BYKdb

Dataset for cluster tadcd of phylum acidobacteria

[Download (right click)] [Edit] [Sequences] [Repertoires]

287 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A2V7VMF7      MDVGQPAGFPGYDMDTFRTGVGYEVGPSMRASMGYERQRVPGAPDRPVIEAEADSVFLKV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      TDDRGPAGSGQVEVAYRDQRSPRAAAAGQRFRGLNYAATLRRAVGVNTLVELGGGRATDV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      SGFEANAFYVSSFARGGLTVALPWELSLHAGRGGLGLEPLPTGRERDRAPARRRPLWLVR
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      GSEPVVRPPPLPARGLPARPARLQHPRLRSRDPRIHRPARDRPVPRQGHRGEGHAVKSLA
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LLLAALVLPGARMVAQEAPRPPATPAPEYVVGPGDILQITVYGNEELSRAPTVQSNGTIG
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LPLLGDVAVTGLSASEIQRKLTALLARDFLVNPQVEVKVKEYQSQFVSVVGEVNNPGRKA
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      -----MEAPNSIQATVPLTATAGPISVTTPAGTGTSSAPFKSATRFENTDPALTYTSGWD
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      LRGRTRLFDVLIEAGGFTPRASGEVVITRREGTFDNGGHSLRLQFSGASPAPKDLVNLEV
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      RTSTLRPWSVGTAAVASTAGQQVTFTFSGTDLTWIGFRGPQAGIARVSLDGVFIQQLDMY
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ------------------------------------------------------------
A0A2V9R9V4      ------------------------------------------------------------
A0A321LE75      ------------------------------------------------------------
A0A2V8R8U7      ------------------------------------------------------------
A0A2V8QMP4      ------------------------------------------------------------
A0A2V8R4S3      ------------------------------------------------------------
A0A2V8NJ55      ------------------------------------------------------------
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ------------------------------------------------------------
A0A317I2L9      ------------------------------------------------------------
A0A2V8LLF9      ------------------------------------------------------------
A0A352FRF4      ------------------------------------------------------------
A0A2V8MKV0      ------------------------------------------------------------
A0A2V8PYY8      ------------------------------------------------------------
A0A1Q7YKQ8      ------------------------------------------------------------
A0A352F3R7      ------------------------------------------------------------
A0A0B6WXT1      ------------------------------------------------------------
A0A3B9MEU8      ------------------------------------------------------------
A0A2V8MHG6      ------------------------------------------------------------
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      ------------------------------------------------------------
A0A1Q7NJH5      ------------------------------------------------------------
A0A2V8PJY0      ------------------------------------------------------------
A0A1Q7Y6W9      ------------------------------------------------------------
A0A2V8NC68      ------------------------------------------------------------
A0A399WK13      ------------------------------------------------------------
A0A352FLX4      ------------------------------------------------------------
A0A2V8RTL7      ------------------------------------------------------------
A0A3E0PCJ6      ------------------------------------------------------------
A0A3M1S4R8      ------------------------------------------------------------
A0A1Q7YFI6      ------------------------------------------------------------
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ------------------------------------------------------------
A0A3M2D6Y5      ------------------------------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      ------------------------------------------------------------
A0A2V8MM59      ------------------------------------------------------------
A0A2V8PFE8      ------------------------------------------------------------
A0A2V8PWS6      ------------------------------------------------------------
A0A2V8LCT5      ------------------------------------------------------------
A0A352FTJ9      ------------------------------------------------------------
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------------
A0A1F2T595      ------------------------------------------------------------
A0A2V8JQV5      ------------------------------------------------------------
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ------------------------------------------------------------
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          ------------------------------------------------------------
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      ------------------------------------------------------------
A0A2V9BCA0      ------------------------------------------------------------
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ------------------------------------------------------------
A0A1F2TPT3      ------------------------------------------------------------
A0A2V8JTQ2      ------------------------------------------------------------
A0A2V8UZY0      ------------------------------------------------------------
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      ------------------------------------------------------------
A0A350UIQ4      ------------------------------------------------------------
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      ------------------------------------------------------------
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      ------------------------------------------------------------
A0A2V8XIF4      ------------------------------------------------------------
A0A3N5XQP8      ------------------------------------------------------------
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      ------------------------------------------------------------
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      ------------------------------------------------------------
A0A2U3KC61      ------------------------------------------------------------
A0A2V9Y2R7      ------------------------------------------------------------
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ------------------------------------------------------------
A0A399WUJ8      ------------------------------------------------------------
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      ------------------------------------------------------------
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------------------------
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      ------------------------------------------------------------
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ------------------------------------------------------------
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ------------------------------------------------------------
A0A3E0PHB0      ------------------------------------------------------------
A0A3M2D491      ------------------------------------------------------------
A0A357F267      ------------------------------------------------------------
A0A353C9L6      ------------------------------------------------------------
A0A2V8RQV0      ------------------------------------------------------------
A0A2V8SJH5      ------------------------------------------------------------
A0A2V9QB26      ------------------------------------------------------------
A0A2V9VYY4      ------------------------------------------------------------
A0A2V9KIE8      ------------------------------------------------------------
A0A352F549      ------------------------------------------------------------
A0A3B9MLP9      ------------------------------------------------------------
A0A3D5SQ87      ------------------------------------------------------------
A0A2V8NW86      ------------------------------------------------------------
A0A2V8ZHL8      ------------------------------------------------------------
A0A2V9B240      ------------------------------------------------------------
A0A2V9CBM2      ------------------------------------------------------------
A0A2V8XN17      ------------------------------------------------------------
A0A2V8WX45      ------------------------------------------------------------
A0A1Q6YR79      ------------------------------------------------------------
A0A1Q7VA32      ------------------------------------------------------------
A0A2V9EY85      ------------------------------------------------------------
A0A2V9H8K0      ------------------------------------------------------------
A0A2V9FFE5      ------------------------------------------------------------
A0A2V9GM43      ------------------------------------------------------------
A0A1F2RFI7      ------------------------------------------------------------
A0A1F2RZS3      ------------------------------------------------------------
A0A1F2USE2      ------------------------------------------------------------
A0A2V9C238      ------------------------------------------------------------
A0A1F2Q9F5      ------------------------------------------------------------
A0A1F2QQH9      ------------------------------------------------------------
A0A1F2QXK7      ------------------------------------------------------------
A0A2V9DEM9      ------------------------------------------------------------
A0A2V9CYQ5      ------------------------------------------------------------
A0A2V9BWU8      ------------------------------------------------------------
A0A2V8ZG48      ------------------------------------------------------------
A0A2V8Y334      ------------------------------------------------------------
A0A2V9AY68      ------------------------------------------------------------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      ------------------------------------------------------------
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ------------------------------------------------------------
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A2V8G155      ------------------------------------------------------------
A0A2V8HDM7      ------------------------------------------------------------
A0A2V8DRT9      ------------------------------------------------------------
A0A2V7VYF3      ------------------------------------------------------------
A0A1F2SVH2      ------------------------------------------------------------
A0A2V8AJG9      ------------------------------------------------------------
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      ------------------------------------------------------------
A0A2W0BVQ9      ------------------------------------------------------------
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      ------------------------------------------------------------
A0A1Q7RBU1      ------------------------------------------------------------
A0A2V9JPV9      ------------------------------------------------------------
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      PLQNGDLITASAKYYVTVEGEVVRPGRYPLEEETTISTAVIAAGGLTRFAKNDVRIRRVS
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      SVAEEVQAEVFKATGLASGNHTLLIEVTGTSNPASTGSYVAVDAFDIAPQVPATVNITSP
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      --------------------------------------------------------MAQE
A0A2V9R9V4      --------------------------------------------------------MSDQ
A0A321LE75      --------------------------------------------------------MSDE
A0A2V8R8U7      ---------------------------------------------------------MIQ
A0A2V8QMP4      ---------------------------------------------------------MMQ
A0A2V8R4S3      ---------------------------------------------------------MMQ
A0A2V8NJ55      --------------------------------------------------------MMSQ
A0A2V8Q7I0      ------------------------------------------------------------
A0A2V8S6K4      ---------------------------------------------------------MSQ
A0A317I2L9      --------------------------------------------------------MMSQ
A0A2V8LLF9      ---------------------------------------------------------MTH
A0A352FRF4      ---------------------------------------------------------MTQ
A0A2V8MKV0      ---------------------------------------------------------MTQ
A0A2V8PYY8      ---------------------------------------------------------MTQ
A0A1Q7YKQ8      --------------------------------------------------------MVSQ
A0A352F3R7      ---------------------------------------------------------MAQ
A0A0B6WXT1      ----------------------------------------------------------MQ
A0A3B9MEU8      --------------------------------------------------------MMSQ
A0A2V8MHG6      -----------------------------------------------------------M
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      -----------------------------------------------------------M
A0A1Q7NJH5      -----------------------------------------------------------M
A0A2V8PJY0      -----------------------------------------------------------M
A0A1Q7Y6W9      --------------------------------------------------------MKES
A0A2V8NC68      --------------------------------------------------------MKES
A0A399WK13      ----------------------------------------------------------MK
A0A352FLX4      -----------------------------------------------------------M
A0A2V8RTL7      ----------------------------------------------------------MK
A0A3E0PCJ6      ----------------------------------------------------------MR
A0A3M1S4R8      ----------------------------------------------------------MR
A0A1Q7YFI6      -----------------------------------------------------------M
A0A136KC10      ------------------------------------------------------------
A0A2V8SEX6      ----------------------------------------------------------MK
A0A3M2D6Y5      ----------------------------------------------------------MR
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      -----------------------------------------------------------M
A0A2V8MM59      -----------------------------------------------------------M
A0A2V8PFE8      -----------------------------------------------------------M
A0A2V8PWS6      -----------------------------------------------------------M
A0A2V8LCT5      -----------------------------------------------------------M
A0A352FTJ9      -----------------------------------------------------------M
A0A2G6PYV5      ------------------------------------------------------------
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      ------------------------------------------------------MSVPSQ
A0A1F2T595      -------------------------------------------MSTQIPPEFSQKAPASQ
A0A2V8JQV5      -----------------------------------------------------------M
A0A2V9AC41      ------------------------------------------------------------
A0A2V8K4L4      ------------------------------------------------------------
A0A2V8NCZ3      ------------------------------------------------------------
A0A2V9MAM9      ---------------------------------------------------------MLP
A0A2V9M454      ------------------------------------------------------------
A0A2V9IVR7      ------------------------------------------------------------
A0A2V9ILE2      ------------------------------------------------------------
A0A2V9LGY4      ------------------------------------------------------------
A0A2V9J4D6      ------------------------------------------------------------
A0A2V9L9C5      ------------------------------------------------------------
A0A2N9M9N1      ------------------------------------------------------------
A0A2V9JEC4      ------------------------------------------------------------
A0A2V9LPQ3      ------------------------------------------------------------
A0A348V070      ------------------------------------------------------------
A0A2Z5G3A3      ------------------------------------------------------------
A0A2V7UGP8      ------------------------------------------------------------
A0A239MKT6      ------------------------------------------------------------
A0A3E0PCN7      ------------------------------------------------------------
A0A2V8IYW3      ------------------------------------------------------------
G2LEI9          -----------------------------------------------------------M
