCPPVSMQVIKNLDLG--------H-------R
A0A2P6WFK7      --EMISQKLGGSDDINS-VLQTEVKVIQSDTVAMRVIDSLELA--------K-------R
A0A2V8U914      --DIDPAATPNASSNDV-YVKTQSEILQQDALIEQASDKLNLA--------E-------R
A0A2V7W309      --GIASSDQE------F--LQTQYELLKSRGLAMRVIEDHKLL--------N-------D
A0A2W0BGU4      --YQQLQTDQD-----F--LRTQIQVLQSDNLAWRTIEELRLA--------D-------N
A0A2W0BVQ9      --YQQLQTDQD-----F--LRTQVQVLQSDNLAWRTIEQLGLA--------D-------N
A0A2V9MN96      --DLENGGMSEDWDYNV-SLETQLSILRSDALALKVVEALHLD--------S-------N
A0A2V7V2Z1      --EVAQVDAARDD---Y--YQTQYKLLQSRALVRRVIESMSLL--------Q-------D
A0A2V7X2F7      --DVTEVDAAKDD---Y--YQTQYRLLQSRSLARRVVESLNLL--------Q-------D
A0A2V7V2I1      --EVARVDSERDD---Y--YQTQYKLLQSRALVRKVIEEMDLF--------Q-------D
A0A2V7U3M2      --EVAQVDAARDD---Y--YQTQYKLLQSRLLARRVIETMNLL--------Q-------D
A0A2V7UHT0      --EVAQVDAARDD---Y--YQTQYKLLQSRALARRVIESMNLL--------Q-------D
A0A2Z5FVL3      --AASPAGGDTDPNSASMNLETQATVLESPALAMKVIEDLHLE--------D-------T
A0A2V9KBD6      --GVDTSLLEDPEDRAA--IDTQISILQTDALALKVIQDLRLD--------Q-------N
A0A2W0AJ66      --GPGSSLPEDADERAA--INTQIGILESDGLASQVIHDLHLE----------------N
A0A1Q7RBU1      --SVHPSLLEDPEDRAA--IDTQIGILQTDALAMQVINDLHLD--------K-------N
A0A2V9JPV9      --GVDTSLLEDPEDRAA--IDTQIGILETDTLAMQVINDLHLD--------T-------N
A0A3P0X3W6      --SATPNISDVEE---F--LTTEIDLLQSDAVLRPVAKAYHL------------------
A0A2N9MK30      --STQTGLNDADQ---F--LATQIKLIQSDAVLRPVADQYHLR--------D-------L
A0A3D1ASD2      --SGRAPVNDADE---Y--LATQINLIKADSVVRPVVQKLRLR--------E-------V
A0A7C5AXI3      --ALRTVSNDADQ---F--LATQVKLIQSDSVLRPVVEKFGLR--------D-------R
A0A7C6E4H7      --SAQSAINDADQ---F--LATQVKLIQSDSVLRPVVERYKLR--------V-------E
A0A1F2TCR2      ------ANDPMFWQDSTQYYNTQYSILKSRVLGQRVVRRLHLQ--------D-------N
A0A350UQT3      -----SQANVPSALDAESFLASQIRLLQSDSVVRPVAQRFRLL--------E-------S
A0A7C3HRX0      -----SQAASISTPESEQFLASQIRLIQSDSVVRPVAERFNLL--------E-------R
A0A1F2V330      ----------GSVARVQDQLLTIREVLFSRPVLEPVMRNFHLL--------P-------M
A0A662EE63      ---NNQFDAFVSYWQLDRYISDQVQVLETDRLAKRVVDQLGLA--------S-------L
A0A2V8TLH7      --VSQLGTSNFGWSAEERYFNTQNEIIKSRDVAQRVFDKLDLY--------H-------H
A0A1Q7ZJT1      --VAETGMAQYGWYAEERYFNTQYEIIKSRDVARRVFDRLDLY--------N-------H
A0A2V8VC99      --VAEMGASQYGWFAEERYFNTQYEIIKSRDVARRVFDRLDLY--------N-------H
A0A348UZU3      ---FQIETFRDD------YFQTQYKLLQSRSLAERTIERLKLW--------E-------K
Q01XL7          --QVDPQAGTDMTTASASNIQTQTRILTSRSMLARVAERMSLE--------M-------T
A0A2V8ERZ5      ------NDANQYYEDPEPYYQTQYKILKGRDLTRRVVRKLRLD--------T-------V
A0A2V8GTX0      ------QPELVY-SDPEPYYQTQYKILQGRDLALRAVKRVKLE--------D-------V
A0A2V8J0X9      ------ASDPAFWQESGPYYQTQYSILQSRGLGRRVVRKLDLQ--------N-------S
A0A523DUV7      ---NPYPTSAFNYFDYRNYYNTQYRIIRSKSLGERSIEKLDLA--------D-------K
A0A1F2U158      ------AAD--YYQDPIPYYNTQYRILRGRDLARRVVKRIDLQ--------N-------V
A0A2V8F6S9      ------TPDNTYYEDPEPYYKTQYRIIKGRELTRRVVKKLNLQ--------D-------R
A0A7D8BEX2      ---ASSALQGSSSLDD--KLNTEVLVLTSDSLLLHVAKDLDLA--------N-------K
A0A4Q1SCH5      ---DALLGANSD------EVPTEIGILGSAQVALSALEMLTPE--------Q-------F
A0A372IRG7      -DIIESKLSGGEESDQ--KLQTELRIMQSDSVVMDVINSLDLY--------H-------R
A0A2V8K4L4      --NLNPTSSPSGYLDPSYEILTQVKVFQSRSLLQQTTERLLKE--------K-------K
A0A2V8NCZ3      --NLNPTSVTGGW---GYEIMTQVRVLQSRSLMEKVTERLLND--------K-------K
A0A4Q7YNP3      ---AVAPTGEGNGSSAETNVQTQIKLLQSDTLLQRTKARLAAE--------P-------H
E8UZE1          -----SQSTASVATEQ--KMATQLSILESQSIAWKVIEELKLD--------A-------N
A0A2U3JZ71      -----STRTVANDSDQ--FLATQAKLIQSDSVLRPVAQQYRLL--------D--------
A0A2V8TTB0      -----SLQNATNDADQ--FLATQMKLIQSDSVLRPVVDKFRLR--------E--------
A0A1V6HR88      --VQSAVEAAWENYYSMEFYPTQYRLLQSRGLAERTVQNLRLD--------Q-------D
A0A3E0P0A3      ---FAQPWWNPE------FFPTQEQLLKGRGLAEAVTRDLALW--------N-------H
A0A2V8EXP2      -----EVFEQNQVADD--YYQTQYKILQGRALARRTLDALRLW--------D-------H
A0A2W4RYA1      -----GVVDQEQAQPD--YYTTQINLLRSRLLARRTIEALDAW--------N-------H
G8P0Y7          --DNNSSSSALEDPQA--GINTQVKILQSDTMAELVIHRMNLD--------T-------R
A0A5M8T4U7      ---GDQERSSADTS----AIQTELLILQSDSVLLQTAEKLDIY--------G-------R
A0A7L5A491      -----TVAGSASDAEQ--VFNTELQLIQSDAVLRPVAERFHLV--------S-------N
A0A7D8BF18      ---FRLSSGTGSDNTF--PIPTQVALLKSDTLLLNVARDLNLA--------N-------D
A0A1E3Y9R6      -----TVLEERESWYQDDFYPTQYRVLQSRTLAQRTARVLARE--------P-------A
A0A2W4TLP2      -----TVLEDRDSWYQDDFYPTQYRILQSRTLASRTAAAIEGG--------L-------P
A0A7G8BDY8      I--TASIGGGGLDFDE--KLETQVRILKSNSLAWTVISQLRLD--------K-------E
A0A7C4BZ42      ---NYSPTTPGYSYDPSYDITTQIKLMESGAVKKRAMDRLLKQ--------G-------G
A0A3R9WF43      ---TDTPSDSADDLKA--EVQTDTSILQSDGLVLRVIKDLDLA--------K-------K
A0A317HKM4      ------LVDQRDWMST--FLPTQVGILMSADLARTAHDELTSS--------E--------
A0A2V9CG11      --SVDPTVTADDYTTGASYFETQVKLLQSESLLERVIEKLNLR--------E-------A
A0A523E0N1      ---INPSRTYAD------IYGTQEKIVNSRQLAEHVVEDLELW--------E-------H
A0A4R1LAZ7      L--IEQKLTGGEGSSD--RMQTEIRIMQSDSVSMAVINSQDLY--------H-------K
A0A7G8BMP1      L--VEQNLAGEDASSE--RLQTEVAIMRSNTVALDVINTLDLY--------H-------R
A0A523ECP2      ---VQDYWSGYDE-----FYPTQQRVLMSRNLSRRIVKHLRLW--------E-------H
A0A2W0C122      A--FASALGDADDYSV--SLETQIRVLASRSLAEVVVRKLDLA--------H-------N
A0A2W0AUU7      T--FASPLGDADDYSV--SLETQIHVIASRSLALAVVRKLDLT--------H-------N
A0A2W0BQL1      T--FASPLGDADDYSV--SLETQIHVIASRSLALAVVRKLDLT--------H-------N
A0A4Q1SDL1      LQNNAAAGGGDDALAANINLETQSQILQSDTLALRVIEDLNLE--------K-------N
A0A3P0XH15      L--VQQEQGGIEADLT--RTATEIAIMQSDTVSLDVINSLDLY--------H-------K
A0A3M1WQW8      -----EALPYSSNDTQ--YLRTQINVLQSRTLARRVIEELSLD--------R-------Q
A0A3N1JHC1      ---DADPYANGVTQDS--YLETQIMLLKNEVVADRVAMVM--------------------
C1F294          ---SLASSSGGLQSQD--RVETQLHIMQSNTIAWNVIKTLKLY--------N-------K
A0A2V9KA79      H------------IQD--QLRIIKEHLYKPALLERIIREFGLY--------P--------
A0A522PSP1      -----PGTVSLDSMDV--LFATATKEIITPAVVTPAILKLGLW--------A--------
G8P085          L--TGTQADSAE------LIATEMAIIKSDAVAIDTMHSLSDE--------E-------F
A0A7C6A629      -----AAQSAINDADQ--FLATQVKLIQSDSVLRPVVERFKLP--------V--------
A0A4Q1SGQ1      P--SQAEGDSLD-YSM--TLETESKILESPTLALRVMHDLELE--------T-------T
Q1ILD9          ---PDLGLSSGMDWNS--QLATQIKILQSDALAWDVVKRLRLD--------Q-------K
A0A7G8BJH7      A--ADSASDALD-YNI--TLQTEANILNSESLALRVIQDLHLE--------T-------T
A0A7C5SHM3      V--MPMVWNEFE-IQR--FYQTQYLLIKDAKVLMRALHREDYP-----------------
Q1IJZ6          DTLASTVGGGSGDTKT--EVQTQVAILQSDDLAIETIERTGFE--------K-------H
A0A2V8TCE6      I--IRTDPSYQG-YSA--FYETQYRILQSRAVARRAAERLDLP--------R-------H
A0A522TBE8      L----QRASTAD-SDA--LVLTDQTVMTSPAVLLQVVEQLHLQ--------D-------N
Q1ITG0          LGDLATGAGGLD-WSS--KLETQARILKSDTLAWDVISQLRLD--------Q-------N
A0A7C2ML20      F--STTDQGSYE--GT--IIKTHLDILQSRALAERVIERLSRS--------G-------S
A0A7C5AXS9      L--EPTEAPAGS-PEL--DIRTQVRILQSEALVERVLSKVGNE--------Q-------A
A0A7C2RGE3      E--TGADLSSND--AQ--YLETQQNVLRSRELARRVIEALGLE--------K-------H
A0A3N5PCI5      A--ADPQAN----ERG--YLETQHRLLRSRSLARRVIDALNLW--------D-------L
A0A3M1Q0S9      L--SSAEPSWLD-YQN--WYNTQYQIMQSDEVLRRAVDLLDLM--------N-------T
A0A2Z5G448      L--LNSKAGGND-EST--RLLTEARILQSDSVIFAVIESENLF--------A--------
A0A3M1VZ38      L--TATEPSWLD-YQN--WYNTQYRIISSDAVLRYAVKQLDLE--------N-------R
A0A4Q1SD29      L--IQQQLGGGGNAED--KLQTEVEIMQSETVAMEVINSLDLY--------H--------
A0A6N9FGE2      V--I-VERGFFG-MDA---QTTQRDMLRSRSLARAAIDRLDLW--------D-------H
A0A3M1PY35      V--VSAPVGFFD-TER--FYQTQYLLMRDPAVLERALDNDGL------------------
A0A3M1VMP2      V--VPMVWNEYE-IQR--FYQTQYLLLRDPAVLRDALDRYGV------------------
                                          .                                 

A0A2V7VMF7      PPFKDN------------------------------------------------------
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      PE--------------AIQARVT-------------------------------------
Q01X01          PEYQRSSSLWDRLRPGTSQAPVT-------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      KEFAAPQRGFLAAQAGNLKKISSVEKTEQASDDEGDQL----------------------
A0A2V9IXG5      PRFQNQSS----------------------------------------------------
A0A2V9J2P4      PRFQNQSS----------------------------------------------------
A0A1Q7RLS4      PLFKKS------------------------------------------------------
A0A2V2R525      KAFFRPQMGQ-RTTWQRLLDMVGMGRDSGDSSQPVDDGVLMTSSVAPATD----KEDLAE
A0A321LPW6      PEFLAAEDRR--GVWSAIKSIGGRSALREAGESPP-----EQASDAADTDKQ--PGPGAD
A0A2V9R9V4      PAFL-ASQKK--SVWESLHEIAGKIQRDDASAPPA-----VFTATAMKSKIEG-NRSPEE
A0A321LE75      PQFMEVTRKK--SLVEAVQTIGSKFKQEVTSELPV-----LEPGVQIEGGID---RSPEE
A0A2V8R8U7      PSFLGGQAQS--SVFASLKRIFSGERIATPPAQNPA--AEQTVTMDEMKD--R-QLTPEE
A0A2V8QMP4      PAFFGTNRGT--GVIAGLRHIIARGKPTPTPQPAAG--GVPVLSDAELSA--D-QIAPEQ
A0A2V8R4S3      PAFFGTNRGT--GVIAGLRHIIARGKPTPTPQPAAG--GVPVLSDAELSA--D-QIAPEQ
A0A2V8NJ55      PTFFEGQASS--GFFASIRRIFFGDKPAPAHVD-----KVPVVVNPTIKN--E-QLSPEQ
A0A2V8Q7I0      PTFFGGQSQG--GIFASIKRMFAGDKAKPKISAPGPT-GLDVVRAAQLRD--Q-PLSPEE
A0A2V8S6K4      PSFLGGQSRP--SIFTTLRRAFSRNKAQTNEQPQPADGGLTVANEAAPGD--ELKLTPEQ
A0A317I2L9      PNFFGGGSQG--GFFASLRRILSGDQRRTKAKPAEPT-KLELVGESQLRD--Q-PLSPEE
A0A2V8LLF9      SRFLSGQAQT--SIVASLKRIFSRENAPAS-SPSTNA-TVEPISEEDLRS--R-QFTAEE
A0A352FRF4      PTFFGPQGQS--TIFASLKRIFSRDSVPKT-SPTPAA-GSVPLNEEALNN--Q-EFTPEQ
A0A2V8MKV0      PNFLGGRANS--GLFNSLKYLFSRTKIAPAPAPAASS-GEQTITQDELIDKVN-NLTPEE
A0A2V8PYY8      PNFLGGRANG--GLFNSLKYLFSRTKNAPSPAPATGS-SETTMSEDELKNKIS-NLTPEE
A0A1Q7YKQ8      SAFLGNQSQH--GLFTALRRIFSSERTTNA-SPATRT-NLPVISPERVTE--Q-QLTPEQ
A0A352F3R7      PAFFGGQTQG--GVFSSLRRIFSKPKKATV-APAAPA-GLVVVGESEVTG--D-SLTPEQ
A0A0B6WXT1      PAFLSGQAGP--SLTSSLRRILSRRKKEEN-E---QG-KLQVVTDSEVDA--E-NLTPEQ
A0A3B9MEU8      PAFFGGQSQG--GVFASLRRIFAKPKKASE-SPAVSS-GLTVVGESEVTN--G-SLTPEQ
A0A2V8MHG6      EGFLHPQSATRPSVWESLKGLVGLSKSQSKPREPE-G-----YVLRPSSAL-S-NDDIAQ
A0A2V8P7N1      QAFLHPQSAQDLSFGESLKGLIGLRKSQSKTKEQE-G-----YVLRPNSAL-S-NDDIAE
A0A2V8M3M6      QAFLHPQSAQDLSFGESLKGLIGLRKSQSKTKEQE-G-----YVLRPNSAL-S-NDDIAE
A0A1Q7NJH5      QAFLHPQSAQNLSFWESLKGLIGFKKSQSKTKEQE-E-----YVLRPNSAL-S-NDDIAE
A0A2V8PJY0      QAFLHPQSAQNLSFWESLKGLIGFKKSQSKTKEQE-E-----YVLRPNSAL-S-NDDIAE
A0A1Q7Y6W9      QAFVHPQSQSNRSTWQSILQMIGLSRSSTQEQNQQ-ASQDIPLTTNVASAV-A-SEDLAE
A0A2V8NC68      QAFLNPQSFNKRSTWDSIKRMFGLSDKKEREQEQK-L-DDAPLVDRIAPAT-A-REDLKE
A0A399WK13      KEFQAAAKASSGSMLGRLLRSVGLASGDKQKQEES-------VPIDPNSTLAS-ADEIAE
A0A352FLX4      PDFLRETSSKNKSTWLDIRGMLGLKAKTPPQSSTP----DVLPQSSSSSSSTA-AQEQAE
A0A2V8RTL7      KDFQAAKNAHGTSAWRSMMKAVGLASDKSSNSPDA----NTQKSEETNSSLVS-ADEIAE
A0A3E0PCJ6      EAFRKDSAEGSGSALRGMLTALGLASDDSKKEDVV----E-EVPLASNTELAT-VEEMNE
A0A3M1S4R8      KEFQEERNRQQASTWRAILRSIGLAREETKKTRDL----E-EV--LAGMNLAT-AEEINE
A0A7C2G442      KEFQEERNRQQASTWRAILRSIGLAREETKKTKDL----E-EV--LAGMNLAT-AEEINE
A0A1Q7YFI6      QAFLNPQAAQSRSTWENLKRMFGFGRPANNQQSV--PQNMMPLVDSSLAPATI-EGDIAE
A0A136KC10      PEFQALARTDSTSTFGRILRSVGLASGETQKSEQL-----A--AIDPNSTLAS-ADEIAE
A0A3M2D6Y5      KEFQEEKNQQRASAWRAFLRSIGLVREERRKEDTK-----ID-EITPGMNLAS-VEEMNE
A0A2V8SEX6      KEFLTARSEG-TGILRAMLRAVGLASDPKKDTAPN-----DEFAASANSSLIS-SDEIAE
A0A7C5ZUU4      KE-LQAEKNN-AGYWQTLMRTLGLAGDGTKKDDSK-----DN-ADQIDASLLA-NDEVAD
A0A0B6WWQ6      PEFLRPRAVRDLSPWLNLRRMLMLGTGQEKSAGQRGTRGQMPLPSEIAPATES-QDDFDV
A0A3B9MK99      PDFFK-GTIQKRSTWQTIKRMAGFASADPPDVTAK-PKDELQLRPAVAAAT-S-QEDLVE
A0A352EX26      PDFFK--GTQKRTTWQTVKMMAGFDNNVPKPDQSK-PNDVLQLRTTVAPTT-S-QEDLVE
A0A2V8MM59      KGFLSPQSSQPHSTWQTIMQMSGFANPDPK-AGKQ-SKE-LPLTTSFAPAT-S-SEDLVE
A0A2V8PFE8      QAFLRPQSLRQPSTWKTILQMWGVSGPEKKDPSTQ-PKE-LPLTSTVAAAT-S-NDDLAE
A0A2V8PWS6      QAFLRPQTLRQRSTWKTILQMWGVSGPEKKDPSTQ-PKE-LPLTSTVAAMT-S-NDDLAE
A0A2V8LCT5      QAFLRPQTAQPHSTWKTILQMLGVGGREKKETKQQ-NNV-LPLTTSVAPAT-S-SEDLVE
A0A352FTJ9      QAFLRPTAAQPHSTWKTIVKMLGAGA-EKKDTVPA-PNV-LPLTSAMAPAV-S-SDDLVE
A0A257VBK0      EAFKDV------------------------------------------------------
A0A2G6PYV5      ---------------------YFREQEQEDAQPKNLLDLGTVNEPREKTQKTKEDQAKEI
A0A2V8F956      PPFRNDKRFSLKRMMLGAPALVGQYAVSGISRTGDAASDFSGTGGSAARTTESANPGPDE
A0A1F2S1W5      PQF--TQPARPTVRSVIMMPVNAVARWFEPPRPVEPPDAAETRVQ---------------
A0A1F2T595      PSL--NQPPRLTIRGILFWPVGKLASWFEPARPPQAADAAETRTQ---------------
A0A2V8JQV5      TRW---------------------------RIALGIAKTSAASAR---------------
A0A2V9AC41      PLFGGKADKADSQKGLVANLKDGLKERVKGFVPDKPKVNAPPPDPATAG-----------
A0A2V9MAM9      GGL-----------------VLPGWSERLLPVFAPRSPGGNDD-----------------
A0A348V070      PEF--------------------IAPKLPVKLQKEGVQPDNPVFK---------------
A0A2V9M454      PNS----------------------GQTSPADGRVLGTPPA--MK---------------
A0A2V9IVR7      PAF----------------------APPLKGASPQRGESAE--AE---------------
A0A2V9ILE2      PAF----------------------APPLKGASPQRGESAE--AE---------------
A0A2V9LGY4      PAF----------------------APPLKGASPQRGESAE--AE---------------
A0A2V9J4D6      PSF----------------------TKGPQKQRKESIDSAD--VR---------------
A0A2V9L9C5      PSF----------------------TKGPQKQRKESIDSAD--VR---------------
A0A2N9M9N1      GDL----------------------WPVSTSRSTVA-------TP---------------
A0A2V9JEC4      PEF----------------------NPRRTASSKSQLESLPP-LQ---------------
A0A2V9LPQ3      GAF----------------------IPQTPKDASGQRAPEPRMLR---------------
A0A2Z5G3A3      PDF----ESKFNPIDMVLGIFSPGGASDPPGASLQQSPGRM-------------------
A0A2V7UGP8      PVV----------NRLVNRVRHKGPFTRLAEIVRHSPLDEIPEDPD--------------
A0A239MKT6      PPY---------------NEIPKGKLHDVYERERSLPLKDAPYTR---------------
A0A3E0PCN7      PEFLQPNQGEQSTVWQNVLKMFGFYQTKSMTPVEFADKETEDALQLSLDSNEQPSEPEKL
A0A2V8IYW3      VPM---------------------------------------------------------
G2LEI9          PKFLATGPTTLSAALLDLIRSPRGPRKPPQSETKSAELPEASPTPATTEDEL--------
A0A317J121      PPP-----------------PVQNDIFSRLRRRLTTNTQDPMALM---------------
A0A2V7YW66      PAF-------------------NPGAAARKDGGRGPTAEDDDAVL---------------
A0A2V7Z0V0      PAF-------------------NPGAA--REGAKGGTAEADEAVL---------------
A0A2V8GFD4      AQLSGGGRQMFDLQSLFNSVVAYVNGKMTGEAYSKSTAVDETPLE---------------
A0A2V8HSS5      AQLSGGGRQMFDLQSLFNSVVAYVNGKMTGEAYSKSTAVDETPLE---------------
A0A2V8KP55      KEF----------AAPQRGFLAAQAGNLKKISSVEKTEQASDDEG---------------
A0A399WNU1      PTFFRPGKDQDTTVWQNVARMFGLYSQPVRNQAESAPPAKNTLDLKTDTDADLDSQAEQL
A0A2V9JSI3      AEF--------------------SPPRGGKPVSPAIVQ----------------------
A0A2V9WI32      PAF---------------------------------------------------------
A0A2V8IVN9      GEF----------------VTNKRGIVQTLAGGVASLFGKKAPEPGIPDAGET-------
A0A7C5Z4J3      PSF--------------------------TSVLPGGGAGDEGLSP---------------
A0A1F2TPT3      EPVAGRGAGNGVGKRDGQAGKSGPDGWWSAASLFVSRAFGGFPPPPRAAEPLAGERPAE-
A0A2V8JTQ2      PKF-----------------------------------TARGGRA---------------
A0A2V8UZY0      PKF-----------------------------------TGRVEQP---------------
A0A350UEK1      -TT-------------PAEPAA-PGRLAAWRQALNLPEEAATGAK---------------
A0A350UIQ4      VAA-------------PAEPASTPSRISAWRRALNLPDVPENDAR---------------
A0A1H5Z7N3      PWF------------------------LGTQKSKQAQPHRNIDDP---------------
A0A1G7JVV8      PDF------------------------MG------SGPYRNINDP---------------
A0A1H4T6W9      PDF------------------------MGGK----AARFRDINDP---------------
I3ZEU5          PDF------------------------MGIR----VGKVRDINDP---------------
A0A7L5A6M5      PDF------------------------LETR-D--PIQHKSMDDL---------------
A0A428MDU2      PEF------------------------LEVK-G--PVSHTTLDDA---------------
A0A5B9EBI2      PAF------------------------LGVR-P--PVPVTSLDTP---------------
A0A239HDF6      PAF------------------------LGRKTA--PEPRRDLNDP---------------
A0A4Q0T270      PEF------------------------LGVK-G--KVPHASLDDP---------------
A0A1Q3QQB6      PDF------------------------IGKD-A----PHGNIDDP---------------
A0A3N1K1G7      SEF------------------------LEVK-G--PLPHTNLDDA---------------
A0A4V2G466      PDF------------------------LGGN-A--PSTRASIDDP---------------
A0A6B9YNQ8      PDF------------------------LNGP-A--PKPRASLDDP---------------
A0A7G8BSK5      PDF------------------------LDDK-A--PQPRASIDDP---------------
A0A1I6MH75      SDF------------------------LEIK-G--KAPHASLDSP---------------
E8WVF6          PTF------------------------LSVK-G--PIPHSSMEDP---------------
A0A3N5YNR8      PRFSVPVREGVVTSQLSWLKRTVSNLRPGRSDAPKTGADESGAGR---------------
A0A3N6A5T6      PSF--------------NAETSGGLLTDSLAGLIGGTIALLKGRQPETPDSAENRLDKDE
A0A1F2Q9L4      PVF------------------NPGRSRLPGGSGGAVTASDDAATL---------------
A0A2U3KC61      PQ----------------------AED------------AMQPDP---------------
A0A2V9Y2R7      PRF-------------------VGSTA------------ASQPNP---------------
A0A2V9NGH6      PEF-------------------GGSGQ-AQSTSLELTTDILQPDS---------------
A0A2V9PYE6      PDF-------------------GGSGP-AQSTSLGLTTDILQPDS---------------
A0A2V9NL07      PEF-------------------GGHGA-PPASSLALTTDAFEADS---------------
A0A2V9QD92      PEF-------------------GGHGA-PPASSLALTTDAFEADS---------------
A0A2V9WPZ6      TEF-------------------GGKPD--SASSLNLAPDPLQTDS---------------
A0A2V9ZLH4      VEF-------------------GGKGDMPSPNALGITTDELQINS---------------
A0A2V9RQF1      PEF-------------------GGKGE-SSGNSLALTTDALQPDS---------------
A0A2V9YDK8      SEL-------------------GRKPD--DASSLNLAPDPLPTDS---------------
A0A2V9V8F7      TEF-------------------GGKPD--SASSLNLAPDPLQTDS---------------
A0A2V9XGR9      TEF-------------------GGKPD--SASSLNLAPDPLQTDS---------------
A0A2V9V3Q5      PEY-------------------GGQSA----PQPNLVADPLQNDS---------------
A0A2V9NWS3      AEF-------------------GGNGQVPSPNSVQLTTDSLQVDS---------------
A0A2V9USA9      GGP-------------------NGRAP----SSLELTPDPLQVDS---------------
A0A2V9XW18      PEI-------------------AGQAPPIPSPSLDLT-DPLQIDP---------------
A0A1H5SQF5      QPF-----------------LALRPANATASGQSLLETDP--------------------
A0A2V9AEW6      QPT--------------------TAWGIFASRVHRLFAFSRTGRL---------------
A0A2V8WQK6      RPR--------------------TGWRGLASRVQRIFAFSKASNL---------------
A0A2V8XIF4      RPA--------------------TGWRAFESRVQRFFDLSKTPHL---------------
A0A2V2R0I6      PEF-----------------STPTGPSEAVAIGTL----ANQKRP---------------
A0A2V8XAR9      PEF-----------------SSPNGPSEAMASGSL----ANQKRP---------------
A0A2V8VZA0      PEF-----------------SSPNGPSEAVASGSL----ANQKRP---------------
A0A1Q7CB82      PEF-----------------SSPNGPSEAVASGSL----ANQKRP---------------
A0A2V8WIU1      PEF-----------------SSPNGPSEAVASGSL----ANQKRP---------------
A0A1Q6Y9F5      PEF-----------------SSPNGPSEAVASGSL----ANQKRP---------------
A0A2V9EVV8      PEF-----------------SSPNGPSEAVASGSL----ANQKRP---------------
A0A2V8YF91      PEF-----------------SGPGGPSEAVASGSL----TNQIRP---------------
A0A2V8XZK2      PEF-----------------SVGGGPSEAVASGSL----ANRTRP---------------
A0A2V8ZTX6      PEF-----------------AASGGPSEAVASGNL----ANQTRP---------------
A0A2V9BT79      PEF-----------------AESGGISEAVANGNL----ANQTRP---------------
A0A2V9YHT3      ----------------------WDKAFAPANAGAIPL--DSKLTP---------------
A0A7C2XNI7      PEF-------------------AGDEAAAPAVTVPTTTGEPQPRP---------------
A0A1Q8B793      PDF-----------------SEGGKPSEAVTTGSL----ANQNRP---------------
A0A2V9BCA0      PDF-----------------SEGGKPSEAVTTGSL----ANQNRP---------------
A0A2V9BWU9      PEF-------------------GGQPGKASKPASVPVNAANQARP---------------
A0A2V9DKX2      PEF-------------------GGQPGKASKPASVPVNAANQARP---------------
A0A7C2YQY3      PEF------------------------------AVRPLGANGTAPFSP------------
A0A3E0NV31      PEF-------------------------VRSVDRGFFLDAAEAGLDLIKNGFRPRRRGEA
A0A3N5M5V0      PRFEVPVREGLVTSQLGSVKKAMSGLFSKSDSGAAAANRESMPGM---------------
A0A3N5XQP8      RLL--------------------QLREKSGVISETLRQVMRAVRGVIDRLIDEGGPGGQN
A0A2Z5G7H4      RDY--------------------------QPRYDALGSIFRLLSPSGPADPLNASLENSP
A0A2V9L5B5      PEF-----------------YRNRGLFGLYESDPEKIPS-SDPGP----------PDTLT
A0A2V9LK56      PEF-----------------YRSRRLFGLFESDPARIPSPTED------------LDPSS
A0A2V9L7I0      PEF-----------------YRNQMFFGLFESDPEKIPSISQPGL----------PDTSS
A0A522PPT0      PEF-----------------YQSRSFLGLVAKDPEKIPSASDPNP----------PDPNS
A0A7C5V1G5      PEF-----------------YQSRSYFGLVTKDPKHIPSPSDPNP----------PDPNS
A0A2V9KCS3      PAA------------------------------------LEQPTKLSAWRKALGLPQPAA
A0A372IT17      QNF--FPAKKRGLTIPGWIFFWRSPLEPRSVPLEEAP-----------------------
A0A4R1LC91      PDFKPMFNPIGW--------ALGLVSPKGPADPPNAPLE---DSP---------------
A0A3M2BZG9      PTF--------------------------TGRSADLLPGAADATT----------VDDDA
A0A1Q7N5R7      AVMATFAVADQY--------RPGRYHLKVDRTGQHFSLQDEDGTELERGDVGAAIGRTDS
A0A2V9QB26      ---------------------------------DRFPEDPKVRTSRFSLWRKASLPETKP
A0A2V9VYY4      PRF--------------------------TAVKQSSPESAMGEPS----------MQPDP
A0A3E0PHB0      DSL--YGGKSRGIFETLGAMFTGGPKNSEEA--GALPVVDSVD---GETVDQINLTPEQS
A0A3M1SIV3      PDL--IIRRNSGITALFKSIFESEKDKQEQI---VLPVINESDFQKSLDNLEAKLSPEEK
A0A3M2D491      PEL--FKGQGRGVIASIKSLFSGGSDEPSKT--QSLPVLSENN-DEGFSSEEIKLSPEER
A0A353C9L6      PNL--FGASERGILASLRSIFTGSGQNAEVP--SALPVVSEPE-LLGEERPRTILSPDEE
A0A2V8RQV0      KTL--FGGQNAGILAGIKSLFSRSKAQTEEA--NALPVISDTE-QLNSKGELAKLSPEEE
A0A2V8SJH5      ADV--FGEEDRGLLSGVRSMFSSRKANSGPD--NSLPVVSELP-AGTDASDNIQLTPEER
A0A357F267      PDL--FGDGDRGFFAAVTSIFSSTKEEEKEKEADSLPIVSDTA-ESPSPSSALELTPEEE
A0A7C5ZUA8      PNL--FGSQDRGFLSAIKSLFSSEQQTSQTE--KSLPVVTDID-E--ST-SPSSLTPEEQ
A0A136JPP4      PDL--FGSSNRGFFASIKSLFVSPKSPETPK--GALPVLTGTE-N--ADPAAVQLSPEEA
A0A399WUJ8      PDL--LGQSDRGFFATIKSLFSGPAKAQAPQ--GTLPVLTGTE-N--ADPTAAQLSPEES
A0A2V9KIE8      PEF-----------------YRKSILFGLMETTPANVPSPTDNAP----------PDVNS
A0A352F549      RTFLDGRVENRSTWRSLLTMFGFSQKQAEAPKNQN-VLPDVNSSPAFASAGFNADDPAEV
A0A3B9MLP9      RTFLDSHVDNRSTWQSLMRMFGLGSNPKNSAVAENGALPDRGNQP-LTTSGLSLEDPAEV
A0A3D5SQ87      RTFLDSHVDNRSTWQSLMRMFGLGSNPKNSAVAENGALPDRGNQP-LTTSGLSLEDPAEV
A0A2V8NW86      EDPKVKTSRFSL--------WRK-------------------AVL----------PELKL
A0A7C2GJ20      PEF------------------------------------ADITTR----------VADPD
A0A7C4BTL5      ADLKMETGRISA--------WRRAL-----------------NLP----------ESPEK
A0A2V8ZHL8      PGW-------------------------------VLAAGSGNDGL----------PAQPQ
A0A2V9B240      PAW-------------------------------ALAVGLGNDVP----------PVQLQ
A0A2V9CBM2      SEF----NAPQL--------FS-WKWKKKAPTSQTFTVG---PIP----------A--DR
A0A2V8XN17      PEF----NSPRW--------WQFWPSKKKSPPPQTFTIG---PVS----------EARDR
A0A2V8WX45      PEF----NSPRW--------WQIWPKTKKPSTAQTFAIG---PVP----------AGGDR
A0A1Q6YR79      PEF----NSPKW--------WQFWPRNKKSPAPQTFAIG---PVP----------ETRDR
A0A1Q7VA32      PEF----NSPKW--------WQFWPRNKKSPAPQTFAIG---PVP----------ETRDR
A0A2V9EY85      PEF----NSAKW--------WQLWPRKKKSPAPQTLAIG---PVP----------EAPDR
A0A2V9H8K0      PEF----NSPRW--------WRFWQERRKPSTTQTLATG---PVP----------EVRDR
A0A2V9FFE5      REF----NSRKW--------WQLWPETRKPSTTQTFTVG---PLP----------QVRDR
A0A2V9GM43      REF----NTRKW--------WQLWPETRKPSTTQTFAVG---PVP----------QVRDR
A0A2V9CYQ5      SEF-----NAPP--------LLSWKWKKKAPRSQTFTVA---PIP----------A--DR
A0A2V9BWU8      PEF-----NAPK--------WWSLKRFARAPQKQAFALG---PAP----------VAHDS
A0A2V8ZG48      PEF-----NRPK--------WWQFGKRLSLPRKQTFALD---PVR----------PGQDP
A0A2V8Y334      PEF-----NSPK--------WWQFRKKAFKPRNQTFALD---QES----------SARDP
A0A2V9AY68      PEF-----NKPK--------WWQLQERFFTPHKQTLALD---PAG----------RARDP
A0A1F2RFI7      PEY----DEKPS--------WFAKLLSKSRSESQQLPAE---DL------------ALDP
A0A1F2RZS3      PEFAKEQESSPS--------WLGTLWPGGAEQPEGPLSP---EE------------QLDP
A0A1F2USE2      AEF----NPPQP--------WWSWGGKETAAAAPTLVVG---TSE----------PEQDP
A0A7C2VB08      PEF----NPNAS----------SAGTVSAASVPDS---------------------APGP
A0A2V9C238      EEF----NPRAS--------QLGDAKPQNAAAAQSFTAG---DT------------ERDP
A0A1F2Q9F5      AEF----SRPGF--------RLRGGKRETPASPQTFAVG---AAG----------VARDP
A0A1F2QQH9      AEF----SRPGF--------RLRGGKRETPASPQTFAVG---AAG----------VARDP
A0A1F2QXK7      AEF----SRPGF--------RLRGGKRETPASPQTFAVG---AAG----------VARDP
A0A2V9DEM9      EEF----NPRAS--------QLGDAKPQNAAAPQSFTAG---DT------------ERDP
A0A7C5TWV7      PAFG--------------------------------------------------------
A0A2V7XDY0      ---------------------------------------------------PAEH-----
A0A2V8G155      PPFGGTAP--------------ADSPFSLR-RVIALVHTTNAGPPPPPPDETALQ-----
A0A2V8HDM7      PPFGGTAP--------------ADSPFSLR-RVIALVHTTNAGPPPPPPDETALQ-----
A0A2V8DRT9      --------DTFDSAKAPKKMSIRTAVASVV-APVFHLFVARKAIEPEQTGETTTQ-----
A0A2V7VYF3      PYFGGPTPNTTSSSSTRGAIGFTNGILALV-RGAFQSKAETIGREKRAPAESAAE-----
A0A1F2SVH2      PQFNPKPDDSLTMRK------IALAPVVLV-AGWFKPAQPL---EPPLPDESKVQ-----
A0A2V8AJG9      PLLKPN-DDNLTVGK------IAAAPAAFV-SSWFRTAAPV---GMPGSDESKQQ-----
A0A2N9LQU7      EEFAGKTL-----------------MASVT-AI------------DPVKMDPLSR-----
A0A2P6WFK7      PAFAGK-Y-----------------AASAK-LT------------NPSAMPPADR-----
A0A2V8U914      PEFQPHSG-----------------FWERL-RE------------ASPRAAQNAA-----
A0A2V7W309      RDFYGPGV-----------------EG------------------KTKAEIDQIT-----
A0A2W0BGU4      RMFADE---------------------------------------SRVTESQAHK-----
A0A2W0BVQ9      RMFADE---------------------------------------SRVIDAQAHK-----
A0A2V9MN96      PRFTGFVP-----------------VANDA-SRSIGS--------ANLGPDSQQI-----
A0A2V7V2Z1      PEFGGPRS-----------------AEEIE-AVK-----------AASPGASAVM-----
A0A2V7X2F7      PEFGGPRS-----------------PEEVK-GAL-----------AAPPGSSPVM-----
A0A2V7V2I1      PEFGGPQP-----------------AEQRA-ALK-----------ASAPGSSRVM-----
A0A2V7U3M2      PEFGGPRS-----------------PEEME-AVK-----------AAAPGASPVM-----
A0A2V7UHT0      AEYGGPRS-----------------PEEIE-AVK-----------AAAPGASQLM-----
A0A2Z5FVL3      SAFKPHFT-----------------FTGWV-NSLFSPPPPADPAGVALSAAPLRR-----
A0A2V9KBD6      PMF------------------------------------------IGGA-KAVNE-----
A0A2W0AJ66      GKF------------------------------------------DGGKIEPGNE-----
A0A1Q7RBU1      PKF------------------------------------------AGRAEQPVNE-----
A0A2V9JPV9      PNF------------------------------------------ADRAAHSGNE-----
A0A3P0X3W6      ---------------------------------------------LPRDKKGKEF-----
A0A2N9MK30      ER-------------------------------------------KARAGSDQGL-----
A0A3D1ASD2      DGNDLM---------------------------------------ENTSEARSAA-----
A0A7C5AXI3      PGE------------------------------------------LAGAEPGKPY-----
A0A7C6E4H7      DVD------------------------------------------KTKLPPAE-------
A0A1F2TCR2      PAFNGQAPPRRGPLIAVRNARASLGKAI---RRLITRPIQTPAVEPAAPDENAAE-----
A0A350UQT3      E-------------------------------------------QQLAKEGDQAR-----
A0A7C3HRX0      E-------------------------------------------KQLAVPADKAR-----
A0A1F2V330      P-------------------------------------------------DGKIS-----
A0A662EE63      PEFEG-------------------------------------------------R-----
A0A2V8TLH7      PMF-------------------------------------------------RKS-----
A0A1Q7ZJT1      PLF-------------------------------------------------KKS-----
A0A2V8VC99      PLF-------------------------------------------------KET-----
A0A348UZU3      KEFSG-----------------------------------GKNVTGEDLKNPVFR-----
Q01XL7          P------------------------------IASTPTTFFTKLRAHIPFAQKEPL-----
A0A2V8ERZ5      PEFNGTKPAPPTASTLLQEAKDKIIGI----AKP------NAPAEAPKVDETADE-----
A0A2V8GTX0      PEFNGKGAKPPLLTQVISDLKAKIAAP----FRG------QTAAPPPRPAGPVNE-----
A0A2V8J0X9      PLFNGSAPPPRDPLSLARQGRAAASAW----LRGLIVKPPPAAAAPPAPDEPAHE-----
A0A523DUV7      PPF-------------------------------------------------RDA-----
A0A1F2U158      AEFNGTAKPAETPVTKARDAGDR--------LLRFLARTPTPIAEVPKPDETADE-----
A0A2V8F6S9      AEFNGTERPRPTPFSMLREAEQR--------IVRLVRPAKEEPTEAPKVDEAPDE-----
A0A7D8BEX2      PEFFE-----------------------------------PARTRHQVLDAPETR-----
A0A4Q1SCH5      QNYAG--------------------------FSRSQMVFRLEDDQHRPINLTPQQ-----
A0A372IRG7      KPFSDMFAKQPYTG----------------------------------HLTPLQR-----
A0A2V8K4L4      TGY----------------------------GTSTDRLAAWRKVLHIAPKQALDR-----
A0A2V8NCZ3      TPY----------------------------GTSSDRLAAWRKVFHLSSKPAIDR-----
A0A4Q7YNP3      SATTP--------------------------RLDLASRLIGMLHLPISVGKPISS-----
E8UZE1          PVFSGITS--------------------------------SATPKPLNSLTDQER-----
A0A2U3JZ71      ----------------------------------------TEAEGSDATLSRVPG-----
A0A2V8TTB0      ----------------------------------------VEKDALEQPSERWQG-----
A0A1V6HR88      PAFNPARASLA-----------------------------GSDEGGSAAADQSAL-----
A0A3E0P0A3      RYFGGAVDRSSYVR---------------------------PGEPVTADDDAVVV-----
A0A2V8EXP2      PQFNPKGEAAFSLGALVTAPLRWLSA-----W--ATPPPAI-EPGGVSAGETSAQ-----
A0A2W4RYA1      PLLVPERGALAVVREGVASVMRWFRS-----PEGGVPDPAVGQAGGQEPPETPEQ-----
G8P0Y7          ADFAGRAQTQSNGG---------------------------IAVSQSPAEESFRL-----
A0A5M8T4U7      LR-----------------------------AGEHATPGSIAQYKLPVVLSPVER-----
A0A7L5A491      --------------------------------------------TPTKKMPAGMT-----
A0A7D8BF18      PRFMG------------------------------------PSPKPRNLDDPIVR-----
A0A1E3Y9R6      ERVPAASTWSFSPSAVVGTTIAAVRHWF---GPAPVLPAASDGADPAPGAVSPQE-----
A0A2W4TLP2      ERVPPASSLSFSLSSLLGGAVSAVADMF---GPGPV---PAAGGEEPAAVESAAR-----
A0A7G8BDY8      PTFAGRRK-----------------------YILFGPYVTPDAPAQIDKTSPERQ-----
A0A7C4BZ42      APY----------------------------AYPVGRFEAWKQALGLGQAEAVTK-----
A0A3R9WF43      RPFLGAIVR--------------------------------GEADKPLEDAPRTR-----
A0A317HKM4      --------------------------------------------AALPPNERLSQ-----
A0A2V9CG11      RKSHSIVRRMLRLS----------------------------------NSQHVPE-----
A0A523E0N1      PLF--------------------------------------APDPDAHLDQKKVV-----
A0A4R1LAZ7      KPFSKIFKQTPYHG----------------------------------QLTPLQR-----
A0A7G8BMP1      KPFSEVFRDSPYNG----------------------------------HLTPGQR-----
A0A523ECP2      PHFGG---------------------------------------DKTHTADEQTL-----
A0A2W0C122      AEFMRDANRQF---------------------------------ASLREIAPAPE-----
A0A2W0AUU7      AEFMRDANRQF---------------------------------ASLREAAPDPT-----
A0A2W0BQL1      AEFMRDANRQF---------------------------------ASLQEAAPDPT-----
A0A4Q1SDL1      RDFQPHFNPIGWV------------------MGLFAPKGIADPPGASLENSPARR-----
A0A3P0XH15      QPFAQVFVRQPYNG----------------------------------KLTPNQR-----
A0A3M1WQW8      PEFAG---------------------------------------LARIRDATLRD-----
A0A3N1JHC1      ----------------------------------------APRVPPSLASNDAGR-----
C1F294          PPYSGVFKKAGYHG----------------------------------TVTPSQK-----
A0A2V9KA79      ------------------------------------------------VTRGAAT-----
A0A522PSP1      --------------------------------------------PPADSSSTEVP-----
G8P085          -------------------------------REYAGPNAKQLAIPLGAISLSPAQ-----
A0A7C6A629      -------------------------------------------EDVDKETLPSTD-----
A0A4Q1SGQ1      HDYFPQRTTGWHLP-----------------AWLFFWRQPLEPLNIRLEDAPNRR-----
Q1ILD9          PPFAGDKLYTEGSG-----------------TWYSHHGLRSLPNEPLSNIGNARR-----
A0A7G8BJH7      EDFYPPSKTRHERLLP---------------PWLFFWKRPVEPLAVPLDHAPNRR-----
A0A7C5SHM3      -------------------------------IRERILELLSADEQPEEDATPPDD-----
Q1IJZ6          IGSY---------------------------WHLFPSGRVTSEQGLPLRNAPRQR-----
A0A2V8TCE6      PLLPRKSPGLL--------------------QRTLAALRRALPRGEAHAAPAEPM-----
A0A522TBE8      PAF----------------------------------------RAPSHPNLTPSP-----
Q1ITG0          EAFAT--------------------------KSLFGRSLQTPVGKDVSSVDEARK-----
A0A7C2ML20      SEF-------------------------------------TLPSAATEEERETQR-----
A0A7C5AXS9      AEE----------------------------AGGRGRVSAWREALGLKPPAEPGP-----
A0A7C2RGE3      PEF--------------------------------------ADITARVADPDRRR-----
A0A3N5PCI5      GRAPADGNAQPAGTFAFLGQWRSWLGRA---VGAATGATSSQEKEPGSVRETVAE-----
A0A3M1Q0S9      GLPGQDDSRENRFFSAI--------------RKLRTTVVRTLSRTQVPIEEDDPY-----
A0A2Z5G448      -------------------------------KKPFSKVFEKQPYVLGKPLTPAQR-----
A0A3M1VZ38      PTLLGEQADEEPSPFSLGGLR----------AKILSVIGRGAPETGEVDPLRP-------
A0A4Q1SD29      -------------------------------KAPFDAIFKTSPYTG--TLTPAQR-----
A0A6N9FGE2      PEFGGAGGARRSSVLRALNPVRLVRRAFSWVRSAVLGPPPPVETEGLVDAESRAE-----
A0A3M1PY35      -------------------------------RELLLASLRPEDEEDLAAWEPPDD-----
A0A3M1VMP2      -------------------------------REALAPEL-TEPGEDGEEPKPPTD-----
                                                                            

A0A2V7VMF7      --------------------------------------PEAGALFVTHVGVEPI------
A0A2V7YYV7      --------------------------------------KTRPDDLAKRIKATPQ------
A0A2V7Z0J5      --------------------------------------KTTSDELVKQVKVTPDA-----
A0A2V7Z3M4      --------------------------------------NTTSDDLARQIKVTPD------
A0A399Y5V2      --------------------------------------AQVLGQ----------------
Q01X01          --------------------------------------RTAVDEVRKNLQIISS------
A0A3M2D9H8      -------------------------------------------ISSSQVRVQQV------
A0A2V8JK38      --------------------------------------RSLIDQYLDRITVKPL------
A0A2V9IXG5      --------------------------------------DGIAGELGGGISLAPV------
A0A2V9J2P4      --------------------------------------DGIAGELGGGISLAPV------
A0A1Q7RLS4      --------------------------------------VDSIGAFSEMIVVAPV------
A0A2V2R525      IKRL----------------------------------NPFVGAIQSGLEVEQV------
A0A321LPW6      ANDL----------------------------------AALIRALDKNLSVEPI------
A0A2V9R9V4      VERL----------------------------------APYVGMLEESLRVRPI------
A0A321LE75      SARL----------------------------------APFVAVLSGNLSPEPL------
A0A2V8R8U7      LATL----------------------------------EPYEDAIIANETIEPI------
A0A2V8QMP4      AQAL----------------------------------EPYEDAMRAGLNIDAV------
A0A2V8R4S3      AQAL----------------------------------EPYEDAMRAGLNIDAV------
A0A2V8NJ55      LERL----------------------------------EPYEDALRASLTVEPV------
A0A2V8Q7I0      LAAL----------------------------------EPYEDTIIANEDIDGI------
A0A2V8S6K4      LKQL----------------------------------EPYEDALAGNLTVDPV------
A0A317I2L9      LAAL----------------------------------EPYEDAIIGNEQVDGI------
A0A2V8LLF9      LTQL----------------------------------EPYEDAIAAGETVEAV------
A0A352FRF4      LAAL----------------------------------EPYEDTITANEIIEPQ------
A0A2V8MKV0      VVRL----------------------------------EPYEDAITANEEVDTV------
A0A2V8PYY8      LVRL----------------------------------EPYEDAIIANEDVGIV------
A0A1Q7YKQ8      LTRL----------------------------------EPYEDALAGNLTVEPV------
A0A352F3R7      LAEL----------------------------------EPYEDGIIAGEAVEAV------
A0A0B6WXT1      LAKL----------------------------------EPYEEAILAGITVEPV------
A0A3B9MEU8      LAEL----------------------------------EPYEDAIIAGETIEPV------
A0A2V8MHG6      TNHL----------------------------------QPYVEMLQSQLSVKQL------
A0A2V8P7N1      ANHL----------------------------------QPYVEMLQSQVSVKQL------
A0A2V8M3M6      ANHL----------------------------------QPYVEMLQSQVSVKQL------
A0A1Q7NJH5      ANHL----------------------------------QPYVEMLQSQVSVKPL------
A0A2V8PJY0      ANHL----------------------------------QPYVEMLQSQVSVKPL------
A0A1Q7Y6W9      AKRL----------------------------------QPYVSMLQGGLKVDPVKETRLL
A0A2V8NC68      VNQL----------------------------------APYIESLQGGLSVKEV------
A0A399WK13      AVRL----------------------------------TPFVEVIRRNLSVDPVRESRAT
A0A352FLX4      AERL----------------------------------SDYVDDLQETLKVEPVKETRLT
A0A2V8RTL7      ALRL----------------------------------SPYVDLIKEDLIVEPVRESRAT
A0A3E0PCJ6      AVRL----------------------------------APFVDAVQRDLIVDPVRESRAT
A0A3M1S4R8      AVRL----------------------------------APFVEILKKNLRVDPVRVSQAT
A0A7C2G442      AVRL----------------------------------APFVEILKKNLRVDPVRVSQAT
A0A1Q7YFI6      VNRL----------------------------------APYVGMLQGGLSIKEI------
A0A136KC10      AVRL----------------------------------TPFVEVIRRSLSVDPVRESRAT
A0A3M2D6Y5      AIRL----------------------------------APYVEIIKKKLQVEPVRESRAT
A0A2V8SEX6      AVRL----------------------------------APYVEIIRKNMSVEPVRESRAT
A0A7C5ZUU4      AMRL----------------------------------APYVELIKPNLSIEPIRESRAT
A0A0B6WWQ6      AMRL----------------------------------DPYVRTIASSLKVDPVKEVRLP
A0A3B9MK99      AKRL----------------------------------APYVGAVLGGLRVEPVKESR-G
A0A352EX26      AKRL----------------------------------SPYVGAILGGLRVDPVKESR-G
A0A2V8MM59      AKRL----------------------------------APFVGALQGGLKVEPVRESRAG
A0A2V8PFE8      AKRL----------------------------------APYVGALQGGLKVEPVRESRAG
A0A2V8PWS6      AKRL----------------------------------APFVGALQGGLKVEPVRESRAG
A0A2V8LCT5      AKRL----------------------------------APYVGMLLGGLRVDPVRENRAG
A0A352FTJ9      AKRL----------------------------------APYVSALAAGLRVEPVRENRAG
A0A257VBK0      --------------------------------------KDPAAMLRGMTKVDNI------
A0A2G6PYV5      --------------------------------------TKIASNLIGGVEIKEV------
A0A2V8F956      TASQ----------------------------------SDAIDAFENALTIAPV------
A0A1F2S1W5      --------------------------------------SRVINRFLAALDVSAV------
A0A1F2T595      --------------------------------------TVVINRFLANLGVSAV------
A0A2V8JQV5      --------------------------------------EAAISLAAATLQVEAL------
A0A2V9AC41      --------------------------------------KRLAGSYLSKLHISPV------
A0A2V9MAM9      --------------------------------------REAILRVKDRLRIEPS------
A0A348V070      --------------------------------------ERLIDEFIESLNVSPL------
A0A2V9M454      --------------------------------------NAAVAAFKARLKVERP------
A0A2V9IVR7      --------------------------------------SPLVGIFKGGLRVEIM------
A0A2V9ILE2      --------------------------------------SPLVGIFKGGLRVEIM------
A0A2V9LGY4      --------------------------------------SPLVGIFKGGLRVEIM------
A0A2V9J4D6      --------------------------------------GRLVKLFDSYLGVNLH------
A0A2V9L9C5      --------------------------------------GRLVKLFDSYLGVNLH------
A0A2N9M9N1      --------------------------------------ANLIRSFKKHLHIELL------
A0A2V9JEC4      --------------------------------------DRLIRAFKKHLHVALM------
A0A2V9LPQ3      --------------------------------------DRLVREFQRSTTVRLM------
A0A2Z5G3A3      --------------------------------------SHALKVFSKNLTVTPV------
A0A2V7UGP8      --------------------------------------KPYIQFVLSGLDINPL------
A0A239MKT6      --------------------------------------DRVLAIFHKGLQVEVL------
A0A3E0PCN7      --------------------------------------APFVNSIRGNLSVNPV------
A0A2V8IYW3      --------------------------------------EDVVARMRTEVDVDPP------
G2LEI9          ----------------------QRY-------------APQIGRLASGLQAYNV------
A0A317J121      --------------------------------------TSGLNVALATFDARPI------
A0A2V7YW66      --------------------------------------GSLAEQVRGGLSVAPV------
A0A2V7Z0V0      --------------------------------------GALADQLRGGLAVDPV------
A0A2V8GFD4      --------------------------------------RRRVDAFLGALSIVPV------
A0A2V8HSS5      --------------------------------------RRRVDAFLGALSIVPV------
A0A2V8KP55      ----------------------DQL-------------RSLIDQYLDRITVKPL------
A0A399WNU1      --------------------------------------APYVGFIKRNLEVSPV------
A0A2V9JSI3      --------------------------------------ISLINAFRDHLRVEWV------
A0A2V9WI32      ----------------------AE--------------SSLLDRFRRGLKLNVV------
A0A2V8IVN9      ----------------------SSQ-------------SRAVDAFLKRLTVSPV------
A0A7C5Z4J3      ----------------------ARR-------------ARLIAAFKKSLHIDLV------
A0A1F2TPT3      --------------------------------------APQISAFLGGLSLAPT------
A0A2V8JTQ2      ----------------------ANQ-------------DALLQSFHKGLEISKV------
A0A2V8UZY0      ----------------------DNE-------------DRLVKSFHKSLRISKV------
A0A350UEK1      --------------------------------------ARAVEMAADTLKVRAS------
A0A350UIQ4      --------------------------------------QHAIAMAADSLKVRAS------
A0A1H5Z7N3      ----------------------VVR-------------QMVLYTLRADVNVSVI------
A0A1G7JVV8      ----------------------IVR-------------AAVIGKLSNAFKVASI------
A0A1H4T6W9      ----------------------VVR-------------TEVLRRLGGAVVATVI------
I3ZEU5          ----------------------AVR-------------TDVLQRLGNSVNASII------
A0A7L5A6M5      ----------------------AVR-------------EGVIKTLKGNLTVALV------
A0A428MDU2      ----------------------GVR-------------QSTVHRLQSNLHITLV------
A0A5B9EBI2      ----------------------MIR-------------QATLSRLKANLTVSIV------
A0A239HDF6      ----------------------QVR-------------QGTLLVLSSNLKIAMQ------
A0A4Q0T270      ----------------------GVR-------------QGTIHRLQSSLRIQLV------
A0A1Q3QQB6      ----------------------AVR-------------QATVHALQSGLRIVLV------
A0A3N1K1G7      ----------------------AVR-------------QSTVHRLQSNLHITLV------
A0A4V2G466      ----------------------DVR-------------QRTIHQLLGGLRIAQV------
A0A6B9YNQ8      ----------------------AVR-------------QATIHGLLANLVISQV------
A0A7G8BSK5      ----------------------AVR-------------QQTIHTLKAGLHIAQV------
A0A1I6MH75      ----------------------AVQ-------------AGTIRRLNGHLKVSLI------
E8WVF6          ----------------------RVR-------------QTIVGILQKNLKVTLV------
A0A3N5YNR8      ----------------------DKN-------------RDVLDTFRDRLEVAQV------
A0A3N6A5T6      ----------------------ADL-------------SADVDRFLGSLQVQPI------
A0A1F2Q9L4      --------------------------------------AGLAYGVLGGLEVNPI------
A0A2U3KC61      ----------------------ARE-------------AGLLGAFRGGLSVQII------
A0A2V9Y2R7      ----------------------GAQGLSELKPNNDEETTALLAAFHSGLSVRVI------
A0A2V9NGH6      ----------------------VKA-------------SAVLASFKSDLKVLLK------
A0A2V9PYE6      ----------------------VRT-------------SEILAHFKSDLKVSLK------
A0A2V9NL07      ----------------------ARA-------------NALLGAFKGGLHVVLE------
A0A2V9QD92      ----------------------ARA-------------NALLGAFKGGLHVVLE------
A0A2V9WPZ6      ----------------------TRT-------------SALLSAVKGSLRVSLV------
A0A2V9ZLH4      ----------------------SRV-------------TNLLGAFKGNLKVTLQ------
A0A2V9RQF1      ----------------------EQT-------------TALLSAFKGNLRVALQ------
A0A2V9YDK8      ----------------------ART-------------SALLAGFKGNLRVSLL------
A0A2V9V8F7      ----------------------TRT-------------SALLSAVKGSLRVSLV------
A0A2V9XGR9      ----------------------TRT-------------SALLSAVKGSLRVSLV------
A0A2V9V3Q5      ----------------------KRT-------------TALLGGFKGNLKVSLI------
A0A2V9NWS3      ----------------------QRT-------------TDLLSAFKGKLRVALE------
A0A2V9USA9      ----------------------AHL-------------SSVIGGFKGSLRVALS------
A0A2V9XW18      ----------------------GRA-------------SSMIGGFKGNLRVTLS------
A0A1H5SQF5      ----------------------TYR-------------DSAVNLFQSRLKITLV------
A0A2V9AEW6      ----------------------SER-------------EQMIRQVERNLTVQSS------
A0A2V8WQK6      ----------------------PER-------------EELIRQIKRNLTVRTS------
A0A2V8XIF4      ----------------------PEK-------------EELIRQIQRNLTVRES------
A0A2V2R0I6      ----------------------PE-----------------LGEFLGSLSVKRV------
A0A2V8XAR9      ----------------------PE-----------------LGEFLGSLSVKRV------
A0A2V8VZA0      ----------------------PE-----------------LAEFLGSLSVKRV------
A0A1Q7CB82      ----------------------PE-----------------LAEFLGSLSVKRV------
A0A2V8WIU1      ----------------------PE-----------------LAEFLGSLSVKRV------
A0A1Q6Y9F5      ----------------------PE-----------------LAEFLGSLSVKRV------
A0A2V9EVV8      ----------------------PE-----------------LAEFLGSLSVKRV------
A0A2V8YF91      ----------------------QE-----------------LGQFLGSLSVKRV------
A0A2V8XZK2      ----------------------PE-----------------LAEFLGSLSVRRV------
A0A2V8ZTX6      ----------------------PE-----------------LAEFLGNLSVKRV------
A0A2V9BT79      ----------------------PE-----------------LAAFLGNLSVRRV------
A0A2V9YHT3      ----------------------PQE-------------SALIGRLRGSLQVSSI------
A0A7C2XNI7      ----------------------PI-----------------LGAFLARLEIKRV------
A0A1Q8B793      ----------------------PE-----------------LAAFLGSLTVKRV------
A0A2V9BCA0      ----------------------PE-----------------LAAFLGSLTVKRV------
A0A2V9BWU9      ----------------------PA-----------------LGGFLGSLRVKRV------
A0A2V9DKX2      ----------------------PA-----------------LGGFLGSLRVKRV------
A0A7C2YQY3      ----------------------AEE-------------VMLIGRFKGGLNVQLI------
A0A3E0NV31      ----------------------LSE-------------AGALRRLQENLSIAPV------
A0A3N5M5V0      ----------------------AEN-------------RAVIEKVLSRLEVTQV------
A0A3N5XQP8      ----------------------DPT-------------EYMIDRLLSDLQINPV------
A0A2Z5G7H4      ----------------------RRR-------------TRALKIFDANLNVKVV------
A0A2V9L5B5      ----------------------DAY-------------RNSVTHFLASVDVNPV------
A0A2V9LK56      ----------------------EAF-------------NNSIANFMNSMSVGPV------
A0A2V9L7I0      ----------------------DAY-------------VNAIAHFRKSVDVSPV------
A0A522PPT0      ----------------------DAY-------------LNSVTNFMRAVVVNPI------
A0A7C5V1G5      ----------------------SAY-------------RNSVANFMGLLNVNPI------
A0A2V9KCS3      ----------------------PSR-------------EQAAGMAAASVSVRSV------
A0A372IT17      ----------------------NRR-------------YVALRIFARHLTVQPV------
A0A4R1LC91      ----------------------HKL-------------SHMLKAFSHNLTVKPV------
A0A3M2BZG9      ----------------------AEL-------------ARQAMRLQSGLVVNPI------
A0A1Q7N5R7      LGFRWTPAAADLAPGAEIVFGVTTL-------------RDASRGLSDGLRVSPD------
A0A2V9QB26      ----------------------SDE-------------SGAAQAAARSLNARVS------
A0A2V9VYY4      ----------------------VQA-------------AGLLGAFRGGLSVQPV------
A0A3E0PHB0      ----------------------QRA-------------DKYTAALVNSLVVEKV------
A0A3M1SIV3      ----------------------EAV-------------EKVTASLLPGVDVVQE------
A0A3M2D491      ----------------------LRV-------------ERITASLAGSVDAIQE------
A0A353C9L6      ----------------------KRA-------------DQYAGILFSGLTVDQV------
A0A2V8RQV0      ----------------------ALA-------------NQHVGNLIGRLQIVPQ------
A0A2V8SJH5      ----------------------ARV-------------ENYAAMLAGRVTVQPK------
A0A357F267      ----------------------KRV-------------QIYAAMLRGGLSVEQR------
A0A7C5ZUA8      ----------------------ARA-------------ARYAAILLGGLSVEQV------
A0A136JPP4      ----------------------ARA-------------GQYAGILSGGLHVEQT------
A0A399WUJ8      ----------------------ARA-------------NQYAAALSGGLRVDQT------
A0A2V9KIE8      ----------------------EAF-------------TNAVKHFLDAVEISPV------
A0A352F549      ----------------------ERL-------------TPYAESLQGLVDVEQV------
A0A3B9MLP9      ----------------------ERL-------------APYVDSLQGMLDVAQL------
A0A3D5SQ87      ----------------------ERL-------------APYVDSLQGMLDVAQL------
A0A2V8NW86      ----------------------SDE-------------SGAVQAAAESLKARAS------
A0A7C2GJ20      ----------------------RQR-------------VLLIDRFLANLKVELV------
A0A7C4BTL5      ----------------------DAR-------------EAALTMAAGGVKVKAA------
A0A2V8ZHL8      ----------------------NSE-------------DKLLRLFKSRLHVQRV------
A0A2V9B240      ----------------------VWE-------------DRLLGPFKRRLHVQRV------
A0A2V9CBM2      ----------------------ELY-------------QRVLERFRDHLTIAPI------
A0A2V8XN17      ----------------------ELS-------------QRVLERFQDRLTIDPV------
A0A2V8WX45      ----------------------ELS-------------QRVLERFQDQLTVDPV------
A0A1Q6YR79      ----------------------ELS-------------QRVLERFQDRLTIDPV------
A0A1Q7VA32      ----------------------ELS-------------QRVLERFQDRLTIDPV------
A0A2V9EY85      ----------------------ELS-------------QRVLERFQDRLTIDPV------
A0A2V9H8K0      ----------------------ELS-------------QRVLERFLDRLTIDPV------
A0A2V9FFE5      ----------------------ELS-------------ERVLERFLDRLTIDPV------
A0A2V9GM43      ----------------------ELS-------------ERVLERFLDRLTIDPV------
A0A2V9CYQ5      ----------------------ELY-------------QHVLERFRNHLTIAPI------
A0A2V9BWU8      ----------------------AVY-------------QRVLERFQDRLSIEPV------
A0A2V8ZG48      ----------------------EVY-------------QRVLERFQGRLTVDPV------
A0A2V8Y334      ----------------------EVY-------------QRVLERFQDRLTVDPV------
A0A2V9AY68      ----------------------EVY-------------QRALGRFQDRLTVEPV------
A0A1F2RFI7      -----------------------KY-------------YNVLDNFQDRLTVNPV------
A0A1F2RZS3      -----------------------KY-------------SAVIDNFLGRLQIVPI------
A0A1F2USE2      ----------------------AAY-------------QGVLRRFQDRLAVAPV------
A0A7C2VB08      ----------------------EAL-------------EATLASYHRRLTIAPV------
A0A2V9C238      ----------------------WAY-------------QTALKRFRDRLSVDPI------
A0A1F2Q9F5      ----------------------VAY-------------QNALETFSRRLAVAPI------
A0A1F2QQH9      ----------------------VAY-------------QNALETFSRRLAVAPI------
A0A1F2QXK7      ----------------------VAY-------------QNALETFSRRLAVAPI------
A0A2V9DEM9      ----------------------RAY-------------QTALKRFRDRLSVDPI------
A0A7C5TWV7      --------------------------------------KDPAAMLLGRLKIENV------
A0A2V7XDY0      --------------------------------------RDAGGEFMSHVNVEPI------
A0A2V8G155      --------------------------------------SRAVDAFLARLDVTPV------
A0A2V8HDM7      --------------------------------------SRAVDAFLARLDVTPV------
A0A2V8DRT9      --------------------------------------SRILNDFLSNLTISPI------
A0A2V7VYF3      --------------------------------------SQAIDAFLGGLVINPV------
A0A1F2SVH2      --------------------------------------SNTIDRFLRALTVAPV------
A0A2V8AJG9      --------------------------------------SRVIDRFLKDLTVSPI------
A0A2N9LQU7      --------------------------------------EKLLLKFHDAEKLEVL------
A0A2P6WFK7      --------------------------------------QRLVSAFKQSLSVRVL------
A0A2V8U914      --------------------------------------QYAADVARKHLKIEPA------
A0A2V7W309      --------------------------------------QAMAGGLLGGVNIAPK------
A0A2W0BGU4      --------------------------------------MKLIETFKRQLSVELV------
A0A2W0BVQ9      --------------------------------------MKLIETFKRQLSVELV------
A0A2V9MN96      --------------------------------------ASMLSIFRSGLTVQVM------
A0A2V7V2Z1      --------------------------------------ERAIDEFLGKLKVVPI------
A0A2V7X2F7      --------------------------------------EGAIDGVLGRLRINAG------
A0A2V7V2I1      --------------------------------------EAAIDQFLSRVKVQPV------
A0A2V7U3M2      --------------------------------------ERAIDSFLRKLRVLPV------
A0A2V7UHT0      --------------------------------------EGAIDAFLRRLRVLPV------
A0A2Z5FVL3      --------------------------------------DRLLKQFQENLEVKII------
A0A2V9KBD6      --------------------------------------DRLVKLFHKSLDISKV------
A0A2W0AJ66      --------------------------------------DSLVRAFHKNLAISNV------
A0A1Q7RBU1      --------------------------------------DRLVESFHKNLTISKV------
A0A2V9JPV9      --------------------------------------DRLVKSFHKNLTISKV------
A0A3P0X3W6      --------------------------------------LPAGSVTLPGLTITHP------
A0A2N9MK30      --------------------------------------LIDAPVLLKQLKVTRP------
A0A3D1ASD2      --------------------------------------AEDAPVRLKRLEVIRP------
A0A7C5AXI3      --------------------------------------SPDAPMVLKRLKVSRP------
A0A7C6E4H7      --------------------------------------VANAPVKLPNLKVTRP------
A0A1F2TCR2      --------------------------------------AGIISQFIGSINIIPE------
A0A350UQT3      --------------------------------------AQDAPIVLRNLKVARP------
A0A7C3HRX0      --------------------------------------ASNAPILLKNLRVSRP------
A0A1F2V330      --------------------------------------DTDLDRMRESIKITVE------
A0A662EE63      --------------------------------------KPGPGIVLGGLTVKPV------
A0A2V8TLH7      --------------------------------------SDPVGVFSSMVQVELI------
A0A1Q7ZJT1      --------------------------------------VDSIGEFSQMIVVAPV------
A0A2V8VC99      --------------------------------------TDPIGTFSSAIEVEPI------
A0A348UZU3      --------------------------------------QKLVDKFLGRLEVKPI------
Q01XL7          --------------------------------------EQMKEAVRTAAFTVSA------
A0A2V8ERZ5      --------------------------------------SGLVSAFIGRVSVDPV------
A0A2V8GTX0      --------------------------------------NQQADAFLGRVQVVPV------
A0A2V8J0X9      --------------------------------------AGLISAFLGGLSIRPE------
A0A523DUV7      --------------------------------------KEPGRIFMSRVQVVPI------
A0A1F2U158      --------------------------------------SALVSRFLGRVQVVPV------
A0A2V8F6S9      --------------------------------------SGLVSGFISRVTVAPI------
A0A7D8BEX2      --------------------------------------DAIIAQMKKSLDIAHV------
A0A4Q1SCH5      --------------------------------------EDVLDKFQLALKAKQE------
A0A372IRG7      --------------------------------------YQLIRAFQSSEKVIVE------
A0A2V8K4L4      --------------------------------------NNAIAAAAGGINVKAS------
A0A2V8NCZ3      --------------------------------------DRAIRMAGEDIKVKGS------
A0A4Q7YNP3      --------------------------------------DDLIEDTAKHVTVKPL------
E8UZE1          --------------------------------------YSLIRRFQSGLGVQLE------
A0A2U3JZ71      --------------------------------------AEDAPVLLKNLKVSRP------
A0A2V8TTB0      --------------------------------------SDEAPVILKYLKITRP------
A0A1V6HR88      --------------------------------------ARLAGRLLGGLEVKPV------
A0A3E0P0A3      --------------------------------------ARLASRVRSGLSVQQV------
A0A2V8EXP2      --------------------------------------ARAIDRLLGGLTVTPI------
A0A2W4RYA1      --------------------------------------TAVIDAFLRRVSVSPV------
G8P0Y7          --------------------------------------ESLIRKLQGNLTIQQI------
A0A5M8T4U7      --------------------------------------RALIGYIRGGLSVKLV------
A0A7L5A491      --------------------------------------PADASISLSKMSVVHP------
A0A7D8BF18      --------------------------------------QSVLGSMQGIVSISPL------
A0A1E3Y9R6      --------------------------------------AALTSRVQAGVSVVPV------
A0A2W4TLP2      --------------------------------------AALTSRIQGGIVVVPI------
A0A7G8BDY8      --------------------------------------NQLLGKFRKSLTVQSI------
A0A7C4BZ42      --------------------------------------ETAVAAAAGSLTIKAS------
A0A3R9WF43      --------------------------------------ERMVKLFRKNLKVDSP------
A0A317HKM4      --------------------------------------VPTVAEIAAARSIGGV------
A0A2V9CG11      --------------------------------------DELVHQAERNLTVRAA------
A0A523E0N1      --------------------------------------SNIGRSIQAMANVSRV------
A0A4R1LAZ7      --------------------------------------YLLLLSYHGALKIMVI------
A0A7G8BMP1      --------------------------------------TALLKTFSGNLKIMLV------
A0A523ECP2      --------------------------------------EDLAEQVAGMLQVTQI------
A0A2W0C122      --------------------------------------SIAVQALLSGLSVKTI------
A0A2W0AUU7      --------------------------------------DIAGEAVVSGLSVKTI------
A0A2W0BQL1      --------------------------------------DIAGEAVVSGLSVKTI------
A0A4Q1SDL1      --------------------------------------TRLLKIFAANLKAESV------
A0A3P0XH15      --------------------------------------IEMLSIFKGSTKIATK------
A0A3M1WQW8      --------------------------------------KLMVDRFLSGLRVELI------
A0A3N1JHC1      --------------------------------------EGVVRNMVMDAKAKEE------
C1F294          --------------------------------------LALLNTFKGATQVVLV------
A0A2V9KA79      --------------------------------------SRQIDEMRARIQITVE------
A0A522PSP1      --------------------------------------RSFVAGITGGIKTSQD------
G8P085          --------------------------------------EEMLSHFKSQINVLQV------
A0A7C6A629      --------------------------------------VANAPVKLKNLKVTRP------
A0A4Q1SGQ1      --------------------------------------YVALKIFEHHLKVKAE------
Q1ILD9          --------------------------------------QQLLARFQLGLDVTEV------
A0A7G8BJH7      --------------------------------------YVVLKIFASHLKVETV------
A0A7C5SHM3      --------------------------------------KQMARWIRERLKVEQL------
Q1IJZ6          --------------------------------------EAMLKKFGKALTVTPI------
A0A2V8TCE6      --------------------------------------GPFIDLVLAGLSIEPV------
A0A522TBE8      --------------------------------------DDVLRQLSNGVSVSRP------
Q1ITG0          --------------------------------------SKLLTRFSKALRVEAV------
A0A7C2ML20      --------------------------------------TLVINRFLAGLQVKKP------
A0A7C5AXS9      --------------------------------------QARVSRALGNLKAQVL------
A0A7C2RGE3      --------------------------------------VLLIDRFLENLKVELV------
A0A3N5PCI5      --------------------------------------SIAIDRLLANLRILPV------
A0A3M1Q0S9      --------------------------------------APYVKTLRGGLSVEPI------
A0A2Z5G448      --------------------------------------IPLIRLLRSNLQVVVI------
A0A3M1VZ38      ----------------------------------------YIKQLRAGLSVDPV------
A0A4Q1SD29      --------------------------------------HEIISLFLGSTKVQVL------
A0A6N9FGE2      --------------------------------------SRAISALLARFEVVAG------
A0A3M1PY35      --------------------------------------GDLVEMLGAGLDVAPL------
A0A3M1VMP2      --------------------------------------DQIAAYIRDNLDTEQL------
                                                                            