A0A317J121      ------------------------------------------------------------
A0A2V7YW66      ------------------------------------------------------------
A0A2V7Z0V0      ------------------------------------------------------------
A0A2V8GFD4      ------------------------------------------------------------
A0A2V8HSS5      ------------------------------------------------------------
A0A2V8KP55      ------------------------------------------------------------
A0A399WNU1      ------------------------------------------------------------
A0A2V9CG11      ------------------------------------------------------------
A0A2V2R0I6      ------------------------------------------------------------
A0A2V8XAR9      ------------------------------------------------------------
A0A2V8VZA0      ------------------------------------------------------------
A0A1Q7CB82      ------------------------------------------------------------
A0A2V8WIU1      ------------------------------------------------------------
A0A1Q6Y9F5      ------------------------------------------------------------
A0A2V9EVV8      ------------------------------------------------------------
A0A2V8YF91      ------------------------------------------------------------
A0A2V8XZK2      ------------------------------------------------------------
A0A2V8ZTX6      ------------------------------------------------------------
A0A2V9BT79      ------------------------------------------------------------
A0A1Q8B793      -----------------------------------------------------------M
A0A2V9BCA0      -----------------------------------------------------------M
A0A2V9BWU9      ------------------------------------------------------------
A0A2V9DKX2      ------------------------------------------------------------
A0A2V9JSI3      ------------------------------------------------------------
A0A2V9WI32      ------------------------------------------------------------
A0A2V8IVN9      ----------------------------------------------------------MS
A0A1F2TPT3      ---------------------------------------------------------MSD
A0A2V8JTQ2      -------------------------------------MSESFELMNQRARDFDPVQLPRV
A0A2V8UZY0      -------------------------------------MSKYFELMNRLRRD-SPLAVSAC
A0A3N5YNR8      ------------------------------------------------------------
A0A350UEK1      -------------------------------------------------------MSQQS
A0A350UIQ4      -------------------------------------------------------MPKPT
A0A3N6A5T6      ------------------------------------------------------------
A0A1F2Q9L4      ------------------------------------------------------------
A0A1H5SQF5      -------------------------------------------------------MPYDP
A0A3E0NV31      ------------------------------------------------------------
A0A3N5M5V0      ------------------------------------------------------------
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      -----------------------------------------------------------M
A0A2V8XIF4      -----------------------------------------------------------M
A0A3N5XQP8      -----------------------------------------------------------M
A0A2Z5G7H4      ------------------------------------------------------------
A0A2V9L5B5      -------------------------------------------------------MNESI
A0A2V9LK56      ------------------------------------------------------------
A0A2V9L7I0      ------------------------------------------------------------
A0A522PPT0      ------------------------------------------------------------
A0A2V9KCS3      -MWRCIPTTFSSFRAAPARRPGGARWKRCWAWARASAQAPRSIAVNRDLFRVNHSRADST
A0A2U3KC61      -------------------------------------------------MPLQPKRNNSD
A0A2V9Y2R7      -------------------------------------------------MDSPIVVRSAD
A0A372IT17      ------------------------------------------------------------
A0A136JPP4      ---------------------------------------------------------MDQ
A0A399WUJ8      ---------------------------------------------------------MDQ
A0A2V9NGH6      ------------------------------------------------------------
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      -------------------------------------------------MYLLFQFSIQL
A0A2V9QD92      ------------------------------------------------------------
A0A2V9WPZ6      ------------------------------------------MACWSALLGRNRMQDCCS
A0A2V9ZLH4      ------------------------------------------------------------
A0A2V9RQF1      ------------------------------------------------------------
A0A2V9YDK8      ------------------------------------------------------------
A0A2V9V8F7      -------------MCSARMRQTFITNNFLSASEHPRRRLWSLWACWSALLGRNRMQDCCS
A0A2V9XGR9      ------------------------------------------------------------
A0A2V9V3Q5      ------------------------------------------------------------
A0A2V9NWS3      ----------------------------------------------------MVGLNFFL
A0A2V9USA9      ------------------------------------------------------------
A0A2V9XW18      ------------------------------------------------------------
A0A4R1LC91      ------------------------------------------------------------
A0A3M2BZG9      ------------------------------------------------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      ---------------------------------------------------------MEK
A0A3E0PHB0      ---------------------------------------------------------MES
A0A3M2D491      -------------------------------------------------------MNKER
A0A357F267      ---------------------------------------------------------MEQ
A0A353C9L6      -------------IDGLKYGRFGVIRSKNRENTADIWYKTRLRKFCRVGDVQGQESSMEQ
A0A2V8RQV0      ---------------------------------------------------------MEQ
A0A2V8SJH5      ---------------------------------------------------------MEQ
A0A2V9QB26      ------------------------------------------------------MTEPMD
A0A2V9VYY4      -------------------------------------------------MALQPTRNNSD
A0A2V9KIE8      -----------------------------------------------------------M
A0A352F549      ---------------------------------------------------MKEPSDLSK
A0A3B9MLP9      ---------------------------------------------------MKEPSDLAK
A0A3D5SQ87      ---------------------------------------------------MKEPSDLAK
A0A2V8NW86      ---------------------------------------------------MDKHELPPT
A0A2V8ZHL8      ---------------------------------------------------------MPP
A0A2V9B240      ---------------------------------------------------------MPH
A0A2V9CBM2      -------------------------------------------------------MGEQN
A0A2V8XN17      -------------------------------------------------------MDDQN
A0A2V8WX45      -------------------------------------------------------MEDQK
A0A1Q6YR79      -------------------------------------------------------MDDQN
A0A1Q7VA32      -------------------------------------------------------MDDQN
A0A2V9EY85      -------------------------------------------------------MDDQN
A0A2V9H8K0      -------------------------------------------------------MDDKN
A0A2V9FFE5      -------------------------------------------------------MDDRD
A0A2V9GM43      -------------------------------------------------------MDDRD
A0A1F2RFI7      -------------------------------------------------------MSEEM
A0A1F2RZS3      -------------------------------------------------------MEENN
A0A1F2USE2      ---------------------------------------------MGEEIPDSKREVPDG
A0A2V9C238      -------------------------------------------------------MDPEN
A0A1F2Q9F5      -------------------------------------------------------MSDEK
A0A1F2QQH9      -------------------------------------------------------MSDEK
A0A1F2QXK7      -------------------------------------------------------MSDEK
A0A2V9DEM9      -------------------------------------------------------MDPEN
A0A2V9CYQ5      -------------------------------------------------------MGEQN
A0A2V9BWU8      -------------------------------------------------------MSEPN
A0A2V8ZG48      -------------------------------------------------------MSEQN
A0A2V8Y334      -------------------------------------------------------MGEQQ
A0A2V9AY68      -------------------------------------------------------MSEQN
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      --------------------------------------------------------MVGD
A0A2V8TTB0      ------------------------------------------------------------
A0A1F2TCR2      ------------------------------------------------------------
A0A1F2V330      ------------------------------------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      ------------------------------------------------------------
Q01XL7          ------------------------------------------------------------
A0A2V8ERZ5      ------------------------------------------------------------
A0A2V8GTX0      ------------------------------------------------------------
A0A2V8J0X9      ------------------------------------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      ------------------------------------------------------------
A0A1F2U158      ------------------------------------------------------------
A0A2V8F6S9      ------------------------------------------------------------
A0A4Q1SCH5      ------------------------------------------------------------
A0A3D1ASD2      ------------------------------------------------------------
A0A2N9MK30      ------------------------------------------------------------
A0A4Q7YNP3      ------------------------------------------------------------
E8UZE1          ------------------------------------------------------------
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      ------------------------------------------------------------
A0A2V8EXP2      ---------------------------------------------------MSTQFRDST
A0A2W4RYA1      ------------------------------------------------------------
G8P0Y7          ------------------------------------------------------------
A0A5M8T4U7      ------------------------------------------------------------
A0A3P0X3W6      ------------------------------------------------------------
A0A1E3Y9R6      ------------------------------------------------------------
A0A2W4TLP2      ------------------------------------------------------------
A0A3R9WF43      ------------------------------------------------------------
A0A317HKM4      ------------------------------------------------------------
A0A523E0N1      ------------------------------------------------------------
A0A523ECP2      ------------------------------------------------------------
A0A2W0C122      ------------------------------------------------------------
A0A2W0AUU7      ------------------------------------------------------------
A0A2W0BQL1      ------------------------------------------------------------
A0A4Q1SDL1      ------------------------------------------------------------
A0A3P0XH15      ------------------------------------------------------------
A0A4R1LAZ7      ------------------------------------------------------------
A0A3M1WQW8      ------------------------------------------------------------
A0A3N1JHC1      ------------------------------------------------------------
C1F294          ------------------------------------------------------------
A0A2V9KA79      ------------------------------------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          ------------------------------------------------------------
A0A4Q1SGQ1      ------------------------------------------------------------
Q1ILD9          ------------------------------------------------------------
Q1IJZ6          ------------------------------------------------------------
A0A2V8TCE6      ------------------------------------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          ------------------------------------------------------------
A0A3N5PCI5      ------------------------------------------------------------
A0A3M1Q0S9      ------------------------------------------------------------
A0A2Z5G448      ------------------------------------------------------------
A0A3M1VZ38      ------------------------------------------------------------
A0A4Q1SD29      ------------------------------------------------------------
A0A3M1PY35      ------------------------------------------------------------
A0A3M1VMP2      ------------------------------------------------------------
A0A2V8G155      --------------------------------------------------MSDT------
A0A2V8HDM7      --------------------------------------------------MSDT------
A0A2V8DRT9      --------------------------------------------------MADQFQLDPG
A0A2V7VYF3      --------------------------------------------------MSKR------
A0A1F2SVH2      --------------------------------------------------MSEE------
A0A2V8AJG9      --------------------------------------------------MSEQFSSNPG
A0A2N9LQU7      ------------------------------------------------------------
A0A2P6WFK7      ------------------------------------------------------------
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------------------------
A0A2W0BGU4      -----------------------------------------------------------M
A0A2W0BVQ9      -----------------------------------------------------------M
A0A2V9MN96      ------------------------------------------------------------
A0A2V7V2Z1      -------------------------------------------------------MAYSF
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      ------------------------------------------------------------
A0A2W0AJ66      -----------------------------------------------------------M
A0A1Q7RBU1      -----------------------------------------------------------M
A0A2V9JPV9      --------------------------------------------------MSRYFNKDEE
A0A1I6MH75      ------------------------------------------------------------
E8WVF6          ------------------------------------------------------------
A0A1H5Z7N3      ------------------------------------------------------------
A0A2V9YHT3      ------------------------------------------------------------
A0A1G7JVV8      ------------------------------------------------------------
A0A1H4T6W9      ------------------------------------------------------------
I3ZEU5          ------------------------------------------------------------
A0A428MDU2      ------------------------------------------------------------
A0A5B9EBI2      ------------------------------------------------------------
A0A239HDF6      ------------------------------------------------------------
A0A4Q0T270      ------------------------------------------------------------
A0A1Q3QQB6      ------------------------------------------------------------
A0A3N1K1G7      ------------------------------------------------------------
A0A4V2G466      ------------------------------------------------------------
A0A6B9YNQ8      ------------------------------------------------------------
                                                                            

A0A2V7VMF7      PETGKTEILEADLKAIRNGKETDLLLXXXEDGDAPMSTAPPVFDPPSERELDLRY-----
A0A2V7YYV7      --------------------------------------------------MELGR-----
A0A2V7Z0J5      --------------------------------------------------MELNR-----
A0A2V7Z3M4      --------------------------------------------------MELNR-----
A0A399Y5V2      ------------------------------------------MTESHATTLELRD-----
Q01X01          -----------------------------------------------------ME-----
A0A3M2D9H8      --------------------------------------------------MLPRD-----
A0A2V8JK38      PSGSTVSGTDKAKTPGRRAGKDKLVRINHRKYPEIVENLPRNLATQEEDETHLLA-----
A0A2V9IXG5      --------------------------------------MQDLNVSESLPQLDIRY-----
A0A2V9J2P4      --------------------------------------MQDLNVSESLPQLDIRY-----
A0A1Q7RLS4      --------------------------------------------MEEKREIHLLD-----
A0A2V2R525      ------MKEDQITKHSSIHDLDSPYNVFPFPPVIQTGER------QDQSQASLAF-----
A0A321LPW6      RVELERVSTA----RVALDAAPPPR---YPALAGAAGTEYGLGYPEEYGRIHLLE-----
A0A2V9R9V4      KRYPDNLPPEVTFRQLPARQAHDSGAVIYPEIDLP---RYG----EAED-FHLRM-----
A0A321LE75      RTDIERIKPE----EMAFGRPGYPRAVGYPEAYATGSYGYG----EADDRINIRA-----
A0A2V8R8U7      DERL--V-------P-AGRGLDNSLADLTQAKPFGRYDRYN----SAPAETNVRE-----
A0A2V8QMP4      DNRL--L-------PLTPETLDRPLRDLAQPSP--VAV-------SSNEPVNLRD-----
A0A2V8R4S3      DNRL--L-------PLTPETLDRPLRDLAQPSP--VAV-------SSNEPVNLRD-----
A0A2V8NJ55      DNRL--L-------PLTSTSLDRPLSDLAQ-SK--KYYGV-----SATSETHLRD-----
A0A2V8Q7I0      ------M-------PAVDRGLEKPQTD----QI--RSYGP-----AANEPTQLRD-----
A0A2V8S6K4      DNRLLPL-------PTPAGNIDRPLRDLTQPAV--QVTGSY----SLPEPTHLRD-----
A0A317I2L9      DNRLMPM-------PAVERSLDKPLTDLN--AA--RSYGP-----AANEPTQLRD-----
A0A2V8LLF9      DEHLVPA-------RT-GRDFDSTLADLTQSKPYGKYARYG----TTQSETNVKE-----
A0A352FRF4      DERLVPA-------RP-ARDLDRTLAELTQSKGYGGRYG-G----GSPAEVNLKE-----
A0A2V8MKV0      DERLIPA-------RA-GRELDRSLADFATAKPYERY---G----AAGVETSLRD-----
A0A2V8PYY8      DERLIPA-------RA-GRELDRSLADFATAKPYDRY---G----ATAVETSLRD-----
A0A1Q7YKQ8      DNRLLPL-------PQ-ERGLDRPLSSLPHSKSYG-Y---G----AAAESTHLRD-----
A0A352F3R7      DNRLLPV-------SALDRSIDRPLADLVPAKPYG-----T----SGSEPTTLRD-----
A0A0B6WXT1      DNRLLPL-------SQTEQQLDRPLHDLTLGQP-------A----TFIEQAHLRE-----
A0A3B9MEU8      DNRLLPV-------SALDRSIDRPLADIAQAKPYG-----V----SGADTTTFRD-----
A0A2V8MHG6      KEPTELIEKSNGS-RDVGGVLERSLTPYTRYDSYEDES---------NGYSRLRD-----
A0A2V8P7N1      ------------------------------------------------------------
A0A2V8M3M6      KEPAELIEKSNGS-RDVGGVMERSLAPYTRYDSYADES---------NGYHRLRD-----
A0A1Q7NJH5      KEPTELIEKSNGS-RDVGGPWDRSLAPYTRYDSYADDS---------NGYSRLRD-----
A0A2V8PJY0      KEPTELIEKSNGS-RDVGGPWDRSLAPYTRYDSYADDS---------NGYSRLRD-----
A0A1Q7Y6W9      RELITRVKEANEL-EVAGETFSPSPSAYKGYDSAAEDE------------VHLLD-----
A0A2V8NC68      SRPTETTALVHGN-GNSGEPLM-QPSFRQDYRYMGEDSFQT----SGGGYARLRE-----
A0A399WK13      ETRNIITTTSPEP-VELQRPPDPAIPTTGR-YPGYSATPQG----EGFQ---LID-----
A0A352FLX4      NQSTNLSRTNTVPIGDEHIGLERTNGGHVLPGVMQGAYSYE----REERGSRLLD-----
A0A2V8RTL7      EIRELVPTKPNDTVVELERPFETHVIPGTGRYPAYRDVYGP----EGFQ---IVD-----
A0A3E0PCJ6      ESRDIVRNPRTES-AEVERPFEAVAPITNYGYARYRNEDLR----EHSP---LFE-----
A0A3M1S4R8      ESRELISTRSAGR-EELEPRWQ--SPSYYPSYKSFSEGSAK-----------IFE-----
A0A1Q7YFI6      EKETQLVKASVEP-RVVELQANGNGAGLPYGSYAYGSSEPQ----EESGFSRLQA-----
A0A136KC10      --------------MEMERPADPTIAATGR-YPGYPQTGQA----EGFQ---LID-----
A0A2V8SEX6      ETREIIQKPLNEP-VELERHFEPQIVPAGR-YPSYREN-VA----EGFQ---LLD-----
A0A3M2D6Y5      KTNELIVREAQEN-TEVEFRSQPFVSSGNY-YSAATRD-SA----GSLK---LRE-----
A0A0B6WWQ6      ----MMKGDPEKE-PQSLIRLDASAPYPKL-YADYDHRWER----EERTQQIVAG-----
A0A3B9MK99      ------------------------------------------------------------
A0A352EX26      NPSNELIRKEPAD-TAIGRPADSNGIPHSY-NYGVDPNA-E----SEVH---LLD-----
A0A2V8MM59      NEGTKLARVETEP-QDLDRRLDDHGP-RPY-AYGYGTNGFD----GEVN---LLD-----
A0A2V8PFE8      NQATKLVKREDEP-GEIDRRFDGSANYRGP-VYGYGPESSE----GEVH---LLD-----
A0A2V8PWS6      NQGTKLVKREDEP-GEMDRRFDDAANYRGG-VYGYGPEGSE----GEVH---LLD-----
A0A2V8LCT5      NEATKLVRRDDQP-REIDRRTGDTTSYRTA--YGYNMDAGE----NEVH---LLD-----
A0A352FTJ9      NEATKLVKQDE-S-RPVERRSDESQPYR-G--YGYGADAGD----GEVH---LLD-----
A0A2G6PYV5      --------------------------------------MQDNQPFDQQADFNIFH-----
A0A2V8F956      ------------------------------------------------------------
A0A1F2S1W5      FERKSPESSVLGLDAAPDAGLAPQPSAATGGSGYGYGYGYSGSMPSGDSELSFIH-----
A0A1F2T595      GSGSESPVFNAVPSNGSGGSGYGSGSYGGYSGYGYGTSVTSDS------ELTLVH-----
A0A2V8JQV5      DMEFSEHDLTNKGNGEPSQDPVRKVSKSGKPQQSPAYSGPMTS------PAGVFD-----
A0A2V9AC41      ---------MEQVNQPSPYFIKRTARVEQGTIDLNEFAVVDDQ------VHPLRE-----
A0A2V8K4L4      ----------MRNHDDSSNLPVPFTPPPGNQLSTPLQARFMPEPQEEASREGVVA-----
A0A2V8NCZ3      ----------MKDQDDSSNLPVPFKSARGSQLPTPVPARFTAE--DDSSREGVVA-----
A0A2V9MAM9      VSKLSKAPQRPSHSLSRAEFQRLARPSPEALAAGTSAEIETG-------SLSIIE-----
A0A2V9M454      ---------MNGDELVPLNSGPVTPPPNRNGSGP----HSYIDLEQVDAFGQLRA-----
A0A2V9IVR7      ---------MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRA-----
A0A2V9ILE2      ---------MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRA-----
A0A2V9LGY4      ---------MENDPIESRELAPVEAAPQDRLSYPRPPKITELDAGSDEAYSYVRA-----
A0A2V9J4D6      --------MTHRSRFTPSSASLRPGSSNAPPSFA--PLPSCASAGG--------------
A0A2V9L9C5      ----------MREEFGKSGTLVGRAINDSPEPIH--PIISITSAGEFE--RPSVL-----
A0A2N9M9N1      -------------MAENDKLIPVSAVSSDRLGYSGYPVTDLDPAGSEA--YSFQS-----
A0A2V9JEC4      --------MPRNTDHEQTASARSETALSERPAIGEYVVPQLEDAEGGA--SAFRV-----
A0A2V9LPQ3      -----MADIQKLTTTEPAPLARRRAASSESIGFG--LLPT--DFDGFS--SVLRV-----
A0A348V070      MDKITPTTPTTGARQTQQNL-----------------------------LEQILY-----
A0A2Z5G3A3      --------------------------MKTLPSPQSIYTPIPET------PLTISD-----
A0A2V7UGP8      ------------------------------------MDVLSQK------EINLVD-----
A0A239MKT6      ---------------------------MAFDNNDASIASDLNDAEQGSSDLTLES-----
A0A3E0PCN7      -MQKNKQLALRPKEEGQETIVYGDYEGDYFDSSYYGGAPAPSE------RQQLMA-----
A0A2V8IYW3      --------------------------------------MIPGH------KYTPQD-----
G2LEI9          PQEHPNNNVMLAPTAAELDLATPTVQDRMRRRGSYQYTLPQEDA-----GQPIRQ-----
A0A317J121      -------MRHLNHDQPEPGNNRLPALPNSYFVQPGELTIEPAS------SSPGID-----
A0A2V7YW66      ----------------------------MSPLSPVPFEEEPEGAAEPASELNFGE-----
A0A2V7Z0V0      ----------------------------MSPLTPVPLDDEPEVAPEPESELNLTE-----
A0A2V8GFD4      --MSDNEQHQHHEIRIDMPADSAFASARDAVEKDGVERLPPGSGEMVDGTLSGFD-----
A0A2V8HSS5      --MSDNEQHQHHEIRIDMPADSAFASARDAVEKDGVERLPPGSGEVVDGTLSGFD-----
A0A2V8KP55      ----------------------------------------EED------ETHLLA-----
A0A399WNU1      -MQSNFQVVKRNSRQDPESLDFYDQDDLYPESYYGDSIQEPTE------KQQLFN-----
A0A2V9CG11      -----------------------------MESPPNREVATAGG------YDSFLD-----
A0A2V2R0I6      MADEHKLVRRESGSNVPVEIVPPANRLPAWELSPR--------------EPHLYD-----
A0A2V8XAR9      MADDNKLVPRENGSNGPVELVPLPARLPSWELSPR--------------EPHLYD-----
A0A2V8VZA0      MADENKLVPRENGSSGAVEVVSLSNRVPSFELSPR--------------EPHLYD-----
A0A1Q7CB82      MADENKLVPRENGSSGAVEVVSLSSRVPSFELSPR--------------EPHLYD-----
A0A2V8WIU1      MADENKLVPRENGSSGAVEVVSLSSRVPSFELSPR--------------EPHLYD-----
A0A1Q6Y9F5      MADENKLVPRENGSNGAVELVSLQSRVPSFELSPR--------------EPHLYD-----
A0A2V9EVV8      MADENKLVPRENGSNGAVELVSLQSRVPSFELSPR--------------EPHLYD-----
A0A2V8YF91      MTDENKLVSRGNGSNGAIELAPVTPRFVSFDLSPR--------------EPHLYD-----
A0A2V8XZK2      MAEENKLVPRENGSNGAVELVPNTPRFASFELSPR--------------EPHLYD-----
A0A2V8ZTX6      ----------------HVELAPLPNRFASFDLSPR--------------EPHLYD-----
A0A2V9BT79      MTDENKLVPHENGSNGNVELVPIPGRFASFDLSPR--------------EPHLYD-----
A0A1Q8B793      EENGSKLAAHDNGANGAVEIIQAPLRMPVFDLSPH--------------EPHLYD-----
A0A2V9BCA0      EENGSKLAAHDNGANGAVEIIQAPLRMPVFDLSPH--------------EPHLYD-----
A0A2V9BWU9      MDESTALMQRDRRAGSSFEVITAHPQFSSWETPPR--------------EPHLLD-----
A0A2V9DKX2      MDESTALIQRDRRAGSSFEVITAHPQLSSWETPPR--------------EPHLLD-----
A0A2V9JSI3      --------MTNDNALAPIEHVPFERVGYRKPSVVTVEAEEFDS------PLDLRH-----
A0A2V9WI32      MGESLMDSGIVRRRSDTSTLEQLPTEIQFPADPARSYAPLPEE------GFLLRE-----
A0A2V8IVN9      DIRNFDPSVKLRFEEAANPEDAVLRAPGEAAGGGYASYPDIVGGSGEGGEPHLLD-----
A0A1F2TPT3      EPRSNPPAEATPPDDIRLSMEGTAEPALRRYENDALWQGLEGE------DRHFQY-----
A0A2V8JTQ2      ALSSG--------------------PNPANHYLPRVG---APD------EVFAAG-----
A0A2V8UZY0      DIGPEEPENLEVHGTRAAPRFVRSLPNHPPHPVARASDERASD------EMFAAG-----
A0A3N5YNR8      -----------MGDLIRREYSSIPDPSIRIQRNTEYQWASDDD------SLDIRR-----
A0A350UEK1      PPP---GDARDHDSRLPARFEIVEAGVPHRLEGPQVNYYGSPAPEEDPDSGGLLD-----
A0A350UIQ4      PPSNPQGDSASANSRLPVKFEIVDA--PPANSDP---YYGGPQFDSDEEEGGLLE-----
A0A3N6A5T6      -------MADLMIPGTEGLPTQIRPSPSPNWAHQKPKAPSKVE------VPHLRD-----
A0A1F2Q9L4      -----------------------MVARRPAAPDKIGFEVEPES------EFHISQ-----
A0A1H5SQF5      LQDVTSRSASTHRRSAFRR------------------------------EMHLSD-----
A0A3E0NV31      -----------MDRESYFNEDLRRHGGGGVGPGARRGDNDPSE------GIKVRQ-----
A0A3N5M5V0      ------------MGDLIRREPSSFADPTIRMQRTGNYQWGPDED-----SLDVRR-----
A0A2V9AEW6      ------------------------------------------------------------
A0A2V8WQK6      KPSEFPLDKTDRRRNELSRGAEQRPTVYKYVESPSTEVGASPG------YDSLLD-----
A0A2V8XIF4      QASQFSIEKSKRRPNGLSANGKQRPVLYAYLDSPAAEGAATPG------YDNLLE-----
A0A3N5XQP8      ADLAKQSRQGMQERGGGPRLFEPSPSSRD--------------------RSTVRF-----
A0A2Z5G7H4      ---------------------------------MGPRADVRER------PITLGD-----
A0A2V9L5B5      DVHQRRGLVQGDQDSSGESQHAIEPAFSRSLQESEVLDVSPEE------VPHLLD-----
A0A2V9LK56      --------MDEIQNSNGFQGASLAPRTTA-LPDSRVLDIGPEK------VPSLFD-----
A0A2V9L7I0      --------MDESENLQRDPVRALARTATQPLEKPEILDVSPEE------VPDLID-----
A0A522PPT0      --------MDSNEITPINQTGNVERLNGHYLREEDVLDVLPEE------SPRLLD-----
A0A2V9KCS3      SGALMDQIVHLPKGPQRELIRRTNGGVPASGSLPYGDSPVDQEYGADAVSGGLLY-----
A0A2U3KC61      ALEALEPIDPLPVKGPQSVYPH-----------FAQPQNS------------ILH-----
A0A2V9Y2R7      NLPGQRSLEILDQTPPSCQIPY-----------SYNSYSASGH------AINLLH-----
A0A372IT17      ---MTSPTHILER-----------------------DAMAVYD------EWTVAD-----
A0A136JPP4      DQRLTPLPKGLELNQPAGDLTTSYA--------AYYDHESQSG------KRTLRQ-----
A0A399WUJ8      DQRLTPLPRGLDLNQPHGELPAAYT--------AYYDHESQSG------QRTLRQ-----
A0A2V9NGH6      ---MDSAPLIAANTRVLRELPSAHPVEFRRQFGFGIYNPATFQ------DSVVHE-----
A0A2V9PYE6      ------------------------------------------------------------
A0A2V9NL07      GRQMEPSPVMQI-GNQVREM-GPASMQIGRNI-AAIHPAMAAQ------DSILRE-----
A0A2V9QD92      ---MEPSPVMQI-GNQVREM-GPASMQIGRNI-AAIHPAMAAQ------DSILRE-----
A0A2V9WPZ6      GVGMDSGPLVHTNGQMIREVQAPYPVEFSRQLLTGIYPNAPAQ------DSVLRE-----
A0A2V9ZLH4      ---MEPGSLIPSNGQPVRELQAIAPVEFSQQVGPGVYPPLPTN------DSVLRE-----
A0A2V9RQF1      ---------MPANAQGLRESPDPLPVEVNRTTQHYAYPVLPSQ------DSVLRE-----
A0A2V9YDK8      ---MDSGPLVQTNGQTIREVQPVYPVEFGRQMLTGIYPTLHPQ------DSALRE-----
A0A2V9V8F7      GVGMDSGPLVHTNGHMIREVQAPYPVEFSRQLLTGIYPNAPAQ------DSVLRE-----
A0A2V9XGR9      ---MDSGPLVHTNGQMIREVQAPYPVEFSRQLLTGIYPNAPAQ------DSVLRE-----
A0A2V9V3Q5      ---MALGPLVPHNDG-FREIQPAEPTELIKPIGPGLYTVLPSQ------ESALRE-----
A0A2V9NWS3      GASMASGPLIPANGQMLREISSLSSFDLNR-QLAAYYPNAPIQ------DSVVRE-----
A0A2V9USA9      ---MDSGPLVPANSGVVREI-PLTSPEFGRAAVPQVYPVLPSQ------ESAAGE-----
A0A2V9XW18      ---MDLGPLAPLGTPTIREIQPSQNVDLVRPQDPRFYPPLASH------ESGARE-----
A0A4R1LC91      ------------------------MKALTGSQANF-AQNSLDG------ELTIKG-----
A0A3M2BZG9      -MKMIPSSEQPLPRPAV-RDDFLAYDAAPATATPVPPMPGDAG------ELDVAK-----
A0A1Q7N5R7      -----MPDHTSLRRTPPPPLTAADLSRAGTAVEKF--SPNGDE------GPDWHR-----
A0A3M1SIV3      DERLLPLPKELEANKNAITYQEEGPRYFASYA--Y-GDDILEK------KFNPRD-----
A0A3E0PHB0      NDRLLQIPEIQERRSKK-SLQTAPQDYPPAYSPFY-DDEALGD------SRSIRE-----
A0A3M2D491      DERLLPLPKEIQEYELT-S------RYYPSYGG---STELVEQ------RFDPRE-----
A0A357F267      DQRLTHLPKAVDLRANG-G------DYGSGYSSFY-DEEIADG------RRSLQQ-----
A0A353C9L6      DQRLTPLPKSADLRANA-S------EYGSSYSSFY-DEEVIEG------KRTVQQ-----
A0A2V8RQV0      EQRLTTLPHLGELRHSK-H------EYAGSYSGAY-SDEVIEG------RRTVQQ-----
A0A2V8SJH5      DQRLTPLPKSLDLRASK-T------EYPATYAGFY-DDEVSEG------RRSIQQ-----
A0A2V9QB26      KHALPPASHDLVLRKSE-GSPGHGEAGSY----LY-GHRDELE------PGGFVE-----
A0A2V9VYY4      DFEALAPIDPLPVNGHQ-PLHTYFGEPHN----------------------ALLH-----
A0A2V9KIE8      GKSEILPGDRLNRIAPV-SMEQVRGQ-------EF-LEVGHEE------APHLMD-----
A0A352F549      ALEIILKNSALEQSNGS-SHNGHGNPPIV----AYGEEASPEG------EMHLRD-----
A0A3B9MLP9      ALDIILKNSSLEPTNGS-LRNGYATPPIV----AYGEEASPEG------EMHLRD-----
A0A3D5SQ87      ALDIILKNSSLEPTNGS-LRNGYATPPIV----AYGEEASPEG------EMHLRD-----
A0A2V8NW86      SHELVPRKSTEAYPGHG-EAGSYLHGRRD----EF-E------------HGGFVE-----
A0A2V8ZHL8      GVKDMPDNEALSLRGAK-LPVLESPQSPAFPVLGI-DVQDFES------FSYLQA-----
A0A2V9B240      KVKDMPDNQALSLRGPR-LPVPESPHLPAFPVLGT-DVQEFES------FSYLQT-----
A0A2V9CBM2      QSEPYSHAHRLARK-RG-SLEASVVELAD----SY-EIIGPEE------GIDLRA-----
A0A2V8XN17      QVELYGRGHRLDRRGPG-APDSRVIELPD----SY-EILESGE------ALDLRS-----
A0A2V8WX45      QVELYGRGHRLDRRGPG-ALDGRVVELPD----SY-EILESDE------GLDLRA-----
A0A1Q6YR79      QVELYSRGHRLDRRGPG-ALDGRVLELPD----SY-EILEPGE------ALDLRS-----
A0A1Q7VA32      QVELYSRGHRLDRRGPG-ALDGRVLELPD----SY-EILEPGE------ALDLRS-----
A0A2V9EY85      QVELYGRSHRLDRRGPG-ALDSRIIELPD----SY-EILEPGE------ALDLRS-----
A0A2V9H8K0      QVELYGRDQRLERRGPD-ALNTRVIEMPD----SY-EILESAE------ALDLRS-----
A0A2V9FFE5      QVELYGRRHQLERRGPD-ALNTRIVELPD----SY-EILESGE------ALDLRS-----
A0A2V9GM43      QVELYGRRHQLERRGPD-ALNTRIVELPD----SY-EILESGE------ALDLRS-----
A0A1F2RFI7      SLEKIPPLKGE--------VPATTTVAAY----TI-SQEEEAA------TPSFLD-----
A0A1F2RZS3      SLERVSRGQID--------APASVPVSSY----PV-EVLEEQD------SFPLLE-----
A0A1F2USE2      RIERYEPSPPM--------LARPEPPVPV----AY-ETVETEE------APDLLA-----
A0A2V9C238      KIKLYEPAVRK--------WERLRPTPAV----RA-EPLEMKE------SADLLA-----
A0A1F2Q9F5      SVERYEPAART--------LERRRPGVPA----PL-QTLEMEP------AADLLS-----
A0A1F2QQH9      SVERYEPAART--------LERRRPGVPA----PL-QTLEMEP------AADLLS-----
A0A1F2QXK7      SVERYEPAARA--------LERRRPGVPA----PL-QTLEMEP------AADLLS-----
A0A2V9DEM9      KIKLYEPAVRK--------WERLRPTAAV----RA-EPVEMKE------SADLLA-----
A0A2V9CYQ5      QSEPYRHAHRLVRRTGN-GLEASVVELAD----SY-EILGPEE------GIDLRA-----
A0A2V9BWU8      KLEPFAQGPRSGHGGLR-FMDNRVVDLSD----SY-EIIEAEE------PVDLRA-----
A0A2V8ZG48      KVELYARDARFERARLG-FLDHRIVDLSD----SY-EILEPDE------PLDLRA-----
A0A2V8Y334      NVELYSRGPRFERGGRA-FLDHRVLDLSD----AY-EIVEPEE------PLDFRA-----
A0A2V9AY68      KVELYARRPRFERGGSV-LLDNRVLDLSD----SY-EILEPDE------PLDLRA-----
A0A257VBK0      --------------------------------MADSDPPQVQAEFSAAQDVDLLH-----
A0A2V7XDY0      ----------------------------------MPSPVPAPAGGSSESPIDFRY-----
A0A350UQT3      ------------------------------------------------------------
A0A2U3JZ71      KEMVENNLTPALPAPLEALPGRNLPVPMEVYRTSNLMP----EVEAAPSSVPLSH-----
A0A2V8TTB0      MKKFENNL-PAVP---------------EVYRAAAPVPVIDAEFEPQAPQVPLAH-----
A0A1F2TCR2      ------------------MFDTHDLQQAPAIAIEAPPQLPMPPVAQSQQPLHVLD-----
A0A1F2V330      -----------------------------------------MPSDGTGKEISVLA-----
A0A662EE63      --------------MRHRDIDMDRWMPADQGAMPPGGPAMGGWVDDQGHEIDVME-----
A0A2V8TLH7      -------------------------------------MSENLPIVEEQREVHLLD-----
A0A1Q7ZJT1      -------------------------------------MPDSLNPLEEKREIHLLD-----
A0A2V8VC99      -------------------------------------MPETLAPLEEKRDVHLLD-----
A0A348UZU3      -----------------------------------MSENYVDPQSLETAEIDLRK-----
Q01XL7          --------------------------MNDHYEPESNGSGPHGLPVGPDVRMLPSPSDGWV
A0A2V8ERZ5      --------MLPSSPPDAPAPSTTAVTAGSPSHAGSSHGQGSAPHYAPEQDVHLLD-----
A0A2V8GTX0      --------MFTPGGLSTTGP---AAGSPPPVPVHQPQARKTAGLFSPDPNIHLFD-----
A0A2V8J0X9      --------MFDTQEVRAQLP---AEVSPSALIALPSSTSQST---------HVLD-----
A0A523DUV7      -----------------------------MDPQDSHHQEHTNLIAGLSGEFDLKY-----
A0A372IRG7      -----------------------MQGSAIAPQGQQELHPPGGVPPHESPAFTPAD-----
A0A1F2U158      ----------------MSESSPAHPTPASAPTSSGAPRAPQPLTYAVDKDVHILD-----
A0A2V8F6S9      ----------------MADSTPSGSRPASSASNSNGGVAP-PLTYGTDGDVHILD-----
A0A4Q1SCH5      -----------------------MNQPAAASPLQAQPAAFSSPGVGDSEGISFRE-----
A0A3D1ASD2      -----------------MSEMRLDRSNLPALPSTYSVSHITAEPEARETTVPLTH-----
A0A2N9MK30      ---------MNTSLQELTIVEERGPRSLPVAAGFGPAQPASWDLEPEEQTLPLSH-----
A0A4Q7YNP3      ---------MGNTFNTNGIDRRPVGIVARDESGETFPKSWTANDRVEQRTSLFAE-----
E8UZE1          --------------------------------MKNPGIPDEVAARSSFSAVGLPE-----
A0A1V6HR88      ------------------------------------------------------------
A0A3E0P0A3      --------------------------MNLRQRTVAPRESDEAFAGSGDDLKLIAE-----
A0A2V8EXP2      DSLQHRLTMASADAENAGAARAADSGPAAAAPPPTAYGYGSNVVGDDQ--VHLLD-----
A0A2W4RYA1      ---MPDINLDDLDDASRRGAAGDGQPPAGATVPSRAGAQHAHGLDEDHGDVHLRD-----
G8P0Y7          ----------------MSTGRMRGEFAEPVRHDSPRLASLQEMYRPPAREHSISD-----
A0A5M8T4U7      -----------------------MAIEPQSEHQLDRVMINPATIAAPSESLSLMD-----
A0A3P0X3W6      --------------MSSVYNNKPRILPASAPPSQIAHYTGPQAAAEPDELLPMQH-----
A0A1E3Y9R6      -------------------------------MAHLPNA-GGRQASAKGGGWHPTD-----
A0A2W4TLP2      -------------------------------MAHLPPAHGGRAARRGGSSWHPTD-----
A0A3R9WF43      --------------MDRSPPKVSITKKEHRSFLAEMQTRAHLAPVNASEYESLSG-----
A0A317HKM4      -------------------MSLDSHRPARSDPDSDDARGTGSPDTWGTDTLQIRD-----
A0A523E0N1      ------------------------------MSTERLPPDYSDYAPEIYPRASLRE-----
A0A523ECP2      ---------------MELKKSEQGSNANWAPPPTPTSEPERVDFHPPESETHLRD-----
A0A2W0C122      ---------------MDARELIKSNPAELSAQNTPASQGIHYGWARLVPLNPVQR-----
A0A2W0AUU7      ---------------MDARGLMKWNSTDISTQQSSASQNLHRASSRRVPLNPMQV-----
A0A2W0BQL1      ---------------MDARGLMKWNSTDISTQQSSASQNLHRASSRRVPLNPMQV-----
A0A4Q1SDL1      ----------------------------------MNNYLLEAPPTHVEPGLTLGD-----
A0A3P0XH15      ---------------------MEGPAVQPERQVAAGPQLAPEQAI-----ITPSD-----
A0A4R1LAZ7      -----------------------MEGPRTTTRVSPAGDMQAELPVNERSILTPGD-----