A0A2V7VMF7      --PE-------SRLVTVAVTHQDAKEAALWANTLAEVYVEQTL-ASRVEAAKKAYDWLQE
A0A2V7YYV7      --PN-------TTILDIAVDDTNPALARNIANDLVDKLI---------------------
A0A2V7Z0J5      --TT-------ALVLHINVQDTNRARSRDVANTLVSEFI---------------------
A0A2V7Z3M4      --TL-------ALVLHINVQDTNRARARDVANTLVAEFV---------------------
A0A399Y5V2      -----------TSIIRVRARDASASLARDIANGVSATY----I-DLRRKSALDSFAQQAN
Q01X01          --RG-------TSIIRIVAEAREPQLAADLANTLAQTFIEQSI-EARQRSAQQTFASLSG
A0A3M2D9H8      --RG-------AQLIQIVVEDSDPQKAAEIANTLVTVFLEQNA-KIQSNRFSASEESLQA
A0A2V8JK38      --RQ-------SWLVEVTFQAKDPKLAAQVINAHGRHFVEQNI-ENRFQTTQQVSELLSQ
A0A2V9IXG5      --ED-------TNLLWLEFVADDPRKAADWVNLYVDLYVEEND-RQQGEAVKQSRDVLKR
A0A2V9J2P4      --ED-------TNLLWLEFVADDPRKAADWVNLYVDLYVEEND-RQQGEAVKQSRDVLKR
A0A1Q7RLS4      --KE-------TGIVEISMEGLNPEEVASWVNTISEVYVERNL-DQVVEATSKAVKALLS
A0A2V2R525      --GK-------TRLVEIRYTHRDPHVAAKVVNAIADTFVQANL-EKMTETNSGAGAFLKK
A0A321LPW6      --RD-------TRVIKVVFTHTDPKLAAEVVNAVTQSFIARSF-STKAEKYNNAASWLDR
A0A2V9R9V4      --LD-------TRAMTLTFKHTDPVIAAGVANAIAQRFVETSF-DKKIEKFTSASEWLDR
A0A321LE75      --ED-------TRLLVINYSHTDPKLAATISNTVAAAFINRSF-SNKTEKFTKTSDWLNT
A0A2V8R8U7      --IG-------TSLVTIRYQHTDPALAQRIANTLADVFVQNNR-ERLDIGTSKAVESLAQ
A0A2V8QMP4      --EK-------TNLVEIHFQHTDPEIAASVANTLATIFRDNDI-QEETTGSQKAEDVLAN
A0A2V8R4S3      --EK-------TNLVEIHFQHTDPEIAASVANTLATIFRDNDI-QEETTGSQKAEDVLAN
A0A2V8NJ55      --EK-------TNLVTIRFRHSNPVIAMKVADTFAQVFIYNDL-QRTTSGTQTATEKLAN
A0A2V8Q7I0      --VH-------TNLFTIKYKHHDPEMAQKIANTLAEVFASNNI-DSQTVNSKDAGDLLER
A0A2V8S6K4      --ER-------TSLVDIHFKHTDPELARQVADTLAAVFIENDR-ARESKGTEDMKVATAR
A0A317I2L9      --VN-------TNLFVIKYKHHDPDIAQKVANTLAEVFANNNL-ERSTTNSSKQETMLAK
A0A2V8LLF9      --EK-------TSLVTIHFQHTDPELAQKIANTLADVFVQNNL-DRITAGTSKAEIDLTN
A0A352FRF4      --PQ-------TNLVIIRYRHTDPALAQKIADTLAEVFVANNL-NLQESGTSKQSQDLGQ
A0A2V8MKV0      --EK-------TNLVSIRYHHSDPALAQKVANTLVDVFANNNK-ESLESGTRKSAAQLGS
A0A2V8PYY8      --EK-------TNLVTITYHHNDPALAQKVANTLVDVFANNNL-ERLESGTKKSAEQLAN
A0A1Q7YKQ8      --MT-------TNLVMLKFTHSDPVLAQKIVNTFADTFAYNNF-ERETQGTAKATELLAQ
A0A352F3R7      --TN-------TNLVKIRFVHSDPELAQKIANTLAEVFVNNNL-QRATAGSSKAEDVLAK
A0A0B6WXT1      --EK-------TNLVNIKFQHSDPEMAAKVANTIADVFIYNNL-ERETQGAQRASVLLAK
A0A3B9MEU8      --PT-------TNLVKIKFMHSDPELAQKIANTLAEVFRNNNL-ERSTAGSSKAEDQLAK
A0A2V8MHG6      --SD-------TRIIEIRFKHQDPEIAEKINNTIADTFVVSNL-ERKTETTNSAGDFLQR
A0A2V8P7N1      --SD-------TRIIEIRFKHQDSEIAEKINNTIADTFVVSNL-ERKTETTNSAGDFLQR
A0A2V8M3M6      --SD-------TRIIEIRFKHQDSEIAEKINNTIADTFVVSNL-ERKTETTNSAGDFLQR
A0A1Q7NJH5      --SD-------TRIIEIRFKHQDSEIAGKINNAIADTFVVSNL-ERKNETTNNAGDFLQR
A0A2V8PJY0      --SD-------TRIIEIRFKHQDSEIAGKINNAIADTFVVSNL-ERKNETTNNAGDFLQR
A0A1Q7Y6W9      I-KE-------TRLIDISFTHQDPQVAAKIINALADTFVLSNQ-EKRNESNNTTGGYLQR
A0A2V8NC68      --NE-------TRIIELRYRHLDPEVATKIVNTIADTFIQSNL-EKKTETSSSAGDFLQK
A0A399WK13      V-KD-------TRLIEISYSDTDPDLAAFVANAIAETFTNQNQ-EKRTGTSRKTNDFLQE
A0A352FLX4      V-RE-------TRLIDISYRHSDPHLAAKIVNTVAQIFIDQNR-EKKTETSGSTGTYLLK
A0A2V8RTL7      V-KD-------TRLIEISYRNTNPELAAFVVNAIGETFVNANQ-EKRSGTSRKTSDFLQK
A0A3E0PCJ6      V-KD-------TRLISISYRNQDPNVAAFVVNGIAEVFTRVND-EKRTGVNSKTNEFLKK
A0A3M1S4R8      F-KD-------TRLIEISFQHTNPELAALIVNGIAEVFVKQNQ-EKRTGTNKRTNDFLAE
A0A7C2G442      F-KD-------TRLIEISFQHTNPELAALIVNGIAEVFVRQNQ-EKRTGTNKRTNDFLAE
A0A1Q7YFI6      --TD-------TRLIEIHYTHPDPQVAAKIVNSIADTYIISNL-EQKTKNTNSAADFLQR
A0A136KC10      V-KD-------TRLIEISFNSTDPALAAFVANAIAETFVNQNQ-EKRTGTSRKTNDFLQE
A0A3M2D6Y5      F-KD-------TRLIEVRFQHTNPELAALVVNGIAEIFAKQNQ-EKRTGTSKRTNDFLSE
A0A2V8SEX6      V-KD-------TRLIEISFRHTNPQLAAFVVNSIGETFVTANQ-NKRSGTNRKTSDFLQR
A0A7C5ZUU4      F-KD-------TRLIELSFRHTDPKFAAFLVNAIGETFVKANW-EKRSGVSRKTNDFLQQ
A0A0B6WWQ6      V-KE-------TRLIDISFRHPDPYVAATVVNTIAETYKLSNL-EKRTSARATTSQFLQR
A0A3B9MK99      LFKE-------TRLIDLSYTHIDPEVASKVVNAIAETYVYNNL-EKKSDTNMGTADFLQK
A0A352EX26      LYKE-------TRLIDIGYTHTDPEVASKVCNAIADTYVFNNL-EKKTESNASTGDVLQK
A0A2V8MM59      YYKE-------TRLIDITYQHGDPEVAARVANCVAETFVHSNL-EKTNQTNTSTSEFLSK
A0A2V8PFE8      YYKE-------TRLIDIVFQHGDPEVSAKITNAVADTFVRANL-EKKNETNTSTGEFLSK
A0A2V8PWS6      YYKE-------TRLIDIAFQHGDPEIAARITNAVAETFVRANL-EKKNETNTSTGEFLSK
A0A2V8LCT5      YYKE-------TRLIDIDYQHGDPEIAAKVVNCVAETFVRSNL-EKKNETNTSTSEFLSK
A0A352FTJ9      YNKE-------TRLIDIDYQHGDPEVAARVVNAVAQTFVRSNL-EKKNETNTTTSEFLSK
A0A257VBK0      --RD-------SALFRITVMAPYKADVAIWANAIAEAYQDRML-KDALDFIAKANEVMLA
A0A2G6PYV5      --KD-------TNLVRISYTDTNPERAMILANTWVKAYIAHSL-NMTYDKNLEAYNFLEE
A0A2V8F956      --RN-------SRLVDLKFDLPDGALAATIVNALAKNYISQSL-EFKFMASKDASDWLGQ
A0A1F2S1W5      --RY-------SRLVDVSFRSNDPALAARVSNALADQYIKQSV-ELRSNTTKEASEFLVQ
A0A1F2T595      --RY-------SRLVDVSFRSADPGLAAKVANEHSKQYIEQSL-EFRTTTTREASDFLTQ
A0A2V8JQV5      --QQ-------AHIIQITADSTDPKIAAEFLNTLTDEFINQKL-RSRLQTNERTAEWLQL
A0A2V9AC41      --GG-------TSLVKVRFTTPDPALSARLANAHANSYVRYGV-DLRSQTNEEASEFLKQ
A0A2V9MAM9      --KQ-------GRIIRILCDATDPQLAADFANALAQVFIEQSV-EARWNGASQIREWLNP
A0A348V070      --TG-------TKLIQVSFNHRNPELAAEVLNTLLDSYIEMLI-KRKYTASEQATEFLST
A0A2V9M454      --KD-------TRMALVSFESTDPREAAAVVNGLVTNYIEHNF-KSKYDATRQATGWMEQ
A0A2V9IVR7      --RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNY-HKNYEATRKASGWMEQ
A0A2V9ILE2      --RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNY-HKNYEATRKASGWMEQ
A0A2V9LGY4      --RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNY-HKNYEATRKASGWMEQ
A0A2V9J4D6      --RN-------THIVEVSFESTDRDLAARVVNALINNYIEYNF-HTKYDATRQASGWMEQ
A0A2V9L9C5      --RN-------THIVEVSFESTDRDLAARVVNALINNYIEYNF-HTKYDATRQASGWMEQ
A0A2N9M9N1      --TE-------SRLVEVSFESVDSNLAARVANTLVKNYVEANF-RSKYETTRQASAWMEQ
A0A2V9JEC4      --GN-------SRLITVSFESTDPELAANAANTLATNFVEANF-QGAYDTTREATKWMEQ
A0A2V9LPQ3      --PN-------SHMMEVSFESTDPDLSAKVANTLINHYIEYNF-RKRYDATRQASGFMEQ
A0A2Z5G3A3      --VG-------TRLIQISYVSSDRKLAESVVNALAQDLTNFSF-ETRYKATAQTSQWLTS
A0A2V7UGP8      --KN-------THLVEISFVSVDPELSSRIANAVANSYMEFNQ-SARYDTSAQASEFIGT
A0A239MKT6      --KS-------TRLLAVSYTDTDRNRASKIANYVVQAYLQDNT-ENRYQATSMASTWLTT
A0A3E0PCN7      --RDNRTAAQETRLIEVQFTHFRPEVAAKIVNTLGETYVRQNL-EQKVQTNASAGEFIQK
A0A2V8IYW3      --VK-------DDTFKISYVSGDPVVAMKVVARLASMFIDGNV-RDRRVVAEGTNQFLES
G2LEI9          --PR-------TRLVRITFQHHDPETTKAVVNTVAEVFARRNV-SDRLQQGSSQKEFLSS
A0A317J121      --NG-------TRIIEITCDSTSPDIAANFVNTLANEYIEQNS-QGRAQNLQQTSQWLSG
A0A2V7YW66      --RS-------TQLVQLAYTAASPEFAAKAANAFSEAFIDMGV-EDRYATAGKASTFLGT
A0A2V7Z0V0      --RN-------TQLVQLSFRASSPEFAAKAANAFAESYIDMGV-EDRFATAGKASTFLSS
A0A2V8GFD4      --RN-------SRLVDIVYSSPDPKFATAAANAIAKAYIEQNL-EYRFTASKEASDWLAA
A0A2V8HSS5      --RN-------SRLVDIVYSSPDPKFATAAANAIAKAYIEQNL-EYRFTASKEASDWLAA
A0A2V8KP55      --RQ-------SWLVEVTFQAKDPKLAAQVINVHGRQFVEQNI-ENRFQTTQQVSELLSQ
A0A399WNU1      --KDSRTATKETRLIRIEYRHYDPVIATKLVNAIADTYVLQNL-EQKVQSNASASDFLQK
A0A2V9JSI3      --RN-------SRMLEVSFEARDPRLAAAVANALVSNYAEYNF-RKRYDATRQASGWMEQ
A0A2V9WI32      --PR-------TRIVEIHYSHPDARLAAQIANILINTFIEQNF-KTKFESTMQTSAWLSV
A0A2V8IVN9      --RN-------SRIVDVKFEAKDPDVAERVVNALAKGYIDQNL-EFKFMSTKEASDWLGE
A0A7C5Z4J3      --PG-------SRMIQVSFESTDPNLAAEAANALVSNYREYNF-HSRYDATREASGYMRE
A0A1F2TPT3      --AN-------G-VLDIKYRSSDPVLAARFANAHAQEYINENL-EMRVAAVREVTGWLTA
A0A2V8JTQ2      --KG-------TRLIEIQFRSTDPQLAADVVNGLAKEYVDQYY-RSQFQVSTQFSDFLAN
A0A2V8UZY0      --KG-------TRLIEIKFRSTDPRLSADVVNSLAKEYVDHYY-RSQFQVNAQISSFLAN
A0A350UEK1      --GQ-------TRIVEVLVDSTDPAVAASFANRLTAEYVEQSM-EARWQSSQRTGEWLTR
A0A350UIQ4      --GQ-------TRIVEVLVDSTDPAIAAQFANLLTSEYVDQSM-EARWQSSQRTGEWLTK
A0A1H5Z7N3      --AK-------TDLIHISCQTFSADLSAEIVNKLIREYIFRSL-ESSAEAQKRVSDFLST
A0A1G7JVV8      --PR-------TQMIRITVTANKAQLAADLVNHLINAYQQRSF-ESRFASTQRVSQWLQG
A0A1H4T6W9      --PR-------TAMVRITCTASKPQLAADIVNQVINAYQQRSF-ETRFESTKRISQWLSG
I3ZEU5          --PR-------TAMIKITCTASRPQLAADIVNQVINAYQQRSF-ETRFESTKRVSQWLSG
A0A7L5A6M5      --PK-------TDIIKISYSSLNAKLSADIVNKLIADYIQRSY-ESRFASTQRVSQWLSG
A0A428MDU2      --PK-------TDIIRISYTCLSAKLSADIVNTVIATYVHRSY-QTRFDSTQRVSQWLSG
A0A5B9EBI2      --AR-------TNLITINYRSLDAHLSANIINTLIKDYIQRSY-QTRFNSAQHASQWLTG
A0A239HDF6      --PR-------TNILRLSYSSLDGKLSAEIVNTVISEYIQRSY-ETRFASTQRVSKWLSK
A0A4Q0T270      --PK-------TEIMRISYSSLSPKLSADIVNKVVSDYIQRSY-ETRFASTQRVSQWLSG
A0A1Q3QQB6      --PK-------TEIINISYSSLNPKLAADIVNKVISAYIQRSY-ETRFASTQRVSRWLSS
A0A3N1K1G7      --PK-------TDIIRISYSSRSPKLSADVVNKVISTYIQRSF-ETRFASTQRVSQWLQG
A0A4V2G466      --QK-------TELIRISFQSLSPKLASDIVNKIISAYIQRSY-ETRFSSSQKVSTWLSG
A0A6B9YNQ8      --QK-------TEIIRISYRSLSPKLAADIVNKIISAYIQRSY-ETRFASSQRVSNWLSG
A0A7G8BSK5      --QK-------TDIIRISYQSLSAKLATDIVNKVIAAYIQRSY-ETRFSSSQRISNWLSG
A0A1I6MH75      --PK-------TEIIAISYTSLNAKLSADIANKVVSDYIQRSF-ETRFQSQQRVSAWLQN
E8WVF6          --PK-------TDIIRIAYSSLDPKLSADVVNKVIADYQQRSY-ETRFDSTKRVSQWLSG
A0A3N5YNR8      --PN-------SRLVEIRWVSPDPTLAAAVSDTLAEEFIEQNL-QTKFEANTRATEFLKK
A0A3N6A5T6      --RG-------SRLVEVSYASHDARLAATIVNTLADQFIEMNF-ESRYQATTKATEFLQK
A0A1F2Q9L4      --RN-------TRLVEVSYVATTPELAARIANGVADTYIDWGV-ETRFATVGKASTFLTS
A0A2U3KC61      --PN-------SRLVQISYTHPNPRLAEAIVNKLVDTFKEENT-NAKYESVNETSEWLKA
A0A2V9Y2R7      --PR-------TRLLELRYIHQDPVLARDIVNKLAKTYIEENF-RKRYESTTQTSEWLSG
A0A2V9NGH6      --PN-------TRIIEIRYRSTDKDSAARVVNTLINTYIEQNF-KTKFESTMQASDWLSK
A0A2V9PYE6      --TN-------TRIIEIRYRSTDKGLAARVVNALINTYIEQNF-KTKFESTMQASDWLSK
A0A2V9NL07      --PN-------TRIIDIHYRSPNKELAARVVNTLANTYIEQNF-KTRFESTMQASDWLSR
A0A2V9QD92      --PN-------TRIIDLHYRSPNKELAARVVNTLANTYIEQNF-KTRFESTMQASDWLSR
A0A2V9WPZ6      --PN-------SRIIELHYRSPNQELAATVVNTLATTYVEQNF-KTKFESTMQAADWLSK
A0A2V9ZLH4      --PN-------TRIIEIHYTSPNKELAATIVNTLVNTYIEQNF-KTKFESTMQASDWLSK
A0A2V9RQF1      --PD-------SRVVDIHFRSPDRQLAAHVVNALTSTYIEQNF-KTRFESTMQASDWLSK
A0A2V9YDK8      --PN-------SRIIELHYRSPDKNLAANIVNTLAATYVEQNF-KTKFESTMQAADWLSK
A0A2V9V8F7      --PN-------SRIIELHYRSPNKELAATVVNTLATTYVEQNF-KTKFESTMQAADWLSK
A0A2V9XGR9      --PN-------SRIIELHYRSPNKELAATVVNTLATTYVEQNF-KTKFESTMQAADWLSK
A0A2V9V3Q5      --PN-------TRIIEIHYRSTDPTLAASVVNTLAATYVEQNF-KTKFESTMQASDWLSK
A0A2V9NWS3      --PN-------TRIVDIHFRSPDRELAAHVVNTLISTYIEQNF-KTRFESTMQTSDWLSK
A0A2V9USA9      --PN-------TRIIEVHYRSGDPQMAANVVNTLMQTYVENNF-KSRFESTMQASDWLNK
A0A2V9XW18      --PN-------TRIIEVHYRSADPQMAANVVNTLMQTYVENNF-KARFESTMQASDWLSK
A0A1H5SQF5      --KG-------TRLVNVTYTDADPKQAARVANAVVEAYLISST-QQRYDATSKTSAWLTN
A0A2V9AEW6      --GS-------SRLLEVLYESPDPKQAADFANTLVSEFTELSQ-EAHWKSAQGTAEWLTN
A0A2V8WQK6      --GN-------SRLLEVLYESPDPQRAADFANTLVSQYVELSQ-EERWRSAQGTAEWLTS
A0A2V8XIF4      --GN-------SRLLEILYESPDPKLAADFTNTLVSEFVELSQ-EERWKSAQGTAEFLTN
A0A2V2R0I6      --PN-------SRLMDVSFESTDPQLGARIVNAHINNFIEQNF-RSRFEATSQASSWLTD
A0A2V8XAR9      --PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNF-RSKYEATTQASTWLAD
A0A2V8VZA0      --PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNF-RSKYEATTQASSWLAD
A0A1Q7CB82      --PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNF-RSKYEATTQASSWLAD
A0A2V8WIU1      --PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNF-RSKYEATTQASSWLAD
A0A1Q6Y9F5      --PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNF-RSKYEATTQASTWLAD
A0A2V9EVV8      --PN-------SRLMDVSFESTDPRLAARIVNAHIASYIEQNF-RSKYEATTQASTWLAD
A0A2V8YF91      --PN-------SRLMDVSFESTDPRLAARIANAHIATYVEQNY-RSKYESTTQASNWLAD
A0A2V8XZK2      --PN-------SRLMDVSFESTNPQLAARIVNAHIATYVEQNF-RSKYESTTHASDWLAD
A0A2V8ZTX6      --PN-------SRLMDVSFESTDPRLAARTVNAHIATYVEQNY-RSKYEATSQASDWLAD
A0A2V9BT79      --PN-------SRLMDVSFESTDPRLAARTVNAHIATYIEQNY-RSKYEATSQASDWLAD
A0A2V9YHT3      --PN-------TRMIELRFSDPAPRETARVLNVFMDDYIQENI-RAKYDSTMQATDWLTR
A0A7C2XNI7      --PN-------SRLLEVQFESTDPQLAARVVNTHLHNYVEHNF-RARYESTTKASDWLAA
A0A1Q8B793      --PN-------STLLDVAFESTDPRLAARVVNAHIENFIEHNF-RSRYEATTQASSWLAG
A0A2V9BCA0      --PN-------STLLDVAFESTDPRLAARVVNAHIENFIEHNF-RSRYEATTQASSWLAD
A0A2V9BWU9      --PN-------SRLLDVTFEAGDPKLAARVVNVHLENYIEQNF-RSKYLATTTASNWLKD
A0A2V9DKX2      --LN-------SRLLDVTFEAGDAKLAARVVNAHLENYIEQNF-RSKYLATTTASNWLKD
A0A7C2YQY3      --RT-------SRLVEVRFESADPKVCSDVPNTLAQLYIENNF-RKKYESTMQAQEWMSG
A0A3E0NV31      --GN-------TQLVRVSYSSPDPDLSTDVAGAIALTFIETTL-QTRYDATRRAVKFLED
A0A3N5M5V0      --PN-------SRLVEVGWVSPDPSLASAVSDTLAEEFIEQNL-QTKFEANTRATAFLKK
A0A3N5XQP8      --LE-------SRLMDVSFSSPSPKFAAMVANAWVEEYIEQNF-QSKLKTTEMATKFLAE
A0A2Z5G7H4      --SG-------TRLIEVRFLSSDPVLAAKVVNQLMDGLVEYNF-QTRFTATNQASEWLTG
A0A2V9L5B5      --RR-------SNLVEVTFDSYSRTVAALAANKLADDYVEQNL-EVKWDAAEKASQWLQG
A0A2V9LK56      --RR-------SNLVEISFYSNDPKLAARIANRLADDYIEQNL-QVKWDAALKASEWLSG
A0A2V9L7I0      --RR-------SNLVELTFDSYSPEVAAQAANKLARDYIEQNL-EVKWDAAAEASKWLEG
A0A522PPT0      --ER-------SNLVEVAFYSQDAAVAARVANQLGEDYIDQNL-QVKWNEALKASEWLSG
A0A7C5V1G5      --ER-------SNLVEVTFYSRDPALAARIANQLGEDYIDENL-QVKWNEALKASEWLSG
A0A2V9KCS3      --NE-------TRIVEILCDSTDPKFAADFANTLVSEYMEQSL-ESRWKNAQRTGDWLTR
A0A372IT17      --TG-------TRLIEIRYSDPDPALAARVVNRLVQALADYTF-QSRLAQTSESSSWLAG
A0A4R1LC91      --SG-------SRLIQITYLSSNPHTAAAVVNALSAALIDYTF-QTRFNATNQASGWLSN
A0A3M2BZG9      --RD-------TQLVELTYRSDKPELAARIANGYAQAFIDWGI-ETRTSTVSRASTLLTS
A0A1Q7N5R7      --LS-------GNFLRIALTGPSATGVTGVVNAVADRFVAVAT-DLKRAKLTELGRLLRE
A0A2V9QB26      --GL-------TRVVEASYDSTDPRFAAAFLNTLVQEFMDSNM-EARLKSSEYTSQWLSR
A0A2V9VYY4      --PS-------TRLIQVSYTHSDPRFATEITNALVKTFIEENF-RTKYNSASQTSEWLGK
A0A3E0PHB0      --EG-------TNLVKLTMNGSDPELIRRVADTLTEVYKDRSI-MLATKTQVEAHKELQN
A0A3M1SIV3      --ER-------TNLFSINVANSNPELAAILANTIAEVYIERTI-RRETEGMQKSLEDITK
A0A3M2D491      --ER-------TNLFSVKVVHTNPELAARLANAIVGVYIDRAA-RREVEGTRKSLEDLTK
A0A353C9L6      --ER-------TNLVNVRVKSTNQALAPKVADKIAEVFKLRDA-ERETQGAKNSAADLAK
A0A2V8RQV0      --ER-------TNLVNVTIQNEDPALAGKVTDEIAAIFIEEDK-ERETQGERKAIEDLTK
A0A2V8SJH5      --ER-------TNLVNVSVTTPKAELSARVADKVEEVFIDKDA-QRETEGSRRTYEDISK
A0A357F267      --ER-------TNLVNVSIRSTNPDLAARVADKVAEVFRDQDA-ERETQGAKNASEDLGR
A0A7C5ZUA8      --EK-------TNLVDISVRSTNPELAAKVSLKVAELFRDRDA-ERETAGARKAVEDLDK
A0A136JPP4      --ER-------TSLFTLTINSTNPQIAANVANKVGEVFIEEDA-KRELETTQSAYDELTK
A0A399WUJ8      --ER-------TSLFTVSVSSTNPQLAAAVSDKVAEVFIEEDA-KRELEGTQSAYDELTK
A0A2V9KIE8      --RR-------SNLVEVSFGSHDPRVAAQVANRLAQDYIDSNL-QVKWDETIKASDWLQG
A0A352F549      --KK-------TYLIDLRATHTDPVVATKVVNAMADAFALWNM-EVKTKTNTVAGSYLQK
A0A3B9MLP9      --KK-------TRLIDIRASHTDPGVAAKVVNAVADAFALWNI-EVKTKTNTLAGTYLQK
A0A3D5SQ87      --KK-------TRLIDIRASHTDPGVAAKVVNAVADAFALWNI-EVKTKTNTLAGTYLQK
A0A2V8NW86      --GL-------TRVVEASYDSTDPRFAAAFLNTLVQELMESNM-EARMKSSEYTSQWLSR
A0A7C2GJ20      --RN-------TRVVAVTYSAHDPQLAARAVNELFTQYGEYML-EARSDSTRKATEWLQE
A0A7C4BTL5      --GQ-------TRIIEVTVDSTDPNIAATFANTLANEFIDQNM-EARWLMAQRTGDWLGR
A0A2V8ZHL8      --RD-------SHVVNISFEGPDSSLSAKIANSLASNFIEYNF-RQKYDATRQASGWMEQ
A0A2V9B240      --RD-------SHVVNISFESPDPGLSAKIANSLANNYIEYNF-RQKYDATRQASGWLEQ
A0A2V9CBM2      --NR-------SRLVAVRFDSHNPDLAARVANNLAADYVEQGL-DERWAAAQRASDWLSR
A0A2V8XN17      --NR-------SRLVAVRFDSRDPELAARVVNTLASDYVDQSL-EARWQATQRAAEWLSQ
A0A2V8WX45      --NR-------SRLVTVRFDSRDPELAARVVNTLAADYVDQSL-EARWQATQKAAEWLTQ
A0A1Q6YR79      --NR-------SRLVTVRFDSRDPELAARVVNTLASDYVDQSL-EARWQATQRAAEWLSQ
A0A1Q7VA32      --NR-------SRLVTVRFDSRDPELAARVVNTLASDYVDQSL-EARWQATQRAAEWLSQ
A0A2V9EY85      --NR-------SRLVAVRFDSRDPELAARVVNTLASDYVDQSL-EARWQATQRAAEWLSQ
A0A2V9H8K0      --NR-------SRLVAVRFDSHDPELAARVVNTLAADYVDQNL-EARWQATQKAAEWLSQ
A0A2V9FFE5      --NR-------SRLVAIRFDSHDPELAARVVNTLAADYVDQSL-EARWQATQKAAEWLSQ
A0A2V9GM43      --NR-------SRLVAVRFDSHDPELAARVVNTLAADYVDQSL-EARWQATQKAAEWLSQ
A0A2V9CYQ5      --NR-------SRLVAVRFDSQNPDLAARVANALAADYVEQGL-DERWAAAQRASDWLSR
A0A2V9BWU8      --SR-------SRLVTVRFDSGNAQLSARIANALAEDYIDQSL-EARWLATQKATDWLSQ
A0A2V8ZG48      --SR-------SRLVNVRFDSNDAQLSARIVNTLAEDYIDQNL-DSRWKATQKATDWLSQ
A0A2V8Y334      --SR-------SRLVTVRFDSNSAELSARIVNTLAEDYIDKNL-EARWKATQKAADWLSQ
A0A2V9AY68      --SR-------SRLVTVSFDSNNARLSASIVNTLAEDYIDENL-EARWMATQKATDWLSQ
A0A1F2RFI7      --RR-------SRLVEISFDSYDPALSARTANALAANFIDQNL-EAKWDATQKASDWLSQ
A0A1F2RZS3      --RR-------SQLVEITYESYEPSQSARVTNTIAANYIDMNL-EAKWDATQKASEWLSQ
A0A1F2USE2      --KY-------SRLVEVHFESEDPALAAQATNTLAANYIEQNL-EARWEASQKASEWLSQ
A0A7C2VB08      --KR-------SRLVEISFQSHDPELAAAVVNALADNYIDQSL-EVRWQATQKASEWLGQ
A0A2V9C238      --KR-------SRLVEISFESRDAELAARVLNALASHYIEQSL-EVRWEATQKASEWLSQ
A0A1F2Q9F5      --KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNF-ERRWEATQKASEWLSE
A0A1F2QQH9      --KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNF-ERRWEATQKASEWLSE
A0A1F2QXK7      --KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNF-ERRWEATQKASEWLSE
A0A2V9DEM9      --KR-------SRLVEISFESRDAELAARVLNALASHYIEQSL-EVRWEATQKASEWLSQ
A0A7C5TWV7      --KD-------TNILELSMTGKDPDKVAEWLNVYVQEYIAINI-EDNLNRTRKVYQVISE
A0A2V7XDY0      --PE-------SRLVLIHVTHRYPKEAALWANTLADVYIEDTI-STRVEAARKAYEWLQE
A0A2V8G155      --RN-------SRLVDIKYRLGDPALAQKIVNAVAHAYIEQTM-EFKFTASKQAGDWLEE
A0A2V8HDM7      --RN-------SRLVDIKYRLDDPALAQKIVNAVAHAYIEQTM-EFKFTASKQAGDWLEE
A0A2V8DRT9      --RN-------SRLVEIEFASPYPYVAANVANSLSKAYIELNL-EYKFTASRDASDWLGE
A0A2V7VYF3      --KN-------SRLVDVVYRSPDPVFATTIVNELAHQYIQQNV-ELRFHASKDASDWLGQ
A0A1F2SVH2      --RN-------SRLVDVRFDSPDAAFSATVANALARAYIEQHL-EFKFLSSKEASDWLGE
A0A2V8AJG9      --RN-------SRLVDVKFESPSAALSAQVANGLAKAYIEQNL-EFKFMSSKEASDWLGE
A0A2N9LQU7      --PK-------TRVIEIRFQNVNPKLASDVVNGIVDAYLQRNF-DVKYQGAVQVSEWLSK
A0A2P6WFK7      --PN-------TQIVEVLFRCTDPKLATDVANAVVEKYMQHTL-QTRYEGTVQVSNWLSK
A0A2V8U914      --RD-------SQIIRVAFDAHDPQLAADFANTLARTFIEQSV-NGRRRAAQEIQEWLGP
A0A2V7W309      --HG-------TNLIVITYTGSSPKLAQKIAEAWGDSFMRMTI-AKKLDSVRQATEFLSQ
A0A2W0BGU4      --PG-------SRVVLVGFESRDPELAARIANTQVENYSDYNF-RQKYDATRQAAGKMEE
A0A2W0BVQ9      --PG-------SRVVLVGFESRDPELAARIANTQVENYSDRNF-RQKYDATRQAAGKMEE
A0A2V9MN96      --PR-------TRVIEITYIHPDPQLAAEVTNALVKTFVEENF-RTKYESTSQTADWLSK
A0A2V7V2Z1      --KS-------SRLVMVSYESFRPEMAAAAANGLSKLYIEQTL-EFRYQTSSEAAQWLGQ
A0A2V7X2F7      --KG-------TRLVGVGSEAFRPDLAMNVANKLSQLYIEQTL-EYRYQTSSEAGVWLGG
A0A2V7V2I1      --RN-------SRLVLVGFEAYRPELAAQAANKLSQLYIQQTM-EFRYQTSADAGLWLGS
A0A2V7U3M2      --KN-------SRLVLVAYESYVPEMAAAAANWLSQLYIKQTL-EFRYETSSEAAQWLGQ
A0A2V7UHT0      --RN-------SRLVTVTYESYRPDMAAAAANRLSQLYIQQTL-EFRYQTSSEAAQWLGQ
A0A2Z5FVL3      --PG-------TRVIEVAFSSSDPNLAARVVNQLVASLVNYSF-QSRRTVDTEASKFLES
A0A2V9KBD6      --KG-------TRLIQIRFRSPDPQLAADVVNGLAKDYVDHYY-QSQFQVSEQISAFLTN
A0A2W0AJ66      --RG-------TRLIEIKFRATDPRLAADVVNYVTKAYVDRNY-SSQLYASNQLSQFLLN
A0A1Q7RBU1      --KG-------TRLIEIQFRNTDPRLAADVVNELARAYVDQYY-KSLFQVSTQISEFLAN
A0A2V9JPV9      --KG-------TRLLEIKFRNTDPRLAADVVNQLTKAYVDRYY-RNQFEASTQMSEFLAS
A0A3P0X3W6      --AS-------SLLLKITYRSKDPRKAADVANAVAHSYIDEAM-DMRLHSSMNLSGFMAK
A0A2N9MK30      --VN-------TYLLLISYRSPDRRLAADVANAIARSFVEHTY-DIRFRSSASLSTFMEK
A0A3D1ASD2      --PN-------TYLLQITYQSANPRLAAEVANGVANSFLQHSF-EIRFKSSESVSQFMTK
A0A7C5AXI3      --PN-------TYLLLISYRNTDPQLAAAVANAIAASYLEHTY-NIRFRSSASLSAFMEK
A0A7C6E4H7      --PN-------TYLVLVSYRSPDPRLAAEVANAIANSYIQHTY-NIRYRASVGLSSFMEQ
A0A1F2TCR2      --QT-------TRLVSIQYRSPDPRFAALAANTIAEEYATQNL-DLHLDNVLGKLAWLDD
A0A350UQT3      --PN-------TYLLQVSYRSPDPQLAADVANQVAQSYIEHTY-NIRIRSSQSLSRFMER
A0A7C3HRX0      --VN-------TTLLQLSYRSDDPRLAADVANSLAQSYIEHTY-NIRIRSSASISRFMER
A0A1F2V330      --G--------SDSFHLAFEGRGRTQVMNVTNDLSERFIRRLA-NMREQQVNEGAGLLNA
A0A662EE63      --AE-------SNVIELSMIGRNPDRVAEWLNVYVEQYIAANI-EDGIDKTRKIYKVIQS
A0A2V8TLH7      --KD-------TGIMQITLDGPEPKEVQTWVNSVAEAYVDRNL-DLSIEATGRAVKALLS
A0A1Q7ZJT1      --KE-------TGIVEISMEGLNPEEVASWVNTISEVYVERNL-DQVVEATSRAVKALLS
A0A2V8VC99      --KD-------TGIVVIGLEGLNPEEVAAWANAIAEVYVDRNR-DQAVEATAKAVRALLS
A0A348UZU3      --RM-------TRLVEVAFKAHDPALASDCVNALFDSFVDMNI-EARYETTEQATEFLSE
Q01XL7          --RG----VGATRLIELRCQSPSPEVAANFLNTLAAEHISQNL-AIRSSATQRTSQWMDS
A0A2V8ERZ5      --RG-------SHLVDVSFVSEDPKFAAEAVNALIEEYVNQNL-ELKLQSTQGMLDWLDK
A0A2V8GTX0      --RG-------SRLVDVYFVSADPEFAARAVNVLAEEYVNENL-DFRLQNTDKTLQWLTE
A0A2V8J0X9      --PN-------SRLVKIVYSHSDPKFAALAANTVADEYTQQNI-DLRLQNTEKTLQWLGE
A0A523DUV7      --PD-------TRLAQIVVEHEDPREAARWADTLAESYIEQNL-ASKIEATRNVYSWLQE
A0A1F2U158      --AE-------SKLVDVYFTSADPQFAATAANALADEYVASNL-EVKMQGTQSMLDWLEK
A0A2V8F6S9      --TG-------SKLVDVTFQSSEPKFAATAANALVDEYVDSNL-EIKQAGTQNMIEWLDK
A0A7D8BEX2      --PK-------SEIISISATTHSGSLSANLVNTLINDYISNSL-EVRFGSTRRVSQWLIG
A0A4Q1SCH5      --EG-------TQLVDVSFRDQNPQMAALLLNHVVDAYLRQSF-NSRYGSVAQVRDWLSA
A0A372IRG7      --TG-------TQIVEIHFQNPDPEVAAKVVNAIVQAYMERDL-RSRFEGTTRVSNWLSQ
A0A2V8K4L4      --GT-------TRIIEITSDSTDPQLAADFANTLVDEFIQKNL-DDRWKTTERTGEWLTK
A0A2V8NCZ3      --NT-------TRIIEITADSADPRLAADFANTLVDEFIEKNL-DDRWKTTERTGEWLTK
A0A4Q7YNP3      --GI-------TRLVEITCDSWNAEFAARFCNTLTTQFKEADL-ETRSSESEKTSRWLAQ
E8UZE1          --RG-------TEIVQIRYKSTNPALAATIANTVAAKYIQRNF-ETKYNTTHETSAWLQD
A0A2U3JZ71      --PN-------TYLLLISYRSTDPRLAADVANGVARSYLEHTY-NIRFKSSASLSAFMEK
A0A2V8TTB0      --PN-------TYLLLISYRSPNRQLAADVANAIALSYLAHTY-RIRYKATAGLSEFMER
A0A1V6HR88      --GQ-------TQMVDISYRSTDPALAARIANGVAETYIDWGI-ESRSNLAGKTSVFLGA
A0A3E0P0A3      --SG-------TQLFNLTYSTGDPEIAMMLANGYAEAFIETGK-ASSRADAAQASSDIQA
A0A2V8EXP2      --RN-------SRLVDVKFSSLSPMLSSQVANALARAYIDQNL-EFKFLSSKEASDWLGE
A0A2W4RYA1      --RN-------SRLVDVSFESPSAAFSMRVANALAKAYVQETL-DYRLSASRDANDWLMA
G8P0Y7          --PD-------TTLVQVGYSDPSPALAAEIANGITAAYIEQNV-KSRYDSTMQAADWLSK
A0A5M8T4U7      --GG-------TQMVDIRYRNHDPKLATDVVNTLMDTFIHENL-RSKFDQTKQTSAWLEK
A0A7L5A491      --PN-------TFLIDISYRSPDPRLAADVANAVAHSYISHGM-ETRAHSSVEQTAFMEK
A0A7D8BF18      --PK-------TDIIRISCSTLDARLSADIVNRLVKDYITRSF-QSRQEAEQRVTEFFSH
A0A1E3Y9R6      --RN-------SRLVDLRFRSPDPEFAARVVNQHAAQYIEQSL-EFRLAATTQTNAWLTS
A0A2W4TLP2      --RN-------SRLVEIKFQSPDPEFAARVVNAHAEQYIEQSL-QFRLEATSQTNAWLNT
A0A7G8BDY8      --AR-------TQAVEITFRDANPILAREVVNRLSSAYAQRNF-VTRFNNTMKASDWLSG
A0A7C4BZ42      --GT-------TRIVEVLCDSPDPRLAADFANAIVAEFIEESL-DARWRTTEKTGEYLTR
A0A3R9WF43      --PD-------TRLINVTFENPDPTVAALAANSLAKTFIDDYL-ERRHRSTSQASYWLQK
A0A317HKM4      --KD-------TRLVNVGFRSTDPEIAARVANALARAYVRWNV-EYRSKMTGEASAWLSR
A0A2V9CG11      --GN-------TRVLEVLYESPDPKLAADFANTLASEFIEETQ-GMRLKAFQRTAEHLTV
A0A523E0N1      --KK-------TQLMEVSFVSPDPELSAQLANSLVVQYRQFNI-DSESGLARDTSSFIDE
A0A4R1LAZ7      --PS-------TDVVEIHFSNPDPEVATNVANAIVDAYLERDL-KSRFEGTTRVSSWLAQ
A0A7G8BMP1      --PG-------TNLVEIRYRNPDPKLATSVTNAILDAYMERDL-RARYEGTNRVSSWLSQ
A0A523ECP2      --RN-------TQLMELKFTSTEPKVAADLANALARQYMTFSM-EKETTLARDTAGFIRE
A0A2W0C122      --KN-------TRVVEVSFTGRYRDLNARIVNTLVDVFIDDNI-RSRYEAANRAAKFLSA
A0A2W0AUU7      --KN-------TRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNI-RSRYEAANHAAKFLST
A0A2W0BQL1      --KN-------TRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNI-RSRYEAANHAAKFLST
A0A4Q1SDL1      --SG-------TRLIEIDFTNSDPKVAAAVVNHLIQALTDYAF-QTRVNSTSEAATWLTG
A0A3P0XH15      --PG-------TQLVEVRFRNQSPAVAASVSNAIVDRYMDRSR-RARYEGTTRISEWLAK
A0A3M1WQW8      --RD-------TRIVKVTYESPDPQLAAQIVNALMDQLIEYTL-MARFESTRQAREWLNK
A0A3N1JHC1      --GM-------SNLIRITLIGPDPHLAADTANELTNQYIQQGQ-NARLAAASETGVFLTQ
C1F294          --PE-------TDLAEIHFQNQNPKVAQEAANEIVNAYQDWTL-RAHFETMTRISDWLSQ
A0A2V9KA79      --GN--------DAFYVSFEGTGAAQVRDVANRLAEEFIHEVS-AADESRVEEAAGLVGA
A0A522PSP1      --PG-------TYLLNVSYRSSSPDQSAAVANALAEAFIEHEY-KTRNSALVSLTQYMRE
G8P085          --PS-------TQLVTISFRNPNPQVAALLANRLIEAYLRQTF-DSRYGSVTQVTKWLSS
A0A7C6A629      --PN-------TYLLLVSYRSPDPRLAAEVANAIANSYVEHTY-NIRFRSTMGLSSFMEK
A0A4Q1SGQ1      --PG-------TRLIDVSYADPNPYLATAVVNRLLSALTEYTY-QARFQATAQASDWLAG
Q1ILD9          --PR-------TGIVQLRFRSSDPELAAAVVNELAEAYTEHNF-QVAYESTIKASDWLAK
A0A7G8BJH7      --TG-------TRLINVSYSSPDPRLAAEVVNHLTSALMDYSF-QARFTATAQASNWLTT
A0A7C5SHM3      --EY-------SSVVGVSFRHSSPELAADVVNAVVHAYQDFFVEEIGLAPRRRALEVIED
Q1IJZ6          --PD-------TRLIQIAFEDPDPNFAAQVLNTLIGQYTQDVL-TRRNASTTQASEWMSA
A0A2V8TCE6      --KD-------SNLVEVVYLSPDPRFCAQLANAVADAYIEFAL-SSQFDTTEQASDFLSR
A0A522TBE8      --PA-------SLLLNVSYQTQSATLAAQIANAIANSFLNLEY-NSRAQALNQSTAYMSG
Q1ITG0          --PK-------TQVIEIRFRSTDPALAAKVVNTLTSSYMHHNF-MTRFEATMQASAWLQQ
A0A7C2ML20      --TD----IYGQRVIGVSYTSTNARLSADVLNALFETFIDYQR-EANTQAVEFAQDWLTR
A0A7C5AXS9      --PQ-------TRLVEVKFDSTDPEAAAKFLNVLAAEFIEQNL-EVRWETTQKTGEWLTR
A0A7C2RGE3      --RN-------TRVVAVTYSAHDPQLAARAVNELFAQYGEYML-EARSDSTRKATEWLQE
A0A3N5PCI5      --RD-------TRIIEVRYESPDPELAARVVNTLATTYITHNL-EVQSQASKEATTWLAE
A0A3M1Q0S9      --RD-------SQLVTISFVHPDRVFAARVANALAEAYIRFSL-AAKLDIAAQSEAFLVD
A0A2Z5G448      --PN-------TDLVEIHYRDPDPNQASRIAQAVVDQYLELDL-RSRYEGTLRISNWLSG
A0A3M1VZ38      --RD-------SHLVEISFVHPDPRIAAEVANAIAYGYLRFTL-DRKTRIAKQSKDWFVE
A0A4Q1SD29      --PN-------TEMVEISFRNPDPKVAMEGANGIVDAYLDRDL-RAKFQGTTRVSNWLSQ
A0A6N9FGE2      --RQ-------SRIVTLRFSAFEPQLAADVVNALAELHVARDM-EFRYTTSRNASKWLEQ
A0A3M1PY35      --EK-------SNVVRVSYRHRDPEIAARIVNAVVRAYRDFFV-ESGTDARRGASEFLDR
A0A3M1VMP2      --EY-------SSVVRVSFTHPSPEIAANVVNAVVDAYRDFFV-RTGVDARRGAADFLER
                                                                            

A0A2V7VMF7      RLGETQKGMREAQDKLAKTYQGQDGFVPEGSGG-----------------------SAAA
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      DLQQKVDE------------------------------------------------AT--
Q01X01          DLKEIRNR------------------------------------------------A---
A0A3M2D9H8      QIQQVEAQIADLQKQLAQSSEQSSE-----------------------------------
A0A2V8JK38      QIVNLKGGLEKAEERLQKYGQDNDILF---------TEDGRNT-------------VT--
A0A2V9IXG5      QLYEIKSMLASQQTQMNQYAESSNLPVTPEMA------------------------SVEF
A0A2V9J2P4      QLYEIKSMLASQQTQMNQYAESSNLPVTPEMA------------------------SVEF
A0A1Q7RLS4      EIAPLKEKLEDTQRTSFEFAEKANLYV---------PENQQKI-------------TN--
A0A2V2R525      RIYELQEQIKNGEERLINYAKDNQI-ISLE------PSQN-------------T--VV--
A0A321LPW6      STRELQAKVQKAEQSVADYTRDHNI-YSTE------GKET-------------L--TT--
A0A2V9R9V4      STRELKSKIERSEQALADYTKTNNI-YSTD------GKAT-------------L--VA--
A0A321LE75      MVRERRAEVQKAEEELANYTREHNL-FSTD------GKEA-------------P--AV--
A0A2V8R8U7      EIAKYQDKVNKEQDARFAFAKAKDLPLGPE------SGPN-------------I--EA--
A0A2V8QMP4      EIIDLQARIQANEQKRINYRKENDLPLGTK------QGQD-------------L--NA--
A0A2V8R4S3      EIIDLQARIQANEQKRINYRKENDLPLGTK------QGQD-------------L--NA--
A0A2V8NJ55      QIAELQLKIKADEEKLLNYKEKNDIPISTA------QGVD-------------I--TN--
A0A2V8Q7I0      EISEMQGKVRTKTERLFNYAREYSLPLTED------VMLN-------------T--EA--
A0A2V8S6K4      QITDLQAQIAE-----LEKKRTDALVQSGSAVNPEAKGAN-------------V--TV--
A0A317I2L9      EIGELQFKVKHDQEVLFNYARENNLNPTGN------QNLD-------------V--EG--
A0A2V8LLF9      QIAKVQDKIKKEEQDRFSFAKAHNLPIDNT------PGTN-------------L--EA--
A0A352FRF4      EIAKYQGQVKQKQADVFNYAKQYELPLTDA------PASN-------------L--RQ--
A0A2V8MKV0      QIGTYDELVKKERDDRIAYAKQYGLPLTPT------EN-N-------------V--PI--
A0A2V8PYY8      QIATYERKVKEERDARVAYAKQYNLPLTPT------EN-N-------------V--AA--
A0A1Q7YKQ8      KIAELQLEIRRQDEERVNYIKLKNLPPSKS------PGAD-------------L--AA--
A0A352F3R7      EIASYQTKIKQEQEAQFNYAKNHNLPLTID------ASSN-------------L--EV--
A0A0B6WXT1      QIAELQLKIRQGEEARINYLRSHNLPLGQA------KGQN-------------L--TL--
A0A3B9MEU8      EIAKLQTQIKHDQEAQFNYAKNHNLPLTAE------AGGN-------------L--EA--
A0A2V8MHG6      RIADLQSEIRSDEEQLINYAKNHQI-LSLD------ASQN-------------T--VV--
A0A2V8P7N1      RIDDLQSEIRSDEEQLINYAKNHQI-LSLD------ASQN-------------T--VV--
A0A2V8M3M6      RIDDLQSEIRSDEEQLINYAKNHQI-LSLD------ASQN-------------T--VV--
A0A1Q7NJH5      RIADLQSEIRSDEEQLINYAKNHQI-LSLD------ASQN-------------T--VV--
A0A2V8PJY0      RIADLQSEIRSDEEQLINYAKNHQI-LSLD------ASQN-------------T--VV--
A0A1Q7Y6W9      RIADLQGEIRSDEERLINYANQHQI-LSLD------PGQN-------------T--VV--
A0A2V8NC68      RIADLQSEIRSGEEQLINYAKNHQI-LSLD------ASQN-------------T--VV--
A0A399WK13      RIASLQSDIRRDEEKLVEMTQNAGI-LKTS------DDST-------------I--VM--
A0A352FLX4      RIAELQSNIRGKEEELINYGKNHQI-LSLD------ANQN-------------T--VV--
A0A2V8RTL7      RINDLQTDIRGDEIKLVELKQSEGI-LKTD------GDQT-------------I--VI--
A0A3E0PCJ6      RIGELQSEIRQGEERLVDLKKNAGI-LKTD------ENTT-------------I--VT--
A0A3M1S4R8      RIATLQSEIKRDEMRLAELKNNAGI-LKKD------EGQT-------------I--VI--
A0A7C2G442      RIATLQSEIKRDEMRLAELKNNAGI-LKKD------EGQT-------------I--VI--
A0A1Q7YFI6      RIAEIQSEIRNGEERLINYAKNNQI-LSLD------GSQN-------------T--VV--
A0A136KC10      RIASLQSDIRRDEEKLVEMTQNAGI-LKTS------DDST-------------I--VM--
A0A3M2D6Y5      RIASLQAEIKRDEMRLAELKNSAGI-LKKD------EGQT-------------I--VI--
A0A2V8SEX6      RITDLQSEIRSDELELAELQKNIGI-LKTD------GEQT-------------I--VL--
A0A7C5ZUU4      RIAELQAEIRNDELKLVELKKTAGI-LKTE------GEQT-------------I--VL--
A0A0B6WWQ6      RIAELQAQIRAGEAQLLAYSKSHQI-LSLD------PSQN-------------T--VV--
A0A3B9MK99      RIAELQQQIRSDEERLVNYARNNKI-ISLD------ANQN-------------T--VV--
A0A352EX26      RIAELQQAIRSDEERLVNYAKNNQI-ISLD------ANQN-------------T--VV--
A0A2V8MM59      RVAELQDKIRSDEEKLVSYAKSNQI-LSLD------ANQN-------------T--VV--
A0A2V8PFE8      RVAELQQQIRADEEKLVSYAKNNQI-LSLD------ASQN-------------T--VV--
A0A2V8PWS6      RVAELQQQIRADEEKLVSYAKSNQI-LSLD------ASQN-------------T--VV--
A0A2V8LCT5      RVTELQSQIRSDEEKLVVYAKSNQI-LSLD------ASQN-------------T--VV--
A0A352FTJ9      RVEELQAQIRAAEEKLMAYAKSNQM-LSLD------ANQN-------------T--VV--
A0A257VBK0      EAKKMQDQYARQQTTMTTSLAASGSYF---------PQNQKEI-------------LD--
A0A2G6PYV5      KSNEYRQRIMELYSQLGEQQKNSEDLI--VG---------------------RAKSAVEE
A0A2V8F956      QLLEQRKQVEGAEKKLQQYREQNDSIS--MK------DRE------------NI--VV--
A0A1F2S1W5      QLAEQRNKVEASEQALQAYRERTGSVS--FE------ERQ------------NV--VV--
A0A1F2T595      QLAEQRKKVEASERALQEYRERTDSVS--LE------ERQ------------NI--VV--
A0A2V8JQV5      QLQELKVNLEKSEQELQDFGRATGLMFTSEK-------DS------------SV--AE--
A0A2V9AC41      RLTELKERVEQSETALNSYRKDKGIIS--VD------EKE------------NV--VI--
A0A2V9MAM9      QLEELKGKLVKSEGELQAYLRSSGLIF--GA------GQE------------TL--AE--
A0A348V070      QISALRKDIEEAEKKLAELGTAQGILP--LS------SAE----------------APLI
A0A2V9M454      RLDELKLKVEKSEEAMVTYERQNNIAN--IG------DKQ------------TA--EE--
A0A2V9IVR7      QLDELKAKVERSQQALVDYERDNKIIN--IS------DKE------------NV--EE--
A0A2V9ILE2      QLDELKAKVERSQQALVDYERDNKIIN--IS------DKE------------NV--EE--
A0A2V9LGY4      QLDELKAKVERSQQALVDYERDNKIIN--IS------DKE------------NV--EE--
A0A2V9J4D6      QLDELKAKVEKSQEALVNYERANSIVN--VN------DKQ------------SV--AE--
A0A2V9L9C5      QLDELKAKVEKSQEALVNYERANSIVN--VN------DKQ------------SV--AE--
A0A2N9M9N1      QLDELKAKVEKAQQALVDYEREYSITN--LG------DKE------------NV--VQ--
A0A2V9JEC4      QLDELKTKVERSQQALVDYEKANDIAS--IG------DKE------------NV--VQ--
A0A2V9LPQ3      QLEELKAKVEKSQEALVGYERQNSIVN--VS------DRQ------------NV--VE--
A0A2Z5G3A3      QMADLRKQSEALQAKVADLQKEAGVYT--VGDG---GPDG-----KTQAYSSDI------
A0A2V7UGP8      QTTELKKQVSDLEAKLNQYGKENEIIG--LD------DKE------------NI--TN--
A0A239MKT6      QLEDLKRKIEENHRQVAAFQQKSGIVSEGMSAP---APSAGGGARGNIGAMAPSVDSTAF
A0A3E0PCN7      RVAELQSKIRAGEQNLLSYSRNNEILS--LD------PDQ------------NI--VV--
A0A2V8IYW3      QLEDAKLRLIDREKKLEEYRRR-------YIGE---LPSQLQSNLQ------VIQTTQ--
G2LEI9          TAARLQQEILEEERKLTEYLRTRKIVS--LK------PED------------NP--EV--
A0A317J121      QLEETRNKLQEAQQHLQEFVQSSGNLF--VL------QDN------------TL--DN--
A0A2V7YW66      QIETLKKEVQDKETQLQAFSRRTDIVT--LD------PAT------------NV--IL--
A0A2V7Z0V0      QIEKLKEEIQDKETQLQAFSRRSDIVT--MD------PAA------------NV--TL--
A0A2V8GFD4      RMAEQRSAVEASERALQQYREQYDAIS--LE------DRQ------------NI--VV--
A0A2V8HSS5      RMAEQRSAVEASERALQQYREQYDAIS--LE------DRQ------------NI--VV--
A0A2V8KP55      QIVNLKGGLEKAEERLQKYGQDNDILF--TE------DGR------------NT--VT--
A0A399WNU1      RVAELQAKIRTGEESLINYAKSNQILS--LD------ANQ------------NT--VV--
A0A2V9JSI3      QLDELKAKVEKSQQAMVDYERQNAIVN--IN------DKQ------------SV--EE--
A0A2V9WI32      QLSDLQMKVETSQEKLVRYQKEHDILG--ID------EKQ------------NI--VT--
A0A2V8IVN9      RLGEERKQVEAAEARLQQYREQNDAIS--LK------DRE------------NI--VV--
A0A7C5Z4J3      QLDELKAKVEQSQQALVNYERANSIVD--AT------GKV------------NV--EE--
A0A1F2TPT3      RLAEQKEKLDASEQALEHFREQNQLIT--AE-------GS------------PI--VM--
A0A2V8JTQ2      QLKELQARVEDSQRKLVDYQKENGLFG--LD------DKQ------------NI--VT--
A0A2V8UZY0      QLKELQSKVEESQQRLLAYQKQSGLFG--LD------NKQ------------NL--VT--
A0A350UEK1      QMDDLRIKLERSEDALQSYAQRNKLVF--TG------KDT------------NV--DE--
A0A350UIQ4      QLDDMRIKLERSEDALQNYAQRNNLLF--TG------NDT------------NV--DE--
A0A1H5Z7N3      QLGDLKQQVETSQEQMIDLQKKIGILG--FD------PTH------------NE--IT--
A0A1G7JVV8      QLDDLKQQVEASQEQLMDLQKKIGVLGLGADAS---KPVT------------TQ--VT--
A0A1H4T6W9      QLDDLRQQVETSQEQLIDLQKRLGVLGLGFDAT---KPPT------------TQ--LA--
I3ZEU5          QLDDLRQQVETSQEQLIDLQKRLGVLGLGFDAT---KPPT------------TQ--LA--
A0A7L5A6M5      QLDDLKQKVETSQQRMLDLQRKLGVLG--VD------SSH------------DE--IA--
A0A428MDU2      QLDDLKQQVQTSQERMMDLQRRLGMLG--FD------PSH------------NQ--IS--
A0A5B9EBI2      QLDDLKQQVETSQEQLLELQRRLGSVGVSID------PTH------------SQSEIT--
A0A239HDF6      QLEDLKADVEASQEKMINLQRRLGILG--FD------PTH------------NQ--IS--
A0A4Q0T270      QLDDLKAQVELSQEQMMDLQKRLGVLG--FD------PKD------------NQ--IS--
A0A1Q3QQB6      QLDDLKQQVETSQEQMMDLQRKLGIVG--FD------PNH------------NQ--IS--
A0A3N1K1G7      QLDDLKQSVETSQEQMMELQKRLGILG--FD------PSH------------NQ--IS--
A0A4V2G466      QLDDLKQQVQASQEQMLDVQRRLGILG--FD------PNH------------SQ--IT--
A0A6B9YNQ8      QLDDLKQQVQSSQERMLDVQKRLGILG--FD------PNH------------SQ--IT--
A0A7G8BSK5      QLDDLKQQVQASQERMLDVQKRLGILG--MD------PTR------------SQ--IN--
A0A1I6MH75      QLDGLKQEVETSQEQMMDLQKRLGTLG--FD------PKD------------NQ--TT--
E8WVF6          QLDDLKRQVETSQEQVLDLGKKLGTLG--FD------STH------------NQ--IA--
A0A3N5YNR8      QLQDMKGKVEKSEQELVQYARENNIVN--IG------PDR-----G------SI--VL--
A0A3N6A5T6      QMHELKVKVEKSEEQLVAYARAHNILS--LA------GSSSKEGDRSQ----NI--IM--
A0A1F2Q9L4      QIEALKQEIQDKEAQLQAYSRRSDIVA--LD------PSS------------NV--TL--
A0A2U3KC61      KLDDLRRKVQTSEEILVRYQKDHSILG--VD------EKQ------------NI--VT--
A0A2V9Y2R7      QLADLQLKVETSEGKLVRYQKEHSILG--ID------EKQ------------NI--VT--
A0A2V9NGH6      QLIDLQIKVETSQEKLVRYQKQHQILG--ID------EKQ------------NI--IT--
A0A2V9PYE6      QLIDLQMKVETSQEKLVRYQKQHQILG--ID------EKQ------------NI--IT--
A0A2V9NL07      QLVDLQMKVETSQEKLVKYQKDHQILG--ID------EKQ------------NI--TT--
A0A2V9QD92      QLVDLQMKVETSQEKLVKYQKDHQILG--ID------EKQ------------NI--TT--
A0A2V9WPZ6      QLVDLQMKVETSQEKLVKYQKQHEILG--ID------EKQ------------NI--TT--
A0A2V9ZLH4      QLVDLQMKVETSQQKLVKYQKEHSILG--ID------EKQ------------NI--IT--
A0A2V9RQF1      QLVDLQLKVETSQEKLVKYQKEHGILG--ID------EKQ------------NI--IT--
A0A2V9YDK8      QLVDLQMKVETSQEKLVKYQKQHEILG--ID------EKQ------------NI--TT--
A0A2V9V8F7      QLVDLQMKVETSQEKLVKYQKQHEILG--ID------EKQ------------NI--TT--
A0A2V9XGR9      QLVDLQMKVETSQEKLVKYQKQHEILG--ID------EKQ------------NI--TT--
A0A2V9V3Q5      QLVDLQMKVETSQEKLVRYQKEHEILG--ID------EKQ------------NI--IT--
A0A2V9NWS3      QLVDLQMKVETSQEKLVKYQKEHEILG--ID------EKQ------------NI--TT--
A0A2V9USA9      QLVDLQMKVETSQEKLVRYQKEHEILG--MD------EKQ------------NI--TT--
A0A2V9XW18      QLVDLQMKVETSQEKLVRYQKEHEILG--AD------EKQ------------NI--TM--
A0A1H5SQF5      QLSDLKNKVAESQRRVDDFRQKVGIIG--AP------TMSSAGSPQVGSDLGSV--EL--
A0A2V9AEW6      HLDEMKTQLEASEAQLQDYARITGLSF--TS-------EK-----E------SL--AE--
A0A2V8WQK6      HLGKMKGELEASEAQLQDYARASGLSL--TS-------EK-----E------NP--VV--
A0A2V8XIF4      HLDQMKAQLEASETQLQEYARTSGLSI--TA-------EK-----E------NP--AE--
A0A2V2R0I6      QLSELKVKVQKSEDARIAYERQNQIWT--LD-------DK-----Q------NI--AT--
A0A2V8XAR9      QLSELKIKVQKSEDARIAYERQNQIWT--LD-------DK-----Q------NI--TT--
A0A2V8VZA0      QLGELKIRVQRSEDARIAYERQNQIWT--LD-------DK-----Q------NI--TT--
A0A1Q7CB82      QLGELKIRVQRSEDARIAYERQNQIWT--LD-------DK-----Q------NI--TT--
A0A2V8WIU1      QLGELKIRVQRSEDARIAYERQNQIWT--LD-------DK-----Q------NI--TT--
A0A1Q6Y9F5      QLGELKIRVQKSEDARIAYERQNQIWT--LD-------DK-----Q------NI--TT--
A0A2V9EVV8      QLGELKIRVQKSEDTRIAYERQNQIWT--LD-------DK-----Q------NI--TT--
A0A2V8YF91      QLSELKVKVQKSEDARIAYERQNQIWT--LD-------DK-----Q------NI--TT--
A0A2V8XZK2      QLNDFKIKVQRSEDARIAYERQNQIWT--LD-------DK-----Q------NM--TT--
A0A2V8ZTX6      QLRDFKIKVQKSEDARIAYERQNQIWT--LD-------DK-----Q------NM--TT--
A0A2V9BT79      QLRDFKIKVQKSEDARIAYERQNQIWT--LD-------DK-----Q------NM--TT--
A0A2V9YHT3      QLSELRMKVESSQEKLVKYEKDNDILG--ID-------EK-----Q------NI--IT--
A0A7C2XNI7      QLDELKIRVEKAEDARLAYERENRIWT--ID-------EK-----Q------NI--TT--
A0A1Q8B793      QLNELKIRVEKSEDARIAYERQNQIWT--ID-------DK-----Q------SI--TT--
A0A2V9BCA0      QLNELKIRVEKSEDARIAYERQNQIWT--ID-------DK-----Q------SI--TT--
A0A2V9BWU9      QLNELQFKVEKSEDARIAYERQNQIWN--ID-------EK-----Q------NI--TQ--
A0A2V9DKX2      QLRELQFKVEKSEDARIAYERQNQIWN--ID-------EK-----Q------NI--TQ--
A0A7C2YQY3      QLQELKAKMEKAHQSLVNYERENQIYA--IS-------EG-----Q------NV--TM--
A0A3E0NV31      QLAELENEIEDSQDQLLAFARSRDLDV--DG--------------E------SA--SS--
A0A3N5M5V0      QLQDMKGNVEKSEGDLYRYARENNILN--IN------DRG------------SI--VL--
A0A3N5XQP8      ELKELRVKVEQSERDLNDYARTKGIFT--TE-------GS-----Q------NE--VT--
A0A2Z5G7H4      QLSDLKKQAEALQARVIALQRQSGVVS--LG------VQDAQGRDQ------AY--SVIV
A0A2V9L5B5      KNAEIKAKLEKAEDELQAYAQANSIVY--I------------TEKQ------NM--AT--
A0A2V9LK56      RLDELKGKLEKSDNALQEYAKKNSILF--V------------DDRK------NL--AN--
A0A2V9L7I0      KIVEIKAKLEKAEDALQAYAEANSIVY--I------------TEKQ------NM--GN--
A0A522PPT0      RLVELKAKLKASEDALQAYAAKNSILF--IQ------NAV-NAQAQ------SM--AN--
A0A7C5V1G5      RLVELKAKLKKSEDALQEYAAKNSILF--IQ------NAV-NSQAE------SM--AN--
A0A2V9KCS3      QLEDQRINLEKSEDRLQGYARSSGLMF--TA-------EK-----D------NV--AE--
A0A372IT17      QMSGLKKQAEALQTKAIGLQSEAGM-------------YG-DNGSH------DV--VL--
A0A4R1LC91      QLADLRKQSEDLQARVVELQKKAGIVT--LG------DDG-TGRTP------AY--SSVL
A0A3M2BZG9      QIEELSREIEKLRTKLASSAAEANLVL--DP-------------DG------EA--II--
A0A1Q7N5R7      QLQAAEAGMHRAESALEAFRVRTITLP--GD------PGV-AAAGA------PP--RG--
A0A2V9QB26      QLEDMRIKLEHSEDALQSYARSTGLIF--TS-------EK-----T------KI--SE--
A0A2V9VYY4      ELADLQLKVQTSEEKLVRYQKDHGILG--VD-------EK-----Q------NI--VT--
A0A3E0PHB0      SIEKLKKTIEDGEQNYIGALRESNLPV--GD------GKG-----A------EL--SA--
A0A3M1SIV3      SIDQLQENIAELENQRIAQMRESGLPL--AE-------KG-----Q------EL--TA--
A0A3M2D491      SIEELKENIAQLEQQRIEEMKSSGLPL--AE-------KG-----Q------EL--AA--
A0A353C9L6      SIEELQNTIAQQEIDLIAEMRSSGLPL--QE-------RG-----Q------DL--SA--
A0A2V8RQV0      SIEELKLTIQDQESQLMAQMRESDLPL--LE-------KG-----Q------DL--AA--
A0A2V8SJH5      SIEELGKTISEQEADLISYMRSSGLPL--QE-------KG-----Q------DL--SA--
A0A357F267      SIDELRETIAQQEIELIEYMRSSGLPL--QE-------KG-----Q------DL--AA--
A0A7C5ZUA8      SIEELNKTIAAQELELIDEMRKSNLPL--QE-------KG-----Q------DL--AA--
A0A136JPP4      SIADLKVTIADQENKLTEYMRSSNLPL--QE-------KG-----S------DL--AA--
A0A399WUJ8      SIADLKVTIADQENKLTEYMRSSNLPL--QE-------KG-----A------DL--AA--
A0A2V9KIE8      QLVGLKAKLEKSDDQLQAYAQEHSILF--IT-------EK-----Q------NL--VN--
A0A352F549      RIAELQSQIRSGEEQLVNYAQSHEILS--LD-------AS-----Q------NT--VV--
A0A3B9MLP9      RIGELQSQIRNGEEQLVNYAQSHEILS--LD-------AS-----Q------NT--VV--
A0A3D5SQ87      RIGELQSQIRNGEEQLVNYAQSHEILS--LD-------AS-----Q------NT--VV--
A0A2V8NW86      QLEDMRIKLEHSEDALQSYARSTGLIF--TS-------EK-----T------NI--SE--
A0A7C2GJ20      QLALLRERAEKAQEELVRYSRENEIVQ--LS-------EN-----Q------TI--TV--
A0A7C4BTL5      QLDEMRIKLEKSEDALQDYARKAGLVF--------------TGEKQ------NI--SE--
A0A2V8ZHL8      QLDELKAKVEKSQQALVDYERQNAIVN--IS-------DK-----E------SV--VE--
A0A2V9B240      QLDELKAKVEKSQQALVDYERQNLIVN--IS-------DK-----E------SV--VE--
A0A2V9CBM2      QLLSVKAKLEKSEDQLQAYARHNGLVF--LQ-------TD-NGTTQ------NI--AN--
A0A2V8XN17      QLVGVKAKLEKSEDELQSYARRNGLVF--LE-------TD-KGASQ------NV--AN--
A0A2V8WX45      QLVGVKAKLEKSEDELQTYARRNGLVF--LE-------TD-KGASQ------NV--AN--
A0A1Q6YR79      QLVGVKAKLEKSEDDLQSYARRNGLVF--LE-------TD-KGASQ------NV--AN--
A0A1Q7VA32      QLVGVKAKLEKSEDDLQSYARRNGLVF--LE-------TD-KGASQ------NV--AN--
A0A2V9EY85      QLVGVKAKLEKSEDELQGYARRNGLVF--LE-------TD-KGASQ------NV--AN--
A0A2V9H8K0      QLVGVKAKLEKSEDELQSYARHNGLVF--LE-------TD-KGASQ------SV--AN--
A0A2V9FFE5      QLVGVKAKLEKSEDALQGYARHNGLVF--LE-------TD-KGASQ------NV--AN--
A0A2V9GM43      QLVGVKAKLEKSEDALQSYARRNGLVF--LE-------TD-KGASQ------NV--AN--
A0A2V9CYQ5      QLLSEKAKLEKSEDQLQAYAHRNGLVF--LQ-------TD-NGTTQ------NI--AN--
A0A2V9BWU8      QLVGVKAKLEKSEEQLQDYARHNGLVF--LE-------ND-KGASQ------NV--AN--
A0A2V8ZG48      QLVGVKAKLEKSEEQLQDYAQRNGLVF--LE-------TD-KGTSE------NV--AN--
A0A2V8Y334      QLVGVKAKLEKSEEQLQDYARHNGLVF--LE-------TD-KGASE------NV--AN--
A0A2V9AY68      QLVGVKAKLEKSEEQLQDYARHNGLVF--LE-------SD-KGVSE------NV--AN--
A0A1F2RFI7      QLVGLKGRLEKSEEDMQRYAKDNAILF--LD-------EK-----Q------SL--TT--
A0A1F2RZS3      QLVGLKGKLEKSEEDLQRYAKENSILF--LD-------EK-----Q------SM--NA--
A0A1F2USE2      QLTGLKAKLEQSEEELQTYAHEQGLLF--LQ-------NQ-RGENE------NI--VN--
A0A7C2VB08      QLDGLKVKLERSEEELQRYARENGLLF--LE-------TS-EGQPE------HI--LD--
A0A2V9C238      QLLELKARLEKSENEMQSYARENGLLF--LE-------KE-KG-AE------NI--VN--
A0A1F2Q9F5      QLLEIKANLEKSEEQLQAYARQNGLLF--LE-------NE-AGQPE------NI--VN--
A0A1F2QQH9      QLLEIKANLEKSEEQLQAYARQNGLLF--LE-------NE-AGQPE------NI--VN--
A0A1F2QXK7      QLLEIKANLEKSEEQLQAYARQNGLLF--LE-------NE-AGQPE------NI--VN--
A0A2V9DEM9      QLLELKARLEKSENELQSYARENGLLF--LE-------RE-KGVPE------NI--VN--
A0A7C5TWV7      KLNPLRQQLEQSEQKLISFKEKEESFL---------VGDQDKN----------V--IT--
A0A2V7XDY0      RLGATQKSMREAQDRLFKSYQSQDL-F---------VPEGSTS----------A--VT--
A0A2V8G155      RLAEQRKVVEQAEARLQAYREEHDAIV---------PAEDRQN----------I--VV--
A0A2V8HDM7      RLAEQRKVVEQAEARLQAYREEHDAIV---------PAEDRQN----------I--VV--
A0A2V8DRT9      RMGEQRKTVDASERALQVYREQHDA-V---------SLEERQN----------I--VV--
A0A2V7VYF3      QLAEQRKKVEVSELAIQRFREDNDA-V---------SLEDRQN----------I--VV--
A0A1F2SVH2      RLAEQRKQVEASEQAVQRYREQTDS-V---------SLEEKQN----------I--VV--
A0A2V8AJG9      RLSEQRKQVEASEQALQRYREQTDS-V---------SLEDKQN----------I--VV--
A0A2N9LQU7      QMEELKLNAARAEQRLAEFQKQNNI-L---------GTDENNN----------I--VI--
A0A2P6WFK7      QMDDLQTRATQSQQRLSEFQMKNNM-I---------GADENDN----------I--TV--
A0A2V8U914      RIQELRSKLQTSEAALDEYTRESGL-V---------LAPGDDT----------L--AA--
A0A2V7W309      QIATVQANLEESRQDLLSYGKSKGI-I---------SVDEGSN----------V--TL--
A0A2W0BGU4      QLDELKAKVEKSQRALVEYERQNAI-L---------SIGEKQN----------V--VE--
A0A2W0BVQ9      QLDELKAKVEKSQRALVEYERQNAI-L---------SIGEKQN----------V--VQ--
A0A2V9MN96      ELSDLQLKVQASEEKLVRYEKQKGI-V---------GIDEKQN----------I--VT--
A0A2V7V2Z1      QIEEQKGKVEQAERALQQVKEQEGI-V---------NIEERRT----------L--LD--
A0A2V7X2F7      QIDQQRQKVEQATQELQKLKEREGI-V---------NIEERRT----------L--LA--
A0A2V7V2I1      QIEEQRHKVEQAELALQKLKEKDGI-V---------NIEERRT----------L--VE--
A0A2V7U3M2      QIEEQKAKVEAADLALQKVKEQEGI-V---------NIEERRT----------L--LE--
A0A2V7UHT0      QIEEQKTKVEEADRALQKVKEQEGI-V---------NIEERRT----------L--LD--
A0A2Z5FVL3      QLAEMKADSDALEQKAVKLQKQTGV-VQVAGSGDGDGQGQAYS----------S--TL--
A0A2V9KBD6      QLKELQARVEDSQQKLMEYQKQNGI-L---------GLDNQQN----------I--VT--
A0A2W0AJ66      QLTDLKAKVEESQQKLVDYQNRNGI-F---------GLDDKQN----------I--VT--
A0A1Q7RBU1      QLKELQAKVEESQQKLVDYQKENGI-F---------GLDDKQN----------I--VT--
A0A2V9JPV9      QLKELQAKVEESQQKVVDYTKEIGI-F---------GLGDKQN----------I--VT--
A0A3P0X3W6      QLDDLKANMDKSAEALTTYQRQLGV-I---------DPEQQTS----------I--LS--
A0A2N9MK30      QLEELRAKMERSDTALAQFEKELNV-I---------NPEEKTN----------I--LS--
A0A3D1ASD2      ELEELKAKMERSSDALAKFQRDLSV-V---------NPEEKTS----------I--LS--
A0A7C5AXI3      QLEELKAKMERSSAALAQFEKELNV-I---------NPEERTN----------I--LS--
A0A7C6E4H7      QLEELKAKMERSSAALAQFERELNV-I---------NPEEKTS----------I--LS--
A0A1F2TCR2      ELKKQQQKVTDSEAAMMQYREQKDA-------L---SLDSSQN----------T--VL--
A0A350UQT3      QIEELRVKMEDSSGRLAQMERELNV-------I---NPEEKTN----------I--LS--
A0A7C3HRX0      QIEELRAKMEASSERLARLEREMNV-------I---NPEEKTN----------I--LS--
A0A1F2V330      ELETLRSQLNEQEERLKIYKESAVN-------E---LPDRLAT-------------NL--
A0A662EE63      RLDPLRLQVEAGQRKLMSFQEGHDS-L-----G---FADEQKS----------V--IT--
A0A2V8TLH7      EIAPMREKLQDTQRSSFELAEKENL-------Y---VPENQQK----------I--TN--
A0A1Q7ZJT1      EIAPLKEKLEDTQRTSFEFAEKANL-------Y---VPENQQK----------I--TN--
A0A2V8VC99      EIAPLREKLKDSQQSTFEFAERANL-------Y---VPENQQK----------I--TN--
A0A348UZU3      QIAELKKEISQKEQELQNYGQEKDI-------V---ILSDKET----------T--ML--
Q01XL7          QMEEAKSRLQTAGEKLRDFVRQSGM-------D---FFPEQST----------L--AD--
A0A2V8ERZ5      ELDNQQKRVEGSEKGLAEYREKENA-------L---SLDDKQN----------I--VL--
A0A2V8GTX0      EVAKQQSVVQASERMLAEYRENQNA-------I---SLEDRQN----------I--IV--
A0A2V8J0X9      ELKRQEQQLAASEGALTEYRERNNA-------L---SLEDRQN----------I--VV--
A0A523DUV7      RLAAAEGDVKSSENSLYEYTKQQDL-------F---VPSGGQS----------I--AA--
A0A1F2U158      EVATQQSKVEQSERDLAEYRDRENA-------M---SLDEKNN----------I--VL--
A0A2V8F6S9      ELAKQLQKVQESERAMANYRERQNA-------L---SLDDKQN----------L--VG--
A0A7D8BEX2      QLNELKGQVQSDQEKLVDLESKLGLLA-----L---DPRNPAY----------L--NA--
A0A4Q1SCH5      QMDDLQKHAADAQQKLAKFQEDNNL-------V---GTDPTDN----------T--VI--
A0A372IRG7      QLSTLKSQVQSSQQELSDYQKKNNL-V-----G---LGPTGTS----------L--VT--
A0A2V8K4L4      QLDDLKIKLERSEDTLQSYALAVGLQFTASSKG---KDGDQEN----------V--AS--
A0A2V8NCZ3      QMDDLKIRLEKSEDTLQSYAVAVGLQFTGAA-S---KDGEQEN----------V--VS--
A0A4Q7YNP3      QAADIKLLAEESQHKLEAATGGNGL-------V---LSQESTT----------V--GE--
E8UZE1          QLETLRHQVDADQKNFEEFQERTGL-------L---QTGEGHN----------A--IV--
A0A2U3JZ71      QLEELKAKMERSSGALVQFERELNV-------I---SPEEKTS----------I--LS--
A0A2V8TTB0      QLEELRAKMEKSSAALAQFERELNV-------I---NPEEKTS----------I--LS--
A0A1V6HR88      QIETLKQEIQDKENQALAYSKRADI-------V---TLDTGGN----------V--VL--
A0A3E0P0A3      EISSLEAEIQELEADLVSYTQSSDI-------V---APNEETN----------V--TL--
A0A2V8EXP2      RLAEQRQKVEVSEQAVQRYREQTES-------V---AFEDRQN----------I--VV--
A0A2W4RYA1      RLAEQRKAVEEAEAALQRYREQNNA-------L---SLQDSQN----------I--VA--
G8P0Y7          QLADMQIKMETAQAKLVQYQKEHAI-------V---GTDDKQN----------L--TT--
A0A5M8T4U7      QLEDLKEQAADAQIRLANFQKQHNI-------V---GTDENSN----------L--TI--
A0A7L5A491      QIAELKKNMDNSAIALEAYQRRLGI-------I---NPDEKTS----------M--LA--
A0A7D8BF18      QLDDLKKQVEASQGNMIDLQKQLGV-L-----G---FDPNLNQ-------------VT--
A0A1E3Y9R6      QLEEQRRLVEESERRLQDYKEQNNA-------T---SVDDKQN----------I--IV--
A0A2W4TLP2      QLEEQRRLVEESERKLQQYKEQHNT-------V---SVDDKQN----------I--VV--
A0A7G8BDY8      QLDQLKSRVEESQVKLAKFQKETGI-F-----G---TDEN-DN----------L--VL--
A0A7C4BZ42      QLQDLKIKLEKSEDELQQYASAVGL-QLTASDS---KDGGKEN----------V--AE--
A0A3R9WF43      ELDDLKKQVRDSEQRLADYERTTGL-AGVQVSG---STSG-DGTSSVSVNSHNT--VL--
A0A317HKM4      QVEEQRKLLEASETALQAYRRDHGADALVRTNQ---LGEERQN----------I--VV--
A0A2V9CG11      KLDEMKAKLEQSEAQLQDYARTSGL-T-----F---TSEK-DN----------V--SD--
A0A523E0N1      EIGELRNDIQEKERLLRDYSRENQI-V-----I---AEDENNS----------I--VM--
A0A4R1LAZ7      QLTALKGQVEDSQKALAKFQRDNNL-I-----G---IDSEGGN----------L--VT--
A0A7G8BMP1      QLSALKKQVEDSQQQVAQYQRANNL-I-----G---LNADGQT----------L--VT--
A0A523ECP2      QVEKIQVEIQEREQRLQEYSQRQDL-M-----M---VDEK-EL----------L--VM--
A0A2W0C122      QLTELRATVEESQQKLVAYEREHNI-L-----M---VDDK-QN----------V--VT--
A0A2W0AUU7      QLNELRAKVEESQQKLVAYEREHNI-V-----M---VDEK-QN----------V--VT--
A0A2W0BQL1      QLNELRAKVEESQQKLVAYEREHNI-V-----M---VDEK-QN----------V--VT--
A0A4Q1SDL1      QLGDLRKQSEEEQEKLAALEKQTGI-Y-----S---FGTDNQGREQVYS----D--VL--
A0A3P0XH15      QLEPLKNQVTESQDALSTYQKQNNL-IGVDSNG---SGQD-------------L--TI--
A0A3M1WQW8      RLTELREKLEQLQEELVRYSREHEI-I-----Q---LDEN-QT----------I--AI--
A0A3N1JHC1      QLEGAKKKLQESGEALQEYARASGI-V-----L---TSETQEP----------V--AA--
C1F294          QIISLRESVNKSQNDLVQYQREHNL-L-----S---VGQQGSS----------L--VD--
A0A2V9KA79      RVEQLRKQMQEQQDRITRYKQATLS-ELPENLG---NNYKLLE----------T--IQ--
A0A522PSP1      QVKELSERMKESQLALNAFERENSI-I-----N---PENT-SG----------L--LT--
G8P085          EMDSLRERAAEAQKKLADFQEKNNI-LMLGGGS---SGSSKDGGGESPSPSAST--VT--
A0A7C6A629      QLEELKAKMERSSAALAQFERELNV-I-----N---PQEK-TS----------I--LS--
A0A4Q1SGQ1      QLKGLRAQTQALEDRASRLQRDTGI-Y-----G---DDAG-HN----------I--VL--
Q1ILD9          QLVELKTGIQSSEQQIADYQKTHKI-I-----G---TDEN-NN----------L--TL--
A0A7G8BJH7      QLDDLRKQTEDLQAKAITLQRDTGM-F-----G---DDES-HN----------V--VL--
A0A7C5SHM3      GIDEANAELREIEGQLEQATRTHDA-A-----L---VASD-RD----------M--RR--
Q1IJZ6          QIKDLNQQVEAAQQKLINYEKESGL-I-----A---ITATDPKNPAAAPVLHIP--AL--
A0A2V8TCE6      RVGELRDEVEDLEKRLQSYRESRRI-L-----P---SAGA-EN----------I--AL--
A0A522TBE8      QLDNLRAQTEQAQQNLVSYESRANI-L-----D---PDSK-DN----------I--MV--
Q1ITG0          RLTELKNNVEESQRKLAEYQSKANI-I-----G---TDET-DN----------L--AV--
A0A7C2ML20      QLAELESKVNKSKETLLRYHENVDL-V-----T---TGEGEEN----------P--AL--
A0A7C5AXS9      QLQELKIKLERAEDELQRYARTAGL-M-----F---TAEK-DN----------V--AE--
A0A7C2RGE3      QLTLLRDRAEKAQEELVRYSRENEI-V-----Q---LSEN-QT----------I--TV--
A0A3N5PCI5      QLAEQRRKVEVSELALQKYRERENS-L-----S---LEAG-QN----------I--VV--
A0A3M1Q0S9      QVRSLKEDINRRRLELHEYAMRHNI-V-----T---GDA--NE----------V--SL--
A0A2Z5G448      QLTELKAHAADAQRKIAQFQRANNL-I-----G---MDAEGGN----------L--VS--
A0A3M1VZ38      RVAELKREVSDLELALQDYAAQHQI-V-----L---GQG--ED----------V--TR--
A0A4Q1SD29      QLTSVKKQVEDAQQDLAKFQRENNL-V-----A---MDATGGD----------L--VT--
A0A6N9FGE2      RIAEQRQKLEASERALQTYREEHGA-A-----G---IADR-QN----------I--IV--
A0A3M1PY35      RIEDAQAELLELERRLAEERRRLGP-V-----L---ARGS-DE----------M--GS--
A0A3M1VMP2      AIQEAQAEVLELEAKLAQARRQAPP-T-----V---PERE-DE----------P--GS--
                                                                            

A0A2V7VMF7      SSIGKLNEDYVAAQARRIGIEAALKQFAEMRKA-----RKNLDTIPQVATDPVV------
A0A2V7YYV7      GELKDIQTSHLQVPNSRL------------------------------------------
A0A2V7Z0J5      KEVNQIQQAETQSTNARS------------------------------------------
A0A2V7Z3M4      SEVKQIQQAETQSPNTRT------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      KRLQDVTNIISGLQAE--------------------------------------------
A0A2V8JK38      EKLRQLQEEYTRAQAERIQKQSYERMVR----T------GSADALPQITGSSLI------
A0A2V9IXG5      EMVSRYRADYEDAKAKREEEEQKLAKLETYIAD-----SSKLTNIPELVSSPSF------
A0A2V9J2P4      EMVSRYRADYEDAKAKREEEEQKLAKLETYIAD-----SSKLTNIPELVSSPSF------
A0A1Q7RLS4      DRLSTLQSELTEAQVKKGEIEGLLKQID-----------ANRQNGGAYENIPQISGDTV-
A0A2V2R525      ERLNSLNRSLLTAENDRTLAEAAYRAAL----E------PGAAEALAASNQ---------
A0A321LPW6      DKLSRLHDQVMRAETDRLLKGSLYEELN----M------GRLDRLSEAFSDPKI------
A0A2V9R9V4      EKLSRLHDLATRAETDRILKESLYEQVR----Q------GRVAQIPEAFADTKT------
A0A321LE75      NKLAQLYTQVTTAEVQRKLKESLYQQVK----G------GNIDVATEAFTDSKL------
A0A2V8R8U7      VRDATYSSQLLAAENERRTFLAIYEAAKN---A------PDPFANPEVQKDERI------
A0A2V8QMP4      LQLSTYSSQMQTAEAA-------YTSAEQTKNT------SGIWAIPQVQSNPTV------
A0A2V8R4S3      LQLSTYSSQMQTAEAARKQAEADYKSAVETRNT------SGIWAVPQVQSNPSV------
A0A2V8NJ55      VRVGSYSSQLIEAENKRKQAQATYDAARN---S------SDPWSIPEIQDDKSV------
A0A2V8Q7I0      QRLADLTKQLFESENKRKNAEAVYKSAST---A------TDKFSIPEVQKSGRV------
A0A2V8S6K4      ERVAMLSTEWLNAQNEVTKLQSEYDAAQKAQAA------SDIFSIPKVQDNKQI------
A0A317I2L9      QRLNSLSGQLLDAENQRKTAQAIYNSAKN---A------SDPFTVPEVIKSTRI------
A0A2V8LLF9      MRLQTYSAQLLAAEDNRRSQEAIYDAARD---A------NDPFNAPEIQSDQRI------
A0A352FRF4      QRVSTYSSQLLEAENQKRSLQSAYEAAKT---S------PDPFANPEVQKDERI------
A0A2V8MKV0      QREQTYNKQLLDAQNEYRKLKADYDEAKA---S------TELLSNPEVQKNESV------
A0A2V8PYY8      QSEQAYNKQLHDAENERRKLKADYEEAKG---A------ADLISNPEVQKNESV------
A0A1Q7YKQ8      DRLAQLSKQLLEAENNRKNLQSLYEAAAH---Q------SNPMAVPDVADSKRI------
A0A352F3R7      ARLSTLSSQLLQAENDRKLIQAQLEAARR---E------KDPFSIPDVNASARV------
A0A0B6WXT1      ERLATLSGQLLEAENERKNLQSAYEAAQR---E------TDIWSVPEVQSDQRI------
A0A3B9MEU8      ARLATLSGQLLQAENDRKMIQAQLEAARK---E------PDPFSVPDVNSSARV------
A0A2V8MHG6      DRLAGLNKQLLEAENERKAAEAAYRATL----A------PGALEAQAEATNN-SS-----
A0A2V8P7N1      DRLAGLNKQLLEAENERKAAEAAYRAVL----A------PGALEAQAEATSNKSS-----
A0A2V8M3M6      DRLAGLNKQLLEAENERKAAEAAYRAVL----A------PGALEAQAEATSNKSS-----
A0A1Q7NJH5      DRLAGLNKQLLEAENDRKAAEAAYRAVL----A------PGALEAQAEATSNKSS-----
A0A2V8PJY0      DRLAGLNKQLLEAENDRKAAEAAYRAVL----A------PGALEAQAEATSNKSS-----
A0A1Q7Y6W9      ERLAGLNRQLLEAENQRKLAQAVYEASL----Q------PGASEARAEDANK-QI-----
A0A2V8NC68      DRLVGLNRQLLEAENDRKMAEASYRAAL----R------PDAASAMVE--AK-SS-----
A0A399WK13      DRLSGLNKAMLEAENARKNAEANYFEIAK---S------PERLSAMAEAEMARFITEQQN
A0A352FLX4      ERLEGLSKQLLIAENERKMAESAYKASL----Q------PGAAEALAEGGINEKDVPSAT
A0A2V8RTL7      DRLSGLNKQLLEAENARKLAEAKYFAIKD---S------PESLNALAEQDSQRYITEREN
A0A3E0PCJ6      QRLMGLNEQLLEAEEQRKNAEAQFNAVRD---S------PSRLSALAEEQMARYITEREN
A0A3M1S4R8      DRLAGLNKQLLEAENIRKIAEAEYMAVKD---S------PEKLRALAEEKLQRFITEREN
A0A7C2G442      DRLAGLNKQLLEAENIRKIAEAEYMAIKD---S------PEKLRALAEEKLQRFITEREN
A0A1Q7YFI6      ERLAGLNRQLLEAENERKLAEAAYRAAQ----A------PGAAEALARENRN--------
A0A136KC10      DRLSGLNKSMLEAENARKNAEANYFEVAK---S------PERLAAMAEAEMARFITEQQN
A0A3M2D6Y5      DRLAGLNRQLLEAENARKIAEAEYNAVKD---S------PDRLKALVEEKLQRYITEREN
A0A2V8SEX6      ERLAGLNKNLLEAENKRKNAEAQYVAIKD---S------PEAINALAEQDNQRIIQDRKL
A0A7C5ZUU4      DRLSGLNRDLLEAENARKLAEAKYNSVLS---S------PDNARALTEERMARYITEQEN
A0A0B6WWQ6      ERLAGLNRQLLDAENERKLAEAAYLASL----E------PGAAEAMVEKEDGIS------
A0A3B9MK99      ERLGGLNKQLLEAENARIEAESKFNAAK----V------GGAATALAEVDAKQV------
A0A352EX26      ERLAGLNKQLLEAENERKTAEAAFNAAK----A------PGAASALAEGDNKQA------
A0A2V8MM59      ERLSGLNKQLLEAENDRKLAEAEYNAAK----A------PGAANALAEAGAKDI------
A0A2V8PFE8      ERLAGLNKQLLEAENDRKMAEAEYNAAK----A------PGAATALAE-GAKDI------
A0A2V8PWS6      ERLAGLNKQLLEAENDRKMAEAEYNAAK----T------PGAATALAEAGAKDI------
A0A2V8LCT5      ERLAGLNKQLLEAENDRKMAEAEFNAAK----A------PGAASALAEAG-KDI------
A0A352FTJ9      ERLAGLNKQLLEAENDRKMAEAEFNAAK----A------PGAASALAEAGAKEI------
A0A257VBK0      TKIASINERLTQVGVKESEVAAIASQLE----AWRTSG-GDPLSIPAVAQDPSV------
A0A2G6PYV5      QALVKLNEEIAVANRSFIEKRNNLQALQ----A------STPSQAIEV-NQNVA------
A0A2V8F956      QKLTELTGAVTQAKTERFQREALYRQVE----S-LRGNPAMLDTFPAI-LANTF------
A0A1F2S1W5      QRLADLNAAVTKANTVRIQKEATYNQVK----A-VLENPAAIDTVPAI-LSNAF------
A0A1F2T595      QKLQELNAAVTRANTARIQKEAVYNQVR----T-VLEDPAAMDTVPAI-LSNTF------
A0A2V8JQV5      EKLHHLEADLSEALADRVEKQSKYEIAK----S------APVESLPQI-LDDGT------
A0A2V9AC41      DRLLDLNRSLTKAEAERIGLEAQMHSIH----G------RNYDEVPLV-RDSLV------
A0A2V9MAM9      NRLHLIESELSKAQADRIAKTPAYQLAD----K----------EHPELLVDNAV------
A0A348V070      QKITEVNTALTAATLDRVNKFSAYNQLK----A------LRPEELPES-PSNPA------
A0A2V9M454      ARFEDMSKELSQAQSDRISKESLYKMVV----S--------NEAQVGFIQTNSL------
A0A2V9IVR7      KKLGDLSKELTDAQAEVVRAESLYNVAR----N--------NENQMASLVGNDL------
A0A2V9ILE2      KKLGDLSKELTDAQAEVVRAESLYNVAR----N--------NENQMASLVGNDL------
A0A2V9LGY4      KKLGDLSKELTDAQAEVVRAESLYNVAR----N--------NENQMASLVGNDL------
A0A2V9J4D6      QRLSELSSDLTRAQSDRAEKESLHQLVK----S--------NEAQIALLAQDHL------
A0A2V9L9C5      QRLSELSSDLTRAQSDRAEKESLHQLVK----S--------NEAQIALLAQDHL------
A0A2N9M9N1      QRLAQLSTDLTAAQVERANKQSVYDSAR----H--------NNAEAAVLAEDAL------
A0A2V9JEC4      LRLEDLSKDLTTAQTDRAQKESLWESVQ----E--------DNSLAEVASNDAL------
A0A2V9LPQ3      QRLSDLSRDLTTAESDRAQKESLYQMVK----S--------NPEQIAMLAQNDL------
A0A2Z5G3A3      NRLELATTALSGAESNRILTGAVEQIVK----T------GDPELISGLAGSPML------
A0A2V7UGP8      QKLGQLNQDVLEAQVESSRKEARYRGLL----T------TPPGSIKEV-TQSNL------
A0A239MKT6      QRLSALNEELTRAEVARIQREALYHIIQ----T------NDVDLVLNSASSLGA------
A0A3E0PCN7      QRLSDLNGKLNQAEMERINAEAALSAAQ----Q------DPMRGVTVASKDART------
A0A2V8IYW3      IQLQSLSESLNRDRDRRLVLERGLADMR----A------DPATAAATADPSDRT------
G2LEI9          ARLTGLNQALLEAEKERLRAEERYQASL----T------QPIDSLDEM-QSDPE------
A0A317J121      SKLRQLQGELSAIQADRIAKQAKYELVA----K------TSPEALPGV-LEDIN------
A0A2V7YW66      KRLEVLNGSLMEAKRVRIEKEAKYHETI----T------GPKENVADS-LSGGM------
A0A2V7Z0V0      KRLEALNTQYIEAKKMRIEREAQYHETQ----S------GPRESMSDS-LTTGV------
A0A2V8GFD4      QRLEDLNGAVTKAHTERLQKQALFEQLQ----AARGDA-AALDRFPTV-LSNGF------
A0A2V8HSS5      QRLEDLNGAVTKAHTERLQKQALFEQLQ----AARGDA-AALDRFPTV-LSNGF------
A0A2V8KP55      EKLRQLQEEYTRAQAERIQKQSYERMVR----T------GSADALPQI-TGSSL------
A0A399WNU1      QRLSDLNTKLSQAENDRITAEAAYKAAL----N------NPLAGTTAQAKDART------
A0A2V9JSI3      QRLAQLSNDYTNAQNVRLDKESLFELAS----S--------NEAEAAVLMQSEV------
A0A2V9WI32      SKLDELNKELTAAEGDRIQKESAYKLAS----A------GNPEIFAKA-EPSSL------
A0A2V8IVN9      QKLSDLNSAVTQAKTERLQKEALYSQLN----SLRSGRGAALDTFPAI-LSNTF------
A0A7C5Z4J3      QRLADLSQDLTAAQNDLAQEESLYLLVK----S-------NPEKVGML-AQDRL------
A0A1F2TPT3      ARLNELSASITRAQTGLFDKEASYNRAL----ALRA--NPDKLDQLPQMLNNAA------
A0A2V8JTQ2      TKLTDLNRELTAAEVDRVQKDVNYQLAR----S------GQPDLVARL-EPDNL------
A0A2V8UZY0      AKLDDLNRGLTAAEADRIQKEVNYRLAV----S------GRPELIAKL-EPDNL------
A0A350UEK1      EKLKQIQDQLTAVQGDRVSKQSRWEMAS----S------APAETLPDV-LNDTL------
A0A350UIQ4      VKLKQIQDQLTAVQGDRVSKQSRWEMAS----S------APAASLPDV-LNDSS------
A0A1H5Z7N3      TSLEDLNRAVGQAQISRIMAEVRYHTLS----G------MDPNQIDDSVASTQVGSSGNL
A0A1G7JVV8      AAVEALSTAAIAAKVQRILAESRYRVLA----S------SDPALMESNL---Q----AS-
A0A1H4T6W9      VSVDALSTASVGAKVQRILAESRYRVLA----N------SDPDLLESNL---D----VA-
I3ZEU5          VSVDALSTASVSAKVQRILAESRYRVLA----S------SDPDLLESNL---D----VA-
A0A7L5A6M5      AAIEDLQKAAGVARLQRIVSEARYRLLA----G------MDPDAMEGSI---D----IPM
A0A428MDU2      TSLEDLSKAAGDARIARIVAESRYRMLA----G------MDPNTMEGSI---E----TT-
A0A5B9EBI2      SLIDSLTKAAGDARINRIIAESRYRALA----Q------ADPASMEGLI---D----AT-
A0A239HDF6      TSLDDLAKASGQAKLARIIAESRYRMLS----G------MEPDAIEGSI---D----AG-
A0A4Q0T270      SSLEDLSKASGTAKIARIVAESRYRMLS----G------MDPDSIDNSI---E----TT-
A0A1Q3QQB6      SSLEDLSKAAGEAKIARIIAESRYRVLS----G------MDPDSVESSI---D----AA-
A0A3N1K1G7      SSLEDLSKAAGEARIARIIAESRYRILS----G------MDPNTIEGSI---E----TT-
A0A4V2G466      ASLEQLSTASNDAHIVRIMAESRYRMLS----G------MDPNTIEGSL---E----AS-
A0A6B9YNQ8      SSLEQLSTASNQARIARIMAESQYRMLS----T------MDPNSIEGAV---S----TG-
A0A7G8BSK5      ASLEQLSTAANEARIARIMAESRYRMLS----G------MDPNSIEGSI---E----IT-
A0A1I6MH75      STLEDLSKASGAAHIARILAESRYRMLS----G------MDPGTIDGTI---D----MN-
E8WVF6          SSLEDLAKASGTAKLARIIAESRYRMLN----G------MDPNAIEGSI---DAGTTAT-
A0A3N5YNR8      QTLEDLNRQMTTVEGELIGKTADYQAVR----D------ATPENFPQS-LRTPS------
A0A3N6A5T6      QKLADLNQEMTKVEAQMIERSAEFDAVK----N------ATVQDFPDALVTDN-------
A0A1F2Q9L4      QRLEGLNKDYVGAMSERIGKEAHYKELA----N------TPDDMVADT-VSGGL------
A0A2U3KC61      AKLNELNNELTVAQTDRIQKESNYNLAM----A------GDPAEFAKPSREGT-------
A0A2V9Y2R7      AKLDELNKELTEAQTDRIQKEANYKSAM----V------GDPTAFAKIQAGGT-------
A0A2V9NGH6      AKLDELNRELTTAESGRMEKESIYGLVQ----A------TDSDAAAAAAISADH------
A0A2V9PYE6      AKLDELNKELTAAESGRMEKESIYGLVQ----A------TDSDAAAAAATSADH------
A0A2V9NL07      AKLDELNKELTAAESARMEKESVFRLSD----S------VDTESAAAVANSGSA------
A0A2V9QD92      AKLDELNKELTAAESARMEKESVFRLSD----S------VDTESAAAVANSGSA------
A0A2V9WPZ6      AKLDELNKELTAAESERMEKESVYRLIQ----S------GDPDVVASVPVGGDS------
A0A2V9ZLH4      EKLDELNKELTAAESDRMQRESLYRLTR----S------GDPDVIATATATGGT------
A0A2V9RQF1      SKLDELNKELTAAESDRMQKESVYRLVQ----S------GDPDTAASAALSAAG------
A0A2V9YDK8      AKLDELNKELTSAESERMEKESVYRLIQ----S------GDPDVIASTTSVAGS------
A0A2V9V8F7      AKLDELNKELTAAESGRMEKESVYRLIQ----S------GDPDVVASAPVGGDS------
A0A2V9XGR9      AKLDELNKELTAAESGRMEKESVYRLIQ----S------GDPDVVASAPVGGDS------
A0A2V9V3Q5      QKLDELNKELTSAESERMEKEAIYRMTQ----T------GDPDAVASAVTSAPV------
A0A2V9NWS3      SKLDELNKELTSAESDRMAKESFYTLVQ----A------ADADTAAAAALSSAT------
A0A2V9USA9      AKLDELNKELTSAESERMDKEAFYRLVE----S------GDPDAIASSAGGIET------
A0A2V9XW18      AKLDELNKELTAAESERMDKEALYRLVD----S------GDPDAILSSANALEE------
A0A1H5SQF5      ARLNDLNAQLTAAETVRIAAEAAYRMTQ----S------RDADVVLGI-DSSQLNGAPGA
A0A2V9AEW6      ARLKEIQDELSKAQADRIANQAKYAEAA----G------KSADSLPEI-LEDPT------
A0A2V8WQK6      NRLKELQDELSKAQADRIAKQAKSEEAR----S------KPADSVPEM-LEDPT------
A0A2V8XIF4      NRLKELLDELSKAEADRIAKQAKFEEAQ----S------KPADSLPEM-LEDPT------
A0A2V2R0I6      QRLGDVNRELTQAQSERMKREALFEFAK----A------GNLDAVPQM-QNNSF------
A0A2V8XAR9      QRLSDINKQLTDAQSERMKKESLYEFAK----S------GNLDAVPQV-QSDAG------
A0A2V8VZA0      QRLSDINKQLTDAQSERMKKESLYQFAK----A------GNLDAVPEV-QNNSA------
A0A1Q7CB82      QRLSDINKQLTDAQSERMKKESLYQFAK----A------GNLDAVPEV-QNNSA------
A0A2V8WIU1      QRLSDINKQLTDAQSERMKKESLYQFAK----A------GNLDAVPEV-QNNSA------
A0A1Q6Y9F5      QRLSDINKQLTDAQSERMKKESLYQFAK----A------GNLDAVPEV-QNNSA------
A0A2V9EVV8      QRLSDINKQLTDAQSERLKKESLYQFAK----A------GNLDAVPEV-QNNSA------
A0A2V8YF91      QRLSDINRQLTEAQSERMKKESLYQFAK----S------GNLDAVPQV-QTNTA------
A0A2V8XZK2      QRLGDINRQFTDAQSERMKKESLYEFAK----A------GDLDAVPQV-QSNAA------
A0A2V8ZTX6      QRLSDINKQFTDAQAERMRKESLYEFAK----A------GNLDAVPQV-ESNTA------
A0A2V9BT79      QRLSDINKQYTDAQAERMKKESLYEFAK----A------GNLDAVPQL-DSNSA------
A0A2V9YHT3      AKLNDLNKAYTDATNDRIHKQATYRLTL----N------SSPELLSQA-DPNTL------
A0A7C2XNI7      QKLADLNTELTQAQADRMRKEASYRLAR----E------GNVDGLPEV-RESQV------
A0A1Q8B793      QRLGEINKELTEAQSDRMKKEALYQLAQ----S------GSLDALPAV-RDSEL------
A0A2V9BCA0      QRLGEINKELTEAQSDRMKKEALYQLAQ----S------GSLDALPAV-RDSEL------
A0A2V9BWU9      QKLSDLNKELTQAQGERMRSEALYQLVG----T------GHIDALPPV-RDSLL------
A0A2V9DKX2      QKLSDLNKELTQAQGERMRSEALYQLVG----T------GHIDALPPV-RDSLL------
A0A7C2YQY3      QKLGQLNHELTLAQSERIARESQFQQVK----S------RRLDDLSAI-SSSPY------
A0A3E0NV31      RRVGDLARLQTEAEAEAARLRSYVDTLR----A------GRTEGVPDT-AKTQE------
A0A3N5M5V0      QTLEDLNRQMTTVEGELIGKTAEFQAVR----D------ATPEDFPQS-LRTPS------
A0A3N5XQP8      QKLNDLNTEITRAQANLIAEQSQYDQAR----A------ASATRVPTN-LRSSV------
A0A2Z5G7H4      DRLQQATATLSQATSNRILKGAVYKIVQ----S------GNAELISGL-SANGI------
A0A2V9L5B5      ARLEELLEAYTKAQSERFEKQSLYSLVE----A------GKIQDLPGV-LSNRL------
A0A2V9LK56      ERLGQLQQEYTKAQADRFQTESLYNLVK----P------DAAKDVPGT-LSNKL------
A0A2V9L7I0      ARLEELLQEYTKAQAQRFEKQSLYSLVE----A------GKVQDLPAV-LSNRL------
A0A522PPT0      ARLEQLEEEYTRAQADRAQKEAQYSLVH----T------GKVQDLPGV-LDNRL------
A0A7C5V1G5      ARLDQLVQEYTKAQADRAQKEALYSLVQ----E------GKVQDLPGV-LSNNL------
A0A2V9KCS3      ARLRQLQEELSKAQGDRVAKQSRYEVAL----S------SSLEALPEV-LDDAS------
A0A372IT17      AQLENLNQALSQAELNRILKEAIDHTAQ----S------GDPELISGLTASAGA------
A0A4R1LC91      DRLEQATTALTQAQSSRIEKGALYQAIK----S------GNGELISGL-VGNSI-----T
A0A3M2BZG9      ERKKSLETTLNRAVIDRLDKQAIW---------------DELRNLTDAEVANSL------
A0A1Q7N5R7      SPLGEFFSLRIEQDQMRRDADALEHVLI----SMRD--PGALADALAPIGAVQR------
A0A2V9QB26      EKLQQLQGELSKTQTDRITAQSRWEITA----A------SPPDALPDF-LNDSA------
A0A2V9VYY4      EKLGELNKELTEAETDRIQKEADYKLAM----NGDP--EMFMKTSPDGRGGSGL------
A0A3E0PHB0      SRLSTVSSQYLTAIDERRKLEAEYSAAV----QAKN--PYALSD-----ASGGVLASQLR
A0A3M1SIV3      GILRSKSEEWLKAEADRRKLEQMYEAAL----QAAN--RGEIFSIVSRETPNSEFISTLR
A0A3M2D491      SILEQKSTEWLKAEAERRAIEQQYRTAV----EVAK--KGEILSVAS---DNKFIITARE
A0A353C9L6      SRLSSLSETWLKAMESRRQLEGRYNAAL----TANS--RGEGMNIPDL-YENKIFQDTIR
A0A2V8RQV0      QRLGAMSEAYMKAMETRRQLEATLNAAE----SANA--RGEAVNIPSI-GENKIFQDTMR
A0A2V8SJH5      ARLQSMSETWLKAMEGRRQLEARYTAAA----QAGA--RGEGMNIPDL-SESKIFQDTIR
A0A357F267      TRLGSMSETWLRALEARRQLESRYNAAV----SARA--RGEGMNLPDL-YENKIFQDTMR
A0A7C5ZUA8      SRLAALSETWLKAMEARRQLESRYNAAV----AANA--RGEGASIPEI-TESKIYQDAVR
A0A136JPP4      SRLQTLSEQWLSAADDRRKLEARYNGAV----QASS--RGEGRNIPDL-YENKVYQDTVR
A0A399WUJ8      SRLQTLSEQWLSAADDRRKLEARYNGAV----TASS--RGQGQNIPDL-YENKVYQDTVR
A0A2V9KIE8      DRLQQLEQEYTKAQAARFHAEASYTLVK----S------TKNMDLPSV-LSDKF------
A0A352F549      ERLAGLNKELLEAENDRGLAEAAFRTSK----L------PGATEASAE-VSDKQ------
A0A3B9MLP9      ERLAGLNKELLVAENERSLAEAAYRASL----A------PGVTEANAE-TSDKQ------
A0A3D5SQ87      ERLAGLNKELLVAENGRSLAEAAYRASL----A------PGVTEANAE-TSDKQ------
A0A2V8NW86      EKLRQLQGELSKTQADRITAQSRWQGTT----T------SPPDALPDV-LNDSS------
A0A7C2GJ20      ERLADLNRRLIEAETDRIRAETLYRLSR----E------GEVEALPPV-LADPQ------
A0A7C4BTL5      EKLRQLQTALAAAQMDRVAKQSRYEMAK----N------SPPETLPDV-LNDPT------
A0A2V8ZHL8      QRLADLSRDLTNAQSDRVQKESLYELVK----S------NE-SQVAFV-AQNDL------
A0A2V9B240      QRLADLSRDLTNAEGDRVQKESLYELVR----S------NE-SQVAFV-AQNEI------
A0A2V9CBM2      ERLQQLQQELTKAQAELYEKESLYRLVQ----T------SDYGSLPGV-FENRM------
A0A2V8XN17      ERLQQLQEQLTKAQSERYEKEALYRLVQ----T------GELGALPGV-FENKL------
A0A2V8WX45      ERLQQLQEQLTKAQAERYEKEALYRLVQ----T------GEYESLPGV-FENKL------
A0A1Q6YR79      ERLQQLQEQLTRAQSERYEKEALYRLVQ----T------GEFGALPGV-FENKL------
A0A1Q7VA32      ERLQQLQEQLTRAQSERYEKEALYRLVQ----T------GEFGALPGV-FENKL------
A0A2V9EY85      ERLQQLQEQLTKAQSERYEKEALYRLVQ----N------GEFGALPGV-FENKL------
A0A2V9H8K0      ERLQQLQEQLTKTQAERYEKEALYRLVQ----A------GESGALPGV-FENKL------
A0A2V9FFE5      ERLQQLQEQLTKAQSERYEKEALYRLVQ----T------GESGALPGV-FENKL------
A0A2V9GM43      ERLRQLQEQLTKAQSERYEKEALYRLVQ----T------GESGALPGV-FENKL------
A0A2V9CYQ5      ERLQQLQQELTKAQAELYEKEALHRLVQ----T------SDYGSLPGV-FENRM------
A0A2V9BWU8      ERLQALQEELTKAQADGYQKESVYRLVQ----S------GNYGSLPGV-VENKL------
A0A2V8ZG48      ERLQQLQEELTKTQAERYEKEAVYRLVQ----A------GDYGSLPGV-VENKL------
A0A2V8Y334      ERLQQLQEELTKAQTERYQKEALYRLVQ----A------GDYGSLPGV-VENKL------
A0A2V9AY68      ERLQQLQQELTKAQAQRYEKESVYRLVQ----A------GDYESLPGV-VENKL------
A0A1F2RFI7      EKLKQLQEEATRAQADLFQKESLYNQVR----T------GDLSSVPGI-LENKL------
A0A1F2RZS3      QKLQQLQEEATRAQSDLIQKESLYNQIR----D------GDFSSVPGI-LENKL------
A0A1F2USE2      QRLRQLQEQLTQAEADRYQKEALYQLLA----Q------GDYASLPGI-HDNTV------
A0A7C2VB08      ERLRQLQEELTRAQAERFERESRYRLVE----A------GHFSALPG--GESKV------
A0A2V9C238      ERLRQLQEELTRAQAARYEKESLYRLVQ----A------ADYASLPGM-AENKL------
A0A1F2Q9F5      ERLLQLQAELTRAQAERIAKESLYRLTQ----A------GEYGALPGI-FENKL------
A0A1F2QQH9      ERLLQLQAELTRAQAERIAKESLYRLTQ----A------GEYGALPGI-FENKL------
A0A1F2QXK7      ERLLQLQAELTRAQAERIAKESLYRLTQ----A------GEYGALPGI-FENKL------
A0A2V9DEM9      ERLRQLQEELTRAQAARYEKESLYRLVQ----A------ADYASLPGM-AENKL------
A0A7C5TWV7      EQVNTLTTEYAKAKAERIKLETKIAALQ----G------VDVTSLSRA-TLPDVLQDPT-
A0A2V7XDY0      SSITKLTADLIEAQARRIGLEAALKQIA----Q------LKAANQPLD-AVPQFAADPT-
A0A2V8G155      QRLADLNTALTRAKTERIQKQAAYDQIR----N------ARDVPGSVD-TFPLILTNGF-
A0A2V8HDM7      QKLADLNTALTRAKTERIQKQSAYDQIR----N------ARDVPGSVD-TFPLILTNSF-
A0A2V8DRT9      QKLADLNAAVTRAKTERIQKESAYEQIK----A------VQSDREALD-TIPAILSNVF-
A0A2V7VYF3      QKLADLNGAVTSAKNERITKEAGYNRLR----T------MADDRSALD-AFPAILSNSF-
A0A1F2SVH2      QKLSELNAAVTRAKTERIEKEAAYNQIR----T------VQNDRATLD-TIPAILSNGF-
A0A2V8AJG9      QKLADLNAAVTRAKTERIQKEAAHNQLR----G------LQHDRNALD-TFPAILSNTF-
A0A2N9LQU7      DRLRHLNSQLADAEGDRIIKEARYRLAS-----------T----GNPE-LVAAVVPSTT-
A0A2P6WFK7      DRLKLLNQQLTEAEADRIVKEARHRLAA-----------T----RNPE-LLGTVDPN---
A0A2V8U914      DKLRGVQDELSKAQSDLIAKQVQFDLIA------------------KN-PAEITTENPG-
A0A2V7W309      QKLGKLNTDVTSAQGDMYDKQARYNSIQ-----------S----TAPE-TVAQ--QDAT-
A0A2W0BGU4      QRLGEISTNFTQSQNDRIQKEALYNQVQ----------------TNPD-QVPAIANNEV-
A0A2W0BVQ9      QRLGEISTNFTQSQNDRIQKEALYNQIQ----------------ANPD-QVPAIANNEV-
A0A2V9MN96      AKLDELNKELTGAQTDRMQKEANYGLAE-----------A----GDPS-GFAKLSADNL-
A0A2V7V2Z1      QKLKELGTSLTTLRTERLEREALYNQMR----G------A----ANPE-ELPEVMRSPL-
A0A2V7X2F7      QKLQQLGTALTETRTVRLEKEALYRQMR----G------A----DVPE-DLPEVRKDSV-
A0A2V7V2I1      QRLRELGTSLTALKTQRIEKEALYRQMK----E------A----PNSE-ELPEVMRNPL-
A0A2V7U3M2      QKLKELGTALTTLRTDRLEKEALYNQMR----N------A----ANPE-ELPDVMRSPL-
A0A2V7UHT0      QKLKELGTALTTLRTERLEKEALYRQMR----G------A----SNPE-ELPEVMRNPL-
A0A2Z5FVL3      DQLQKATAAVSQAHTNVILKGAIYEVVK-----------S----GDPE-TIMGLPSNTA-
A0A2V9KBD6      TKLADLNKELTASEADRVQKEVSYRLAR-----------S----GQPE-LLAKLEPGSL-
A0A2W0AJ66      AKLDDLNKELTAAEADRMQKEATYRLTP-----------S----SQPE-LIAKSEPDNL-
A0A1Q7RBU1      AKLDDLNRELTAAEAERVQKEVNYRLAS-----------S----GRPE-LIAKLEPDNL-
A0A2V9JPV9      AKLDDLNKELTSAEADRVQKEIDYRLAR-----------S----GEPE-LIAKLGPDNL-
A0A3P0X3W6      ARVAQLNSEYTEAENDRIRKQTAYQGVK-----------S----GNAS-AIDISTQAEQ-
A0A2N9MK30      ARLLQLNTDYTNAETERVKKEAAYKSVS-----------T----GSLE-SAQASTQGDA-
A0A3D1ASD2      ARLQQLNTEYTNAQTDRVRKEAGFNAMQ-----------S----GQME-AALISSQGQS-
A0A7C5AXI3      SRLLQLNTEYTNAQADRVRKESAYQSMQ-----------A----GSIE-AALVSSQGES-
A0A7C6E4H7      ARLLQLNTEYTNAQADRVRKEAAYNSVR-----------S----GSIE-AAQASPQGEG-
A0A1F2TCR2      PRLNSLNDSVTRARLARLQKGQVYEQVR----A------VKPDSDEAD-NLSIIATSPG-
A0A350UQT3      ARLLQLNTEYTRAQAERVAAEAGYEQTR----S------GSLES------AQVSGQGEA-
A0A7C3HRX0      ARLLQLNTEYTKAQAERVAAEAAYNSTR----N------GDMEA------AQVSGQGEQ-
A0A1F2V330      SLFAATQAQLRSSSGLKANDQARLAAVQ----Q------EITELEKEG-VLDAAPPKEK-
A0A662EE63      EQVDLLTKEYAQAKAERIDVETKLNALN----Q------LRARHVSEV-AFPEVLEDAT-
A0A2V8TLH7      DRLSALQADYTETQVKAAELESVLKRVD----E------VRQNGGSYE-VIPQISGDAV-
A0A1Q7ZJT1      DRLSTLQSELTEAQVKKGEIEGLLKQID----A------NRQNGGAYE-NIPQISGDTV-
A0A2V8VC99      DRLSTLQAGLTETQVKKGELEGLLKQID----S------VRLSHGSYE-NIQQISGDPV-
A0A348UZU3      DKISELNKALTEAQIERVRKESYYNGIK----N------ASPDF------IPEAMNNPL-
Q01XL7          SKMKVLQGDLAAIQADRIAKQARWEMAK----N------TPIDS------LPDVLSDPT-
A0A2V8ERZ5      SRLNQLNDAVTRARTERVQKESLYNQV-----K------AIANGTAPD-AIPAIATNAG-
A0A2V8GTX0      SRLNQVNDAASHARTNRIQKEALYNQV--------------AATKDRE-GLSQIASNPF-
A0A2V8J0X9      SRLNQLNDKVTTSRNERLSKEAIYNQLR----R------ADPSSDAID-NFPIVGTNSA-
A0A523DUV7      STMTRLNEEATEAKTRRIEIESALAQVD----K------LKQSGGALD-AMPQIAADPL-
A0A1F2U158      SRLNALNDAVLRARTTRIEKESVNNQIK----S------LGT-T-PVD-SIPAIAQNAQ-
A0A2V8F6S9      ARLNKLNDDAMMARSRKLQKELLYNQVK----A------MAAGQ-PLD-SVPAIAQNPT-
A0A7D8BEX2      GALATLSRASSDATLQRIVAEARYRYLN----E------SDPNL--IE-SEQAVLGGEQS
A0A4Q1SCH5      DRLKLINEQLTQAEGDRIVKEAQYRAAE----T------GDPAV------LAALMPDQN-
A0A372IRG7      DDLRTINDQLAEARADRIVKEARYRMAQ----T------RNPDL------LVSVSGGV--
A0A2V8K4L4      ASVRLVQEELLKARADRMIAQSKYELLA----S------SPPEA------LPQVLDDSS-
A0A2V8NCZ3      TSVRLLQEELLKARAERMVTQSRFELIQ----S------SPPEA------LPQVLDDPS-
A0A4Q7YNP3      DKLRELQAELVRAQADRIQKESQSEIAA----V------ALSTT------LPSVMDSPE-
E8UZE1          DRLSQLNSDLSKAQADRIMKEVTFRESM----V------SDADQ------IVPTTTFPG-
A0A2U3JZ71      ARLLQLNTEYTNAQADRVRKEAAYKSVA----G------GSLEA------AQVSTQGEA-
A0A2V8TTB0      ARLLQLNTEYTNAQGDRVKKEAAYNSIQ----S------GSLAA------AQVSSQGEA-
A0A1V6HR88      SRLQALNADYTRAVSERIGKGAALKELE----V------ATPQI------AAEILPDPV-
A0A3E0P0A3      QRLTAANSAFLEAQRRRIEAQAEYNELS----N------RPADD------LAETLSGGL-
A0A2V8EXP2      QKLADLNAAVTRAKTERIQKEATYNQMK----A------LQTERAGLD-TFPAILSNQF-
A0A2W4RYA1      QKLTDVNTEVTRARTERMRQESLYRQLQ----D------ALARSADLD-GFPAVLNNQL-
G8P0Y7          EKLDELNRELTSAQADRIQKESLYNVAK----R------GDPST------LSVILQDPI-
A0A5M8T4U7      QKLGQTSSDLESAEADRIMRESRMREFA----S------QDTDM------AALTGDNPQ-
A0A7L5A491      SRLLQLNTQYTDAANDRIRKEASYRALE----S------GSQAA------AIEVSTQAAD
A0A7D8BF18      NNLADLNKAANAAELSRIEAETRYKVIA----G------TDPSSTTQE--MDASRTSPA-
A0A1E3Y9R6      QKLNALNEQFVQARIARMNAEVQVNAMA----E------RRARGESLE-SFPPVLASPV-
A0A2W4TLP2      QKLNALNEQLVQARIERMNREVQVNAIR----E------LRASGESLE-TYPAIMNSPV-
A0A7G8BDY8      SKLDDLSKELTDAEADRIVKEAKYRVAQ----S------GNPEL------IGTIVPDSV-
A0A7C4BZ42      ERFRALQSELLKAQAERMAAQSKYEMAN----A------SPAEA------LPQVLDDAT-
A0A3R9WF43      DRLFTLNQEMTSAEANRISSEAVYHLVK----T------QNPEVVLGL-GSMSIASGNGS
A0A317HKM4      QKLGDLQAAVTRARADTIEKDAQIKQMS----A------LEADHKPLD-TLPAIAANPF-
A0A2V9CG11      ARLVELQSELTKAQAERIAKQAKFEQVK----S------TPVES------LPEMLDDPT-
A0A523E0N1      QRLETLNEQLAQAEVQRTAAEARYANLA----S------ADPFS------LSEVRTSGP-
A0A4R1LAZ7      DSLRTVNQQLAQAEADRIVKEARYRLAQ----T------RNPEL------LVSVAPTTV-
A0A7G8BMP1      SNLQTVNQQLAEAQADRIVKEARYRLAQ----T------RNPEL------LVSVAPGTT-
A0A523ECP2      RQLQDLNGAVAVARTARAGAEANYTSLR----A------ADRQT------LPAVLANPT-
A0A2W0C122      SKLNELNKQLTAAEEDRMEKEASYQAIA----A------GSLDR------IGENKSGEA-
A0A2W0AUU7      SKLDELNKQLTAAEEDRMEKDASYQAIA----A------GSLDR------LSESKSGDA-
A0A2W0BQL1      SKLDELNKQLTAAEEDRMEKDASYQAIA----A------GSLDR------LSESKSGDA-
A0A4Q1SDL1      DRLQQSTAALSVASQNRILKEAVYKAVE----S------GNAEL------ISELGGTSTA
A0A3P0XH15      EDMRVANQQLSEAQADRVVKEARYRMAM----T------RNPEL------LLSVAPSAT-
A0A3M1WQW8      ERLTDLNRRLVEAEAERIRAETLYRLSQ----E------ADVDT------LPPVMSNPI-
A0A3N1JHC1      EHLREIQQGLAQAEVDRANRQSAVEMAR----N------ASVDS------LPQVADDPT-
C1F294          ANLETINSQLAQAEADRIVKEARYKMAL----T------RNPDL------LVSVAPNTV-
A0A2V9KA79      ARLQTVGERISNDAARRVAAANEMRELQ----R------QGATE------NRAVVEEAS-
A0A522PSP1      QQLSSLQQELGQEQSKQRTLEANLALAN----E------GSLDA------LLVSDRGDS-
G8P085          DRLTQLNNRLTVAQGDRIVKEAQMRAAE----N------GNTAV------LAAMFPSAN-
A0A7C6A629      ARLLQLNTEFTNAQADRVRKEAAYNSVR----S------GSLEA------AEASTQGEA-
A0A4Q1SGQ1      DRLTTLNQRLAAAETNRILMQAIAQAAE----S------GDPEL------LPALSGGGGS
Q1ILD9          ATLDDVSKQYTDAQADRIMKEAKYRLAK----S------GNPEL------IGMLVPDSV-
A0A7G8BJH7      ARLESLNEALAAAESNRILKEAVYRAAR----S------GDPEL------ISGLSGNASV
A0A7C5SHM3      TRLERLDATLTEAKSRRASAEAQLHAYE----Q------SEPMA------LEVVRSNLQ-
Q1IJZ6          DRLTALNQDLVTAEASRVTREALYRLAR----S------GDLDR------LTSLGAESLT
A0A2V8TCE6      KGVSDIDAIYLQARARRIATESEWTAAR----G------TDPSS------LPAVVENPT-
A0A522TBE8      ARLTELNSDLTKAKSQRMQMQAAVRVID----S------GAAAG------WTNPTLTQE-
Q1ITG0          SDLTDVSKQLTDAESDRIMKEAKYRLAQ----T------GNPEL------IGTILPDSV-
A0A7C2ML20      KQLDKLYEQLAEAKAQHLHAEFLYRATR----E------GNPEA------LAEPVDDPV-
A0A7C5AXS9      EKLRQLQEELSKAQADRVAKQARYEQAR----A------APPET------LPEILEDST-
A0A7C2RGE3      ERLADLNRRLVEAETDRIRAETLYRLSR----E------GEIDA------LPPVLADPQ-
A0A3N5PCI5      QRLNSLNASVTQAKTDLIAVESLYRQLA----A------SQRDQGALD-TFPLIRSNGV-
A0A3M1Q0S9      QNLQDLRNRRVEAEADLEDKRARYQVLT----S------ASPDS------IDEVRQHPT-
A0A2Z5G448      DSLRLVNEQLIQAEADRIVKEARYHLAE----T------RNPEL------LVSVAPTTT-
A0A3M1VZ38      RNLSNIQERYTQAKIKLAEARARLDTVR----S------TRPES------LQEVLENPV-
A0A4Q1SD29      ERLRTVNEQLAEAEADRIVKEARYRMAM----T------RNPDL------LVSVAPGTV-
A0A6N9FGE2      RELENLHAAATEATLARVESEARYRDLE----E------AQDDAEALG-RFPEILRNEV-
A0A3M1PY35      ERLVALDQALTEAKRERAAAEARVEALD----G------AEPLS------IEAVRSDPL-
A0A3M1VMP2      TRLSRLEQTLTEVKAERAAAEARLAAYQ----E------ATPSG------IPEVNANPQ-
                                                                            

A0A2V7VMF7      ----------------------------AGLNAQIATFTVELSR---LKEK-YKEGHPEV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ----------------------------AELQQRDAELADAISK---TRGE---------
Q01X01          ------------------------------LQTESDLNAYGRGK---RAAG---------
A0A3M2D9H8      -------------I--------------NQLQADIVRLESDHETVLGVNALGQPARVTPT
A0A2V8JK38      ----------------------------SQFVGRLSDLKRQDAE---LTVT-FAPDYPSR
A0A2V9IXG5      ----------------------------RSYYIQWVEANNALEK---LRLDGKGEEHPTL
A0A2V9J2P4      ----------------------------RSYYIQWVEANNALEK---LRLDGKGEEHPTL
A0A1Q7RLS4      -------------V--------------RDLYREKAGLEREYER---LLVT-YKDKHVRV
A0A2V2R525      ----------------------------STAAAKLSDLRQRLAQ---LKAE-YTDKWPEI
A0A321LPW6      ----------------------------SELTKIRGELAATYAQ---LSVR-YGPENPRV
A0A2V9R9V4      ----------------------------VELQRKLGELATTAAE---LSVT-YGPKYPKM
A0A321LE75      ----------------------------TGLQARLNELEVKARE---LDVK-FGADHPRV
A0A2V8R8U7      ----------------------------LRLRGKISDLKDKLTF---LRQK-YTDEWPDV
A0A2V8QMP4      ----------------------------VKLRDKIGELEEQKAA---LLVN-YTPEWPAV
A0A2V8R4S3      ----------------------------LKLREKMGELEEQKAA---LLVN-YTPEWPAV
A0A2V8NJ55      ----------------------------QRLRDRISDLEEKRAS---LLRT-YTEEWPAV
A0A2V8Q7I0      ----------------------------TALRDRISALREKRET---LKVT-YTDKWPEV
A0A2V8S6K4      ----------------------------QDLQIKLAALNEQRVA---LLKQ-YTENWPAV
A0A317I2L9      ----------------------------VALRERISAIKERRDA---LLVT-YTPEWPEV
A0A2V8LLF9      ----------------------------QKLRDKIGDLEDKRNS---LLEI-YTPEWPEV
A0A352FRF4      ----------------------------MKLREKISELKDKETG---LLQK-YTKEWPEV
A0A2V8MKV0      ----------------------------LKLRDKLSELQAQRAA---LRQT-YTDEWPDI
A0A2V8PYY8      ----------------------------MKIRDKLTELQSQRAA---LLQT-YTTEWPDV
A0A1Q7YKQ8      ----------------------------QQLREKLDQLKQKRSE---LLVI-YTVEWPEV
A0A352F3R7      ----------------------------DKLRDRISALKEKRDA---LLIV-YTSEWPEV
A0A0B6WXT1      ----------------------------QKLRDRIGELEEKRAA---LLVQ-YTPEWPEV
A0A3B9MEU8      ----------------------------EKLRDRISALKEKRDA---LLIV-YTPEWPEV
A0A2V8MHG6      ----------------------------ATTEAKLAELKQHRAQ---LLQE-YTEKYPEV
A0A2V8P7N1      ----------------------------ATPEAKLAELKQHRAQ---LLLE-YTEKYPEV
A0A2V8M3M6      ----------------------------ATPEAKLAELKQHRAQ---LLLE-YTEKYPEV
A0A1Q7NJH5      ----------------------------AATEAKLAELKQRRAQ---LLLE-YTEKYPEV
A0A2V8PJY0      ----------------------------AATEAKLAELKQRRAQ---LLLE-YTEKYPEV
A0A1Q7Y6W9      ----------------------------QQYEANLVELRRKRAE---LLVE-NTEEHPDV
A0A2V8NC68      ----------------------------SDADAKLNELKRKRAQ---LLLE-YTEKYPEV
A0A399WK13      NIRQFQ----------------------SDTLKKISDLRQARAL---KLQE-YQEGAPEI
A0A352FLX4      RIT-------------------------TDSELKLAELKQKRAE---LLVE-NTEKWPAV
A0A2V8RTL7      SVLQLR----------------------TDVRKKINDLNAEKAR---KLED-YKETAPEI
A0A3E0PCJ6      DIRRFV----------------------NDTQKEITALRAKRQK---MLVE-YVERAPEI
A0A3M1S4R8      DMRSLN----------------------NETAKKIAELEAEKAK---LLIE-YQESAIEV
A0A7C2G442      DMRSLN----------------------NETAKKIAELEAEKAK---LLIE-YQESAIEV
A0A1Q7YFI6      ----------------------------KQAEEQLLELRKKRAE---LLVE-NTEDWPEV
A0A136KC10      NIRAFQ----------------------SDTLKKISDLRQARAL---KLQE-YQEGAPEI
A0A3M2D6Y5      DMRALN----------------------NEATKRIAELEAEKAR---LLVE-YQESALEV
A0A2V8SEX6      AIIAYR----------------------NDTQKKISDFRSQRAK---LLQE-YKESAPEI
A0A7C5ZUU4      SLRELR----------------------NETQKKIAELKANRAK---LLEE-YKESAPEI
A0A0B6WWQ6      ----------------------------VAALNKLTELRQRRAQ---LLVE-ATEEMPEV
A0A3B9MK99      ----------------------------NETEGKLADLRQKRAL---LMVD-ATEEAPEV
A0A352EX26      ----------------------------GDGENKLADLRQKRAL---LMVD-ATEEAPEV
A0A2V8MM59      ----------------------------ADSESKLSDLKQKRAQ---LLVD-ATEEAPEV
A0A2V8PFE8      ----------------------------NESESKLADLKQKRAQ---LLVD-ATEEAPEV
A0A2V8PWS6      ----------------------------NESESKLADLKQKRAQ---LLVD-ATEEAPEV
A0A2V8LCT5      ----------------------------ELSESKLAELKQKRAE---LLVT-ATEEAPEV
A0A352FTJ9      ----------------------------EATDSELTKLRQKRAQ---LLIE-ATEEAPEV
A0A257VBK0      ----------------------------QDLAKQYNELNRDLGK---LQAK-FTPKHPEV
A0A2G6PYV5      -------------I--------------KDLSSQISRKKLEYEA---NLSK-YKPQLPKM
A0A2V8F956      -------------I--------------QQQKTELAQLQSQSAQ---LGDK-LGPNHPDM
A0A1F2S1W5      -------------V--------------QQQKTELAQLLRQRAQ---LSEK-LGPNHPDM
A0A1F2T595      -------------V--------------QQQKAALADLQRQRAQ---MSEK-LGPNHPEM
A0A2V8JQV5      -------------L--------------RDLQSKLTELRSQTAE---LRVS-LTPAHYRV
A0A2V9AC41      -------------I--------------GGLKGELAKSEADYAS---LAKE-FKAGYPPL
A0A2V9MAM9      -------------I--------------RDYQVKLTELRKQLAD---LDSV-LTPENYKV
A0A348V070      -------------I--------------ARLREQYALLSREYAR---RLAT-LKPEYPEM
A0A2V9M454      -------------L--------------PGLEAKELDLKEQYSE---ALAH-YGPTYPKV
A0A2V9IVR7      -------------L--------------SRLEERYAELKSQYVE---AREQ-YGPNFPKV
A0A2V9ILE2      -------------L--------------SRLEEKYAELKSQYVE---AREQ-YGPNFPKV
A0A2V9LGY4      -------------L--------------SRLEERYAELKSQYVE---AREQ-YGPNFPKV
A0A2V9J4D6      -------------L--------------ETLEQKVADVKTEYID---ARTT-YGPNFPKV
A0A2V9L9C5      -------------L--------------ETLEQKVADVKTEYID---ARTT-YGPNFPKV
A0A2N9M9N1      -------------L--------------GQLESKNAELHTEYAA---ATSQ-YGPNFYKV
A0A2V9JEC4      -------------L--------------QHLEQNYADLKTQYAA---SLAQ-AGPNFYKA
A0A2V9LPQ3      -------------L--------------QKLQEKSADLKAQYVD---ALGQ-FGPNFPKV
A0A2Z5G3A3      GAASSGVASSLSLI--------------QGLRSQEAVLQGQMAE---YSSK-FSPDYPKL
A0A2V7UGP8      -------------I--------------QQLRQKTAELEREYTQ---KSKQ-FKPDWPDM
A0A239MKT6      ---GLAGGNEMRVL--------------GTLREQASAIKIRMAS---ESVK-FGSQYPAV
A0A3E0PCN7      ----------------------------TSLEQELSTLRLQLEQ---LKVE-FTEEWPAV
A0A2V8IYW3      -------------------------------PDPLDAARTELAT---LGRR-LLPTHPDV
G2LEI9          -------------L--------------QKLRGKISELKQRRLE---LLGT-YTELHPDV
A0A317J121      -------------V--------------RGYQTRIADLRREAAV---LKTT-LTPDNPKV
A0A2V7YW66      -------------V--------------TELRKEVLNLQRDYDT---KLKT-YKPDFPEM
A0A2V7Z0V0      -------------V--------------SDQRGQILKLEREYET---KLKT-YKPDFPDM
A0A2V8GFD4      -------------I--------------QQLKGEIAALQRQHAE---MADN-LGERHPTM
A0A2V8HSS5      -------------I--------------QQLKGEIAALQRQQAE---MADN-LGERHPTM
A0A2V8KP55      -------------I--------------SQFVGRLSDLKRQDAE---LTVT-FAPDYPSR
A0A399WNU1      ----------------------------AGLESQLTTLRQQLAQ---LKVD-YTDEWPEV
A0A2V9JSI3      -------------L--------------GRLEEKYAELKAQLVD---ASGQ-YGPNYPKV
A0A2V9WI32      -------------I--------------NQLRTQESDLRMKYAE---ATTQ-FGSSYPKV
A0A2V8IVN9      -------------I--------------QQQKSELLQLQSQYTQ---LSEK-FGDKHPDI
A0A7C5Z4J3      -------------L--------------QNMDEKYADLKAAYAD---ALAR-YGPKFPEV
A0A1F2TPT3      -------------L--------------QQLRLELERLRRDRAT---AART-LRAQHPSM
A0A2V8JTQ2      -------------L--------------TRLRAQQADLENQIAQ---ASVQ-LGPAHPKM
A0A2V8UZY0      -------------I--------------TRLRAQLADLENQIAQ---ASVQ-LGPAHPKM
A0A350UEK1      -------------M--------------RGYQEKISDLRRQQQE---LLET-FTPENQRV
A0A350UIQ4      -------------M--------------RGYQEKLSDLRRQQED---LLEV-FTPETSRV
A0A1H5Z7N3      TSGAPG--AGDQQL--------------ATLRTQMETTKADLAK---LNVA-MGDRNPQI
A0A1G7JVV8      ----GA--GQESEL--------------SKLRDDAAQTKAQIAQ---SSVS-LGPKNPQI
A0A1H4T6W9      ----GG----QSEL--------------SKLRSDAAETQASIAE---LSIT-LGPKNPKI
I3ZEU5          ----GG----QSEL--------------SKLRSDAAETQASIAE---LSIT-LGAKNPKI
A0A7L5A6M5      NPGINN--LPPPAL--------------TSLRQSLATAKSNYAM---LEGT-LGVNHPQA
A0A428MDU2      ----PG--TAPGEL--------------NLLRGQVASAKANYAQ---MEST-LGPNHPQA
A0A5B9EBI2      ----PS--IQPAPL--------------NALRSQLATARAHYAE---LTSQ-LGPNHPQV
A0A239HDF6      ----PG--LPPSGL--------------NALRTQLSTARSTYAE---QEAT-LGPNHPQA
A0A4Q0T270      ----PG--TAPGEF--------------SALRGQVAFARSNLAQ---LLTT-YGANHPLV
A0A1Q3QQB6      ----PG--AAPQEL--------------TQLRTQLATARASYAQ---MQAT-LGPNHPQA
A0A3N1K1G7      ----PG--TAPGEL--------------NTLRAQIAVARASYAQ---LEAT-MGPNHPQA
A0A4V2G466      -----G--AAPSQL--------------NALRAQLATARATLAQ---MESD-LGPNHPQA
A0A6B9YNQ8      ----QG--IAPSQI--------------NTLRAQLATARASLAQ---IESD-LGPNHPTV
A0A7G8BSK5      ----PGASGQLSAL--------------STLRTQLATARASYAQ---MESD-LGLNHPQA
A0A1I6MH75      ----PG--TMPVQF--------------AQLRSQIALAKANYAQ---LMTT-LGPNNPKA
E8WVF6          ----TG--GATNGL--------------ANLRSNLATARATYAE---LTAT-LGPNHPQV
A0A3N5YNR8      -------------I--------------SLLEERLFGLQQNLAS---LSAQ-FGSEWPAV
A0A3N6A5T6      -------------I--------------RQLETTLADLEQKLAN---MTSH-YGPVWPEV
A0A1F2Q9L4      -------------V--------------TQLRGEQLKLERDYAT---KLNT-YKPEWPAM
A0A2U3KC61      ----------SSML--------------EKLREKEADLNTQYAQ---ATTQ-FGSGYPKV
A0A2V9Y2R7      ----------SSLV--------------DKLREKEADLNVQHAQ---ATTQ-FGSAYPKV
A0A2V9NGH6      -STRNASLS-SSLL--------------EKLREQQADFRIQVSQ---LSTQ-FGPAYPKV
A0A2V9PYE6      -STRIASLS-SSLL--------------EKLREQQADLRIQVSQ---LSTQ-FGPAYPKV
A0A2V9NL07      -KG---SGSTSGLL--------------DKLQAAKADLKIQIAQ---VSTQ-FGPAYPKL
A0A2V9QD92      -KG---SGSTSGLL--------------DKLQAAKADLKIQIAQ---VSTQ-FGPAYPKL
A0A2V9WPZ6      -NSGNNPNSGSPLL--------------DSLRGKQADLKILVAE---LSTQ-FGASYPKV
A0A2V9ZLH4      -EG--NASSGSTLL--------------DKLRSQEADVKIQVAE---LSTQ-FGPSYPKV
A0A2V9RQF1      -TAGTNSST-SGLL--------------EKLREQQADIRIQTAQ---LSTQ-FGPSYPRL
A0A2V9YDK8      -NGGTGANSGSSLL--------------DNLRSKQADLKIQVAE---LSTQ-FGSSYPKV
A0A2V9V8F7      -NSGNNPNSGSPLL--------------DSLRGKQADLKILVAE---LSTQ-FGASYPKV
A0A2V9XGR9      -NSGNNPNSGSPLL--------------DSLRGKQADLKILVAE---LSTQ-FGASYPKV
A0A2V9V3Q5      -ATLAGTGS-SPLL--------------DKLHQQQADLKIQVAE---LSTQ-FGPAYPKV
A0A2V9NWS3      -GSGLSSAS-SNLL--------------EKLREQQADLKIQVAQ---LATQ-FGPAYPKL
A0A2V9USA9      -GSA--QSA-SALL--------------ESLRAKQAELHIQTAD---LNTQ-FGPSYPKL
A0A2V9XW18      -AGAGGQSS-SALL--------------GGLRSKEADLKIQAAD---LSTQ-FGPSYPRL
A0A1H5SQF5      LASLDTVR-----L--------------HQLRTQTGQLEVQISA---ETQK-YGPRNPAI
A0A2V9AEW6      -------------M--------------RDYRQKLTELQRQYAE---LSAT-LTPEHYKV
A0A2V8WQK6      -------------M--------------REYRQKLTELQRQYAE---LSAT-LTPEHYKV
A0A2V8XIF4      -------------M--------------REYRQKLTELQRQYAE---LSAT-LTPEHYKV
A0A2V2R0I6      -------------L--------------NELIRKRNELNAEYND---AVSQ-YGPNFPRV
A0A2V8XAR9      -------------L--------------AELLRKRNDLSSQHSD---ALSQ-YGPNFPKV
A0A2V8VZA0      -------------L--------------GDLLKKRSDAASQYND---ALAQ-YGPNFPKV
A0A1Q7CB82      -------------L--------------GDLLKKRSDAASQYND---ALAQ-YGPNFPKV
A0A2V8WIU1      -------------L--------------GDLLKKRSDAASQYND---ALAQ-YGPNFPKV
A0A1Q6Y9F5      -------------L--------------GDLFKKRSDAASQYTD---ALAQ-YGPNFPKV
A0A2V9EVV8      -------------L--------------GDLFKKRSDAASQYTD---ALAQ-YGPNFPKV
A0A2V8YF91      -------------L--------------TELLKKRSDTSAEYAN---ALTQ-YGPNFPKV
A0A2V8XZK2      -------------L--------------TDLLKKQRDSSAEYTD---ALAQ-YGPNFPKV
A0A2V8ZTX6      -------------L--------------ADLLKKKGETSADYAD---ALTQ-YGPNFPKV
A0A2V9BT79      -------------L--------------TELLKKRGETSADYAD---ALQQ-YGPNFPKV
A0A2V9YHT3      -------------I--------------EQLRTREADLKTQYAQ---VSTQ-FGPAYPKV
A0A7C2XNI7      -------------L--------------QELVARRTELLVQYRE---AEAQ-FGPNYPKV
A0A1Q8B793      -------------L--------------QDIYKKRNDAYTQYTS---ALNQ-FGPNFPRV
A0A2V9BCA0      -------------L--------------QDIYKKRNDAYTQYTS---ALNQ-FGPNFPRV
A0A2V9BWU9      -------------L--------------QDLQKKQSELNTQYVE---ALNQ-YGPSFPKV
A0A2V9DKX2      -------------L--------------QDLQKKQSELNTQYIE---ALNQ-YGPSFPKV
A0A7C2YQY3      -------------I--------------QELQSRLNKLNDEYAE---VRTT-FGPKYPKV
A0A3E0NV31      -------------L--------------RALEAQIARQEQELAA---LSAR-YGPEWPSV
A0A3N5M5V0      -------------I--------------SLLEERLFGLQQNLAS---LSAQ-FGNEWPAV
A0A3N5XQP8      -------------T--------------EQIEARLSALRQDYAR---LTSQ-FGPEWPEV
A0A2Z5G7H4      VSGSPTLSTSLGLI--------------QSLRMQEAALQGQIAQ---DTSK-FGPSYPRL
A0A2V9L5B5      -------------V--------------QDLEIRLADTKKEYAQ---VTTW-VKPDYPKA
A0A2V9LK56      -------------I--------------QDLEFKIADLEREYAQ---LTAV-VKPDYPSA
A0A2V9L7I0      -------------I--------------QDLEERLADVQKEYAL---VTTW-VKPEYPKA
A0A522PPT0      -------------I--------------QTLEQNLSDLRRQYSE---LTAT-VKPGYPKA
A0A7C5V1G5      -------------I--------------QNLEVNLSELKRQYAE---LTTT-VKPAYPKA
A0A2V9KCS3      -------------L--------------QDYRQKLTELRRQLAE---LGAT-YTSTHPKV
A0A372IT17      -EETGGLQHSLELI--------------ETLRSRESTAKAELAQ---DETR-YGAAWPGM
A0A4R1LC91      AGASPGVNSSLNLI--------------QNLRLQEATLQGQIGE---LSAK-FGSAYPKI
A0A3M2BZG9      ---------ISSQI--------------TQLRSEVDKLERQYRK---ALQT-FRDDWPSV
A0A1Q7N5R7      -------------S--------------ADLTQALHELTTKRAEQRALAYR-YTPDHPTL
A0A2V9QB26      -------------L--------------RSLQEKLTELRRQHAE---LITI-YTEKHNKV
A0A2V9VYY4      -------------L--------------DKLREKEADLETQYAM---ATTQ-FGSGYPRV
A0A3E0PHB0      QTKTERKAKFDEQV--------------RALDEKVKTAESELAK---LRVK-YTEQHWKV
A0A3M1SIV3      ANIIAKKNSLDARL--------------SEIDNKIKAAESERAA---LLAR-YTPENPKV
A0A3M2D491      QQ-LKLKKDSEARL--------------EDIEGQIEKAEKEKAA---LLAR-YTEEHPSV
A0A353C9L6      LN-TERKAKLQDQI--------------RDIEKQIQETEAEKAE---LLVK-YTPEYPEV
A0A2V8RQV0      LN-TERKAKLQDQI--------------RDIEKQIQQTEVEKSE---LLVK-YTEAYPEV
A0A2V8SJH5      LN-TERKAKLQDQI--------------RDIEKKIQDSEVEKAE---LLVK-YTPEYSKV
A0A357F267      LN-TERKAKLQDQI--------------RDIDKQIQQAETEKAE---LLVK-YTPEYFEV
A0A7C5ZUA8      LS-TERRSKLQDDI--------------RSLERQIQSAETEKAE---LLVK-YTEEYPEV
A0A136JPP4      LN-TERKAKLQDQI--------------REIEKQIKDAETEKAE---LLVK-YTPEYVKV
A0A399WUJ8      LN-TERKAKLQDQI--------------RDIEKQIKDAETEKAE---LLVK-YTPEYVKV
A0A2V9KIE8      -------------I--------------QELEGRLAELERQYAE---MTSM-VKPEYPKA
A0A352F549      -------------I--------------AELKTRLGELRQKRAQ---LLLT-DTEESPEV
A0A3B9MLP9      -------------V--------------AEFKTRLAELKQKRAQ---LALT-DTEESPEV
A0A3D5SQ87      -------------V--------------AEFKTRLAELKQKRAQ---LALT-DTEESPEV
A0A2V8NW86      -------------L--------------RSLQEKLTELRRQKAE---LITI-YTEKHNKV
A0A7C2GJ20      -------------V--------------QALNARLAELRQELAQ---LNVE-YQPTHPRV
A0A7C4BTL5      -------------L--------------QDYQAKITDLRRQEAE---LAAT-YKPEYSRV
A0A2V8ZHL8      -------------L--------------QRLEEKFADLKAQYVD---ALEQ-YGPKHPKV
A0A2V9B240      -------------L--------------QRLEEKFADLKAQYVD---ALEQ-YGPKHPKV
A0A2V9CBM2      -------------L--------------QDLTVRLTDLKREYAQ---LSTT-FGSDYPRV
A0A2V8XN17      -------------I--------------QDLSERLAELKREHAQ---LSTT-FSPDYPRV
A0A2V8WX45      -------------I--------------QDLSERLAELKREHAQ---LSTT-FNADYPRV
A0A1Q6YR79      -------------I--------------QDLSERLAELKREHAQ---LSTT-FSPDYPRV
A0A1Q7VA32      -------------I--------------QDLSERLAELKREHAQ---LSTT-FSPDYPRV
A0A2V9EY85      -------------I--------------QDLSERLAELKREHAQ---LSTT-FSPDYPRV
A0A2V9H8K0      -------------I--------------QDLSARLAELKREHAQ---LSTT-FNPDYPRV
A0A2V9FFE5      -------------I--------------QDLSERLAELKREHAQ---LSTT-FNPDYPRV
A0A2V9GM43      -------------I--------------QDLSERLAELKREHAQ---LSTT-FNPDYPRV
A0A2V9CYQ5      -------------L--------------QDLTVRLTDLKREYAQ---LSTT-FGSDYPRV
A0A2V9BWU8      -------------I--------------QDLSERLAELKRELAQ---LSTK-FNAEYPRV
A0A2V8ZG48      -------------I--------------QDLSERLAELKRQFAD---LSTK-FNPEYPRV
A0A2V8Y334      -------------I--------------QDLSERLADLKRELAQ---LSTK-FNAEYPRV
A0A2V9AY68      -------------V--------------QDLSERLAELKRELAQ---LSTK-FNPEYPRV
A0A1F2RFI7      -------------Y--------------QDLSIKLADLRREYSE---LTAT-FTPEYPRV
A0A1F2RZS3      -------------Y--------------QDLSLKLNDLRREYSD---LSAT-FTEEYPRV
A0A1F2USE2      -------------M--------------ETLTVKLAELQREHAQ---LTTT-FTAKYPRV
A0A7C2VB08      -------------I--------------EDLLVRLADLRRERAE---LATL-FTGEYPRV
A0A2V9C238      -------------V--------------ADLAVRLADLQREQAQ---LATT-FTADYPKV
A0A1F2Q9F5      -------------M--------------QDLTVQLAELRRQHAQ---AATT-FSPDYPTV
A0A1F2QQH9      -------------M--------------QDLTVQLAELRRQHAQ---AATT-FSPDYPTV
A0A1F2QXK7      -------------M--------------QDLTVQLAELRRQHAQ---AATT-FSPDYPTV
A0A2V9DEM9      -------------V--------------ADLAVRLADLQREQAQ---LATT-FTADYPKV
A0A7C5TWV7      -------------I--------------QQLKRQLDDLEVELAD---KLRT-YKSGHPVI
A0A2V7XDY0      -------------I--------------MILNTQVSAANNELTR---LRQQ-YKEGHPEI
A0A2V8G155      -------------I--------------QQQKSQLSELQREYAQ---LSEK-LGDKHPEI
A0A2V8HDM7      -------------I--------------QQQKSQLSELQREYAQ---LSEK-LGDKHPEI
A0A2V8DRT9      -------------I--------------QQQKTELAELQRQESQ---LSEK-LGQRHPDM
A0A2V7VYF3      -------------V--------------QQLKSELADAQHKQAQ---FSET-LGDKHPDM
A0A1F2SVH2      -------------I--------------QQQKNVLADLQRQQAQ---LSDK-LGPNHPDM
A0A2V8AJG9      -------------I--------------QQQKGEIAELQRQQAQ---LSEK-LGPRHPDM
A0A2N9LQU7      -------------L--------------QALRMQEADLKSQYAQ---LDAK-FGSGFPRV
A0A2P6WFK7      -------------L--------------QTLRTQEADLKAQLAQ---VSAK-YGNGYPKL
A0A2V8U914      -------------I--------------RDYETKLTDLRRQLAD---LESI-LQPESYKV
A0A2V7W309      -------------V--------------IHLNEELSRLQRDFNA---KRAQ-YTEAHPVM
A0A2W0BGU4      -------------M--------------QKLEENYANLRGQYVE---ALNQ-YGPNYPKV
A0A2W0BVQ9      -------------M--------------QKLEENYANLRGQYVE---ALNQ-YGPNYPKV
A0A2V9MN96      -------------L--------------EKLRVQQAELETQYAQ---ATTQ-FGPSYPEV
A0A2V7V2Z1      -------------V--------------QSLRIELAGLERQQAQ---LLER-YMDQHPEV
A0A2V7X2F7      -------------V--------------QQLRMDLSTLEQKQTQ---LLEQ-YLDQHPEV
A0A2V7V2I1      -------------I--------------GSLRVELASLQRQSVQ---LQER-YLDQHPEV
A0A2V7U3M2      -------------V--------------QALRIELATLERSQAQ---LLER-YMDQHPEV
A0A2V7UHT0      -------------V--------------QSVRIELASLERAQAQ---LLER-YMDQHPEV
A0A2Z5FVL3      -------------LAGAASGMSNDLAVISSLRTREATLNGQINE---LLAK-FGPAYPKV
A0A2V9KBD6      -------------L--------------TTLRAQQDDLERQNAQ---ASVQ-LGPTNPKM
A0A2W0AJ66      -------------V--------------TKLRAQEADLQMQLAQ---ASVQ-LGPTHPKI
A0A1Q7RBU1      -------------I--------------TKLRAQQADLENQMAQ---ASVQ-LGPAHPKM
A0A2V9JPV9      -------------I--------------TKLRAQQADLENQMAQ---ASVQ-LGPANPKI
A0A3P0X3W6      -------------L--------------TRLQQQMQDAEQAMAI---VQTH-YGPNNANY
A0A2N9MK30      -------------L--------------KTIAERLEQAQEKFAE---VKTH-YGPNHPEF
A0A3D1ASD2      -------------L--------------KKLTEAYDEAQSRLAD---VKLH-YGINHPEY
A0A7C5AXI3      -------------L--------------RRLVERRDEAEQKFAE---VRTH-FGSNHPEY
A0A7C6E4H7      -------------L--------------KKLTERLYEAEEKFAQ---IRTH-FGTNHPEY
A0A1F2TCR2      -------------V--------------VTAKSRLADLNSQRLT---LSSR-YMDTHPDI
A0A350UQT3      -------------I--------------RRLLERQNEAAERFAE---VKAH-FGVNHPEF
A0A7C3HRX0      -------------L--------------KRLIDRRNEAYERFSD---IRTH-FGPNHPEH
A0A1F2V330      ----------------------------TPAETNLEERRLHLKQ---LRSV-FTEQYPEV
A0A662EE63      -------------I--------------SNLMQRRGEVEVELLD---KLGT-YKEGHPAI
A0A2V8TLH7      -------------V--------------QDVYREKAILERDLEK---LSVT-YKDKHVRV
A0A1Q7ZJT1      -------------V--------------RDLYREKAGLEREYER---LLVT-YKDKHVRV
A0A2V8VC99      -------------V--------------QELYREKVGLEREYER---LLVT-YKDKHIRV
A0A348UZU3      -------------I--------------QRLREEYLKLSREYAK---MEEK-FQPEYPEM
Q01XL7          -------------L--------------LGLKSRIVDLRREMAQ---LTAT-LTPEHYKV
A0A2V8ERZ5      -------------V--------------ASAKAKLSDLQREKAK---LLER-YQDKHPQV
A0A2V8GTX0      -------------V--------------QQLKTRIVELQRDRVR---LEER-YGEKHPDV
A0A2V8J0X9      -------------V--------------VDAKNALATLTAQKAN---YAGR-YGPEHPRM
A0A523DUV7      -------------V--------------QRLNLSKAELEVERVQ---LKNR-YKEGHPKV
A0A1F2U158      -------------V--------------QLHKAQLSELQRQKAQ---LSER-YGEKHPDI
A0A2V8F6S9      -------------V--------------VGAKNKVQELQRTLTE---LSAR-YGEKHPSI
A0A7D8BEX2      QNSL---------L--------------KNLRASQADALANYAS---LTAQ-FGKNYPAV
A0A4Q1SCH5      -------------L--------------QSLQTTEASLYAQEAQ---LATK-FGSSYPPL
A0A372IRG7      -------------L--------------GSLRSQEADLMVQKAQ---LQSK-FGPEYPKL
A0A2V8K4L4      -------------L--------------REYESKLVDLKRQRAE---LSPS-FTPDHPRM
A0A2V8NCZ3      -------------L--------------REYESKLVDLRRQGAE---LGSS-FTPAHPRM
A0A4Q7YNP3      -------------Y--------------RRYQEKLADLKGKVAQ---LVPP-LTEENPKV
E8UZE1          -------------L--------------TSLRAQKITLESQYAS---LSSK-YGDSYPRV
A0A2U3JZ71      -------------L--------------KRLSERLDEEQQKFAE---IKAH-YGPNHPEY
A0A2V8TTB0      -------------L--------------KKLTENLNEAKERFAE---VRNH-YGINHPEY
A0A1V6HR88      -------------V--------------AQLRGEVVEMEREYAS---RLAT-FKPEWPAM
A0A3E0P0A3      -------------V--------------SSQRAELIRLQREYDT---KLET-YRPDFPTM
A0A2V8EXP2      -------------I--------------QQQKGELAELQRQQAQ---LSEK-LGPRHPDM
A0A2W4RYA1      -------------V--------------QQQKLELAALNQKKAQ---LSET-FGDRHPEI
G8P0Y7          -------------L--------------SALRQRQSELQTRYAQ---LDTW-AGQSYPQM
A0A5M8T4U7      -------------V--------------AALRTQLADLQTQRDQ---LALE-VGPRHPKM
A0A7L5A491      -------------L--------------AKLTDTMHVAQQKMET---IKAI-YGPNYIEY
A0A7D8BF18      -------------V--------------ISLRTQLNTARARMAE---LTAN-LGPNHPQV
A0A1E3Y9R6      -------------V--------------QKLRADIVAKESERAR---LGTQ-YGPAYPAM
A0A2W4TLP2      -------------V--------------QALRADIAAKEAERAR---LGTQ-YGPAYPAM
A0A7G8BDY8      -------------L--------------PVLRSQEADLKNQLAL---ASTE-FGPHYPKV
A0A7C4BZ42      -------------L--------------REYQSKLVDLKRQLAE---LNTT-LMPANPKV
A0A3R9WF43      SSGALTADGGVDLL--------------RSLRTQEASLRREYAS---YATK-YGEKNPRL
A0A317HKM4      -------------I--------------QTLKGELTTSERELGQ---ASKE-LGEHHPTI
A0A2V9CG11      -------------L--------------REYRLRLTDLQRQFVE---LTAT-LTPAHYKV
A0A523E0N1      -------------V--------------RDLERRYLDLSERYSE---LRTT-FGPDWPEI
A0A4R1LAZ7      -------------L--------------ASLREQQAALLVQAAQ---LESK-YGPDWPRV
A0A7G8BMP1      -------------L--------------TALRQQQSELLVQYAQ---LKSK-YGSDWPKV
A0A523ECP2      -------------V--------------QGLVQQRGVLEGQVAE---LTAK-FKDDWPDL
A0A2W0C122      -------------L--------------QSLRLREAELKNEYAQ---ATTT-YGPNHPKV
A0A2W0AUU7      -------------L--------------QSLYLREAELKNEYAQ---ATTT-YGPNHPKV
A0A2W0BQL1      -------------L--------------QSLYLREAELKNEYAQ---ATTT-YGPNHPKV
A0A4Q1SDL1      DTAPAVTNALSL-I--------------QNLRLQQANIETEIAS---GEKH-YGSAYPHM
A0A3P0XH15      -------------L--------------SQLQQQAAALTVQQAQ---LQSK-FGPEWPRV
A0A3M1WQW8      -------------V--------------QTLRQRLADDRRRLVK---LQQQ-YTDEWPEI
A0A3N1JHC1      -------------M--------------RDDRAKLTELHRQLAE---MSTT-MTPSNYKV
C1F294          -------------L--------------TSLRSQEANLLVQQAD---LQSR-FGPRYPKL
A0A2V9KA79      -----------------------------AVQKKLEDLRLELKG---LQARGYTENHPEV
A0A522PSP1      -------------L--------------ATLVQAQQQTQLQLDA---LSSK-YGPGNYLF
G8P085          -------------L--------------AALQSQQATLYGQYVQ---LSTK-FGQNYPPL
A0A7C6A629      -------------L--------------KKLTERLSEAEEKFAQ---AKTH-YGANHPGY
A0A4Q1SGQ1      GMPGYGPQLAV--I--------------QELRMREAALEAEIAE---NDAR-YGPAHPHT
Q1ILD9          -------------L--------------PVLRTQEADIQNQLSQ---ATAI-YGPNYPRV
A0A7G8BJH7      GAVASMANSLSL-I--------------QNLRTQEATAKAELDE---DKIR-YGSAYPRI
A0A7C5SHM3      -------------V--------------LKYHEQLASIQAEIAD---MEGK-VGPSWPRL
Q1IJZ6          SPTDQAQAAMFTNL--------------QALRQRQSQLKQQMAS---AVQI-YGARNPHL
A0A2V8TCE6      -------------V--------------QRLQHEVNDLEIQRAE---LLRT-FKPGWPQV
A0A522TBE8      -------------V--------------QTLRGRLQTDQNQLQV---LGQI-YGTSHPRY
Q1ITG0          -------------L--------------PVLRSQEADLRNQLAQ---YSTK-FGSNYPKV
A0A7C2ML20      -------------V--------------EGLKQERVKLEAELSQ---LLLT-YQPTAPPV
A0A7C5AXS9      -------------L--------------ASQSSRLTDLRRELAE---LETT-LTASHPKV
A0A7C2RGE3      -------------V--------------QALNARLAELRQELAQ---LNVE-YQPTHPRV
A0A3N5PCI5      -------------V--------------QEIRGRLANLQRERMQ---LASN-LGAKHPEM
A0A3M1Q0S9      -------------I--------------AQLSAEVARLERDYAN---KRVL-LGERHPDV
A0A2Z5G448      -------------L--------------VSLRTQQAELLVQSAE---LKSK-YGFDYPRV
A0A3M1VZ38      -------------V--------------RELRSRVSALESEYRE---KLVQ-LGEKHPEV
A0A4Q1SD29      -------------L--------------GSLRTQQAALLVQAAQ---LKAK-FGPNYPKV
A0A6N9FGE2      -------------I--------------QEQRLIVAGLRRERAR---LAES-LGPRHPDM
A0A3M1PY35      -------------V--------------VRLREELASREQRLEE---LRTR-FGPDWPEV
A0A3M1VMP2      -------------V--------------QRYRQDLAELRRELAE---LEGK-VGPNWPRL
                                                                            