A0A3M1WQW8      ------MSERDERTHLPAPADTGAMDRNVVTRLYPIGYGHERYGTAVERDVHLLD-----
A0A3N1JHC1      -----------MRTPAGKLRAIAPAETPGPRLPSAGTLDPFRSSTVYGTPEEQID-----
C1F294          -----------------------MDTLDPQRQSGSAIASADEKTVAPQSTINLSD-----
A0A2V9KA79      -----------------------------------------MQNGTANTSASLTN-----
A0A522PSP1      --------MNFNITERSDAVLRSAGPEEATRLAPDNQKGTWGFPTEPAISLALSR-----
G8P085          -----------------MRVQTTQPDTEGKLDQRSLTEADSASA------LSLGD-----
A0A4Q1SGQ1      -----------------MNEKALLAGRPLEWTDLLTRPRRE---------WTMLD-----
Q1ILD9          -------------------MSATNLATRKDLLPQNGKGARWQPSESDGQKIDFDG-----
Q1IJZ6          ---------------------MDSLFRKSELPPLGVSEQSTTNAGLEDEDLSLRQ-----
A0A2V8TCE6      ---------------------MTSPREAE---------------------SEIRE-----
A0A522TBE8      -----------------MPKAVQQPSPIPPPQPVAGRAGAPAPWWQATEEAGPQAERPAG
Q1ITG0          ------------------------MEKFSQIENVQGASRTSWADVQEDREADLLH-----
A0A3N5PCI5      ---------------------MSDTQQPPSEHDAVTSRAEPQ--------WQLED-----
A0A3M1Q0S9      ---------------------MTESSEQRE--------------------FNLRD-----
A0A2Z5G448      ---------------------MQGPDPASERQQGTSVAGKPAGSDRQDFILTPAD-----
A0A3M1VZ38      ---------------------MIQQDPQN-QE------------------FNLRS-----
A0A4Q1SD29      ---------------------MQGWSAPP-QEPQKVASSPAVGSVQEHTVFTPAD-----
A0A3M1PY35      ---------------------MAASEPYR-REPPTGGE------------WDLDA-----
A0A3M1VMP2      ---------------------MPAMTVPG-VGP--GGD------------WDLAA-----
A0A2V8G155      --------------------KEGLRMMGAPAPG----DYALNDAALPPASPHVVN-----
A0A2V8HDM7      --------------------KEGLRVVGAPAPG----DYALNDAALPPASPHVVN-----
A0A2V8DRT9      DLDNQKKNLAP---------RPRRAVRAASGKP--------AAAEHALEEVHLSD-----
A0A2V7VYF3      ----------IGHDETAEDTRPQAESYWNDDRD---------ADNAAPEEAHLLE-----
A0A1F2SVH2      --------------------SPRIAMAGEDARAQTSPVYGYGSNVLGDTEVHLLD-----
A0A2V8AJG9      PAAAGRLEMAPGLDSIDAGAAPPISAAAPNGRG---PAYGYGSNVIGDGEVHLLD-----
A0A2N9LQU7      ---------------MQNIPEQQLARVTARGRI---SGPVPLPPALRNPDVSLGE-----
A0A2P6WFK7      --------MRPAACQESHMPEIEQDSLATMRES---GLKRFGNDSVTERELSVTE-----
A0A2V8U914      ------------------------------------------------------------
A0A2V7W309      ------------------------------------------MDLNTQQEVHLSQ-----
A0A2W0BGU4      TNPLMKSDPATRRELVDYEIAPHPTPEPITIAP---RYYPDPNASP--EAGSLAL-----
A0A2W0BVQ9      TNPLMKSDPATRRELVDYEIAPHATPEPITISP---RYYPAPNSGP--EAGSLAL-----
A0A2V9MN96      -------------------------------------------PYRIGGQHPLLS-----
A0A2V7V2Z1      GYRLRSSSRCPAPTWPPGPSRSERRRGSPAVSP---SASSGYEGEP--QEAHLWE-----
A0A2V7X2F7      ---------------------------MASPSQ---PPPSEPAG-----EDHLWD-----
A0A2V7V2I1      ------------------------------MST---TAPAGQAGVP--EETHLWE-----
A0A2V7U3M2      ------------------------MEGTSPVTP---TPPTSSESEA--QETHLWE-----
A0A2V7UHT0      ----------------MWPRRTVLSKELSSVTP---IPPAGSEGEP--QEAHLWE-----
A0A2Z5FVL3      ------------------------------------------------------------
A0A2V9KBD6      -----------------MDLSRPEPRLPPKVPS---PRVQRVVGAP--DEALAST-----
A0A2W0AJ66      TRYFELTGEPAPDSAA-QTLVQTPPNLKPGLPN---RYTQKVVEAL--EETFLGN-----
A0A1Q7RBU1      SKYFELMNQLGRDSAAVQ-----LTRAAPNLPN---RYPQRLIDAP--EQMSTAG-----
A0A2V9JPV9      RRYFELMNQHPRNSLAVQPPSRGVPRSTPNLSN---RYPQRVIDAP--EQVSAAG-----
A0A1I6MH75      -----------------MDRQTTETTSPTGVPH---TPGGGFAAATAATETTLSD-----
E8WVF6          -----------------MSSDNPYSNPGPGMSQ---AQQPTFVAPS--NDTTLSE-----
A0A1H5Z7N3      ----------------MIPVRAQTSQASESEVV---MPQAMQDRAS--GDTTLSD-----
A0A2V9YHT3      --------MDSGKLIRAEDAGNGKSSLDFPPPL---LPAGYFPATL--PQPALLD-----
A0A1G7JVV8      ----------------MPPLTNQPSDR---VVP---ETNAGFSAIT--AESALSE-----
A0A1H4T6W9      --------------------MNQPVTH----DP---ANPAGFTSTA--ADSALSE-----
I3ZEU5          ----------------MPPATNQPVPT----DP---ASPTGFTTTS--ADSALSE-----
A0A428MDU2      ----------------MGLENPQQPGP--GAPE---TNPTGFSTTV--TDTTLSE-----
A0A5B9EBI2      ----------------MGPQNPQ-QPL---PPT---TDYRAAASAP--TDASLSE-----
A0A239HDF6      --------------------------------------MPGSIPQA--ADASLAD-----
A0A4Q0T270      ------------------MADDG-PGT--GTPH---APLGGLSTSG--SETTLAE-----
A0A1Q3QQB6      ----------------MGLQNTQ-PSADGDTSE---LNSPRFGSAV--TDTALSD-----
A0A3N1K1G7      ----------------MGPKETP-PVA--GAPD---LSPSAFSSTA--TDTTLSE-----
A0A4V2G466      ----------------MGPQSAQTPSHTGGASE---TTPPAFSTAT--TDTTLSE-----
A0A6B9YNQ8      ----------------MGLQSAQTPPQAGGASD---TSPLAFGTAA--TDTTLSE-----
                                                                            

A0A2V7VMF7      -------YAGLVWRSRV-FIVALGLVGLGLGFVVALLQTPQYRAGAMIQI---EPP--AP
A0A2V7YYV7      -------YLRVARHRLW-MIIACPILAALSAGIVSFALPPVYEAHAALLV--------LP
A0A2V7Z0J5      -------YLRVVRHRLW-MIVACPLLAAVTAGVVSFALPPVYEAKVDLAV--------KP
A0A2V7Z3M4      -------YLRVVRHRLW-MIVACPLLAAVTAGIVSFAVPPVYEAKVDLAV--------RP
A0A399Y5V2      -------YLGILRRRKW-FIILPTVVILVAAITASLLTTPIYEASADVLI---QSN--KR
Q01X01          -------CARTLYRRKA-TVLWITFFAVIAAALISVAQPRMYESQASIQV---QGV--NE
A0A3M2D9H8      -------YLFLAKRWAW-LLGVGVLIGLIGGLIYSLVQEPVYQATTKVMVLGAPQS--NL
A0A2V8JK38      -------YWRVIVTRRW-TVVAVFATIVLLTLIWTLKQKPMYAATITIQI---ERE--TP
A0A2V9IXG5      -------ILHVLWTGKW-VILACMLVALALAAVNNNFQKVSYRAQAQIQI---DAPPFLP
A0A2V9J2P4      -------ILHVLWTGKW-VILACMLVAMALAAVNNNFQKVSYRAQAQIQI---DAPPFLP
A0A1Q7RLS4      -------YWRTIWRGRW-TILSIFVVVFTLVAIGTFTQKPVYRASVTVEI---TPQ--SR
A0A2V2R525      -------YVQIIRKHFL-MIIALTALCTLTTAVYMARKPDVYGAAVRVQI---DVE--SN
A0A321LPW6      -------VWRTIRKRRW-LIAATVVIVTSIVTVEMFRIKTAYQASAMIEI---GKD--VQ
A0A2V9R9V4      -------LWRIVRKRRW-LIIGIASIITTLVTIDVFRTKPLYEATTTIEI---GRD--NG
A0A321LE75      -------IWRTVRKRLW-LISLIALIVTTIVTLEMFRTKSMYKASTTIEI---EKE--NR
A0A2V8R8U7      -------YLYVILKRKW-LILSLVLVVTSLVTIQAYRQPSIYEGGTTIRI---ESK--PA
A0A2V8QMP4      -------YLAVVLKRKW-LILSLMVVITSLVAIQMYRLPSIYEAQATIQI---EQK--KG
A0A2V8R4S3      -------YLAVVLKRKW-LILSLMVVITSLVAIQMYRLPSIYEAQATIQI---EQK--KG
A0A2V8NJ55      -------YLAIILKRKW-LILSLVVVVTSLVTIQMYRQPPIYEAETTIQI---E-Q--KK
A0A2V8Q7I0      -------YLFVVLKRKW-LILSLCLVVTSLVAVQMFRQPSIFQAETTIRI---E-R--KQ
A0A2V8S6K4      -------YLNIVLKRKW-LILSLVTVVTTLVAIQMYRLPSIYEAKTTIQI---EPK--RN
A0A317I2L9      -------YLFVILKRKW-LILSLCLVVTSLVAVQMFRQPSIYEAETTIRI---EQR--KS
A0A2V8LLF9      -------YFFIILKRKW-LIMSLLLVVTSLATIQAYREPSIYQASTMIRI---EGR--PQ
A0A352FRF4      -------YLFVVLKRKW-LIMSLVLIITSLATIQAYREPSIYEGATTIKI---EQK--TP
A0A2V8MKV0      -------YLFVILKRKW-LILSVALVITSMAAIQQYRQPSIYDGIAQLKI---EEK--PP
A0A2V8PYY8      -------YLFVILKRKW-LILGVVLVITSMAAVQQYRQPSIYDGIAQLKI---EEK--PP
A0A1Q7YKQ8      -------YLNVVLKRKW-LILTLMLVVTSLVAIQMYRLPPIYQAEATIQI---EPK--HD
A0A352F3R7      -------YLFVVLKRKW-LILSLVLVITSLVTIQSFRAPSIYEGETTIRI---EQR--PM
A0A0B6WXT1      -------YWAIVYKRRW-LILSLALAVTSLVAIYMYRQPNVYEAMVTIDI---EPR--R-
A0A3B9MEU8      -------YLSVVLKRKW-LILSLVLVITSLVTIQSFRAPSIYEGETTIRI---EQK--PM
A0A2V8MHG6      -------YWRSVRKHLW-LVMGIVVLVSGVTAMYMARQRDIYESLARVQV---DSE--TA
A0A2V8P7N1      ----------------------------------------------KVQV---DSE--TA
A0A2V8M3M6      -------YWRSVRKHFW-LIIAILILVTGITAIYMARQPDVYESLSKVQV---DSE--TA
A0A1Q7NJH5      -------YWRSIRKHVW-LVIGIVVVVTGLTAVYMARQPDVYESASRVQV---DSE--TA
A0A2V8PJY0      -------YWRSIRKHVW-LVIGIVVLLTGLTAVYMARQPDVYESASRVQV---DSE--TA
A0A1Q7Y6W9      -------YWRSIRKRLW-LVISITVLMTTLAAIYMARKPDIYTAQARVQV---DLE--N-
A0A2V8NC68      -------YWCSIRKHIW-LVMGIILLITMLATIYMARQPDVFEARARVQV---DLE--I-
A0A399WK13      -------YWRAVRKRLW-LVVGIAVVMTTLATIYIARKPNVYRAKAVVQV---DNE--QV
A0A352FLX4      -------YWRIVSKHLW-LILGISVLIPTLVAIYVVRKPDIYESQARIQV---DLE--NA
A0A2V8RTL7      -------YWRAIRKRLW-LVVGIAVLITTLAAIYMARKPNIYLASSVVQV---DLE--QT
A0A3E0PCJ6      -------YWRIIRKRLW-LVLGITVLLTTVTAIYMARKPNVYMASATVQV---DLE--QA
A0A3M1S4R8      -------YWNAIRKRLW-LIVGLVVLVTTLTAIYVARQPNVYEARARVQV---DLE--QG
A0A1Q7YFI6      -------YWQSVRKHLW-LIIGIVVLITMIAAVYMARQADIYEAKSRVQV---DLE--VN
A0A136KC10      -------YWRAIRKRLW-LVAGIAVVMTTLATIYIARKPNVYRAKAVVQV---DNE--QV
A0A2V8SEX6      -------YWKAIRKRLW-LVAGIAVLVTTLVAIYMARKPDIFSATARIQV---DLE--QV
A0A3M2D6Y5      -------YWNAIRKRLW-LIVSIAILVTTLTAIYVARKPNIYEAKARIQV---DLE--QN
A0A0B6WWQ6      -------YWRAVRRYLW-LVIGLVALAAAATAIYMARQPDLYLARARVEI---GSE--ED
A0A3B9MK99      ---------MCIRDR----VISVLVLITTISVIHVARKPDIYQASARVQV---GLE--NN
A0A352EX26      -------YWRAVRKRLW-LVIGIVILITTLAVINAAQKPDIYSANARVQV---DLE--NN
A0A2V8MM59      -------YWRAVRKRLW-LVIGVAALITAMAVIYAARKPDVYEAASQVRV---DLE--NN
A0A2V8PFE8      -------YWRAIRKRLW-LVLGVAALITALSTVYVARKPDVYEAKSQVQV---DLE--NN
A0A2V8PWS6      -------YWRAIRKRLW-LVLGVAALITALSTIYVARKADVYEASSRAQV---DLE--NN
A0A2V8LCT5      -------YWRAIRKRLW-LVIGVAALLTTLALVYVARKPDIYEAKSQVQV---DLE--NN
A0A352FTJ9      -------YWRAIRKRLW-LVIGVAVLMTTLAIIYVARKPDIYESSSRVQV---DLE--NN
A0A2G6PYV5      -------YIGLLRKHFF-LTLSLLILGLGLAYLAWLVKPPLYKSSVLIKM---NHL--SM
A0A2V8F956      ------------------MAITTFLLVVGSVTVYTFTATPIFEAKTRLLI---EAE--NR
A0A1F2S1W5      -------YLQVLYRRRY-VAATAFLVVVLSVALYTFTAVRIYEGTVRILI---ERD--DP
A0A1F2T595      -------YLQILYRRRY-AAITVFLATVVTVALFTFTATRVYEGSVRILI---ERD--DP
A0A2V8JQV5      -------YWRVFLNRKG-TVLIAAVLGTAIGLLISFPRTPIYQARTTLEI---QGL--ND
A0A2V9AC41      -------YWLTIKRHRW-LIVMTALAILACAMLYLFTRIPLYTAEATVLI---ERK--AP
A0A2V8K4L4      -------YWRMVMRHKW-IVVLVAFLGTVAGILFTLPQTPIYQSSTSLEV---QGL--NE
A0A2V8NCZ3      -------YWRMVMRHKW-IVILVAFLGATAGILITLPQTPIYQSTTLVEV---QGL--NE
A0A2V9MAM9      -------YLRVLRRHSL-LLAVITAATVGAAFLVSIAQPRLYQSVASVEV---QGL--NE
A0A2V9M454      -------TWDILLKHQW-LILVTAFVLTLLVTVYSYKMKPVYRATARVDV---EAE--EP
A0A2V9IVR7      -------YWRMLVRHGW-TILTVAFVVTMLVALISFRLQPVYQATARVEI---EAA--TP
A0A2V9ILE2      -------YWRMLVRHGW-TILTVAFVVTMLVALISFRLQPVYQATARVEI---EAA--TP
A0A2V9LGY4      -------YWRMLVRHGW-TILTVAFVVTMLVALISFRLQPVYQATARVEI---EAA--TP
A0A2V9J4D6      ----------KSFRWRW--------LSWISVTIYTFKAERVYQATARLDI---EAE--TP
A0A2V9L9C5      -------RAIAVLRKRWWEVLSVAMVVLISVTIYTFKAERVYQATARLDI---EAE--TP
A0A2N9M9N1      -------YWEIL-RKRRSTVFAAAFLVTLLVTVVVYRMKPIYRATARMEV---QAE--TP
A0A2V9JEC4      -------YWHVL-KRRWPTVITVASAVTLLATLISLKMQPVYKATARLEV---KGE--MP
A0A2V9LPQ3      -------YWEIVYRRRWQIVAITVAAVTIMA-IYSFKVNPIYRATAHVEI---EAE--AP
A0A348V070      -------YWHAVLRWKW-TGLTVAVLIVALTLVYILISPHIYTASGTIWI---DE---TQ
A0A2Z5G3A3      -------MGALVVRRRA-IIAGVTFAFLAIASLYCLLSTRRYMATGTIQI---QKD--SS
A0A2V7UGP8      -------YWNVLKRRRW-VVFTAVVVLVITVTLGSFLIPPSYQAICTLQI---ERE--QP
A0A239MKT6      -------VWEFLRRRKI-WIALGIVLGFLSGLAVYLHTPPLYTATAIVEL---NKD--SS
A0A3E0PCN7      -------AIGVLRKYWL-MIVAITLLGSLAAVVYVAQKPDYYTATVRIQV---NNE--NN
A0A2V8IYW3      -------VLDAVNRRKW-LLICPVLVFGIAAFLITRSLPNLYQSETTILV---VPQRVPE
G2LEI9          -------AFLTILRYKF-TVILCVVLTMTVTGLALSRMQPVYEASSHIEV--------AP
A0A317J121      -------YWHLLRKYLI-LLSLFAVAGAAAGFFSVAFLNPVYQSRALLEV---Q----AP
A0A2V7YW66      -------YLGIARRHWK-LAAVCCLLGLAGAAVHYAITPKAFQATATIQI---ERR----
A0A2V7Z0V0      -------YLGMLRRHWR-LAAVCCALGLAGAGIHYAITPKAYQASTIIQI---ERR----
A0A2V8GFD4      -------YLRILYKRRW-LCLAVFVLTLGSVVMYTFTATPIYEARTQILI---ETE--NP
A0A2V8HSS5      -------YLRILYKRRW-LCLAVFVLTLGSVVMYTFTATPIYEARTQILI---ETE--NP
A0A2V8KP55      -------YWRVIVTRRW-TVVAVFATIVLLTLIWTLKQKPMYAATITIQI---ERE--TP
A0A399WNU1      -------LLSILKKHWL-LVLSITLIGTFLVIVYEAQKPDFYEASVRVQV---NNE--SN
A0A2V9CG11      -------YWRILIRHKK-MLLLVTLAGLIAAILIGLVQTPVYRARTSLEI---QDF--NE
A0A2V2R0I6      -------YLLVLRKHQW-LILSFMLAVVTIVAIATFRMQPVYTATARIEI---DRE--NS
A0A2V8XAR9      -------YLLVLRKHQW-LILSFMLAVVTIVTISTFRMQPVYNATARIEI---DRE--NA
A0A2V8VZA0      -------YLLILRKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTRVEI---DRE--NA
A0A1Q7CB82      -------YLLILRKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTRVEI---DRE--NA
A0A2V8WIU1      -------YLLILRKHQW-LILSFMLAVVTIVAIATFRMQPVYVATTRVEI---DRE--NA
A0A1Q6Y9F5      -------YLLILRKHQW-LILSFMLAVVTIVAIATFRMQPVYVATARIEI---DRE--NA
A0A2V9EVV8      -------YLLILRKHQW-LILSFMLAVVTIVAIATFRMQPVYVGTARIEI---DRE--NA
A0A2V8YF91      -------YLLILRKHLW-LIVSFMLTVVTIVAIANFRMKPVYVATARIEI---DRE--NA
A0A2V8XZK2      -------YLLILRKHQW-LILSFMLAVVTIVAIATFRMQPVYVATARVEI---DRE--NA
A0A2V8ZTX6      -------YLLILRKHQW-LILSFMLAVVTIVSIATFRMQPVYVAIARIEI---DRE--NA
A0A2V9BT79      -------YLLILRKHQW-LIVSFMLSVVTIVSIATFRMQPVYVATARIEI---DKE--NA
A0A1Q8B793      -------YLLILRKHQW-LILTFLLTVVTIVSIATFRMKSVYVAPARIEV---DRE--NA
A0A2V9BCA0      -------YLLILRKHQW-LILTFLLTVVTIVSIATFRMKSVYVAPARIEV---DRE--NA
A0A2V9BWU9      -------YWRILRKYQW-SILSFLLTVVTFVTIATLRMHPVYEATARVEI---DNE--NT
A0A2V9DKX2      -------YWRILRKYQW-SILSFLLTVVTFVTIATLRMHPVYEATARVEI---DNE--NT
A0A2V9JSI3      -------YWNNLVKRRW-TVVTVAFVVSTVVAMVNFRMPPVYEARVSVEV---EGE--AP
A0A2V9WI32      -------YGRILKKRKW-VVISTWLIIAILATVYALHMTPVYDATGRIAI---NRE--NS
A0A2V8IVN9      -------YVRVLYKRRW-IAGTAFTVVMLLVTVYTFTVTPIYQATTKLLI---ESD--SP
A0A1F2TPT3      -------YLAVLYKRRW-IAITALLVVLTFAINRNFTAVPVYEASVRVLL---DAE--RL
A0A2V8JTQ2      -------MWRIIRDRKW-TIAAFALVVVGIVVTASLLMEPQYKAVGRVVVVFHRDN--DS
A0A2V8UZY0      -------LWRIIQDRKW-TITAFALVVVAIVLTASYYMKPRYEAVGRVVVVFHREN--DS
A0A3N5YNR8      -------YFQVLLKRKW-LIGLVVGAVLLLVGLQSFTTTPLYRATARVQI---DPE--SA
A0A350UEK1      -------YWRILRRRKG-TLIIGAVAGLLIGIASTLPRTPIYQAKTTLEI---QSF--NQ
A0A350UIQ4      -------YWRILRRRKG-TLVIGATVGLLLGIAVTLPQTPIYQAKTTLEI---QSF--NQ
A0A3N6A5T6      -------YWNVVLKRKW-LVLTVLVTVVVGTAVQTMTTTKVYRSTARVRI---DPE--ST
A0A1F2Q9L4      -------WLGVVRRRRL-LLILVAGLVAAISIVLYFMTPRQYRATTVLQI---ERR--PT
A0A1H5SQF5      -------ALVILRKKLW-LIVGCVVVGVGLAVLLTSLMQRRFSSTVTIEV---HKE--GG
A0A3E0NV31      -------LIESIRVRIF-TVVLVWLLTVVVMVVHVWTQTPLYRSTATLEI---EPK---Q
A0A3N5M5V0      -------YFQILRKRKW-LIVAVVTTVLVLVAVQSFTTTPLYRATARIQI---DPE--SE
A0A2V9AEW6      ----------------M-TLLGFAVVGLLASIMISLVQTPIYRVRTSLEI---Q----GT
A0A2V8WQK6      -------YWHILIRHRM-TVLRFAVAGLLGAIVVSLVQTPIYRVRTSLEI---Q----GP
A0A2V8XIF4      -------YWHLLAQHKM-TLLAFGVCGLVAAILFSFIQTPTYRVRTSLEI---Q----ST
A0A3N5XQP8      -------YWEAIIKYRR-FVLLVLFLVVALVALETFTATPLYRASVRVEV---DAE--PA
A0A2Z5G7H4      -------LRHIFRRRRR-VMVSCVGGCVALAVLVCVFCTRRYQAFGEIQV---QKD--SS
A0A2V9L5B5      -------YWQVVLKRRW-TVLVCLLVVFTTVAIGTLKKRPVYEGKVLLEI---NPE--EP
A0A2V9LK56      -------YWQIILKHRW-LLISTLLIVFSIVAVGTLKQKPSFQGSILVEI---DPD--PP
A0A2V9L7I0      -------YWQLILKRRW-TVLVCLLAVFTTVAIGTLKQRPVYVGKVLLEI---NPE--EP
A0A522PPT0      -------YWHVMLKRRW-AVLTCLLIVFTTVAIGTFKQKPIYAGKILIEI---NPE--EP
A0A2V9KCS3      -------YWHMILRRKW-TVLIIGFVGTLSGFLVSLPQTPVYRSRTSVEI---QAL--ND
A0A2U3KC61      -------YWQILRKRKW-AVLATFAIVFALSVIKTLRETRLYQATSKVAI---FEE--NP
A0A2V9Y2R7      -------YWHVLRKRKW-AVLVTLIVVWVLSAVATMKQTRLYEAVSQLAI---FPE--NL
A0A372IT17      -------LLSILRRRRR-IVLGMVFALLLLVTLYCLLITPLYQATGEIEI---QRE--PS
A0A136JPP4      -------YVRVVTKRLP-MIGAIAVVVTAAAAFYSFRQPSIYSASTEMLI---EPR--KA
A0A399WUJ8      -------YVRVITKRLP-LIGAIAIVVTAAAAFYSFRQPSIYSASTEMLI---EPR--KA
A0A2V9NGH6      -------YLRVLIKRKW-VVISSVVMIFVVVAIATLKATPVYDATGSIAI---NKL--DP
A0A2V9PYE6      -------------------------------------------------------M--DP
A0A2V9NL07      -------YLRVLIKRKW-IVVGTLAAIFGASLVATLRITPIYDAVGSIAI---NKP--DP
A0A2V9QD92      -------YLRVLIKRKW-IVVGTLAAIFGASLVATLRITPIYDAVGSIAI---NKP--DP
A0A2V9WPZ6      -------YLRVLIKRKW-TILFCLAGIFIMVAISSLKMTPVYEASGSIAV---NKA--DP
A0A2V9ZLH4      -------YLRILIKRKF-VALSCVVVIFLLVLIATLRMTPIYDAAGSIAI---NKL--DP
A0A2V9RQF1      -------YLRVLIKRKW-IVISSVTVIFGVVAIATLKSIPIYDASGSIAI---NKS--DP
A0A2V9YDK8      -------YLRVLIKRKW-TIILCFSGIFIAVAIASLKMTPIYEASGSIAV---NKT--DP
A0A2V9V8F7      -------YLRVLIKRKW-TVLFCLAGIFIMVAISSLKMTPVYEASGSIAV---NKA--DP
A0A2V9XGR9      -------YLRVLIKRKW-TILFCLAGIFIMVAISSLKMTPVYEASGSIAV---NKA--DP
A0A2V9V3Q5      -------YLRVLLKRKW-IIIACVVGIFAAVAIASLRQTPVFDAVGRIAI---NKA--DS
A0A2V9NWS3      -------YMRVLIKRKW-VIISCLAIIFGAVSVVTMRSTRIYDATGSIAI---NKS--DP
A0A2V9USA9      -------YIRVLAKRKW-VIFSCVAAIFAVVAIASLKMTPIYEANGSIAI---NKP--DS
A0A2V9XW18      -------YLRTLIKRKW-IVIICLVTIFSVVAIATLKTTPVYEAGGTIAI---NKP--DT
A0A4R1LC91      -------LWALLRRRRS-VVYGTTLVLFGAAILYCLLSTRRYEVTGEVQV---QKT----
A0A3M2BZG9      -------YLGALQRRWP-LILIFCALAAAYSLVRYSLTTKMYQATAVIQI---ERR----
A0A1Q7N5R7      -------YLTVVWRYRW-WILAATALGTIGGAAASRFLPPRYVAQATIWI---QTS--GG
A0A3M1SIV3      -------YLLVIHKRLP-LIIALVLVITTLTALYMYRQPSIYQATAILLI---EPP--KP
A0A3E0PHB0      -------YFNIVYKRLP-LILAATIIVTAAVAFYMFRLSDQYAAAATMIV---EPP--KP
A0A3M2D491      -------YLIIIYKRLP-MIIALVVIVTSLVAFYMYRQPSIYEARAVLLI---EPR--RP
A0A357F267      -------YFNIVYKRLP-MILTLAIIVTAATAFYMYRQKSVYQATTEMLI---EPR--KP
A0A353C9L6      -------YFRIVYKRLP-LIIAIVTIVTAAAAIYMYRQPTVYQATTDMII---EPR--RP