A0A2V7VMF7      QKVNKQVVQIQ----KA-----------KEERAAQ---------------------I---
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      LTVDQQIELTQ-----------------KRSRLDE-------------------------
A0A2V8JK38      RRIRSQIEEIQ----KQ-----------IEGERGR---------------------I---
A0A2V9IXG5      VAKRTELDNLR----KQ-----------LRNELVK---------------------Y---
A0A2V9J2P4      VAKRTELDNLR----KQ-----------LRNELVK---------------------Y---
A0A1Q7RLS4      LEKQKEIEETT----QK-----------IASEVDR---------------------I---
A0A2V2R525      KVVQEQIAEIE----K-----------QDVENKTN---------------------SKSL
A0A321LPW6      AESKKQMAEID----N---------------QIRA---------------------SRAS
A0A2V9R9V4      AEINQQMAAIR----D---------------QIAA---------------------GRVQ
A0A321LE75      VEIRNQMVTIQ----E---------------QINR---------------------SRGD
A0A2V8R8U7      KQASAQIDELE----K---------------ELKK---------------------APQE
A0A2V8QMP4      QKIEKQLKSLH----E---------------QLDK---------------------MPDE
A0A2V8R4S3      QKIEKQLKSLH----E---------------QLDK---------------------MPDE
A0A2V8NJ55      QATNDEIKQVK----S---------------ELDK---------------------KPAE
A0A2V8Q7I0      LKLDAAIKPLE----A---------------ELDR---------------------AADE
A0A2V8S6K4      QKVEAQIKQTE----D---------------AQQK---------------------IAKA
A0A317I2L9      RKLEASLKPLE----A---------------ELQA---------------------AAAE
A0A2V8LLF9      KKIEAQLEPLK----K---------------QLIA---------------------APKE
A0A352FRF4      QQVEAQIAQLE----V---------------ELKK---------------------APTE
A0A2V8MKV0      KKLDAQIKPLE----Q---------------ALEA---------------------AKRQ
A0A2V8PYY8      KKLDAQIKPLE----Q---------------ALEA---------------------AKRQ
A0A1Q7YKQ8      KRVDEQIKTIE----E---------------ALTK---------------------APGE
A0A352F3R7      KKIDAQLKGLE----A---------------ELAK---------------------APPE
A0A0B6WXT1      KKVDEQIKRLK----Q---------------DLDK---------------------APYE
A0A3B9MEU8      KKIDAQLKGLE----A---------------ELAK---------------------APPE
A0A2V8MHG6      RDLDQQIAMLE----K-----------QAEQSRAH---------------------TESV
A0A2V8P7N1      KDVDQQIAMLE----K-----------QVDQSRRH---------------------TESM
A0A2V8M3M6      KDVDQQIAMLE----K-----------QVDQSRRH---------------------TESV
A0A1Q7NJH5      KDVEQQIAMLE----K-----------QVDQVRTH---------------------TESV
A0A2V8PJY0      KDVEQQIAMLE----K-----------QVDQVRTH---------------------TESV
A0A1Q7Y6W9      QQVEQQIAEIE----R-----------QLKEAKSH---------------------AANI
A0A2V8NC68      KDLDEEIALLE----K-----------QTKEGKTH---------------------ATSV
A0A399WK13      KEIDAQITSYQ----NSIDNAVQKFQNDLDKYRDS---------------------TKKT
A0A352FLX4      REIDKQIAAIE----K-----------VMGDARRR---------------------ATGV
A0A2V8RTL7      IEIDKQIASLE----DSLEKLLEKNNKDIQAYKER---------------------SATI
A0A3E0PCJ6      QEIDREIATLM----NEIADFRDKNDKALQQYRKT---------------------VGET
A0A3M1S4R8      QEINRKMEALK----STVEKAQEKNREELEKYRAR---------------------TAKE
A0A7C2G442      QEINRKIEALK----NTVEKAQEKNREELEKYRAR---------------------TAQE
A0A1Q7YFI6      KEIDRQIAILE----A-----------QVNQSHSE---------------------DVST
A0A136KC10      KEIDAQITSYQ----NSIDNAVQKFQGDLEKYREA---------------------TKKT
A0A3M2D6Y5      QEINRKIDALK----RTVEVAQEKNRKDLEEYRSR---------------------TAKE
A0A2V8SEX6      VEIDTQIRSLE----DSLTKLVDENTTEVQKLQER---------------------ASKL
A0A7C5ZUU4      REIDTQIKSLE----DSIAREVQKNKAELDDFRKR---------------------STQV
A0A0B6WWQ6      KEVNEQIAELE----R-----------QINEARAR---------------------AKDV
A0A3B9MK99      KEVDQQIAELE----R-----------QVKDVRSR---------------------KSVT
A0A352EX26      KEVDQQIAELE----R-----------QVNDSRNR---------------------KTNT
A0A2V8MM59      KEIQQQIAELQ----K-----------HLGETRSR---------------------STSV
A0A2V8PFE8      KEVDQQIAELQ----K-----------HLHESRAR---------------------NTNT
A0A2V8PWS6      KEVDQQIVELQ----K-----------HLNESRAR---------------------NTNT
A0A2V8LCT5      KEVDQQIDVIQ----K-----------HLVETRSR---------------------STAT
A0A352FTJ9      KEIDQQIDVLQ----K-----------HLADTRAR---------------------GTAT
A0A257VBK0      LKKQEEIRGLK----ER-----------ISQQAET---------------------V---
A0A2G6PYV5      VALNAEIKSME----KR-----------LANEQKK---------------------L---
A0A2V8F956      VKIRSAIRLTQ----AK-----------LDGEIGK---------------------V---
A0A1F2S1W5      IKVNTAIQLAE----TR-----------LQAEVAQ---------------------V---
A0A1F2T595      VKINVALRGAE----TR-----------LQNEIAQ---------------------I---
A0A2V8JQV5      QRLEAQMGELE----TA-----------FERERAN---------------------I---
A0A2V9AC41      DNLKVRMEETR----RR-----------LQAEIQN---------------------E---
A0A2V9MAM9      VRLKAQITALE----SA-----------LAKEREE---------------------T---
A0A348V070      QKLKSEIEATY----DS-----------LTREKEN---------------------L---
A0A2V9M454      LSLQDQIKDLQ----AL-----------VVRERKR---------------------V---
A0A2V9IVR7      VRLRDQAEEIR----SS-----------LEAERKR---------------------I---
A0A2V9ILE2      VRLRDQAEEIR----SS-----------LEAERKR---------------------I---
A0A2V9LGY4      VRLRDQAEEIR----SS-----------LEAERKR---------------------I---
A0A2V9J4D6      VRLQQQIDEVQ----LL-----------IQQERHR---------------------V---
A0A2V9L9C5      VRLQQQIDEVQ----LL-----------IQQERHR---------------------V---
A0A2N9M9N1      KQLGNQINEVE----EL-----------IDRERKR---------------------I---
A0A2V9JEC4      VQIRKQLAEVE----SL-----------INRQRMR---------------------L---
A0A2V9LPQ3      VRLRGQVAQMQ----SL-----------IEQEQKR---------------------T---
A0A2Z5G3A3      VDMKSNLQVIQ----AA-----------IASEVAR---------------------M---
A0A2V7UGP8      VRLQAEWDSAR----KT-----------MAEESQK---------------------I---
A0A239MKT6      LELQNQLNSID----AQ-----------VHEQMVR---------------------L---
A0A3E0PCN7      KEVRRKIAAVE----NE-----------LKGTRKL---------------------S---
A0A2V8IYW3      IAAKRRVAQLE----AERVAMPKASDAPASAAAPQ---------------------V---
G2LEI9          VQIDQVLAQAE----NE-----------LKEAKAN---------------------T---
A0A317J121      KKIEVQINELQ----IT-----------LNKEVTA---------------------E---
A0A2V7YW66      VTLKAEIEKSQ----QH-----------INDVVKE---------------------L---
A0A2V7Z0V0      VTLKADIEKAR----QH-----------LNEVLGE---------------------Q---
A0A2V8GFD4      IKLKASLQSAD----AK-----------LQAEIAK---------------------I---
A0A2V8HSS5      IKLKASLQSAD----AK-----------LQAEIAK---------------------I---
A0A2V8KP55      RRIRSQIEEIQ----KQ-----------IEGERGR---------------------I---
A0A399WNU1      QKVEKQIAGIE----KE-----------LQSNRKR---------------------S---
A0A2V9JSI3      VRLQDQVNEIQ----GF-----------IERERKR---------------------I---
A0A2V9WI32      MQLGNQLKQVE----AS-----------IQAEDER---------------------I---
A0A2V8IVN9      IKVKSAIQLAQ----AR-----------LDGEIGK---------------------V---
A0A7C5Z4J3      IRLGHQINEIQ----SL-----------IKQYRTL---------------------A---
A0A1F2TPT3      LKLEETIQATQ----AK-----------LDVERSR---------------------V---
A0A2V8JTQ2      AELSKQLAQVR----RS-----------VDAEVKG---------------------I---
A0A2V8UZY0      VELSKQLDQAR----RS-----------VDAEVNR---------------------I---
A0A350UEK1      KRVAAQVASLE----KS-----------LEVERAQ---------------------I---
A0A350UIQ4      KRVNAQISSLE----KS-----------LANERDQ---------------------I---
A0A1H5Z7N3      RALRAQVDTLN----QE-----------IRAEQDR---------------------I---
A0A1G7JVV8      LALQAHLREVD----RE-----------IKTEETR---------------------M---
A0A1H4T6W9      VALQAHQREIQ----RE-----------LRSEENR---------------------L---
I3ZEU5          IALRAHQREVQ----RE-----------VQAEENR---------------------L---
A0A7L5A6M5      LASRAQIDELS----KE-----------VTAEQNR---------------------L---
A0A428MDU2      QALKAQIDELE----KE-----------IDAEQKR---------------------L---
A0A5B9EBI2      KAAKAQMDELA----TE-----------INTEQGR---------------------L---
A0A239HDF6      KSTKAQIDELA----RQ-----------VAAEQNR---------------------L---
A0A4Q0T270      KAQSNELAELE----KQ-----------LKAEQER---------------------L---
A0A1Q3QQB6      KALRAQIDELS----KE-----------VTKEQNR---------------------L---
A0A3N1K1G7      KAQKAQIDELA----KE-----------IDAEQSR---------------------L---
A0A4V2G466      KAQKAQIAALS----TE-----------INTEQQR---------------------L---
A0A6B9YNQ8      KAQKAQIDELS----KE-----------ISTEQQR---------------------L---
A0A7G8BSK5      KAQKAQIEELT----KE-----------INTEQQR---------------------L---
A0A1I6MH75      LELSNEIKELD----AQ-----------LAAEQKR---------------------L---
E8WVF6          KAARAQIDEFQ----HA-----------VEAEQNR---------------------L---
A0A3N5YNR8      IQVRQQIQEVE----KQ-----------LQREKKE---------------------T---
A0A3N6A5T6      VQLKREVNEVN----TQ-----------LVREKKR---------------------A---
A0A1F2Q9L4      QELKAQIDKGR----QH-----------LGNVTKE---------------------M---
A0A2U3KC61      VELKNQLKQVR----TE-----------IVAEETR---------------------M---
A0A2V9Y2R7      VELRNQLQEVR----SG-----------ISVEQTR---------------------M---
A0A2V9NGH6      AQLNSQLQEVE----SQ-----------IQLEMKK---------------------V---
A0A2V9PYE6      AQLNSQLQEVE----SQ-----------IQLEMKK---------------------V---
A0A2V9NL07      AELNNQLQEID----SQ-----------IQGETKK---------------------V---
A0A2V9QD92      AELNNQLQEID----SQ-----------IQGETKK---------------------V---
A0A2V9WPZ6      AQLNNQLKEID----IQ-----------IQGEMKK---------------------M---
A0A2V9ZLH4      AQLNNQLKEID----VQ-----------IQSEIRK---------------------I---
A0A2V9RQF1      AQLNNQLKEVE----AQ-----------TQVEMKK---------------------I---
A0A2V9YDK8      AQLSNQLKEIV----AQ-----------IQAETKK---------------------I---
A0A2V9V8F7      AQLNNQLKEID----IQ-----------IQGEMKK---------------------M---
A0A2V9XGR9      AQLNNQLKEID----IQ-----------IQGEMKK---------------------M---
A0A2V9V3Q5      AQLNSQLKEIE----NQ-----------IQVETRK---------------------A---
A0A2V9NWS3      TQLNGQLKEVD----AQ-----------LQAEMKK---------------------V---
A0A2V9USA9      AQLNNQLKEID----TQ-----------IQGEMKK---------------------I---
A0A2V9XW18      NQLNNQLKEID----SQ-----------IQGEMKK---------------------I---
A0A1H5SQF5      LSLKSELAELQ----RQ-----------TNEEISR---------------------V---
A0A2V9AEW6      LRVQAQIDELK----AQ-----------IEKERGN---------------------V---
A0A2V8WQK6      KRVQAQITELR----SE-----------MQKERAN---------------------V---
A0A2V8XIF4      QRVQAQINDLK----AE-----------MQRERNN---------------------V---
A0A2V2R0I6      QRLQAQLKDLD----AT-----------IEKEKQN---------------------I---
A0A2V8XAR9      QRLQAQLKDLD----AN-----------IEKEKKK---------------------I---
A0A2V8VZA0      QRLQAQLKEFD----QT-----------IEKEKQK---------------------I---
A0A1Q7CB82      QRLQAQLKEFD----QT-----------IEKEKQK---------------------I---
A0A2V8WIU1      QRLQAQLKEFD----QT-----------IEKEKQK---------------------I---
A0A1Q6Y9F5      QRLQAQIKEFD----QT-----------IEKEKQN---------------------I---
A0A2V9EVV8      QRLQAQIKEFD----QT-----------IEKEKQK---------------------I---
A0A2V8YF91      LRLQAQLKEID----EN-----------IQGEKRG---------------------I---
A0A2V8XZK2      QRLKTELKDIE----DS-----------IEKEKRK---------------------V---
A0A2V8ZTX6      LRLKAQLKDID----DN-----------IEKEKQK---------------------I---
A0A2V9BT79      LRLKAQLKDID----DN-----------IEKEKRK---------------------I---
A0A2V9YHT3      VEVGNQLKQVQ----ET-----------IQGETRR---------------------I---
A0A7C2XNI7      QRLKVQLDELD----ST-----------IAREKKN---------------------I---
A0A1Q8B793      QRLQEQLKEFD----GL-----------IDAEKKN---------------------I---
A0A2V9BCA0      QRLQEQLKEFD----GL-----------IDAEKKN---------------------I---
A0A2V9BWU9      VRLQAQLKEIE----HL-----------IAREKAN---------------------I---
A0A2V9DKX2      MRLQAQLKEIE----HL-----------IAREKAN---------------------I---
A0A7C2YQY3      QRLEQQIADAK----AQ-----------MEREKQQ---------------------I---
A0A3E0NV31      RQTRSELAELR----RD-----------LSAAGGR---------------------A---
A0A3N5M5V0      VQVRQQIREVE----QQ-----------LVREKRE---------------------T---
A0A3N5XQP8      IQAQRQITQGE----QE-----------LKQERER---------------------A---
A0A2Z5G7H4      MDSRANLSGME----SA-----------IEDEVHR---------------------V---
A0A2V9L5B5      QQVEKQIDALQ----AE-----------LDKQKKA---------------------V---
A0A2V9LK56      VRLKKQIDLLQ----SI-----------LGKDKRT---------------------L---
A0A2V9L7I0      LQVKKQIDALQ----AE-----------IDRQKKA---------------------V---
A0A522PPT0      MALKKQIETLQ----AN-----------LDHQKQA---------------------L---
A0A7C5V1G5      VALKKQIDTLQ----AN-----------LNRQKQA---------------------L---
A0A2V9KCS3      ERVDAQIASVQ----SA-----------LERERVN---------------------I---
A0A372IT17      QERQAQLTEIQ----KS-----------IHDEVRR---------------------V---
A0A4R1LC91      EELQGNLHSIQ----KA-----------IQAETHR---------------------V---
A0A3M2BZG9      TKLKEELEGKR----AK-----------LTALVSA---------------------E---
A0A1Q7N5R7      QRVTSEIETLE----RT-----------TIPALAK---------------------A---
A0A2V9QB26      KQVEAQIALLE----AA-----------LQKEQAA---------------------I---
A0A2V9VYY4      TELNNQLKQVR----AA-----------IEAEKTK---------------------L---
A0A3E0PHB0      KEAISLIASLK----EQ-----------KNQLEDE---------------------S---
A0A3M1SIV3      KQIEATIQKLQ----EG-----------KEKIRQE---------------------E---
A0A3M2D491      KQIEAQIQQLR----ET-----------KEKVKNE---------------------V---
A0A353C9L6      GKKEAKIASLK----ET-----------KDKTERE---------------------V---
A0A2V8RQV0      GKKDAKIASLR----ET-----------KEKTEKE---------------------V---
A0A2V8SJH5      KVVEERIASLK----AT-----------KDRTESE---------------------V---
A0A357F267      KKKVERIAALQ----ET-----------RAKTETE---------------------V---
A0A7C5ZUA8      KKLNERIASLR----ST-----------KERMESE---------------------V---
A0A136JPP4      KQVEEKIASLK----TT-----------KQQTETE---------------------V---
A0A399WUJ8      KQVEEKIVSLK----NT-----------KQQTESE---------------------V---
A0A2V9KIE8      VQLKKQIDVLE----AR-----------ITAQKQA---------------------L---
A0A352F549      KDATQQIATLE----KQ-----------LADTRGS---------------------A---
A0A3B9MLP9      KDVNQQIAILE----KQ-----------LDETRGS---------------------A---
A0A3D5SQ87      KDVNQQIAILE----KQ-----------LDETRGS---------------------A---
A0A2V8NW86      KQVEAQIASLE----AA-----------LQKERTA---------------------I---
A0A7C2GJ20      ARVREQIAEAE----RQ-----------LALAKRR---------------------I---
A0A7C4BTL5      KRVQAQLAAVE----SA-----------LQRERQA---------------------I---
A0A2V8ZHL8      ERFRSQVDEVQ----SL-----------IDTERKR---------------------I---
A0A2V9B240      ERLRSQVDEIQ----SL-----------IDTERKR---------------------V---
A0A2V9CBM2      KEIQSQITDVE----AS-----------LQQERKR---------------------A---
A0A2V8XN17      KEIQSQIDEIE----AS-----------LRDERQR---------------------A---
A0A2V8WX45      KEIQSQIDEIE----GS-----------LQVERKR---------------------A---
A0A1Q6YR79      KEIQSQVDEIE----SS-----------LREERQR---------------------A---
A0A1Q7VA32      KEIQSQVDEIE----SS-----------LREERQR---------------------A---
A0A2V9EY85      KEIQSQIDEIE----SS-----------LREERQR---------------------A---
A0A2V9H8K0      KEIQSQIDEIA----AS-----------LREERQR---------------------A---
A0A2V9FFE5      KEIQSQIDEIA----AS-----------LREERQR---------------------A---
A0A2V9GM43      KEIQSQIDEIA----AS-----------LREERQR---------------------A---
A0A2V9CYQ5      KEIQSQITDVE----AS-----------LQQERKR---------------------A---
A0A2V9BWU8      KEIQSQIDEIE----AT-----------LREERQR---------------------A---
A0A2V8ZG48      KEIQSQINEIE----AT-----------LKEERQR---------------------V---
A0A2V8Y334      KEIQSQIDEIE----GT-----------LKEERQR---------------------A---
A0A2V9AY68      KEIQSQIDEIE----AA-----------LKDERKR---------------------A---
A0A1F2RFI7      KRLKNQIEEIE----RT-----------VQRERGA---------------------F---
A0A1F2RZS3      QRLKSQIDQTA----AA-----------LDRERQA---------------------F---
A0A1F2USE2      EQLENQIQEVQ----GL-----------LGQEQDK---------------------A---
A0A7C2VB08      RQLDNQIGELE----QL-----------LAAERAR---------------------M---
A0A2V9C238      RQIQSQINELD----AA-----------LARERGR---------------------V---
A0A1F2Q9F5      KQLQNQIDEIE----RL-----------LAQERAR---------------------A---
A0A1F2QQH9      KQLQNQIDEIE----RL-----------LAQERAR---------------------A---
A0A1F2QXK7      KQLQNQIDEIE----RL-----------LAQERAR---------------------A---
A0A2V9DEM9      RQIQSQINELD----AT-----------LARERGR---------------------V---
A0A7C5TWV7      KELRSRISSIK----LR-----------IKQQIQT---------------------I---
A0A2V7XDY0      QKLLLQLDQAQ----KT-----------KERQGTQ---------------------I---
A0A2V8G155      IKVKSAIQISQ----AK-----------LSGEISK---------------------V---
A0A2V8HDM7      IKVKSAVQISQ----AK-----------LSGEISK---------------------V---
A0A2V8DRT9      LKAKLNVQNAE----AR-----------IQAEINK---------------------V---
A0A2V7VYF3      IKARSAVDTAL----AK-----------LNTEIDK---------------------V---
A0A1F2SVH2      VRLSSAVREAE----SK-----------IQGEIAK---------------------V---
A0A2V8AJG9      LKVSNAIQLAE----SK-----------LQGEIAK---------------------V---
A0A2N9LQU7      QELQAQLARLD----QN-----------IADELTN---------------------V---
A0A2P6WFK7      RELQTQLSKLN----AA-----------IADEVAN---------------------V---
A0A2V8U914      VRVKAQIVQLE----AA-----------IARESRR---------------------V---
A0A2V7W309      QDLAQQIEKTKLARAAA-----------VREAYSR---------------------A---
A0A2W0BGU4      LRLDKQVKEAS----AL-----------IAAERGR---------------------I---
A0A2W0BVQ9      LRLDKQVKEAS----AL-----------IAAERGR---------------------I---
A0A2V9MN96      IQLRSQLNQVR----NS-----------IATEQKN---------------------L---
A0A2V7V2Z1      VKVRNQIQETR----KK-----------IAAESQR---------------------V---
A0A2V7X2F7      IKVRRQIEDTR----KR-----------LSAEGQR---------------------V---
A0A2V7V2I1      VKNRNQITETR----EK-----------IASEAQR---------------------V---
A0A2V7U3M2      VKVRNQIQETR----KK-----------IAAESQR---------------------V---
A0A2V7UHT0      VKVRNQIQETR----KK-----------IAAESQR---------------------V---
A0A2Z5FVL3      DELKADLTAIQ----NS-----------IKEEIQR---------------------M---
A0A2V9KBD6      AELSSQLSQVR----SS-----------IDAEVKR---------------------I---
A0A2W0AJ66      RELSNQLAQTR----RS-----------IRSEVKR---------------------T---
A0A1Q7RBU1      GELSNQLAQAQ----RS-----------VDAEVRR---------------------I---
A0A2V9JPV9      SELSKQLAQAR----QS-----------VDVEVRR---------------------I---
A0A3P0X3W6      KVAANTLAEVT----RE-----------YQAARDN---------------------T---
A0A2N9MK30      HKAQTQLDQVQ----AQ-----------FDATRGS---------------------V---
A0A3D1ASD2      RKAQGQVAELD----RQ-----------LQTAKTS---------------------I---
A0A7C5AXI3      KKAQAQLNEVK----RL-----------LAETTQD---------------------I---
A0A7C6E4H7      RKAAAQVAQLK----QQ-----------LDETLRT---------------------I---
A0A1F2TCR2      QKLDAQIAIAK----KD-----------LIAQRQR---------------------V---
A0A350UQT3      RKAQAQLREIQ----SQ-----------VDATRDN---------------------A---
A0A7C3HRX0      RRALAATNELD----RQ-----------IAEMRAS---------------------I---
A0A1F2V330      VSTEREIKELE----KA-----------VAAAPPK-------PTVAEPSAARMHYVQIRA
A0A662EE63      KELRVRLEGID----QA-----------IERQIQT---------------------L---
A0A2V8TLH7      LEKQSEIDKTN----QK-----------LASEVDR---------------------I---
A0A1Q7ZJT1      LEKQKEIEETT----QK-----------IASEVDR---------------------I---
A0A2V8VC99      QEKQKEIDEIS----RK-----------IASEVDR---------------------I---
A0A348UZU3      QRLKAELDTAR----EL-----------LKNETQR---------------------L---
Q01XL7          QKIQAQISELQ----QT-----------LDKEKTG---------------------L---
A0A2V8ERZ5      INAVAALQDAQ----RQ-----------LDLEIAR---------------------A---
A0A2V8GTX0      QRVNGQIQDAQ----RQ-----------LDAEIER---------------------S---
A0A2V8J0X9      MEVKDQIENAK----RR-----------LVAERTK---------------------V---
A0A523DUV7      KKVVTQIEQLQ----DA-----------VRTQAEK---------------------L---
A0A1F2U158      INVNARLGDEQ----RQ-----------LDLETAK---------------------A---
A0A2V8F6S9      QKARTDLAEGQ----KQ-----------YEFEVAR---------------------A---
A0A7D8BEX2      KEAKAKVDTLS----QQ-----------IKTEEDR---------------------I---
A0A4Q1SCH5      VETREQLASVR----DQ-----------IRKNVGN---------------------I---
A0A372IRG7      REIDRQLGSVR----SD-----------IQTEITN---------------------L---
A0A2V8K4L4      QKLEAQITELE----TA-----------LEAARQK---------------------V---
A0A2V8NCZ3      QKLEAQIAEME----TA-----------LEDARQK---------------------V---
A0A4Q7YNP3      IHLRSEIREVE----AG-----------MEAARNA---------------------N---
E8UZE1          AQIKSELAEVN----RT-----------ITTELRR---------------------G---
A0A2U3JZ71      RKASLQLAELE----RQ-----------LQSGKEN---------------------I---
A0A2V8TTB0      RKAQTKVQELE----TQ-----------IADTGAS---------------------I---
A0A1V6HR88      VELKGRIDQAR----GN-----------LIPAARE---------------------ALAK
A0A3E0P0A3      VELKTQIDEAR----RQ-----------LNQLIEE---------------------NSRQ
A0A2V8EXP2      VKIGLAINAAE----ER-----------IQGEIAK---------------------V---
A0A2W4RYA1      VAINRAIELAQ----QK-----------LDTEIQK---------------------V---
G8P0Y7          REITSQLDQLN----KS-----------INEQVKN---------------------S---
A0A5M8T4U7      QAMNAQIAKVK----VD-----------LDHEVSL---------------------A---
A0A7L5A491      KRAANELAEAT----RE-----------YNDTKTS---------------------I---
A0A7D8BF18      LAVKDQIAELT----RE-----------LTEEQNR---------------------V---
A0A1E3Y9R6      RDLASQIEAAN----RD-----------LDLEIDK---------------------V---
A0A2W4TLP2      RELATQIERAR----RD-----------LETEVSK---------------------V---
A0A7G8BDY8      IQLQNQMAQLE----KA-----------LHKEVAD---------------------I---
A0A7C4BZ42      QRVQAQIEEIE----GA-----------LRREQSN---------------------V---
A0A3R9WF43      LQLQEQINAVD----AQ-----------MQTEMAR---------------------I---
A0A317HKM4      IKLREAVQNAD----RK-----------LQAEIAA---------------------A---
A0A2V9CG11      QRVQAQIAELQ----SA-----------VKNQRTL---------------------I---
A0A523E0N1      KRVKGALDETK----RD-----------LDVVATE---------------------QAAK
A0A4R1LAZ7      REIRSQLSQVQ----RD-----------IDSEINS---------------------L---
A0A7G8BMP1      KEAEKQLAAVQ----VN-----------IDTEINN---------------------L---
A0A523ECP2      RRAREGLTDIK----SR-----------IEIERNV---------------------LAVE
A0A2W0C122      IELTNRINAIN----LS-----------IQTELKR---------------------L---
A0A2W0AUU7      LELTNRIKAMD----TS-----------IQTELKR---------------------L---
A0A2W0BQL1      LELTNRIKAMD----TS-----------IQTELKR---------------------L---
A0A4Q1SDL1      VELRASLDKVN----QA-----------ISDEVSR---------------------V---
A0A3P0XH15      KEVQGSLVQVR----KA-----------IDVEINN---------------------M---
A0A3M1WQW8      QSLKGEIAETE----QQ-----------LAEIEKQ---------------------I---
A0A3N1JHC1      QKVESQIKELE----EE-----------MQRHRFT---------------------I---
C1F294          EEVRQQLKQVR----SD-----------INKEITN---------------------L---
A0A2V9KA79      IRLRRQIQEFE----AS-----------ASAQAPVEGPVSARRPAGEPSPFFLRYLQLKS
A0A522PSP1      QQKQRELTQID----NS-----------IRKGQQH---------------------I---
G8P085          AQVKDQMQKTD----AE-----------LERQSSI---------------------V---
A0A7C6A629      RQAAAQVAELK----SQ-----------LNQTVRS---------------------I---
A0A4Q1SGQ1      AELQAELTGVQ----RS-----------IRAEAER---------------------M---
Q1ILD9          VELKKQLAQVN----AS-----------LAKETRD---------------------I---
A0A7G8BJH7      AEVQAELNGIE----KE-----------IQDEVHR---------------------I---
A0A7C5SHM3      RELHTAEQETR----RN-----------LQAEAEK---------------------LYHQ
Q1IJZ6          VDVDKQLSDVD----SQ-----------IKGELKL---------------------I---
A0A2V8TCE6      EVLTRKLEGAR----QQ-----------LSSETEA---------------------IARR
A0A522TBE8      RQQSTVVRRDE----EA-----------VQQAQAR---------------------L---
Q1ITG0          IQLNNQLAQTD----AS-----------LKKEIRD---------------------I---
A0A7C2ML20      KQAEQKLASLE----TR-----------MKRAEIE---------------------ARRA
A0A7C5AXS9      RKVQAQITALE----NS-----------FERQRRN---------------------V---
A0A7C2RGE3      ARVREQIAEAE----RQ-----------LALAKRR---------------------I---
A0A3N5PCI5      VRVNSAIEAAE----RE-----------LDSEVAK---------------------T---
A0A3M1Q0S9      QQIATELAAGR----ER-----------LASETER---------------------IARQ
A0A2Z5G448      REVEKQLTAVQ----TD-----------IDAEISN---------------------L---
A0A3M1VZ38      QTVKAKLDSSR----EH-----------LQEQIAA---------------------IAAS
A0A4Q1SD29      VEVNNQLEKVQ----SD-----------IDQEINS---------------------L---
A0A6N9FGE2      IATESSLGDAE----DR-----------LRNEVLA---------------------V---
A0A3M1PY35      RELSRAIAEAR----VR-----------LAERAAA---------------------VFEE
A0A3M1VMP2      VELRAAVKETE----RN-----------LENEMEA---------------------IYRQ
                                                                            

A0A2V7VMF7      -ADGL---------------Q----AEFAQLQKRESELRDAIDAQKADAARQSQKKTEVE
A0A2V7YYV7      -SDVL-------------------------------------------------------
A0A2V7Z0J5      -GDTF-------------------------------------------------------
A0A2V7Z3M4      -ADDF-------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      -LKSL---------------L----NIYQQIYVNLSFSPASQSSQNGTNNQLQAALVLY-
A0A2V8JK38      -VKTF---------------E----VEYSAATERERLLSVALEQQRDAVNKMNREIIQYN
A0A2V9IXG5      -ADGM---------------R----VSVSVLRNREQASQKSYSEKMAERRVTSRHMAEMS
A0A2V9J2P4      -ADGM---------------R----VSVSVLRNREQASQKSYSEKMAERRVTSRHMAEMS
A0A1Q7RLS4      -INGL---------------R----SQYDLLKDREAKLIKATDETRTESLQVNRKASGYE
A0A2V2R525      AVKGL---------------E----TKFREAQRREQEIRDAFEKARSETITQNSAAVNYR
A0A321LPW6      LEARL---------------R----ADYERSARDEVSLKGALDRAKTEAARQNQDAIQYG
A0A2V9R9V4      LEEKL---------------K----ADYERVVRDENALKAALEEAKAGAAQENQRAIQYS
A0A321LE75      LEARL---------------K----AEYERAIRDETALKESLERAKIDAAQQNQDAITFN
A0A2V8R8U7      VLASM---------------K----SRADAAEAHERSLEKAYSVQHGKTVSQTRNVIDLA
A0A2V8QMP4      IIAGL---------------E----NRYEAAVKNERSATGSYFAARAKANDQSVADTKLA
A0A2V8R4S3      IIAGL---------------E----NRYEAAIKNERSATGSYFAARAKANDQSVADTKLA
A0A2V8NJ55      IINSL---------------K----LRYETALATEQKIKTDYEHERGAAQAQGKAALDIG
A0A2V8Q7I0      IIARL---------------K----SEYQESYAHENSVRAMYNSQHGTATQQTRNQIEMA
A0A2V8S6K4      IVIGM---------------G----ASLDGAKKRAASLQAAYYKERSAAQAQGIQVIGLS
A0A317I2L9      AIQGL---------------K----AQYEAALAHEQSIKSMYNAQRGVTSQQTRAQIDMV
A0A2V8LLF9      VLAGL---------------K----SRRDSAIAHEKSLVGAYSRQHGTTIQQTKDQIDMA
A0A352FRF4      VLASM---------------K----AKSDAATTQLADLKTAYTKESGLTAQQTKNIIELA
A0A2V8MKV0      ILVSM---------------E----SRYKAAEATERSLAQAYSQAHGVTAAQLDHELELA
A0A2V8PYY8      ILASM---------------E----SRYKAAEATEKSLAQAYSQAHGVSTAQIQHELELA
A0A1Q7YKQ8      VLATM---------------K----SKYDAAVTTENSLRASYNQQHSEFSQQTQDQIQLT
A0A352F3R7      IVTSI---------------Q----RRYEAAVSRENLLRRSYEQQKGTTTQQTRDQIDLI
A0A0B6WXT1      VIKAM---------------R----SRYEAALARENKLKQAYYQEAAAANEQNQAEIELS
A0A3B9MEU8      IVTSI---------------Q----RRYEAAVSRENLLKRSYEQQKGTTTQQTRDQIDLM
A0A2V8MHG6      VKTNL---------------E----TRYRQALQKEEALRQAFEKQRAETLTQNEAAVNYR
A0A2V8P7N1      VKTNL---------------E----TSYRQALQKEEALRQAFDKQRAETLTQNEAAVNYR
A0A2V8M3M6      VKTNL---------------E----TSYRQALQKEEALRQAFDKQRAETLTQNEAAVNYR
A0A1Q7NJH5      VKTNL---------------E----TSYRQALQKEEALRQAFAKQRAETLTQNEAAVNYR
A0A2V8PJY0      VKTNL---------------E----TSYRQALQKEEALRQAFAKQRAETLTQNEAAVNYR
A0A1Q7Y6W9      LTTNL---------------K----TNYLQAKAQEDSLRDAFNKQRSETLVQNEAAVNYN
A0A2V8NC68      AITNL---------------E----TSYRQAMAREQALRADFEKQRGETLTQNEAAVNYR
A0A399WK13      LLYNL---------------Q----TKYLQAKANEDKIRADFNKQFGEATGQNQSAVSLA
A0A352FLX4      VTTNL---------------A----TRYRQALATEELLRKAYDQQRAETLTQNEAAVSYR
A0A2V8RTL7      LLENY---------------K----TQYQQAKDQETKIRSAYDVQYNEAQGQNSGAVMIK
A0A3E0PCJ6      ILENL---------------K----TRYLQTKEREDKVRSAFNAQYNEAQGQNQSEVTIK
A0A3M1S4R8      ILTNL---------------Q----TRYEQAKAQEDKIRRAFEEQYRKAEGENRAAIDIK
A0A7C2G442      ILTNL---------------Q----TRYEQAKAQEDKIRRAFEEQYRKAEGENRAAIDIK
A0A1Q7YFI6      LKTNL---------------E----TRYHQALAREESLRQAFDQQRAQTLTQNEAAVNYR
A0A136KC10      LLYNL---------------Q----TKYLQAKANEDKIRADFNKQFGEATGQNQSAVSLA
A0A3M2D6Y5      ILTNL---------------Q----TKYEQAKAQEDKIRKAFDEQYRRAEGENRAAIDIR
A0A2V8SEX6      LVDNL---------------R----TKYLQTKNEEDKIRAAYDEQYNAAQVQNGGAVRLK
A0A7C5ZUU4      LLDSL---------------R----TDYVQAKDREDKIRKAYNEQYNLAQGQNVGAVQIR
A0A0B6WWQ6      MLTNL---------------R----TRYRQALAREEALRQAFDEQRGETLTQNEAAINYR
A0A3B9MK99      LLTNL---------------E----TDYRQTLAREQALRKAFEQQRGETLSQNEAAINYR
A0A352EX26      LLTNL---------------E----TQYRQTLGREQALRAAFQQSRSETVTQNEAAINYR
A0A2V8MM59      LLTNL---------------E----TRYRQTLAREQALRKSFDQQRAETLTQNEAAINYR
A0A2V8PFE8      LLTNL---------------E----TKYRQSLAREESLRKSFNQQKGETVTQNEAAINYR
A0A2V8PWS6      LLTNL---------------E----TKYRQALAREDSLRKSFNQQKGETVTQNEAAINYR
A0A2V8LCT5      LLTNL---------------E----TKYRQAAEREDSLRKSFNQQKGETLSQNEAAINYR
A0A352FTJ9      LLKNL---------------E----TKYRQAADREEALRKSFNQQKGETVTQNEAAINYR
A0A257VBK0      -LGSY---------------R----NQLSALRGERANLAQEVDGARREGLQFVEGLSRGE
A0A2G6PYV5      -YNRLIQSISKDVQD-----RKNELAYLEAQRKKQNQKIVLADLKTKEQNASLDSKIQVL
A0A2V8F956      -VQGV---------------K----NEYLAALAKENSLTGALNAQKGDA-----------
A0A1F2S1W5      -LQAM---------------R----NDYEAALTEERTLANELNRQKIEAQQLNRTSIDYS
A0A1F2T595      -AQAI---------------R----SEYEAALAEERSLSASLNQQKIEAQSLNRAGIEYG
A0A2V8JQV5      -LRGI---------------A----NQYEDAKRREELLAQEYDAQTRVVSDQADKVAHYA
A0A2V9AC41      -VKRI---------------E----VTYTAAKNNETGLRATMEDQKKTTLNLKDAAVQYA
A0A2V9MAM9      -RQRL---------------R----NDYLTARRREALLSSAYQQQTHLASDLRKKMIHYD
A0A348V070      -IKTA---------------Y----AEYQGALAKEQNLQKLLDDLKAQAYKANSTAILYN
A0A2V9M454      -VDNL---------------H----NDYLAAVEREKFLATAVAQQKVQVDRVNQLLIQHN
A0A2V9IVR7      -VERY---------------H----GEYVAAQQREAMISEALARQKVELEKLNQLLIQQN
A0A2V9ILE2      -VERY---------------H----GEYVAAQQREAMISEALARQKVELEKLNQLLIQQN
A0A2V9LGY4      -VERY---------------H----GEYVAAQQREAMISEALARQKVELEKLNQLLIQQN
A0A2V9J4D6      -VERI---------------Q----RDYEAAVEREKLLEATVAQQKFEVGKLNQLLIQHN
A0A2V9L9C5      -VERI---------------Q----RDYEAAVEREKLLEATVAQQKFEVGKLNQLLIQHN
A0A2N9M9N1      -MERI---------------E----SDYRTAVRREQLLSQDVSAQRTEVEKLNQLLIKYT
A0A2V9JEC4      -VKQT---------------K----DAYDTAVRRETLLSRTVAEQRKDVERLNQLLIQHN
A0A2V9LPQ3      -VERI---------------Q----NDYRAASTRVSLVSTSVVQQKAEVGRLNQLLIQHN
A0A2Z5G3A3      -GARA---------------E----NDFKVAKTAEAQSQMSYKALKKRADALNDKTIEYE
A0A2V7UGP8      -FDDT---------------LKTAKMEYEEASAHEKTVRGALEGQKSEAIKQKQYGVEYS
A0A239MKT6      -NSET---------------R----SSYLLAKADEDGIRKRATDQRQQVLELGNSLTALT
A0A3E0PCN7      -ADVQ---------------LSDLQRQFREASSRENELRRNFEAQRNAVLNQNEAAINYN
A0A2V8IYW3      -ADNVVVRRMRETQTEIDKLD----RQIAGKEADSVRLRGTIAEYQRRVETAPTRESEMA
G2LEI9          -LVRI---------------K----TAYENAKRREEELRARVEKQRNEVVTQNGDGVMQR
A0A317J121      -IQRI---------------K----NDYDVALRREKLLSADYTKQASQVSAEATKASQYS
A0A2V7YW66      -TEKA---------------RNAAAASYQTALRQEQSLDGELTTLKGQAIDQNSAAVGFT
A0A2V7Z0V0      -VDKA---------------KSNSLAAYQTAQRQEQELEGELNALKRDVINQSSAAVEYT
A0A2V8GFD4      -AESV---------------R----TEYLAAAAQERSLQAALDQQKHEAQELNRRAIDYG
A0A2V8HSS5      -AESV---------------R----TEYLAAAAQERSLQAALDQQKHEAQELNRRAIDYG
A0A2V8KP55      -VKTF---------------E----VEYSAATERERLLSVALEQQRDAVNKMNREIIQYN
A0A399WNU1      -ADTQ---------------IASLLQTYREAASRENELRSNFDAQRSAVLNQNEAAINYR
A0A2V9JSI3      -AGRV---------------R----NDYRAAMGREKLLAAALAREKEAVGRLNQVLIQHN
A0A2V9WI32      -ASRV---------------Q----NEYLSALQREKLLGAALDVQKQEANHLNESAIEYN
A0A2V8IVN9      -VQSV---------------K----NEYLGSLAKENSFIAALNQQKGEALTMNRKAIDYG
A0A7C5Z4J3      -VERI---------------V----HNYQAAFGRVKLLSASVAREKMEVGKLNQLMIQHN
A0A1F2TPT3      -LEAM---------------R----EDLGVSRAAEANLGKELESLKIEATAQNRKNVELS
A0A2V8JTQ2      -GERI---------------T----YEYQTAAERERMLRDALEAQKQVVDHLNASAVQSD
A0A2V8UZY0      -GKRI---------------T----YEYQSAVGRERILQDALEAQKQTADKLYANAVQSE
A0A350UEK1      -LRRI---------------R----NEYEEAMRKERLLQTDYDRQTRLVTALGEKAIQYN
A0A350UIQ4      -LRRI---------------R----NEYEEAMRKERLLQADYDKQTRLVTVQGEKAIQYN
A0A1H5Z7N3      -LAQA---------------R----QNYIASRTNEQQTRGALEAEKSTAYQLRDQMVQYT
A0A1G7JVV8      -VTEA---------------K----QALVAAQANEAQTEGALEDQKNQSYRLRDDLVEYT
A0A1H4T6W9      -LTEA---------------K----QALVAAKANEDQTSSALEEQKQESYRLRDDLVEYT
I3ZEU5          -LTEA---------------K----QALVAARANEDQTTSALEQQKQESYRLRDDLVEYT
A0A7L5A6M5      -LEQA---------------K----QNFELAKSNQTQTESVLEAQKTAAYKMRDDLVEYT
A0A428MDU2      -LLQA---------------K----QNYVVARTNEDQTSAALEKQKSDAYKLRDDLVEYT
A0A5B9EBI2      -LNQA---------------K----QTYLAAKATEEQTQAALEAQKADAYKLRDELVEYT
A0A239HDF6      -LLQS---------------K----ENYLIAQANEEKTNAALDAQKADAYKLRDDLVEYT
A0A4Q0T270      -LTQA---------------R----ENFNAAKANEEQTTAALEKQKADAYKMRDDLIEYT
A0A1Q3QQB6      -LLQA---------------K----ENFVVARANEVQTKAALEQQKTDAYKLRDDLIEYT
A0A3N1K1G7      -LLQA---------------K----QNYVIARANEDQTAAVLEAQKTDAYKLRDDLVEYT
A0A4V2G466      -VLQA---------------K----ENFLAARTNQEETAAALEKEKSDAYKLRDDLVEYT
A0A6B9YNQ8      -VLQA---------------K----QTYLAALKDEQDTTAALEAEKNQAYKMRDDLVEYT
A0A7G8BSK5      -VLQA---------------K----QVYLAARTNEDETRATLDSEKNDAYKLRDDMVEYT
A0A1I6MH75      -LIQT---------------R----EAYLATKANEQQTSAALEQQKTDAYKLRDDLVEYT
E8WVF6          -LTQA---------------K----ETYLIAKANETQTTAALEAEKQDAYSLRDAQVEYT
A0A3N5YNR8      -INRV---------------Q----SEYRVAVNRRQMLLGALNRQKSEANQLNQDSIQYN
A0A3N6A5T6      -IQRA---------------R----AQYQVAVDRRNRLQTALVAQKEMADQLNENSIQYN
A0A1F2Q9L4      -VGKA---------------RDSARAEYQGALRREEALVAELTRQKSDAMQLNSAAVEYN
A0A2U3KC61      -QHGV---------------R----DEYLAAVQRENLLTTAFNQQTQQANQLNESAIEYS
A0A2V9Y2R7      -QHRI---------------R----DEYLAAAQRERLLTSAFEQQKQRANLLNESAIEYS
A0A2V9NGH6      -IARV---------------R----SDYLASVHREEMLRAAMEKQKQEANQLNESAIEYT
A0A2V9PYE6      -IARV---------------R----SDYLASVHREEMLHAAMEKQKQEANQLNESAIDYT
A0A2V9NL07      -GGRL---------------R----GDYLAALQRENMLRSALEEQKQQENKLNESAIEFS
A0A2V9QD92      -GGRL---------------R----GDYLAALQRENMLRSALEEQKQQENKLNESAIEFS
A0A2V9WPZ6      -GGRV---------------R----GQYMASLHREGLLRDALEKQKQQANKLNESAIEYS
A0A2V9ZLH4      -AGKV---------------R----NQYLAAVQRESMLHDAMEKQKQEANKLNESAIEYS
A0A2V9RQF1      -TSRV---------------R----SDYLASLQRENMLRDALDRQKQQANRLNESAIDYS
A0A2V9YDK8      -AGHV---------------R----SQYMASLQRENMLRAALEKQKQEANKLNQSAIEYS
A0A2V9V8F7      -GGRV---------------R----GQYMASLHREGLLRDALEKQKQQANKLNESAIEYS
A0A2V9XGR9      -SGRV---------------R----GQYMASLHREGLLRDALEKQKQQANKLNESAIEYS
A0A2V9V3Q5      -VDHL---------------R----GQYQTALQRETMLRAALEKQKQEANRLNENAIDYT
A0A2V9NWS3      -VARV---------------R----SDYLAALQRETMLRGALTKQKQEANKLNESAIEFT
A0A2V9USA9      -ASKV---------------R----GQYMTALQRENMLRDALEKQKQEANKLNESAIQYN
A0A2V9XW18      -VAKV---------------R----GQYNAALQRENMLHTALDKQKQEANKLNESAIEYT
A0A1H5SQF5      -GNQA---------------A----RNLDLARKTEDGLLQSVDREKLRLGHMTTSADQLL
A0A2V9AEW6      -LGRM---------------R----NEYEAALRREKLLTEAHDAQQKVVADQSSKAIHYD
A0A2V8WQK6      -LRGL---------------G----NEYAAAVRRERLLSKAQAEQEKIAADQSDKVIHYD
A0A2V8XIF4      -LRRI---------------G----NEYTAAVRRERLLVEVHANQEKVVADQSSKAIHYD
A0A2V2R0I6      -LNGL---------------E----ADYREARQHENLLMRELEDQKAQANAMAEKLVEYN
A0A2V8XAR9      -VDVL---------------E----SDYREARQRESMLTQALDQQKAAANQMAEKLVEYN
A0A2V8VZA0      -LDVL---------------E----SDYHEAQQRETLLTQALDQQKAETNQMAGRLVEYN
A0A1Q7CB82      -LDVL---------------E----SDYHEAQQRETLLTQALDQQKAETNQMAGRLVEYN
A0A2V8WIU1      -LDVL---------------E----SDYHEAQQRETLLTQALDQQKAETNQMAGRLVEYN
A0A1Q6Y9F5      -LNVL---------------E----SDYHEAQQREALLTRALDQQKADTNQMAGKLVEYN
A0A2V9EVV8      -LDVL---------------E----SDYHEAQQREALLTRALDQQKADTNQMAGKLVEYN
A0A2V8YF91      -LDAL---------------E----SDYREARQRETLLTDALDQAKAEANQMAERLVEYN
A0A2V8XZK2      -LEVL---------------E----SDYREARQRETLLSEALDQAKVEANQMSEKLVEYN
A0A2V8ZTX6      -LDVL---------------E----SEYREARQRETLMGQALDQAKAETNQMAEKMVEYN
A0A2V9BT79      -LEVL---------------E----SDYREARQRETLLADALNEAKAETNQMAEKMVEYN
A0A2V9YHT3      -GGRL---------------Q----SEYQAATQRETLLQEALNQQKREANRLNERAIQYT
A0A7C2XNI7      -VDRI---------------E----SEYRAARQRELLLSQALEQQKAEANALAEKLVQYN
A0A1Q8B793      -VTSI---------------E----NEYRAARQRELLLLKALDQQKAEANQMAERLVQYN
A0A2V9BCA0      -VTSI---------------E----NEYRAARQRELLLLKALDQQKAEANQMAERLVQYN
A0A2V9BWU9      -INRI---------------E----AEYHTARQRENLLSQALDKQKGESNAMAEKLVQFN
A0A2V9DKX2      -VNRI---------------E----AEYHTARQRETLLSQALDKQKGESNAMAEKLVQFN
A0A7C2YQY3      -GNRI---------------E----NEYQAALRREQLLRKAVEGQKAEANVMNAKLVEYS
A0A3E0NV31      -ADAV---------------L----QQYRAAQRRADSFAAQIRAERRSSDRESEAAVQLE
A0A3N5M5V0      -IRRA---------------Q----SEYKVAVNRQQMLRRALQKQKAEANQLNQDSIQYN
A0A3N5XQP8      -LEEA---------------Q----GRYRASLQQYSQLSRVMDRQRQLAYRLNSDLVQFN
A0A2Z5G7H4      -AERS---------------K----NDYEIARREEDESRTEFATEKHQADSLNDKAIEYA
A0A2V9L5B5      -VDNI---------------V----DEYRSATAKEQYFAQAVDDQKREVNEIAARSIQYN
A0A2V9LK56      -VQNL---------------V----DAYSSAVNREKYLEQALKGQEKQVNDIAEKTIQYN
A0A2V9L7I0      -TENI---------------V----DEYRSAAAKEKYFAQAVEDQKREVNRIADKSIQFN
A0A522PPT0      -TQNI---------------A----QQYDAAVVREKYLNSLVSQQESLVDVVSQKTIQYN
A0A7C5V1G5      -TKNI---------------A----QEYQAAEARERYLNDLIKKQEKLVDVVSQKTIQYN
A0A2V9KCS3      -LKRI---------------R----NEQEAAVRRESLLAAEYGSQAKLVSEQSGKTIHYN
A0A372IT17      -GERA---------------H----ADYEIAQRAEDTAREEFEKQKTLAAQMNDRRIAWT
A0A4R1LC91      -AERA---------------Q----NDYLVAQGVENSTQKVFDEEKKQADAMNDKSIEYA
A0A3M2BZG9      -VNQR---------------RDLARTAYQEALRKEQNVEEELRKLTDEISAYSSSALDYT
A0A1Q7N5R7      -LATE-------------------------LESREAVLGTQITAGGRELRGIPQRAIEEA
A0A2V9QB26      -VDRI---------------R----NDYKTALRREKLLSAAYRNQSRLVTDQDEKSIQYG
A0A2V9VYY4      -QQKM---------------R----DDYLAALQRENLLDSAFNKQKQEANKLNESAIEYT
A0A3E0PHB0      -KQIIEDESKTLEKAVQKEITSALAAKLNTARRREAQLAAAYEQESAKANQQGQKETMLT
A0A3M1SIV3      -SAQIEQESKQAEERAKKEILTGLAAQLNSARKREAKAKESYLREVEKANQQGQAAMSLT
A0A3M2D491      -EKKLELESKLLEQRAQKELLTALSAQLNAAKQKEEQARASYLAEVERSNQQGQAGMRLK
A0A353C9L6      -SGIIDRDQKKIEKDAVTGALVSLRAQLDSKRREEAQALDAYEKEAALANVQGQAQTKLT
A0A2V8RQV0      -SKIIDTDQKKIEKEAVSGALVSLRAQLNAARTQEAQAQAAYEQESGTANVQGQAQTKMI
A0A2V8SJH5      -STIIDKDQKKIEKDAVNGALVTLRSQLSAAQKQEAQSLAAYEQEASQANVQGQAQTELI
A0A357F267      -TQIIDRDQKKIEVDAINGALVSLKAQLDAKRKEEAQAQAAYDAEAARANIQGQAETKLT
A0A7C5ZUA8      -SQIIERDKKSLEKDAVSGALVSLRSQLESKRREEAQALAAYEKEAALANLQGQAETRLT
A0A136JPP4      -SQIIDRDQKKIEKDAVSGALVSLRSQVDAARRREDQLLNAYEVEAERANVQGQAATTLT
A0A399WUJ8      -SQIIDRDQKKIEKDAVSGALVSLRSQLDAAKRREDQLLNAYEVEAERANVQGQATTTLT
A0A2V9KIE8      -VENI---------------V----EEYHAAESNEKLLAQAVVQQKAEVNDIAQKTIQYN
A0A352F549      -KQII---------------TTNLEVNYRKAVEREKTLRDSFNKQRGETVAQNQAAINYN
A0A3B9MLP9      -RKII---------------TVSLDSNYRQALDREKTLRDSFNKQRAETVAQNQAAINYN
A0A3D5SQ87      -RKII---------------TVSLDSNYRQALDREKTLRDSFNKQRAETVAQNQAAINYN
A0A2V8NW86      -VDRI---------------R----NDYETALRREKLLSAEYRNQSRLVTDQDEKSIQYG
A0A7C2GJ20      -LANI---------------E----AEYKAAVRRERDLRAALEQQRAETLRQNERAIELS
A0A7C4BTL5      -VNRI---------------R----NEFEEAAQRERMLARDYAEQTRVVTAEAERSIQYN
A0A2V8ZHL8      -VERL---------------R----NDYMAALGREKLLAAAVAKEKADVGALSQLLIQHN
A0A2V9B240      -VERL---------------R----NDYEAALGREKLLAAAVAKEKVGVGALSQLLIQHN
A0A2V9CBM2      -ADQI---------------T----NEYFAASSRESLLRHELAEQQKQIDRIAEKSVQYN
A0A2V8XN17      -ADRI---------------A----NDYSAAVRRENLVQQALDNQQKQVSLIAEKSVQYN
A0A2V8WX45      -ADRI---------------A----NDYSAAVRRENLVQQALGEQQEQVSLIAEKSVQYN
A0A1Q6YR79      -ADRI---------------A----NDYSAAVRREDLVHQAVDGQQKQVSLIAEKSVQYN
A0A1Q7VA32      -ADRI---------------A----NDYSAAVRREDLVHQAVDGQQKQVSLIAEKSVQYN
A0A2V9EY85      -ADRI---------------A----NDYSAAVRREDLVHQAVDGQLKQVNLIAEKSVQYN
A0A2V9H8K0      -TDRI---------------V----NDYSAAVRRENLVQQALNDQQKQINLIAEKSVQYN
A0A2V9FFE5      -ADRM---------------V----NDYSAAVRRENLVQQALDDQQKQVNLIAEKSVQYN
A0A2V9GM43      -ADRM---------------V----NDYSAAVRRENLVQQALDDQQKQVNLIAEKSVQYN
A0A2V9CYQ5      -ADQI---------------T----NQYLAASSRESLLRHELAEQQKQIDLIAEKSVQYN
A0A2V9BWU8      -ADKI---------------T----NEYSAAVRREELVKQALDDQQKQVNVIAEKAVQYN
A0A2V8ZG48      -ADKI---------------V----NEYLAAVRRESLVKQALDEQQKQVNLIAEKAVQYN
A0A2V8Y334      -ADKI---------------T----NEYFAALRRESLVKEALDGQQKQVNLIAEKAVQYN
A0A2V9AY68      -ADKI---------------T----NEYFAALRREGLVKGALDTQQNQVNVIAEKAVQYN
A0A1F2RFI7      -AKRV---------------T----DDYRAALNRKRLLDQAVEQQTKEINQIAEKSIPYN
A0A1F2RZS3      -AQRV---------------A----NDYKAAANRKRLLDQAVAQQTSDFNAMAEKSIQYN
A0A1F2USE2      -AERI---------------R----KEYGAAQQRQEFLRQAFQKQEEQANLIAEKSVQYS
A0A7C2VB08      -AERV---------------G----NEYRAALAREQMLVRAFAEQQQRRNQVAERSVQYN
A0A2V9C238      -AGRI---------------T----NDYLAAVRRENLVAQAFAEQQKQANLIAGRSVQYN
A0A1F2Q9F5      -AERL---------------A----NDYQAAMRRETLLRRAFADQQAQAGRVAEKSVQYN
A0A1F2QQH9      -AERL---------------A----NDYQAAMRRETLLRRAFADQQAQAGRVAEKSVQYN
A0A1F2QXK7      -AERL---------------A----NDYQAAMRRETLLRRAFADQQAQAGRVAEKSVQYN
A0A2V9DEM9      -AGRI---------------I----NDYLAAVRRENLVAQAFAEQQKQANLIAGRSVQYN
A0A7C5TWV7      -VKGL---------------R----TDYRIRKAREASLYRALQQLRDQAINLSKQNLEYE
A0A2V7XDY0      -IAAL---------------R----ADYEQLQKRESELRGAIDTEKAQAASQSRKAAELD
A0A2V8G155      -VDSV---------------K----TDYLAAVAQERSLTAALEQQKTEALVMNRKAIEYG
A0A2V8HDM7      -VDSV---------------K----TDYLAAVAQERSLTAALEQQKTEALVMNRKAIEYG
A0A2V8DRT9      -VHAL---------------S----NDYQAALAQEQSLMHALDQQKNDALALNRKGIEYG
A0A2V7VYF3      -VESV---------------H----NEYLTALAREQDLVAALNAQKNEALGQNRKAIAYG
A0A1F2SVH2      -VQAM---------------R----NDYRQTVAQEQSLMSALEQQKSEALSLNRKGIEYG
A0A2V8AJG9      -VQSV---------------K----NEYQAALIQEQTLTGALDQQKRDALALSRKGIDYG
A0A2N9LQU7      -GQRL---------------H----DEFLAAQNSESLLRDQFEHQRQEAFNLNASAVQFA
A0A2P6WFK7      -GRRM---------------E----TEYQSAAKTEAALRNQFNKQKEEAFKLNEHAVQYL
A0A2V8U914      -RQSV---------------Q----NDYVAAQRRQTGLASVYARQSALVSKMTAKMTHYN
A0A2V7W309      -LEEA---------------R----AQVSAASSREGSVRSAYEQQRTEAQRLNVDAAKYF
A0A2W0BGU4      -AQRI---------------R----NDYFAAARREQLLGATLAEQKKESGNFNRLLIEHD
A0A2W0BVQ9      -AQRI---------------R----NEYFAAARREQLLGATLAEQKKESGNFNRLLIEHD
A0A2V9MN96      -LSKV---------------R----DEYMAAIQRETLLTSAFDHQKQEANQLNESGIEYT
A0A2V7V2Z1      -IRAA---------------E----NDYKAYAAQEASVASALEAAKAEALDLSRRSVQYD
A0A2V7X2F7      -IRSA---------------E----NDYKAAAAQEASLAAALESTKEEIQELGARSGHYD
A0A2V7V2I1      -IRAA---------------E----NDYRAAVAQEHGVADALEMAKREALELSRRGVQYD
A0A2V7U3M2      -IRAA---------------E----NDYKAAAAQEASVSSALEAAKAEALDLSRRSVQYD
A0A2V7UHT0      -IRAA---------------E----NDYKAAAAQEASVSSALEAAKEEALDLSRRSVQYD
A0A2Z5FVL3      -RDRA---------------R----NEYVVAQQVESGAKQLYDAEKQRADEMNDKAVQYS
A0A2V9KBD6      -GDRL---------------T----YEYHSAAERERMLRAALEKQKQVADDLDAHAVQSE
A0A2W0AJ66      -RERM---------------T----NEYRMALERERMLRNALETQKQAADTLNANAIQYN
A0A1Q7RBU1      -GEHI---------------T----YEYKSAVGRERMLRSALEAQKQAADKLNANAIQNN
A0A2V9JPV9      -GERI---------------T----YEYKSAVGRERMLRYALEAQKQAADELNANAIQYD
A0A3P0X3W6      -GRRI---------------Q----TDFAQADTREKMLAATLAAAKAQSDALSLKSLEYQ
A0A2N9MK30      -MRRV---------------E----VEFREGVNREEMLKKAVTETKAEFDRLNARSFEYE
A0A3D1ASD2      -TEQV---------------A----IEYRTATQREQMLKQELARTKSESDALNARSFGYE
A0A7C5AXI3      -KRRV---------------E----IEYQEALRRESMLQKAVQETKAEFDNLNARSFEYQ
A0A7C6E4H7      -VRRA---------------E----VEYREALNREAMLKKAVDQTKAEFDRLNARSFEYQ
A0A1F2TCR2      -IETA---------------K----TDYEAAVAEERSFASSLEDQKRVAMDLDRKSTDYS
A0A350UQT3      -IRRM---------------Q----VEYEQAQAREKMLERSVNETKAEYDTLNFRSFEYQ
A0A7C3HRX0      -ARRM---------------E----VQFREVSAREQMLARSVAETKAEYDALNMRGFDYQ
A0A1F2V330      EKESL---------------E----QRLTSYGQEERALESEMGRLQRRVQSTPQHEIAIT
A0A662EE63      -RLGM---------------E----TRFDMVKRREQSLFENIQGLRNQTIELSKTSLEYD
A0A2V8TLH7      -ISNL---------------R----TQYALLKDRESKLAVAINETRSESLRVNQKASNYE
A0A1Q7ZJT1      -INGL---------------R----SQYDLLKDREAKLIKATDETRTESLQVNRKASGYE
A0A2V8VC99      -INGL---------------R----AQYELLKDREAKLIKVSDDTRAESLQVNRKASSYE
A0A348UZU3      -IRAA---------------Y----ADYQAALKKEASLKELFEQQKEEAFRLNSNAILYN
Q01XL7          -LKRL---------------D----NDYQEALRREKLLSGAYNAQTHAVGAQADKASQYA
A0A2V8ERZ5      -VQSV---------------K----NEYETAVLQEQTLARNLDGAKSEAQDLNRKGIGYG
A0A2V8GTX0      -VAAI---------------K----ADYQAALDEEKQLSADLEGQKAQATDLNRKSIDYS
A0A2V8J0X9      -LESL---------------K----NDYNAAFAQERSFSSQLEEQKGASMDLDRKSGDYK
A0A523DUV7      -VAGM---------------R----ADYQQLRRRERELLASINSQRKESIEDSRKTVQLE
A0A1F2U158      -LQTV---------------R----NEYERAVLEERTFAANLEEAKKDVQDLGRKSVSYN
A0A2V8F6S9      -ATTI---------------K----NDYESAVLEEQTIARGLESAKADAQNLSRLGVDYN
A0A7D8BEX2      -LSQS---------------K----LAYSAATANEAMTKTALAEQQKDAFQSRDEMVRYA
A0A4Q1SCH5      -TAHL---------------K----QDLDASRQAESLMHQEYQDAVSQAYALNRKQADYA
A0A372IRG7      -TQRF---------------Q----TEYDAAVKTEGLLQQRLDDTKQQAFHENESAAQFE
A0A2V8K4L4      -VTRL---------------R----NDYAAAESHEKLLNDEFAKQLDTVSSQAANEVHYN
A0A2V8NCZ3      -VTRL---------------N----NDYAAAQSHEKLLNDEFAKQLNTMSSQTAKEIHYN
A0A4Q7YNP3      -SNRL---------------K----NELETARHREMLLMTAYHMQEANVSSDLGKAAQVS
E8UZE1          -RNQL---------------E----LEYKLASENENKLRAATEAQKQQIFSMNEDALHYS
A0A2U3JZ71      -GQRV---------------E----VEYREALNRESMLRKTVSETKAEFDALNARSFEYQ
A0A2V8TTB0      -AQRV---------------E----IEYREAVNREAMLEKAVAETKAEFDRLNARSFEYQ
A0A1V6HR88      AREAA---------------R----AEYQGAQRREAALAAEINSLKVENREVNSASIEYN
A0A3E0P0A3      AVTAA---------------R----ARYQQALQTERSLEREYEAMKEETRRYQSASTALQ
A0A2V8EXP2      -VQAV---------------R----NEYLSAQTQEQSLINVLDQQKREALALNRKGIDYS
A0A2W4RYA1      -VASI---------------T----AQYEAAVAHENNLLAALAQQEREAQQLNAKAVEYR
G8P0Y7          -VSRI---------------H----NDYQTAVNREQMLQEALGEQMGIADQLNQNAIEYK
A0A5M8T4U7      -HRQI---------------Q----DEYQGALRTEQLLRQRLDAQKEEAFRLNEDVGQYA
A0A7L5A491      -AKRM---------------Q----VDYEEAKSRESMLLAELTRAKSESDAVNSNTIDYQ
A0A7D8BF18      -LVDA---------------K----AAYIAAKAEEDHTKAALEAQQDEAFRLRDALVNYT
A0A1E3Y9R6      -AAAL---------------Q----AEFQTARAREAALQQSLAGQQRESLGLDRQMLDYS
A0A2W4TLP2      -AAAI---------------E----ADFETALARERALQQSLDQQQRESLGLDRRMLEYA
A0A7G8BDY8      -QERF---------------R----TDYEASAVAEKQLRASFDQQKQKAYDMSEGLSEYG
A0A7C4BZ42      -VRRL---------------G----NDYQSALRREQLLLAETNVQSRLVSVQAAKSVHYN
A0A3R9WF43      -TKRA---------------E----NAYQYAKDNENSIKGQFEKQQHEAIQLADNTVQLQ
A0A317HKM4      -AHTI---------------R----NDFEAAQSREQALEAALDRSKREVQALNAKAVEYS
A0A2V9CG11      -LRRI---------------G----SEYSAARQREEFLAKAYADQEMIAADQSSKAIRYR
A0A523E0N1      VVGTA---------------K----GEFQEARDRENSLRKSLNAQKSQVRKLAHAASDYG
A0A4R1LAZ7      -TQRF---------------Q----EEYNAASNTEALMRKRLDATKQEAFRENESSAEFE
A0A7G8BMP1      -TNRF---------------E----EEYNTSVKTENLLHQRLEEIKQEAYHNNESAAEFE
A0A523ECP2      VVAKA---------------R----VEYRAAVEREHLLLAEVESQKKEAQELSKLTTNYT
A0A2W0C122      -QARA---------------E----LEYQVASRREQKLRAAFEAQKVEANRLNVSAIQYG
A0A2W0AUU7      -QGRA---------------E----LEYQVAARREQKLRAAFEAQKIEANKLNESAIQYG
A0A2W0BQL1      -QGRA---------------E----LEYQVAARREQKLRAAFEAQKIEANKLNESAIQYG
A0A4Q1SDL1      -QARA---------------K----SDYEIAQKTENDSRAQYEANRQAADALKDKAIDYS
A0A3P0XH15      -QQRF---------------Q----VEYETALSTENLMRKRLEDAKQQAYQQNRSSAEYQ
A0A3M1WQW8      -LAKI---------------E----ADYKAARTREENLRAELMAQRAETLRQNERAINLS
A0A3N1JHC1      -VKRL---------------S----VEDDTAARRQQLLKQQYDRQLAVVTDQGSKQVRFN
C1F294          -TQRF---------------K----AEYDAAVQTQNLLEARLENTKQQAFKQNESSAQFE
A0A2V9KA79      EVEAI---------------D----QRLNSSKQEQRDLTAQLETYRSRVQSTPTHAGALA
A0A522PSP1      -LAQI---------------K----AQARAQAVQVKLTERQLADVKAQLEEFNRKGVEFQ
G8P085          -KNRL---------------K----QEYDTAVAIQSSLQQQYDEQTDKAYALNRKAAEFA
A0A7C6A629      -LRRA---------------E----VEYREAMNREAMLKKAVDEAKAEFDRLNARSFEYQ
A0A4Q1SGQ1      -GHRA---------------R----VDLDIAQNTENAARDAFEKQRSTADAMSNRTVAYQ
Q1ILD9          -EARF---------------S----SEYEASLNTENKIKGNFDQHQQEALSKSQNFSEYS
A0A7G8BJH7      -GERA---------------R----TDYEIASRAETSARDAFEGQKKVVNALNDKAIAYG
A0A7C5SHM3      ALSGA---------------R----ADVVAAREQEQRLRDLYEREKQLANAKQYQASEVE
Q1IJZ6          -VDRT---------------E----LDLELARQSEDALRQAYEKQEQEANKINDSQIRLA
A0A2V8TCE6      IVSAE---------------Q----AKYRAALDEEERLGKLLEEQKSEAQRTGRDSIEYA
A0A522TBE8      -AGAA---------------R----AQFVAARLQEMLLEQAVAQQKQAMDQFERRAITYR
Q1ITG0          -EERF---------------R----TEYESAKRTEDQLRASVENRKKEAFSQSAKFSQYD
A0A7C2ML20      LLSKV---------------A----KEYKNADNRLQTLTGELERQKKEIQQHNREALQFS
A0A7C5AXS9      -LERI---------------R----NEFEAAERRERLLARDYEAQSKVVSDQAARAVHYN
A0A7C2RGE3      -VANI---------------E----AEYRAAVRRENDLRAALERQRAETLRQNERAIELS
A0A3N5PCI5      -VESV---------------R----QEYLAALSREKELTAELDAQKSRALALNRQGIEYG
A0A3M1Q0S9      VREAA---------------K----IDYEQARRRAEGLRRLYEETEQRVSELQQAFVEYE
A0A2Z5G448      -LKRF---------------E----EEYNAAVNTEALLKGRLEQVKQEAFRVSDSSADFE
A0A3M1VZ38      AIDSA---------------Q----AAFEQARREEQQLAQLLADATREASEADRAMIEYE
A0A4Q1SD29      -TKRF---------------T----EEYDASVNTESLMRARLEATKQEAYRENESAAQFD
A0A6N9FGE2      -VDSL---------------R----IEFEVASSRERELAAELDRQTANALALDRTGIEYN
A0A3M1PY35      AVGAA---------------R----ADLELARTREARLQALFQQELAATDALQRRAQDYD
A0A3M1VMP2      ALESA---------------R----AELALRRESEARLQRLIEEEQARAAQLQLATGELE
                                                                            