A0A2V8RQV0      -------YFNIVYKRLP-LILALTILVTAAAAFYMYRQASVYQASTQLVI---EPR--KP
A0A2V8SJH5      -------YFNVVKKRLP-IILAITLLATVAAALYMYKQPSLYQATTEMVI---EPR--KP
A0A2V9QB26      -------DWRILCRHTG-ILAGITLMGALAGVLLSIWQSPVYRARTALEI---QNI--NE
A0A2V9VYY4      -------YWHVLTKRKW-VVLPTFAIVFALSAIATLSETRLYQATSKVAI---FPE--VP
A0A2V9KIE8      -------YWHLILKRRW-TVLTALLAVFLTVAIGTFKQKPGYSGTALLEI---NPE--PP
A0A352F549      -------YWKTIRKRLW-LIIGLALIVGSVTALRQARQPDIYQARARVQV---GTQTYSP
A0A3B9MLP9      -------YWQTIRKRLW-LIIGLALIVSTIAALKQARQPDIYQARARVQV---DTETYSP
A0A3D5SQ87      -------YWQTIRKRLW-LIIGLALIVSTIAALKQARQPDIYQARARVQV---DTETYSP
A0A2V8NW86      -------DWRILCRQKD-ILAWITFLGALAGVLLTIWQSPVYRARTALEI---QNI--NE
A0A2V8ZHL8      -------YWNIVNKRRW-TIATVAFIATLLVAIASFKMTPIYEATARLDI---EAD--TA
A0A2V9B240      -------YWNIINKRRW-TIVTVAFIVTLLVAIASFKMVSIYEATAHLDI---EAD--TP
A0A2V9CBM2      -------CGHIVRRRLS-TILAVFFVVFVVIAIATLKQKPTYRAQVVLEI---QKE--NP
A0A2V8XN17      -------YGRILRKRLP-TILVVFFILFTGILIATLKQKPVYRAQVLLEI---QKE--NP
A0A2V8WX45      -------YGRILHKRLP-TILIVFFILFTTILVVTLKQRSVYRAQVLLEI---QKE--NP
A0A1Q6YR79      -------YGRILRKRLP-TILVVFFILFTGILIATLKQKPVYRAQVLLEI---QKE--NP
A0A1Q7VA32      -------YGRILRKRLP-TILVVFFILFTGILIATLKQKPVYRAQVLLEI---QKE--NP
A0A2V9EY85      -------YGRILRKRLP-AILVVFFILFTAILIYTLKQKPVYRAQVLLEI---QKE--NP
A0A2V9H8K0      -------YGRILRKRLP-TILIVFFILFTAILIATLKQRPVYRAQVLLEI---QKE--NP
A0A2V9FFE5      -------YGRILRKRLP-SILVVFFILFTVILIATLKQRPVYRAQALLEI---QKE--NP
A0A2V9GM43      -------YGRILRKRLP-SILVVFFILFTVILIATLKQRPVYRAQALLEI---QKE--NP
A0A1F2RFI7      -------YWRVLRKRRW-TVLGLLLLVVVTVMIGTLKQKPVYRAKAVLQI---DKE--SS
A0A1F2RZS3      -------YWRVLQKRRW-TILSILLLVVVTVMIGTLKQRPIYEAKTVIQI---DRE--SP
A0A1F2USE2      -------YWRVVQKRRW-TILTIFFVFLTLVLLWTLKQKPIYGATVLLEI---EKE--NP
A0A2V9C238      -------YWRVLRKRRW-TILTVFFVLFTVVLLGTLKQKPIYRAKALLEV---AKE--NP
A0A1F2Q9F5      -------YWRILRKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKALLEI---ERE--GP
A0A1F2QQH9      -------YWRILRKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKALLEI---ERE--GP
A0A1F2QXK7      -------YWRILRKRRW-TLASILVVLLVVVLVGTLKQKPVYRAKALLEI---ERE--GP
A0A2V9DEM9      -------YWRVLRKRRW-TILTVFFVLFTVVLLGTLKQKPIYRAKALLEV---AKE--NP
A0A2V9CYQ5      -------CGHIIRRRLS-TILTVFFVVFVGIAIATLKQKPTYRAQVMLEI---QKE--NP
A0A2V9BWU8      -------YGRILRKRFA-TVAIVFFLVFAGSLIATLKEKPVYRAQVLLEI---QKE--NA
A0A2V8ZG48      -------YGRILRKRLP-TILIVFFLVFTVGLIATLKEKPIYRAQLLLEI---QKE--NP
A0A2V8Y334      -------YARILRKRFS-TVLIVFFLVFAVTLIATLKEKPLYRAQVLLEI---QKE--NP
A0A2V9AY68      -------YGRILRKRFS-TILIVFFLVFAATLIVTLKEKPVYQAQVLLEI---QKE--NP
A0A257VBK0      -------WVQILWDQRF-WIAGVTAAVVILVALYTFLATPIYSATATVYV---QTY--SR
A0A2V7XDY0      -------YGNLLWKNRI-LLATAAVLGLALGLVIAFAQTPEYRASVMVQI---DPP--TP
A0A350UQT3      --------VSRIDEEMW-KIGAFILVVLIATAVISLRLTPVYESTATLYV---DRQ--EA
A0A2U3JZ71      -------YLWILRRNWW-KMLLFVSCAVAATLMVSARLIPVYESTSTIDI---DRQ--MP
A0A2V8TTB0      -------YLWILRKHGW-TIAGFVVAAVLGTLIVSLRLTPVYESTVTVDI---DRQ--MP
A0A1F2TCR2      -------RLSAVFKHRR-VAGAAFVIVVMAMMVQTYSTIPLYLATARVMI---EDE--RS
A0A1F2V330      -------LLDIVMRRKL-FVLIPAAVLIVAVGIYTVYQPPLYRAQALLGV---EPG--AR
A0A662EE63      -------YARLLWSRRW-LVLAVLLSTVVLTTAWSVTRPKLYRAATKLIV---EPT--SS
A0A2V8TLH7      -------YWRTISRGRW-TILSVFVVIVTLVAIGTFTQKPVYRARATVEI---TSQ--AS
A0A1Q7ZJT1      -------YWRTIWRGRW-TILSIFVVVFTLVAIGTFTQKPVYRASVTVEI---TPQ--SR
A0A2V8VC99      -------YWRIIWRGRW-TILTIFVVVVTLVAIGTLTQKPVYRAQATIEI---SPQ--SR
A0A348UZU3      -------YIDIFYRRRW-TVISLTLIAVALSLIISFVTRPVYKARGTVMI---EKE--PN
Q01XL7          PEPTKISYWKIAWGHKF-ILLLCIFAGALGGTAYVILKTPEYAAASTVEL---IGF--NQ
A0A2V8ERZ5      -------RLAVIYRYRR-ICAATFVLVSAALIIQGYSTVQMYQAQARLLI---EDE--RS
A0A2V8GTX0      -------RLAIIIKHWK-ACAAIAVLVIAGMMYQTFTTVPLYRAQARIQI---DEE--QT
A0A2V8J0X9      -------RLNAVFKHRR-LSGTAFVLVVTAMMVQTYSTIPVYEAWSRVQI---QDE--RT
A0A523DUV7      -------GLRLLWVGKS-WILVIALLGLGVGFLATFLQVPIYSARALVQI---DPP--GQ
A0A372IRG7      -------FRKIIIKRKW-VILFCVLVGVGIAFYHIFTTIPQYEAISRMSI---DFS--RS
A0A1F2U158      -------RLAVVYRYKR-IALSVFLLTALALMIQGYSGEQVFQAKAQVLI---EDE--RS
A0A2V8F6S9      -------RLAVLYRYRR-IAITVFVLTTAALMIQGYSTTPMFEARAQIEI---DAE--RA
A0A4Q1SCH5      -------IFRAILKGKW-FILASTVLCGAIALIYITVTKPVYEADGIVRI---DPN--RS
A0A3D1ASD2      -------YVWVLRRHKW-KILGFVLACCIATLLVSTRLTPIYAATATVDV---DRQ--MP
A0A2N9MK30      -------YLWVLRRHRW-KILSFIGVSAIATLIVSARLTPMYEATVTVDV---DRK--VP
A0A4Q7YNP3      -------YLRILSRHRW-MIFASAIAGILLSFLLSFASLPYYRARTSLDI---QSL--NS
E8UZE1          -------IYRLLKRRKW-LVLLIFLVFVAASALYTLRLPKRYEALCKIDI---DLS--TP
A0A1V6HR88      --------MKVFTARWR-LIALTTLLAIAGGVLAYLVTPKEYRATTTILI---ERR--LS
A0A3E0P0A3      -------YGSILLRGWK-VLIAFAVLGLALGIARYLSAPVVYSATSQIQI---ERR--AP
A0A2V8EXP2      -------YVKVLHKRRV-AALTAFLLVFVSTAVYTFTAKPIYESKVQILI---EKE--NA
A0A2W4RYA1      -------YVRILYKRRW-LMASAFLTVMVAVALYTFTATPLYEARTRLLI---DSD---P
G8P0Y7          -------YWHILLKRKW-IVIVSVAIVLITTALISLHTTPIYEAVTKITI---SPP--TS
A0A5M8T4U7      -------VWRVVMKQRF-VILAVTIISFAAATVYSFRTKSVYESGGRLQI---NPN--VP
A0A3P0X3W6      -------YMWLLRRAWW-KIALFVVTCTALTAVACFLMTPVYEATVRLAV---DSK--VP
A0A1E3Y9R6      -------YLRVLYKRRW-VAIPGFLLVFVSGAIGSIRTVPVYEARTQIII---EKD--AR
A0A2W4TLP2      -------YLRVLYKRRW-VAIPGFLLVFLSGAIGSIRTVPVYEARTQLII---EKD--AR
A0A3R9WF43      -------LLRVLRRRWR-SAVLVAVVIALLGTVAVLLMTPRYSATATIEV---NRE--DH
A0A317HKM4      -------YARIVYRRRW-IIFLIVVAGLIGGALYNWTAPRIFEAGATLQI---EGD--TN
A0A523E0N1      -------IYFVLLKHRW-PFVAVILATWMFAFISKYTETPYYRATALIQI---DWG--KI
A0A523ECP2      -------YWYIILKRRW-VILAVFISVLSYTAVKALMRQPVYSATTILQI---DRG--RI
A0A2W0C122      -------VVRLLHKHVW-IILGCTSLSVSVSVLYAMRQPRLYRATTNIAI---DRD--SN
A0A2W0AUU7      -------VFRLLHKHLW-TIAACTSLALSISLLYAVHQPRLYRATANIAI---DRD--SN
A0A2W0BQL1      -------VFRLLHKHLW-TIAACTSLALSISLLYAVHQPRLYRATANIAI---DRD--SN
A0A4Q1SDL1      -------LSKIIRRRRR-TVYSIFGAILLLAILYCIFATRRYMATGIVQL---QKD--TD
A0A3P0XH15      -------IRKILIKRKW-LILAGIVVGLAFAAVYILTTIPQYEAIALIDI---NEG--QQ
A0A4R1LAZ7      -------VRKIFIRRKW-LLLAFALIGLGAGVLFLLMSVPLYEATARIDI---DPG--RS
A0A3M1WQW8      -------YWRIIKKRKW-IVLGVLMMVVTVVAIRMYRARPIYQASGKVII---NQQ--TP
A0A3N1JHC1      -------YLLLLRRHRF-AVMMIFALCLLGGLLYAFFVPKSYKAQTVLEI---TGI--NQ
C1F294          -------LRKLFLKRKW-IILICVLAGIGVALYHVETATPQYEAVSSVSI---DMN--KS
A0A2V9KA79      -------LVAIFKRRLW-LVLATTFVGTLCGGGASVLLPVRYRAQVLLAA---ESA--PT
A0A522PSP1      -------YWGAIRRHAL-RIAIFVAATFLFTGIILLRLPRKYESTCVIRL---DPS--VP
G8P085          -------IAQMLGRHKW-FILACIVIGTVVAVVYVKSVTPIYEATASIRI---DPG--RI
A0A4Q1SGQ1      -------LWQVMRRRRR-WVLWPTGAALLLATLYWLLATPRFQANGEIEV---QRE--SA
Q1ILD9          -------LFRIIVRRRK-LLAAGVLLGILLATAYCILKTRRYEGEATVYV---HPE--GS
Q1IJZ6          -------VIRILRKRKN-LILGAAGACLACALLLSFVMRSYYNSSATIEI---QKD--QD
A0A2V8TCE6      -------FWSILVRRQW-AIYTVAGLVLGLTALRLLMVQSTYKAKALVEI---QRS--SP
A0A522TBE8      SGTPWVYYGRLLQRNLW-RLVTFVCVVTAVATLIALTRPKQYAAVTTLQV---DAL--GA
Q1ITG0          -------VLYVLRRHLQ-MIIGVTAFGVLVAILFCLFMKPRYEGMADLNV---HPE--ES
A0A3N5PCI5      -------VFAVLYKRRW-IALFTFLIAAAGVVTYTMSVTPIYEAHTQLLL---QQR--AS
A0A3M1Q0S9      -------YWQIVVRRRW-LIVTCVLVATVAALVSSLLATPVYRATCTLAI---ERT--GV
A0A2Z5G448      -------FRKILIKRQF-IILACLATGLILGAVITFFTTPVFESTARIDI---NPD--RS
A0A3M1VZ38      -------YWQILVRRRW-LIGTCVLVTTVAAAVSSFLATPIYKATTTISI---ERR--GV
A0A4Q1SD29      -------LRKVVFKRKW-IILACLLLGLGIGLYFALATIPQYEATARVHI---DFS--RS
A0A3M1PY35      -------LRRVLWQRRW-LVAAIALEVLLVGAVVTFLRTPLYEASARLII---EKT--MP
A0A3M1VMP2      -------VRKVLWQRRW-LVAAIAAEVFLLTALVTFLRTPVYTASARLLI---ERT--TP
A0A2V8G155      -------SLMVVYRRRW-TVVTAFVLATAGATVYTFSQPRLYEARTRLLI---ETE--NP
A0A2V8HDM7      -------SLMVVYRRRW-TVVTAFVLATAGATVYTFSQPRLYEARTRLLI---ETE--NP
A0A2V8DRT9      -------YVKIMYRRRW-PAGTAFMLVVLVVLVYTFTATPIYKARVQLLI---EDE--KS
A0A2V7VYF3      -------HLRVLYKRRW-TAVTTFVLVVLAMMLRTLNGIPVYEARVQLLI---DVE--AP
A0A1F2SVH2      -------YVKVLYKRRW-TALTAFLIVVLSVSVYTFTATPVFEARVQILI---EKE--AT
A0A2V8AJG9      -------YVKVLYKRRW-TAITAFLVVFLSVTIYTFTATPIYEAKVQILI---EKE--NT
A0A2N9LQU7      -------IWLKIWKRRV-AASLFASGIFLAVILYTFLKKPVYESVAQIRV---DSS--QQ
A0A2P6WFK7      -------ISRTIFKHKL-LILLTALTVFGIITLRTLTMTPVYESAVRLQV---DPS--RS
A0A2V8U914      --------MRVLYRRRV-TLLSVTLAGVFIAALLSMAQPRLYRSVASLEV---QGV--NE
A0A2V7W309      -------YWNVIRKRWK-VAAAIVLVVMIGTFLASYFSKPLYQSWIQIEV---EEE--SQ
A0A2W0BGU4      -------YWNILLRRRW-SILAVVFLATLTATLASLKMKPVYKATARIEV---EAD--TP
A0A2W0BVQ9      -------YWNILLRRRW-SILAVVFLATLTATLASLKMKPIYKATARIEV---EAD--TP
A0A2V9MN96      -------YWRILKKRKW-TIVATFAIILVLAIIATLRMPRLYEAASRIAI---YPE--NS
A0A2V7V2Z1      -------YIYVILRRRR-LVLAVFLGVAALATFRSLLTRPVYEASAQILI---ERD--TP
A0A2V7X2F7      -------YLAVVLRHRK-FALAIFLTATAVATIRTLLTRPVYMATAQILI---ERE--KS
A0A2V7V2I1      -------YLHVVLRRRR-LVLAVFLTVAAAATVRTLLTRPVYEADVQILI---ERE--NP
A0A2V7U3M2      -------YIYIVLRRRR-LVLAVFVAVTALATLRALLTRPVYEASAQILI---ERD--TP
A0A2V7UHT0      -------YIYVVLRRRR-LVLAIFLGVAALATLRALLTRPVYEASAQILI---ERD--TP
A0A2Z5FVL3      ---------------------------------MCILMTRRYTAVAEIQV---QKP--NS
A0A2V9KBD6      -------LWRIIRPHKW-ITAGFTLAVVAIVTVASLVMKPQYDAVGRMVV---VFH--RD
A0A2W0AJ66      -------LWRVVRSRKK-IIAAFAVMVVSTVMTASFLMKPRYDAVGR--V---LFF--RE
A0A1Q7RBU1      -------LWRIIRNRKW-TIAVFALVVVAIVVTASLLMKPQYEAVGR--V---VFH--RE
A0A2V9JPV9      -------LWRIIRNRKW-VIALFALVVVAIVATASFLMKPQYEAVGR--V---VFH--RE
A0A1I6MH75      -------ALMTLRKRKW-VLVACVLLGMVYGSYDAITQPRLYESHSRIQV---RSG--AS
E8WVF6          -------ALITLRKRRM-VLIIAVVLGTLFGFYKSVTQIKPYEAYGRLEV---NTG--AS
A0A1H5Z7N3      -------AWLTIRKRKY-WILAAALIGILLALYQSATQPRLFEAYGNIEI---RSG--AS
A0A2V9YHT3      -------YWHILVKRKA-VVLITLAVVFALVAFRTYRTTPLYESTGRVAI---YHE--SQ
A0A1G7JVV8      -------ALNVLRKRKW-VLIIAAILGILYGVYQAATQPIVYVATGRIQV---AKP--NG
A0A1H4T6W9      -------ALAVIRKRRW-ILIACAIVGILYGYYLASTQPIIFTATGRIQV---HEA--NS
I3ZEU5          -------ALAVIRKRKW-ILVACAVIAILYGYYTASTQPIIYTATGRIQI---HEA--NS
A0A428MDU2      -------ALITLRKRRW-ILITSVVLGIAYGVYKAETQPKLFEAFGRIEV---RSG--SS
A0A5B9EBI2      -------AILVLRKRRW-VLLIAIAVGLAYGMYRSVSQPRLYIATGRIEV---RSG--SS
A0A239HDF6      -------ALLTLRKRRW-VLIVAFVLGAAFGLYRAFFQPRIFEAYGRIQV---RTG--SA
A0A4Q0T270      -------ALTTLRKRKW-VLILAVLIGFAYGYWKASSQPRLFEAYARIQV---RSG--SS
A0A1Q3QQB6      -------AILTLKKRRK-ILILAILLGLGYGIYKAQTQPKLYEAVGRIQV---RSG--SS
A0A3N1K1G7      -------AIITLRKRRW-ILIVAVLLGLIYGVYKAETQPKLYEAYGRIQV---RSG--SS
A0A4V2G466      -------TLITLRKRKR-ILLVFVLLGLIYGIYRAETQPRIYEAFGRIQV---RSG--SS
A0A6B9YNQ8      -------TLVTLRKRKR-VLLAFVLAGLLYGIYAAETQPRIYEAFGRIQV---RSG--SS
                                                                            

A0A2V7VMF7      TF---MTVTDALAGMGNYWQNADF-----------YNTQFRVLKS----KTLGSRVVERL
A0A2V7YYV7      SN-LGTSDPNVIPLTPDQI----------------LRTYALLLTQ----RKLLDEVIADL
A0A2V7Z0J5      AQLLPSTDPNAPSISATTI----------------LATYALFMTE----PPLLNKVIADL
A0A2V7Z3M4      AQLLPSTDPNAPSVSSATI----------------LATYALFMTE----PPLLNKVISDL
A0A399Y5V2      SS---V----IADVAMPAEDPARE-----------LQTQIQVITS----RPVAEETAKRL
Q01X01          NF---LNLRDIFPTAAPSADSAVY-----------VQTQAEMLQQ----DALLERVVKKL
A0A3M2D9H8      SD---------------------------------ILNQNTELLS----QTFTELLVTRP
A0A2V8JK38      SL---VNLRDYYQADSD------------TYVDYMLQSYFRILKS----RSLARRVVTEL
A0A2V9IXG5      SPGADFNAQSSYYLNIDRY----------------FKTEKQKLTS----RRMHLLFAGRL
A0A2V9J2P4      SPGADFNAQSSYYLNIDRY----------------FKTEKQKLTS----RRMHLLFAGRL
A0A1Q7RLS4      KV-------SPVAEVAETGMAQYGWYAEERY----FNTQYEIIKS----RDVARRVFDRL
A0A2V2R525      PA---SGINGKPVVINNSASAP-------DY----FETQLEILKG----SGLLRRVVKTL
A0A321LPW6      A----VQGPSAAAVQDDS--DN-------FYPLVRIKTYMIELKS----RPLLSDVAARL
A0A2V9R9V4      A----RINSNGLFIQEED------------YLNVTMNTSEVILKS----LPLLEDVVVQL
A0A321LE75      T----LVKSGDVVISTDESDDA-------YYTSLVMKTKIRTLMS----RPLLEDVVIHL
A0A2V8R8U7      PV---LATGQV--I-INAPADA-------NF----WGTQLKLLQN----PQLARQVVLSL
A0A2V8QMP4      GV---LQTAGAGNL-IIRGSDP-------NY----WNTQLQKLKT----QKLARQVILRL
A0A2V8R4S3      GV---LQTAGAGNL-IIRGSDP-------NY----WNTQLQKLKT----QKLARQVILRL
A0A2V8NJ55      NI---LQTKEL--I-LNTGTDP-------YY----WNTQLKLLEN----PELARQVAITL
A0A2V8Q7I0      NV---LVSKDF--V-LNSQPDA-------NF----WGTQITLLQS----PALARQVALTL
A0A2V8S6K4      AL---IKTKDI--V-VNAGADP-------AY----WGTQLKLLEN----PSLLRQVIMRL
A0A317I2L9      NI---LQSDKL--V-IGGQLDP-------NF----WGTQLKLLES----PALARQVALTL
A0A2V8LLF9      SV---LSTGNLIIS---GQPDP-------NF----WGTQLRLLQN----PLLARQVIVSL
A0A352FRF4      SI---LQSGNGGGI-VIGQSDP-------NF----WGTQLNLLHN----EALARQVIVRL
A0A2V8MKV0      NI---LSSSQIVIT----QRDP-------NF----WGTQIKMLQN----PSLARQVILTL
A0A2V8PYY8      NI---LSSSQLVIV----QRDP-------NF----WGTQIKMLQN----AQLARQVILTL
A0A1Q7YKQ8      SI---LKAGNNVVINTGGGDDA-------QY----WNTQIKLLES----QQLARQVALTL
A0A352F3R7      SV---LQTKE--IV-ITGQNDP-------NF----WGTQLKLLEN----PALARQVVLTL
A0A0B6WXT1      SV---LQTKGDVQV-VSVPNDP-------NY----WSTQIKLLQN----PQLARQVALTL
A0A3B9MEU8      SV---LQTKE--IV-INAQSDP-------SF----WGTQLKLLEN----PALARQVVLTL
A0A2V8MHG6      NNPAIGALKGNSIFLNNPSQDP-------TY----FNTQIQILTS----AGLLGRVAKTL
A0A2V8P7N1      NNPAIGALKGNPIFLNNSSQDP-------TY----FNTQIQILTS----AGLLGRVARTL
A0A2V8M3M6      NNPAIGALKGNPIFLNNPSQDP-------TY----FNTQIQILTS----AGLLGRVARTL
A0A1Q7NJH5      NNPAIGALKGNPIFLNYPSQDP-------TY----FNTQIQILTS----AGLLGRVAKTL
A0A2V8PJY0      NNPAIGALKGNPIFLNNPSQDP-------TY----FNTQIQILTS----AGLLGRVAKTL
A0A1Q7Y6W9      INPALGTNR-NGVNINYRISDP-------AY----FNTQLQILNS----PGLLRRVVKTL
A0A2V8NC68      NNPALGSIKGNSIVLNTPYQDP-------TY----FNTQLQILSS----AGLLSRVVKTL
A0A399WK13      NPDL-VTTDRARPISNA---DP-------SY----FNTQLQLLWS----ESLLRRVVKEH
A0A352FLX4      NPLLGGMSKNSNVILNSETNDP-------AY----FNTQLQILTG----PGLLRSVAKTL
A0A2V8RTL7      NPDL-ITNDRQRVLSNP---DP-------SY----FNTQLQLLNS----DTLLRRVVKEH
A0A3E0PCJ6      NQDL-VTPDRRMPVMTS---DP-------AY----FNTQLQLLNS----EVLLRRVVKEL
A0A3M1S4R8      NPQL-QVSDRPTLLPNP---DP-------AY----FNTQLQLLTS----DSLLRRVVKEM
A0A1Q7YFI6      NPGI-GAMKNTSYILEQQYQDP-------TY----FNTQIQILSS----PGLLSRVVKTL
A0A136KC10      NPDL-VTNDRARPISNA---DP-------SY----FNTQLQLLWS----ESLLRRVVKEH
A0A2V8SEX6      NQDL-VTSDRQRPISNP---DP-------SY----FNTQLQLLDS----ENLLRQVVKEH
A0A3M2D6Y5      NPQL-QVTDRPALLSNP---DP-------AY----FNTQLQLLTS----DSLLRRVIKEM
A0A0B6WWQ6      SALS-LSPTGGPVVINRS-SDP-------TY----FSTQLQILTG----SQLLRRVVRTL
A0A3B9MK99      AD---LVGKT-PYYFGPT-NDP-------VY----FNTQLQILGS----PGLMRRVVKTL
A0A352EX26      GA---LVGKT-PYYMGSM-NDP-------VY----FNTQLQILGS----QALARRVVKTL
A0A2V8MM59      PM---YEGKTTQLIYSPV-NDP-------AY----FNTQLQILTS----QGLLRRVVKTL
A0A2V8PFE8      PM---YAGKSVPMIYSPV-NDP-------AY----FNTQLQILTS----PGLLRRVVKTL
A0A2V8PWS6      PM---YAGKSVPMIYSPV-NDP-------AY----FNTQLQILTS----PGLLRRVVKTL
A0A2V8LCT5      PM---YAGKTAPMIVSPV-NDP-------AY----FNTQLQILTS----QGLLRRVVKTL
A0A352FTJ9      PM---YAEKAAPMIVNPI-NDP-------AY----FNTQLQILTS----PGLLRRVVKTL
A0A2G6PYV5      DV---IGFTEKLQWNPYRE----------EY----FKTEFRIIKS----LPVAEEVARTL
A0A2V8F956      NV---VSFKAVLDEDQTRA----------DY----YQTQYNLLQS----RALALRTIDQL
A0A1F2S1W5      NV---VSFQEVLEQNEVTD----------DY----YETQYRLLQG----RGLARRTIDAL
A0A1F2T595      NV---LSFQQVFEQSDGAD----------DY----YETQYRILQG----RGLARRTIDAL
A0A2V8JQV5      NL---LNTREVNPSAPSVISTAF------EE----IQTQIKILKS----DSLIGQAMKRF
A0A2V9AC41      QI---LKVQDTRADSIDSGDYNN------EF----YKTQYEILRS----PALAERVIREE
A0A2V8K4L4      NF---LNLENLNPTSSPSGYLDPS-----YE----ILTQVKVFQS----RSLLQQTTERL
A0A2V8NCZ3      NF---LNMQNLNPTSVTGGW---G-----YE----IMTQVRVLQS----RSLMEKVTERL
A0A2V9MAM9      NF---LNLRDVNPTATAPTHSED------SY----IETQAEILRQ----DSLIGRAFNRL
A0A2V9M454      LL---QSLNDLFR--TEQADD--------SF----LASQISILQS----DNLAWETIQQL
A0A2V9IVR7      EI---RTLSDLFE--AMPADD--------MF----LQTQVNVLQS----DNLAWQTIEQL
A0A2V9ILE2      EI---RTLSDLFE--AMPADD--------MF----LQTQVNVLQS----DNLAWQTIEQL
A0A2V9LGY4      EI---RTLSDLFE--AMPADD--------MF----LQTQVNVLQS----DNLAWQTIEQL
A0A2V9J4D6      MN---LSAESLYRNESTPADE--------TF----LLTQTQVLRS----DNLAWETIQQL
A0A2V9L9C5      MN---LSAESLYRNESTPADE--------TF----LLTQTQVLRS----DNLAWETIQQL
A0A2N9M9N1      AL---QTLNELGP--SGATDA--------AF----LQTQVDLLQN----NNLSWQTMQEL
A0A2V9JEC4      QL---QTINEIDR--HAPVDS--------TF----LQTQVDLLQN----DSLMWQTIHRL
A0A2V9LPQ3      LT---MSVSDRFR--SMPADE--------AF----LKTQALVIGS----DHLAWETIGQL
A0A348V070      SV---LPFEELSRLSGG------------IN----SQSHAMLLKS----RSLAADVIEKM
A0A2Z5G3A3      DA---LRLESMMQGGAADEDALDEN----IT----LQTQTNILQS----DSLALRVIEDL
A0A2V7UGP8      NV---LTFQQVQPVGYDYMSYN-------DF----YQTQYRLLAS----HNVARKAMLKL
A0A239MKT6      SG---LGLQELSGLSDSLSGGMELN----TD----MLTHQRILQN----DNTALSVISSL
A0A3E0PCN7      PA---VGNDTSSSVILNSGSDP-------AY----FATQLQILEG----PGLLRRVVRTL
A0A2V8IYW3      SY---IRSTVT------------------NR----IEDRLRSIRE----QVLSRSMLEPI
G2LEI9          EK---ELYSSSGRIAFVPYSVDP------DY----LNTQIRKISS----PSLLVEVVKTL
A0A317J121      TV---TLFKNSGVSGNDEVSQ--------VN----IQTQIQLLRS----SSFLRRVMERL
A0A2V7YW66      NL---TPLGNGGQNPWLENYWNM------EF----YPTQYELLQS----RGLAERVVKSL
A0A2V7Z0V0      NL---TPLGN-TQNPWLENYWNM------EF----YPTQYELLQS----RGLAERVVKSL
A0A2V8GFD4      NV---VSFQEVVDQNKTTL----------DY----YQTQYRILQS----RAIARRSIADP
A0A2V8HSS5      NV---VSFQEVVDQNKTTL----------DY----YQTQYRILQS----RAIARRSIADP
A0A2V8KP55      SL---VNLRDYYQADSDTYVD--------YM----LQSYFRILKS----RSLARRVVTEL
A0A399WNU1      PA---AGEGTASSIILNPGSDP-------TY----FATQLQIIEG----PGLIRRVVKNL
A0A2V9CG11      NF---LDLKSVDPTVTADDYTTGA-----SY----FETQVKLLQS----ESLLERVIEKL
A0A2V2R0I6      NI---LPFQGPEAYDFYSDSE--------SY----IETQSKILTS----ETLALQTIRNS
A0A2V8XAR9      NI---LPFPGADSYDYMMDLE--------NY----IETQSKILTS----ETLALQTIRNT
A0A2V8VZA0      NI---LPFQGTDSYDYMMDLE--------NY----IETQSKILTS----ETLALQTIRNN
A0A1Q7CB82      NI---LPFQGTDSYDYMMDLE--------NY----IETQSKILTS----ETLALQTIRNN
A0A2V8WIU1      NI---LPFQGTDSYDYMMDLE--------NY----IETQSKILTS----ETLALQTIRNN
A0A1Q6Y9F5      NI---LPFQGAESYEYMMDLE--------NY----IETQSKILTS----ETLALLTIRNN
A0A2V9EVV8      NI---LPFQGAESYEYMMDLE--------NY----IETQSKILTS----ETLALLTIRNN
A0A2V8YF91      NL---LPFQGADPYDYTVDFD--------NY----IETQAKILTS----ETLALQTIRNG
A0A2V8XZK2      NI---LPFQGADSYDYMVDSE--------NY----IETQAKILTS----ETLVLQTIRDS
A0A2V8ZTX6      NI---LPFPGGESFDYMVDSE--------NY----IETQAKILTS----ETLALQTIRNN
A0A2V9BT79      NI---LPFQGADSYDYMMDSD--------NY----IETQSKILTS----ETLALQTIRNN
A0A1Q8B793      NF---LPFQPADPYAYLLDQE--------NY----IETQSKILTS----ETLALQTIRSV
A0A2V9BCA0      NF---LPFQPADPYAYLLDQE--------NY----IETQSKILTS----ETLALQTIRSV
A0A2V9BWU9      NF---LPFK-SDSYEMYMDME--------NY----IETQSKILQS----ETLALQTIQSA
A0A2V9DKX2      NF---LPFK-SDSYEMYMDME--------NY----IETQSKILQS----ETLALQTIQSA
A0A2V9JSI3      EV---QSISNFYRGTPSDE----------AF----LRTQVKVLES----DSLAWQTIQQL
A0A2V9WI32      VN---LGFKDSDQGTIGADYEDYN-----IA----LETQIRILQS----DALAFQVIKNL
A0A2V8IVN9      NV---VSFKEVINEEQTKA----------DY----YQTQYNILQS----RSLARRTLETL
A0A1F2TPT3      NL---VNVEDVIDQR--------------RP----LDTELAILRS----RWLAAKTVASL
A0A2V8JTQ2      GV---LGFRGADTSLLDDPEDR-------TA----IDTQIRILQT----DALAMQVIKNL
A0A2V8UZY0      GV---LGFKGVDTSLLEDPEDR-------AA----IDTQIGILQT----DALAMQVIKDL
A0A3N5YNR8      SI---LPYQPLNESAERYLSSE-------IY----LQTQLEILQS----RALARRVVDRL
A0A350UEK1      NF---MNMGNLQEVTEGSGPAGNM-----VD----LQTQIKILQS----DTLVDRVTAQL
A0A350UIQ4      NF---MNMGNLQEVTEGAGPSGST-----ID----IQTQIKILQS----DTLLERVHSLM
A0A3N6A5T6      NI---LPYEDVYQAADQGIAME-------TY----LQTQFKILQG----RTLAERIVKQL
A0A1F2Q9L4      SA---AAMQQPMQIDDWFDAQ--------SF----YPTQYRLLQS----RGLAERVVKNL
A0A1H5SQF5      TS---LSLEDLSGAGQQLIGGDQLS----VD----LLTQQAVIGN----ENIAMKVLEDL
A0A3E0NV31      NL---LPYQDLSARGGDQ-----------SN----IETQITLLRS----GNLLAKVVERL
A0A3N5M5V0      NI---LPYKDVYEGPERYLSSE-------VY----LQTQLEILQS----RALARRVVDRL
A0A2V9AEW6      NF---QEMKGID---SNGNYVSQE-----SY----VETQVKLLQS----ESLIEHVIDKM
A0A2V8WQK6      NF---PEMKGAN--DSNGSYASPE-----SY----VETQVKILQS----ESVIEHVIDKL
A0A2V8XIF4      NF---VEIKGGDPSGSTASIASPE-----SY----VETQVRRLQS----ESLLERVIDKL
A0A3N5XQP8      KV---LPYQEIYQVAMDPRSME-------SD----LRTQYSILQS----RTMARGVIKRL
A0A2Z5G7H4      DA---LGLD--SMMGGAEDASDALDAN--IT----LQTQADLLES----DTLALQVIEAL
A0A2V9L5B5      QV---LNFREVSQEAPTVDVD--------SY----RETQYKILRS----RTLAEKVVNDL
A0A2V9LK56      SV---VNFKEILQVASA-DVE--------SY----RETQYRVLES----RSLAESVVKDL
A0A2V9L7I0      QV---LSFKEVTQAAPTVDVD--------SY----RETQYKVLQS----RTLAEKVVNDL
A0A522PPT0      QV---LSFQQIAQAGPSWDLQ--------SY----RETQYQILKS----RSLAERVVRDL
A0A2V9KCS3      NL---MNTR------QIDPTPGTNDMYVQTD----ILTQIKILQS----DSLMERVVTKL
A0A2U3KC61      NV---LGFK------DVENNLP--DFDYQAT----LETQAAILRS----DVLALKVIKAM
A0A2V9Y2R7      NA---LGLK------DGDGGSPGEDWDYNVT----LETQTAILRS----DALALKVIETM
A0A372IT17      GA---FGLDNGVLGDTSHEASDALENS--MS----IETQAGILES----DTLALHVIRAL
A0A136JPP4      AP---TAKDAININFGLDET---------TY----YNTQLQLLQN----PDLMKKAVVAL
A0A399WUJ8      AP---T--DAININLGGDET---------TY----YNTQLQLLQN----PDLMKKVVLAL
A0A2V9NGH6      AL---ISFKDSANA-GPDYYDP-------SD----LDTEVGILKS----DLLAFQVIKQL
A0A2V9PYE6      AL---ISFKDSPSV-GPDYYDP-------SD----LDTEVGILKS----DLLTFQVIKQL
A0A2V9NL07      ML---QNLRDPGNS-GMDYYDP-------TD----LDTEVRILHS----DLLALQVIKQL
A0A2V9QD92      ML---QNLRDPGNS-GMDYYDP-------TD----LDTEVRILHS----DLLALQVIKQL
A0A2V9WPZ6      GL---VNFKDSGSM-SIDYYDP-------AD----LDTEVKILQS----DLLALQVIKQL
A0A2V9ZLH4      SF---INFKDSASA-S-DYYDP-------AD----LDTEVKILKS----DLLALQVIKQL
A0A2V9RQF1      AL---LNIKDSANA-PIEYYDP-------AD----LDTEVRILKS----DLLALQVIRQL
A0A2V9YDK8      GL---VNFKDSGSV-SVDYFDP-------AD----LDTEVKILQS----DLLALQVIKQL
A0A2V9V8F7      GL---VNFKDSGSM-SIDYYDP-------AD----LDTEVKILQS----DLLALQVIKQL
A0A2V9XGR9      GL---VNFKDSGSM-SIDYYDP-------AD----LDTEVKILQS----DLLALQVIKQL
A0A2V9V3Q5      NL---VTFKDSMPV--MDYYDP-------TD----LDTETRILQS----DILALQVIRQL
A0A2V9NWS3      AL---LNFKDSPSA-AVDYSDP-------TE----LDTEVRILKS----DLLALQVIRQL
A0A2V9USA9      T----LNFQNSATF-SLDYYDP-------TE----LDTEVKILQS----DLLALQVIKEL
A0A2V9XW18      T----LNFQNSATF-SLDYFDP-------TE----LDTEVKILQS----DLLAMQVIREL
A0A4R1LC91      ------PADSLGLDVSGNGGAGGDALDANIT----METEANILQS----DTLALKVIKEL
A0A3M2BZG9      QL---ATIA------MGGATNWLEEWWNLEY----YPTQYRLLRS----RGMAERVIQNL
A0A1Q7N5R7      NG---PERGPIGANQLLVASAW-------TD----LLKSYVVLDA----VARERRLYLQA
A0A3M1SIV3      KI---QSKDTININFGYDL----------NY----YNTQEKLLES----PELMKEVVVKL
A0A3E0PHB0      KA---TDSQSVILNFGYDQ----------NY----YNTQLQLMRS----EDVMRDVVVKM
A0A3M2D491      KI---QSKDTININFGYDM----------NY----YNTQEKLLES----PELIKEAVIKL
A0A357F267      KV---TSKDSININFGNDA----------NY----YATQLQLLQN----ADLMRRVVVDL
A0A353C9L6      KV---TSKDAININFGQDA----------NY----YQTQLMLLRN----RDLVKQVVIDL
A0A2V8RQV0      KV---TSKDSININFGNDA----------NY----YNTQLELLKN----PELMKKVVISL
A0A2V8SJH5      KV---QSKESININFGNDA----------NY----YNTQLELLQS----HDLMKEVVIRL
A0A2V9QB26      DF---LNIK------QVTPVSEGNSSTALTE----IATQVRLLQS----ESLIKRVLTKL
A0A2V9VYY4      NV---LGFKDAENI-APDYEYE-------AT----LETQVAILRS----DALALKVIEGM
A0A2V9KIE8      NV---LNFK--EVLQISNQDVD-------SY----RETQFRVLES----RTLAERVVRDL
A0A352F549      AL---GASRGESFYPENGYMEP-------EY----FNTQVQILTS----PTLLRRVAKNL
A0A3B9MLP9      AL---GASRGGSYYVDNTYMDP-------EY----FNTQVQIISS----PTLLRRVAKTL
A0A3D5SQ87      AL---GASRGGSYYVDNTYMDP-------EY----FNTQVQIISS----PTLLRRVAKTL
A0A2V8NW86      DF---LNIK------QVNPVSEGDSSTVLTE----IATQVRLLQS----ESLIKRVLTKL
A0A2V8ZHL8      QI---QSFN--DLY-RQVPTDE-------AF----IGTQIQVLES----DNLAQRTIEQL
A0A2V9B240      QI---QSLN--DLY-RQVPTDD-------AF----IGTQIQVLES----DNLAQRTIEQL
A0A2V9CBM2      DI---PTIQ--ELY-QLETVSD-------DY----LRTQYDILAS----DSLARRVIDQL
A0A2V8XN17      DI---PTIK--EMY-ELDAVSD-------AY----LRTQYSILAS----ESLARQVIDQL
A0A2V8WX45      DI---PTIK--ELY-ELEAVSD-------AY----LRTQYNILAS----ESLSRRVIEQL
A0A1Q6YR79      DI---PTIK--EMY-ELDAVSD-------AY----LRTQYSILAS----ESLARRVIDQL
A0A1Q7VA32      DI---PTIK--EMY-ELDAVSD-------AY----LRTQYSILAS----ESLARRVIDQL
A0A2V9EY85      DI---PTIK--ELY-ELDAVSD-------AY----LRTQYSILAS----ESLARRVIDQL
A0A2V9H8K0      DI---PTIK--ELY-ELDAVSD-------AY----LRTQYSILAS----DSLARHAIGQL
A0A2V9FFE5      DI---PTIK--ELY-ELDAVSD-------AY----LRTQYSILAS----ESLARRAIDQL
A0A2V9GM43      DI---PTIK--ELY-ELDAVSD-------AY----LRTQYSILAS----ESLARRAIDQL
A0A1F2RFI7      NI---FSFK--DFVADIDPFDE-------SY----LETAYKVLQS----RTLARRVIDKL
A0A1F2RZS3      NI---LSFQ--GFVAEMNPYDD-------SY----LETAYKVLQS----RSLAYRVINKL
A0A1F2USE2      GL---ATVQ--ELF-ELDAVSD-------TY----LETQYKILGS----ESLARRVINQL
A0A2V9C238      NI---LTVQ--ELF-ALDTVSD-------TY----LETQFKILQS----DTLARRVIEGL
A0A1F2Q9F5      NI---LTVQ--ELF-QIESASD-------TY----LETQYRILES----ESLARRVVDQL
A0A1F2QQH9      NI---LTVQ--ELF-QIESASD-------TY----LETQYRILES----ESLARRVVDQL
A0A1F2QXK7      NI---LTVQ--ELF-QIESASD-------TY----LETQYRILES----ESLARRVVDQL
A0A2V9DEM9      NI---LTVQ--ELF-ALDTVSD-------TY----LETQFKILQS----DTLARRVIEGL
A0A2V9CYQ5      DI---PTIQ--ELY-QLETVSD-------DY----LRTQYDILAS----DSLARRVIDQL
A0A2V9BWU8      DI---PTIK--DLY-ELESVSD-------SY----LKTQYTILAS----DSIARRVIDQL
A0A2V8ZG48      DI---PTIK--DLY-ELESVSD-------SY----LKTQYSILAS----ESVARQVIDQL
A0A2V8Y334      DI---PTIK--DLY-ELESVSD-------SY----LKTQYSILAS----ESVVRRVIDQL
A0A2V9AY68      DI---PTIK--DLY-ELESVSD-------SY----LKTQYSILAS----ESVARRVIDQL
A0A257VBK0      QP---MSGF------NPTGASSWMEEQKF------YNSQQQIMTS----SVVMQDVVDKL
A0A2V7XDY0      TF---MSV-------QEALGGGYWQNADF------YNTQFRVLRS----SALGEKVLDRL
A0A350UQT3      KG---IVGQE-----SQANVPSALDAESF------LASQIRLLQS----DSVVRPVAQRF
A0A2U3JZ71      SA---IIG-------QESTRTVANDSDQF------LATQAKLIQS----DSVLRPVAQQY
A0A2V8TTB0      TG---VLG-------PESLQNATNDADQF------LATQMKLIQS----DSVLRPVVDKF
A0A1F2TCR2      IA---VANL------NANDPMFWQDSTQY------YNTQYSILKS----RVLGQRVVRRL
A0A1F2V330      NY---VQTMDGSV--------------AR------VQDQLLTIREVLFSRPVLEPVMRNF
A0A662EE63      IN---NNQFDAFV--------SYWQLDRY------ISDQVQVLET----DRLAKRVVDQL
A0A2V8TLH7      KV---APVADVSQ--LGTSNFGWSAEERY------FNTQNEIIKS----RDVAQRVFDKL
A0A1Q7ZJT1      KV---SPVAEVAE--TGMAQYGWYAEERY------FNTQYEIIKS----RDVARRVFDRL
A0A2V8VC99      KV---SPVADVAE--MGASQYGWFAEERY------FNTQYEIIKS----RDVARRVFDRL
A0A348UZU3      IL---S---------FEDIFQIETFRDDY------FQTQYKLLQS----RSLAERTIERL
Q01XL7          SF---MNMSQVD---PQAGTDMTTASASN------IQTQTRILTS----RSMLARVAERM
A0A2V8ERZ5      TA---VPGL------QNDANQYYEDPEPY------YQTQYKILKG----RDLTRRVVRKL
A0A2V8GTX0      TA---QVDF------KQPELVY-SDPEPY------YQTQYKILQG----RDLALRAVKRV
A0A2V8J0X9      TQ---VGTL------NASDPAFWQESGPY------YQTQYSILQS----RGLGRRVVRKL
A0A523DUV7      NI---SQLSNPYP----TSAFNYFDYRNY------YNTQYRIIRS----KSLGERSIEKL
A0A372IRG7      TN---IGIEDIIE----SKLSGGEESDQK------LQTELRIMQS----DSVVMDVINSL
A0A1F2U158      TA---MPGI------AAAD--YYQDPIPY------YNTQYRILRG----RDLARRVVKRI
A0A2V8F6S9      TA---LPGI------TTPDNTYYEDPEPY------YKTQYRIIKG----RELTRRVVKKL
A0A4Q1SCH5      GT---LGLTDALL----------GANSDE------VPTEIGILGS----AQVALSALEML
A0A3D1ASD2      TN---VLG-------QDSGRAPVNDADEY------LATQINLIKA----DSVVRPVVQKL
A0A2N9MK30      TA---VVG-------QDSTQTGLNDADQF------LATQIKLIQS----DAVLRPVADQY
A0A4Q7YNP3      DF---MNMRAV----APTGEGNGSSAETN------VQTQIKLLQS----DTLLQRTKARL
E8UZE1          KS---VLA-------LDSQSTASVATEQK------MATQLSILES----QSIAWKVIEEL
A0A1V6HR88      IP---VQS-------AVEAAWENYYSMEF------YPTQYRLLQS----RGLAERTVQNL
A0A3E0P0A3      NL---L---------GGQMFAQPWWNPEF------FPTQEQLLKG----RGLAEAVTRDL
A0A2V8EXP2      NV---VTFKEVFE--------QNQVADDY------YQTQYKILQG----RALARRTLDAL
A0A2W4RYA1      NI---VSFEGVVD--------QEQAQPDY------YTTQINLLRS----RLLARRTIEAL
G8P0Y7          NP---LNFKD-----NNSSSSALEDPQAG------INTQVKILQS----DTMAELVIHRM
A0A5M8T4U7      KV---GLQ-------GYGDQERSSADTSA------IQTELLILQS----DSVLLQTAEKL
A0A3P0X3W6      AS---VIG-------QDSATPNISDVEEF------LTTEIDLLQS----DAVLRPVAKAY
A0A1E3Y9R6      RN---TSIN------TVLEERESWYQDDF------YPTQYRVLQS----RTLAQRTARVL
A0A2W4TLP2      RA---TSIN------TVLEDRDSWYQDDF------YPTQYRILQS----RTLASRTAAAI
A0A3R9WF43      EE---ASGPR-----TDTPSDSADDLKAE------VQTDTSILQS----DGLVLRVIKDL
A0A317HKM4      IL---ALDRPLVD--------QRDWMSTF------LPTQVGILMS----ADLARTAHDEL
A0A523E0N1      NV---V---------QDVMINPSRTYADI------YGTQEKIVNS----RQLAEHVVEDL
A0A523ECP2      NL---VQDVMVQD--------YWSGYDEF------YPTQQRVLMS----RNLSRRIVKHL
A0A2W0C122      AT---VPLNKAFA----SALGDADDYSVS------LETQIRVLAS----RSLAEVVVRKL
A0A2W0AUU7      AG---VSLNKTFA----SPLGDADDYSVS------LETQIHVIAS----RSLALAVVRKL
A0A2W0BQL1      AG---VSLNKTFA----SPLGDADDYSVS------LETQIHVIAS----RSLALAVVRKL
A0A4Q1SDL1      SG---LSMSDLQNNAAAGGGDDALAANIN------LETQSQILQS----DTLALRVIEDL
A0A3P0XH15      SN---IGISELVQ----QEQGGIEADLTR------TATEIAIMQS----DTVSLDVINSL
A0A4R1LAZ7      TN---IGINDLIE----QKLTGGEGSSDR------MQTEIRIMQS----DSVSMAVINSQ
A0A3M1WQW8      VP---LAN-------RQEALPYSSNDTQY------LRTQINVLQS----RTLARRVIEEL
A0A3N1JHC1      DF---MNTR------DADPYANGVTQDSY------LETQIMLLKN----EVVADRVAMVM
C1F294          TG---VELT------SLASSSGGLQSQDR------VETQLHIMQS----NTIAWNVIKTL
A0A2V9KA79      RD---YLRL------------GGYGDAIH------IQDQLRIIKEHLYKPALLERIIREF
A0A522PSP1      VS---VVN-------NQPGTVSLDSMDVL------FATATKEIIT----PAVVTPAILKL
G8P085          GS---LGLADLTG--------TQADSAEL------IATEMAIIKS----DAVAIDTMHSL
A0A4Q1SGQ1      AA---FGLDNSVNGEPSQAEGDSLDYSMT------LETESKILES----PTLALRVMHDL
Q1ILD9          DV---LGSMPDLG--LS----SGMDWNSQ------LATQIKILQS----DALAWDVVKRL
Q1IJZ6          AS---LGSALDTL--ASTVGGGSGDTKTE------VQTQVAILQS----DDLAIETIERT
A0A2V8TCE6      DV---LAFR-DII--RTDP--SYQGYSAF------YETQYRILQS----RAVARRAAERL
A0A522TBE8      QV---VGDE-HLQ--RA----STADSDAL------VLTDQTVMTS----PAVLLQVVEQL
Q1ITG0          AA---LDMG-ALG--DLATGAGGLDWSSK------LETQARILKS----DTLAWDVISQL
A0A3N5PCI5      IV---TFEG-AAD--PQA------NERGY------LETQHRLLRS----RSLARRVIDAL
A0A3M1Q0S9      RV---LRET-LSS--AEP---SWLDYQNW------YNTQYQIMQS----DEVLRRAVDLL
A0A2Z5G448      TN---LGIS-DLL--NSKA--GGNDESTR------LLTEARILQS----DSVIFAVIESE
A0A3M1VZ38      RL---LNTS-LTA--TEP---SWLDYQNW------YNTQYRIISS----DAVLRYAVKQL
A0A4Q1SD29      AN---IGIE-DLI--QQQLG-GGGNAEDK------LQTEVEIMQS----ETVAMEVINSL
A0A3M1PY35      RV---LDSE-DVV--SAPV--GFFDTERF------YQTQYLLMRD----PAVLERALDND
A0A3M1VMP2      RV---LDTE-DVV--PMVW--NEYEIQRF------YQTQYLLLRD----PAVLRDALDRY
A0A2V8G155      NV-------VNFKAV----IDEDQTKAEY------YQTQYNIIQS----RAIARRALDEL
A0A2V8HDM7      NV-------VNFKAV----IDEDQTKAEY------YQTQYNIIQS----RAIGRRALDEL
A0A2V8DRT9      NV-------VSFKEV----IEQDKATNDY------YQTQYRILQS----RSLARRTLDRM
A0A2V7VYF3      KV-------LNFKDV----FDQGHSPYDYEF----TETQQKLLTS----RSLARKTLDAL
A0A1F2SVH2      NV-------VTFKEA----YEQNQVTDDY------YQTQYKILQS----RALARRTLDAL
A0A2V8AJG9      NV-------VTFKEA----FEQNQIADDY------YQTQYKILQS----RALARRTIDGL
A0A2N9LQU7      GS-------LGLEDLVSQKLADSDSEGGR------LQTELTILQC----PPVSMQVIKNL
A0A2P6WFK7      SS-------LGLDEMISQKLGGSDDINSV------LQTEVKVIQS----DTVAMRVIDSL
A0A2V8U914      NF-------LNLRDIDPAATPNASSNDVY------VKTQSEILQQ----DALIEQASDKL
A0A2V7W309      NV-----------TI-EDLFGIASSDQEF------LQTQYELLKS----RGLAMRVIEDH
A0A2W0BGU4      QT---QMLNDRYQQL--------QTDQDF------LRTQIQVLQS----DNLAWRTIEEL
A0A2W0BVQ9      QT---QMLNDRYQQL--------QTDQDF------LRTQVQVLQS----DNLAWRTIEQL
A0A2V9MN96      NV-------LGLKDLENGGMSEDWDYNVS------LETQLSILRS----DALALKVVEAL
A0A2V7V2Z1      SV-------LTFKEV-AQV---DAARDDY------YQTQYKLLQS----RALVRRVIESM
A0A2V7X2F7      NV-------LSFKDV-TEV---DAAKDDY------YQTQYRLLQS----RSLARRVVESL
A0A2V7V2I1      NV-------LTFKEV-ARV---DSERDDY------YQTQYKLLQS----RALVRKVIEEM
A0A2V7U3M2      NV-------LTFKEV-AQV---DAARDDY------YQTQYKLLQS----RLLARRVIETM
A0A2V7UHT0      NV-------LTFKEV-AQV---DAARDDY------YQTQYKLLQS----RALARRVIESM
A0A2Z5FVL3      DS---LTLDSNAASP-AGGDTDPNSASMN------LETQATVLES----PALAMKVIEDL
A0A2V9KBD6      ND----SGVLGFKGV-DTSLLEDPEDRAA------IDTQISILQT----DALALKVIQDL
A0A2W0AJ66      DE---GAGVLGFKGP-GSSLPEDADERAA------INTQIGILES----DGLASQVIHDL
A0A1Q7RBU1      ND----SGVLGFKSV-HPSLLEDPEDRAA------IDTQIGILQT----DALAMQVINDL
A0A2V9JPV9      ND----SGVLGFKGV-DTSLLEDPEDRAA------IDTQIGILET----DTLAMQVINDL
A0A1I6MH75      NE-------YRVSAV-PGM-GQDTQTK--------MNTEIAIMQS----DTLLLTVAREL
E8WVF6          NQ-------FKLSPF-SGL-GDDPQQK--------MMSEIAIITS----DTLLTTVAKEM
A0A1H5Z7N3      NE-------YKIGAA-TGGSGIESSSA-H------LPTQVSILKS----DTLLLTVARDL
A0A2V9YHT3      TL-------TGFKDS-VPIDADDWDYTVA------METQVRIMQS----DSLALKVAHDL
A0A1G7JVV8      QA-------SLGVAT-GNLTGSLQSED--------LETEVLIISS----ESLMLSVAQEM
A0A1H4T6W9      TA-------T-------QMMGSSLSQETN------LENELGIIMS----DSLLLNVARNM
I3ZEU5          AA-------T-------QLMGSVGSQETN------LENELGIITS----DSLLLNVARNM
A0A428MDU2      NE-------YRVSAV-QGYASDTAASK--------MLTEVAILQS----DSLMLTVAREM
A0A5B9EBI2      NE-------YRLTT----VGAPDTSNH--------LTTQSSILTS----ETLLLTVAREL
A0A239HDF6      DQ-------YKLTSP-VGL-GQDTMTQ--------MMTETAILQS----DTLLLTVAKDL
A0A4Q0T270      NE-------YKVSAS-TGI--SDPQTK--------MMTEIAILQS----DTLMLTVAREM
A0A1Q3QQB6      NE-------YRLSAV-QALGGTDTASK--------MLTEIAILRS----DSLMLTVARDM
A0A3N1K1G7      NE-------YRVTAV-QGYAGDAQSSR--------MLTEIAILQS----DSLMLTVAREL
A0A4V2G466      NE-------FRVSAV-PGM-ASDSGQR--------MLTEVAILQS----DSLMLSVAREM
A0A6B9YNQ8      NE-------YRVSSV-SGA-STDSSQR--------LLTEVAILQS----DSLMLTVAREM
                                                          .                 