A0A2V7VMF7      VLKKEAQSAASLYDVLLQKLNESD--------------IA-A--SIRTNNA----SVVER
A0A2V7YYV7      -------------------------------------------------------VPVSP
A0A2V7Z0J5      -------------------------------------------------------VVLSP
A0A2V7Z3M4      -------------------------------------------------------VVLSP
A0A399Y5V2      --KTSDTGSQALVATLTNRREQAAAVQSFWKTALDKLQIQ-S--NLQTSSA----ETVAP
Q01X01          --RAEGDGNREFYDAMARRANEAS--------------VA-S--TLRQSNV----RLVDP
A0A3M2D9H8      ---------QQIYANLLSNYEAIR--------------LA----RLQSTP-----EVVQV
A0A2V8JK38      ILKREADSSKDIYNGLLTRLKEAG--------------IS-G--GLRASNI----RVVDQ
A0A2V9IXG5      SFIKSKENWASAFAAVEQKLRDLS--------------LQ-E--GFVTSNI----KVVEH
A0A2V9J2P4      SFIKSKENWASAFAAVEQKLRDLS--------------LQ-E--GFVTSNI----KVVEH
A0A1Q7RLS4      MVRGEATETKRIYDLISARVKEID--------------LS-S--SLLSNNL----RILDK
A0A2V2R525      ILQQEIQTNQELLNGLWQRYKEND--------------VIL-AGT--PNNI----RVADY
A0A321LPW6      ILKQDVDTAKSLYTEFLQKTNQAN--------------LEL-AQQ--SSAL----HVIEP
A0A2V9R9V4      LLKQDVDTAKSLYTEFLQKTNQAY--------------LEV-AQQ--QSNI----RIISP
A0A321LE75      ILRQNVETAKTLYTDFLQKQSQAR--------------VQV-AEQ--HNNM----RVIEP
A0A2V8R8U7      IKTQELTTDAQYLNTLMQKRRELA--------------AGG-ADR--GTDV----SVSNY
A0A2V8QMP4      DLDQQIATDRQNLNLYMQRANELK--------------VTAPDRA--SGNV----TMVEE
A0A2V8R4S3      DLDQQIATDRQNLNLYMQRANELK--------------VTAPDRA--SGNV----TMVEE
A0A2V8NJ55      GLTQELETYRQLFQTLSQKQNEID--------------LAG-NDQ--GNNV----TVATP
A0A2V8Q7I0      QYKQELETDKQYLNTLMARKRDVQ--------------TSN-TDR--ANEV----SIENY
A0A2V8S6K4      NVEQQLTTSKQMLSTLLQRRQELE--------------TADIEGQ--SNNV----IIQTP
A0A317I2L9      SYTQTLETNKQYLNTLQQRLREIQ--------------ASS-GDR--GNEV----SVENY
A0A2V8LLF9      IITQALTTDQQYLNTLTQRLRELT--------------ATS-GSG-TASEV----SIANY
A0A352FRF4      SMRADLASDQQYLNTLFQKRRELN--------------AVS-GET--GTNV----SVSNP
A0A2V8MKV0      AMTQKLTSDEQYLNTLNQKERELK--------------ATG-SDK--GTNV----SVVSY
A0A2V8PYY8      AMTQNLTSDEQYLNTLNQKERELK--------------ATG-TDK--GTNV----SVVSY
A0A1Q7YKQ8      MIEQEIETNRQYLTTLLQRQRELE--------------NEQ-TGRMQTNNV----SVSQY
A0A352F3R7      ALTQGLETDKQYLNTLLQRQRELQ--------------VTS-GDR--SNEV----NIATY
A0A0B6WXT1      RITQELETNKQFYNTLFQRQKELE--------------ITS-NDR--ANNI----TVATP
A0A3B9MEU8      AITQELETNKQYLNTLLQRERELT--------------VAS-GDR--SNEV----SIPTP
A0A2V8MHG6      IIQQQIETNKSLLDGLLQRSKENE--------------VIL-AGT--PNNV----HVVDH
A0A2V8P7N1      IIQQQIETNKSLLDGLLQRSKENE--------------VIL-AGT--PNNV----HVVDH
A0A2V8M3M6      IIQQQIETNKSLLDGLLQRSKENE--------------VIL-AGT--PNNV----HVVDH
A0A1Q7NJH5      IIQQQVETNKSLLDGLLQRSKENE--------------VIL-AGT--PNNV----HVVDH
A0A2V8PJY0      IIQQQVETNKSLLDGLLQRSKENE--------------VIL-AGT--PNNV----HVVDH
A0A1Q7Y6W9      IIKQGIETNKQLLDGLLQQERTND--------------VVG-EGT--PNNI----HIVDY
A0A2V8NC68      ILQQEIDTNKSLLDGLLQRAKEND--------------VVL-AGT--PNNI----HVLDY
A0A399WK13      LLKQTIDTNKGFLENLRKQVSSND--------------VAA-QGS--DNNI----TVTEP
A0A352FLX4      IIQQEIETNKTLLDGLLQRTKEND--------------VVM-AGT--PNNI----RVVDY
A0A2V8RTL7      LLEQTIETNRGFLDNLRKQQSGND--------------VAS-QGS--DNNI----SVASF
A0A3E0PCJ6      LLEQDIETKKGFYANLENQQKGND--------------LAG-AGT--ENNI----SVAEI
A0A3M1S4R8      LLEQNIETNRGFLKNLIEQQSSND--------------VVA-QGT--TNNI----SVVDL
A0A7C2G442      LLEQNIETNRGFLKNLIEQQSSND--------------VVA-QGT--TNNI----SVVDL
A0A1Q7YFI6      IIQQEVETNKQLLDGLLQTAKGND--------------VVM-SGT--PNNV----HVLDY
A0A136KC10      LLKQTIDTNKGFLENLQKQVSSND--------------VAA-QGS--DNNI----SVTEP
A0A3M2D6Y5      LLEQNLETNRGFLKNLIEQQSSND--------------VIA-RGT--ENNI----SVVDP
A0A2V8SEX6      LLEQTIETNRGFLDNIRKQQSSND--------------VAS-QGS--DNNI----SVAGF
A0A7C5ZUU4      LLEQNIETNKGFLDNLRKQQSGND--------------IAS-QGS--DNNI----SIADY
A0A0B6WWQ6      IIQQEIETNKSLLDNLLQRAKENG--------------MAM-AGV--ANNI----HIVEY
A0A3B9MK99      IIQQEIDTNKTLLDSLLQRSKEND--------------VIM-ASK--PNNI----SIVDY
A0A352EX26      IIQQEIDTNKTLLDSLLQRSKEND--------------VIM-ASK--PNNI----SVVDY
A0A2V8MM59      ITQQEIDTNKGLLDSLLQRSKEND--------------VVL-AGR--PNNI----SIVDY
A0A2V8PFE8      ILQQEIETNKGLLDNLLQRSKEND--------------VVL-AGR--PNNI----SIVDY
A0A2V8PWS6      ILQQEIETNKGLLDNLLQRSKEND--------------VVL-AGR--PNNI----SVVDY
A0A2V8LCT5      ILQQQIETNRGLLDNLLQRSKEND--------------VVL-AGR--PNNI----SVVDY
A0A352FTJ9      ILQQEIETNKGLLDNLLQRSKEND--------------VVL-AGR--PNNI----SVVDY
A0A257VBK0      GLNTSSAAIKKYMDLLYDKMSELN--------------VS-S--SLMSSNV----RMVEP
A0A2G6PYV5      EQNSLVIDKRKEYLELALGLKEIG--------------RTDK-------------VIVEH
A0A2V8F956      -----VQSSRQIFDSLMQRAKETG--------------VS-A--ELKTSNI----RVVDR
A0A1F2S1W5      ALQRDAAANRQMFEALLKRTQETG--------------VS-E--ELKTGNI----RVVDL
A0A1F2T595      ALERDATANRQMFEALLKRTQETG--------------VT-E--ELRTGNI----RVVDP
A0A2V8JQV5      RLKREADSNRQLYEAMLQKVKEYN--------------IA-S--AVTANNV----NIVDP
A0A2V9AC41      MLAREVDMNKQLYDGVLQRLKEIG--------------VA-A--EIRSSNI----YLMGK
A0A2V9MAM9      TLNREVATTRQFYEAMLQKVNDAG--------------VA-T--AIRPSNI----RVVGP
A0A348V070      SLKIETDNKKALLEALSKRQSETD--------------LASRLKDLQALNV----WIVDR
A0A2V9M454      LLKREFESNQQLYDNLLQHLKDGN--------------VS-A--GLRATNI----RIIDE
A0A2V9IVR7      ILKHEFETNQQLYEGLLQRLKDAT--------------LS-S------------------
A0A2V9ILE2      ILKHEFQTNQQLYEGLLQRLKDAT--------------LS-S--GLRATNI----HIVDQ
A0A2V9LGY4      ILKHEFQTNQQLYEGLLQRLKDAT--------------LS-S--GLRATNI----HIVDQ
A0A2V9J4D6      ILKRDSDTNQQLYDNLLQRLKDAT--------------VT-A--GLRATNI----HVVDK
A0A2V9L9C5      ILKRDSDTNQQLYDNLLQRLKDAT--------------VT-A--GLRATNI----HVVDK
A0A2N9M9N1      ILKGDFETNQQLYDELLKRLKDAT--------------VS-V--SLRATSV----RLADA
A0A2V9JEC4      ILKGEFETNQQLYNDLLRRLKDAT--------------LS-V--SLRAASV----RVADR
A0A2V9LPQ3      ILQREFQTNQQLYDDLLQRLKDAT--------------VS-A--GLRATNI----HIVDT
A0A2Z5G3A3      LTRQEATDSRTLYVSLLGRLKEAG--------------LL-E--GLRSTNV----SVVDP
A0A2V7UGP8      NLKAAVDSKREILNKLMQRETETG--------------SLSQLKNAGTGNV----WVVDA
A0A239MKT6      FLQQEENTSRGLYQDLYTRLQEAS--------------IS-A--GVRSTDM----VIVDP
A0A3E0PCN7      IIRQEIATNKTLLDSLLQRARETE--------------VI-L--NGTPNNV----NLVDR
A0A2V8IYW3      ELTRDYETLKKGYESLLAKKEDSN--------------IA-A--NLEKQQVGEQFKVLDP
G2LEI9          MMQDNIDNKKKMLQALQATTKDTE--------------IN-L--RMDLNNI----TVVDR
A0A317J121      GLKREVETLQQTYSAMLLQANESN--------------IN-SSVPLGMGTI----RLVDP
A0A2V7YW66      NLKVEIQTRRDLLNELMHKQSETE--------------VAVRLQDTRQSNI----RIIDK
A0A2V7Z0V0      NLKVEIQTRRDLLDELMRKQSETE--------------VAVRLQDTRQSNI----RIIDK
A0A2V8GFD4      VLQRDAATNRQIFDALLQRSKETG--------------IS-G--ELRTSNV----RVVDA
A0A2V8HSS5      VLQRDAATNRQIFDALLQRSKETG--------------IS-G--ELRTSNV----RVVDA
A0A2V8KP55      ILKREADSSKDIYNGLLTRLKEAG--------------IS-G--GLRASNI----RVVDQ
A0A399WNU1      IIQQEIDTNKSLLNSLLQKARETE--------------VV-L--NGTPNNV----HVVDR
A0A2V9JSI3      LLKREFETTQQLYENLLQHLKDAT--------------VS-A--GLRATNI----HVVDP
A0A2V9WI32      LLKRDAESNRQLYEGLLQKLKEAG--------------VS-A--GLRSSNI----RIVDV
A0A2V8IVN9      VLDRDVQSSKQIYESLLQRAKETG--------------VS-T--ELKTSNI----RVVDP
A0A7C5Z4J3      LLKHEFETNQALYDNLLTKVKDAA--------------VS-S--GLRASNV----RLVDR
A0A1F2TPT3      ILTREVASNRQIYDMFMQRARETG--------------VA-K--DINPSRI----RILDA
A0A2V8JTQ2      ILKREFETNRKLYEDLLQKQKEVG--------------IS-A--SLKSSNI----WIVDP
A0A2V8UZY0      ILKHEFETNRKLYEDLLQKQKEVG--------------IS-A--SLKSSNI----WIVDP
A0A350UEK1      ILKREVETNRQLYESMLQRVKEAG--------------LA-S--ALRASNV----RVVDE
A0A350UIQ4      ILKREVETNRQLYESMLQRVKEAG--------------LA-S--ALKASNV----RIVDP
A0A1H5Z7N3      LRQREYETNRQLYDGLLQRLRSAA--------------VE-A--GLESTEI----EIVDN
A0A1G7JVV8      LRQRDYETNRALYEALLAKLRSAS--------------VQ-A--GLDALEI----DVVDP
A0A1H4T6W9      LRQRDYEANRTLYESLLSKLRAAS--------------VQ-A--GLDSLEI----DIVDQ
I3ZEU5          LRQRDYEANRTLYESLLSKLRAAS--------------IQ-A--GLDSLEI----DIVDQ
A0A7L5A6M5      LRQREFESDRTLYEGLLQRLRSAG--------------VE-A--GLESMEV----DIVDQ
A0A428MDU2      VRQRDFESNRTLYEGLLQRLRTAG--------------VQ-A--GLESLEI----DVVDQ
A0A5B9EBI2      LRQREFESGRQLYDSLLQRLRAAG--------------IQ-A--GLESLEI----DVVDQ
A0A239HDF6      LRQREFESNRTLYEGLLQRLRTAG--------------IQ-A--GLESLEI----DIVDQ
A0A4Q0T270      IKQREFESSRTLYEGLLERLRTAG--------------VQ-A--GLESLEI----DVVDQ
A0A1Q3QQB6      LRQREFESNRTLYEGLLQRLRTAG--------------VE-A--GLESLEI----DVVDQ
A0A3N1K1G7      LRQREFESNRTLYEGLLQRLRTAG--------------VQ-A--GLESLEI----DVVDQ
A0A4V2G466      IRQREFESSRHLYESLLERLRTAG--------------IE-A--GLESLEI----DVVDP
A0A6B9YNQ8      IRQREFESDRNLYEGLLQRLRTAG--------------VE-A--GLESLEI----DVVDP
A0A7G8BSK5      IRQREFESNRNLYEGLLQRLRTAG--------------VE-A--GLESLEI----DVVDP
A0A1I6MH75      LKAREYETTRTLYDGLVSRLRTAS--------------VQ-A--GLESTEI----DVVDL
E8WVF6          LRLREFESNRTLYEGLLQKLRTAG--------------VE-A--GLESSEI----DIIDQ
A0A3N5YNR8      ILQREVDTNRQLYEGLLQRLKETG--------------IS-A--GMRASNI----HVVDH
A0A3N6A5T6      ILQREVETNKQLYEGLLQRLKEAG--------------VA-A--GLKSSNI----NVVDR
A0A1F2Q9L4      NLKVEVSTRRTLLDELVRKQSETE--------------VASRLQGTHDSNI----VVVDR
A0A2U3KC61      VLKRDAEANRQLYQDLLQRFSEAS--------------VS-E--TLKSSNI----RVVDF
A0A2V9Y2R7      VLKRDAESNRQLYLSLLQKLKEAG--------------VT-A--GLRSSNI----RVVDV
A0A2V9NGH6      LLKRDVDTNRTLYEGLLEKLKEAG--------------VT-A--GLRSNNI----RPVDL
A0A2V9PYE6      LLKRDVDTNRTLYEGLLEKLKEAG--------------VT-A--GLRSNNI----RPVDL
A0A2V9NL07      LLKRDFETNRTLYEGLLQKLKEAG--------------VT-A--GLRSNNI----RQVDI
A0A2V9QD92      LLKRDFETNRTLYEGLLQKLKEAG--------------VT-A--GLRSNNI----RQVDI
A0A2V9WPZ6      LLKRDVETNRQLYEGLLEKLKEAG--------------VT-A--GLHSSNV----KIVNA
A0A2V9ZLH4      LLKRDVETNRQLYEGLLEKLKEAG--------------VT-A--GLRSNNV----KIVDA
A0A2V9RQF1      LLKRDVETNRTLYEGLLEKLKEAG--------------VT-A--GLRSNNI----RNVDI
A0A2V9YDK8      FLKRDVETSRQLYEGLLEKLKEAG--------------VT-A--GLRSSNV----KIVNA
A0A2V9V8F7      LLKRDVETNRQLYEGLLEKLKEAG--------------VT-A--GLHSSNV----KIVNA
A0A2V9XGR9      LLKRDVETNRQLYEGLLEKLKEAG--------------VT-A--GLHSSNV----KIVNA
A0A2V9V3Q5      LLKRDVDSNRQLYEGLLEKLKQAG--------------VT-A--GLKSNNF----RIVDP
A0A2V9NWS3      LLKRDVETNRALYEGLLEKLKEAG--------------VS-A--GLRSNNI----RNVDA
A0A2V9USA9      ILKRDSESYRQLYEGLLQRMKEAG--------------VS-A--GLKSNNF----RIVDT
A0A2V9XW18      LLKRDVDTNRQLYEGLLQKLKEAG--------------VS-A--GLKSNNF----RIVDS
A0A1H5SQF5      LLEQEETSNRTLYQDLYGKLEAAN--------------IL-A--GAKSSNV----TIVNP
A0A2V9AEW6      TLKRDVDSNRRLYETMLQRVKEAS--------------LA-A--AMRDSNV----MVIDR
A0A2V8WQK6      TLKRDVDSNRRLYEVMLQRVKEAS--------------LA-T--AMRDSNV----LVVDR
A0A2V8XIF4      TLRRDVDSNRRLYEVMLQRVKEAS--------------LA-T--AMRDSNV----LVVDR
A0A2V2R0I6      ILKREAEANKTLYDGLMNKLKEVG--------------IA-E--SLKSSNI----RVVDP
A0A2V8XAR9      ILKREAEANKALYEGLMTKLKETA--------------IS-L--GLRSSNI----RIVDP
A0A2V8VZA0      ILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLRSSNI----RVVDP
A0A1Q7CB82      ILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLRSSNI----RVVDP
A0A2V8WIU1      ILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLRSSNI----RVVDP
A0A1Q6Y9F5      ILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLRSSNI----RVVDP
A0A2V9EVV8      ILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLRSSNI----RVVDP
A0A2V8YF91      ILKREAEANKALYEGLTTKMKETA--------------IS-A--GLRSSNI----RIIDP
A0A2V8XZK2      ILKREAEANKALYEGLMTKMKETA--------------IS-A--GLRSSNI----RIVDP
A0A2V8ZTX6      ILKREAEANKALYEGLMTKMKETA--------------IS-G--ALRSSNT---------
A0A2V9BT79      ILKREAEANKALYEGLMTKMKETA--------------IS-G--ALRSSNI----RVVDP
A0A2V9YHT3      LLKRDLDTNQQLYDGLLQRLKEAG--------------IS-A--ALKSSNI----RIVDS
A0A7C2XNI7      ILKREAEANKELYDGLLQKLKEAG--------------IS-A--GLRSSNI----RIVDP
A0A1Q8B793      ILKREAEANKALYEGLLTKLKEAG--------------IS-A--GLRSSNI----RVVDP
A0A2V9BCA0      ILKREAEANKALYEGLLTKLKEAG--------------IS-A--GLRSSNI----RVVDP
A0A2V9BWU9      ILKREAEANKQLYEGLLQKMKEAS--------------IS-A--GLRSSNI----RVVDP
A0A2V9DKX2      ILKHEAEANKQLYDGLLQKMKEAS--------------IS-A--GLRSSNI----RVVDP
A0A7C2YQY3      LLKREYETNQQLYDGLLNRLKEAG--------------VS-A--GMRSNNI----HIVDR
A0A3E0NV31      ILERKTQTNKQLYDGILQRLRETD--------------IV-A--ELQKEGI----RISIP
A0A3N5M5V0      ILQREVDTNRQLYEGLLQRLKETG--------------IS-A--GMRTSNI----HIVDH
A0A3N5XQP8      TLKREADTNRQLYEGLLARLKQAG--------------VE-A--GFRSNNI----QIVDR
A0A2Z5G7H4      IVRQEADDSRGLYEDLLKRLKEAG--------------VL-E--GLRSSNI----TVVDP
A0A2V9L5B5      ILKREVDSNRQLYEGLLQRMKEAQ--------------AS-A--GLRASNI----RVVDA
A0A2V9LK56      ILKREADSNKDLYNGLLQRMKEAQ--------------VS-A--GLRASNI----RIVDA
A0A2V9L7I0      ILKREVDTNKQLYEGLLQRMKEAQ--------------VS-S--GLNASNV----RIVDA
A0A522PPT0      ILKREVDTNRSLYDGVLQRMKEAQ--------------VA-A--GLNASNI----MVVDP
A0A7C5V1G5      ILKRDVETNQSLYDGVLQRMKEAQ--------------VA-A--GLNASNI----MVVDP
A0A2V9KCS3      ILRREVDTNRQLYDSMLQRVKEYG--------------IA-S--AMHASNM----RVVDP
A0A372IT17      LARQEADESRRLYDQLFGKLKQAG--------------VL-E--GLHTSSF----SIVNP
A0A4R1LC91      IARQEADQSRTLYETLLNHLKEAG--------------VL-E--GLRSTNI----TVVDP
A0A3M2BZG9      TAKLELETKQRLFNDLLKKQSEAE--------------VASSFHDAKESNV----RVVDY
A0A1Q7N5R7      RLRRDATIAENLFTSVQQRYSEAR--------------LA-E--ASSTADV----RVLDA
A0A2V9QB26      ILKREVDSNRETYQAMLQRVKEAN--------------IA-S--AVRPSNV----RIIDA
A0A2V9VYY4      VLKRDAETNRQLYQDLLQRLKEAG--------------VS-A--GLRSSNI----RIVDI
A0A3E0PHB0      TARREIENNRGILDRLLQREREME--------------LSIN--TSAPDNI----KVSGK
A0A3M1SIV3      DLTQKIETSRSLLNTYVQRQKELE--------------SAIS--SSRPDNV----AVSTK
A0A3M2D491      TLTQAIDTNRELLNTYIQRQKELE--------------LAIS--SSRPDNI----SIATE
A0A353C9L6      TLKREIETKRNLLDTYTQRLKEKE--------------LEVE--SGAPDNI----KIAAN
A0A2V8RQV0      TLKREIETNRNLLDTYTQRLKEQE--------------LSRA--NDAPENI----KIAAN
A0A2V8SJH5      TKKRAIETNRNLLDTYTQRQKEQE--------------LAIA--SGRPENI----KIAAN
A0A357F267      TLKRGIETNRNLLDTYTQRQKEAE--------------LAIA--SGRPDNI----KIAAR
A0A7C5ZUA8      TLKRGIETNRNLLDTYTQRKKEQE--------------LAIA--NTQPDNI----KIPAP
A0A136JPP4      TLKRALETNRGLLDTYTQRQKEQE--------------LALA--SGKPNNI----KISER
A0A399WUJ8      TLKRALETNRGLLDTYTQRQKEQE--------------LSLA--AGKPNNI----KISNR
A0A2V9KIE8      ILKREADTNKQLYESLLQRLKEAQ--------------VS-E--GLKASNI----RIVDQ
A0A352F549      ILKQEIETNKGLLAGLMQRSKEND--------------VT-M--AGTPNNI----HVVDY
A0A3B9MLP9      ILKQEIETNKGLLEGLMQRSKEND--------------VT-M--AGTPNNI----HVVDY
A0A3D5SQ87      ILKQEIETNKGLLEGLMQRSKEND--------------VT-M--AGTPNNI----HVVDY
A0A2V8NW86      ILKREVDSNRGIYEAMLQRVKEAN--------------IA-S--AVRATNV----RIIDA
A0A7C2GJ20      LRKREVEVTTQLYEGLLEKLNDVK--------------LL-S--TLTTTNV----QILDK
A0A7C4BTL5      ILKREVETNRQLYEAMLQRVKESS--------------IL-S--ALRASNV----RVVDP
A0A2V8ZHL8      LLKREFDSNQQLYDSLLQRLKDAT--------------VS-A--GLRATNI----HVVDP
A0A2V9B240      LLKREFDTNQQLYDSLLQRLKDAT--------------VS-A--GLRATNI----HVVDL
A0A2V9CBM2      ILKREVDTNKQVYDGLLQQLKSAG--------------LA-A--SLKASNI----LIVDP
A0A2V8XN17      ILKREVDTNKQLYEGLLQQLKEAG--------------VS-A--GLKASNI----RLVDS
A0A2V8WX45      ILKREVDTNKQLYEGLLQRLKEAG--------------VS-A--SLKASNI----RIVDS
A0A1Q6YR79      ILKREVDTNKQLYEGLLQQLKEAG--------------VS-A--GLKASNI----RLVDS
A0A1Q7VA32      ILKREVDTNKQLYEGLLQQLKEAG--------------VS-A--GLKASNI----RLVDS
A0A2V9EY85      ILKREVDTNKQLYEGLLQQLKEAG--------------VS-A--GLKASNI----RLVDS
A0A2V9H8K0      ILKREADTNKQLYEGLLLQLKEAG--------------VS-A--SLKASNI----RLVDS
A0A2V9FFE5      ILKREVDTNKQLYEGLLLQLKEAG--------------VS-A--SLKASNI----RLVDS
A0A2V9GM43      ILKREVDTNKQLYEGLLLQLKEAG--------------VS-A--SLKASNI----RLVDS
A0A2V9CYQ5      IRKREVDANKQVYEGLLQQLKSAG--------------LA-A--SLKASNI----LIVDP
A0A2V9BWU8      ILKREVETNRQLYEGLLQRLKEAG--------------VS-A--SLKASNI----RVVDS
A0A2V8ZG48      ILKREVDTNRQLYEGLLQRLKEAG--------------VS-A--SLKASNI----RIVDS
A0A2V8Y334      ILKREVETNKQLYEGLLQRLKEAG--------------VS-A--SLKASNI----RIVDP
A0A2V9AY68      ILKREVETNKQLYEGLLQRLKEAG--------------VS-A--SLKASNI----RIVDS
A0A1F2RFI7      ILKREADTNKQLYEGLLQRLKEAS--------------VS-A--GLRASNI----RVVDQ
A0A1F2RZS3      ILKREADTNKQLYDGLLQRLKEAS--------------VS-A--GLRASNV----RVVDP
A0A1F2USE2      ILQREVETNQQLYEGLLQRLKEAG--------------VS-A--GLKASNI----RIVDS
A0A7C2VB08      ILKREVETNRQLYEALLQRLKEAG--------------VS-S--GIKSSNI----RVVDR
A0A2V9C238      ILKREVETNQQLYEGLLQRLKEAG--------------VS-A--GLKASNI----RIVDA
A0A1F2Q9F5      ILKREVDTNKQLYEGLLQRLKEAG--------------MS-A--GMKASHV----RVVDP
A0A1F2QQH9      ILKREVDTNKQLYEGLLQRLKEAG--------------MS-A--GMKASHV----RVVDP
A0A1F2QXK7      ILKREVDTNKQLYEGLLQRLKEAG--------------MS-A--GMKASHV----RVVDP
A0A2V9DEM9      ILKREVETNQQLYEGLLQRLKEAG--------------VS-A--GLKASNI----RIVDA
A0A7C5TWV7      KLQHEYEQNKTFYEQMLQRSKETD--------------IS-A--SAAL---NNV-RVIDP
A0A2V7XDY0      AIKKEAESAKGLYDVLLQKLNETD--------------IA-A--SIRS---NNV-SVVER
A0A2V8G155      VLERDAKSSRQIYESLMQRAKETG--------------VS-A--ELK---TSNI-SVIDR
A0A2V8HDM7      VLERDAKSSRQIYESLMQRAKETG--------------VS-A--ELK---TSNI-SVIDR
A0A2V8DRT9      ALQRDAASNRQIFESLLQRTKETG--------------IS-G--ELK---VSNI-RIVDA
A0A2V7VYF3      ALQRDAASNRQMFEALLQRTKETG--------------LS-E--ELR---ATNV-RIVDA
A0A1F2SVH2      VLARNAASNRQIFESLMQRTKETG--------------IS-G--ELK---TSNI-RVVDA
A0A2V8AJG9      ALQRDNATNRQVFESLLQRAKETG--------------VS-T--ELK---TSNI-RVVDA
A0A2N9LQU7      TLKHEVESSQELSDTLQLKLKEAG--------------LM-A--GLA---SADI-SIVSR
A0A2P6WFK7      VLKHDVENSRDLYDTLQLKLKMAG--------------VT-A--GLS---SGYI-SIIDR
A0A2V8U914      TLKHEVDTNRQFYEAMLQKVNEAG--------------LA-S--AVR---QSNI-RLVAP
A0A2V7W309      DLRMAVDSKQTLLAALQKQLNETQ--------------VT-A--RLRGSASSNV-HWVDH
A0A2W0BGU4      LLKGDFEANQQLYQRLLQRVKDAT--------------VI-A--GLS---STNI-HIVDP
A0A2W0BVQ9      LLKGDFEANQQLYQRLLQRVKDAT--------------VI-A--GLS---STNI-HIVDP
A0A2V9MN96      ALRRDADSNRQLYQSLLQRLKEAS--------------VT-A--GLR---SSNI-RVIDV
A0A2V7V2Z1      TAKREAEAGKEVLNSLLSRHKQTD--------------VA-Q--ELK---NSNI-RIVDP
A0A2V7X2F7      SVKREVEASRAVLNSLTERHKETD--------------VA-Q--ELK---ASNI-RIVDP
A0A2V7V2I1      SLKRELDASKEVLNSLMARHKQTD--------------VA-Q--ELK---ASNI-RIVDA
A0A2V7U3M2      NAKREADAGKEVLNSLLSRHKQTD--------------VA-Q--ELK---NSNI-RIVDA
A0A2V7UHT0      NAKREADAGKEVLNSLLSRHKQTD--------------VA-Q--ELK---NSNI-RIVDG
A0A2Z5FVL3      MARQQADQSRSLYEKLQSRMKEAG--------------VL-E--GFH---SSNI-TVVSP
A0A2V9KBD6      ILKHEFETNRKLYEDLLQKQKELG--------------IT-A--SLK---SSNI-WIVDP
A0A2W0AJ66      ILKRDVDTNRKLYEDLLEKQKELG--------------IS-A--TLK---LSGL-RVIDP
A0A1Q7RBU1      ILKHEFETNRKLYEDLLQKQKEMA--------------IS-A--SLK---SSNI-WIVDP
A0A2V9JPV9      ILKHEFETNRKLYEDLLQKQKEVG--------------IS-A--SLK---SSNI-WIVDP
A0A3P0X3W6      QLKRDADANKTLYNELFQKIKEAG--------------IN-S--GFQ---NSSI-RIADE
A0A2N9MK30      SLKHEAEADKKLYEELITKIREAE--------------IN-A--GFQ---SNTV-RIADN
A0A3D1ASD2      ELKREAEADKKLYDELIRKIKEAS--------------IN-A--NFQ---TSNV-RIADS
A0A7C5AXI3      ALKREAEADKALYEELVRKIKEAG--------------IN-A--SFQ---NSSI-RIADP
A0A7C6E4H7      ALKREAEADKKLYEELVRKIKEAG--------------IN-A--GFQ---NSSI-RLADP
A0A1F2TCR2      MLQRQADGDRKMYDTLLQEQKSLQ--------------VI-S--NSRS---NNV-QLMDR
A0A350UQT3      RAKREAEADKNLYDELVRKIREAG--------------IN-A--GFQN---NMV-RIADA
A0A7C3HRX0      RAKREAEADKQLYEELVRKIREAG--------------IN-A--GFQN---NAV-RVADP
A0A1F2V330      ELTRGYEATKTRYNALLAKQQEAG--------------LA-S--RPERMNKTVAFRIVEP
A0A662EE63      RLEETYLQNRRFLDDMLARSNEAD--------------LS-A--TAWM---NNI-RVIEK
A0A2V8TLH7      LMRTEALDTKRIYDLISARVKEID--------------LS-A--SLLS---NNL-RVLDR
A0A1Q7ZJT1      MVRGEATETKRIYDLISARVKEID--------------LS-S--SLLS---NNL-RILDK
A0A2V8VC99      MVRGEEAETKRIYDLISIRVKEID--------------LS-S--SLMS---NNL-SILDK
A0A348UZU3      SLKIELENKKNLLESLLKRQSETG--------------VS-A--RLKGLRTSNI-RIVDR
Q01XL7          MLKRDAEMAQQVYNGLLQQANQAA--------------LI-A--LVPA---SNI-RVVDA
A0A2V8ERZ5      VMEREAKSNREVYQSLLTREKELR--------------VS-A--NSRT---NNV-RLVDR
A0A2V8GTX0      VLQREAESNRQVYESLLQREKELR--------------VV-S--NSRA---NNV-RLLDR
A0A2V8J0X9      LLQRKADSDRQVYQSLLSQQKELA--------------VV-A--NSRA---NNV-QVLDR
A0A523DUV7      MLQREALSNKSLYEAILQKIKETD--------------VA-S--SLRE---NNV-SIVER
A0A1F2U158      VLEREARSNRTVYESLLQRENELR--------------VS-S--NSRA---NNV-RVVER
A0A2V8F6S9      VMQRDAQTNRTIYDTLLARQKELT--------------VS-S--NSRQ---NNV-RVIDH
A0A7D8BEX2      ILQREYESHRTLYEGLVQRLEEAS--------------VD-S--GLQS---AQI-DVVDL
A0A4Q1SCH5      VLAAEGAASRDLYDTLQYKIQQAS--------------VN-A--GLDS---INT-MIVDR
A0A372IRG7      ILQHGAESASELYDALQMKLKEAG--------------IT-A--GLNS---NNI-DVIDT
A0A2V8K4L4      ILKREVDTNRQLYESMLSKVKESS--------------IA-S--AMRA---SNF-RIVDL
A0A2V8NCZ3      ILKREVETNRQLYESMLARVKESS--------------IA-S--AMRA---SNF-RIVDL
A0A4Q7YNP3      LLRREVESEQQLYQTLLQRAKEAG--------------FA-S--AMQA---STV-RLVDA
E8UZE1          ILQGQVASGRALYQDLTRKLQEAQ--------------IT-S--GLSS---DTI-SVIDP
A0A2U3JZ71      SLKREAEADKTLYEELVRKIREAS--------------IN-S--GFQN---SAI-RIADL
A0A2V8TTB0      TLKREAESDKKLYEELVRKIKEAG--------------IN-A--SFQN---SSI-RVADP
A0A1V6HR88      NLRLEIDTRRQLLDEMLRKQSETD--------------VS-S--RLQATRESNV-RIVDR
A0A3E0P0A3      NLTGDIAAKRETLDRLRRSQSQAN--------------IS-A--SSGN---QAIVTQTER
A0A2V8EXP2      ALQRDALSNRQIFESLLQRTKETG--------------IS-G--ELKT---SNI-RVIDV
A0A2W4RYA1      VLERNAQSARQLYDSLLQRAQETG--------------VS-G--ELRT---SGI-RIVDP
G8P0Y7          ILKQEADSNRQIYDGLLQQLKEAS--------------LA-A--GLTS---SNT-RVVDR
A0A5M8T4U7      ILRHEAELNRDLYDTLQMRLKEAS--------------VT-A--GLSA---TNI-SVVDP
A0A7L5A491      QLKNEAEANKTLYNELFRKVKEAG--------------MN-G--SFQG---SAS-RIADE
A0A7D8BF18      LKQREFDANRTLYDNLSQRLRTAG--------------VQ-A--GLES---TEI-DIVDV
A0A1E3Y9R6      ALEREAQSNRQLYENLLARAKETG--------------AA-G--EYRG---TAI-QVLDP
A0A2W4TLP2      ALEREALSNRQLYENLMARAKETG--------------AA-A--DYRG---TSI-QVLDR
A0A7G8BDY8      ILKREVESGSDLYEDLLKKLKEAG--------------VV-A--SLKA---ATI-DVIDP
A0A7C4BZ42      ILKREVDTNRSMYESMLQKVKEAG--------------IA-S--AMRA---STY-RVVDA
A0A3R9WF43      VLAQEAYSNRALYQNLFSKLQEAS--------------LS-S--GVRA---TRI-DVVNE
A0A317HKM4      ALEREAASNREVLDKLLQRSTEAR--------------LA-R--ELES---TNI-RIVDS
A0A2V9CG11      TLKGEVDSSRQLYEAMLERVKQAE--------------LA-T--AMRA---SNV-LVIDH
A0A523E0N1      HIKAELANQRQILKRLLRRRSETA--------------IT-A--ELGEKQPVRV-KFIER
A0A4R1LAZ7      ILKHGAESASDLYDALQIKLKEAG--------------IM-A--GLNS---NNI-DVIDR
A0A7G8BMP1      ILKHGADSASDLYDALQTKLKEAG--------------IT-A--GLNS---NNI-DVVDR
A0A523ECP2      QIKAGIDNQRSMLRQLLRRQSETG--------------LS-A--ELFEREPVNV-RIVEA
A0A2W0C122      LLRRESEANRQLYDNLEERMKEAG--------------VA-A--GLRS---TNV-RLIDP
A0A2W0AUU7      LLKRESEANRQLYDTLEERMKEAG--------------VT-A--GLRS---TNI-RLIDP
A0A2W0BQL1      LLKRESEANRQLYDTLEERMKEAG--------------VT-A--GLRS---TNI-RLIDP
A0A4Q1SDL1      ILREEATQSRGLYEDLLRKLKEAG--------------VL-E--GLKA---SDI-TVVDP
A0A3P0XH15      ILRHGADSASDLYDALQTRLKEAG--------------IT-A--GLNA---TQI-DIVDR
A0A3M1WQW8      IKQQQVEASAELYRSLLQKMNDVD--------------LL-S--TLTT---TNI-QILDR
A0A3N1JHC1      MLKHEVDVNEQVYQSMLQKAKEAG--------------VI-A--ALRA---ANA-RVVSP
C1F294          ILKHKAQTSSELYDALQLRLEEAG--------------IT-A--GLNS---NSL-EVVDH
A0A2V9KA79      DMTRDLESTRTQYQSLLDKQQQAT--------------LA-S--KRGKVETNVLWRIADP
A0A522PSP1      ILKHQADTDKLVYDDLLERLDAAD--------------VS-A--GYHS---TAL-RIIDP
G8P085          VLYAEGSSSRELYNTLQYKLQQAG--------------VD-A--GLQS---VNT-MRVDT
A0A7C6A629      ALKGEAEADKKLYEELVRKIKEAG--------------IN-A--GFQN---SSI-RLADP
A0A4Q1SGQ1      LARQEADSSRNVYEGLLAKLKQAG--------------VL-E--GLRS---TNL-TVVAP
Q1ILD9          RLRREVDTSRDIYDDLLRKLREAG--------------VM-A--SLKA---ANI-DVVDA
A0A7G8BJH7      LAKQEADESRDVYEGLLAKLKQAG--------------VL-E--GLRS---TNI-TVVNP
A0A7C5SHM3      SLRRQYDQKKANLERLLARREEVA--------------RS-S--DLREILERQV-AIIGP
Q1IJZ6          VLQQEADSTRQLYETLYGRLEVSK--------------LD-E--GIKS---TNV-AVISA
A0A2V8TCE6      TLQAEVERKRAVLNALLQRQNETA--------------VS-S--QLRDMNAGNA-RIVDR
A0A522TBE8      SLQAAAQNYTKLYYDLLQRIAESK--------------LA-A--GFHT---TNA-RVVSP
Q1ITG0          ILKNEVASGRSLYEDLLRKLNEAG--------------IA-A--GLKS---TNV-DVIDP
A0A7C2ML20      LLKRQSEVDEKLFQMLSERLREAG--------------LM-R--SLTP--NTNI-RIIDR
A0A7C5AXS9      ILKREVDTQRSLYEAMLQRVKEYG--------------IA-S--AMQA---SNV-RVVDK
A0A7C2RGE3      LRKREVEVTTQLYEGLLEKLNDVK--------------LL-S--TLTT---TNI-QILDK
A0A3N5PCI5      VLLREVESNRQIYQNLLQRSNETA--------------VS-K--DIQG---PDI-QVVDA
A0A3M1Q0S9      ARKAEIDRKQATLRELLDRKNQMT--------------LS-A--SLAEDRALNI-RVIEK
A0A2Z5G448      ILKHEAQSTTDLYDALQMKLKEAS--------------VT-A--GLNS---NNV-NLVDK
A0A3M1VZ38      ARSLELERKKATLNELIAKENEME--------------QS-A--NLGD-TAHNV-QIIDE
A0A4Q1SD29      ILKHGAESASELYDALQMRLKEAG--------------IT-A--GLSA---TNI-DVIDR
A0A6N9FGE2      VMLRGAESDRSLYESLLRRAAETG--------------VT-G--ELET---SNV-RILDT
A0A3M1PY35      RLYREYEQKRQVLDRLLARREEIG--------------IA-K--DLRSILERQV-SVVAP
A0A3M1VMP2      ALRSLYKQKREALDRLLARREEVA--------------VT-R--DLQSILERQV-HVVDR
                                                                            