A0A2V7VMF7      K---LDD-------RPPF------------------------------------------
A0A2V7YYV7      R---LKT-----------------------------------------------------
A0A2V7Z0J5      G---LKT-----------------------------------------------------
A0A2V7Z3M4      R---LNT-----------------------------------------------------
A0A399Y5V2      Q---LNV-------PPE--------------AIQA-------------------------
Q01X01          R---LED-------RPEYQRSSSLWDRLRPGTSQA-------------------------
A0A3M2D9H8      V---LEA-----------------------------------------------------
A0A2V8JK38      H---EEL-------EKEFAAPQRGFLAAQAGNLKKISSVEKTEQASDDEG----------
A0A2V9IXG5      K----QQ-------NPRFQN----------------------------------------
A0A2V9J2P4      K----QQ-------NPRFQN----------------------------------------
A0A1Q7RLS4      D---LYN-------HPLF------------------------------------------
A0A2V2R525      D---LEH-------NKAFFRPQM-GQRTTWQRLLDMVGMGRDSGDSSQPV---DDGVLMT
A0A321LPW6      R---LDQ-------RPEFLAAED--RRGVWSAIKSIGGRSALREAGESPPEQ------AS
A0A2V9R9V4      R---LDQ-------NPAFL-ASQ--KKSVWESLHEIAGKIQRDDASAPPAVF------TA
A0A321LE75      G---LDH-------NPQFMEVTR--KKSLVEAVQTIGSKFKQEVTSELPVLE------PG
A0A2V8R8U7      E---LQK-------NPSFLGGQA--QSSVFASLKRIFSGERIATPPAQNPA--AEQTVTM
A0A2V8QMP4      D---LQN-------SPAFFGTNR--GTGVIAGLRHIIARGKPTPTPQPAAG--GVPVLSD
A0A2V8R4S3      D---LQN-------SPAFFGTNR--GTGVIAGLRHIIARGKPTPTPQPAAG--GVPVLSD
A0A2V8NJ55      D---LQN-------NPTFFEGQA--SSGFFASIRRIFFGDKPAPAHVD-----KVPVVVN
A0A2V8Q7I0      D---LQH-------NPTFFGGQS--QGGIFASIKRMFAGDKAKPKISAPGPT-GLDVVRA
A0A2V8S6K4      G---LQN-------NPSFLGGQS--RPSIFTTLRRAFSRNKAQTNEQPQPADGGLTVANE
A0A317I2L9      D---LQH-------NPNFFGGGS--QGGFFASLRRILSGDQRRTKAKPAEPT-KLELVGE
A0A2V8LLF9      D---LQH-------NSRFLSGQA--QTSIVASLKRIFSRENAPAS-SPSTNA-TVEPISE
A0A352FRF4      D---LPH-------NPTFFGPQG--QSTIFASLKRIFSRDSVPKT-SPTPAA-GSVPLNE
A0A2V8MKV0      D---LPH-------NPNFLGGRA--NSGLFNSLKYLFSRTKIAPAPAPAASS-GEQTITQ
A0A2V8PYY8      D---LQH-------NPNFLGGRA--NGGLFNSLKYLFSRTKNAPSPAPATGS-SETTMSE
A0A1Q7YKQ8      D---LQN-------NSAFLGNQS--QHGLFTALRRIFSSERTTNA-SPATRT-NLPVISP
A0A352F3R7      D---LQH-------NPAFFGGQT--QGGVFSSLRRIFSKPKKATV-APAAPA-GLVVVGE
A0A0B6WXT1      D---LPN-------NPAFLSGQA--GPSLTSSLRRILSRRKKEEN-E---QG-KLQVVTD
A0A3B9MEU8      D---LQH-------NPAFFGGQS--QGGVFASLRRIFAKPKKASE-SPAVSS-GLTVVGE
A0A2V8MHG6      D---LEH-------NEGFLHPQSATRPSVWESLKGLVGLSKSQSKPREPE-G------YV
A0A2V8P7N1      D---LEH-------NQAFLHPQSAQDLSFGESLKGLIGLRKSQSKTKEQE-G------YV
A0A2V8M3M6      D---LEH-------NQAFLHPQSAQDLSFGESLKGLIGLRKSQSKTKEQE-G------YV
A0A1Q7NJH5      D---LEH-------NQAFLHPQSAQNLSFWESLKGLIGFKKSQSKTKEQE-E------YV
A0A2V8PJY0      D---LEH-------NQAFLHPQSAQNLSFWESLKGLIGFKKSQSKTKEQE-E------YV
A0A1Q7Y6W9      D---LEH-------NQAFVHPQSQSNRSTWQSILQMIGLSRSSTQEQNQQ-A-SQDIPLT
A0A2V8NC68      D---LEH-------NQAFLNPQSFNKRSTWDSIKRMFGLSDKKEREQEQK-L--DDAPLV
A0A399WK13      N---LDA-------NKEFQAAAKASSGSMLGRLLRSVGLASGDKQKQEES----VPIDPN
A0A352FLX4      D---LEH-------NPDFLRETSSKNKSTWLDIRGMLGLKAKTPPQSSTP----DVLPQS
A0A2V8RTL7      N---LDA-------NKDFQAAKNAHGTSAWRSMMKAVGLASDKSSNSPDANT-QKSEETN
A0A3E0PCJ6      N---LDT-------NEAFRKDSAEGSGSALRGMLTALGLASDDSKKEDVVE--EVPLASN
A0A3M1S4R8      N---LET-------NKEFQEERNRQQASTWRAILRSIGLAREETKKTRDLE--EV--LAG
A0A1Q7YFI6      D---LEH-------NQAFLNPQAAQSRSTWENLKRMFGFGRPANNQQSVP-Q-NMMPLVD
A0A136KC10      N---LDA-------NPEFQALARTDSTSTFGRILRSVGLASGETQKSEQLA----AIDPN
A0A2V8SEX6      S---LDT-------NKEFLTARSEG-TGILRAMLRAVGLA-SDPKKDTAPND-EFAASAN
A0A3M2D6Y5      N---LDT-------NKEFQEEKNQQRASAWRAFLRSIGLVREERRKEDTKID-EITPGMN
A0A0B6WWQ6      D---LEH-------NPEFLRPRAVRDLSPWLNLRRMLMLGTGQEKSAGQRGT-RGQMPLP
A0A3B9MK99      D---LEH-------NPDFFK-GTIQKRSTWQTIKRMAGFASADPPDVTAK-P-KDELQLR
A0A352EX26      D---LEH-------NPDFFK--GTQKRTTWQTVKMMAGFDNNVPKPDQSK-P-NDVLQLR
A0A2V8MM59      D---LEH-------NKGFLSPQSSQPHSTWQTIMQMSGFANPDPK-AGKQ-S-KE-LPLT
A0A2V8PFE8      D---LEH-------NQAFLRPQSLRQPSTWKTILQMWGVSGPEKKDPSTQ-P-KE-LPLT
A0A2V8PWS6      E---LEH-------DQAFLRPQTLRQRSTWKTILQMWGVSGPEKKDPSTQ-P-KE-LPLT
A0A2V8LCT5      D---LEH-------NQAFLRPQTAQPHSTWKTILQMLGVGGREKKETKQQ-N-NV-LPLT
A0A352FTJ9      D---LEH-------NQAFLRPTAAQPHSTWKTIVKMLGAGA-EKKDTVPA-P-NV-LPLT
A0A2G6PYV5      GVKYFREQEQEDAQPKNL------------------------LDLGTVNEPREKTQKTKE
A0A2V8F956      K---LWE-------TPPFRNDKRFSLKRMMLGAPALVGQYAVSGISRTGDAASDFSGTGG
A0A1F2S1W5      N---LWS-------HPQFTQPARPTVRSVIMMPVNAVARWFEPPRPVEPPDAAET-----
A0A1F2T595      D---LWR-------HPSLNQPPRLTIRGILFWPVGKLASWFEPARPPQAADAAET-----
A0A2V8JQV5      G---LTH-------SADPLTRLTRWRIALGIAKTSAA-----------------------
A0A2V9AC41      G---LQN-------LPLFGGKADKADSQKGLVANLKDGLKERVKGFVPDKPKVNAPPPDP
A0A2V8K4L4      L---KEK-------KTGY------------------------GTSTDRLAAWRKVLHIAP
A0A2V8NCZ3      L---NDK-------KTPY------------------------GTSSDRLAAWRKVFHLSS
A0A2V9MAM9      P---AER-------RGGLVLPGWSERLLPVFAPRSPGG----------------------
A0A2V9M454      G---LAR-------LPNS----------------------------GQTSPADGRVLGTP
A0A2V9IVR7      R---LGE-------NPAF----------------------------APPLKGASPQRGES
A0A2V9ILE2      R---LGE-------NPAF----------------------------APPLKGASPQRGES
A0A2V9LGY4      R---LGE-------NPAF----------------------------APPLKGASPQRGES
A0A2V9J4D6      K---LAD-------DPSF----------------------------TKGPQKQRKESIDS
A0A2V9L9C5      K---LAD-------DPSF----------------------------TKGPQKQRKESIDS
A0A2N9M9N1      G---LANGNTELGVGGDL----------------------------WPVSTSRSTVA---
A0A2V9JEC4      D---LES-------RPEF----------------------------NPRRTASSKSQLES
A0A2V9LPQ3      G---LAE-------NGAF----------------------------IPQTPKDASGQRAP
A0A348V070      K---LHS-------HPEF------------------------IAPKLPVKLQKEGVQPDN
A0A2Z5G3A3      H---LDK-------TPDFESKFNPIDMVLGI-----------FSPGGASDPPGASLQQSP
A0A2V7UGP8      D---LRN-------DPVVNRLVNR------------------VRHKGPFTRLAEIVRHSP
A0A239MKT6      N---LMQ-------EPPYNEIPKG------------------KLHDVYERERSLPLKDAP
A0A3E0PCN7      G---LEK-------NPEFLQPNQGE------QSTVWQNVLKMFGFYQTKSMTPVEFADKE
A0A2V8IYW3      I--------------------------------------------------LEFDLYPEQ
G2LEI9          K---LDR-------DPKFLATGPTTLSAALLDLIRSPRGPRKPPQSETKSAELPEASPTP
A0A317J121      Q---LET-------VPPP------------------------PVQNDIFSRLRRRLTTNT
A0A2V7YW66      D---LME-------DPAF------------------------NPGAAARKDGGRGPTAED
A0A2V7Z0V0      D---LME-------DPAF------------------------NPGAA--REGAKGGTAEA
A0A2V8GFD4      F---LAT-------NAQLSGGGRQMFDLQSLFNSVVAYVNGKMTGEAYSKSTAVDET---
A0A2V8HSS5      F---LAT-------NAQLSGGGRQMFDLQSLFNSVVAYVNGKMTGEAYSKSTAVDET---
A0A2V8KP55      H---EEL-------EKEF----------------------------AAPQRGFLAAQAGN
A0A399WNU1      D---LEH-------NPTFFRPGKDQDTTVWQNVARMFGLYSQPVRNQAESAPPAKNTLDL
A0A2V9CG11      N---L-------------------------------------REARKSHSIVRRMLRLSN
A0A2V2R0I6      G---LSA-------RPEF------------------------STPTGPSEAVAIGTL---
A0A2V8XAR9      G---LSA-------RPEF------------------------SSPNGPSEAMASGSL---
A0A2V8VZA0      A---LST-------RPEF------------------------SSPNGPSEAVASGSL---
A0A1Q7CB82      A---LST-------RPEF------------------------SSPNGPSEAVASGSL---
A0A2V8WIU1      A---LST-------RPEF------------------------SSPNGPSEAVASGSL---
A0A1Q6Y9F5      A---LST-------RPEF------------------------SSPNGPSEAVASGSL---
A0A2V9EVV8      A---LST-------RPEF------------------------SSPNGPSEAVASGSL---
A0A2V8YF91      G---LSD-------RPEF------------------------SGPGGPSEAVASGSL---
A0A2V8XZK2      G---LTA-------RPEF------------------------SVGGGPSEAVASGSL---
A0A2V8ZTX6      G---LAL-------RPEF------------------------AASGGPSEAVASGNL---
A0A2V9BT79      G---LAL-------RPEF------------------------AESGGISEAVANGNL---
A0A1Q8B793      G---LAG-------HPDF------------------------SEGGKPSEAVTTGSL---
A0A2V9BCA0      G---LAG-------HPDF------------------------SEGGKPSEAVTTGSL---
A0A2V9BWU9      G---LVE-------LPEF--------------------------GGQPGKASKPASVPVN
A0A2V9DKX2      G---LVE-------LPEF--------------------------GGQPGKASKPASVPVN
A0A2V9JSI3      G---IDQ-------SAEFSPPRGGKPVSPA------------------------------
A0A2V9WI32      K---LDN-------NPAF------------------------------------------
A0A2V8IVN9      K---LWE-------SGEFVTNKR-------------------GIVQTLAGGVASLFGKKA
A0A1F2TPT3      G---LIQ-------NEPVAGRGAGNGVGKRDGQAGKSGPDGWWSAASLFVSRAFGGFPPP
A0A2V8JTQ2      Q---LDK-------NPKFTARGGRA-----------------------------------
A0A2V8UZY0      H---LNK-------NPKFTGRVEQP-----------------------------------
A0A3N5YNR8      N---LAN-------DPRFSVPVREGVVTSQLSWLKRTVSNLRPGRSDAPKTGADESGAGR
A0A350UEK1      S--------------------------------------------NG---TTPAEPAA-P
A0A350UIQ4      N--------------------------------------------PGEEVAAPAEPASTP
A0A3N6A5T6      Q---LHE-------NPSFNAETSGGLLTDSLAGLIGGTIALLKGRQPETPDSAENRLDKD
A0A1F2Q9L4      R---LAD-------DPVF------------------------NPGRSRLPGGSGGAVTAS
A0A1H5SQF5      G---LTN-------SQPFLA----------------------LRPANATASGQSLLETDP
A0A3E0NV31      E---LTT-------RPEFVRSVDRG----------------------------FFLDAAE
A0A3N5M5V0      N---LAN-------DPRFEVPVREGLVTSQLGSVKKAMSGLFSKSDSGAAAANRESMPGM
A0A2V9AEW6      K---LHK-------EQPTT-----------------------AWGIFASRVHRLFAFSRT
A0A2V8WQK6      K---LQK-------ERPRT-----------------------GWRGLASRVQRIFAFSKA
A0A2V8XIF4      K---LRK-------ERPAT-----------------------GWRAFESRVQRFFDLSKT
A0A3N5XQP8      N---LTN-------ERLLQLREKSGVISETLRQVMRAVRGVIDRLIDEGGPGGQN-----
A0A2Z5G7H4      E---LET-------TRDYQPRYDALGSIFRL-----------LSPSGPADPLNASLENSP
A0A2V9L5B5      H---LYQ-------SPEFYRNRGLF-----------------GLYESDPEKIPS-SDPGP
A0A2V9LK56      E---LYR-------LPEFYRSRRLF-----------------GLFESDPARIPSPTED--
A0A2V9L7I0      R---LYL-------SPEFYRNQMFF-----------------GLFESDPEKIPSISQPGL
A0A522PPT0      R---LYR-------YPEFYQSRSFL-----------------GLVAKDPEKIPSASDPNP
A0A2V9KCS3      K---LDK-------KPAA------------------------LEQPTKLSAWRKALGLPQ
A0A2U3KC61      H---LDP-------NPQ---A---------------------EDAMQPDPARE-------
A0A2V9Y2R7      H---LDK-------DPRFVGS---------------------TAASQPNPGAQGLSELKP
A0A372IT17      D---LES-------TQNFFPAKKRGLTIPGWIFFW----------RSPLEPRSVPLEEAP
A0A136JPP4      G---LQR-------EPDLFGS--SN---RGFFASIKSLFVSPKSPETPKGALPVLTGTEN
A0A399WUJ8      G---LQR-------DPDLLGQ--SD---RGFFATIKSLFSGPAKAQAPQGTLPVLTGTEN
A0A2V9NGH6      N---LDK-------RPEF------------------------GGSGQ-AQSTSLELTTDI
A0A2V9PYE6      N---LDK-------RPDF------------------------GGSGP-AQSTSLGLTTDI
A0A2V9NL07      N---LDQ-------MPEF------------------------GGHGA-PPASSLALTTDA
A0A2V9QD92      N---LDQ-------MPEF------------------------GGHGA-PPASSLALTTDA
A0A2V9WPZ6      N---LDK-------RTEF------------------------GGKPD--SASSLNLAPDP
A0A2V9ZLH4      N---LDR-------RVEF------------------------GGKGDMPSPNALGITTDE
A0A2V9RQF1      N---LDK-------RPEF------------------------GGKGE-SSGNSLALTTDA
A0A2V9YDK8      N---LDK-------RSEL------------------------GRKPD--DASSLNLAPDP
A0A2V9V8F7      N---LDK-------RTEF------------------------GGKPD--SASSLNLAPDP
A0A2V9XGR9      N---LDK-------RTEF------------------------GGKPD--SASSLNLAPDP
A0A2V9V3Q5      N---LDK-------RPEY------------------------GGQSA----PQPNLVADP
A0A2V9NWS3      D---LDK-------RAEF------------------------GGNGQVPSPNSVQLTTDS
A0A2V9USA9      N---LDH-------SGGP------------------------NGRAP----SSLELTPDP
A0A2V9XW18      N---LDR-------RPEI------------------------AGQAPPIPSPSLDLT-DP
A0A4R1LC91      H---LES-------SPDFKPMF-NP---IGWALGL-------VSPKGPADPPNAPLEDSP
A0A3M2BZG9      H---LLQ-------DPTFTGR---------------------SADLLPGAADATTVDD--
A0A1Q7N5R7      RPRDMAV-------MATFAVADQYR---PGR-----------YHLKVDRTGQHFSLQDED
A0A3M1SIV3      G---LYR-------TPDLIIR--RN---SGITALFKSIFESEKDK---QEQIVLPVINES
A0A3E0PHB0      K---LYE-------KDSLYGG--KS---RGIFETLGAMFTGGPKN--SEEAGALPVVDSV
A0A3M2D491      G---LYR-------NPELFKG--QG---RGVIASIKSLFSGGSDE--PSKTQSLPVLSEN
A0A357F267      G---LYR-------EPDLFGD--GD---RGFFAAVTSIFSSTKEEEKEKEADSLPIVSDT
A0A353C9L6      G---LYR-------EPNLFGA--SE---RGILASLRSIFTGSGQN--AEVPSALPVVSEP
A0A2V8RQV0      G---LYR-------NKTLFGG--QN---AGILAGIKSLFSRSKAQ--TEEANALPVISDT
A0A2V8SJH5      G---LYK-------EADVFGE--ED---RGLLSGVRSMFSSRKAN--SGPDNSLPVVSEL
A0A2V9QB26      K----DR-------FPEDPKVRTSR---FSLWRKA-------------------SLPETK
A0A2V9VYY4      R---LYQ-------DPRFTAVKQSS---PES-----------------------AMGEPS
A0A2V9KIE8      A---LYR-------SPEF-----YR---KSILF---------GLMETTPANVPSPTDNAP
A0A352F549      D---LEH-------NRTFLDGRVEN---RSTWRSLLTMFGFSQKQAEAPKNQN-VLPDVN
A0A3B9MLP9      D---LEH-------NRTFLDSHVDN---RSTWQSLMRMFGLGSNPKNSAVAENGALPDRG
A0A3D5SQ87      D---LEH-------NRTFLDSHVDN---RSTWQSLMRMFGLGSNPKNSAVAENGALPDRG
A0A2V8NW86      R---DRF-------AEDPKVKTSRF---SLW--------------------RKAVLPELK
A0A2V8ZHL8      G---LA-----------------RE---PGWVLAA-------GSGNDGLPAQP-------
A0A2V9B240      G---LA-----------------RD---PAWALAV-------GLGNDVPPVQL-------
A0A2V9CBM2      R---LDT-------VSEF-----NA---PQLFS-W-------KWKKKAPTSQTFTVGPIP
A0A2V8XN17      Q---LEA-------LPEF-----NS---PRWWQFW-------PSKKKSPPPQTFTIGPVS
A0A2V8WX45      R---LDT-------LPEF-----NS---PRWWQIW-------PKTKKPSTAQTFAIGPVP
A0A1Q6YR79      Q---LET-------LPEF-----NS---PKWWQFW-------PRNKKSPAPQTFAIGPVP
A0A1Q7VA32      Q---LET-------LPEF-----NS---PKWWQFW-------PRNKKSPAPQTFAIGPVP
A0A2V9EY85      Q---LET-------LPEF-----NS---AKWWQLW-------PRKKKSPAPQTLAIGPVP
A0A2V9H8K0      G---LET-------LPEF-----NS---PRWWRFW-------QERRKPSTTQTLATGPVP
A0A2V9FFE5      R---LET-------LREF-----NS---RKWWQLW-------PETRKPSTTQTFTVGPLP
A0A2V9GM43      H---LET-------LREF-----NT---RKWWQLW-------PETRKPSTTQTFAVGPVP
A0A1F2RFI7      Q---LDK-------LPEY----DEK---PSW---F-------AKLLSKSRSESQQLPAED
A0A1F2RZS3      N---LAH-------SPEFAKEQESS---PSW---L-------GTLWPGGAEQPEGPLSPE
A0A1F2USE2      R---LDQ-------RAEF-----NP---PQPWWSW-------GGKETAAAAPTLVVGTSE
A0A2V9C238      R---LDK-------LEEF-----NP---RASQLGD-------AKPQNAAAAQSFTAGDT-
A0A1F2Q9F5      R---LDQ-------LAEF-----SR---PGFRLRG-------GKRETPASPQTFAVGAAG
A0A1F2QQH9      R---LDQ-------LAEF-----SR---PGFRLRG-------GKRETPASPQTFAVGAAG
A0A1F2QXK7      R---LDQ-------LAEF-----SR---PGFRLRG-------GKRETPASPQTFAVGAAG
A0A2V9DEM9      R---LDM-------LEEF-----NP---RASQLGD-------AKPQNAAAPQSFTAGDT-
A0A2V9CYQ5      R---LDT-------VSEF-----NA---PPL-LSW-------KWKKKAPRSQTFTVAPIP
A0A2V9BWU8      H---LDS-------LPEF-----NA---PKW-WSL-------KRFARAPQKQAFALGPAP
A0A2V8ZG48      H---LDT-------LPEF-----NR---PKW-WQF-------GKRLSLPRKQTFALDPVR
A0A2V8Y334      H---IDA-------LPEF-----NS---PKW-WQF-------RKKAFKPRNQTFALDQES
A0A2V9AY68      H---LDS-------LPEF-----NK---PKW-WQL-------QERFFTPHKQTLALDPAG
A0A257VBK0      K---LQS-------HEAF------------------------------------------
A0A2V7XDY0      K---L-------------------------------------------------------
A0A350UQT3      R---LLE-------SEQQ------------------------------------------
A0A2U3JZ71      R---LLD-------TEAEGS----------------------------------------
A0A2V8TTB0      R---LRE-------VEKDAL----------------------------------------
A0A1F2TCR2      H---LQD-------NPAFNGQAPPRRGPLIAVRNARASLGKAIRRLITRPIQTPAVEP--
A0A1F2V330      H---L-------------------------------------------------------
A0A662EE63      G---LAS-------LPEFEGRKPGP-----------------------------------
A0A2V8TLH7      D---LYH-------HPMFRKSSDP------------------------------------
A0A1Q7ZJT1      D---LYN-------HPLFKKSVDS------------------------------------
A0A2V8VC99      D---LYN-------HPLFKETTDP------------------------------------
A0A348UZU3      K---LWE-------KKEFSGGKNVTG----------------------------------
Q01XL7          S---LEM-------TPIASTPTTFFTKLRAHIPF--------------------------
A0A2V8ERZ5      R---LDT-------VPEFNGTKPAPPTASTLLQEAKDKIIGIAKP------NAPAEA---
A0A2V8GTX0      K---LED-------VPEFNGKGAKPPLLTQVISDLKAKIAAPFRG------QTAAPP---
A0A2V8J0X9      D---LQN-------SPLFNGSAPPPRDPLSLARQGRAAASAWLRGLIVKPPPAAAAP---
A0A523DUV7      D---LAD-------KPPFRDAKEPG-----------------------------------
A0A372IRG7      D---LYH-------RKPFSDMFAKQPY---------------------------------
A0A1F2U158      D---LQN-------VAEFNGTAKPAETPVTKARDAGDRLLRFLARTPTPIAEV-------
A0A2V8F6S9      N---LQD-------RAEFNGTERPRPTPFSMLREAEQRIVRLVRPAKEEPTEA-------
A0A4Q1SCH5      T---PEQ-------FQNYAGFSRSQMVFRLEDDQH-------------------------
A0A3D1ASD2      R---LRE-------VDGNDLME--------------------------------------
A0A2N9MK30      H---LRD-------LERK------------------------------------------
A0A4Q7YNP3      A---AEP-------HSATTPRLDLASRLIGMLHLP-------------------------
E8UZE1          K---LDA-------NPVFSGITSSATPKP-------------------------------
A0A1V6HR88      R---LDQ-------DPAFNPARASLAGSDEGG----------------------------
A0A3E0P0A3      A---LWN-------HRYFGGAVDRSSYVRPGEPV--------------------------
A0A2V8EXP2      R---LWD-------HPQFNPKGEAAFSLGALVTAPLRWLSAW--ATPPPAI-EPGG----
A0A2W4RYA1      D---AWN-------HPLLVPERGALAVVREGVASVMRWFRSPEGGVPDPAVGQAGG----
G8P0Y7          N---LDT-------RADFAGRAQTQSNGGIAVSQ--------------------------
A0A5M8T4U7      D---IYG-------RLRAGEHATPGSIAQYKL----------------------------
A0A3P0X3W6      H---LL------------------------------------------------------
A0A1E3Y9R6      A---REP-------AERVPAASTWSFSPSAVVGTTIAAVRHWFGPAPVLPAASDGADP--
A0A2W4TLP2      E---GGL-------PERVPPASSLSFSLSSLLGGAVSAVADMFGPGPV---PAAGGEE--
A0A3R9WF43      D---LAK-------KRPFLGAIVRGEADK-------------------------------
A0A317HKM4      T---SSE-------AA--------------------------------------------
A0A523E0N1      E---LWE-------HPLFAPDPD-------------------------------------
A0A523ECP2      R---LWE-------HPHFGGDK--------------------------------------
A0A2W0C122      D---LAH-------NAEFMRDANRQFAS--------------------------------
A0A2W0AUU7      D---LTH-------NAEFMRDANRQFAS--------------------------------
A0A2W0BQL1      D---LTH-------NAEFMRDANRQFAS--------------------------------
A0A4Q1SDL1      N---LEK-------NRDFQPHFNPIGWV-----------------MGLFAPKGIADPPGA
A0A3P0XH15      D---LYH-------KQPFAQVFVRQPY---------------------------------
A0A4R1LAZ7      D---LYH-------KKPFSKIFKQTPY---------------------------------
A0A3M1WQW8      S---LDR-------QPEFAGLA--------------------------------------
A0A3N1JHC1      A---PRV-------PP--------------------------------------------
C1F294          K---LYN-------KPPYSGVFKKAGY---------------------------------
A0A2V9KA79      G---L-------------------------------------------------------
A0A522PSP1      G---LWA-------PP--------------------------------------------
G8P085          S---DEE-------FREYAGPNAKQLAIPL------------------------------
A0A4Q1SGQ1      E---LET-------THDYFPQRTTGWHLP----------------AWLFFWRQPLEPLNI
Q1ILD9          R---LDQ-------KPPFAGDKLYTEGSG----------------TWYSHHGLRSLPNEP
Q1IJZ6          G---FEK-------HIGSY--------------------------WHLFPSGRVTSEQGL
A0A2V8TCE6      D---LPR-------HPLLPRKSPGLL-------------------QRTLAALRRALPRGE
A0A522TBE8      H---LQD-------NPAFRAP---------------------------------------
Q1ITG0          R---LDQ-------NEAFAT-------------------------KSLFGRSLQTPVGKD
A0A3N5PCI5      N---LWD-------LGRAPADGNAQPAGTFAFLGQWRSWLGRAVGAATGATSSQEKEP--
A0A3M1Q0S9      D---LMN-------TGLPGQDDSRENRFFSAI---------RKLRTTVVRTLSRTQVP--
A0A2Z5G448      N---LFA--------------------------------------KKPFSKVFEKQPYVL
A0A3M1VZ38      D---LEN-------RPTLLGEQADEEPSPFSL---------GGLRAKILSVIGRGAPE--