A0A2V7VMF7      AS--PP--LAPVWPNKRKMAGVGILVGVALGLGLVL-LRDFLS-NT-----VRDPEEIER
A0A2V7YYV7      AV--VP--DRPVSPTKALNISIAFGAGLLLAVGLAY-LLERLD-QS-----IKTNEDLTE
A0A2V7Z0J5      AV--LP--KNPVSPNKALNVAVAFVAGLLLALGLAL-LFDYLD-QS-----IKSDAELTD
A0A2V7Z3M4      AV--LP--SKPVSPNKVLNVAIALMAGLLLALGVAF-LLDYLD-QS-----IKSDQELTE
A0A399Y5V2      AT--LP--TAPVEPKLSRKVIFALTIGILLGAGIAF-LVEYLD-DS-----LRSKQDAEK
Q01X01          AQ--PA--THHHKPNVPLNLLFGLFGGLALATGYVM-LQEQTN-SA-----LRSPGDAGA
A0A3M2D9H8      EEARVP--SRPVRPQTATNVLLGGILGLILAGGIVF-LIEYLD-DS-----IRNGETVTK
A0A2V8JK38      AE--VP--KGAVTPNHKLNLAWGIFFGLIFGVGSAV-FQEYID-RS-----IKSPDDVTR
A0A2V9IXG5      AG---A--GYRVATRGANFVILATLGGMILGMALVV-LGEVIN-PR-----VKTVEEIQT
A0A2V9J2P4      AG---A--GYRVATRGANFVILATLGGMILGMALVV-LGEVIN-PR-----VKTVEEIQT
A0A1Q7RLS4      AP--VP--KVPVRPRTVLNLAIGMLLGILLGVGAIF-FLDYMD-NT-----VRTSDDVEQ
A0A2V2R525      AN--TP--ERPIGPQRTRGVGLAFAFSLAFGIGLAL-LRELSN-NT-----VRTMSDVTR
A0A321LPW6      AE--VP--TFPVDAKRLQGVLIALFVSLCAGLIFAF-LLEYLD-NT-----IKTVDDVAR
A0A2V9R9V4      AR--VP--KEPVSPNRQRTILIGLLLSLSGGIGLAW-LLERFD-DS-----IRSVDDVNR
A0A321LE75      AQ--PP--GGPIGPNRMRGILIGLFLSLVAGIGLAF-VLEYFD-NT-----IKSVEDVNR
A0A2V8R8U7      SR--TP--QL-VGPQRMRNIMIAFVLALVAGIGLAF-LIDYLD-DT-----VKSLDDIDR
A0A2V8QMP4      AR--TP--REPIGPPRVRNIIIALLLSIAVGIGLAF-LLDYLD-DT-----LKSIEDVDR
A0A2V8R4S3      AR--TP--REPIGPPRVRNIIIALLLSIAVGIGLAF-LLDYLD-DT-----LKSIEDVDR
A0A2V8NJ55      AR--LP--RGPVGPARSRNIIVAFLLSLGVGIGLAF-LLDYLD-DT-----VKSIEDVDR
A0A2V8Q7I0      SR--IP--RSPIGPARLRNVMIAFVLSLVAGIGLAF-LLDFLD-DT-----VKSVDDIDR
A0A2V8S6K4      AR--TP--QL-VGPPRVRNIIIALLLALGAGIGLAF-LLDYLD-DT-----LKSIEDVDR
A0A317I2L9      SR--VP--KAPIGPARIRNVMIAFLLSLVAGIGLAF-LLDFLD-DT-----VKSIEDIDR
A0A2V8LLF9      SR--LP--HEPVGPARLRTIILALVMSLLVGIGLAF-LLDFLD-DT-----LKSVDDVDR
A0A352FRF4      SR--LP--RAPVGPARLKTILIALILSLVAGIGLAF-LLDFLD-DT-----IKSVDDVDR
A0A2V8MKV0      SR--LP--HEPTGPPRTRNILLALALALLAGIGLAF-LLDFLD-DT-----VKSLDDVDR
A0A2V8PYY8      SR--LP--HEPVGPQRTRNILVALALAFLAGIGLAF-LLDFLD-DT-----VKSLDDVDR
A0A1Q7YKQ8      SR--EP--RAPVGPPRLRNILIAFLLSLGAGIGLAF-LLDYLD-DT-----LKSVEDVDR
A0A352F3R7      SR--LP--KEPIGPQRLRNIFIAFLLSLGAGIGLAF-LLDFLD-DT-----VKTVDDIDR
A0A0B6WXT1      AR--VP--REPVGPKRLRNILIALLVALGAGIGLAF-LLDYLD-DT-----LKSAEDVER
A0A3B9MEU8      SR--LP--KTPVGPQRLRNIFVALLLSLGAGIGLAF-LLDFLD-DT-----LKSVDDVDR
A0A2V8MHG6      AA--IP--KTPIGPKRMQAIALAALFALILGIALAR-YLDYMD-DS-----VRTSEDVEN
A0A2V8P7N1      AA--IP--KNPIGPKRMQAIVLAALFALIVGIALAR-YLDYMD-DS-----VRTSDDVEN
A0A2V8M3M6      AA--IP--KNPIGPKRMQAIVLAALFALIVGIALAR-YLDYMD-DS-----VRTSDDVEN
A0A1Q7NJH5      AA--IP--KTPIGPKRMQAIVLAALFALIAGIALAH-YLDYMD-DS-----VRTSEDVEN
A0A2V8PJY0      AA--IP--KTPIGPKRMQAIVLAALFALIAGIALAH-YLDYMD-DS-----VRTSEDVEN
A0A1Q7Y6W9      AL--VP--DGPVGPNRTRVVMLALVLSFGFGIGFAL-FLDYLD-DT-----VRTADDVEK
A0A2V8NC68      SP--QP--KVPVGPHRMQGILLASLFSLVFGVALAR-YLDYLD-DS-----VRTVEDIER
A0A399WK13      AV--PS--NIPVSPRRLTTVLGALFLSTLFGVGLAL-FLEYLD-DT-----VRSTEEVES
A0A352FLX4      AI--AG--KKPVAPRRVLTVALAFLFSIGCGIGLAF-IIEYLD-DS-----VRSMEDVEN
A0A2V8RTL7      GI--PP--EAPVAPRRLMTVVAALLLSSLFGMGLAL-FLEYLD-DT-----INTTEEVEN
A0A3E0PCJ6      AI--PP--ERPVSPRRLTTVAVVMMLSLLFGAGLAL-FLEYLD-DS-----IKTTEEAET
A0A3M1S4R8      AI--PP--DTPVSPRRLLTVMMALFLSTCFGVGLAF-FLEYLD-DT-----IKTAEDVEN
A0A7C2G442      AI--PP--DTPVSPRRLLTVMVALFLSTCFGIGLAF-FLEHLD-DT-----IKTAEDVEN
A0A1Q7YFI6      AP--IP--KSPVGPRRMQGVALGFLFSLVIGIALAR-YLDYLD-DT-----LHSAAEVDE
A0A136KC10      AV--PS--NIPVSPRRLATVLGALFLSTLFGMGLAL-FLEYLD-DT-----VHSTEEVES
A0A3M2D6Y5      AI--PP--DTPVSPRRLLTVMMAFFLSIVFGVGLSL-FLEYLD-DS-----VKTVEDVET
A0A2V8SEX6      AI--PP--EHAVSPSRLMTVFAALFLSTLFGMGLAL-FLEYLD-DT-----IRSTEEIET
A0A7C5ZUU4      AI--PN--ETPVSPRRLMTVFAAFFLSLLFGVGLAL-FLEYLD-DT-----ISSTEEIET
A0A0B6WWQ6      AF--PP--NRPIGPARLQAVGLAIVLGLAVGIGLAI-FLDYLD-DS-----LQSAEEVER
A0A3B9MK99      AV--TP--DGPIGPNRSSTVSMALFLSLGLGVGLAL-LLEYFD-DT-----LRSSEEVER
A0A352EX26      AI--TP--AGPVGPNRMRTVALALFLSLGLGVGLAL-FLEYLD-DT-----VHSTDEVER
A0A2V8MM59      AI--QP--DGPVGPARMRSVMLALVLSLALGVGLAL-FLEYLD-DS-----VHSTDDVER
A0A2V8PFE8      AI--TP--DFPVGPARMRSVMLAFVLALALGVGLAL-FLEYLD-DS-----IHSTDDVEK
A0A2V8PWS6      AI--TP--DFPVGPARMRSVMLAFVLALALGVGLAL-FLEYLD-DS-----IHSTDDVEK
A0A2V8LCT5      AI--VP--DFPVGPGRMRTVMLAFVLSLGLGIALAL-FLEYLD-DT-----VHSTEDVEK
A0A352FTJ9      AI--VP--DFPVGPARLRTVMLAFLLALGFGAALAL-FLEYLD-DT-----VHSTDDVER
A0A257VBK0      AQ--PP--MAPVKPNKRMNLLMGLLFGLMLSVGSIV-AWQYLD-TS-----VKSVEDLET
A0A2G6PYV5      AR--LP--HSPYAPSLKRHLFSGFIIAAGLAGLLIF-LIEITD-RK-----IHNTEVLEM
A0A2V8F956      AQ--TP--TEPVSPQKGLNLLLALFGGSLLACGLVF-FFEHID-SR-----IKTPDEVTA
A0A1F2S1W5      AE--NP--TGPISPNIFNSLLMALLGGLTLAVGLAF-GLEYAD-DR-----IKNPDEMKK
A0A1F2T595      AE--MP--TGPVSPNIINNLLLALFGGMVLAVGLAF-TLEYAD-DR-----IKNPDELKK
A0A2V8JQV5      AR--PP--GGAYKPDVYMYAMLGLATGVFLGLMLIV-RQEQAD-RS-----IHAPAEAPV
A0A2V9AC41      AE--PP--GGPSYPDKNGILLRGLFLGLLMGVGLAF-LFDQLD-NT-----IKSPEEAER
A0A2V9MAM9      AQ--PA--LQPYKPNFLLNVAIGLFGGLVLAIGCVT-VVNQAEAGR-----SREPGDVEA
A0A348V070      AS--PP--VNPSFPNRRKTFIIGVLLALIGGAGTSL-FINYLV-AT-----VKSSRDIAQ
A0A2V9M454      AT--IP--SFPVRPNRPRNIEFALAAGLILGIALAF-TREALD-NS-----IKNAQEIEK
A0A2V9IVR7      --------GAPVRPRKLFNVTIGLLVGLILGVALAF-VQEALD-DS-----IKSIGQVER
A0A2V9ILE2      AR--VP--GAPVRPRKLFNVTIGLLVGLILGVALAF-VQEALD-DS-----IKSIGQVER
A0A2V9LGY4      AR--VP--GAPVRPRKLFNVTIGLLVGLILGVALAF-VQEALD-DS-----IKSIGQVER
A0A2V9J4D6      AV--PP--ATPVRPKKALNVALGLLAGIILGTAFAF-LEEQLEQKT-----VKTMEDVQR
A0A2V9L9C5      AV--PP--ATPVRPKKALNVALGLLAGIILGTAFAF-LEEQLEQKT-----VKTMEDVQR
A0A2N9M9N1      AL--VP--ATPIRPDKRVDIAVGLLVGLILGVTLAF-IREGLD-RT-----VKTAEDIEN
A0A2V9JEC4      AR--VP--AVPVRPDTRRNFPLFAFAGLVIGVTLAF-AQEALN-NS-----IRTPDDLEG
A0A2V9LPQ3      AS--PP--AVPVRPNKLLNLMLGLVAGGLLGLVLAF-AEEGLERRS-----IRTPDDVER
A0A2Z5G3A3      GR--SP--AKPTKPNIPLFLGGGLASGLFLGFCAAL-LFDTTD-TK-----IQDLDELEL
A0A2V7UGP8      AE--IP--DRIFRPNKKMNILLSLFVGLALGVGMAF-FLEYLD-NS-----IKSTSDVEK
A0A239MKT6      AR--PP--SLNSSPNASRLLATGTAAGLLLGLLIGI-ALHLRD-RF-----LYTIEDFQA
A0A3E0PCN7      AQ--PP--SAPQGPNRSRAVLMAFVASLIGGIGLAF-VLNWLD-DT-----VRADDNFEL
A0A2V8IYW3      AR--VP--ERPFSPKRLQLNLTAIGIGLMLGMAVSA-LLEYRD-TS-----LRTESQLLE
G2LEI9          AG--TP--GAPISPRVSYTLSVAFFLSLFGGVGLAF-AREYLN-TR-----IKSVEDVDR
A0A317J121      ST--PP--AKPYKPRPALNIAFGTMAGLFLSVGIAF-LWERMD-KS-----VRTPGHSRT
A0A2V7YW66      AL--VP--GGPFRPSLRQDVTYGLLLGLLAGLGLAV-LIELMD-RT-----VKSPEEVER
A0A2V7Z0V0      AT--VP--GGPFQPSLRKDGSYGLLLGLLFGVGCAV-LIEVLD-RT-----VKAPEEIER
A0A2V8GFD4      AE--EP--PWPAYPRKRTNVTYGLLAAVLLAGMFGF-VIEALD-TC-----LKTPDDIKV
A0A2V8HSS5      AE--EP--PWPAYPRKRTNVTYGLLAAVLLAGMFGF-VIEALD-TC-----LKTPDDIKV
A0A2V8KP55      AE--VP--KGAVTPNHKLNLAWGIFFGLIFGVGSAV-FQEYID-RS-----IKSPDDVTR
A0A399WNU1      AL--VP--GAPSGPQRTKNVVIAFFASLFGGIAIAF-GLNWLD-DT-----IRVPVASQA
A0A2V9JSI3      AL--PP--AAPIRPKKTQNIAMGLLGGLALGVMLAL-FADVLD-NS-----VKSVEDIER
A0A2V9WI32      AR--VP--TSPSAPNIPRDIVLGLALGLFGGIGLAF-VLESLD-NT-----VRTPEEAQI
A0A2V8IVN9      AE--RP--RKPSSPQYALNLLLGLLGGTMLGVGLAF-FFEYLD-SH-----IKTPDEIRA
A0A7C5Z4J3      AF--AP--PQPIRPKKARNIAVGLMVGLVLGTTLAF-LNEALD-TS-----IKTAEDIER
A0A1F2TPT3      AT--VP--SSPVGPDKGRSILGAVFAGLGLALVLAF-GFEYLD-NR-----IKLPEEIGQ
A0A2V8JTQ2      AR--PP--KLPAEPNILRNLALSLLFGICGGVWLSFGLAKIEE-KT-----INTVEQAQS
A0A2V8UZY0      AR--PP--KLPVEPDIRRNFALSLLFGIFGGVLLAFGLAKVNE-KT-----IITLEQARL
A0A350UEK1      AQ--PP--ERPYKPSLPLNAVLGLLAGGFLAVGFVV-TTEKAD-RA-----LREPSDIPF
A0A350UIQ4      AK--AP--ERPYKPRLPLNALLGLLAGGFLAVAFVV-TTEKAD-RA-----LREPSDVPF
A0A1H5Z7N3      AV--PP--VYPTLKPRSTILMIDLVVALIVGLIVAF-VLDSLD-TG-----LRDVMEIER
A0A1G7JVV8      AF--KP--IGPTMTPRSSILSRDLILSLVFGIMLAF-ALESLD-TG-----IRSVSEVEH
A0A1H4T6W9      AL--KP--AAPSITPRSTILLRTLLISLVAGLMIAF-TMESLD-TG-----IRSVAEVEQ
I3ZEU5          AL--KP--AGPSMTPRSTILLRTVLIGLVAGLMIAF-TMESLD-TG-----IRSVAEVEQ
A0A7L5A6M5      AI--PP--ARPTMRSKSFDLLLASLVALIIGVLLAF-LLENLD-TG-----LRSIAEIEA
A0A428MDU2      AL--PP--ASPMLRPQSTIIMTSFVFGLLGGIVLAF-LMESLD-TG-----LRSVAEIES
A0A5B9EBI2      AL--IP--AAPTLQSATTIIIVTLLFSLFGGIVIAF-LLESLD-TG-----LRTIAEVEG
A0A239HDF6      AV--PP--ASPMLRPKSTLVLTTLAVAMILGVLIAF-LLDTLD-TG-----IRSVTELEA
A0A4Q0T270      AL--LP--AYPTLQPYSSIITTNVLFALIVGIVVAF-VLDSLD-TG-----LRSIAEIES
A0A1Q3QQB6      AL--PP--AKPTLKRRSTVVLTGMVFGLLGGIIIAF-IVESLD-TG-----LSSVAEIES
A0A3N1K1G7      AL--PP--ANPVLRPQSTIILTMLFVGLIAGIIIAF-LMESLD-TG-----LRSIAEIES
A0A4V2G466      AL--LP--ATPTLKPKSTVVLTYLFMGLVAGVMLSF-LLESLD-TG-----LRSVAEVES
A0A6B9YNQ8      AL--LP--ANPTLKRKTTVVLTYLVLGFIAGVMMAF-LLESLD-TG-----LQSVADVEA
A0A7G8BSK5      AM--LP--ATPTLKPKSTVILTYLFFGFLAGVILAF-LLESLD-TG-----LRTVAEIEN
A0A1I6MH75      AM--IP--ASPRLQPYSSVVLTACIFALLVGIILAF-TLESLD-TG-----LRSIAEIES
E8WVF6          AV--PP--SDPQSTPQSTIILTYFAVSLVLGTLLAF-LLESLD-TG-----LRSVAEIEA
A0A3N5YNR8      AE--VP--ETPYSPQRAGDLALGLGVGLFLAIGLAF-LMEYLD-NT-----LKTPEDMEQ
A0A3N6A5T6      GE--TP--RRVYRPRTAINLALGLILGLMLGVSMAF-FIDYLD-NT-----IKTPDDIEK
A0A1F2Q9L4      AL--VP--GGPYRPSLRRNLGLGLVLGLALGLGFVF-FLEYLD-RS-----VKTAEDVDR
A0A2U3KC61      AR--TP--TSPITPNVPRNIELGLLLGLACGIGLAF-VLESLD-TS-----IRNMEELSA
A0A2V9Y2R7      AR--TP--MFPVKPDVPRNIKLGFILGLCLGVGLAF-VLESCD-NT-----VRNMEQVSA
A0A2V9NGH6      AR--VP--IEPAEPDVPRNLSFALVLGLTTGVSLAF-LLEGID-NT-----VRTPEQAQA
A0A2V9PYE6      AR--VP--IEPAEPDVPRNLSFALVLGLTTGVSLAF-LLEGID-NT-----VRTPEQAQA
A0A2V9NL07      AR--TP--AGPAEPNIPRNLGFALALGLTSGIGLAF-LLEGID-NT-----VRTPEQAQL
A0A2V9QD92      AR--TP--AGPAEPNIPRNLGFALAFGLTSGIGLAF-LLEGID-NT-----VRTPEQAQL
A0A2V9WPZ6      AR--VP--MAPSEPNIPRNLAFGLLLGLTSGIGLAF-LLENLD-NT-----VRTPEQAQI
A0A2V9ZLH4      AR--VP--QAPSEPNIPRNLAFALLLGLTSGVGLAF-LLENLD-NT-----VRTPEQAQM
A0A2V9RQF1      AR--AP--RSPAEPNVPRNLSFALALGITTGIGLAF-LLEGID-NT-----VRTPEQAEA
A0A2V9YDK8      AR--VP--MAPSEPNIPRNLAFALVLGLTSGVGLAF-LLENLD-NT-----VRTPEQAQI
A0A2V9V8F7      AR--VP--MAPSEPNIPRNLAFGLLLGLTSGIGLAF-LLENLD-NT-----VRTPEQAQL
A0A2V9XGR9      AR--VP--MAPSEPNIPRNLAFGLLLGLTSGIGLAF-LLENLD-NT-----VRTPEQAQI
A0A2V9V3Q5      AR--SP--NAPVEPNIPRNLLFALVLGVSSGVGLAF-LLEGMD-NT-----VRTTEQAQM
A0A2V9NWS3      AR--VP--SEPVEPNVPRNLAFALALGLSTGIGLAF-LLEGVD-NT-----VRTPEQAQA
A0A2V9USA9      AR--VP--NGPIEPNIPRNLGFALVLGLMSGVGLAF-LLEGLD-NT-----VRTTEQAQT
A0A2V9XW18      AR--PP--TGPIEPNVPRNLLFAAVLGLASGMGLAF-LIEALD-NT-----VRTTEQAQM
A0A1H5SQF5      AR--VP--SGPSRPQPVQNIALGFLAGLATGLFLAF-ATAYHN-DV-----LSTPEEVAS
A0A2V9AEW6      AR--PP--KLPYRPSLPMNSAIGLLGGMFLGLGFVL-LRERLD-RR-----ISAPGEAQI
A0A2V8WQK6      AK--PP--LLPYRPSLPVNSAIGLFSGVFLGFGFVL-LRERID-RR-----ISAPGDAQV
A0A2V8XIF4      AK--PP--LLPYRPSFPMNSAIGLFSGLFLGFGFVI-LRDRLD-RR-----ITAPGDAQA
A0A2V2R0I6      AM--IP--SYPSRPAKARNLALAFLVGLVGGVGLAL-LREYLD-NT-----VKSPDDVEN
A0A2V8XAR9      AM--IP--STPSRPAKARNITLAFLVGLVGGIGLAL-MREYLD-NT-----VKSPDDVET
A0A2V8VZA0      AM--IP--STPARPAKTRNVALAFLVGLVGGMGLAL-MREYLD-NT-----VKSPDDVET
A0A1Q7CB82      AM--IP--STPARPAKTRNVALAFLVGLVGGMGLAL-MREYLD-NT-----VKSPDDVET
A0A2V8WIU1      AM--IP--STPARPAKTRNVALAFLVGLVGGMGLAL-MREYLD-NT-----VKSPDDVET
A0A1Q6Y9F5      AM--IP--STPARPAKTRNIALAFLVGLVGGIGLAL-MREYLD-NT-----VKSPDDVET
A0A2V9EVV8      AM--IP--STPARPAKTRNIALAFLVGLVGGIGLAL-MREYLD-NT-----VKSPDDVET
A0A2V8YF91      AM--VP--TSPARPAKTKNITLAFLVGLVGGIGLAL-LREYLD-NT-----VKSPDDIEA
A0A2V8XZK2      AM--VP--TSPARPAKARNIMLAFLVGLIGGIGLAL-MREYLD-NT-----VKTPDDIES
A0A2V8ZTX6      -----------------KNIILSFLVGLVGGIGLAL-LREYLD-NT-----VKTPDDIET
A0A2V9BT79      AM--VP--ATPARPAKGKNIMLSFLAGLVGGIGLAL-LREYLD-NT-----VKTPDDIET
A0A2V9YHT3      AR--PP--VLPSQPDVPRNLLLGLAAGLIAGVVLAF-GAEVMD-ST-----IRTPEQVQI
A0A7C2XNI7      AL--VP--PAPARPQKARNVLLALLVGLVGGVGLAF-LREYLD-NT-----VKTPDDIEH
A0A1Q8B793      AM--IP--SSPARPAKMRNISLAFLVGLVGGIGLAL-LREYMD-NT-----VKTPDDVEM
A0A2V9BCA0      AM--IP--SSPARPAKMRNISLAFLVGLVGGIGLAL-LREYMD-NT-----VKTPDDVEM
A0A2V9BWU9      AM--VP--SAPSRPQKTRNILLAFLIGLVGGVGLAL-LREYLD-NT-----VKTPGDIEM
A0A2V9DKX2      AM--VP--SAPSRPQKTRNILLAFLIGLVGGVGLAL-LREYLD-NT-----VKTPGDIEM
A0A7C2YQY3      AR--PP--LAPIRPRKSLNIALSAVVGLILGGALAL-FNEYLD-NS-----VKVPEEVEQ
A0A3E0NV31      AT--RP--NSQYAPNKTRSTLFALGIGLALGIAAAL-GLEFLD-QT-----VKSSDHITE
A0A3N5M5V0      AQ--VP--TAPYSPQRAADLALGFGVGLLIAVGLAF-LMEYLD-NT-----LKTPEDMEQ
A0A3N5XQP8      AR--TP--LNTWWPRRTMNLALAFLGGLFLGLGLAV-TLHLLD-NR-----VHSPEDV-L
A0A2Z5G7H4      GR--IP--STPKQPNIPVYLAIAAGVGLFLGVCGAF-ISDSID-DK-----IQTIEEIER
A0A2V9L5B5      AE--AP--KYPAKPRVLLNLVLGLILGLGLGVGMAF-FQEYLD-KT-----LKTPDEVER
A0A2V9LK56      AE--VP--RRPVRPRVILNLALGIIFGLGLGVAGVI-LLEYLD-NT-----LKSPSQVES
A0A2V9L7I0      AE--IP--KGPAKPRVLLNLILGLVVGLALGVGVAF-LQEHLD-KT-----LKTPDEVER
A0A522PPT0      AQ--VP--KGPAKPRVILNLAVGFILGLSLGVGLAF-LQEYLD-NT-----LKTPDEVEF
A0A7C5V1G5      AE--VP--KSPAKPRVVLNLAFGCILGLSLGVGLAF-LQEFLD-NT-----LKTPDEVES
A0A2V9KCS3      AK--AP--RLPYKPNLLQHAGVGFIAGLLLGTVFVV-IQEQAD-RS-----LQSPGDGPT
A0A372IT17      AR--IPPGNHPKSPNLPLYYAAALGAGLFLGCAGAI-TCEFTD-RS-----ITSLTEVER
A0A4R1LC91      GR--VP--AKPAKPNVPLVLAGSLLGGLFLGCCGAL-LADVMD-NK-----IQDVSELEG
A0A3M2BZG9      AI--VP--SAPFRPVLRKDLTTALLLGLLAGVGLIL-LIEFFD-RT-----IKSPEELEK
A0A1Q7N5R7      AV--AP--RRPVKDSASRLIALGFLAGLGFGVVGAV-LVDRLD-RR-----VRYPDQVTN
A0A2V9QB26      AE--PP--EHPYKPNLPMNAAVGLLSGLCIGVAFVV-TRGRAD-RT-----FRAPGEAQL
A0A2V9VYY4      AR--VP--TQPISPNVHRSLVLGFLLALGLGVGLAL-VRETFD-ST-----VRSMEEVRA
A0A3E0PHB0      A----Q--VNRTGPQRTRNILIALFISLAGGIGLTF-LLDYLD-DS-----IKSSDDIGR
A0A3M1SIV3      AS--KP--DSPIGPPRNRNILISLIVSLFLGIGLAF-LLDYLD-DS-----VRDVDDITR
A0A3M2D491      AT--KP--DAPIGPQRNRNILLAFLASLFVGIGLAF-LFDYLD-DS-----VRTVDDVTK
A0A353C9L6      A---GG--AYPVGPQRSRNILVAFLLSLAAGLGLAF-LLDYLD-DS-----VKTSEDIGR
A0A2V8RQV0      A---GP--AILVGPPRGRNIFVAFLFSLAAGIGLAF-LMDYLD-DS-----VRTSEDIGR
A0A2V8SJH5      AV--TP--GGPIGPARTRNILVAFLVSFGVGIGLAF-LLDYLD-DS-----VKTSDDIGR
A0A357F267      AI--TP--KSPIGPQRNRNIFVAFMLSLAAGIGLAF-LLDYLD-DS-----VKESEDIGR
A0A7C5ZUA8      AE--VP--TVPEGPQRGRNVLIAFLVSLFAGVGLAF-LLDYLD-DS-----VKTSEDISR
A0A136JPP4      AE--AP--TYPVGPNRARNIFIALLASLGAGIGLAF-LLDYLD-DS-----IRTSDDISR
A0A399WUJ8      AV--VP--TSPDGPKRARNIFIALLASLGAGIGLAF-LLDYLD-DS-----VRTSDDVSR
A0A2V9KIE8      AE--TP--KLPVKPRVILNLALGFAFGLALGIGLAF-FQEYLD-NT-----VKSPDEVEE
A0A352F549      AA--IP--KGPVGPRRMQAVTLAMMLATAFGIALAL-FLEYLD-DT-----VKDSRDIES
A0A3B9MLP9      AA--VP--KGPIGPRRMEAVFLALVLALVFGVALAL-FLEYLD-DT-----IKSPGDIES
A0A3D5SQ87      AA--VP--KGPIGPRRMEAVFLALVLALVFGVALAL-FLEYLD-DT-----IKSPGDIES
A0A2V8NW86      AE--PP--KRPYKPSLPVNAAVGLLSGLCIGVAFLV-TRGRAD-RT-----LRAPGEAQL
A0A7C2GJ20      AE--VP--LRPARPRKLFNIGLSVLVGLVLGVGLAL-FVEYLD-NT-----VKSAEDVDR
A0A7C4BTL5      AK--PP--KTPYKPDVPMNAGVGLLAGLGLGVAFVI-IRERAD-RT-----LQEPGDAPF
A0A2V8ZHL8      AR--PP--RVPVRPQKLLNIAIGLVVGLILGVTLAF-VKEALD-TS-----IKSIEEAER
A0A2V9B240      AR--PP--KVPVRPQKLFNIAVSLVVGLILGVTLAF-VKEALD-SS-----IKSIEEAER
A0A2V9CBM2      AE--PP--AKPAKPKILLNLVLASILGLALGVGEAF-LQERLD-DT-----VTGADDVER
A0A2V8XN17      AE--PP--AKPVKPRTLLNLSVALFLGLALGICAAL-FQERMD-DT-----LKGDDDVER
A0A2V8WX45      AE--PP--ARPVKPRIALNLMVAAFLGLGLGVCAAF-FQERMD-NT-----LKGDDDVER
A0A1Q6YR79      AE--PP--AKPFKPRTLLNLSVAVFLGLALGICAAL-FQERMD-DT-----LKGDDDVER
A0A1Q7VA32      AE--PP--AKPFKPRTLLNLSVAVFLGLALGICAAL-FQERMD-DT-----LKGDDDVER
A0A2V9EY85      AE--PP--AKPFKPRTLLNLSVAVFLGLALGICAAL-FQERMD-DT-----LKGDDDVER
A0A2V9H8K0      AQ--PP--AKPVTPRTLLNLAVAMFLGLGLGICTAL-FQERMD-DT-----LKGDDDVER
A0A2V9FFE5      AQ--PP--AKPVKPKILLNLAVAMFLGLGLGIGTAL-FQERMD-NT-----LKGDDDVER
A0A2V9GM43      AQ--PP--AKPVKPKILLNLAVAMFLGLGLGIGTAL-FQERMD-NT-----LKGDDDVER
A0A2V9CYQ5      AE--PP--TKPAKPKILLNLLVASILGLALGVGEAF-LQEHLD-DT-----VRGADDVER
A0A2V9BWU8      AE--PP--ARPAKPRIPLNLAVAALLGLGLGISTAF-LQERLD-DT-----LKGADDVER
A0A2V8ZG48      AV--PP--AKPAKPKIPLNLAVATLLGLGLGISAAF-LQERLD-DT-----LKGADDVER
A0A2V8Y334      AD--PP--AKPAKPRIPLNLAVGVLLGLGLGISTAF-LQERLD-DT-----LKGADDVER
A0A2V9AY68      AE--AP--AKPAKPKIPLNLAVASLLGLGLGISAAF-LQERLD-DT-----LKGADDVER
A0A1F2RFI7      AE--VP--EMPAKPQKLVNLALALIFGLGLGVGMAF-FQEYLD-NT-----LKTPEDVQR
A0A1F2RZS3      AE--VP--TLPSKPRKLMNLALALMVGLSLGIGMAF-FQEYLD-NT-----LKTPEDVQR
A0A1F2USE2      AR--PP--EKPAKPKVLLHLAMGFLLGLGLGVGAAF-LQEYLD-NT-----LKTPEDVER
A0A7C2VB08      AT--PP--RRPAKPNLLLNLLLGTAFGLGLGIGAAL-LAEHVD-SS-----IKSSEEIER
A0A2V9C238      AE--PP--KKPARPNLPLNLALAVLLGTGLGV-----VQEHVD-NS-----LKTSEDVER
A0A1F2Q9F5      AQ--PP--DKPAKPSLALNLLLALVLGLGLGLAAVF-LQEHFD-NS-----LKTSEDVER
A0A1F2QQH9      AQ--PP--DKPAKPSLALNLLLALVLGLGLGLAAVF-LQEHFD-NS-----LKTSEDVER
A0A1F2QXK7      AQ--PP--DKPAKPSLALNLLLALVLGLGLGLAAVF-LQEHFD-NS-----LKTSEDVER
A0A2V9DEM9      AE--PP--KKPARPNLPLNLVLAVLLGTGLGVGAAF-LQEHVD-NS-----LKTSEDVER
A0A7C5TWV7      AE--PP--KHPYKPNPPRILSLSLILGLFLGVGLAF-GLDFID-QT-----LRRPEEAER
A0A2V7XDY0      AS--AP--TSPIRPNKKRIAAVAGFLGLLLGVGLVI-ARDYLD-NT-----IKDPEEIER
A0A2V8G155      AE--TP--RTPVEPRVQYMLTLGGCGAFLFALCLAF-FFEHFD-NR-----IKTPEEIQT
A0A2V8HDM7      AE--TP--RTPVEPRVQYMLTLGGCGAFLFALCLAF-FFEHFD-NR-----IKTPEEIQT
A0A2V8DRT9      AE--LP--QVPASPDKPLNVLLAILGGSIMAVGLAF-FFEYCD-NR-----IKSPAEIKA
A0A2V7VYF3      AE--VP--RSPAGPNTRTDFLLAVLVGGVVAVGFVF-GLEYLD-NR-----IKSPDEITA
A0A1F2SVH2      AE--TP--RGPVRPNTRNNLLLALFGGATLAVGLAF-FFEYLD-NR-----IKSPDEIKQ
A0A2V8AJG9      AE--VP--RRPASPNVPTNLLLAFFGGGTLALGLAF-FFEYLD-NR-----IKTPDEVKA
A0A2N9LQU7      GM--VA--ARPAFPKKSLMLPLGFLISVFGGLVFVF-VLESFD-DS-----LRTSEEVEA
A0A2P6WFK7      AE--IP--ATPVEPRIKRNLALGLFGGVIAGLLLAF-GVEALD-DT-----LSNSEELET
A0A2V8U914      AE--PA--FRPYKPNLPLNLSIGLFAGLVLAVGSVM-LTEQTN-SR-----LRAPGEASF
A0A2V7W309      AE--TP--GSRINLSMKKNLQTAFPLGLFLGFAAIF-FLEYMD-RS-----IKTPEELER
A0A2W0BGU4      AL--AP--IIPVRPRTRLNIVLGLLVGMIFGSMLAF-IQDSLD-NS-----LKSPEEVEM
A0A2W0BVQ9      AL--AP--IIPVRPRTRLNIVLGLLVGMIFGSMLAF-IQDSLD-NS-----LKSPEEVEM
A0A2V9MN96      AR--LP--TGPAKPDVRRNIFLGFLLGLAGGVALAF-LQESMD-TT-----VGSLEELSA
A0A2V7V2Z1      AS--VP--RGPVRPRTTRDILYGVFLGLALGIGLAF-FLDYLD-NT-----IKTPEDVRK
A0A2V7X2F7      AV--MP--NGPVRPNRQRDILTGALLGLVLAFGAAF-FLEYLD-NT-----LKTPDDVRN
A0A2V7V2I1      AA--VP--GSPVRPNRPSDIAMGLFLGLALGVMAAF-FLEYLD-NS-----IKTPEEVRL
A0A2V7U3M2      AS--VP--RSPVRPQKTRDIAMGVALGLFLGIGLAF-FLDYLD-NT-----IKTPEDVRK
A0A2V7UHT0      AS--VP--RGPVRPQKTRDIAMGLALGLFLGIGLAF-FLDYLD-NT-----IKTPEDVRK
A0A2Z5FVL3      AL--AP--SAPSRPNIPLYLAGSLATGLLFGCIMAV-VVDLMD-SK-----IADIHGLES
A0A2V9KBD6      AR--AP--KLPSEPNLVRNVALSLAFGLFGGMCLAF-GLEKIN-EKT----IRTVEQVQL
A0A2W0AJ66      AQ--PP--KRPSEPNVPRNFGLSVGFGLVGGVLLAF-GLAKMH-EP-----ISTLEQAQI
A0A1Q7RBU1      AR--PP--KLPAEPKILRNLALSLLFGIFGGVLLAF-GLTKMN-EK-----ISTLEQALA
A0A2V9JPV9      AR--PP--KRPAEPNILRNFALSLLFGIFGGVLLAF-GLTKMN-ET-----ISTLEQAIA
A0A3P0X3W6      AR--PQ--NAPVFPKKGIFIFIGFFLSGVIAVAATL-LSDMMD-KS-----VRDPEQARR
A0A2N9MK30      AR--PG--LSPVFPNVPLNVGLALLFAAILAVGAAV-LSDTLD-NT-----IRNTEQVAR
A0A3D1ASD2      AR--PP--LKPVFPRTRLNVLIAFLFSTILAIGAAV-MSDVLD-NT-----LKDPEQIAR
A0A7C5AXI3      AR--PA--VKPVFPNMKLNVLLAFLFSTLIAVGMAV-LSDVLD-NT-----LRDPEQVAR
A0A7C6E4H7      AR--PA--LKPVFPNLKLNLALAFLLSSLLAVGAAI-LSDSLD-KT-----VRDPEQVAR
A0A1F2TCR2      AE--VP--AAPFTPNPRKDWFTAIMAGLLVGVGLAF-GIEYLD-DT-----VKTPEDITK
A0A350UQT3      AR--PA--WKPVFPKLTLNLLLAFLFSSLLAVGAAI-LVDTLD-NT-----IRDPEQVSR
A0A7C3HRX0      AR--AP--WKPVFPKMWLNLLIAFLFSSVLACSAAL-LADSLD-TT-----IRDPEQVTQ
A0A1F2V330      AS--LP--KGPSTPRRSRLLLVGLFVGLALGLAVAF-VAEQMD-TT-----FGNIVEFQT
A0A662EE63      AT--PP--SGPFSPNLRRAVALGGVLGLFLGIGLVL-GLDFLD-HT-----LRTPDQVER
A0A2V8TLH7      AP--LP--QMPIRPRPILNLLIGVMLGLLLGVGTVF-FLDYMD-NT-----VRTSEDVER
A0A1Q7ZJT1      AP--VP--KVPVRPRTVLNLAIGMLLGILLGVGAIF-FLDYMD-NT-----VRTSDDVEQ
A0A2V8VC99      AP--VP--KVPVRPRTVLNMAIGVLFGLLLGVGTVF-FMDYMD-NT-----VRTSEDVEQ
A0A348UZU3      AD--IP--LRPDSPRKFRNLLLALFLGLFGGLGLAL-GMEYLD-NT-----VKSAEDVER
Q01XL7          AV--AD--NIPSSPTPMRDIPTWSLFGGALCYGLLW-FREVLR-RKRLTQLFESPGHTRT
A0A2V8ERZ5      AE--TP--RGPITAGGRRTVLMSLMIGLVLAVAVAL-GLDYMN-DT-----IKTPEDVTR
A0A2V8GTX0      SE--VP--ESPFTPNTRRAWLMAILFGLGFGIAAAF-AIDYLD-DT-----VKTPEDVTW
A0A2V8J0X9      AD--VP--PFPVSPNPRRDWMTAILAGLSIALGLAF-GMEYLD-DS-----VKTPEDITK
A0A523DUV7      AS--IS--AVPIRPQPTKNLAIALVLGVLSGCGLIL-LRDYLD-NT-----LKEQEDIER
A0A1F2U158      AE--VP--AGPLTPTGRRTWLLSFAVGLVAAISVAY-GLDYMN-DT-----IKTPEDVTR
A0A2V8F6S9      AE--LP--RGPMAPTGRRTWLLSLAVGLAIAVAVAY-GLDYMN-DT-----IKTPEDVTR
A0A7D8BEX2      GV--PP--SRARLPSPWMLFVGAVFVLLLLGAIAAV-TIDLLK-AT-----FETLEEIEQ
A0A4Q1SCH5      AR--LQ--RFPVEPKKALILASGLILGCVAGIGAAL-LRESMG-GE-----IQSISQVES
A0A372IRG7      AM--IP--PYPVLPQKRQDATFGFLGGLIVGLILAV-FLESMD-DT-----LRTSDDAEA
A0A2V8K4L4      AK--PA--GAPYKPNLMNNAMLGSMAGIFLGVVLVL-LKEQAD-RS-----IQQPGDSSL
A0A2V8NCZ3      AK--PA--NLPYKPSPVNNAILGLMAGIFVGVVLVL-LREQAD-RS-----IQQPGDSAL
A0A4Q7YNP3      AH--KP--KMPFSPRRGTSTMAGLLLGSLFGIGFAF-YKDRNS-DI-----LRVPGEVER
E8UZE1          AL--TP--NIPSEPRRALNMEAGALLGLVVAFAVVF-LIENAN-AT-----IRTGEDIYR
A0A2U3JZ71      AR--PA--FKAVFPNIKLNVLLAFLLSTLLAIGTAI-CADLLN-NA-----VRDPEQVAR
A0A2V8TTB0      AR--PG--LKPVFPLTWLNVLLAFLFATFLGVGAAV-LTDVLD-NT-----IRDPDQVAR
A0A1V6HR88      AL--VP--GGPFRPSLRRNVTFAGGAGLVLGFGLVL-LLHYMD-RT-----LKSSEEVER
A0A3E0P0A3      AV--LP--TSPVSPSLRRHLPFGVALGLLCGVALVL-LIDFLD-RS-----IKSPEELER
A0A2V8EXP2      AE--TP--RRPASPNVVANLLLALFGGLTLAVGIAF-FFEYLD-NR-----IKTPDEIKA
A0A2W4RYA1      AV--LP--RTPSSPRKVLNLSLGFVVAVLGALGLAF-FFEYFD-NR-----LRTPEEMQA
G8P0Y7          AR--LP--RYPTKPNIPRNLEFALLVGLVVGIALAF-GLEALD-AT-----VRTPEQAET
A0A5M8T4U7      AQ--VP--IIPIAPRKTMSMLFGLIGGFVGGLVMAF-IIESID-DR-----MQTSEEVES
A0A7L5A491      AR--PQ--IHPVFPNKMVFIFLGFLFSSVVSLIVVI-VSDMFD-KS-----LRDPDQARR
A0A7D8BF18      AM--PP--IGPSLRPKSTIMMIDALGMLIIGVVLAF-VLDSLD-MG-----LRTVSEVES
A0A1E3Y9R6      AT--VP--SAPVLPRTPRDLLLAALAGGLLALGLAF-GFEYFD-SR-----IKLPEEIKT
A0A2W4TLP2      AE--VP--RVPVLPRTQRDLMLAALAGLVLAFGLAF-GVEHFD-SR-----IKLPEEIKT
A0A7G8BDY8      AT--LP--TRPVEPNIPLTLALSIFLGLGSGVGLAF-LAENLD-NT-----IRSTEDIEF
A0A7C4BZ42      AQ--AP--SAPYRPRPGRMAFFGLLGGLVLGFGFVI-LRERAD-RT-----LQQPGDLTL
A0A3R9WF43      AR--PA--GTPSSPDYPKYLTLVAGIGIFLGISSAF-VRESLD-ES-----IRTPLDIEA
A0A317HKM4      AE--IP--TVPSLPRQTHNLMLAFAGSSSLALVLVF-VLEVFN-TR-----VTSVEDVKR
A0A2V9CG11      AE--VP--RLPYKPNLPMNAALGMFGGFFLALGLVL-FRERLD-RR-----IQSPGDAHV
A0A523E0N1      AE--AP--TVPFAPGSNRRFALLLALGVILGAGTAY-LLDHWD-DA-----IHTVDDVKQ
A0A4R1LAZ7      AS--IP--ALPISPVKRVDLGVGLAAGLLVGISLSL-LLESLD-DT-----IQTSEDAET
A0A7G8BMP1      AA--EP--ARPISPAKKRDLLFGLLGGLLLGTIAAL-FLESLD-DT-----IRTSDDAEA
A0A523ECP2      AL--VP--KVPTGPRLSRSLLLGSVVGIALALGLAL-FLDYWE-TS-----IYTIEDLRR
A0A2W0C122      AE--AT--ELPVSPYLPRSSYLGLFLGFLLSAAVIG-FRESMD-RA-----LRDPADVES
A0A2W0AUU7      AG--AT--GLPVSPNLRRTSCIGLFLGFLLSAAAIG-IREGMD-RA-----LRDPAEVES
A0A2W0BQL1      AG--AT--GLPVSPNLRRTSYIGLFLGFLLSAAAIG-IREGMD-RA-----LRDPAEVES
A0A4Q1SDL1      GR--VP--AKPKKPNVPLYLLIAAFGGLVLGLAGAL-IAEAMD-RR-----IQTVEQLDR
A0A3P0XH15      AV--TP--ALPVFPVKRNDAAIGLAAGLVLGLALAL-FAETID-DT-----IRTSDDAES
A0A3M1WQW8      AQ--VP--TTPARPRKLFTTGVSGLVGLLLGIVLAL-FVEYLD-NT-----VKSTEDVDR
A0A3N1JHC1      AK--AS--LIPTSPKLSICIFLAVLLGGVFSLLYIL-ISERRD-NS-----VRNPGESEQ
C1F294          AN--LP--VIPVTPQKKRTVVFGFLGGLIAGIAISL-LLESLD-DT-----LRTSEEVES
A0A2V9KA79      AR--LP--SAPVTPGRVRILLLGLAAGLCLGLGLAV-LAENLD-TT-----FENAEQFQS
A0A522PSP1      AR--PN--SAPVYPRTKQTLMLALILSGMLGVLGAV-AADGMD-RT-----LRDPRAVPS
G8P085          AR--AP--LIPVEPKKLVILSFGLVLGLFAGVGSAF-LREALS-DK-----LQSVDQIER
A0A7C6A629      AR--PA--LKPVFPDLKLNLALAFLLSSLLAIGAAI-LSDAMD-KT-----IRDPEQVAR
A0A4Q1SGQ1      AQVPPT--HRPSSPRMLLVYACALIGGLFLGCTGGW-TAERFD-HS-----VRSLEQLEE
Q1ILD9          AP--VP--IKPVEPAMKLAMALGLIGGLFMGFAGVV-VAEAVD-QS-----LKTPDDVEL
A0A7G8BJH7      ARVPPP--NRPKSPNVLLYYAAAIVGGFIFGAGAAF-LRDLSD-TK-----VRSLEELER
A0A7C5SHM3      AT--VP--ESPAVPRVKLNLALGLVFGIFLGIGAAF-LAEAMD-NK-----IRGGAHLAE
Q1IJZ6          GL--PP--AKPSHPDPLVNGIVGLGGGLFVGLILAF-VVETLD-DS-----VATTTDAEE
A0A2V8TCE6      AI--PP--TAPCKPRPGVELPLGLFVGLLLGMGAAF-GMESWD-NT-----LRTQEEIER
A0A522TBE8      AR--PD--FRPVAPRPKLTAAVALLLSLLAGVGFVL-ARDALD-QS-----VASAEQVEL
Q1ITG0          SA--VP--QLPVLPNVPLFIALGLFGGAFLGVCSAF-VKESID-QT-----ISSPEDAEE
A0A7C2ML20      AE--VP--LLPSNSR-RSPLVHGALLGLILGIGFAF-FLEFLD-DK-----VKTVEDVES
A0A7C5AXS9      AK--PP--HFPYKPNYPLNSALGLMLGLMLGVGFVL-IRERAD-RT-----IQAPGEVSL
A0A7C2RGE3      AE--VP--LRPARPRKLFNIGLSVIVGLLLGIGLAL-FVEYLD-NT-----VKSTEDVDR
A0A3N5PCI5      AE--VP--RRPVRPDTRSTLMIGLLLSGILAVAIAF-IREAFD-SR-----LQTPSAVRA
A0A3M1Q0S9      AT--PP--RMIFKPKKKLNVALGFLFGLFLGIGAAF-VMEYVD-NT-----IKTPDDVRD
A0A2Z5G448      AE--VP--AFAVAPKKRTNYGFGALIGLFIGIAAAL-FLETLD-DT-----IRTSEDAEA
A0A3M1VZ38      AV--PP--EIIYRPKKKLNILLGFLLGLCLGIGGAV-LAEYID-NT-----IKSPDDVRD
A0A4Q1SD29      AN--IP--PFPVLPAKRSDVMFGLLGGLIVGMALAF-FMEGLD-DT-----VRTSDDAEQ
A0A6N9FGE2      AE--TP--VRPARPRRQLILLLGLLGGGTLGVGLVF-AVEFVD-DR-----IRTPDDMRT
A0A3M1PY35      AT--PP--ERPAVPRYRLDLALSALLGLFLGIGAAF-AAEARD-NK-----VRSVEQLGE
A0A3M1VMP2      AK--PP--KSPSAPRVKLNLALGLLLGLLLGVGGAF-GAEALD-VK-----LRTASQMRE
                                                                            

A0A2V7VMF7      YLHLDLLSAVPRYE----------------------------------------------
A0A2V7YYV7      RLGLLPVGHIGYVL----------------------------------------------
A0A2V7Z0J5      RVGLISLGHVPFLV----------------------------------------------
A0A2V7Z3M4      RLGLVPHGHIAFVP----------------------------------------------
A0A399Y5V2      AFGAPILGMIPRA-----------------------------------------------
Q01X01          YLTLPELGAIPRAA----------------------------------------------
A0A3M2D9H8      NLDLPVLGYISEMN----------------------------------------------
A0A2V8JK38      HLGLLALGTVPRLH----------------------------------------------
A0A2V9IXG5      SLSVPALGFLPRTK----------------------------------------------
A0A2V9J2P4      SLSVPALGFLPRTK----------------------------------------------
A0A1Q7RLS4      YLRLNLLAIVPKEA----------------------------------------------
A0A2V2R525      SIRLPTIAVVPTVK----------------------------------------------
A0A321LPW6      FVRLPALGVIPMMT----------------------------------------------
A0A2V9R9V4      YTQLPALAVIPVIG----------------------------------------------
A0A321LE75      YAQLPALGIIPAIT----------------------------------------------
A0A2V8R8U7      YIHLPALALIPSVR----------------------------------------------
A0A2V8QMP4      HLHLPTLALIPAPR----------------------------------------------
A0A2V8R4S3      HLHLPTLALIPAPR----------------------------------------------
A0A2V8NJ55      YIHLPALALIPGQR----------------------------------------------
A0A2V8Q7I0      YVHLPALALIPASR----------------------------------------------
A0A2V8S6K4      HVHLPTLALIPAPR----------------------------------------------
A0A317I2L9      YVHLPALALIPASR----------------------------------------------
A0A2V8LLF9      YLHLPALALIPTAR----------------------------------------------
A0A352FRF4      YINLPALALIPAVR----------------------------------------------
A0A2V8MKV0      YIHLPTLALIPAAR----------------------------------------------
A0A2V8PYY8      YIHLPTLALIPAAR----------------------------------------------
A0A1Q7YKQ8      YLHLPALALIPSTR----------------------------------------------
A0A352F3R7      YLHLPALALIPASR----------------------------------------------
A0A0B6WXT1      YLHLPTLALIPAPR----------------------------------------------
A0A3B9MEU8      YLHLPALALIPSNR----------------------------------------------
A0A2V8MHG6      FLRLPALTVIPTIG----------------------------------------------
A0A2V8P7N1      FLRLPALTVIPTVG----------------------------------------------
A0A2V8M3M6      FLRLPALTVIPTVG----------------------------------------------
A0A1Q7NJH5      FLRLPALTVIPTIG----------------------------------------------
A0A2V8PJY0      FLRLPALTVIPTIG----------------------------------------------
A0A1Q7Y6W9      VLRLPALGVIPSIE----------------------------------------------
A0A2V8NC68      TLRLPSLAVIPAIG----------------------------------------------
A0A399WK13      LLQLPALAAIPTID----------------------------------------------
A0A352FLX4      LLRLPAIALIPQVG----------------------------------------------
A0A2V8RTL7      LLQLPALTAIPTID----------------------------------------------
A0A3E0PCJ6      YLQLPALAAIPTVE----------------------------------------------
A0A3M1S4R8      YLGLPVLVVIPSMN----------------------------------------------
A0A7C2G442      YLGLPVLVVIPSMN----------------------------------------------
A0A1Q7YFI6      MLRLPTLAVIPAVG----------------------------------------------
A0A136KC10      LLHLPALAAIPTIQ----------------------------------------------
A0A3M2D6Y5      YLGLPALAVIPTIG----------------------------------------------
A0A2V8SEX6      YLQLPALAAIPTID----------------------------------------------
A0A7C5ZUU4      YLQLPALAAIPMME----------------------------------------------
A0A0B6WWQ6      ELHLPALAAIPTVS----------------------------------------------
A0A3B9MK99      LLQLPALGVIPSAN----------------------------------------------
A0A352EX26      LLHLPALAVIPSAN----------------------------------------------
A0A2V8MM59      LLGLPALAVIPSMS----------------------------------------------
A0A2V8PFE8      FLRLPALAVIPSMS----------------------------------------------
A0A2V8PWS6      FLRLPALAVIPSMS----------------------------------------------
A0A2V8LCT5      FLRLPALAVIPAMG----------------------------------------------
A0A352FTJ9      FLRLPALAVIPAMS----------------------------------------------
A0A257VBK0      RMGVALLTMVPKFEP---------------------------------------------
A0A2G6PYV5      VTVLPTLATIPKVS----------------------------------------------
A0A2V8F956      HLQLPHLGLLPALN----------------------------------------------
A0A1F2S1W5      HLGLPFLGMVPALF----------------------------------------------
A0A1F2T595      LLGLPFLGMIPALS----------------------------------------------
A0A2V8JQV5      YLNVPELGVVLSAE---------------------------------------------A
A0A2V9AC41      FIQLPTLGVVPDFA----------------------------------------------
A0A2V9MAM9      RLNLVELGAIPSAR----------------------------------------------
A0A348V070      ATGWPTIGTIPAFE------------------------------KEFKPRGPRAEFRTLS
A0A2V9M454      LTSLPTLSIVPLSH----------------------------------------------
A0A2V9IVR7      YLSTNALAVIPLAR----------------------------------------------
A0A2V9ILE2      YLSTNALAVIPLAR----------------------------------------------
A0A2V9LGY4      YLSTNALAVIPLAR----------------------------------------------
A0A2V9J4D6      LVGLPSLGLIPLWA----------------------------------------------
A0A2V9L9C5      LVGLPSLGLIPLWA----------------------------------------------
A0A2N9M9N1      QIAIPTLAVIPLGT----------------------------------------------
A0A2V9JEC4      SFSIRALTIVP--A----------------------------------------------
A0A2V9LPQ3      LLGIPALAIIPSAS----------------------------------------------
A0A2Z5G3A3      MLGGVPIGILPAFD----------------------------------------------
A0A2V7UGP8      YVQLPTLGTIPMVV----------------------------------------------
A0A239MKT6      AWSAPVIGVVPHFV----------------------------------------------
A0A3E0PCN7      HEGVSVLGMVPGAD----------------------------------------------
A0A2V8IYW3      ALKIPVLAVLPVME----------------------------------------------
G2LEI9          LLNLPTLGLIPQVS----------------------------------------------
A0A317J121      LLNVPELGVIPSIE----------------------------------------------
A0A2V7YW66      RLGLPPLAVIHDVT----------------------------------EMGKAYGYAGGY
A0A2V7Z0V0      KLGLPTLAVIQDLS----------------------------------ESGKAYGYS---
A0A2V8GFD4      QLGLPFLGLVPQLR----------------------------------------------
A0A2V8HSS5      QLGLPFLGLVPQLR----------------------------------------------
A0A2V8KP55      HLGLLALGTVPRLH--------------------------NLSLWRGYKYKYGYGYGFRF
A0A399WNU1      QLGAPIVGMIPQSN------------------------------------------GHRR
A0A2V9JSI3      LTGMPTLAVIPLAA----------------------------------------------
A0A2V9WI32      ISALPSLGIIPLST----------------------------------------------
A0A2V8IVN9      HLGMPALGMLPAVQ----------------------------------------------
A0A7C5Z4J3      SIAEPVLSVIPSAG----------------------------------------------
A0A1F2TPT3      RLGLPVLGFLPEIK----------------------------------------------
A0A2V8JTQ2      LSSLPALGVLPLLE----------------------------------------------
A0A2V8UZY0      LSPLPALGVLPLLK----------------------------------------------
A0A350UEK1      YLGARELGVVPSAG----------------------------------------------
A0A350UIQ4      YLGVRELGVVPSAS----------------------------------------------
A0A1H5Z7N3      ITGLPSLAVIPKTR----------------------------------------------
A0A1G7JVV8      ITQLPSLSIIPRVR----------------------------------------------
A0A1H4T6W9      ITQLPSLSVIPRVR----------------------------------------------
I3ZEU5          ITQLPSLAVIPKVR----------------------------------------------
A0A7L5A6M5      ITELPSLAIIPRSR----------------------------------------------
A0A428MDU2      ITELPSLAVIPRSR----------------------------------------------
A0A5B9EBI2      ITELPALAIIPRSR----------------------------------------------
A0A239HDF6      ITEMPSLAVIPRLR----------------------------------------------
A0A4Q0T270      VIELPSLAVIPKAR----------------------------------------------
A0A1Q3QQB6      LIELPSLAVIPKAR----------------------------------------------
A0A3N1K1G7      ITELPSLAIIPRAR----------------------------------------------
A0A4V2G466      IIELPSLAIIPRFR----------------------------------------------
A0A6B9YNQ8      FLELPSLAIIPRFK----------------------------------------------
A0A7G8BSK5      IIELPSLAVIPRFS----------------------------------------------
A0A1I6MH75      VIELPSLAIIPKAR----------------------------------------------
E8WVF6          ITELPSLSIIPRAR----------------------------------------------
A0A3N5YNR8      SLGLPSLGVIPAMA----------------------------------------------
A0A3N6A5T6      TLDLPSLGVIPAFK----------------------------------------------
A0A1F2Q9L4      ILSLPVLAVIPDVA------------------------------------------RSRN
A0A2U3KC61      ISTLPALGTIPL------------------------------------------------
A0A2V9Y2R7      ISTLPALGMIPL------------------------------------------------
A0A2V9NGH6      ISGLPSLGIIPDGS----------------------------------------------
A0A2V9PYE6      ISGLPSLGIIPDGS----------------------------------------------
A0A2V9NL07      ISGLPSLGMIPLGS----------------------------------------------
A0A2V9QD92      ISGLPSLGMIPLGS----------------------------------------------
A0A2V9WPZ6      ISSLPSLGS-RTGV----------------------------------------------
A0A2V9ZLH4      ISALPALGMIPLGS----------------------------------------------
A0A2V9RQF1      ISGLPSLGMIPLGS----------------------------------------------
A0A2V9YDK8      ISGLPSLGMIPQGS----------------------------------------------
A0A2V9V8F7      ISSLPSLGMIPQGS----------------------------------------------
A0A2V9XGR9      ISSLPSLGMIPQGS----------------------------------------------
A0A2V9V3Q5      ISALPSLGMIPLGS----------------------------------------------
A0A2V9NWS3      ISALPSLGIIPMGS----------------------------------------------
A0A2V9USA9      ISGLAPLGMIPLGS----------------------------------------------
A0A2V9XW18      IAGVASLGMIPLGS----------------------------------------------
A0A1H5SQF5      LTSLPLLGLVPQAG----------------------------------------------
A0A2V9AEW6      YLDLPELGVIPLDD----------------------------------------------
A0A2V8WQK6      YLDLPELGVLPLDQ----------------------------------------------
A0A2V8XIF4      YLDLPELGVIPFDQ----------------------------------------------
A0A2V2R0I6      LARLPSLAVVPHFT-----------------------------------GSN----GNGK
A0A2V8XAR9      LARLPSLAVVPQFA-----------------------------------SSN----GSSK
A0A2V8VZA0      LSGLPSLAVVPQFA-----------------------------------GSN----GNGK
A0A1Q7CB82      LSGLPSLAVVPQFA-----------------------------------GSN----GNGK
A0A2V8WIU1      LSGLPSLAVVPQFA-----------------------------------GSN----GNGK
A0A1Q6Y9F5      LSRLPSLAVVPQFA-----------------------------------SSN----GRSK
A0A2V9EVV8      LSRLPSLAVVPQFA-----------------------------------SSN----GSSK
A0A2V8YF91      LARLPSLAVVPQFS-----------------------------------GSS----G-GN
A0A2V8XZK2      LARLPSLAVVPQFT-----------------------------------GLN----G-SK
A0A2V8ZTX6      LARLPSLAVVPQFA-----------------------------------GTN----G-SK
A0A2V9BT79      LARLPSLAVVPQFA-----------------------------------GSN----G-HK
A0A2V9YHT3      VSALPSLGIVPMSI-----------------------------------SLSSQAQGRNG
A0A7C2XNI7      LARLPSLAVVPAFS-----------------------------------LVN----GRAR
A0A1Q8B793      LARLPSLAVVPAFI-----------------------------------DTN----GRNG
A0A2V9BCA0      LARLPSLAVVPAFI-----------------------------------DTN----GRNG
A0A2V9BWU9      LTRLPSLAVVPAFV-----------------------------------TLN----GRNR
A0A2V9DKX2      LTRLPSLAVVPAFV-----------------------------------TLN----GRNR
A0A7C2YQY3      LIGLPALGVIPGVS----------------------------------------------
A0A3E0NV31      SIGLPVLGTVPSIG-------------------------------------------KQE
A0A3N5M5V0      SLGLPSLGVIPAIS----------------------------------------------
A0A3N5XQP8      ALHIPALGIVPKSQ-----------------------------------ELT----NGAN
A0A2Z5G7H4      DLELVPLGILPHLG-----------------------------------EPN----WYRR
A0A2V9L5B5      LLRLPSLGVLPRFT----------------------------------------------
A0A2V9LK56      LLRLPSLGVILEFD----------------------------------------------
A0A2V9L7I0      LLHLPSLGVLPRFT----------------------------------------------
A0A522PPT0      LLRLPSLGLIPSVH----------------------------------------------
A0A7C5V1G5      LLRLPSLGMIPSVH----------------------------------------------
A0A2V9KCS3      YLNLPELGVIPSAK-----------------------------------ADR----GLNS
A0A372IT17      LTGAPLFSVIPLLE----------------------------------------------
A0A4R1LC91      YIGGLPIGILPKYT----------------------------------------------
A0A3M2BZG9      ITGLPTLTVIPDVAERNRSYAARLRYGLGNGYGYGYGYGYGYGYGYGYYGAE----GRKR
A0A1Q7N5R7      GMGLRILGALPHVK-----------------------------------NRK----AGPD
A0A2V9QB26      WLNVPELQVIPTAV-----------------------------------EES----RRCL
A0A2V9VYY4      VSTLPALGTIPLQL-----------------------------------VTD----ERFR
A0A3E0PHB0      SLGLPTLGLIPHQK-----------------------------------MMD----RGKK
A0A3M1SIV3      HLNLPTLALIPEAQ-----------------------------------EKK----KVKS
A0A3M2D491      HLGLPTLAIIPEAT-----------------------------------ASK----KTKL
A0A353C9L6      HVGLPTLALIPHYF-----------------------------------GSE----KRRL
A0A2V8RQV0      HLGLPTLGLIPHHG-----------------------------------IAE----RRRL
A0A2V8SJH5      HLGLPTLALIPHHF-----------------------------------GSE----KRRL
A0A357F267      HLGLPTLALIPHYF-----------------------------------GSE----KRKH
A0A7C5ZUA8      QLGLPTLALIPHY------------------------------------GSA----DRRK
A0A136JPP4      ALGLPTLAMIPHH------------------------------------GIN----EKKR
A0A399WUJ8      ALGLPTLAMIPHH------------------------------------GIN----EKKR
A0A2V9KIE8      LVRLPSLAVLPSFA-----------------------------------LND----GKGD
A0A352F549      GLRLPSLAVIPIAG-----------------------------------KS---------
A0A3B9MLP9      GLRLPSLAIIPIAG-----------------------------------RS---------
A0A3D5SQ87      GLRLPSLAIIPIAG-----------------------------------RS---------
A0A2V8NW86      WLNVPELQVIPTAV-----------------------------------EES----GRCL
A0A7C2GJ20      LLGLPVLGLVPALE-----------------------------------SLE----RRRW
A0A7C4BTL5      YLNVPELGVIPVAD----------------------------------------------
A0A2V8ZHL8      VVNAPALAVVP-------------------------------------------------
A0A2V9B240      VVNAPALAVVP-------------------------------------------------
A0A2V9CBM2      LCGLSVLALIPAVQ-----------------------------------PSN----GDQH
A0A2V8XN17      LLGLPSLALIPVVA-----------------------------------SAN----GNHL
A0A2V8WX45      LFGLPSLALIPVVP-----------------------------------PSN----GDQH
A0A1Q6YR79      LLGLPSLALIPVVP-----------------------------------ASN----GDHL
A0A1Q7VA32      LLGLPSLALIPVVP-----------------------------------ASN----GDHL
A0A2V9EY85      LLGLPSLALIPVVP-----------------------------------ASN----GDHL
A0A2V9H8K0      LFGLPSLALIPAVP-----------------------------------PSN----GDLQ
A0A2V9FFE5      LFGLPSLALIPVVP-----------------------------------PSD----SDQH
A0A2V9GM43      LFGLPSLALIPVVP-----------------------------------PSD----SDQH
A0A2V9CYQ5      LFGLSVLGLIPAVQ-----------------------------------PSN----GDQH
A0A2V9BWU8      LFGLSALALIPSVH-----------------------------------CLN----GDRP
A0A2V8ZG48      LFGLPALALIPAVH-----------------------------------HLN----GNGP
A0A2V8Y334      LFGLPALALIPSVH-----------------------------------HLD----GDRH
A0A2V9AY68      LFGLSALALIPSVH-----------------------------------QLG----GNRN
A0A1F2RFI7      FLHLPTLGIIPAAS-----------------------------------A-N----GRAG
A0A1F2RZS3      YLRLPTLGVIPAAN-----------------------------------A-A----SRKK
A0A1F2USE2      FLHIPALALIPSVE-----------------------------------SLS----GRRG
A0A7C2VB08      YLQIPTLAFIPAED-----------------------------------SLV----GRRG
A0A2V9C238      FLGLPALALIPAVE-----------------------------------SLN----GRRK
A0A1F2Q9F5      FLHLPVLALIPSLE-----------------------------------SLN----GRRR
A0A1F2QQH9      FLHLPVLALIPSLE-----------------------------------SLN----GRRR
A0A1F2QXK7      FLHLPVLALIPSLE-----------------------------------SLN----GRRR
A0A2V9DEM9      FLGLPALALIPAVE-----------------------------------SLN----GRRR
A0A7C5TWV7      YLGLETLAAVPKFT----------------------------------------------
A0A2V7XDY0      YLHIDLLAAVPQYD----------------------------------------------
A0A2V8G155      HLRLASLGLVPAVR----------------------------------------------
A0A2V8HDM7      HLRLASLGLVPAVR----------------------------------------------
A0A2V8DRT9      HLGLPFIGMIPKMA----------------------------------------------
A0A2V7VYF3      HLRMPCLGLVPAAP----------------------------------------------
A0A1F2SVH2      HLGLPFLGMVPALF----------------------------------------------
A0A2V8AJG9      HLGLPFLGMVPALF----------------------------------------------
A0A2N9LQU7      ASSIPALATIPL------------------------------------------------
A0A2P6WFK7      CLALPVLCTIP-------------------------------------------------
A0A2V8U914      YLNLPELGTIP-------------------------------------------------
A0A2V7W309      VTKFASLGVIPAAG----------------------------------------------
A0A2W0BGU4      LIATRALALIPMKR----------------------------------------------
A0A2W0BVQ9      LIATRALALIPMKR----------------------------------------------
A0A2V9MN96      ITALPMLGVIPLQL----------------------------------------------
A0A2V7V2Z1      QLAAPLLAVIPEIA----------------------------------------------
A0A2V7X2F7      HLGAPLLGVVPETG----------------------------------------------
A0A2V7V2I1      HLGVPLLGVIPEHG----------------------------------------------
A0A2V7U3M2      QLGAPLLAVIPEIS----------------------------------------------
A0A2V7UHT0      QLGAPLLAVIPEIG----------------------------------------------
A0A2Z5FVL3      LMGEAPFGILPSFA----------------------------------------------
A0A2V9KBD6      LSPLPVLGALPLLE----------------------------------------------
A0A2W0AJ66      LSPLPALGVVPLLE----------------------------------------------
A0A1Q7RBU1      LSPLPSLGVVPLLE----------------------------------------------
A0A2V9JPV9      LSPLPSLGVVPLLE----------------------------------------------
A0A3P0X3W6      SLQVEVLGILPDVL----------------------------------------------
A0A2N9MK30      IVKAEVIGGLPQVK----------------------------------------------
A0A3D1ASD2      TLKTQVIGTLPSMK----------------------------------------------
A0A7C5AXI3      VLRTEVVGTLPVVK----------------------------------------------
A0A7C6E4H7      TLNTEVVGSLPMVK----------------------------------------------
A0A1F2TCR2      VLGLPLLGLVPAIR----------------------------------------------
A0A350UQT3      TLKTHIIGTLPSVK----------------------------------------------
A0A7C3HRX0      TLRTHIAGTLPAAR----------------------------------------------
A0A1F2V330      FTNLPAIAVLPSMS---------------------------------------------A
A0A662EE63      YLGLEVLAALPKLT----------------------------------------------
A0A2V8TLH7      YLKLNILAVVPRDN----------------------------------------------
A0A1Q7ZJT1      YLRLNLLAIVPKEA----------------------------------------------
A0A2V8VC99      YLRLNLLAIIPKQS----------------------------------------------
A0A348UZU3      YSGWPTLGVVPIFD-------------------------------------------QDA
Q01XL7          ILGVPELGVIPSAT----------------------------------------------
A0A2V8ERZ5      RLKLPFLGLVPVVR----------------------------------------------
A0A2V8GTX0      RLHLNFLGLVPKVH----------------------------------------------
A0A2V8J0X9      RLRLPLLGLVPAVR----------------------------------------------
A0A523DUV7      HLRVDCLAIVPEHD----------------------------------------------
A0A1F2U158      MLKMTFLGLIPSVR----------------------------------------------
A0A2V8F6S9      RLKLPFLGLVPSVR----------------------------------------------
A0A7D8BEX2      GLHLPGLCLLPLET----------------------------------------------
A0A4Q1SCH5      NVGLANLATVPHMD----------------------------------------------
A0A372IRG7      VSLLPALAVIPHFQ----------------------------------------------
A0A2V8K4L4      YLGISELGVIPSDR----------------------------------------------
A0A2V8NCZ3      YLGVSELGVIPSDR----------------------------------------------
A0A4Q7YNP3      YLNLNELGVIPSSR-----------------------------------YEDKAFPA---
E8UZE1          YSGLPLLSIVPHLS----------------------------------------------
A0A2U3JZ71      TLSTEVIGTLPSVK----------------------------------------------
A0A2V8TTB0      LMNTNVVGSLPTVK----------------------------------------------
A0A1V6HR88      LFGVPVLAVIPDVG-----------------------------------AGGKGYGLRGR
A0A3E0P0A3      RLGLPVLGVVPDLN----------------------------------------------
A0A2V8EXP2      HLGLPFLGLVPALF-----------------------------------AKDLH--DPLI
A0A2W4RYA1      VLGLTSLAMLPSVP-----------------------------------ASSLRSGDPLM
G8P0Y7          TSGLPVLGVIPMQP----------------------------------------------
A0A5M8T4U7      VSTLASLATIPHME----------------------------------------------
A0A7L5A491      ALGTEIIGVLPHVH-----------------------------------TFGPITSRSEL
A0A7D8BF18      VSGLPSLALIPRTR----------------------------------------------
A0A1E3Y9R6      HLNLPFLGMIPVFP----------------------------------------------
A0A2W4TLP2      HLGLPFLGMIPTFP----------------------------------------------
A0A7G8BDY8      LTTIPVFGWVPHFK----------------------------------------------
A0A7C4BZ42      YLNLPELGVIPSGK----------------------------------------------
A0A3R9WF43      ASHLSILAYIPTKS----------------------------------------------
A0A317HKM4      HLRIPVLGLMPQVP----------------------------------------------
A0A2V9CG11      YLNISELGVITSAE--------------------------------------IKHSRQIA
A0A523E0N1      HVPLPYLGMIPRYG-----------------------------------TDSALKSIKSR
A0A4R1LAZ7      VSGLTTLAVIPHF-----------------------------------------RGA---
A0A7G8BMP1      ISGLPSLAVIPHFD-----------------------------------VLKKLSGS---
A0A523ECP2      HVPLPYMGMVPRLD-----------------------------------SDTASRWDALA
A0A2W0C122      FTAMPSLAIIPQHR----------------------------------------------
A0A2W0AUU7      FTAMPSLAIIPQHH----------------------------------------------
A0A2W0BQL1      FTAMPSLAIIPQHH----------------------------------------------
A0A4Q1SDL1      L-GVPLVAILPRYS----------------------------------------------
A0A3P0XH15      VVGLPSLAVIPHFE----------------------------------------PAQKKG
A0A3M1WQW8      LLGLPSLGVVPALE-----------------------------------SLERKKRL---
A0A3N1JHC1      YVERPELAVIPRDR-----------------------------------LIAKKSKA---
C1F294          IGHLPALAIVPRFV-----------------------------------SGAKRKTA---
A0A2V9KA79      FFDFPVLCIIPSMN-----------------------------------LHNLRRKVRSE
A0A522PSP1      ELGAGLLGSLPELQ----------------------------------------NDI---
G8P085          ALGYQLLAIIPHIS----------------------------------------IAQ---
A0A7C6A629      TLNTEVVGSLPMVK----------------------------------------SWR---
A0A4Q1SGQ1      EVGSPLLGILPEFS----------------------------------------RRL---
Q1ILD9          ITSLPVIGVIPNTA----------------------------------------VGR---
A0A7G8BJH7      LTGNPLLGLIPEIR----------------------------------------KGRTLS
A0A7C5SHM3      LTGLPLLGSIPRLA----------------------------------------TPH---
Q1IJZ6          LTGIAVLGVIPIVN----------------------------------------ENPRVL
A0A2V8TCE6      FLGTPTLARIPSAS----------------------------------------LDP---
A0A522TBE8      LFRVPVLGLLPLLE----------------------------------------SEN---
Q1ITG0          MAGISTIGLIPHFS----------------------------------------MEG---
A0A7C2ML20      FVRLPNLGVIPLTK----------------------------------------TDE---
A0A7C5AXS9      WLDAPELGVIPCAH----------------------------------------RHSGLL
A0A7C2RGE3      LLGLPVLGLVPALE----------------------------------------SLE---
A0A3N5PCI5      L-GIPFLGMLPYVG----------------------------------------KRA---
A0A3M1Q0S9      VLQLPVLGMIPAQE----------------------------------------PAT---
A0A2Z5G448      ISSLPSLAVVPRFT----------------------------------------TAA---
A0A3M1VZ38      ILDLPLLGMVPA--------------------------------------------P---
A0A4Q1SD29      IAHLPTLAVIPRF-------------------------------------------P---
A0A6N9FGE2      HLKAPYLGMIPQS-----------------------------------------EVE---
A0A3M1PY35      LGGLPVLGSVPHV-----------------------------------------EGP---
A0A3M1VMP2      ITGLPLLGSIPRA-----------------------------------------SAP---
                                                                            

A0A2V7VMF7      ------------------------------------------------------------
A0A2V7YYV7      ---------------------------------------AGKGNRGELITL---------
A0A2V7Z0J5      ---------------------------------------AGKGKRGELVTL---------
A0A2V7Z3M4      ---------------------------------------AGKGKRGELVAL---------
A0A399Y5V2      --------------------------------------QSWNDRRSAMLLSVK-------
Q01X01          ----------------------------KRKFAVLGFLSESNGKSQVERASLE-------
A0A3M2D9H8      ----------------------------------GKLPREDYPPHVVA------------
A0A2V8JK38      ------NLSLWRGYKYKYGYGYGFRFGRKKEQNEPANAEKSDNRSIELAPH---------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------SWP--ASKLLPSR---------KLFLQ--PRNGNKNGRPLIMY-D---------
A0A321LPW6      ------A----GKRGLGPKRRA------YALAAAGPAARALLASQAEIVEC---------
A0A2V9R9V4      ------A----NKSLLNGRRRKDNTPELLALGSGDKASAIMQRA--RLMEF---------
A0A321LE75      ------S----SRPKLLTAKGQGA----LGANGSAPAAAGLQRAASTLATL---------
A0A2V8R8U7      ------S----EKRLRGAE---------PL--------KPSDTTALAMV-T---------
A0A2V8QMP4      ------E----SRRLLARS---------GHEA------EPATTTALALI-E---------
A0A2V8R4S3      ------E----SRRLLARG---------SHEP------EAGTTTALALI-E---------
A0A2V8NJ55      ------S----ERSLLKSK---------NPPPN-----TGKESTALALI-E---------
A0A2V8Q7I0      ------G----DRGRLKGV---------VPATA----GGPSETTALAMI-D---------
A0A2V8S6K4      ------E----ARRLAFGR---------TAHVH-----DHTESTALALI-E---------
A0A317I2L9      ------S----IGGRLKGM---------TSANV-----GPSESTALAMV-D---------
A0A2V8LLF9      ------N----EKTKL--I---------AGDAA-----APAATTALTMV-N---------
A0A352FRF4      ------N----DRTRLRGG---------EAALA-----GPNDTTALAMV-K---------
A0A2V8MKV0      ------S----EKRL---R---------EGEAP-----TAGASTALAMV-E---------
A0A2V8PYY8      ------S----EKRL---R---------EGDAP-----AAGASTALAMV-E---------
A0A1Q7YKQ8      ------S----EQRL-RLK---------GGAQA-----EHGESTALALV-A---------
A0A352F3R7      ------E----RGRLIG-T---------GPSPE-----GPSDTTALALV-H---------
A0A0B6WXT1      ------T----ERLLLKGK---------ASEPE-----GVAEKTALALI-S---------
A0A3B9MEU8      ------D----RGRLIGIS---------GGPPS-----APSDTTALAMI-T---------
A0A2V8MHG6      ------NS---ARRRLLSA---------MPGSKRNGHQ---GGPELLLY-G---------
A0A2V8P7N1      ------NS---ARRRLLSA---------MPGSKRNGHQ---GGPELLLN-G---------
A0A2V8M3M6      ------NS---ARRRLLSA---------MPGSKRNGHQ---GGPELLLN-G---------
A0A1Q7NJH5      ------NS---ARRRLLSA---------MPGSKRNGHQ---VGPELLLN-S---------
A0A2V8PJY0      ------NS---ARRRLLSA---------MPGSKRNGHQ---VGPELLLN-S---------
A0A1Q7Y6W9      ------GK---TRRKLLPS---------VGSLQIRNGKGGINQPELIFS-T---------
A0A2V8NC68      ------SL---SKRRLLRN---------VSALQKRNGN---HPAELLLSHT---------
A0A399WK13      ------SM---PKRRLQLV---------AENGE---PADDNLGSELLIH-A---------
A0A352FLX4      ------TVK--PKRNLAAS---------GKKGALVSSNGSGSGEVLLTN-I---------
A0A2V8RTL7      ------SI---PKRKLLLV---------GGKGE--EVEEDRLNSELLIF-A---------
A0A3E0PCJ6      ------AS---SKRRLLLV---------GVNES--E-EP-EPGNALLIS-N---------
A0A3M1S4R8      ------AA---QKRRLLLV---------GSSDN--E-PAFKNRSELLIY-D---------
A0A7C2G442      ------AA---QKRRLLLV---------GSNDD--E-SASKNRSELLIY-D---------
A0A1Q7YFI6      ------NA---SRRFLPKM---------TALQK--SDNGDHGS---LLE-P---------
A0A136KC10      ------SM---PKRRLQLV---------GEGGE--T-PEDRPGSELLIH-A---------
A0A3M2D6Y5      ------VS---QRRKLLPV---------GTGEE--NGSQGKAGSEILIY-N---------
A0A2V8SEX6      ------SI---PKRRLLLV---------GASNE--EVEDPGNNSELLIS-A---------
A0A7C5ZUU4      ------SA---PKRKLLLV---------GSGNS--EESEERQRSELLIY-A---------
A0A0B6WWQ6      -----------SRRSLSKA---------VALQT-----DGTAHPELLVG-D---------
A0A3B9MK99      ------ASA--RRRLIGAS---------GALQK--RNGH-SDSPELLMN-V---------
A0A352EX26      ------GMG--RRKLLGGP---------GALQK--RNGH-SGNHELLMN-V---------
A0A2V8MM59      ------GGST-RRRLLSPG---------TSLQK--RNGNGTGSPELLLH-V---------
A0A2V8PFE8      ------GGVARRRRLLSSA---------TALQK--RNGNTSGTPELLLN-V---------
A0A2V8PWS6      ------GGVA-RRRLLSSA---------TALQK--RNGNPGGNPELLLN-V---------
A0A2V8LCT5      ------AASA-PRRLLSSA---------TALQK--RNGNNGGNPELLLN-I---------
A0A352FTJ9      ------SASA-PRRLLSSA---------ASLQK--RNGSNGSNPELLLN-I---------
A0A257VBK0      ------------------------------------------------------------
A0A2G6PYV5      --------GFNKGKITKNK---------VKQKAMATKLRQEIGLLTHL------------
A0A2V8F956      ---------------------------------------EKQFANTYPLISK--------
A0A1F2S1W5      ---------------------------------------DKGAHTPLIGR----------
A0A1F2T595      ---------------------------------------GNRASPPLISE----------
A0A2V8JQV5      DSSLGVPPESSPVRSLRNA---------IEFGKRIAGSDRSTPYGKDRPKPKIELMAWE-
A0A2V9AC41      ---------LLTGTRTGYV---------SKLVNSAKAELPAPTRDEDRPSVLDH------
A0A2V9MAM9      -------------------------------SVVGASPGRSLRSDSHNATELTGWE----
A0A348V070      GLLKGRPGILDKKKKKKHD---------TPRPKSVSLKTEEGAPENDKNNHQIELIIQR-
A0A2V9M454      ---------SSVLRRPGLF---------HSKAANGANGDGGYAVELAVLK----------
A0A2V9IVR7      ---------TVRSR----S---------LDRGGNGSADRRE-AVELTLLK----------
A0A2V9ILE2      ---------TVRSR----S---------LDRGGNGSADRRE-AVELTLLK----------
A0A2V9LGY4      ---------TVRSR----S---------LDRGGNGSADRRE-AVELTLLK----------
A0A2V9J4D6      ---------PNHNGRQYGL---------RRKKNSELPASNG-QTGLAALE----------
A0A2V9L9C5      ---------PNHNGRQYGL---------RRKKNSELPASNG-QTGLAALE----------
A0A2N9M9N1      ---------RSRGRYG--R---------YFARGALKPPGNG-SPGLAIMN----------
A0A2V9JEC4      ---------VFSSRLPYSR---------LPRLRSKHPLPPS-RIELAVLE----------
A0A2V9LPQ3      ---------LLIRRYGSSK---------RGGAQGEAQKRSE-SVAVMMLT----------
A0A2Z5G3A3      -------------RPATFL---------RLTSSSGLDRIDAVDPVTRNVIALQ-------
A0A2V7UGP8      ------------------------------SSALAGESAGGRRLRREPVSPAVDLVTLR-
A0A239MKT6      ---------------------------------------ENGQSKNVPASPDKQEDAAWL
A0A3E0PCN7      -------------------------------RRLGNGFVGSLIRKTQTKLVGENFYSLDR
A0A2V8IYW3      --------SIDEKRRRMLR---------LAFTFTGGFLLVAARITETGVLMPETAEIGVF
G2LEI9          ---------PKELSKSSGY---------YSYGGETRALAKLADGRPLPADFNVGLSAFA-
A0A317J121      ----------PRGSRPAWR---------LLLGRESRNAGEMVGSEVSLDTRVGFWDSA--
A0A2V7YW66      GYGYGYGEPGAGDKPRPVR---------PARSAAEKRGDRKERKERKRAAAAAGAPQIEL
A0A2V7Z0V0      --AYGYGETAADDKPR-AR---------PGKAPAGGW-----REKKKAPAAALPPSQIEL
A0A2V8GFD4      ---------------------------------------RREFAKPSPMINH--------
A0A2V8HSS5      ---------------------------------------RREFAKPSPMINH--------
A0A2V8KP55      GRKKEQNEPANAEKSDNRS---------IELAPHD-------------------------
A0A399WNU1      SNHFLAKFNRHRNGDGDPD---------PAESRSAYADS---------------------
A0A2V9JSI3      ------------------------------SDRARRAWRKGAGEKAASSTTPVGLAVLK-
A0A2V9WI32      ------KQIARDRKNGHPR---------LSLGSRSSESADSLQLITFA------------
A0A2V8IVN9      -----------------------------------EKEFGGSYPMVGA------------
A0A7C5Z4J3      -------------------------------VVGRSSLWSVGGRNLAAGRGAAEWALLK-
A0A1F2TPT3      ---------------------------------------LKSGVTGPLATN---------
A0A2V8JTQ2      ---------------------------------AKSQNGAHRELAGGSGHVDHALVSLL-
A0A2V8UZY0      ---------------------------------TMSRNGAARQLTGVGGDVKPELVSLL-
A0A350UEK1      --------RVEDGKKHRLL---------TGRSKKADAETQSLTLATNGLSEKLELVTLQ-
A0A350UIQ4      --------LLEEKKGRKLL----------------GEESQSLVLTNVGLGEKLELVTVQ-
A0A1H5Z7N3      ---------------------------------------RTSAEQNAT-GLVARNIGVLA
A0A1G7JVV8      ---------------------------------------RMQSDGSGSATVAQTNIGVLA
A0A1H4T6W9      ---------------------------------------RLSSD-TGTMSVAQNNIGVLA
I3ZEU5          ---------------------------------------RLSSD-TGSMSVAQSNIGVLA
A0A7L5A6M5      ---------------------------------------RSTAEQLAGMTTVERNINVLT
A0A428MDU2      ---------------------------------------RAGVSEAAM-STAQRNISVLT
A0A5B9EBI2      ---------------------------------------RTVSELPAGMSVTQLNMGVLT
A0A239HDF6      ---------------------------------------KPAGAAVPDTSP----LPVIS
A0A4Q0T270      ---------------------------------------RTAADQAANLSVAQRNISVLT
A0A1Q3QQB6      ---------------------------------------RLSVEQSSTLTPTQKNLSVLS
A0A3N1K1G7      ---------------------------------------RSSAEQAGNLTTAQRNISVLT
A0A4V2G466      ---------------------------------------RSTAEVPGQ-STTARNIISLA
A0A6B9YNQ8      ---------------------------------------RSAEAAGQG-GTAIRNITSLS
A0A7G8BSK5      ---------------------------------------RRSATEIPGQSFAARNIISLS
A0A1I6MH75      ---------------------------------------RTAAEQVGSLTTAQRNINVLT
E8WVF6          ---------------------------------------RATPEQLAAMSTVERNINVLT
A0A3N5YNR8      -----------DLPAGSSR---------LLASRNESGDSKTGLPAPIS------------
A0A3N6A5T6      ---------MFETPVGTRL---------LTAASTQSTDASVDAVLQGSQ-----------
A0A1F2Q9L4      GYGYGGSYGYGYGQRRGKG---------QPGRPTLAGQRPGGDSGAGQIELVSHF-----
A0A2U3KC61      --------QLSSNGYLRKR---------LKTVSAETEKPESPALVAYA------------
A0A2V9Y2R7      --------QVSGNGNLRKR---------LKTVPAADGELQSPTLVTYA------------
A0A2V9NGH6      --------KLSIESSARRR---------LSLTSSR----EAIELVTQS------------
A0A2V9PYE6      --------KLSIESSARRR---------LSLTSSR----EAIELVTQS------------
A0A2V9NL07      --------RTAAEANP-TG---------LSVAASK----EAVELITIS------------
A0A2V9QD92      --------RTAAEANP-TG---------LSVAASK----EAVELITIS------------
A0A2V9WPZ6      --------EGKNEN----R---------LIVASSK----ESVELVTKS------------
A0A2V9ZLH4      --------KRPNEDGS-RR---------LAVAASK----ESVELVTQS------------
A0A2V9RQF1      --------KSSSDSKS-KR---------LSLASSR----EVVELVTQS------------
A0A2V9YDK8      --------KS-IEASNQKR---------LTVASSK----EAVELVTQA------------
A0A2V9V8F7      --------RTGVEGKNENR---------LIVASSK----ESVELVTKS------------
A0A2V9XGR9      --------RTGVEGKNENR---------LIVASSK----ESVELVTKS------------
A0A2V9V3Q5      --------KSRNNGTGIGR---------LTLTSSR----EVVELVTQV------------
A0A2V9NWS3      --------KAPTESNGRQR---------LSLASSK----EPVELVTQS------------
A0A2V9USA9      --------KGIREGSTGKR---------LALAASN----EAVELITQV------------
A0A2V9XW18      --------KSAREGPNPKR---------LVIASSK----EAVELVTQV------------
A0A1H5SQF5      ---------KRRRWAYAYP---------YAPTKKA----DAAAESEGKFAWVLK------
A0A2V9AEW6      ---TAVSRHGANLLNMRRL---------TPSVPSG----VESDSS-DKSPELATWK----
A0A2V8WQK6      ---AAVSWQIPNRLPPHRA---------ASSRPPE----SALRSSLGDCPELATWK----
A0A2V8XIF4      ---GGLAGQIAGRLHSHRP---------TRTLTSD----TAPDSS-ANWPELATWK----
A0A2V2R0I6      RRALLQ--TVAANGHEKRI---------ELVAQH--------------------------
A0A2V8XAR9      RQGLLQ--GFAANGQDKRI---------ELVAQH--------------------------
A0A2V8VZA0      RHGLLQ--GLSSNGHDKRI---------ELVAQH--------------------------
A0A1Q7CB82      RHGLLQ--GLSSNGHDKRI---------ELVAQH--------------------------
A0A2V8WIU1      RHGLLQ--GLSSNGHDKRI---------ELVAQH--------------------------
A0A1Q6Y9F5      RHGFFQ--GLSSNGHDARI---------ELVAQH--------------------------
A0A2V9EVV8      RHGFFQ--GLSSNGHDARI---------ELVAQH--------------------------
A0A2V8YF91      RRGFLP--SFSGNGHEKRM---------ELVAQH--------------------------
A0A2V8XZK2      GRGVLP--GLSSNGHERRI---------ELVAQH--------------------------
A0A2V8ZTX6      RRSMLQ--GFSENGHNKRI---------ELVAQH--------------------------
A0A2V9BT79      RRGMLP--DFSQNGHDKRI---------ELVAQH--------------------------
A0A2V9YHT3      KGIVLR------PGKRERV---------EMIAHS--------------------------
A0A7C2XNI7      GVRMLK--SAEQEPSRASV---------ALVSHE--------------------------
A0A1Q8B793      RRRFLRGLAAATNGREARV---------ELVSHH--------------------------
A0A2V9BCA0      RRRFLRGLAAATNGREARV---------ELVSHH--------------------------
A0A2V9BWU9      VPKMLK--SGSGNGTESRV---------ELVSHT--------------------------
A0A2V9DKX2      VPKMLK--SGSGNGTESRV---------ELVSHT--------------------------
A0A7C2YQY3      -----------------------------SIPAGA----LRALPGVVPKPQAQELATIS-
A0A3E0NV31      GNWLAAKLKLPRRKPSRTP---------PKLLEPK----GD-------------------
A0A3N5M5V0      -----------DLPAGGSR---------LLAEKST----SGADKTELPARIA--------
A0A3N5XQP8      PLVLA----LPEQVQADHR---------SASDQDR----MGSALARSA------------
A0A2Z5G7H4      P--------------------------------GG----PSLSRARSPSSGVNSLAIFA-
A0A2V9L5B5      ---------PNGAGE-VRQ---------DSLEAVE----PGVATALAPAI----------
A0A2V9LK56      ---------LFSARK--SG---------EARLTKG----SEAGGKSDIVI----------
A0A2V9L7I0      ---------LNGNGKVPEE---------EDSLAAV----PEVEMAVAPAI----------
A0A522PPT0      ---------LNGSSK-SLE---------HGITAIG----KGSNGLYGLAL----------
A0A7C5V1G5      ---------LNGSSK-SSE---------PGLVTPG----DSADGSYGLAL----------
A0A2V9KCS3      YFKRLPALKGPKDSEQTLG---------SALVKKN----GRRNGNGNHEIELVTWY----
A0A372IT17      -----------------PS---------FHLPRLL----RGGGSSGVTAAASWELQGTGS
A0A4R1LC91      ---------QDDRKQLPSS---------LSKGLTG----PGSNFMALQ------------
A0A3M2BZG9      R--------------------------------KL----KGASSDEPEPDRQIELLPHR-
A0A1Q7N5R7      D-----------------------------------------------------------
A0A2V9QB26      YTERCNKTTTLSLSRQQRD---------SGL--PK----RTSKQVDSPSVELVTWY----
A0A2V9VYY4      ---------------------------------KR----RLTISPDGERSGMLALVTYE-
A0A3E0PHB0      QKL------LT----------------------GG----SNGR------GPSTEFVALE-
A0A3M1SIV3      L---------------------------------------GSEING---NTSAALITLR-
A0A3M2D491      ---------LP----------------------AG----EKEQ------SSSVALVTLS-
A0A353C9L6      RLL------AA----------------------NG----NGNGGA----P-STGLVTLE-
A0A2V8RQV0      ---------MA----------------------AG----NGAALS----PHAAALITLE-
A0A2V8SJH5      KLIAANGNGLA----------------------NG----NGNGNS----ATATGLITLA-
A0A357F267      R--------LA----------------------AA----NGSEA-----VASTALVTLD-
A0A7C5ZUA8      L--------LT----------------------AG----DGE-------ALPTQLVTLE-
A0A136JPP4      R--------SR----------------------RG----LGSETNAKA-ASNTALITLE-
A0A399WUJ8      L--------SL----------------------RG----IAGESNGKSTAASTALITLE-
A0A2V9KIE8      ASKQ-----LAKAAPGDRV---------VAPAIQT----TAVGK----------------
A0A352F549      ---------TQRFFPISRA---------LQRT-NG----NGASPELLI------------
A0A3B9MLP9      ---------AQRLLPITRA---------LQRT-NG----NGSGPELLI------------
A0A3D5SQ87      ---------AQRLLPITRA---------LQRT-NG----NGSGPELLI------------
A0A2V8NW86      DTERCDK--TTTLLPSRQQ---------RDPGLPK----RTSEHADSLSVELVTWYRKAS
A0A7C2GJ20      SALPR----VHRAKEGERP---------ILI-----------------------------
A0A7C4BTL5      ---------TGRHLLYYKR---------RKLPEET----KAVTKGDRR-----LLQDRVE
A0A2V8ZHL8      ---------LEREIPHRPA---------LSRA-RN----NGNSKPSET-----ALALLKQ
A0A2V9B240      ---------LERELPHRPA---------RSLT-RN----NGNSKSSGA-----ELALLKE
A0A2V9CBM2      GGV------HYKLLEHAGA---------LSL--RE----NGGARKLVP-----SWYRIDV
A0A2V8XN17      G--------IHRFLPRDKS---------LVL--AG----NGSGKNSRS------WHLIDR
A0A2V8WX45      G--------IHRFLQQDKA---------LVL--KG----NGTGKDARS-----SWHRIDL
A0A1Q6YR79      G--------IHRFLPRDKS---------LSLAGNG----NGSGKDRRP-----SWHLIDR
A0A1Q7VA32      G--------IHRFLPRDKS---------LSLAGNG----NGSGKDRRP-----SWHLIDR
A0A2V9EY85      G--------IHRFLPRDRF---------LSLAGNG----NGPGKDPRP-----SWHLIDR
A0A2V9H8K0      G--------IHRFLPRDKA---------LIL--EG----NAAGKNSRS-----FWHRIDR
A0A2V9FFE5      G--------IHRFLPRDKA---------FEF--KG----NGAGKNSRS-----CWHRIDR
A0A2V9GM43      G--------IHRFLPRDKA---------FEF--KG----NVAGKNSHS-----YWHRIDR
A0A2V9CYQ5      S--------IHKLVEHPGS---------LSL--RE----NGCARKLVA-----SWYRIDV
A0A2V9BWU8      S--------VRKLLDRTLP---------LKS--AH----NGTASNPAA-----RWHRIDQ
A0A2V8ZG48      S--------VRRLLDHSNL---------LRS--RQ----NGTASNPCA-----CWHRIDQ
A0A2V8Y334      G--------VRKLLDRTNH---------PGN--GH----NGTASNPGA-----RWHRIDQ
A0A2V9AY68      G--------VRKLLRRTNG---------LRH--GH----NGTASNPGV-----RWHRIDQ
A0A1F2RFI7      LSYGYG---YGYGYGSRKS---------L----PE----DTSAPDGEK-----KLHPELI
A0A1F2RZS3      LA-------YGYGYSSRQT---------L----AE----VTSEAANGK-----PLSLELI
A0A1F2USE2      RAYGYGYGLYGQTRQLESG---------AEG--TT----EKGLARGGTPH---GWYRIDE
A0A7C2VB08      AV-------YGRRPQISGS---------LLA--GR----RTQKPNGKPAPGLNLWLRIDR
A0A2V9C238      GA----YRLYGGSKPLANG---------K----PQ----TSALPSTTP-----RWYRIDV
A0A1F2Q9F5      A--------YG--LPTPKR---------L----AS----RSVVPAAAP-----LWHLVSG
A0A1F2QQH9      A--------YG--LPTPKR---------L----AS----RSVLPAAAP-----LWHLVSG
A0A1F2QXK7      A--------YG--LPTPKR---------L----AS----RSVVPAAAP-----LWHLVSG
A0A2V9DEM9      GV----YRLYGGSKPLANG---------K----PR----TLALPSTTP-----RWYRIDA
A0A7C5TWV7      --------------------------------------------------D---------
A0A2V7XDY0      --------------------------------------------------E---------
A0A2V8G155      -LK-------------------------------------GSMS--PSLYK---------
A0A2V8HDM7      -LK-------------------------------------GSIS--PSLYK---------
A0A2V8DRT9      -VA-------------------------------------DGES-APLLDK---------
A0A2V7VYF3      -DK-------------------------------------YATGGAPLINN---------
A0A1F2SVH2      -DK-------------------------------------ALEN--PLISD---------
A0A2V8AJG9      -GD-------------------------------------DVKD--PLMNN---------
A0A2N9LQU7      --------------ITRRS---------LRKDMRGRNHQPGLGGLGTMAVQ---------
A0A2P6WFK7      ---------------THQQ---------QPPATSNSREAPKAVPLAPILLG---------
A0A2V8U914      --------------SAESL---------EPALQKLIGTENGKQPVERITWD---------
A0A2V7W309      -TISRQYGYNYSYGRASGP---------QLRAVDAPPEEKPSPGIELLPHL---------
A0A2W0BGU4      -LT-----------RAERL---------LATNRSINARENGTAILNVA--A---------
A0A2W0BVQ9      -LT-----------RAERL---------LATNRSINARENGTALLNVA--A---------
A0A2V9MN96      -AE-----------NGRRH---------LHPAGGSLITASTVDGPVAH--V---------
A0A2V7V2Z1      -N------------PAE-V---------IIKS------------------G---------
A0A2V7X2F7      -QS-----------PADLL---------IQKG------------------G---------
A0A2V7V2I1      -QD-----------SGSPV---------LSNS------------------H---------
A0A2V7U3M2      -V------------PGDIV---------IIQG------------------G---------
A0A2V7UHT0      -S------------PTD-V---------VIKS------------------G---------
A0A2Z5FVL3      -AK-----------KKGLR---------LSGHSFALPGREAIAAL-----K---------
A0A2V9KBD6      -AN-----------SKNGA---------PANLPALSIYRNRALVSL----L---------
A0A2W0AJ66      -G------------SANQS---------LVEGNVPQTASKPELVSF----L---------
A0A1Q7RBU1      -AK-----------SKSRA---------RAQLNGVNGDLKPEMVSF----L---------
A0A2V9JPV9      -AK-----------GKSRA---------PAQLNGVNGDLKPELVSV----L---------
A0A3P0X3W6      -QL-----------KPAGR---------QLLLKSGSDVPAPVAGKQPLDWS---------
A0A2N9MK30      -SW-----------K--SR---------PALVAAGGAASTPVLLRHPDD-D---------
A0A3D1ASD2      -SW-----------R--AR---------LGPIAKGG-AKAELVPLGELG-D---------
A0A7C5AXI3      -PW-----------R--GR---------LGPIPAAA-STTALVPTNGNR-D---------
A0A7C6E4H7      -SW-----------R--RQ---------LPVLKPEG-DSKALVPA-GAG-E---------
A0A1F2TCR2      ------------------------------------------GERVPLLSE---------
A0A350UQT3      --------------NTREL---------MLPAKLLTAGETHVEDPSARPKD---------
A0A7C3HRX0      --------------NAKDL---------LLPAAAPTSGAPSLL-PVRLEAD---------
A0A1F2V330      DLDPGVKPLTGTIPLIPPC---------GGDLSPTLLAFADLHRNHIVMVT---------
A0A662EE63      --------------------------------------------------D---------
A0A2V8TLH7      --------------------------------------------------D---------
A0A1Q7ZJT1      --------------------------------------------------D---------
A0A2V8VC99      --------------------------------------------------D---------
A0A348UZU3      TLNGHYYAYRSAEDEDGKK---------KRKEEKGETENEPRSIELIS-HF---------
Q01XL7          --IDRPKKLAAAQRALNGA---------TSIHPLGTLVEDGQKTLEFATWQ---------
A0A2V8ERZ5      ----------------------------------------GDKHPLLA-SS---------
A0A2V8GTX0      ----------------------------------------GERHPLLS-GP---------
A0A2V8J0X9      ----------------------------------------GERVPVLT-ET---------
A0A523DUV7      --------------------------------------------------A---------
A0A1F2U158      ----------------------------------------GDKHPVLA-SS---------
A0A2V8F6S9      ----------------------------------------GDKHPLLA-SS---------
A0A7D8BEX2      --------------------------------------DEDQHLPFVS-IT---------
A0A4Q1SCH5      ------------------W---------ENKAADGTATKMGHGVRLIT-LR---------
A0A372IRG7      ----------PFSKKAINA---------KDEAADRNGSLAKVSPDLLA-YN---------
A0A2V8K4L4      -------PTMLRRGQRPSA---------LIPSVSGNNSNAGNPVELVT-WQ---------
A0A2V8NCZ3      -------QG---RGQGTAA---------VIPIGNGNTK---NPVELVT-WQ---------
A0A4Q7YNP3      ------------SRSDSII---------TLQSGSSTIVRNADVLDMAG-WS---------
E8UZE1          -------------PAQRNM---------KLGKKEVAGTADSLGLEPRV-LQ---------
A0A2U3JZ71      --EWHGRITAASEPGT-------------------------DLIPHDPSRG---------
A0A2V8TTB0      --DWRRRLSPISSSGSANG---------HRNGNGAIPAPPNGAVPAADNTD---------
A0A1V6HR88      YGYGYGYGYGYGEKPAKAR---------ARKPGKGGGNGEPTQIELLP-HL---------
A0A3E0P0A3      ---------RRGSSRRVYG---------ARAPAKRVDRGADLAIDLLP-HS---------
A0A2V8EXP2      -------------------------------------------------SK---------
A0A2W4RYA1      -------------------------------------------------TG---------
G8P0Y7          ---------VFDKAGTNAA---------RSRLLNKMPGTGTGPQPLIS-YL---------
A0A5M8T4U7      ---------------DGPL---------RRKRPELEDGGSSAQVRQLTALH---------
A0A7L5A491      -------ALVSSLPFRKSQ---------TD-------------------WF---------
A0A7D8BF18      -------------------------------RGSPEVSHLSLVYRSLVVLA---------
A0A1E3Y9R6      --------------------------------------DAGRDGEAPLLQP---------
A0A2W4TLP2      --------------------------------------GGDESGEAPLLSA---------
A0A7G8BDY8      ------------MNQNSRL---------KGASSNMKAPFETEGVGPIV-LL---------
A0A7C4BZ42      ---------TAVTERLAGR---------GAAALLPGKGGEADKLELVT-WK---------
A0A3R9WF43      ----------------------------------RAETVTAGTVGECALIT---------
A0A317HKM4      ----------------------------------------SKNGRVPLLVQ---------
A0A2V9CG11      -------NHKQANPALAME---------AGSSELVLESHLDDRPELAA-WN---------
A0A523E0N1      -------LAPRSGNSRGPL---------ASGRDAKRSTYLPTIYDKRPALA---------
A0A4R1LAZ7      -----------------SK---------KSSAERDDGRPESLSPDLVA-YL---------
A0A7G8BMP1      -----------------AE---------LSALQKE--RNSKVSADLIS-YT---------
A0A523ECP2      -------ASSMARDTDKHG---------KNMSQTRSALALSQSTKIASRAK---------
A0A2W0C122      ------------------------------GSPRLLTSKVGEAPQVLS-LT---------
A0A2W0AUU7      ------------------------------PSPRLLTPRVGEAPQIMC-LT---------
A0A2W0BQL1      ------------------------------PSPRLLTPRVGEVPQIMC-LT---------
A0A4Q1SDL1      ----------------------------------KEKRALDGIQHVRT-LN---------
A0A3P0XH15      -------VSAAGTAAAEAE---------RERMARVSP-------DLIS-YT---------
A0A3M1WQW8      --------------ALPRW---------SRERRTTKP-------ILIL-DD---------
A0A3N1JHC1      ------------------H---------PQMRLNGAGSKDVHPILEHW-KE---------
C1F294          ------------YGSYGAE---------KRPKEPVAEKEDQISRDLLT-LL---------
A0A2V9KA79      -------EISPRAPARRHT---------GEQRVSIASVPDRPGKHSLT-SQ---------
A0A522PSP1      -------------EIKSLL---------TPASVRGND-------------E---------
G8P085          -----------------------------RTDNKGDAPAFDASQMLVA-YN---------
A0A7C6A629      ----------------------------RQLPTVKPSGDTKALVPAGH-TD---------
A0A4Q1SGQ1      --------KTRRRASWREI---------LMRRESVSTSPLFMSRTGIA-DQ---------
Q1ILD9          ----------------------------SSNGRPGRTAVKQEAMGIDV-LT---------
A0A7G8BJH7      -------RNPCQTSALLYS---------KPSSDPQTF-------QIVS-ST---------
A0A7C5SHM3      -------------KPRLAF---------SRKRSGTTP---------VM-AA---------
Q1IJZ6          -------RAAGRAKANGSN---------GSKPGRPTA------------MV---------
A0A2V8TCE6      -------------------------------QRRGGPAWGTGEIDLMS-HH---------
A0A522TBE8      ------------ELQLAGG---------GSEEDREAR-----------------------
Q1ITG0          ------------LNALATE---------NQSVLARVP---------LA-AD---------
A0A7C2ML20      ----------------------------GRSLLPRKPELEGAPLLMMA-SE---------
A0A7C5AXS9      -------GYCRHRRGKEEG---------GKRPEGKTGLEV----ELAT-AN---------
A0A7C2RGE3      ------------RRPWSAL---------PRLPRRKEEER-----PILI-SQ---------
A0A3N5PCI5      ------------LKGR----------------------------SLLL-TH---------
A0A3M1Q0S9      ------------RRERRRS---------ASRGEQAAEIEDP---SLIS-AR---------
A0A2Z5G448      ------------KEARSTY---------GQQAKPITPADSQFPSDLVS-YL---------
A0A3M1VZ38      ------------RPVKKAH---------GEEPVRCDP-------AVIT-AE---------
A0A4Q1SD29      ------------IAARKGT---------DPQPQKVSP-------DLVS-LL---------
A0A6N9FGE2      ------------KGSTDDH---------GPPTRSRTP-------QLLL-GA---------
A0A3M1PY35      ------------PRPRLVF---------SRKRREGAS-------PVV---A---------
A0A3M1VMP2      ------------PRPRLVF---------SRKGRSRSR-------PVI---P---------
                                                                            

A0A2V7VMF7      ----------------------------------------ADAEHLVTEAYQNLRTALL-
A0A2V7YYV7      ----------------------------------------DAHSHA-SEAYRALRTSLL-
A0A2V7Z0J5      ----------------------------------------DAQSHA-AEAYRALRTGIL-
A0A2V7Z3M4      ----------------------------------------DAQSHA-SEAYKALRTGIL-
A0A399Y5V2      ----------------------------------------DPASTT-AEAYRSVRTNLQ-
Q01X01          ----------------------------------------QPASHV-SESFRATLASIL-
A0A3M2D9H8      ----------------------------------------QPRSPV-TEAFRSVRTNLE-
A0A2V8JK38      ----------------------------------------DEPSSVIAESYRSVRTSFF-
A0A2V9IXG5      ----------------------------------------DFGLHQIRESYNVLRTELL-
A0A2V9J2P4      ----------------------------------------DFGLHQIRESYNVLRTELL-
A0A1Q7RLS4      ----------------------------------------DGTHSAFKEAYQTLRTSLL-
A0A2V2R525      ----------------------------------------DAHSRL-AEVYRKLRTTVL-
A0A321LPW6      ----------------------------------------DSASSA-AEAYRVLRTSVL-
A0A2V9R9V4      ----------------------------------------DGRSPA-SEAYRALRTALL-
A0A321LE75      ----------------------------------------DTRSSA-AEAYRVLRTSVL-
A0A2V8R8U7      ----------------------------------------DVRSPI-AESYRHLRTSLL-
A0A2V8QMP4      ----------------------------------------DVRSPV-AEAYRHLRTSLL-
A0A2V8R4S3      ----------------------------------------DVRSPV-AEAYRHLRTSLL-
A0A2V8NJ55      ----------------------------------------DVRSPI-AEAYRHLRTSLL-
A0A2V8Q7I0      ----------------------------------------DVRSPI-AESYRHLRTSLL-
A0A2V8S6K4      ----------------------------------------EVRSPV-AEAYRHLRTSLL-
A0A317I2L9      ----------------------------------------DVRSPV-AESYRHLRTSLL-
A0A2V8LLF9      ----------------------------------------DVRSPI-AESYRHLRTSLL-
A0A352FRF4      ----------------------------------------DIRSPI-AESYRHLRTSLL-
A0A2V8MKV0      ----------------------------------------DVRSHV-AESYRHLRTSLL-
A0A2V8PYY8      ----------------------------------------DVRSHV-AESYRHLRTSLL-
A0A1Q7YKQ8      ----------------------------------------DARSSI-AEAYRHLRTSIL-
A0A352F3R7      ----------------------------------------DARSPI-AESYRHLRTSLL-
A0A0B6WXT1      ----------------------------------------DVRSPI-TEAYRHLRTQLL-
A0A3B9MEU8      ----------------------------------------DVRSPI-AEAYRHLRTSLL-
A0A2V8MHG6      ----------------------------------------SQRSAL-AESYRQLRTLVL-
A0A2V8P7N1      ----------------------------------------SQRSAL-AESYRQLRTLVL-
A0A2V8M3M6      ----------------------------------------SQRSAL-AESYRQLRTLVL-
A0A1Q7NJH5      ----------------------------------------SQRSAL-AESYRQLRTLVL-
A0A2V8PJY0      ----------------------------------------SQRSAL-AESYRQLRTLVL-
A0A1Q7Y6W9      ----------------------------------------DGRSSL-AEAYRQLRTSVL-
A0A2V8NC68      ----------------------------------------DGQSPL-AEAYRQLRTSVL-
A0A399WK13      ----------------------------------------DPRSSL-AEAYRQLRTSIL-
A0A352FLX4      ----------------------------------------EKRSPV-AEAYRHLRTSIL-
A0A2V8RTL7      ----------------------------------------DPRSSL-SESYRQLRTSIL-
A0A3E0PCJ6      ----------------------------------------DSRSST-AEAYRQLRTSIL-
A0A3M1S4R8      ----------------------------------------NSRSSSLSEAYRQLRTSIL-
A0A7C2G442      ----------------------------------------NSKSSSLSEAYRQLRTSIL-
A0A1Q7YFI6      ----------------------------------------DTRSPM-AEAYRQLRTSVL-
A0A136KC10      ----------------------------------------DPRSSL-AEAYRQLRTSIL-
A0A3M2D6Y5      ----------------------------------------SSNSSL-SEAYRQLRTSIL-
A0A2V8SEX6      ----------------------------------------DSRSAL-AEAYRQLRTSIL-
A0A7C5ZUU4      ----------------------------------------DSRSSL-AEAYRQLRTSIL-
A0A0B6WWQ6      ----------------------------------------GGESGL-AETYRQLRTSVL-
A0A3B9MK99      ----------------------------------------DGHSPL-AEAYRHLRTSVL-
A0A352EX26      ----------------------------------------DSRSPL-AESYRHLRTSLL-
A0A2V8MM59      ----------------------------------------TGRSPL-AESYRQLRTSVL-
A0A2V8PFE8      ----------------------------------------NGRSAL-AESYRQLRTSVL-
A0A2V8PWS6      ----------------------------------------NGRSAL-AESYRQLRTSVL-
A0A2V8LCT5      ----------------------------------------TGRSAL-AEAYRQLRTSVL-
A0A352FTJ9      ----------------------------------------NGRSAL-AEAYRQLRTSVL-
A0A257VBK0      ----------------------------------------ETQKVS-AEAFQTLRTAMV-
A0A2G6PYV5      ----------------------------------------KPNDAF-SESYRHLRTNIQ-
A0A2V8F956      ----------------------------------------TAPPNF-SEAIRDLRTNVL-
A0A1F2S1W5      ----------------------------------------GVSALF-TESFRSIRTNVL-
A0A1F2T595      ----------------------------------------GVPGVF-SECFRSIRTNVL-
A0A2V8JQV5      ----------------------------------------KPFSLF-AECFRTTAASVL-
A0A2V9AC41      ----------------------------------------HPLSLV-AEAYRSLRSSLL-
A0A2V9MAM9      ----------------------------------------NKFNAL-SESFRCLVTSILR
A0A348V070      ----------------------------------------EPRCIQ-SEAFRSIRTSLL-
A0A2V9M454      ----------------------------------------KPGAAI-SEAFRTLRTSVL-
A0A2V9IVR7      ----------------------------------------RPASEL-AEAYRSMRTAIL-
A0A2V9ILE2      ----------------------------------------RPASEL-AEAYRSMRTAIL-
A0A2V9LGY4      ----------------------------------------RPASEL-AEAYRSMRTAIL-
A0A2V9J4D6      ----------------------------------------HPASSV-AESYRALRTSIM-
A0A2V9L9C5      ----------------------------------------HPASSV-AESYRALRTSIM-
A0A2N9M9N1      ----------------------------------------APGSEM-AESFRVLRTSIL-
A0A2V9JEC4      ----------------------------------------NSSLDV-AEAFRILRTSIL-
A0A2V9LPQ3      ----------------------------------------EPASAV-AESYRALRSAIL-
A0A2Z5G3A3      ----------------------------------------QPNSGY-VEALRAIRTSLY-
A0A2V7UGP8      ----------------------------------------DPASPA-SEAYKTLRTSLL-
A0A239MKT6      IR--------------------------------------APKSKS-AESYRQIRTAIL-
A0A3E0PCN7      ----------------------------------------FARPVM-VEAFNQIRTSLM-
A0A2V8IYW3      VPLKNPIGVSEELFDPALTGKVAAP---------------GMLPVA-TEQYRRLAAILH-
G2LEI9          ----------------------------------------LSASPI-GEAYRQLRTSIL-
A0A317J121      ----------------------------------------PASQLL-ADSFRVTLASLM-
A0A2V7YW66      VPHE------------------------------------RPRTLI-SEAYRSLRTGLL-
A0A2V7Z0V0      VPHE------------------------------------RPRTLI-SESYRSLRTALM-
A0A2V8GFD4      ----------------------------------------HVPGMF-PEALRAIRTNVL-
A0A2V8HSS5      ----------------------------------------HVPGMF-PEALRAIRTNVL-
A0A2V8KP55      ----------------------------------------EPSSVI-AESYRSVRTSFF-
A0A399WNU1      ----------------------------------------FNNPLI-AEAFHQLRTSLL-
A0A2V9JSI3      ----------------------------------------HPASPL-AESYRALRTSVL-
A0A2V9WI32      ----------------------------------------RPRSEL-AESYRALRTSIM-
A0A2V8IVN9      ----------------------------------------HVTTNF-NEAFRAVRTNII-
A0A7C5Z4J3      ----------------------------------------HPTSAL-AESYHTLRTAVL-
A0A1F2TPT3      ----------------------------------------GVPPEF-SEELRRIRTNLV-
A0A2V8JTQ2      ----------------------------------------QPMSLA-AESYKTVLTSLL-
A0A2V8UZY0      ----------------------------------------QPLSLA-AESYRAMLTPLM-
A0A350UEK1      ----------------------------------------RRLSAT-AESFRAVLTSIL-
A0A350UIQ4      ----------------------------------------RRLSAV-AESFRAALTSIM-
A0A1H5Z7N3      ----------------------------------------APKSQF-AESFRGLRTSLL-
A0A1G7JVV8      ----------------------------------------TSKSQF-SEAFRSLRTALL-
A0A1H4T6W9      ----------------------------------------TSKSQF-SEAFRSLRTSLL-
I3ZEU5          ----------------------------------------TSKSQF-SEAFRSLRTSLL-
A0A7L5A6M5      ----------------------------------------QPKSQF-TESFRSLRTALL-
A0A428MDU2      ----------------------------------------QPKSQF-AEAFRSLRTALL-
A0A5B9EBI2      ----------------------------------------MPKSQF-AEAFRSLRTSIL-
A0A239HDF6      ----------------------------------------QPKSQF-TESFRALRTALL-
A0A4Q0T270      ----------------------------------------QPKSQF-AESFRSLRTSLL-
A0A1Q3QQB6      ----------------------------------------QPKSQF-TESFRALRTSLL-
A0A3N1K1G7      ----------------------------------------QPKSQF-AESFRALRTSLL-
A0A4V2G466      ----------------------------------------QPKSQF-AEAFRSLRTALL-
A0A6B9YNQ8      ----------------------------------------QPKSQF-AESFRSLRTALL-
A0A7G8BSK5      ----------------------------------------QPKSQS-AEAFRSLRTALL-
A0A1I6MH75      ----------------------------------------QPKSQF-SESFRALRTSLL-
E8WVF6          ----------------------------------------QPKSQF-TEAFRSLRTALL-
A0A3N5YNR8      ----------------------------------------PARFRV-WEAYRSLRTSIL-
A0A3N6A5T6      ----------------------------------------DMRSRV-WEAYRSLRTSLL-
A0A1F2Q9L4      ----------------------------------------KPRLAV-SEAYRSLRTALL-
A0A2U3KC61      ----------------------------------------RPKSEA-AEAYRALRTSIL-
A0A2V9Y2R7      ----------------------------------------RPKSQA-AESYRALRTSIL-
A0A2V9NGH6      ----------------------------------------RPQSQM-AEAYRALRTALL-
A0A2V9PYE6      ----------------------------------------RPQSQM-AEAYRALRTALL-
A0A2V9NL07      ----------------------------------------RPQSQM-SESYRALRTSLL-
A0A2V9QD92      ----------------------------------------RPQSQM-SESYRALRTSLL-
A0A2V9WPZ6      ----------------------------------------RPQSQM-AESYRALRTSLL-
A0A2V9ZLH4      ----------------------------------------RPQSQM-AESYRALRTSLL-
A0A2V9RQF1      ----------------------------------------RPQSQM-AESYRALRTSLL-
A0A2V9YDK8      ----------------------------------------RPQSQM-AESYRALRTSLL-
A0A2V9V8F7      ----------------------------------------RPQSQM-AESYRALRTSLL-
A0A2V9XGR9      ----------------------------------------RPQSQM-AESYRALRTSLL-
A0A2V9V3Q5      ----------------------------------------RPQSQM-AESYRALRTSLL-
A0A2V9NWS3      ----------------------------------------RPQSQM-AESYRALRTSLL-
A0A2V9USA9      ----------------------------------------RPQSQM-AESYRALRTSLL-
A0A2V9XW18      ----------------------------------------RPQSQM-AESYRALRTSLL-
A0A1H5SQF5      ----------------------------------------APRSVV-AEACRQIRTAIL-
A0A2V9AEW6      ----------------------------------------RKPSLI-AECVRTTLTSIL-
A0A2V8WQK6      ----------------------------------------RKPSLL-AECTRTTLISIL-
A0A2V8XIF4      ----------------------------------------RKPSFL-AECARTTLTSIL-
A0A2V2R0I6      ----------------------------------------LPKSQM-SEAFRALRTSIL-
A0A2V8XAR9      ----------------------------------------LPKSQI-SEAFRALRTSIL-
A0A2V8VZA0      ----------------------------------------LPKSQM-SEAFRALRTSIL-
A0A1Q7CB82      ----------------------------------------LPKSQM-SEAFRALRTSIL-
A0A2V8WIU1      ----------------------------------------LPKSQM-SEAFRALRTSIL-
A0A1Q6Y9F5      ----------------------------------------LPKSQM-SEAFRALRTSIL-
A0A2V9EVV8      ----------------------------------------LPKSQM-SEAFRALRTSIL-
A0A2V8YF91      ----------------------------------------LPKSQI-SEAFRALRTSIL-
A0A2V8XZK2      ----------------------------------------LPKSQM-SEAFRALRTSIL-
A0A2V8ZTX6      ----------------------------------------LPKSQV-SEAFRALRTSIL-
A0A2V9BT79      ----------------------------------------LPKSQM-SEAFRVLRTSIL-
A0A2V9YHT3      ----------------------------------------HPKSEI-AESYRALRTSIL-
A0A7C2XNI7      ----------------------------------------RPQSQI-SEAFRALRTSLL-
A0A1Q8B793      ----------------------------------------LPKSQM-SEAFRALRTALL-
A0A2V9BCA0      ----------------------------------------LPKSQM-SEAFRALRTALL-
A0A2V9BWU9      ----------------------------------------LPQSQI-SEAFRALRTSLL-
A0A2V9DKX2      ----------------------------------------LPQSQI-SEAFRALRTSLL-
A0A7C2YQY3      ----------------------------------------QPHSVV-SEAYRALRTSIL-
A0A3E0NV31      ----------------------------------------RRSNIV-RESYRSVRTSLL-
A0A3N5M5V0      ----------------------------------------PTRFRV-WEAYRSLRTSIL-
A0A3N5XQP8      ----------------------------------------ALDSPM-WEAYRRLRTCLL-
A0A2Z5G7H4      ----------------------------------------HPNSPY-TEALRGLRTALL-
A0A2V9L5B5      ----------------------------------------QTHAEV-LEAFRSLRTSIL-
A0A2V9LK56      ----------------------------------------RRDPAA-VEAFRSLRTSIL-
A0A2V9L7I0      ----------------------------------------QSHADA-VEAFRSLRTSIL-
A0A522PPT0      ----------------------------------------QKDPTA-VEAFRSLRTSIL-
A0A7C5V1G5      ----------------------------------------QKDPMA-LEAFRSLRTSIL-
A0A2V9KCS3      ----------------------------------------RKPSLL-AESFRTTLASIL-
A0A372IT17      ----------------------------------------ASGSPF-SESLRTLRASLM-
A0A4R1LC91      ----------------------------------------EPRSAY-TEAVRALRTSLL-
A0A3M2BZG9      ----------------------------------------KPRLAV-CEAYRSLRTALL-
A0A1Q7N5R7      ----------------------------------------EQVLQV-IETMRSVRLSLL-
A0A2V9QB26      ----------------------------------------RKASLI-AESFRSLLTSIL-
A0A2V9VYY4      ----------------------------------------RPKSEA-AEAYRALRTSIL-
A0A3E0PHB0      ----------------------------------------DNRSGM-AEAYRHLRTSLL-
A0A3M1SIV3      ----------------------------------------ETSSAT-AEAFRHLRTSLL-
A0A3M2D491      ----------------------------------------SKQSPL-AEAFRHLRTSLL-
A0A353C9L6      ----------------------------------------ERHSPM-AEAYRHLRTSLL-
A0A2V8RQV0      ----------------------------------------ERNSPM-AEAYRHLRTSLL-
A0A2V8SJH5      ----------------------------------------ERRSPM-AEAYRHLRTSLL-
A0A357F267      ----------------------------------------ERNSPM-AEAYRHLRTSLL-
A0A7C5ZUA8      ----------------------------------------ERQSPM-AEAYRHLRTSLL-
A0A136JPP4      ----------------------------------------ERHSPM-AEAYRHLRTSLL-
A0A399WUJ8      ----------------------------------------DRHSPM-AEAYRHLRTSLL-
A0A2V9KIE8      ------------------------------------------------ESFRTLRTSIL-
A0A352F549      ---NG-----------------------------------TGSSVQ-AEAYKHLRTSIL-
A0A3B9MLP9      ---NS-----------------------------------RGPTLQ-AEAYKHLRTSIL-
A0A3D5SQ87      ---NS-----------------------------------RGPTLQ-AEAYKHLRTSIL-
A0A2V8NW86      LIAESYRSLLTSILFSGSNGLPERTSKQADSLSVELVTWYRKASLI-AESYRSLLTSIL-
A0A7C2GJ20      ---SE-----------------------------------RRRSSF-AEAFRTLRTSVL-
A0A7C4BTL5      LATWQ-----------------------------------QKPSLV-AESFRVVLTSIL-
A0A2V8ZHL8      -----------------------------------------PSSAL-AESFRTLLTSVV-
A0A2V9B240      -----------------------------------------PSSAL-AESFRTLLTSVV-
A0A2V9CBM2      ---HA-----------------------------------TRHAPL-VEAFRSLRASIL-
A0A2V8XN17      ---DG-----------------------------------AQHAAL-GEAFRSLRTSVL-
A0A2V8WX45      ---DG-----------------------------------TQHGAL-VEAFRSLRTSVL-
A0A1Q6YR79      ---DG-----------------------------------TQHAAL-GEAFRSLRTSVL-
A0A1Q7VA32      ---DG-----------------------------------TQHAAL-GEAFRSLRTSVL-
A0A2V9EY85      ---DG-----------------------------------TQHAAL-GEAFRSLRTSVL-
A0A2V9H8K0      ---DG-----------------------------------TQHAAL-VEAFRSLRTSVL-
A0A2V9FFE5      ---DE-----------------------------------TQHASL-VEAFRNLRTSVL-
A0A2V9GM43      ---DE-----------------------------------TQHASL-VEAFRNLRTSVL-
A0A2V9CYQ5      ---HA-----------------------------------TRHAPL-VEAFRSLRASIL-
A0A2V9BWU8      VDRGE-----------------------------------KPQAAL-VEAFRSLRASVL-
A0A2V8ZG48      ---GG-----------------------------------KRHAAL-VEAFRSLRASVL-
A0A2V8Y334      ---SG-----------------------------------KPQPAL-VEAFRSLRASVL-
A0A2V9AY68      ---GG-----------------------------------KPQAAL-VEAFRSLRASVL-
A0A1F2RFI7      ---AG-----------------------------------DGTNPL-SEAYRSLRTSVL-
A0A1F2RZS3      ---GA-----------------------------------NGNAAL-SEVYRSLRTSVL-
A0A1F2USE2      ---LD-----------------------------------PQRSTL-AEAFRSLRTSVL-
A0A7C2VB08      ---AE-----------------------------------TQHSVL-AEAFAGLRTSVL-
A0A2V9C238      ---EA-----------------------------------TQQSAL-AEAFRSLRTSVL-
A0A1F2Q9F5      ---NG-----------------------------------EGSTKL-GEAFRSLRTSVL-
A0A1F2QQH9      ---NG-----------------------------------EGSTKL-GEAFRSLRTSVL-
A0A1F2QXK7      ---NG-----------------------------------EGSTKL-GEAFRSLRTSVL-
A0A2V9DEM9      ---EA-----------------------------------TQQSAL-AESFRSLRTSVL-
A0A7C5TWV7      ----------------------------------------ETTHVA-REVYQSLRTAVM-
A0A2V7XDY0      ----------------------------------------ANVHFV-TEAYQNLRTALI-
A0A2V8G155      ----------------------------------------RAPGNF-AEALRTIRTNVL-
A0A2V8HDM7      ----------------------------------------RAPGNF-AEALRTIRTNVL-
A0A2V8DRT9      ----------------------------------------GATPNF-AEAMRTVRTNVL-
A0A2V7VYF3      ----------------------------------------GVPAHF-SEAFRTIRTNVL-
A0A1F2SVH2      ----------------------------------------GVPSNF-SESFRNIRTNLL-
A0A2V8AJG9      ----------------------------------------GVPANF-AEAFRAIRTNVL-
A0A2N9LQU7      ----------------------------------------RPASLL-AESYRVLCNSLL-
A0A2P6WFK7      ----------------------------------------SPRSQA-AEAFRGLRTSLL-
A0A2V8U914      ----------------------------------------KRFSKM-SEAFRATVASIL-
A0A2V7W309      ----------------------------------------DARSPV-SEAYRAFRTSLL-
A0A2W0BGU4      ----------------------------------------QATSEQ-SEAYRALRTSVL-
A0A2W0BVQ9      ----------------------------------------QTTSEQ-SEAYRALRTSVL-
A0A2V9MN96      ----------------------------------------RPKSEA-AESYRALRTSIL-
A0A2V7V2Z1      -----------------------------------------VESPL-ADGYRLLRTSLS-
A0A2V7X2F7      ----------------------------------------STQSTF-AEAYRVIRTSLN-
A0A2V7V2I1      -----------------------------------------QQGPF-MEGYRVLRMALS-
A0A2V7U3M2      -----------------------------------------VESPL-ADGYRLLRTSLT-
A0A2V7UHT0      -----------------------------------------AETPL-ADGYRLLRTSLT-
A0A2Z5FVL3      ----------------------------------------DPHSAY-VEALRALRTTLL-
A0A2V9KBD6      ----------------------------------------EPMSLA-AESYRSVLTSLL-
A0A2W0AJ66      ----------------------------------------QPLSPA-AESYRALLTSIL-
A0A1Q7RBU1      ----------------------------------------QPLSLA-AESYRALLTSIL-
A0A2V9JPV9      ----------------------------------------QPLSLA-AESYRAILTSIL-
A0A3P0X3W6      ----------------------------------------RTQDAY-TEAIRTMRSLVL-
A0A2N9MK30      ----------------------------------------RLLAGF-GEAVRTLRNSIL-
A0A3D1ASD2      ----------------------------------------RYASGY-DEAVRTLRNSIL-
A0A7C5AXI3      ----------------------------------------RVLTGY-DEAIRTLRNSIL-
A0A7C6E4H7      ----------------------------------------RTVTSY-QEAIRTLRNAVL-
A0A1F2TCR2      ----------------------------------------QVPHDF-GEAFRSLRTSLV-
A0A350UQT3      ----------------------------------------RQFSTY-EEAVRTIRSSVL-
A0A7C3HRX0      ----------------------------------------RQFTAY-EEAVRTLRSSIL-
A0A1F2V330      ----------------------------------------DPHSVA-SEQCRMLALKTR-
A0A662EE63      ----------------------------------------DNSRAL-REAFQTLRTALM-
A0A2V8TLH7      ----------------------------------------ATRRAV-REAYQTLRTSLL-
A0A1Q7ZJT1      ----------------------------------------GTHSAF-KEAYQTLRTSLL-
A0A2V8VC99      ----------------------------------------ETLSAV-KEAYQTLRTSLL-
A0A348UZU3      ----------------------------------------APDSTF-AESYRSLRTALL-
Q01XL7          ----------------------------------------NKSSIL-AESFRQTLTSIL-
A0A2V8ERZ5      ----------------------------------------HVPHDF-GESFRSLRTSLL-
A0A2V8GTX0      -----------------------------------------VPHDF-GEAFRALRTALV-
A0A2V8J0X9      -----------------------------------------VPHDF-GEAFRSLRTSLV-
A0A523DUV7      ----------------------------------------ANPSVI-TESYRTLRASLL-
A0A1F2U158      ----------------------------------------HAPHDF-SEAFRSLRTSIA-
A0A2V8F6S9      ----------------------------------------RVPHDF-GESFRALRTSLV-
A0A7D8BEX2      ----------------------------------------KPTTHY-AEGIQMVRNALL-
A0A4Q1SCH5      ----------------------------------------EPRSRA-AESYRTLRNSVL-
A0A372IRG7      ----------------------------------------EPQSIV-AEGFRSLRSSIL-
A0A2V8K4L4      ----------------------------------------RQGSLI-AESFRAVLTSIM-
A0A2V8NCZ3      ----------------------------------------RQGSLI-AESFRTVLTSIM-
A0A4Q7YNP3      ----------------------------------------SHFSVV-AEAYRSTTFSIL-
E8UZE1          ----------------------------------------FPQSHF-AESFRVLRSALL-
A0A2U3JZ71      ----------------------------------------TSLNSF-QEAIRTLRNSIL-
A0A2V8TTB0      ----------------------------------------QALSNY-EEAIRTLRTSIL-
A0A1V6HR88      ----------------------------------------RPRMPV-AEAYRALRTALL-
A0A3E0P0A3      ----------------------------------------QPRLPA-SEAYRALRTATL-
A0A2V8EXP2      ----------------------------------------GVPANF-SEAFRAVRTNVL-
A0A2W4RYA1      ----------------------------------------PVPAGF-AEALRMLRTNLL-
G8P0Y7          ----------------------------------------EPRSEI-AEAYRALRTSIL-
A0A5M8T4U7      ----------------------------------------SPKSLA-GEAYRGLRSSLL-
A0A7L5A491      ----------------------------------------NSTEFY-DESIDTLLTSIL-
A0A7D8BF18      ----------------------------------------SPRSQS-AEAFRALRTSLL-
A0A1E3Y9R6      ----------------------------------------DAPAAF-SEAIRAVRTAVL-
A0A2W4TLP2      ----------------------------------------DAPPAF-AEAIRAVRTAVL-
A0A7G8BDY8      ----------------------------------------RPNSQV-SEAFRSLRTALL-
A0A7C4BZ42      ----------------------------------------RKPSLI-AESFRATLTSIL-
A0A3R9WF43      ----------------------------------------NPYSPF-SESFRTLRTSIL-
A0A317HKM4      ----------------------------------------GAPARL-TELFQAARTNLI-
A0A2V9CG11      ----------------------------------------RKSSLS-ADCYRATVTSIL-
A0A523E0N1      ----------------------------------------ENRDAL-SERFRFLRGSML-
A0A4R1LAZ7      ----------------------------------------EPHSVI-AESFRNLRSTIL-
A0A7G8BMP1      ----------------------------------------EPQSVI-AEGFRTLRSSLM-
A0A523ECP2      ----------------------------------------EDMSLI-AERFKFLRGSLL-
A0A2W0C122      ----------------------------------------EPRTAI-AEAYRSLGTSIL-
A0A2W0AUU7      ----------------------------------------EPRTAA-AEACRALGTSVL-
A0A2W0BQL1      ----------------------------------------EPRTAA-AEACRALGTSVL-
A0A4Q1SDL1      ----------------------------------------APRSAY-SEAMRGLRASLT-
A0A3P0XH15      ----------------------------------------EPQSYV-SEGFRTLRSSIL-
A0A3M1WQW8      ----------------------------------------QRRSSF-AEAFRSLRTSVL-
A0A3N1JHC1      ----------------------------------------ADKTFL-TETYRSAGASIL-
C1F294          ----------------------------------------EPQSIV-AEGFRTLRSSIL-
A0A2V9KA79      ----------------------------------------PPPSIA-TDQYNILAMKIR-
A0A522PSP1      ----------------------------------------VDGTPF-AESLLGIRSTLL-
G8P085          ----------------------------------------SPLSVN-AEAFRNLRNALL-
A0A7C6A629      ----------------------------------------RVATSF-QEAVRTLRNSIL-
A0A4Q1SGQ1      ----------------------------------------ARQEIF-VEALCSLRTSLL-
Q1ILD9          ----------------------------------------RPNSQF-SESFRTLRTSIM-
A0A7G8BJH7      ----------------------------------------YISSPF-VEALRSLRTSLM-
A0A7C5SHM3      ----------------------------------------QRNHDV-EEAFRAMRSALL-
Q1IJZ6          ----------------------------------------YEQAMA-TEAFRSLRTTLL-
A0A2V8TCE6      ----------------------------------------HPSSPL-AESFRDLRTALS-
A0A522TBE8      -------------------------------------------HPY-HEAIVSLQSAIL-
Q1ITG0          ----------------------------------------RPQSKL-AEAFRALRTSLL-
A0A7C2ML20      ----------------------------------------NGNWAT-AEAYRTLRTSVL-
A0A7C5AXS9      ----------------------------------------RSGALL-AESFRATLTSIL-
A0A7C2RGE3      ----------------------------------------RQRSSF-AEAFRTLRTSVL-
A0A3N5PCI5      ----------------------------------------GVPAPY-AEACRALRTNVL-
A0A3M1Q0S9      ----------------------------------------APLSPV-AEAYRELRTAVL-
A0A2Z5G448      ----------------------------------------TPQTVG-AEAFRTLRSSIL-
A0A3M1VZ38      ----------------------------------------MPLSPA-AEAYRELRTAVL-
A0A4Q1SD29      ----------------------------------------EPQSIA-AESFRTLRSSIL-
A0A6N9FGE2      ----------------------------------------GAPASF-TEAIRSVRTNLI-
A0A3M1PY35      ----------------------------------------PGAHSV-EEAFRTLRSSLL-
A0A3M1VMP2      ----------------------------------------EEQMDV-EEAFRALRSSIL-
                                                                :           

A0A2V7VMF7      FA-RKDDA-GQVVLITGTAPQEGKTTTLVNLAKLLAG-S-GERTIVIDCDLRRAQIHQRL
A0A2V7YYV7      FS-AIDRE-LKEIVVTSAEVGEGKSRTAANLAIVLAQ-A-GHWTLLIDADFRRPAQHRMF
A0A2V7Z0J5      FS-GVERS-VKQLIVTSAEMGEGKSRTAANLAVVLAQ-A-GYKTLLMDADFRRPAQHRIF
A0A2V7Z3M4      FS-GINHR------LXXXGSGEGKSRTAANLSVVLAQ-A-GHQTLLIDADFRRPSQHRMF
A0A399Y5V2      FS-LLDSG-SRVVLVTSPSASEGKSTTAANIAVVLAQ-S-GKSVIIVDCDLRRPRVHKFF
Q01X01          SS-SHNGDHPHVLVVTSSRPMEGKTTVVSNLGIALAE-I-GNRVLLIDGDLRRPRLHKVF
A0A3M2D9H8      FV-EIDRP-LKTLLIGSPGPDEGKTTVAVNLAIVMAQ-G-GNRVLLMDTDLRQPQVHERL
A0A2V8JK38      LS-SGSAP-TRSVVITSAVPGEGKTVTAVNTAVIVAQ-T-GARVILIDADMRRPRMHKIF
A0A2V9IXG5      FN-KNLRQ-HKVIMVTSSLPEEGKTTVTMNLAKTLAA-A-GDRTMVVDFDLRKARLRSIL
A0A2V9J2P4      FN-KNLRQ-HKVIMVTSSLPEEGKTTVTMNLAKTLAA-A-GDRTMVVDFDLRKARLRSIL
A0A1Q7RLS4      FS-RKSRG-ANTVLITSAGPQEGKSCTTVNVARTLAT-A-GEKVIIVDCDLRRPAIHTRL
A0A2V2R525      LS-RPGKT-PKTLLVTSSMPAEGKTTTAVNMATILAQ-T-GASVLIIDADMRQPTLHEIF
A0A321LPW6      LC-AAGSP-PRTILVTSGQQGEGKTTTVINTAVSLAQ-L-GAKVLIIDCDLRRPSAHKLF
A0A2V9R9V4      LS-AAGNP-PKTILVTSVRMEEGKTTTATNTAIALAQ-L-GASVLLIDCDMRNPSVHDVF
A0A321LE75      LS-TAGNP-PKTILITSGQPGEGKTFTAINTAISLAQ-L-GASVLIVDCDLRKPSTHKAL
A0A2V8R8U7      LS-SAGTP-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GADVLIIDCDLRRPRLHSHF
A0A2V8QMP4      LS-SAGQP-PKTVLVTSSQPSEGKTTTVVNIATMLAQ-T-GADVLILDCDLRRPRVHAHF
A0A2V8R4S3      LS-SAGQP-PKTVLVTSSQPSEGKTTTVVNIATMLAQ-T-GADVLILDCDLRRPRVHAHF
A0A2V8NJ55      LS-SAGQP-PKTILVTSSQPSEGKTTTAVNTAVMLAQ-T-GAEVLIIDCDLRRPRIHTHF
A0A2V8Q7I0      LS-SAGQP-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GVDVLIIDCDLRRPRLHAQF
A0A2V8S6K4      LS-SAGQP-PKTMLVTSSQPSEGKTTTAVNTAMMLAQ-T-GAEVLILDCDLRRPRVHMHF
A0A317I2L9      LS-SAGQP-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GADVLIIDCDLRRPRLHAQF
A0A2V8LLF9      LS-SAGMQ-PRTILVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHSQF
A0A352FRF4      LS-SAGTA-PRTILVTSSQPSEGKTTTAINTAFILAQ-T-GAEVLIIDCDLRRPRLHAHF
A0A2V8MKV0      LS-SAGQA-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHSNF
A0A2V8PYY8      LS-SAGQA-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHSNF
A0A1Q7YKQ8      LS-SAGQP-PKTILVTSSQPSEGKTTTAVNTAVMMAQ-T-GADVLIVDCDLRRPRLHAQF
A0A352F3R7      LS-SAGQP-PKTILVTSSQPSEGKTTTTINTAFMLAQ-T-GAEVLVVDCDLRRPRLHAHF
A0A0B6WXT1      LS-TAGQP-PRTVLLTSSQPSEGKTTTAVNMAMMLAQ-M-GAEVLLLDCDLRRPRVHVHF
A0A3B9MEU8      LS-SAGQP-PKTILVTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHAHF
A0A2V8MHG6      LS-SAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSIF
A0A2V8P7N1      LS-SAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVIIVDGDMRRPRLHSIF
A0A2V8M3M6      LS-SAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSIF
A0A1Q7NJH5      LS-SAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSIF
A0A2V8PJY0      LS-SAGGA-PKTLLVTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSIF
A0A1Q7Y6W9      LS-TAGRA-PKSLLVTSSQPAEGKTTTATNIAISLAQ-T-GASVLIIDADMRRPRLHTIF
A0A2V8NC68      LS-SAGGA-PQTLLVTSSQPAEGKTTTVVNTATILAQ-T-GATVVVIDADMRRPRLHSIF
A0A399WK13      LS-TAGHA-PKSLLITSSLPSEGKTTTATNTAISLAQ-T-GASVVIIDADMRRPRLHSVF
A0A352FLX4      LS-TAGRP-PRTLLITSSVPSEGKTTTAVNTAISLAQ-T-GAKVLIIDADMRRPRLHSIF
A0A2V8RTL7      LS-TAGHA-PKSLLITSSLPSEGKTTTATNTAISLGQ-T-GAKVLIIDADMRRPRLHSVF
A0A3E0PCJ6      LS-TAGHA-PKSLLITSSLPAEGKTTTAVNTAISLAQ-T-GAKVLVIDADMRRPRVHSFF
A0A3M1S4R8      LS-VAGHA-PKSLLVTSSLPAEGKTTTAVNTAITLAQ-T-GAKVLVIDADMRRPRIHSIF
A0A7C2G442      LS-VAGHA-PKSLLITSSLPAEGKTTTAVNTAITLAQ-T-GAKVLVIDADMRRPRIHSIF
A0A1Q7YFI6      LS-SAGGA-PQALLVTSGVPSEGKTTTALNMAQIMAQ-T-GATVLLIDADMRRPMLHTLM
A0A136KC10      LS-TAGHA-PKSLLITSSLPSEGKTTTATNTAISLAQ-T-GAQVLIIDADMRRPRLHSVF
A0A3M2D6Y5      LS-VAGHA-PRSLLVTSSLPSEGKTTTAVNTAISLAQ-T-GAKVLIVDADMRRPRVHSIF
A0A2V8SEX6      LS-TAGHA-PKSLLITSSLPSEGKTTTATNTAISLAQ-T-GAKVLIIDADMRRPRLHSVF
A0A7C5ZUU4      LS-SAGHA-PKSLLITSSLPSEGKTTTATNTAISLAQ-T-GARVLIIDADMRKPRVHSVF
A0A0B6WWQ6      LS-TPGHA-PKTLLVASSAEAEGKSTVAVNVALILAQ-T-GAQVLLIDADMRRPKLHELF
A0A3B9MK99      LS-TAGRA-PRSLLVTSSLPGEGKTTTAVNTAVSLAQ-T-GASVVIIDADMRRPRLRSIF
A0A352EX26      LS-TAGRA-PRSLLVTSSLPGEGKTTTAVNTAVSLTQ-T-GASVVLIDADMRRPRMRSIF
A0A2V8MM59      LS-TAGRA-PKTLLVTSSLPGEGKTTTAVNTAISLAQ-T-GASVVIIDADMRRPRLRSIF
A0A2V8PFE8      LS-TAGRA-PKTLLITSSLPGEGKTTTAVNTAITLAQ-T-GASVVIIDADMRRPRLRSIF
A0A2V8PWS6      LS-TAGRA-PKTLLITSSLPGEGKTTTAVNTAITLAQ-T-GASVVIIDADMRRPRLRSIF
A0A2V8LCT5      LS-TAGRA-PKTLLVTSSLPGEGKTTTAVNTAISLAQ-T-GANVLIIDADMRRPRLRSIF
A0A352FTJ9      LS-TAGRA-PKTLLVTSSLPGEGKTTTAVNTAISLAQ-T-GASVVIIDGDMRRPRLRSIF
A0A257VBK0      FA-TDNHQ-NNAILVTSASPKEGKTSVSANLAKTLAA-G-GDRVLLMDCDLRRPSIHRIL
A0A2G6PYV5      LSKTTD---NKVLLLSSALSGEGKTVSSLNLAISFAQ-L-EKKTLIIDCDLRRPKLHKIF
A0A2V8F956      FS-SAEKG-SRSVVVTSTGPGEGKSLVAANLAISLAH-A-TQRVLVLDADLRKPQVHDIF
A0A1F2S1W5      FS-STEEG-GRLVVITSSAPGEGKTMVVTNLAVALAQ-A-GHRVLLMDADMRKPRVHEVF
A0A1F2T595      FS-STDEG-GRMIAVTSSAPGEGKTVVSTNLSIALAE-A-GHRVLLLDADMRKPRVHEIF
A0A2V8JQV5      FS-EHGGTVPQILVVTSANPQDGKSTMASNLAVALAE-T-QRRVLVIDSDLRRPDLHRIF
A0A2V9AC41      LS-QAGGP-PHTMLMTSATRGEGKTTTLVNTAIVFSQ-L-GIRVLVIDADLRRPRCHMLL
A0A2V9MAM9      LGGDEGQSPPRVLVITSTLPAEGKTTVATNLGITLAS-I-QRRVLLIDGDMRQPRIHHIF
A0A348V070      LS--FDSPTRKALIFSSPLSKDGKSSVISNLGLALAQ-A-HKRVVIVDSDLRKPRQQEIF
A0A2V9M454      LS-TAERP-PKVLLITSAQPSEGKTATTLNLAVTLAQ-K-GSRVLLIDSDLRRPGLAKAL
A0A2V9IVR7      LA-TSPRP-PQVIVMTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADFRKPGIAAAM
A0A2V9ILE2      LA-TSPRP-PQVIVMTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADFRKPGIAAAM
A0A2V9LGY4      LA-TSPRP-PQVIVMTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADFRKPGIAAAM
A0A2V9J4D6      FS-TSPKP-PQVVLVTSGHPKEGKTATAVNLASLMAQ-T-GSRVLLVDCDLRIPGASKLM
A0A2V9L9C5      FS-TSPKP-PQVVLVTSGHPKEGKTATAVNLASLMAQ-T-GSRVLLVDCDLRIPGASKLM
A0A2N9M9N1      LS-SSPQP-PQVLLVTSAHPSEGKTFASVNLALALAQ-R-GGRVLLVDGDLRKPTVLRAL
A0A2V9JEC4      LS-MTPRP-PQLLLITSPLPCEGKTSCSINLAASLAQ-R-GGRVLLLDADLRRPGVARAL
A0A2V9LPQ3      FS-STPEP-PKVLLVASSQPKEGKTCTSINLALSLAQ-N-SVPVLIIDADLRKPGVTREL
A0A2Z5G3A3      LS-KGGSP-PQVVLITSSIEGEGKSTLAANFAVLLAR-Q-GKKVLLVDGDLRRPKLHTTF
A0A2V7UGP8      LS-TADAP-PKIIVVTSSEPQEGKTVTTLNTAISLTQ-S-GKKVLLVDGDMRRPRLHKAL
A0A239MKT6      FS-RIDDP-PKVILFTSGISGEGKSTTAYNMAVAFAL-Q-TKRVLLIDADMRRPTIRERV
A0A3E0PCN7      LS-TAGGP-PKSVLVTSGQPFEGKTINSLCLAKSMAE-L-GKKVLLIDADMRCPKMHLIN
A0A2V8IYW3      HA-QADTG-MRVVMVTSAISGEGKSLTITNLALTLTR-SYERRVLLIDADLRRPTLHTIF
G2LEI9          LS-SSEDVRNRIILITSSQPGEGKTTTSFNTAISLAQ-T-GASVLLIDCDLRRPQLQKLF
A0A317J121      LGNGTRRP-PRVILVTSPGAGEGKTTIVSNLGTALAE-T-GRSVLILDGDFRRPRLHKVF
A0A2V7YW66      LS-SARE--LKTVAVTSAMAGEGKTATAVNLAIVLAQ-L-GRQVLIVDCDLRKPRLHQVL
A0A2V7Z0V0      LS-SARE--LKAIAVTSAVAGEGKTATASNLAVVLAQ-L-GRQVLLVDCDLRKPRLHQVF
A0A2V8GFD4      FS-FAEGS-AKTLVITSTAPEEGKTMVAANLAIALAM-T-SQRVLLVDADMRRPKIHQLF
A0A2V8HSS5      FS-FAEGS-AKTLVITSTAPEEGKTMVAANLAIALAM-T-SQRVLLVDADMRRPKIHQLF
A0A2V8KP55      LS-SGSAP-TRSVVITSAVPGEGKTVTAVNTAVIVAQ-T-GARVILIDADMRRPRMHKIF
A0A399WNU1      LS-TAGGS-PKTVLVTSGEPSEGKTITSLNLAKSLAQ-L-GGKVLLVDADLRCPKMHLIN
A0A2V9JSI3      LS-TPGHP-PQVILITSSQPNEGKSCTCLNLALTLAQ-R-GGRVVIIDGDLRKPGVASVL
A0A2V9WI32      LS-SLGSP-PKVILVTSALPQEGKTTTSINSAIVLAQ-R-GGRVLLVDADLRRPGVHKAL
A0A2V8IVN9      FS-SAEEG-SRILVVTSTGPGEGKTTFASNLAVSLAQ-T-GQRVLLIDGDMRKPKLQEAF
A0A7C5Z4J3      LS-SAPCP-PRVILVTSTQPFEGKTSTSINLAMGLTQ-I-GKRVLFIDADLRQSSLRRMI
A0A1F2TPT3      FS-FAGDA-TRSVVITSASPTEGKTVVGSNLAVALAQ-A-GERVLLMDADLRRPMIHTHF
A0A2V8JTQ2      LS--QPTP-PRVIQVTSALPGGGKTTVSTNLAILLAR-L-RRRVLLVDADLRRSQIHLAM
A0A2V8UZY0      LS--AATP-PGIILVTSAVPGEGKTTVCTNTAILLAR-L-HRRVLLVDADLRRPSIHRAM
A0A350UEK1      FSGNGHGP-PRMIVVTSASPSEGKTTVATNLALAMAE-T-GQRVLLVDGDTRRPRQHGIF
A0A350UIQ4      FSGNGSGP-PRMIVVTSPNPSEGKTTVATNLAVAMAE-T-GQKVLLIDGDTRRPRIHGIF
A0A1H5Z7N3      LA-TAGKE-PKVVLVTSSTPSEGKTTVSTNLATVLAQ-R-DVKTLLIDADLRRPTVHHRF
A0A1G7JVV8      LA-TTGHP-PKFILITSSTPSEGKTTVSTNLAAILAQ-R-ETRVLLIDADLRRPNVHHRF
A0A1H4T6W9      LA-TTGHP-PKVILISSSTPGEGKTTVATNLAAILAQ-R-DTKVILIDGDLRRPNVHHRF
I3ZEU5          LA-TTGHP-PKIILISSSTPGEGKTTVATNLAAILAQ-R-ETRVLLIDADLRRPNVHHRF
A0A7L5A6M5      LSMSEGRE-PKYILFTSATPSEGKTTAATNLATVMAQ-G-DARVLLIDADLRRPNVHHRF
A0A428MDU2      LS-SAGHP-PKFILFTSATPSEGKTTTASNLACILAQ-R-DARVLLIDADLRRPNVHHRF
A0A5B9EBI2      LA-DTAHP-PRTILFTSATPSEGKTTCSTNLSCILAQ-R-ETRVLLIDADLRRPSVHHRF
A0A239HDF6      LS-TAGRE-PKLLMFTSAAPGEGKTTTSINLAAILAQ-R-GARVLLIDADLRRPAVHVRL
A0A4Q0T270      LS-TTGQP-PKFILFTSSTPSEGKTTTACNLACILAQ-G-DVRVLLIDADLRRPNVHHRF
A0A1Q3QQB6      LA-TTGHP-PKFILLTSATPSEGKTTLSTNLACILAQ-G-DARVLLIDADLRRPSVHHRF
A0A3N1K1G7      LS-TTGHP-PKFILFTSATPSEGKTTTASNLACILAQ-A-DTRVLLIDADLRRPNVHHRF
A0A4V2G466      LS-SAGHP-PKYILLTSATPSEGKTTASTNLATILAQ-G-DARVLLIDADLRRPTVHQRF
A0A6B9YNQ8      LS-SAGHP-PRTILLTSATPSEGKTTASVNLATVLAQ-G-NARVLLIDADLRRPTVHEQF
A0A7G8BSK5      LS-SAGHP-PKYILLTSATPSEGKTTASSNLATILAQ-G-DSRVLLIDADLRRPTVHHQF
A0A1I6MH75      LS-STGHP-PKFVLFTSATPSEGKTTTACNLACILAQ-R-DTRVLLIDADLRRPNVHHRF
E8WVF6          LA-STGKE-PRLLLFTSATPSEGKTTAASNLAVILAQ-G-GTRTLLIDADLRRPNVHHRF
A0A3N5YNR8      LS-HSGKP-PKVIMVTSSVPGEGKTTTVANTGIVLAQ-T-GARTLLIDLDMRKPALASTF
A0A3N6A5T6      LS-NSGKP-PQIILVTSALPAEGKTTTALNAAIVLAQ-T-SARTLLIDLDMRRPKIGSHF
A0A1F2Q9L4      LS-TTNR--LKSVVVTSAIPGEGKTSTAVNLAVVLAQ-L-GRQVLLVDADLRKPRLHEIF
A0A2U3KC61      LS-SFGAP-PKVILVTSAMPQEGKTTVSANSALVLAQ-R-GSRVLLVDADLRRPSIAKLF
A0A2V9Y2R7      LS-SFGAP-PKVILVTSALPQEGKTTISANSAVVLAQ-R-GSRVLLVDADLRRPGIGKMF
A0A2V9NGH6      LS-SVGAA-PKVVVVTSALPSEGKTTTSINTAIVLAQ-K-GNRVLLVDADLRRPSIHKTL
A0A2V9PYE6      LS-SVGAP-PKVVVVTSALPSEGKTTTSINTAIVLAQ-K-GNRVLLVDADLRRPSIHKTL
A0A2V9NL07      LT-SLGAP-PKTILITSALPQEGKTTTSINTATVLAQ-K-GTRVLLIDADLRRPSIHKTL
A0A2V9QD92      LT-SLGAP-PKTILITSALPQEGKTTTSINTATVLAQ-K-GTRVLLIDADLRRPSIHKTL
A0A2V9WPZ6      LS-SLGAP-PKIILITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADLRRPGVHKAL
A0A2V9ZLH4      LS-SSGAP-PKVILVTSAMPQEGKTTTSINCAIVLAQ-K-GTRVLLVDADLRRPGVHKAL
A0A2V9RQF1      LT-SLGAP-PKIILITSALPQEGKTTTSINTAVVLAQ-K-GTRVLLIDADLRRPSIHKTL
A0A2V9YDK8      LS-SSGAP-PKIILVTSALPQEGKTTTSINCAIVLAQ-K-GVRVLLIDADLRRPGVHKTL
A0A2V9V8F7      LS-SLGAP-PKIILITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADLRRPGVHKAL
A0A2V9XGR9      LS-SLGAP-PKIILITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADLRRPGVHKAL
A0A2V9V3Q5      LS-SLGGP-PKVIMVTSARPQEGKTTTAINSAIVLAQ-K-GVRVLLVDADLRRPSVHKTL
A0A2V9NWS3      LT-SIGAP-PKVILVTSALPQEGKTTTSINTAIVLAQ-K-GTRVLLIDADLRRPSIHKAL
A0A2V9USA9      LT-NLGAP-PKVIMVTSALPQEGKSTTSINCAIVLAQ-K-GVRVLLIDADLRRPSIHKTL
A0A2V9XW18      LS-NLGAP-PKVIIVTSALPQEGKTTTSINTAVVLAQ-K-GVRVLLIDADLRRPSIHKTL
A0A1H5SQF5      LS-RAEQ--PRTLLFTSSFSGEGKSTLTSNMAFAFGL-Q-GSRVLLMDADMRRPTLHTKL
A0A2V9AEW6      LP-NQDGDPPQVVLLTSPCLGDGKTTVACNLSIAMAE-I-GRKVLLIDGDLRRPRIHQVF
A0A2V8WQK6      SP-NQNGEGPRIIVLTSACPGDGKTTVACNLSIAMAE-I-GRKVLLIDGDLRRPRLHKIF
A0A2V8XIF4      LP-SQNGDCPGVVVLTSPSSGDGKTTVACNLAIAMAE-I-GRKVLLIDGDLRRPRLHKVF
A0A2V2R0I6      LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVVVDADLRKPGVGRLL
A0A2V8XAR9      LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL
A0A2V8VZA0      LS-QAGHP-PQVILVTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL
A0A1Q7CB82      LS-QAGHP-PQVILVTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL
A0A2V8WIU1      LS-QAGHP-PQVILVTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL
A0A1Q6Y9F5      LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL
A0A2V9EVV8      LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL
A0A2V8YF91      LS-QADHP-PQVILVTSALPREGKTTVAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL
A0A2V8XZK2      LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL
A0A2V8ZTX6      LS-QAEHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIARLL
A0A2V9BT79      LS-QAEHS-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDRTVLVDADLRKPGIGRLL
A0A2V9YHT3      LS-SLGAP-PQVILVTSALPQEGKTTTAVNCGIVLAQ-Q-GSRVLLVDADLRRPAVHHSL
A0A7C2XNI7      LS-QAEHP-PQVILVTSALPREGKTTAAVNLAVTFAH-L-GDRTVLVDGDLRKPGIGKLL
A0A1Q8B793      LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDKTLLIDADLRKPGVGRAL
A0A2V9BCA0      LS-QADHP-PQVILVTSALPREGKTTAAANLAVTLAQ-L-GDKTLLIDADLRKPGVGRAL
A0A2V9BWU9      LS-QAEHP-PQVILVTSALPREGKTTAAVNLAVTLAQ-L-GDRTLLVDADLRKPGISRAL
A0A2V9DKX2      LS-QAEHP-PQVILVTSALPREGKTTAAVNLAVTLAQ-L-GDRTLLVDADLRKPGISRAL
A0A7C2YQY3      LS-TSKHP-PQTILITSGQPREGKTTTALNLAITLAQ-R-GDRVVLMDSDLRRPRVHRSF
A0A3E0NV31      LS-SASEP-PRTILVTSALPAEGKSTTVANMAISFAN-N-NARTLIIDLDLRKPALAPLF
A0A3N5M5V0      LS-HSGKP-PKVIMVTSSIPGEGKTTTVANTGIVLAQ-T-GARTLLIDLDMRKPALAGTF
A0A3N5XQP8      LS-HPDQP-PVRILIASAMPGEGKTTTAAYTGVVLAE-T-GAPTVLIDLDLRRAGLTGLF
A0A2Z5G7H4      LA-KSSAP-PQLLLITSSVAGEGKSILSANLAAVLAQ-S-GRRVLLVDADLRKPSLGDRL
A0A2V9L5B5      LS-A--SPVPRVILITSALPGEGKTTTAVNLGAALAS-L-GSKVVVIDCDMRRPSCHRSV
A0A2V9LK56      LS-A--NPSPKIVLVTSALPSEGKTTITVNMGATLAS-L-GSKVLVLDCDMRRPTCHRAT
A0A2V9L7I0      LS-A--SPVPRLILITSALPGEGKTTTTVNLGAALAS-L-GSRVVIVDCDMRRPACHRST
A0A522PPT0      LS-A--HPVPKVLLVTSALPGEGKTTTTVNLGATLAS-L-GSKVLILDCDMRRPACHRAT
A0A7C5V1G5      LS-A--SPVPKVLLVTSALSGEGKTTTTVNLGATLAS-L-GSRVVIVDCDMRRPAVHRAA
A0A2V9KCS3      FF-EADGNRPRILVMTSSAPGEGKTTVTSNLAIALAE-I-SRRVLVIDADMRRPRIHDIF
A0A372IT17      LS-RSSAP-PQVLLVTGTRDAEGKSTIALNLAAILAH-Q-GAQVLLVDGDLRRPALHRYL
A0A4R1LC91      LS-RGGSP-PQSILLTSSIEGEGKTTLSINLAILLAQ-Q-GKRVLLVDADLRRPSLHKSF
A0A3M2BZG9      LS-SAEE--LRSVAVTSAEPGEGKTATTTNLGVVMAQ-L-GRSVLIVDCDLRRPRMHQVF
A0A1Q7N5R7      HA-YGTAG-PMVITITSPAVGDGKSFVSTNLALACAQ-A-GQRTMLVDGDTRRGALHRVL
A0A2V9QB26      FS-GSNGACPRVLVLTSAGPKEGKTMVASNLGIALAE-T-KRKVLIIDGDLRKPRMHELF
A0A2V9VYY4      LS-SFGAP-PKVILVTSAMPREGKTTISANSALVLAQ-R-GSRVLLVDADLRRPGVEKLF
A0A3E0PHB0      FS-SAGKP-PETILVTSSQPSEGKTTTAINTAITLAQ-S-GAEIVIIDCDLRRPRLHSLF
A0A3M1SIV3      FS-SAGRP-PQTILITSSQPSEGKTTIAVNTAVALAQ-A-GADVVLIDCDLRRPRIHQHF
A0A3M2D491      FS-SAGKP-PQTILITSSQPAEGKTTTAINTAIALAQ-S-GADVVLIDCDLRRPRIHEHL
A0A353C9L6      FS-SAGKP-PQTILITSSQPSEGKTTTAINTAITLAQ-S-DVDVVIVDCDLRRPRLHSHF
A0A2V8RQV0      FS-SAGKP-PQSILVTSSQPSEGKTTTAINTAITLAQ-S-DVDVVIVDCDLRRPRVHSYF
A0A2V8SJH5      FS-SAGKP-PQSILVTSSQPSEGKTTTAINTAVTLAQ-A-DADVVIVDCDLRRPRLHTYF
A0A357F267      FS-SAGKP-PQSILVTSSQPSEGKTTTAINTAVTLAQ-S-DVDVILVDCDLRRPRLHSYF
A0A7C5ZUA8      FS-SAGKP-PQSILITSSQPSEGKTTTAVNTAVTLAQ-A-DVDVIIIDCDLRRPRLHNYF
A0A136JPP4      FS-SAGKP-PQSILVTSSQPSEGKTMTAINTAITLAQ-A-DADVVLIDCDLRRPRMHSHF
A0A399WUJ8      FS-SAGKP-PQSILVTSSQPSEGKTTTAINTAVTLAQ-A-DADVVLIDCDLRRPRMHSHF
A0A2V9KIE8      LS-A--HPVPRTILITSALPGEGKTTTTVNLGVALAG-L-GSKVLIIDCDMRRPACHRAT
A0A352F549      LS-TAGRP-PKTLLVTSSVPAEGKTTTVVNTATVLAQ-T-GAQVLIIDADMRRPRLHQVL
A0A3B9MLP9      LS-TPGRS-PKTLLVTSSVPAEGKTTTAVNTATVLAQ-T-GAKVLLIDADMRRPRLHHVF
A0A3D5SQ87      LS-TPGRS-PKTLLVTSSVPAEGKTTTAVNTATVLAQ-T-GAKVLLIDADMRRPRLHHVF
A0A2V8NW86      FS-GSNGDCPRVLVLTSAGPKEGKTTVATNLGIALAE-T-KRKVLIIDGDLRKPRMHELF
A0A7C2GJ20      LS-HAEHP-PRTILFTSSSPGEGKTTTAVNTAISLAQ-M-GARVLLIDGDLRKPGLHKVL
A0A7C4BTL5      FS-SENGSRPRVLVLTSAASGEGKTTTASNLAIAMAE-I-RLKVLIIDADLRRPRLHSVF
A0A2V8ZHL8      LS-TAPRP-PQALLITSATAREGKSTTALNLAIALAQ-R-GDSTLIIDADLRRPGIAESL
A0A2V9B240      LS-TAPRP-PQALLITSATAREGKSTTALNLAIALAQ-R-GDSTLIIDADLRRPGIAESL
A0A2V9CBM2      LS-AAEGP-RNSFLVTSTQPSEGKTTVASNLAIALAQ-L-GRRVLLVDADLRSPSLHRLF
A0A2V8XN17      LS-TPDRP-PSSLLVTSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKLF
A0A2V8WX45      LS-TPDRP-PGSLLVTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLVDADLRFPSLHKLF
A0A1Q6YR79      LS-TPDRP-PSSLLITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKLF
A0A1Q7VA32      LS-TPDRP-PSSLLITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKLF
A0A2V9EY85      LS-TPDRP-PSSLLITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKLF
A0A2V9H8K0      LA-TPDRP-PGSLLVTSTQPAEGKTTVACNLAISLGQ-L-GHRVLLLDADLRFPSLHKLF
A0A2V9FFE5      LS-TPDRP-PSSLLVTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLLDADLRYPSLHKLF
A0A2V9GM43      LS-TPDRP-PSSLLVTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLLDADLRYPSLHKLF
A0A2V9CYQ5      LS-AAGGP-PNSFLVTSTQPSEGKSTVATNLAIALAQ-I-GRRVLLVDADLRSPSLHRLF
A0A2V9BWU8      LS-TADHP-PGSLLITSTQAGEGKTTIATNLAISLAQ-L-GQRVLLVDADLRFPSLQRLF
A0A2V8ZG48      LS-TADHP-PGSLLITSTQPGEGKTTVATNLAISLAQ-L-GQRVLLVDADLRFPSLEKLF
A0A2V8Y334      LS-TADHP-PGSLLVTSTQPGEGKTTIATNLAISLAQ-L-GQRVLLVDADLRFPSLQKLF
A0A2V9AY68      LS-TADHP-PGSLLVTSTQSGEGKTTIATNLAISLAQ-L-GQRVLLVDADLRFPSLQKLF
A0A1F2RFI7      LS-TSGRP-PRVILVTSGQPGEGKTTTVVNLAIALVQ-L-GGRVLVVDSDMRRPRVGNLL
A0A1F2RZS3      LS-TSGRP-PRVMLITSGQPGEGKTTTTVNLAIALVQ-L-GGRVLVVDSDMRRPRIGTLL
A0A1F2USE2      LS-TAERP-PRILLVTSAQPGEGKTTITLNLAISLAQ-L-GQRVLLIDGDMRRPCLHKVF
A0A7C2VB08      LS-AADRP-PRTLLVTSAQPGEGKTTVSTNLAISLAQ-L-GQRVLLIDGDMRRPSVHLAF
A0A2V9C238      LS-TADRP-PRTLLVSSSQPSEGKTTVSINLAISLAQ-L-GQRVLLIDGDMRRPSVRKAF
A0A1F2Q9F5      LS-TPEQA-PRLLLTSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADLRRPCIHKAF
A0A1F2QQH9      LS-TPEQA-PRLLLTSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADLRRPCIHKAF
A0A1F2QXK7      LS-TPEQA-PRLLLTSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADLRRPCIHKAF
A0A2V9DEM9      LS-TADRP-PRTLLVSSSQPSEGKTTVSINLAISLAQ-L-GQRVLLIDGDMRRPSVRKAF
A0A7C5TWV7      MA-AREEGP-QVLMVTSAAPQEGKTTTAFNLAKALAA-G-GSRVLVVDADLRKPRFHRIL
A0A2V7XDY0      FG-RKDERG-QIVLVTGTVPQEGKTTTIVNLGKLLAS-S-GEKAVLVDFDLRRGQLHSRL
A0A2V8G155      FA-LPEEAAR-CILVTSTAPGEGKSVIASNLAMSLAH-S-GARVLLVDGDMRKPRGHELL
A0A2V8HDM7      FA-LPEEAAR-CILVTSTAPGEGKSVIASNLAMSLAH-S-GARVLLVDGDMRKPRGHELL
A0A2V8DRT9      FS-STADGGQ-SIVVTSSGPGEGKTVVSSNLALALAQ-T-GQRVLLIDADMRRPRVHQVF
A0A2V7VYF3      FS-SVEEGSR-TIVVTSTGPGEGKTVVSSNLALALAQ-A-NQRVLLVDADMRRPQIHSYF
A0A1F2SVH2      FS-SADEGGR-SVLITSTGPSEGKTVVATNLAVALAQ-A-GQRVLLMDADMRKSRVHIVF
A0A2V8AJG9      FS-SAEEGSK-TIVITSTAPGEGKTTVASNIGIALAQ-A-SQRVLIVDADMRKPRVHSVF
A0A2N9LQU7      LT-AADRPPQ-LLVVTSAFPSEGKSVSSCNLAITLAQ-R-GSRVLLVDADLRRSTLLRQL
A0A2P6WFK7      LS-SPDHEPK-IITVVSSVPAEGKTTVSVNLASAFAQ-R-GESVLLIDADLRRSTTHTHF
A0A2V8U914      SA-EQNGDHHDVLVITSPLAGEGKTTVSSNLGIALAE-V-RGRVLLIDGDMRRPRLHKIF
A0A2V7W309      LA-SANSP-K-IIVITSSFAREGKTTTSVNLATVLAQ-M-GKPVLLIDADLRRPRLQKVF
A0A2W0BGU4      LS-VASRAPQ-TVLITSAKIGEGKSSTALNLAMALAQ-C-GSSVVLLDCDLRKPVLARLL
A0A2W0BVQ9      LS-VASRAPQ-TVLITSAKIGEGKSSTALNLAMALAQ-C-GSSVVLLDCDLRKPILARLL
A0A2V9MN96      LS-SFGAPPK-VVLVTSALPQEGKTTVSANSAVVLAQ-K-GGRVLLVDADLRRPGVARAL
A0A2V7V2Z1      YS-WPEAASR-ILLVTSTSAGEGKTVTSVNLALILAS-L-GGRVLLVDCDLRRPQSHVLL
A0A2V7X2F7      YS-WPNTVPR-IIVVTSTAPGEGKTLTSVNLSLTLAS-S-EGKVLLIDADLRRPQAHTLL
A0A2V7V2I1      YS-WPGQDSR-VLVLTSTAPGEGKTLTSVNLALTLAT-M-DGQVLLLDADLRKPQAHELL
A0A2V7U3M2      YS-WPESSPR-ILLVTSTSAGEGKTVTSVNLALILAS-L-GGKVLLIDCDLRRPQSNTLL
A0A2V7UHT0      YS-WPDSSSR-ILLVTSTSPGEGKTVTSVNLALILAS-M-GGKVLLIDCDLRRPQSHTLL
A0A2Z5FVL3      ST-RGGAPPQ-VLLVTSSTEGEGKSTLSSNLAVVLAQ-Q-GKRVLLVDADLRRPNLHVLF
A0A2V9KBD6      LS-QPTPPV--VIQVTSALAAEGKTTVSANLAILLAR-L-RRRVLLIDADLRRPRIHLAM
A0A2W0AJ66      LS-RPTPPA--VIMMTSALPSEGKTTVAMNTAIALAR-L-GRRVLLVDGDLRRPSVHRAM
A0A1Q7RBU1      LS-QSTPPA--VILVTSALPREGKTTVSTNLAIAIAR-L-RKRVLLVDADLRRPSIHRAM
A0A2V9JPV9      LS-QPTPPA--VILVTSALPREGKTTVSTNLAITLAR-L-RRRVLLVDADLRRPSIHRAM
A0A3P0X3W6      LE-RTREKLR-SVQVTSAVAGEGKSTCTAHLAIAHAM-Q-GRKTLLIDADLRRPSQHNHF
A0A2N9MK30      LS-SFDRQIK-SLMVTSATPGEGKSTVCVHLAMAHAQ-Q-NHRTLLIDCDLRRPSVHRRL
A0A3D1ASD2      LT-DFDRRLR-SVLLTSASPSEGKSTVAAHLAVAHAE-Q-KHRTLLIDGDLRRPSLHKFF
A0A7C5AXI3      LA-DFDRRLR-SLLVTSASPGEGKSTVAAHLAVAHAE-Q-GHRTLLIDCDLRRPSVHRRF
A0A7C6E4H7      LA-DFDRGLR-SLMVTSACPGEGKTTTAAHLAIEHAA-Q-GHKTLLIDCDLRRPGIHRVL
A0A1F2TCR2      FT-GKSEGP-RVIAVTSSQPLEGKTTTACNLAMVLAL-G-GSRVLLIDADMRRPGLHKIV
A0A350UQT3      LT-DFDRRL-RTLLMTSATASEGKSTTAGHLAFAHAE-Q-RKRTLLIDCDLRRPSQHKLF
A0A7C3HRX0      LS-DFDRRL-RTMFLTSATAGEGKSTTAGHLAVAHAE-Q-GRKTLIVDCDLRRPTQHKLF
A0A1F2V330      QQ-LSGVRS-PLLAISSVVGGEGKTVTSLNLSLALAGTV-SGRVLLIDSDLRKPRVHEYL
A0A662EE63      LA-ARDEGC-QILLVTSSVPSEGKTTASFNLAKVLAA-G-GARVLLIDGDLRKPRLHHMM
A0A2V8TLH7      FS-RKARTA-NAVLVTSAGPQEGKSCTSVNVARTLAN-A-GEKVVIIDCDLRRPTVHQWL
A0A1Q7ZJT1      FS-RKSRGA-NTVLITSAGPQEGKSCTTVNVARTLAT-A-GEKVIIVDCDLRRPAIHTRL
A0A2V8VC99      FS-RKNRSA-NTVLITSAGPQEGKSCTTVNVARTLAT-A-GERVMILDCDLRRPAIHTRL
A0A348UZU3      LS-GPLSSL-KSLIITSPLPNEGKSVTISNLAVSLAQ-T-EKKVLLMDADLRRPKQHRIF
Q01XL7          RA-QPKGEC-PVYVITSGGPGEGKTTLSANLAIAMAM-I-GQRVLLIDADLRRARLHSVF
A0A2V8ERZ5      SK-YQGDAT-KIITVTSAQPLEGKTTTAANIAMALAY-G-GARVLLIDADMRRPGLHRPL
A0A2V8GTX0      AS-SGTDAT-RLVAITSTQPLEGKTTTAVNVALALAI-G-GARVLLIDADMRRPSLHKAM
A0A2V8J0X9      FT-SGAQST-RIIAVTSSQPLEGKTTTACNLAMALAF-G-GSRVLLIDADMRRPGLHKTV
A0A523DUV7      FT-REREHG-NMILVTSSIPQEGKSTTAVNLAKALAE-S-GDPTLVVDFDLRRSSIHTHL
A0A1F2U158      SR-YPGEGA-KTMIVTSAQPLEGKTTTAANIAMALAY-G-GARVLLIDADMRRPGLHRSL
A0A2V8F6S9      SK-YPGAGT-KVLLVTSAQPLEGKTTTAANVAMALAY-G-GSRVLLIDADMRRPGLHRPL
A0A7D8BEX2      MA-KPDERN-NLFMVVSTVPAEGKSTIARETAATFAE-H-GSKVLLIDGDLRKPSQHIRM
A0A4Q1SCH5      LS-SIDMPP-RLMLVTSSLPGEGKSSTSANYAVVLAQ-N-GAKVLIIDADLRRPTLHKIF
A0A372IRG7      LS-AVDREP-KLLLLTSGFAAEGKSTCSSNLAVSFAQ-R-NARVLLVDTDLRKGTLHMKF
A0A2V8K4L4      FS-EQRP---RVVVISSANPSEGKTTVSTNLSIALSE-I-SQRVLLIDADMRRPRLHRLF
A0A2V8NCZ3      FS-EQRP---RVLVISSANPSEGKTTVSTNLSIALSE-I-SQRVLLIDADMRRPRLHRLF
A0A4Q7YNP3      LT-GNSSNRARVYVVTSPNAGDGKTTVTSNLGVALSK-S-NLRVVILDGDLRKPGMHNAL
E8UZE1          LS-HAGNPP-QLIVICSAWTKEGKSTITINLATVLAQ-M-NRKVLLVDADLRRPSLHHKL
A0A2U3JZ71      LT-DFDRRI-RSLMITSSGPAEGKSTTAAHLALAHAQ-Q-GRKTLLIDGDLRRPSIHRRF
A0A2V8TTB0      LT-DFDRSL-RSVLLTSASPSEGKSTVAAHLAATHAG-Q-HKRTLLIDGDLRRPSVHRLY
A0A1V6HR88      LS-TASEL--KVIVITSSIPGEGKTSTASNLAIVLAQ-L-GKNVLLIDGDLRKSRLHELF
A0A3E0P0A3      LS-KADEP--RLLVVTSTEAQEGKTATALNLAIVMAQ-L-ARRTLLIDGDLRKPRIHEAL
A0A2V8EXP2      FS-SADEGP-KVIVVTSAGPGEGKTLVASNLAVAMAQ-A-AQRVLLMDADMRRPRVHSLF
A0A2W4RYA1      FA-RADPDM-RSVMVTSTGVGEGKSVVAGNLAVAIAQ-T-GQRVLLVDADLRRPRAHGLF
G8P0Y7          LS-SVSHPP-RSILVTSSVPEDGKTMTSINIAIVMAQ-Q-EKRILLVDADMRRPSVHTAF
A0A5M8T4U7      LS-SIDKPP-RVIAITSAFPGEGKTTTAVNCALALAQ-R-GERVLLVDADLRRGTLHQVF
A0A7L5A491      ID-PREKPL-HSILVTSAAPGEGKSSCVAHMAAAFAR-H-GHRTLLIDADLRRPSQQRHF
A0A7D8BF18      LS-VAGGEP-QTILLTSATPAEGKTTVSMNLATVLAQ-R-GVRVLLIDADLRRPTIHHRL
A0A1E3Y9R6      FS-SAEDGA-RSVVVTSTGPHEGKTVVSSSLAITLAQ-A-GQRTIVVDADMRRPRMHEAL
A0A2W4TLP2      FS-SAEEGA-RSVVITSTGPHEGKTVVSSSLAIALAQ-A-GQRTVVVDGDMRRPRMHEAL
A0A7G8BDY8      LT-SARMPP-KTILITSALPGDGKTTVTVNLASVLAQ-Q-GARVLLVDADLRRGLIAEQL
A0A7C4BZ42      LS-GQNGERPRVIALTSAGPSEGKTTAASNLAIALAE-T-NRRVLLVDADMRRPRLHAVF
A0A3R9WF43      HS-HSVTRL-QTLLVTSPHGGDGKTTVAYNLAVAFAQ-Q-GSRVVLLDADLRNPDLHRLF
A0A317HKM4      MA-PELARP-HILLVTSSEPGEGKTVTAANLAASLAG-L-HQRVLLIDADLRKPGLHQLF
A0A2V9CG11      LA-NQNGDLPQVIVVTSPCQGEGKTTVASNLSIAIVE-L-GRRVLLIDGDLRRPRLHKVF
A0A523E0N1      LS-TPNAVP-KIVLVTSPDKNCGKTFISSNLSCALGQ-L-DKKVLLIDSDLRNPRLHRVF
A0A4R1LAZ7      LS-AVDTQP-KVLLLTSSFAAEGKSTCASNLAISFAQ-R-NARVLLVDTDLRKGTLHIKF
A0A7G8BMP1      LS-AVDREP-RLILLTSSFAAEGKSTCAANLAISFAR-R-SARVLLVDSDLRKGTQHLKF
A0A523ECP2      LS-TPGRPP-RTVLVTGPDKNAGKTFVACNLATSLAD-L-DKKVLLIDADLRNPQLHKVF
A0A2W0C122      LA-SRDL---KSLLVSSPLPAEGKTMTAANVAVVLAQ-Q-GKAVLLVDADLRKPGLDREF
A0A2W0AUU7      LA-SADL---KSLLVSSPLPGEGKTMTAANLAVVLAQ-Q-GKRVLLVDADLRKPGLDREF
A0A2W0BQL1      LA-SADL---KSLLVSSPLPGEGKTMTAANLAVVLAQ-Q-GKRVLLVDADLRKPGLDREF
A0A4Q1SDL1      PT-RTTMEPPRVVVVTSASPGEGKSLTAKNLAVSTAQ-Q-GKRVLLIDADLRKPSDKKGL
A0A3P0XH15      LS-AVDREP-KLILLTSSFATEGKSTCAANLAISFAR-R-SARVLLVDTDLRKGTLHMKF
A0A3M1WQW8      LS-HAERPP-RTILFTSSSPGEGKTTTAVNTAISLTQ-T-GARVMLIDGDLRKPGLHKML
A0A3N1JHC1      FS-RNGGMAPKVLLVTSPHPRCGKTVTIANLAISLAE-G-GRRVLLIDGDLRRPALPQLF
C1F294          LS-SVDREP-KAILLTSGLAAEGKSTCAANLAISFAQ-R-PARVLLVDTDLRKGTQHLKF
A0A2V9KA79      SQ-LGDENG-RVLTITSAAGGEGKTLTSVNLSLALASTF-EGQVLLVDADLRKPRIHHYL
A0A522PSP1      LG-ASGNSM-RALAVISSRPEEGKTTIAMALAMSMAA-L-GRRTVLVDGDLRRPQVHRIL
G8P085          LS-SIDRPA-KMLLVSSTIPGEGKSSTTANYGVVLAQ-K-GARVLLVDADLRRPALHSKF
A0A7C6A629      LA-DFDRGL-RSLMVTSACPAEGKTTTATHLALAHAT-Q-GHKTLLIDGDLRRPGIHRVF
A0A4Q1SGQ1      RL-RDGDSS-QVVLITSAVAGEGKSTIAANLAGVLAQ-S-GERVLLVDADLRRPGIYHEL
Q1ILD9          LS-FPSRPP-KSLVVTSALPGEGKSTISMNVAGTLVQ-R-GARVLLVDADMRRGRLASRA
A0A7G8BJH7      LS-RSSKAP-QVVLVTSSNAGEGKSTVSLNLATVLAQ-Q-GVRVLLVDADLRRPVLHARM
A0A7C5SHM3      LA-QAERPP-ASLMVTSALPGEGKSTIAANLARTLAS-F-GHSVVMIDADLRHPRLHRVF
Q1IJZ6          LS-QAGSAP-KSLLLTSSLPGEGKSTTTYGLGRCFGS-L-GTRVLLIDADLRRPTLHKHA
A0A2V8TCE6      LS-SAGSTP-RSLTVASTRPEEGKSTIAINLATVLAQ-S-GKKVLLVDSDLRRPRLHRAF
A0A522TBE8      LG-AAEA---RVVAITSALPAEGKSTAAGHLAASMAQ-M-GQSTLLVDGDLRKPRVHRLF
Q1ITG0          LA-NAGAPP-KVIMITSAQPGDGKSTVSVNISAVLAQ-S-GARVLLVDADLRRGVLARNL
A0A7C2ML20      LS-SATHPP-RSILITSHEARAGKTTTAVNVAIALAQ-T-GKRVLLIDADLRHPSCAPLF
A0A7C5AXS9      FS-SKNGHAPKVLVFTSPNPREGKTSMVSNLGLALAE-I-HRRVLLVDADLRKPRLHEIF
A0A7C2RGE3      LS-HAEHPP-RTILFTSSGPGEGKTTTAVNTAISLAQ-M-GARVLLIDGDMRKPGLHKAL
A0A3N5PCI5      AS-AGGGTTGRSLLVTSAAPGDGKSIVAVNLAVALGR-S-GGRVLVIDADLRRPVLHQVL
A0A3M1Q0S9      LA-MPDHPP-RTLAVTSCQPGEGKTTTAINLATTLAQ-L-GRRVLVVDTDLRRPRCHQIL
A0A2Z5G448      LS-SADNEA-RLILITSSLEAEGKSTIAANLAISFAR-R-DARVLLVDTDLRRGTLHLKF
A0A3M1VZ38      LA-TPGHPP-RDLTVTSCQPGEGKTTTAVNLAIALAQ-L-GRQVLLVDSDLRRPRCHDVL
A0A4Q1SD29      LS-AVDNEM-KLLLITSSFAAEGKSTCAANIAISFAQ-R-SARVLVVDTDLRKGTLHMKF
A0A6N9FGE2      FS-SADEGS-RAVLVTSAAPSEGKSCISANLAIALAQ-L-GRKTLLVDADLRRPHQHLAF
A0A3M1PY35      LS-HPGGPP-RVLMVTSALPGEGKSTFSANLARTLAA-F-GDRVVLLDADLRHPRLHRAF
A0A3M1VMP2      LA-QPQHPP-RSLLVTSALPGEGKSTIAANLARTLGA-F-GRKVVLIDADLRHPRLHRVF
                                      **:      .            :.:* * *        

A0A2V7VMF7      E-I-S-RA---PGFTDYFVRHE----DLDSLIQS--TRVPNLFALTAG-PLPPNPPAMLA
A0A2V7YYV7      ARI---RN---VGLSNLILQDA----AESEAIAT-VESVPNLCVLTSG-PTPPNPSELLG
A0A2V7Z0J5      ARV---RN---IGLSNVIIQDA----AEEETITA-VDAVPNLWLLTSG-SIPPNPSELLG
A0A2V7Z3M4      GRV---RN---VGLSNVILGAT----TEEATVIA-VDSVPNLWLLTSG-PTPPNPSELLG
A0A399Y5V2      E-L-R-NT---EGVTTAILAERPLVDL-LQRPRI-AGAPPSLLALTSG-PIPPNPADLLG
Q01X01          D-Q-A-NS---WGLSDLLREKNAIEDLPLDVLVK-KTAVPRLSLLPSG-TGTDNIFGLLC
A0A3M2D9H8      R-L-P-NR---LGLSDILREHS----TLDESLHH--LTTEGIDVLTSG-TLPPNPAEVLS
A0A2V8JK38      K-C-A-NA---NGLSSVLEGHC----SLENAVSE--TNIKNLFLLPSG-PVRPNPGELIL
A0A2V9IXG5      S-TGKQNG---NSIFSPVEGLK---------LRVEQTQLPSLHLTVAE-SLPQNPPYLLS
A0A2V9J2P4      S-TGKQNG---NSIFSPVEGLK---------LRVEQTQLPSLHLTVAE-SLPQNPPYLLS
A0A1Q7RLS4      N-L-G-RD---GGVTNYILSSE---GDDWRSYIK-NTDMPNLYAMTCG-PIPPNPADVFG
A0A2V2R525      Q-L-D-NS---HGLSTLLAGKN-NQAEMLSLIHQ--HEETGLYVLPAG-PPPIKPAELLS
A0A321LPW6      K-L-P-NT---AGLSTYLSREI-DVEALIHTQ-----ELKNLSLLPCG-PIPPNPAELLS
A0A2V9R9V4      G-T-S-RT---LGLSTYLVRNV-EIDELTQDL-----PGENLRMISSG-PIPPNPAELLS
A0A321LE75      G-I-D-HS---HGLSNYLSRDV-AIDGLIQKL-----PIPNLSILTCG-PIPPNPAELIS
A0A2V8R8U7      N-L-S-NT---RGLTNCLSGES-EVADLLQTY----DKLPKLKLLTSG-PIPPNPAELLG
A0A2V8QMP4      G-L-P-NS---RGVTNYLSGEA-QVSELVQTY----DKLPNLKVITSG-PVPPNAAELLG
A0A2V8R4S3      G-L-P-NS---RGVTNYLSGEA-QVSELVQTY----DKLPNLKVITSG-PVPPNAAELLG
A0A2V8NJ55      N-I-S-NV---KGLTNCLSGDL-NTDELIQAY----EKLPNLKIMTSG-PVPPNPAELLG
A0A2V8Q7I0      E-I-S-NA---RGLTTWLSGEK-DLDGIIQTC----PRVPHLKILTSG-PVPPNPAELLG
A0A2V8S6K4      N-L-P-NT---RGVTNYLSGEI-NVSELIQTY----DKQPNLKVITSG-PVPPNAAELLG
A0A317I2L9      E-V-S-NA---RGLTTWLSGEK-DLDGLLQSL----PRNPNLKILTSG-PVPPNPAELLG
A0A2V8LLF9      N-L-P-NS---RGLTNCLSGDGKDLDALLHVY----DKQPNLKLLTSG-PIPPNPAELLG
A0A352FRF4      N-I-S-NA---RGLTNCLSGEASEIDSVIQSY----AALPNLKLLPSG-PMPPNPAELLG
A0A2V8MKV0      N-I-S-NV---RGLTNFLSGEL-PLDEVIQPF----EKLPNLKLLPSG-PIPPNPAELLG
A0A2V8PYY8      N-I-S-NV---RGLTNHLSGEL-PLDEVIQPF----DKQPNLKLLPSG-PIPPNPAELLG
A0A1Q7YKQ8      N-I-P-NA---RGVTNYLSGEA-GLDELIRSY----DKLPNLKLMTSG-PVPPNPAELLG
A0A352F3R7      N-A-P-NN---KGLTNWLSGET-DIDNLMQTL----PAQPNLKFLTSG-PVPPNPAELLG
A0A0B6WXT1      N-L-A-NA---KGVANYLAGER-NLDALMQTY----APLPNLKIMTSG-PVPPSPAELLS
A0A3B9MEU8      G-A-P-NS---KGLTNWLSGET-DIDALIQTY----EQHANLKFLTSG-PVPPNPAELLG
A0A2V8MHG6      D-V-D-ND---KGLSGILASKM-TEGEMLGCVQQ--HEESSLYLLPSG-RLPPNPAELLG
A0A2V8P7N1      D-V-D-ND---KGLSGILASKM-SEAEMLNCVQQ--HEESSLYLLPSG-RLPPNPAELLG
A0A2V8M3M6      D-V-D-ND---KGLSGILASKM-SEAEMLNCVQQ--HEESSLYLLPSG-RLPPNPAELLG
A0A1Q7NJH5      N-V-D-ND---KGLSGILASKM-SEREMLGWVQQ--HEESSLYLLPSG-RLPPNPAELLG
A0A2V8PJY0      N-V-D-ND---KGLSGILASKM-SEREMLGWVQQ--HEESSLYLLPSG-RLPPNPAELLG
A0A1Q7Y6W9      E-T-E-NR---KGLSTYLSSDM-SDAELLDMIEQ--HGASGLHYLTSG-PVPPNPAELLG
A0A2V8NC68      G-L-K-NE---SGLSTILANKM-SEAEMLSLVEQ--HEESGLYMLSSG-PIPPNPAELLG
A0A399WK13      G-I-S-NA---DGLSTILSNDL-SEAEILNIITQ--DESSKLHLLTSG-PVPPNPAELIG
A0A352FLX4      N-L-S-ND---SGLSALLSREA-SEAEIISAIQH--DEASGLSVLTAG-PVPPNPAELVG
A0A2V8RTL7      N-V-S-NN---QGISTVLSSEL-STKEILDVINY--DERTKVSVMTSG-PIPPNPAELIG
A0A3E0PCJ6      N-L-G-NA---EGLSTVLSSDL-AEKEILNLVKK--DEASGLYLMPSG-PLPPNPAELVG
A0A3M1S4R8      N-I-S-NR---EGLSNLLSSEI-KRDKVLDSVYF--DMSSRLYLLPSG-PVPPNPAELIG
A0A7C2G442      N-I-S-NR---EGLSNLLSSEI-KRDKVLDSVYF--DMSSRLYLLPSG-PVPPNPAELIG
A0A1Q7YFI6      N-L-D-NA---RGLSTILSTDM-SAAEMLSLIEQ--QAGSGLYLLSSG-PVPPNPSELIG
A0A136KC10      G-I-G-NA---DGLSTILANEL-SEAEILNLITQ--DPSSKLHLLPSG-PIPPNPAELIG
A0A3M2D6Y5      N-V-Q-NR---EGLSNLLSSEI-KADKVLDKVQF--DSAAKLYILPSG-PVPPNPAELIG
A0A2V8SEX6      N-I-E-NG---DGLSTILSTEM-TEKEILKVVKQ--DEGTKLNLLTSG-PIPPNPAELIG
A0A7C5ZUU4      D-I-T-ND---EGLSTVLSSNL-SDREILDIIKY--DERTKLSILTSG-PIPPNPAELIG
A0A0B6WWQ6      G-L-K-NE---RGLSTLLSSEI-RNGDAFKCIH---DSARGVQVLTSG-PLAPHPAELLG
A0A3B9MK99      G-L-S-DR---AGLSSILSSDV-SEADMLEMVST--DEATGLRVLTSG-PIPPNPAELLG
A0A352EX26      G-F-S-ER---PGLSSILSSDV-SREDTLAMISK--DEVTGLHVLTSG-PIPPNPAELLG
A0A2V8MM59      D-L-A-EQ---TGLSSILSSAM-TEAEMLGSVHQ--DEASGLHVLSSG-PIPPNPAELLG
A0A2V8PFE8      D-L-P-ER---EGLSSILSSEI-KPEDMLHAIHR--DEATGLNVLASG-PIPPNPAELLG
A0A2V8PWS6      D-L-P-ER---EGLSSILSSET-KPEDMLHAIHR--DEATGLNVLASG-PIPPNPAELLG
A0A2V8LCT5      D-L-S-ER---EGLSSILSSEM-KPDQMLGAIVK--DPTTGLNVLTSG-PVPPNPAELLG
A0A352FTJ9      D-L-P-ER---DGLSSILTSEA-TPEDMLRSVAR--DESSGLFVMSSG-PVPPNPAELLG
A0A257VBK0      K-----APAGVRGLTNYLAERT---AQIEDFVVP--GPQPNLFVLYSG-PTPPNPPELFS
A0A2G6PYV5      N-L-P-NA---KGLVTSLVKGK----SPIDFIQS--TKIPHLFLLSSG-PLPPNPAELVA
A0A2V8F956      E-V-A-QE---PGLSNLLAGQA----KASESVRK--TAIPGLWVLTSG-RIPPNPAELLG
A0A1F2S1W5      G-V-P-SS---PGLSNLMVANA----TASEVIQE--SSTPGLWVLSAG-THPPNPSELLG
A0A1F2T595      S-R-R-VD---PGLSNLLVGNA----TASESIFE--SEIPGLWLMPAG-THPPNPAELIG
A0A2V8JQV5      H-A-E-NR---WGLIDILQGDIEIRDYPLDMLAR-QTEVPNVHLLTSG-TASRSVVHLLH
A0A2V9AC41      K-M-E-NT---AGLADVLAGQI----GMEEAIRP--TQAENLFLISAG-TIPPNPAELLG
A0A2V9MAM9      D-L-P-NT---WGFSNLLRGAD----ELPMDTIVKRTTVPNLYVLSSG-PGTEDIFSLLF
A0A348V070      N-V-D-YT---WGLTHFLSSIV----DASEIIRP--TAYTNLFVVPSG-VTPSDPLEVMF
A0A2V9M454      K-L-----RNQNGLAEILTGAC----EFDETLLEKVEGLDRLSLLPAG-PYPPNPAELLC
A0A2V9IVR7      G-M-----SNERGLSNILRGEQ----SVDEVLLQ-AHTLPNLWVLPAG-PVPSNPTDLLS
A0A2V9ILE2      G-M-----SNERGLSNILRGEQ----SVDEVLLQ-AHTLPNLWVLPAG-PVPSNPTDLLS
A0A2V9LGY4      G-M-----SNERGLSNILRGEQ----SVDEVLLQ-AHTLPNLWVLPAG-PVPSNPTDLLS
A0A2V9J4D6      G-I-----SNSKGLSGILTGAY----SVDEALQE-VKGQPGLWALPSG-PPPPNPAELLS
A0A2V9L9C5      G-I-----SNSKGLSGILTGAY----SVDEALQE-VKGQPGLWALPSG-PPPPNPAELLS
A0A2N9M9N1      G-MGN-GESEANGLSSYLAGGQ----GIDSALMS-FTALPNLSVLPSG-PVPANPAELVS
A0A2V9JEC4      S-L-----DGKKGLSTVLTGGH----QIEVALET-FQNLSTLSILCAG-PVPPNPSELVS
A0A2V9LPQ3      N-L-----PSTKGLSGVLTGRY----SLDEALRE-VEN-TSLSVLPAG-PTPPNPAEMLS
A0A2Z5G3A3      D-V-A-ME---GGLSSILSGSS-SEKDSSQYSAP-VTSLPNLKLLVAG-APPTEPTDLLS
A0A2V7UGP8      G-S-G-NG---HGLSSYLSGNA----ELDPIIQE--TEIPNLFLVSSG-PVPPNPSELLA
A0A239MKT6      N-L-Q-QG---RGLSDLLSLNL----ELDEVLQQ-HPNQDNLFIIEAG-TIPPMPAELLG
A0A3E0PCN7      D-L-S-NT---TGLSTLITADYLSDERIDNAIRK--EVDYCLDVLPSG-PRVPNPANLLG
A0A2V8IYW3      K-L-E-SP---CGVNEYVHSHG------AKPLEL-LPVAPRLFLLPAG-RPDSDPIGALT
G2LEI9          DSYGQ-ERTFQPGLSRYLSGQC----KIGEIFTP--SPIPYLTLITCG-QMPPNPAELLG
A0A317J121      D-L-A-DT---WGLTNILEEGS----AAPERFGL-LTTVPGLFVMPNG-PKSGSISKMLY
A0A2V7YW66      R-V-S-NR---HGLVNQLTATG----EE--AIFP--TEVPNLWITPSG-PIPPNPSELLS
A0A2V7Z0V0      R-V-S-NR---FGLVNQLTATA----ESETVFLP--TEVPNLWLTPSG-PIPPNPSELLS
A0A2V8GFD4      A-L-D-QE---AGLSNVLIGSA----KANDAVKK--TTVPKLWVLPAG-RVPPNPPELLG
A0A2V8HSS5      A-L-D-QE---AGLSNVLIGSA----KANDAVKK--TTVPKLWVLPAG-RVPPNPPELLG
A0A2V8KP55      K-C-A-NA---NGLSSVLEGHC----SLENAVSE--TNIKNLFLLPSG-PVRPNPGELIL
A0A399WNU1      N-I-D-NS---CGLSTLLTAEEVDQDLVDRAVTK--SSEPDLDILPSG-PRVPNPASLFA
A0A2V9JSI3      G-L-A-NG---KGLSSILTGAH----GLEEALQQ-LDALPGLWVLPGG-PRPPNPADLLS
A0A2V9WI32      G-L-R-NT---SGLSTLLTGGD----GSQNAILS--TEIPNLFVLTAG-PPPPQPAELLG
A0A2V8IVN9      G-M-T-QE---PGLSNLLVGTA----KASESVRR--SKTAGLWLLPAG-KIPPNPAELLG
A0A7C5Z4J3      N-T-N-GR---PGLSSILTGTA----ASEAALCQ-VKDLPNLRFLPAG-QQPPNPADLLA
A0A1F2TPT3      A-F-P-QE---PGLSNVLVSGA----KAGEVVRR--SAVANLWVLPAG-RCPPNPSELLG
A0A2V8JTQ2      R-L-S-GN---TGLGPLLRNTV----TFEEAVVS-WANVPNLFILPAG-PVFLPGDTELL
A0A2V8UZY0      R-L-S-CN---TGLGALLRKSV----TFDEAVIQ-RAEVPNLYILPAG-PVMLPDDTELL
A0A350UEK1      E-V-P-ND---AGLTDLLKPGD----GDWKKLIH-ESGAPGLWVLPAG-PGVAAPSHLLY
A0A350UIQ4      E-I-E-NE---AGLSDLLKPDC----GEWKKLIH-QTPVPNLSVMTAG-PGVAAASNMLF
A0A1H5Z7N3      G-L-N-GK---IGLSSVLTGSA----TLEQALQR-VPELPNLDVLVSG-PVPPFPTEMLS
A0A1G7JVV8      G-L-N-GR---VGLSTVLSGGA----TLEEAVKN-VPEVPNLDVLCSG-PVPPFPTEMLS
A0A1H4T6W9      G-L-N-GR---VGLSTVLSGGS----TLEDAVKN-VPEVPNLDVLCSG-PVPPFPTEMLS
I3ZEU5          G-L-N-GR---VGLSTVLSGGS----TLEEATKN-VAEIPNLDVLCSG-PVPPFPTEMLS
A0A7L5A6M5      G-L-A-GK---LGLSTILSGSS----TLENSVQN-VPEVPNLDVLASG-PVPPFPTEMLS
A0A428MDU2      G-L-N-GK---VGLTTLLTGAS----KLKDTVQN-IPNVPNLDILPSG-PVPPFPSEMLS
A0A5B9EBI2      G-L-N-GK---VGLSTVLSGST----SLEEAVQQ-VADVPNLDILASG-PVPPFPTEMLS
A0A239HDF6      G-L-E-GR---LGLSTYLSGSS----TLEESLQH-LDELPSLDILTSG-PVPPFPTELVS
A0A4Q0T270      G-L-S-GK---VGLSTVLSGGS----TLEDSLQH-VTEVPNLDILASG-PVPPFPTEMLS
A0A1Q3QQB6      G-M-S-GK---TGVTTVLTGAA----PLEEAVQT-VPEVPNLDILPAG-PMPPFPTEMLG
A0A3N1K1G7      G-L-N-GK---VGLTTVLTGAT----TLEDTVQH-IPDAPNLDILPSG-PVPPFPTEMLS
A0A4V2G466      G-L-T-SK---IGLSTLLAGAT----TLEAAIQK-IPEVPNLDVLVSG-PMPPFPTEMLS
A0A6B9YNQ8      G-L-S-AR---VGLSSVLTGST----PLEQAVQQ-ISSVPNLDVLVSG-PMPPFPTELLS
A0A7G8BSK5      G-L-N-SK---VGLSTVLTGTT----TLEKAVQA-IPEIPNLDVLVSG-PMPPFPTEMLS
A0A1I6MH75      G-L-S-GK---VGLSTLLTGTT----GLEESLQR-VPEVPNLDIMASG-PVPPFPTEMLS
E8WVF6          G-L-N-GK---LGLSTILSGQT----TLENSVQT-LKEVPTLDILASG-PVPPFPTEMLS
A0A3N5YNR8      G-Y-N-GN---QGISAYLSGNG----DLSSQIRQ--TNYPNLFLLPAG-FRPPNPAELIG
A0A3N6A5T6      G-L-N-GH---QGMSYFLTGNS----DLTSQVRK--TSVPNLFVVSAG-YVPPNPAELIG
A0A1F2Q9L4      G-V-S-NR---LGLVNFLTGSA----DETGIFLR--TSVPNLYLTPTG-PVPPNPSELLS
A0A2U3KC61      G-F-Q-SR---GGLSTLISGSD----KVEDVVIP-CPEVPNLWVLPAG-PIPPQPAELLG
A0A2V9Y2R7      G-I-R-SG---GGVSTVISGVE----KFEDVVVP-FTQVPKLWILPAG-PIPPQPAELLS
A0A2V9NGH6      G-M-G-PR---TGLSSVLTGSA----NVQQTIVR-SALLPSLFILPAG-PPPPNPAELLS
A0A2V9PYE6      G-M-G-PR---TGLSSVLTGSA----NVQQTIVR-SALLPSLFILPAG-PPPPNPAELLS
A0A2V9NL07      G-M-G-PR---AGLSNVLTGGT----TLQQATVR-STLLPNLFILPAG-TPPPNPAELLA
A0A2V9QD92      G-M-G-PR---AGLSNVLTGGT----TLQQATVR-STLLPNLFILPAG-TPPPNPAELLA
A0A2V9WPZ6      G-M-G-PR---SGLSNILTGSA----TLQQAITR-SPLLPNLFVLPAG-TPPPNPAELLA
A0A2V9ZLH4      G-M-G-PR---SGLSNVLTGSA----DVQQTITR-SQVVPSLFVLPAG-TPPPNPAELLA
A0A2V9RQF1      G-M-G-PK---IGLSNVLTGNA----PLQQAIVR-SNVLPSLFVLPAG-PPPPNPAELVA
A0A2V9YDK8      G-M-G-PR---SGLSNVLTGSA----TLQQTITR-SPLVPSLFVLPSG-TPPPNPAELLA
A0A2V9V8F7      G-M-G-PR---SGLSNILTGSA----TLQQAITR-SPLLPNLFVLPAG-TPPPNPAELLA
A0A2V9XGR9      G-M-G-PR---SGLSNILTGSA----TLQQAITR-SPLLPNLFVLPAG-TPPPNPAELLA
A0A2V9V3Q5      G-M-G-PR---SGLSNVLTGNA----TLEQAISP-SPILPNLFILTAG-SPPPNPAELLA
A0A2V9NWS3      N-I-A-TK---IGLSNVLTGNA----TMSQATVR-STILPTLFVLPAG-PPPPNPAELLA
A0A2V9USA9      G-M-G-PR---SGLSNVLTGST----TLQQAITR-TPILPNLHVLPAG-TPPPNPAELLA
A0A2V9XW18      G-M-G-PH---SGLSNVLTGST----TLEQAISD-TTILPNLFVLPAG-TPPPNPAELLA
A0A1H5SQF5      G-L-T-NG---SGLSQCLTSDI----DPASVIQV-HPDMDKVHVMTSG-PVPPAPSELLG
A0A2V9AEW6      G-M-T-NR---WGLNDVLLSDTPFEEFPMSHLAR-KTEVAGLSVLPSG-NCGVTPTNLFY
A0A2V8WQK6      G-V-A-NT---WGLSDLLWADNPLETVPISHLVR-ETEVSSLSLLPGG-SCGITPSNLFY
A0A2V8XIF4      G-A-P-NN---WGLSDVLWGDTPLETLPISHLVR-ETEVAGLSLLPGG-SCGITPTNLFY
A0A2V2R0I6      N-L-S-NN-KYAGLSSYLAGAS----SLDLVTVP-HPAIPNLAAIPTG-PLPPNPADLLS
A0A2V8XAR9      N-L-G-SG-KYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTG-PLPPNPADLLS
A0A2V8VZA0      N-L-A-GG-KYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTG-PLPPNPADLLS
A0A1Q7CB82      N-L-A-GG-KYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTG-PLPPNPADLLS
A0A2V8WIU1      N-L-A-GG-KYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTG-PLPPNPADLLS
A0A1Q6Y9F5      N-L-A-AG-KYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTG-PLPPNPADLLS
A0A2V9EVV8      N-L-A-AG-KYAGLSSYLAGVS----SLDFVSVP-HPAIPNLVAIPTG-PLPPNPADLLS
A0A2V8YF91      N-L-G-PG-KYAGLSSYLAGAS----SLDLVSVP-HPSIPNLVAIPTG-PLPPNPADLLS
A0A2V8XZK2      N-L-G-TG-KYAGLSSYLAGVS----SLDLVSVP-HPAIPNLVAIPTG-PLPPNPADLLS
A0A2V8ZTX6      N-L-G-GG-KYAGLSSYLAGVS----SLDLVSIP-HPAIPNLVAIPTG-PLPPNPADLLS
A0A2V9BT79      N-L-G-AG-KYAGLSSYLAGVS----SLDLVSIP-HPAIPNLVAIPTG-PLPPNPADLLS
A0A2V9YHT3      G-I-R-S--NGGGLSTLLAGQH----SAEEVLVR-SNQLSNLYVLPAG-PPPPQPAELLS
A0A7C2XNI7      S-L-S-DGSRHAGLSTYLAGVS----SLDLVTIP-HPVIPNLAAIPSG-PIPPNPADLLS
A0A1Q8B793      S-L-G-EG-KYAGLSSYLAGVS----SLDLVTVP-HPAIENLAAIPTG-PLPPNPADLLS
A0A2V9BCA0      S-L-G-EG-KYAGLSSYLAGVS----SLDLVTVP-HPAIENLAAIPTG-PLPPNPADLLS
A0A2V9BWU9      S-M-S-DG-KYAGLSSYLAGVS----SLELVTVP-HPAITNLAAIPTG-PVPPNPADLLS
A0A2V9DKX2      S-M-S-DG-KYAGLSSYLAGVS----SLELVTVP-HPAITNLAAIPTG-PVPPNPADLLS
A0A7C2YQY3      N-I-S-ND---VGLSSFLAGVV----GIDDLPRA-VTHIPNLFVIPSG-PTPPNPAELLS
A0A3E0NV31      E-V-D-SE---NGMSKFLAGRA----EFADLLQQ--TKHKNLALVSAG-PCPPNPTELLG
A0A3N5M5V0      G-F-T-GN---QGISSYLSGNA----DLSSQIRQ--TSYPNLFLLPSG-FRPPNPAELIG
A0A3N5XQP8      E-I-E-NK---WGMSVYLSGHS----DLEQEIQP--TGVPNLSILPAG-LRPPNPAALLS
A0A2Z5G7H4      G-M-E-SR---TGLSQYLTDER----SPEDILEV--GRLPKLHLLTSG-PVPPYPADLLG
A0A2V9L5B5      G-V-K-NS---PGFVQCLTGHV----ELAEAVLP-APGVPNLSVIPCG-PIPPNPAEVLS
A0A2V9LK56      G-V-P-NR---PGFVQCLAGRV----ELKQAIFP-VPGTENLFVIPCG-PIPPNPAELLS
A0A2V9L7I0      G-V-R-NA---PGLVQCLTGKG----DLAQAVLP-VPGVANLNVIPCG-PIPPNPAEVLS
A0A522PPT0      G-V-R-NS---PGFVQCLTRRV----QLSEAILP-VNGIPNLSIIPCG-PVPPNPAEVLS
A0A7C5V1G5      G-V-K-NS---PGFVQCMTGRV----TLSQAILP-LSGVPNLYIIPCG-PIPPNPAELLS
A0A2V9KCS3      D-V-A-NT---WGLSDLLREKDAVDDYPFEALSR-KTLIPGLYVLPSG-PGTVSISNLLY
A0A372IT17      N-M-P-ES---PGLSEALAGSA-----APPEPQP-LTALPSLALLHAG-RKPPFPSELIA
A0A4R1LC91      N-V-S-DT---LGLSSVLAGQIDSYLDAGTTAPL--KQVPTLHVLPAG-PIPPYPTDLLA
A0A3M2BZG9      K-T-S-NR---LGVVNHLTGTE----RAEDLVLP--TAVPNLYLCPSG-PIPPNPSELLA
A0A1Q7N5R7      G-G-V-RK---PGLTDFLAGRV----PLEAVKQA--LPYPLLHFIGAG-SRLRESPELLG
A0A2V9QB26      G-L-P-NG---RGLSSLLRDPQRALAKLSRIVQE--TNIPGLFVLTSG-PLTESAADLLH
A0A2V9VYY4      G-V-R-AH---GGLSTLISGSS----NVEEVILP-SSEVPNLWILPAG-PIPPQPTELLG
A0A3E0PHB0      D-L-E-NT---HGLTNYLSGER----NTDNLLKP-YPKLPNLKVITSG-PIPPNPAELLS
A0A3M1SIV3      S-L-K-NS---VGLTNYLSGDQ----ELQDLLKS-PEGLPKLKIITSG-PLPPNPAELLG
A0A3M2D491      S-L-S-NK---TGLTNYLSGDQ----SLEGLLKP-IPELPNLKVITSG-PIPPNPAELLG
A0A353C9L6      D-L-E-NT---QGLTNYLSGER----NTQNLIKT-CRDLPRLKVITSG-PIPPNPAELLS
A0A2V8RQV0      D-L-D-NT---QGLTNYLSGER----NTENLIKS-SRELPRLKVITSG-PIPPNPTELLS
A0A2V8SJH5      D-L-E-NT---QGLTNYLSGER----NTEHLIKT-CRELPRLKVITSG-PIPPNPAELLS
A0A357F267      D-L-D-NT---HGLTNYLSGER----NTDNLIKS-CRDLPRLKVITSG-PIPPNPAELLS
A0A7C5ZUA8      G-F-E-NT---KGLTNYLSGDR----NTENLIKT-CRELPRLKVITSG-PIPPNPAELLS
A0A136JPP4      G-L-S-NS---QGLTNYLSGEK----STENLIKA-APGLPHLKIITSG-PIPPNPAELLS
A0A399WUJ8      G-L-S-NT---QGLTNYLSGEK----STENLIKA-APGLPHLKIITSG-PIPPNPAELLS
A0A2V9KIE8      G-V-E-NK---PGFVQCLTGRV----QISEAILP-VPGVANLWVIPCG-PIPPNPAEVLS
A0A352F549      D-M-S-ND---DGLSAILSSEV-SEADVLSKIRK--YQDSNVYLLSSG-AIPPNPAELLG
A0A3B9MLP9      G-L-S-NN---EGLSAILSSET-SEAEILAKINR--YLETDIYLLSSG-AIPPNPAELLG
A0A3D5SQ87      G-L-S-NN---EGLSAILSSET-SEAEILAKINR--YLETDIYLLSSG-AIPPNPAELLG
A0A2V8NW86      D-L-P-NG---HGLSSLLRDPQRAVAKLSRIVQE--TKIPGLFVLTSG-PLTKNAADLLH
A0A7C2GJ20      N-V-K-NH---PGLSAYLTRPL----DLEAVILH--QPAENLFVIPAG-AIPPNPSELLG
A0A7C4BTL5      D-V-D-NQ---RGLSTLLSERPLAEGALEGVIQQ--SLIPGLYVLPSG-PETAAAANLLH
A0A2V8ZHL8      D-L-I-DG---EGLAGFLTGAH----SIEAALIQ-FSPVPALRVLPAG-PKPPNPAQLLS
A0A2V9B240      D-L-V-DG---EGLAGYLTGAH----SIEAALRQ-FSPVPTLWVLPAG-PKPPNPAQLLS
A0A2V9CBM2      G-A-R-ES---SGLVSYLTDPQ----DWRTLVRH--SGSSGLDLLFCG-PVPPNPSELLS
A0A2V8XN17      G-I-D-RS---LGLVSYLTGQQ----DWRAVVHP--SGSRGLDLLLCG-PVPPNPSELLS
A0A2V8WX45      G-T-S-GS---LGLVSYLTGQQ----DWHAAVRP--CGSHGLDVLVCG-PVPPNPSELLS
A0A1Q6YR79      G-I-D-RT---LGLVSYLTGQQ----DWRAAVHP--SGSRGLDLLVSG-PVPPNPSELLS
A0A1Q7VA32      G-I-D-RT---LGLVSYLTGQQ----DWRAAVHP--SGSRGLDLLVSG-PVPPNPSELLS
A0A2V9EY85      G-I-D-RT---LGLVSYLTGQQ----DWRAAVHP--SGSRGLDLLVSG-PVPPNPSELLS
A0A2V9H8K0      G-T-S-GS---LGLVSYLTGQE----DWRAVVRP--SGSRGLDLLVCG-PVPPNPSELLS
A0A2V9FFE5      G-T-S-GS---LGLVSYLTGQQ----DWRAVVRP--SGSRGLDLLVCG-PVPPNPSEMLS
A0A2V9GM43      G-T-S-GS---LGLVSYLTGQQ----DWRAVVRP--SGSRGLDLLVCG-PVPPNPSEMLS
A0A2V9CYQ5      G-A-R-ES---SGLVSYLADHQ----DWRTLVRH--SGLSGLDLLFCG-PVPPNPSELLS
A0A2V9BWU8      C-I-R-ES---LGLVSYLTGQQ----DWRTAVCP--SASPGLDLLLCG-PVPPNPAELLS
A0A2V8ZG48      C-I-R-EN---LGLVSYLTGQE----DWRTAVCP--SGSPGLDLLPCG-PVPPNPAELLS
A0A2V8Y334      C-I-R-ET---LGLVSYLTGQQ----DWRAAVCP--SGSPGLDVLLCG-PVPPNPAELLS
A0A2V9AY68      C-I-R-EC---PGLVSCLTGQQ----DWHAAVCP--SGSPGLDLLLCG-PVPPNPAELLS
A0A1F2RFI7      E-LPA-TP---AGLSTYLTGQF----GLDDVVTP--TQIPNLFAIPCG-PIPPNPAELLS
A0A1F2RZS3      K-LPT-TP---AGLSTYLTGQF----PLEDVLVG--THVPNLYAVSCG-PVPPNPAELLS
A0A1F2USE2      Q-L-Y-ES---GGLSSYLTGQA----EWRRYALS--TGVPHLDLMACG-PIPPNPAELLS
A0A7C2VB08      G-L-G-RQ---QGLSGYLSGRV----EWMDVVQP--TGVPGLDALVCG-PVPPNPAELLS
A0A2V9C238      D-I-D-NS---LGLVSYLTGQQ----DWRAAVRP--TGLESLDALVCG-PVPPNPAELLS
A0A1F2Q9F5      K-M-A-GG---RGLVSYLTGQQ----EWEAVVHP--SPVENLDLVICG-PIPPNPAELLS
A0A1F2QQH9      K-M-A-GG---RGLVSYLTGQQ----EWEAVVHP--SPVENLDLVICG-PIPPNPAELLS
A0A1F2QXK7      K-M-A-GG---RGLVSYLTGQQ----EWEAVVHP--SPVENLDLVICG-PIPPNPAELLS
A0A2V9DEM9      D-I-D-NS---LGLVSYLTGQQ----DWRAAVRP--TGLESLDALVCG-PVPPNPAELLS
A0A7C5TWV7      G-V-K-NV---RGLTSIVLGERGIR----DVIHT-VADQPNLDIITSG-PLPPNPPEVFG
A0A2V7XDY0      G-L-T-RE---PGVTNFFVNHE-----DLDALVR-PTRVPNLFALTTG-PLPPNPPAILT
A0A2V8G155      G-G-P-QE---PGLSNVIVGETKL-----ADAVR-RTPIPSLWLLAAG-KTPPNPAELLG
A0A2V8HDM7      G-G-P-QE---PGLSNVIVGETKL-----ADAVR-RTPIPSLWLLAAG-KTPPNPAELLG
A0A2V8DRT9      A-E-R-QE---PGLSNILVGDTKT-----GDAVR-PTSCSTLWILPAG-HLPPNPAELLG
A0A2V7VYF3      S-H-P-QE---PGLSNFIVGNSEV-----GDVVR-PSGVPELWLLPSG-LIPPNPAELLG
A0A1F2SVH2      D-R-S-QG---PGLSNVLVGNAKA-----SEAVH-KTAVPGLWVMPAG-PHPPNPAELLG
A0A2V8AJG9      G-Q-T-QE---PGLSNVLVGNAKA-----SEAIR-GTAVSGLWTMTAG-MLPPNPSELLG
A0A2N9LQU7      G-LEAGTS---AGLSSMISGNDASE----AVRKP-FPQLPTLEVIAAG-PQTPWPAELLA
A0A2P6WFK7      G-LPY-SR---YGTSTVLTRGMDER----AIVTP-LKSLPSLKLMPAG-PHPPNPAELLG
A0A2V8U914      G-L-A-NS---WGLSDILRERNATEDLPLDALVK-KTGVPRLYLLPSG-PCTDSIFSLLY
A0A2V7W309      P-G-K-LN---LGIVNYLAANIPF-----EDTVQ-PTQVPNLSVVLSG-PIPPNPSELLA
A0A2W0BGU4      G-I-Q-NE---RGMSTHLTGHDSIN----DVIQP-YKEQPNLWLIPSG-PIPPNPAELLC
A0A2W0BVQ9      G-I-Q-NE---RGMSTHLTGHDSID----DVIQQ-YGEQPNLWLIPSG-PIPPNPAELLC
A0A2V9MN96      G-L-K-TS---GGLSTLLSGVDTME----NVMVP-FPGLPFLQVLPAG-PIPPNPVELLG
A0A2V7V2Z1      R-G-R-KS---PGVSDLLVGQARPS----EAIQR-PAG-TTLSLLASG-TRAPSPADLMT
A0A2V7X2F7      R-G-R-RT---PGLSDVLVGKAKPS----EAIQV-FAG-GH-SLLPAG-TTVPSPADLVT
A0A2V7V2I1      G-L-K-KS---PGLSDILVGLADTA----ECVER-VKG-TNLSLLPSG-SHAPSPAELMS
A0A2V7U3M2      H-A-K-RS---PGLSDLLVGRARPS----EAIQR-PAG-TTLSLLAAG-TRAPSPADLMT
A0A2V7UHT0      R-G-K-KS---PGLSDLLVGKARPS----EAIQR-PSG-TTLSLLAAG-TRAPSPADLMT
A0A2Z5FVL3      N-S-S-LE---VGLSTILAGQLSVDAMG-QAFLQ-VEAVPGLDILLSG-PIPAYSAELLG
A0A2V9KBD6      Q-L-N-AT---AGLGALLKKSVAFE----EAVCS-FPNLPDLFILPAG-PVTQPEDTELL
A0A2W0AJ66      Q-L-T-ST---IGLTALLSNSAPFE----DAVIR-CAELPNLFILTAG-KVSLPEDTELL
A0A1Q7RBU1      G-LKT-TN---AGLGALLRKSTAFE----EAVMG-CTDVPNLFILPAG-PVNLPDDTELL
A0A2V9JPV9      G-L-S-TN---TGLGALLRKSTVFE----KAVSD-CAKIPNLFILPAG-PITLPDDTELL
A0A3P0X3W6      S-L-P-NE---EGLADVIMDGRSLA----DVLHT-IEGIENLHVVTAG-ASAMRA-AHLV
A0A2N9MK30      G-L-T-SE---TGLSAVLLHGLAWR----DCVMQ-APGVPNLDVLPAG-PTSRRA-SDLI
A0A3D1ASD2      D-M-P-MN---AGLSSVVLQSANWR----EVVVP-AENVAGLDVLPAG-PPSRRA-ADMV
A0A7C5AXI3      D-L-P-GS---TGLSNILVSDLPWQ----QAVIN-IPHIPDLDVLPAG-PPSRRA-ADLI
A0A7C6E4H7      G-L-N-GS---GGLSQVILQGERWQ----ALLVQ-PEHLPNLDVLPAG-SGGRRA-AHLV
A0A1F2TCR2      G-I-P-NS---VGLSHLLVGQV-----RVREAVQ-RTSEANLFVMTAG-RTPPNPSELLA
A0A350UQT3      G-I-P-LG---AGLSNVLNGET---GWR-DVLVR-PANNEYLEIITAG-PPSRRAADMIG
A0A7C3HRX0      G-V-S-IT---AGLSNVLQDEI---PWR-DAVLR-PAAAETLDLITAG-PPSRRAAGLLG
A0A1F2V330      G-L-K-PG---KGFSDLLRAPEDEIGKY-------VSKLGDLYIMPGG-SSLANPVSLLA
A0A662EE63      K-V-K-NM---RGLTSLVLGES---QLK-DVIHG-LADVPNLDMVTSG-PLPSNPPELFG
A0A2V8TLH7      K-L-S-KD---QGITNYILSTE---GDDWRTYLK-TTDQSNLYALTSG-PIPPNPADVFG
A0A1Q7ZJT1      N-L-G-RD---GGVTNYILSSE---GDDWRSYIK-NTDMPNLYAMTCG-PIPPNPADVFG
A0A2V8VC99      N-L-S-RD---HGVTNYILSSD---GDDWRNYIK-ASDLPNLYALTCG-PIPPNPADVFG
A0A348UZU3      N-L-K-NH---DGLSNYLTMGL-----ELKKLVK-TTMVPSLYFINSG-PIPPNPAELLG
Q01XL7          G-L-D-NC---PGLSDLLTSTESLEEADLAPYLS-PTKVDNLRVMTHGLAQVGTPATLFF
A0A2V8ERZ5      R-L-T-ND---RGLSQVLTGQA-----RVRDVIQ-RTVDPNLLAITAG-RSPLNPSELLS
A0A2V8GTX0      R-L-P-ND---RGLAELLSGKA-----RMREVVQ-RCGDPNLLVIPAG-HTPSNPSELLA
A0A2V8J0X9      G-L-R-NE---TGLSHLLVGQA-----RVREAVQ-RTSEPNLVVITAG-RTPPNPSELLS
A0A523DUV7      R-L-Y-RE---PGLADYCTRDL-----KLDVIIQ-STREPHLSAVTSG-KLPPNPPALIG
A0A1F2U158      R-L-T-ND---RGLSQILTGQA-----RVRDVIQ-RTVDPNLLAITAG-RTPANPSELLS
A0A2V8F6S9      R-S-T-NE---RGLSQVLIGQA-----RVRDVIQ-RTVDPNLLAITAG-KTPPNPSELLS
A0A7D8BEX2      G-L-R-RE---PGLTSVVSGAT---TFE-KAVQR-PAGADNLWVLTAG-AAPPNAAVVWG
A0A4Q1SCH5      G-V-S-NT---IGISDLLIDRG---TSK-DIAQP-IEELPNLHFLPAG-KSVAFPSETLA
A0A372IRG7      R-L-S-NR---TGLSTYLSRES---KEE-SFEYP-IPGLPNLAVMTRG-PIAPNPGEMLA
A0A2V8K4L4      D-L-K-ND---KGLSELLLSKHALKTSEVVGAVR-ESWIPGLHILTSG-PWAANASTLLY
A0A2V8NCZ3      D-M-K-ND---KGLSELLREKHSTKTSEVLEAAR-ETWIPGLHVLTSG-PWAANASTLLY
A0A4Q7YNP3      H-V-P-ND---VGLRNLLRGEIDLARATIGTFCK-ATRIPNLSVIPSG-SGSEEVVQLLH
E8UZE1          G-L-PKTE---KGLSNLLAVSQ--SPPLVEYLHP-AAVFPGLDFLPAG-PLPPSSSELLM
A0A2U3JZ71      E-V-P-ST---RGLSNVLTSGI---PWR-TVLVR-PDGHPNLDILPAG-PPSRRAADLVG
A0A2V8TTB0      Q-V-P-NS---VGLSNVLLQQI---SWR-DVVIR-MDDPKGLDVLPAG-PPTRRASDLIG
A0A1V6HR88      G-M-S-NR---AGLVSYLTGQV-----PPEQIVL-RTDIPNLYAIPAG-PSPPNPSELLS
A0A3E0P0A3      G-I-S-NR---VGLVNCLVHQT-----ELENVVQ-ATPVPNLWVLPSG-PLPPNPSELLS
A0A2V8EXP2      G-I-A-QE---PGLSNVLVGNA-----KPSDAVR-ITSVPGLWAMPAG-MIPPNPAELLG
A0A2W4RYA1      G-L-A-QE---PGLSNLLVGTA-----ESRECVH-ETPVEGLYVLPAG-HIPPNPAELLG
G8P0Y7          K-I-K-GH---VGLSNVLTGGA-----KVRDAIQ-STVQPNLFVLPAG-LVPPHPSELLS
A0A5M8T4U7      R-I-NDRS---FGLSSVLSHPE---ERR-MAPNP-VPELPQFHILPTG-MRPPNPAEMLS
A0A7L5A491      G-L-DRRK---KGLSDAIATKE---PLS-AIRQN-VDGYDNLHVVTAG-SSDPQLYNQVG
A0A7D8BF18      G-L-T-GN---VGLTSVLTGSA---TLK-EAIQS-LHDAPGLDVLVSG-PVPPFPTEMLS
A0A1E3Y9R6      D-R-S-QE---PGLSNVLVGEA-----SLADAAR-TTAVPNLTLLAAG-HIPPNPAELLS
A0A2W4TLP2      D-R-S-QE---PGLSNVLVGEA-----ALADALR-PTSVPNLTLLAAG-HIPPNPVELLC
A0A7G8BDY8      N-I-P-QN---FGLSGSLAGAG---IWR-DAVAN-LPEAPHLDILQSG-LRPPNSADLLG
A0A7C4BZ42      D-L-A-ND---EGLSTLLQAKDPLKGRSLPASVR-QTEVPGLFLLTSG-PPSGNASNLMY
A0A3R9WF43      G-C-E-NS---PGLGDVSAADT--HIEV-SNLIQ-HSSIKTLYILPAG-NRPDLPSEFFS
A0A317HKM4      G-E-E-QQ---PGLADVLAGKT-----T-SRDFR-QTKISRLWLLPAG-TASRHPADLLG
A0A2V9CG11      G-L-C-NN---RGLSSILSVND--IVHI-KQLLC-ETAISGLYVLPAG-SSTTNTTRLLH
A0A523E0N1      R-Y-R-NR---VGLSNVLTGQK---SLK-DGCIM-RTEIPNLYLMMSG-PKSPNPGELLA
A0A4R1LAZ7      R-R-S-NR---VGLSTLLSRES---GAE-AYEQP-LADLPNLTVVSRG-PVAPNPGEMLG
A0A7G8BMP1      K-T-S-NR---VGLSTLLSRES---GNE-VYEQP-LPDLPNLTVVTRG-PIAPNPGEMLA
A0A523ECP2      R-F-K-NR---VGLSSVLSGQT---SIE-KGCVF-STLIPNLYVLLAG-PASPTPAELLG
A0A2W0C122      G-I-A-GT---PGLSDLLSGGA---GEE-CVIHK-IEGVANLSIVAAG-SSPAMTAEMLG
A0A2W0AUU7      R-I-A-ST---PGLSDLLSGSA---GEE-PVIQQ-IERVSGLSIVSAG-SSQARTAETLG
A0A2W0BQL1      R-I-A-ST---PGLSDLLSGSA---GEE-PVIQQ-IERVSGLSIVSAG-SSQARTAETLG
A0A4Q1SDL1      E-F-S-GK---DGLSLLLTEEE----QV-PHILT-VDGVPNLSLLPSG-PVPVNPSELLS
A0A3P0XH15      R-T-S-NR---FGLSTLLVREN---EES-SYENP-LPDLPNLTLVTRG-PVTVNPGEALA
A0A3M1WQW8      S-I-N-HQ---PGLSTYLTRGI---TID-SVIVP-N-RIDNLWIIPSG-PVPPNPSELLS
A0A3N1JHC1      G-V-Q-NI---EGLSNTLDEAE--CADP-NSLIQ-TTAFPGVSILTSG-TTKGNIVRLLH
C1F294          R-V-S-NR---VGLSTYLSRES---GEE-SIVFP-LPELPNLGVLPRG-PVAPNPGEMLA
A0A2V9KA79      D-I-R-PG---TCFDDLLVQPR-----L-AIEDC-LTTVRTLHVMLGRRSLANNPVQALA
A0A522PSP1      D-I-P-NR---LGLSSILQDQA---KVQ-EAVVP-G-QIDRLSILPAG-PLSANAREHI-
G8P085          G-V-E-NK---RGLSNLILGDD---TAE-PFTNP-LPDLDNLFLLTAG-KKVALPSEALG
A0A7C6A629      G-L-N-GS---SGLAEVVSQGE---RWQ-EAVVK-LEQMPNLDVLPAG--GPARRAAHLV
A0A4Q1SGQ1      G-M-P-AG---LGLRHALRSKS-----E-PAIQK-FPGLPSLSVLCGS-TAASMPAELLA
Q1ILD9          G-A-Q-EG---DGLTECLSGLR---RWT-DVVQD-ASGIAGLRILSAG-VRPPNPAELLS
A0A7G8BJH7      G-L-Q-VQ---NGLSEALSSDH----IH-PQSLP-SDKVPNLYVLCGG-TVPPFPAELLA
A0A7C5SHM3      K-A-D-KN---RGLTNVLASTL---PIE-DVVVP-T-VYPNLSLVPGG-PCPPDPATLLD
Q1IJZ6          M-K-E-ND---RGLSNLLTSVA---EPS-DFIQK-DSSAPNLDILCAG-PIPPNPAELLA
A0A2V8TCE6      G-L-R-NG---SGLSTFLCGKA---SLE-EAVQM-T-LVARLWLLASG-PVPPNPAELLD
A0A522TBE8      G-V-A-NQ---RGLSPVLRGTM---DLE-AALQP-S-RRDNLTLLTAG-PTVTNSAELL-
Q1ITG0          K-V-M-PE---GGLSECLAGRK---SWR-DLIIP-VNGVANMWVLPAG-HRPPSPADLFT
A0A7C2ML20      G-V-D-NE---AGLSTCLSFDE---KST-AIHHD-C-AVAGLDVLPSG-PIPPNPSELLS
A0A7C5AXS9      D-V-P-ND---YGLGDLLSGETPPEGRE-GAIVE-T-SHPGLFVAPAGKQAAGSAANLLY
A0A7C2RGE3      N-V-K-NY---PGLSAYLTRPL---DLE-TVIIH-Q-PAENLFVIPAG-AVPPNPSELLG
A0A3N5PCI5      E-C-E-QR---PGLAEVLTGKR---KPS-EAIVA-T-RSPGVWLLPSG-AGIASPSEQLG
A0A3M1Q0S9      K-A-S-TG---RGVSTYLTGMS---DLP-ALVQT-S-DLERVAVIPAG-PIPPNPAELLD
A0A2Z5G448      R-L-P-NR---EGLSTLLVRES---GSS-AYQSP-IDDLPNLFVLTRG-PIAPNPGEILA
A0A3M1VZ38      G-V-E-KD---RGVSTFLTGLN---DLD-PLIQQ-T-RIDRLSLIAAG-PVPPNPADLLD
A0A4Q1SD29      R-M-S-NR---VGLSTLLSRES---GNE-SFEHP-IPELPNLTVLSRG-PIAPNPGEILA
A0A6N9FGE2      E-L-D-RE---PGLSNLLVGDA---AET-AVVKA-T-FVPGLSLITAG-KTPPNPADLIG
A0A3M1PY35      K-A-P-RD---RGLANVLAGAT---GLD-DVLFE-T-RYDNLALVPGG-PCPPDPATLLD
A0A3M1VMP2      R-V-P-SE---RGLTNLLASHD---PAD-GFVVP-T-RYANLHLLPGG-PCPPDPATLLD
                                                                            

A0A2V7VMF7      RKNVADLFSHLRR--Q--FEWILVDSPPLASVTDALLLARHADLAVMVVQHNNVDKKLVK
A0A2V7YYV7      SGRMRELMARLRT--S--FSYVIVDTPPVNAVTDASILSASANGTILVVEHGQTSFPALE
A0A2V7Z0J5      SGRMRELIGHLLA--N--FNYVIIDTPPVNAVTDAAILAAYANGTILVVEQGRTTFPAVG
A0A2V7Z3M4      SGRMKDLMSRLSD--A--FVYVIIDTPPVNVVTDAAILSAQASGTVLVVEQGRTTFPVVN
A0A399Y5V2      SARVSELIETLGT--L--ADYVVIDSPPIVPLSDAAVLAPKTDGAIIVAKAGQSSRRASA
Q01X01          SGRMARLLPRFRQ--E--FDYVIVDAPPCLEFADARIISRYTERLLLVVRADYTDRKTAQ
A0A3M2D9H8      SERMATLLSEVAT--R--YDKVILDGPPFL-ISDAIVLASRVDGVLLTLRARSTSQSVTL
A0A2V8JK38      SPRFKEVLKSLKK--D--FDLVILDSPPLSNVSDGRILASVSDTAILVVKAFSTSRYIAY
A0A2V9IXG5      QPSLRDFISYLSD--R--YDWVLIDTPPVTSVTDPVIIAALVDTILFVIKYNFVDKRIVR
A0A2V9J2P4      QPSLRDFISYLSD--R--YDWVLIDTPPVTSVTDPVIIAALVDTILFVIKYNFVDKRIVR
A0A1Q7RLS4      HERFLSLLKELRA--E--FDWVFIDSPPVVSLADSMILASLADMVAFVIRHNENDKELIR
A0A2V2R525      SGQMRRLLEITSP--S--FTHVVIDSTPVVSFTDSVLIANLVDGVILVVQGGKSPKEIVQ
A0A321LPW6      SQKMKDLLSAMSE--R--FDHVLIDSPPLINVTDPIILSTIVDGVILVVHGGRSTRDVAR
A0A2V9R9V4      SERMKRLLAQLSE--R--YDHIVLDSPPLASVTDAVILSTMVNGVILVVHGGRNSRQAVQ
A0A321LE75      SEKMKNMLAMLCE--R--YDHIVIDSPPLMHVTDPVILSTLVDGVILVVHGGKSTREVLK
A0A2V8R8U7      SEEMRKLLVSLSE--K--FTHIIVDSPPAISFTDSSILSTFVDGVILVVHGGRSSRAVVR
A0A2V8QMP4      SEEMRRLLYVLSE--N--FTHIVIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRAVVR
A0A2V8R4S3      SEEMRRLLYVLSE--N--FTHIVIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRAVVR
A0A2V8NJ55      SDEMRKLLNSVSE--R--FTHVIIDSPPSISFTDASILSTMVDGVMLVVHGGKSSRAVVR
A0A2V8Q7I0      SEEMRRLLGQLGE--R--YAHIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRAVVR
A0A2V8S6K4      SEQMRRLLQLLGE--Q--FTHIIIDSPPAISFTDASILSTMVDGVVLVVHGGRSSRAVVR
A0A317I2L9      SEEMRRLLGTLSE--R--FAHIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRAVVR
A0A2V8LLF9      SDEMRKLLILLSE--R--FTHIIVDSPPAISFTDASILSTFVDGVILVVHGGRSSRAVVR
A0A352FRF4      SEEMRNLLLSLRE--K--FTHVIVDSPPAISFTDASILSTFVDGVILVVHGGRSSRAVVR
A0A2V8MKV0      SEQMRRLLTLLGE--K--FAHIIVDSPPAVSFTDASILSTFVDGVILVIHSGRSSRAVVR
A0A2V8PYY8      SEQMRQLLTSLGE--R--FAHIIVDSPPAVSFTDASILSTFVDGVILVIHSGRSSRAVVR
A0A1Q7YKQ8      SDEMRKLLSELSE--R--FTHVIIDSPPAISFTDASILSTLVDGVILVVHGGKSSRAVIR
A0A352F3R7      SDEMRKLLGILSE--R--FSHIVLDSPPAISFTDASILSTMVDGVVLVVHGGKSSRAVVR
A0A0B6WXT1      SEEMRRLIDEASA--R--FAHVIIDSPPAVSFTDAAILSTMVDGVVLVVHGGHSSRAIVR
A0A3B9MEU8      SDEMRKLLGILSE--R--FTHIVIDSPPAISFTDASILSTMVDGVVLVVHGGRSSRAVVR
A0A2V8MHG6      SDQIRSLMSVLEN--T--FTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVR
A0A2V8P7N1      SDQIRSLMSVLEN--T--FTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVR
A0A2V8M3M6      SDQIRSLMSVLEN--T--FTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVR
A0A1Q7NJH5      SDQIRTLMSVLGN--T--FTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVR
A0A2V8PJY0      SDQIRTLMSVLEN--T--FTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVR
A0A1Q7Y6W9      SEQMRKLLSCIEK--T--FTHVIIDSPPIASFTDGVLISTIVDGVLLVVHGGKSSRHVVR
A0A2V8NC68      SDQMRRLIAALEN--T--FTHVIIDSPPVASFTDGVLLSSIADGVLLVVHGGRASRAVVR
A0A399WK13      SDQMAKLLKMLQG--H--FTHVVVDSPPIASFTDGVLIASMVDGVVLVVNSGKSSRQVVR
A0A352FLX4      SEQMLKLLSVVAD--N--FAHIVVDSPPIAAFTDGVLIAAIVDAVLLVVHSGKSSRKIVG
A0A2V8RTL7      SEQMVGLLKTLQS--E--FTHVVIDSPPITSFTDGVLLASLVDGVILVVHSGKSSRQVVR
A0A3E0PCJ6      SEQMKRLLVTLEK--N--FTHLVIDSPPIASFTDGVLMASLVDGVIMVVHSGKSSRSVVR
A0A3M1S4R8      STQMSTLMEIFQK--E--FTHVIIDSPPIASFTDGVLIAAMVDGVIMVVHSAKTSRQIVR
A0A7C2G442      SAQMSTLMEIFQK--E--FTHVIIDSPPIASFTDGVLIAAMVDGVIMVVHSAKTSRQIVR
A0A1Q7YFI6      SEQMQRLLATMRT--S--FTHIVIDSPPIASFTDGVLMSTMVDGVLLVVQGGKSSRIVVQ
A0A136KC10      SEQMAKLLKTLEG--H--FTHVVVDSPPIASFTDGVLIASMVDGVILVVHSGKSSRQVVR
A0A3M2D6Y5      SKSMLNLMEILHN--E--FTHVVIDSPPIASFTDGVLIASMVDGVIMVVHSGKSSRHVVR
A0A2V8SEX6      SEQMANLLKLLSQ--N--FTHVVVDSPPITSFTDGVLIASMVDGVILVVHSGKSSRQVVR
A0A7C5ZUU4      SEQMTKILALFQN--H--FDHVVVDSPPITSFTDGVLIASMVDGVILVVHAGRSSRQIVR
A0A0B6WWQ6      SDQMRALLEELRA--R--FDYIIVDSPPIAYFTDGVVVATLVDGVMLVVRRGKSSRRIVR
A0A3B9MK99      SDQMRRLMATLQS--Q--FSHVVVDSPPVNSFTDGVLLSSMVDGVLLVVHGGKSSRHVVR
A0A352EX26      SEQMRRLMTLLQA--E--FTHVVVDSPPINSFTDGVLISSLVDGVLLVVHGGKSSRHVVK
A0A2V8MM59      SDQMRKLIAVLSA--Q--FTHIVIDSPPVSSFTDGVLIASMVDGVLLVVYGGKSSRGVVR
A0A2V8PFE8      SEQMRKLIAVLSG--A--FTHIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSRGVVR
A0A2V8PWS6      SEQMRKLIAVLSG--S--FTHIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSRGVVR
A0A2V8LCT5      SEQMRKLIAVLSI--P--FTHIVIDSPPVSSFTDGVLIASIVDGVLLVVHGGKSSRGVVR
A0A352FTJ9      SDQMRKLLATLSE--K--FTHVVIDSPPVNSFTDGVLLGSMVDGVLLVVHGGKSSRDVVR
A0A257VBK0      MKRFRDLIERFKG--E--YSWVIMDSPPCLSISDAFILGGMADRTILVARYKKTRKPLLE
A0A2G6PYV5      SQKMREVLTELKA--N--FDFIIIDTAPLLAVTDASILGNIVDSLIFVTKASATSRDEVA
A0A2V8F956      SQRFKDFLVSVKE--H--FDWVIVDTPPVMAVTDARLVAHHATGVLFVVGAEMTSWHAAK
A0A1F2S1W5      SKRFKEFAAFLMQ--Y--FDWVLLDTPPVMAVTDASIVANLSHGVLFVVGSEMTSRRVAQ
A0A1F2T595      SRRFRDFTAFLLQ--H--FDWIIVDTPPVMVVTDATIAANFAHGVLFVVGAEMVSRRVAQ
A0A2V8JQV5      STRLPELLQRLRK--D--YDLILIDAPPVLQMADARVLGRLADGVVFVIRSGRTTRDMAL
A0A2V9AC41      SRKMHELLQQLRE--Q--FEFIFIDSSPVMAVSDAVFLSTMVEGTLMVVNR-RTPKPLVR
A0A2V9MAM9      SPRLRRLIERFRE--E--FDHVIIDAPPSLEFADARLLGLTADGVLMVVRANHTDNKTVQ
A0A348V070      SEKMRAFITFLKQ--Q--FDFVLFDSPPVLAVSDALVLGKQVDGLILVVRAGQTPVNALK
A0A2V9M454      STKMENLIKHLRD--Q--YDHLVLDSPPVLPITDATILSSLVDGVIMVVECEATTRAALS
A0A2V9IVR7      SPDMARLVEELKQ--R--FEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVL
A0A2V9ILE2      SPDMARLVEELKQ--R--FEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVL
A0A2V9LGY4      SPDMARLVEELKQ--R--FEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVL
A0A2V9J4D6      SPEMQSVMQNLRQ--R--FDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSSGSTPPAVLI
A0A2V9L9C5      SPEMQSVMQNLRQ--R--FDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSSGSTPPAVLI
A0A2N9M9N1      SPAMGRLVSELRQ--R--FEHIVLDSPPLLLVTDGVLLSTLADGVVLVVESGSTSRGALH
A0A2V9JEC4      SATMEQVIGELRR--R--FDHIVIDSPPALVFTDATILSALVDAVVLVVESDVTTRAALR
A0A2V9LPQ3      SPAMRQLITELVE--R--FKHVVIDSPPLLMVTDATILSTMVDGTVLVAESGVTSPGALA
A0A2Z5G3A3      STRMLEALAAWRR--E--YSFVIIDAAPVLSATDSVILSGLVDTTLLLGRYKYTDRQLLA
A0A2V7UGP8      SEHFDFLLAALKSSAR--FDHVLIDSPPLLSVADPVIMASKAGATILVVQCGRTSRPAVI
A0A239MKT6      SKRFLAILEKARK--E--FDYVLIDGPPVLLVTDPLLIAPHADAIVAVFRSGRSTKQVVR
A0A3E0PCN7      SIEMRSLLDRLGA--R--YSHIIIDSPPILYFADSVILAANVEAVVIVSRANFSSYEVHS
A0A2V8IYW3      SETMQRIVKEGRE--Q--FDWVLIDTPPIGLLPDAGLLGGIADGALLVVRAGHSPFDLIK
G2LEI9          SQRMRSLLAYAVE--K--FDYVILDTPPMLSFADATILAAMADSVILVVNCQRSKREIVK
A0A317J121      GSEIRRFFQMVRE--K--YDIVLIDAPPILEVADGRLLAEFADGVLLVLRSGVTDRVAAL
A0A2V7YW66      SDRMRDWLRTMRS--R--FDFVVLDTPPALAVTDATIVGLLVDGVVLTLRSGKVTREEAR
A0A2V7Z0V0      SDRMRDWLKAVRA--R--FDFVVLDTPPALAVTDATIVGMLADGVVLTLRSGKVTREEAR
A0A2V8GFD4      SPRFAELMAAFRE--N--FDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGADLVTRGAAK
A0A2V8HSS5      SPRFAELMAAFRE--N--FDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGADLVTRGAAK
A0A2V8KP55      SPRFKEVLKSLKK--D--FDLVILDSPPLSNVSDGRILASVSDTAILVVKAFSTSRYIAY
A0A399WNU1      STHMKGLIERLSA--T--YSYIVIDSPPILYFADSVILSTQVDAVVAVARVNFSSRDVLT
A0A2V9JSI3      SVSMKEVLAELRG--R--FDHVVIDSPPVLLVTDATILTPLVDGIMLVVESGMTVRGAIQ
A0A2V9WI32      SILMKDYLCRLRK--E--FDHIVIDTPPALSVTDAVLLSVEADSVLVVVRSGQTTKAALR
A0A2V8IVN9      SQRFRELLASLKD--H--FDWVIVDSPPVMAVIDAAVVAHRATGVVFIIGAEMTSRHTAK
A0A7C5Z4J3      SSSMKELMTTLRE--R--FDHVVVDTPPVLMVTDATVLSSFVDGVILVTESHVTSRAALA
A0A1F2TPT3      SYQFRKFLAALGQ--H--FDWIVIDTPPVMAVTDACVVGHAVTGTLFVVGADMVSRRTAR
A0A2V8JTQ2      MWSFQDWVKRWRE--Q--FDHIIIDTPPVLSVADAVRISVEADSVILVIRSGQTARDAFL
A0A2V8UZY0      VSGFKDLVDHWRD--Q--FDHIIIDTPPVLAMTDAVRMSVEADSVILVIRSGQIARDTFL
A0A350UEK1      SKKLRAALEWFRE--E--FDMVVIDTPPMLQIPDARLFGKLVDGVVLVVRANSTTRDAAL
A0A350UIQ4      SKRLLSALEWCRS--E--FDMVVIDTPPVLQIPDARLFAKVADGVVLVVRANSTTRDAAM
A0A1H5Z7N3      SQVMRNLVEQCRG--I--YTHIVIDSPPLLSVTDSIVLAPEVDTVVLVVRHGKSGKQAVR
A0A1G7JVV8      SESMKNLLQECGE--L--YTHVVIDSPPILSVTDAVILAHYADAIVMVVRHGKSSRNVVR
A0A1H4T6W9      SEAMHDLLLYCCS--I--YTHIVIDTPPILSVTDGVILARQADAIVLVVRHGKSSRNAVR
I3ZEU5          SEAMHDLLLHCCT--L--YTH