A0A4Q1SD29      D---LYH--------------------------------------KAPFDAIFKTSPY--
A0A3M1PY35      G---LRE--------------------------------------LLLASLRPEDEED--
A0A3M1VMP2      G---VRE--------------------------------------ALAPEL-TEPGED--
A0A2V8G155      K---LWN-------TPPFGGTAP--------------ADSPFSLRRVIALVHTTNAGPPP
A0A2V8HDM7      K---LWN-------TPPFGGTAP--------------ADSPFSLRRVIALVHTTNAGPPP
A0A2V8DRT9      G---AW-----------------DTFDSAKAPKKMSIRTAVASVVAPVFHLFVARKAIEP
A0A2V7VYF3      R---MWQ-------HPYFGGPTPNTTSSSSTRGAIGFTNGILALVRGAFQSKAETIGREK
A0A1F2SVH2      K---LWD-------HPQFNPKPDDSLTMRK------IALAPVVLVAGWFKPAQPL---EP
A0A2V8AJG9      K---LWE-------HPLLKPN-DDNLTVGK------IAAAPAAFVSSWFRTAAPV---GM
A0A2N9LQU7      D---LGH-------REEF-------------AGKTLMASVTA----------------ID
A0A2P6WFK7      E---LAK-------RPAF-------------AGK-YAASAKL----------------TN
A0A2V8U914      N---LAE-------RPEFQ------------PHS-GFWERLR----------------EA
A0A2V7W309      K---LLN-------DRDF-------------YGP-G----VE----------------GK
A0A2W0BGU4      R---LAD-------NRMF----------------------AD----------------ES
A0A2W0BVQ9      G---LAD-------NRMF----------------------AD----------------ES
A0A2V9MN96      H---LDS-------NPRFTGFVP--------VAN-DASRSIG----------------SA
A0A2V7V2Z1      S---LLQ-------DPEFGG-----------PRS-AEEIEAV----------------KA
A0A2V7X2F7      N---LLQ-------DPEFGG-----------PRS-PEEVKGA----------------LA
A0A2V7V2I1      D---LFQ-------DPEFGG-----------PQP-AEQRAAL----------------KA
A0A2V7U3M2      N---LLQ-------DPEFGG-----------PRS-PEEMEAV----------------KA
A0A2V7UHT0      N---LLQ-------DAEYGG-----------PRS-PEEIEAV----------------KA
A0A2Z5FVL3      H---LED-------TSAFKPHFTFTGWVNSLFSP-PPPADPA----------------GV
A0A2V9KBD6      R---LDQ-------NPMF-------------IGG-A------------------------
A0A2W0AJ66      H---LE--------NGKF-------------DGG-K------------------------
A0A1Q7RBU1      H---LDK-------NPKF-------------AGR-A------------------------
A0A2V9JPV9      H---LDT-------NPNF-------------ADR-A------------------------
A0A1I6MH75      N---LPN-------NSDF-------------LEI-K-G--KA----------------PH
E8WVF6          N---LAN-------NPTF-------------LSV-K-G--PI----------------PH
A0A1H5Z7N3      D---LAN-------NPWF-------------LGT-QKSKQAQ----------------PH
A0A2V9YHT3      G---W---------DKAF-------------APA-NAG--AI----------------PL
A0A1G7JVV8      N---LAN-------NPDF-------------MG-------SG----------------PY
A0A1H4T6W9      N---LVN-------NPDF-------------MGG-K----AA----------------RF
I3ZEU5          N---LIN-------NPDF-------------MGI-R----VG----------------KV
A0A428MDU2      D---LSN-------NPEF-------------LEV-K-G--PV----------------SH
A0A5B9EBI2      N---LNN-------EPAF-------------LGV-R-P--PV----------------PV
A0A239HDF6      D---LCN-------NPAF-------------LGR-KTA--PE----------------PR
A0A4Q0T270      N---LAN-------NPEF-------------LGV-K-G--KV----------------PH
A0A1Q3QQB6      N---LAN-------NPDF-------------IGK-D-A--------------------PH
A0A3N1K1G7      N---LSN-------NSEF-------------LEV-K-G--PL----------------PH
A0A4V2G466      D---LAN-------NPDF-------------LGG-N-A--PS----------------TR
A0A6B9YNQ8      D---LAN-------NPDF-------------LNG-P-A--PK----------------PR
                                                                            

A0A2V7VMF7      ----------------------------------------KDNPEAGALFVTHVGVEPI-
A0A2V7YYV7      ---------------------------------------------RPDDLAKRIKATPQ-
A0A2V7Z0J5      ---------------------------------------------TSDELVKQVKVTPDA
A0A2V7Z3M4      ---------------------------------------------TSDDLARQIKVTPD-
A0A399Y5V2      ----------------------------------------RVTAQVLGQ-----------
Q01X01          ----------------------------------------PVTRTAVDEVRKNLQIISS-
A0A3M2D9H8      ----------------------------------------ASERLGYYISSSQVRVQQV-
A0A2V8JK38      ----------------------------------------DQLRSLIDQYLDRITVKPL-
A0A2V9IXG5      ----------------------------------------QSSDGIAGELGGGISLAPV-
A0A2V9J2P4      ----------------------------------------QSSDGIAGELGGGISLAPV-
A0A1Q7RLS4      ----------------------------------------KKSVDSIGAFSEMIVVAPV-
A0A2V2R525      SSVAPAT-DKEDLAEI------------------------KRLNPFVGAIQSGLEVEQV-
A0A321LPW6      DAADTDKQ-PGPGADA------------------------NDLAALIRALDKNLSVEPI-
A0A2V9R9V4      TAMKSKIEGNRSPEEV------------------------ERLAPYVGMLEESLRVRPI-
A0A321LE75      VQIEGGID--RSPEES------------------------ARLAPFVAVLSGNLSPEPL-
A0A2V8R8U7      DEMKD--R-QLTPEEL------------------------ATLEPYEDAIIANETIEPI-
A0A2V8QMP4      AELSA--D-QIAPEQA------------------------QALEPYEDAMRAGLNIDAV-
A0A2V8R4S3      AELSA--D-QIAPEQA------------------------QALEPYEDAMRAGLNIDAV-
A0A2V8NJ55      PTIKN--E-QLSPEQL------------------------ERLEPYEDALRASLTVEPV-
A0A2V8Q7I0      AQLRD--Q-PLSPEEL------------------------AALEPYEDTIIANEDIDGI-
A0A2V8S6K4      AAPGD--ELKLTPEQL------------------------KQLEPYEDALAGNLTVDPV-
A0A317I2L9      SQLRD--Q-PLSPEEL------------------------AALEPYEDAIIGNEQVDGI-
A0A2V8LLF9      EDLRS--R-QFTAEEL------------------------TQLEPYEDAIAAGETVEAV-
A0A352FRF4      EALNN--Q-EFTPEQL------------------------AALEPYEDTITANEIIEPQ-
A0A2V8MKV0      DELIDKVN-NLTPEEV------------------------VRLEPYEDAITANEEVDTV-
A0A2V8PYY8      DELKNKIS-NLTPEEL------------------------VRLEPYEDAIIANEDVGIV-
A0A1Q7YKQ8      ERVTE--Q-QLTPEQL------------------------TRLEPYEDALAGNLTVEPV-
A0A352F3R7      SEVTG--D-SLTPEQL------------------------AELEPYEDGIIAGEAVEAV-
A0A0B6WXT1      SEVDA--E-NLTPEQL------------------------AKLEPYEEAILAGITVEPV-
A0A3B9MEU8      SEVTN--G-SLTPEQL------------------------AELEPYEDAIIAGETIEPV-
A0A2V8MHG6      LRPSSAL-SNDDIAQT------------------------NHLQPYVEMLQSQLSVKQL-
A0A2V8P7N1      LRPNSAL-SNDDIAEA------------------------NHLQPYVEMLQSQVSVKQL-
A0A2V8M3M6      LRPNSAL-SNDDIAEA------------------------NHLQPYVEMLQSQVSVKQL-
A0A1Q7NJH5      LRPNSAL-SNDDIAEA------------------------NHLQPYVEMLQSQVSVKPL-
A0A2V8PJY0      LRPNSAL-SNDDIAEA------------------------NHLQPYVEMLQSQVSVKPL-
A0A1Q7Y6W9      TNVASAV-ASEDLAEA------------------------KRLQPYVSMLQGGLKVDPVK
A0A2V8NC68      DRIAPAT-AREDLKEV------------------------NQLAPYIESLQGGLSVKEV-
A0A399WK13      STLA----SADEIAEA------------------------VRLTPFVEVIRRNLSVDPVR
A0A352FLX4      SSSSSST-AAQEQAEA------------------------ERLSDYVDDLQETLKVEPVK
A0A2V8RTL7      SSLV----SADEIAEA------------------------LRLSPYVDLIKEDLIVEPVR
A0A3E0PCJ6      TELA----TVEEMNEA------------------------VRLAPFVDAVQRDLIVDPVR
A0A3M1S4R8      MNLA----TAEEINEA------------------------VRLAPFVEILKKNLRVDPVR
A0A1Q7YFI6      SSLAPAT-IEGDIAEV------------------------NRLAPYVGMLQGGLSIKEI-
A0A136KC10      STLA----SADEIAEA------------------------VRLTPFVEVIRRSLSVDPVR
A0A2V8SEX6      SSLI----SSDEIAEA------------------------VRLAPYVEIIRKNMSVEPVR
A0A3M2D6Y5      --LA----SVEEMNEA------------------------IRLAPYVEIIKKKLQVEPVR
A0A0B6WWQ6      SEIAPATESQDDFDVA------------------------MRLDPYVRTIASSLKVDPVK
A0A3B9MK99      PAVAAAT-SQEDLVEA------------------------KRLAPYVGAVLGGLRVEPVK
A0A352EX26      TTVAPTT-SQEDLVEA------------------------KRLSPYVGAILGGLRVDPVK
A0A2V8MM59      TSFAPAT-SSEDLVEA------------------------KRLAPFVGALQGGLKVEPVR
A0A2V8PFE8      STVAAAT-SNDDLAEA------------------------KRLAPYVGALQGGLKVEPVR
A0A2V8PWS6      STVAAMT-SNDDLAEA------------------------KRLAPFVGALQGGLKVEPVR
A0A2V8LCT5      TSVAPAT-SSEDLVEA------------------------KRLAPYVGMLLGGLRVDPVR
A0A352FTJ9      SAMAPAV-SSDDLVEA------------------------KRLAPYVSALAAGLRVEPVR
A0A2G6PYV5      DQA-------------------------------------KEITKIASNLIGGVEIKEV-
A0A2V8F956      SAARTTESANPGPDET------------------------ASQSDAIDAFENALTIAPV-
A0A1F2S1W5      ----------------------------------------RVQSRVINRFLAALDVSAV-
A0A1F2T595      ----------------------------------------RTQTVVINRFLANLGVSAV-
A0A2V8JQV5      ----------------------------------------SAREAAISLAAATLQVEAL-
A0A2V9AC41      A---------------------------------------TAGKRLAGSYLSKLHISPV-
A0A2V8K4L4      KQA-------------------------------------LDRNNAIAAAAGGINVKAS-
A0A2V8NCZ3      KPA-------------------------------------IDRDRAIRMAGEDIKVKGS-
A0A2V9MAM9      ----------------------------------------NDDREAILRVKDRLRIEPS-
A0A2V9M454      PA---------------------------------------MKNAAVAAFKARLKVERP-
A0A2V9IVR7      AE---------------------------------------AESPLVGIFKGGLRVEIM-
A0A2V9ILE2      AE---------------------------------------AESPLVGIFKGGLRVEIM-
A0A2V9LGY4      AE---------------------------------------AESPLVGIFKGGLRVEIM-
A0A2V9J4D6      AD---------------------------------------VRGRLVKLFDSYLGVNLH-
A0A2V9L9C5      AD---------------------------------------VRGRLVKLFDSYLGVNLH-
A0A2N9M9N1      -----------------------------------------TPANLIRSFKKHLHIELL-
A0A2V9JEC4      LPP--------------------------------------LQDRLIRAFKKHLHVALM-
A0A2V9LPQ3      EPR-------------------------------------MLRDRLVREFQRSTTVRLM-
A0A348V070      P---------------------------------------VFKERLIDEFIESLNVSPL-
A0A2Z5G3A3      ----------------------------------------GRMSHALKVFSKNLTVTPV-
A0A2V7UGP8      LDEIPE----------------------------------DPDKPYIQFVLSGLDINPL-
A0A239MKT6      ----------------------------------------YTRDRVLAIFHKGLQVEVL-
A0A3E0PCN7      TEDALQLSLDSNEQPSEP----------------------EKLAPFVNSIRGNLSVNPV-
A0A2V8IYW3      RKQ-------------------------------------VPMEDVVARMRTEVDVDPP-
G2LEI9          ATTEDEL---------------------------------QRYAPQIGRLASGLQAYNV-
A0A317J121      QDPM------------------------------------ALMTSGLNVALATFDARPI-
A0A2V7YW66      DD--------------------------------------AVLGSLAEQVRGGLSVAPV-
A0A2V7Z0V0      DE--------------------------------------AVLGALADQLRGGLAVDPV-
A0A2V8GFD4      ----------------------------------------PLERRRVDAFLGALSIVPV-
A0A2V8HSS5      ----------------------------------------PLERRRVDAFLGALSIVPV-
A0A2V8KP55      LKKISSVEKTEQASDDEG----------------------DQLRSLIDQYLDRITVKPL-
A0A399WNU1      KTDTDADLDSQA----------------------------EQLAPYVGFIKRNLEVSPV-
A0A2V9CG11      SQH-------------------------------------VPEDELVHQAERNLTVRAA-
A0A2V2R0I6      -AN-------------------------------------QKRPPELGEFLGSLSVKRV-
A0A2V8XAR9      -AN-------------------------------------QKRPPELGEFLGSLSVKRV-
A0A2V8VZA0      -AN-------------------------------------QKRPPELAEFLGSLSVKRV-
A0A1Q7CB82      -AN-------------------------------------QKRPPELAEFLGSLSVKRV-
A0A2V8WIU1      -AN-------------------------------------QKRPPELAEFLGSLSVKRV-
A0A1Q6Y9F5      -AN-------------------------------------QKRPPELAEFLGSLSVKRV-
A0A2V9EVV8      -AN-------------------------------------QKRPPELAEFLGSLSVKRV-
A0A2V8YF91      -TN-------------------------------------QIRPQELGQFLGSLSVKRV-
A0A2V8XZK2      -AN-------------------------------------RTRPPELAEFLGSLSVRRV-
A0A2V8ZTX6      -AN-------------------------------------QTRPPELAEFLGNLSVKRV-
A0A2V9BT79      -AN-------------------------------------QTRPPELAAFLGNLSVRRV-
A0A1Q8B793      -AN-------------------------------------QNRPPELAAFLGSLTVKRV-
A0A2V9BCA0      -AN-------------------------------------QNRPPELAAFLGSLTVKRV-
A0A2V9BWU9      AAN-------------------------------------QARPPALGGFLGSLRVKRV-
A0A2V9DKX2      AAN-------------------------------------QARPPALGGFLGSLRVKRV-
A0A2V9JSI3      ----------------------------------------IVQISLINAFRDHLRVEWV-
A0A2V9WI32      -----------------------------------------AESSLLDRFRRGLKLNVV-
A0A2V8IVN9      PEPGIPDAGET-----------------------------SSQSRAVDAFLKRLTVSPV-
A0A1F2TPT3      PRAAEPLAGER-----------------------------PAEAPQISAFLGGLSLAPT-
A0A2V8JTQ2      ----------------------------------------ANQDALLQSFHKGLEISKV-
A0A2V8UZY0      ----------------------------------------DNEDRLVKSFHKSLRISKV-
A0A3N5YNR8      ----------------------------------------DKNRDVLDTFRDRLEVAQV-
A0A350UEK1      GRLAAWRQALNLPEEAAT----------------------GAKARAVEMAADTLKVRAS-
A0A350UIQ4      SRISAWRRALNLPDVPEN----------------------DARQHAIAMAADSLKVRAS-
A0A3N6A5T6      E---------------------------------------ADLSADVDRFLGSLQVQPI-
A0A1F2Q9L4      DDA-------------------------------------ATLAGLAYGVLGGLEVNPI-
A0A1H5SQF5      ----------------------------------------TYRDSAVNLFQSRLKITLV-
A0A3E0NV31      AGLDLIKNGFRPRRRGEA----------------------LSEAGALRRLQENLSIAPV-
A0A3N5M5V0      ----------------------------------------AENRAVIEKVLSRLEVTQV-
A0A2V9AEW6      GRL-------------------------------------SEREQMIRQVERNLTVQSS-
A0A2V8WQK6      SNL-------------------------------------PEREELIRQIKRNLTVRTS-
A0A2V8XIF4      PHL-------------------------------------PEKEELIRQIQRNLTVRES-
A0A3N5XQP8      ----------------------------------------DPTEYMIDRLLSDLQINPV-
A0A2Z5G7H4      ----------------------------------------RRRTRALKIFDANLNVKVV-
A0A2V9L5B5      PDT-------------LT----------------------DAYRNSVTHFLASVDVNPV-
A0A2V9LK56      LDP-------------SS----------------------EAFNNSIANFMNSMSVGPV-
A0A2V9L7I0      PDT-------------SS----------------------DAYVNAIAHFRKSVDVSPV-
A0A522PPT0      PDP-------------NS----------------------DAYLNSVTNFMRAVVVNPI-
A0A2V9KCS3      PAA-------------------------------------PSREQAAGMAAASVSVRSV-
A0A2U3KC61      -------------------------------------------AGLLGAFRGGLSVQII-
A0A2V9Y2R7      NND-------------------------------------EETTALLAAFHSGLSVRVI-
A0A372IT17      ----------------------------------------NRRYVALRIFARHLTVQPV-
A0A136JPP4      ADP-----AAVQLSPEEA----------------------ARAGQYAGILSGGLHVEQT-
A0A399WUJ8      ADP-----TAAQLSPEES----------------------ARANQYAAALSGGLRVDQT-
A0A2V9NGH6      LQP-------------DS----------------------VKASAVLASFKSDLKVLLK-
A0A2V9PYE6      LQP-------------DS----------------------VRTSEILAHFKSDLKVSLK-
A0A2V9NL07      FEA-------------DS----------------------ARANALLGAFKGGLHVVLE-
A0A2V9QD92      FEA-------------DS----------------------ARANALLGAFKGGLHVVLE-
A0A2V9WPZ6      LQT-------------DS----------------------TRTSALLSAVKGSLRVSLV-
A0A2V9ZLH4      LQI-------------NS----------------------SRVTNLLGAFKGNLKVTLQ-
A0A2V9RQF1      LQP-------------DS----------------------EQTTALLSAFKGNLRVALQ-
A0A2V9YDK8      LPT-------------DS----------------------ARTSALLAGFKGNLRVSLL-
A0A2V9V8F7      LQT-------------DS----------------------TRTSALLSAVKGSLRVSLV-
A0A2V9XGR9      LQT-------------DS----------------------TRTSALLSAVKGSLRVSLV-
A0A2V9V3Q5      LQN-------------DS----------------------KRTTALLGGFKGNLKVSLI-
A0A2V9NWS3      LQV-------------DS----------------------QRTTDLLSAFKGKLRVALE-
A0A2V9USA9      LQV-------------DS----------------------AHLSSVIGGFKGSLRVALS-
A0A2V9XW18      LQI-------------DP----------------------GRASSMIGGFKGNLRVTLS-
A0A4R1LC91      ----------------------------------------HKLSHMLKAFSHNLTVKPV-
A0A3M2BZG9      ----------------DA----------------------AELARQAMRLQSGLVVNPI-
A0A1Q7N5R7      GTELERGDVGAAIGRTDSLGFRWTPAAADLAPGAEIVFGVTTLRDASRGLSDGLRVSPD-
A0A3M1SIV3      DFQKSLDNLEAKLSPEEK----------------------EAVEKVTASLLPGVDVVQE-
A0A3E0PHB0      D---GETVDQINLTPEQS----------------------QRADKYTAALVNSLVVEKV-
A0A3M2D491      N-DEGFSSEEIKLSPEER----------------------LRVERITASLAGSVDAIQE-
A0A357F267      A-ESPSPSSALELTPEEE----------------------KRVQIYAAMLRGGLSVEQR-
A0A353C9L6      E-LLGEERPRTILSPDEE----------------------KRADQYAGILFSGLTVDQV-
A0A2V8RQV0      E-QLNSKGELAKLSPEEE----------------------ALANQHVGNLIGRLQIVPQ-
A0A2V8SJH5      P-AGTDASDNIQLTPEER----------------------ARVENYAAMLAGRVTVQPK-
A0A2V9QB26      PSD-------------ES----------------------GAAQAAARSLNARVS-----
A0A2V9VYY4      MQP-------------DP----------------------VQAAGLLGAFRGGLSVQPV-
A0A2V9KIE8      PDV-------------NS----------------------EAFTNAVKHFLDAVEISPV-
A0A352F549      SSPAFASAGFNADDPAEV----------------------ERLTPYAESLQGLVDVEQV-
A0A3B9MLP9      NQP-LTTSGLSLEDPAEV----------------------ERLAPYVDSLQGMLDVAQL-
A0A3D5SQ87      NQP-LTTSGLSLEDPAEV----------------------ERLAPYVDSLQGMLDVAQL-
A0A2V8NW86      LSD-------------ES----------------------GAVQAAAESLKARAS-----
A0A2V8ZHL8      -----------------Q----------------------NSEDKLLRLFKSRLHVQRV-
A0A2V9B240      -----------------Q----------------------VWEDRLLGPFKRRLHVQRV-
A0A2V9CBM2      A---------------DR----------------------ELYQRVLERFRDHLTIAPI-
A0A2V8XN17      EAR-------------DR----------------------ELSQRVLERFQDRLTIDPV-
A0A2V8WX45      AGG-------------DR----------------------ELSQRVLERFQDQLTVDPV-
A0A1Q6YR79      ETR-------------DR----------------------ELSQRVLERFQDRLTIDPV-
A0A1Q7VA32      ETR-------------DR----------------------ELSQRVLERFQDRLTIDPV-
A0A2V9EY85      EAP-------------DR----------------------ELSQRVLERFQDRLTIDPV-
A0A2V9H8K0      EVR-------------DR----------------------ELSQRVLERFLDRLTIDPV-
A0A2V9FFE5      QVR-------------DR----------------------ELSERVLERFLDRLTIDPV-
A0A2V9GM43      QVR-------------DR----------------------ELSERVLERFLDRLTIDPV-
A0A1F2RFI7      LAL-------------DP----------------------K-YYNVLDNFQDRLTVNPV-
A0A1F2RZS3      EQL-------------DP----------------------K-YSAVIDNFLGRLQIVPI-
A0A1F2USE2      PEQ-------------DP----------------------AAYQGVLRRFQDRLAVAPV-
A0A2V9C238      -ER-------------DP----------------------WAYQTALKRFRDRLSVDPI-
A0A1F2Q9F5      VAR-------------DP----------------------VAYQNALETFSRRLAVAPI-
A0A1F2QQH9      VAR-------------DP----------------------VAYQNALETFSRRLAVAPI-
A0A1F2QXK7      VAR-------------DP----------------------VAYQNALETFSRRLAVAPI-
A0A2V9DEM9      -ER-------------DP----------------------RAYQTALKRFRDRLSVDPI-
A0A2V9CYQ5      A---------------DR----------------------ELYQHVLERFRNHLTIAPI-
A0A2V9BWU8      VAH-------------DS----------------------AVYQRVLERFQDRLSIEPV-
A0A2V8ZG48      PGQ-------------DP----------------------EVYQRVLERFQGRLTVDPV-
A0A2V8Y334      SAR-------------DP----------------------EVYQRVLERFQDRLTVDPV-
A0A2V9AY68      RAR-------------DP----------------------EVYQRALGRFQDRLTVEPV-
A0A257VBK0      ----------------------------------------KDVKDPAAMLRGMTKVDNI-
A0A2V7XDY0      ---KDP----------------------------------AEHRDAGGEFMSHVNVEPI-
A0A350UQT3      LAKEGD----------------------------------QARAQDAPIVLRNLKVARP-
A0A2U3JZ71      DATLSR----------------------------------VPGAEDAPVLLKNLKVSRP-
A0A2V8TTB0      EQPSER----------------------------------WQGSDEAPVILKYLKITRP-
A0A1F2TCR2      AAPDEN----------------------------------AAEAGIISQFIGSINIIPE-
A0A1F2V330      LPMPDG----------------------------------KISDTDLDRMRESIKIT-V-
A0A662EE63      -----------------------------------------------GIVLGGLTVKPV-
A0A2V8TLH7      ----------------------------------------------VGVFSSMVQVELI-
A0A1Q7ZJT1      ----------------------------------------------IGEFSQMIVVAPV-
A0A2V8VC99      ----------------------------------------------IGTFSSAIEVEPI-
A0A348UZU3      EDLKNP----------------------------------VFRQKLVDKFLGRLEVKPI-
Q01XL7          AQKEPL----------------------------------EQMKEAVRTAAFTVSARGV-
A0A2V8ERZ5      PKVDET----------------------------------ADESGLVSAFIGRVSVDPV-
A0A2V8GTX0      PRPAGP----------------------------------VNENQQADAFLGRVQVVPV-
A0A2V8J0X9      PAPDEP----------------------------------AHEAGLISAFLGGLSIRPE-
A0A523DUV7      -----------------------------------------------RIFMSRVQVVPI-
A0A372IRG7      TGHLTP----------------------------------LQRYQLIRAFQSSEKVIVE-
A0A1F2U158      PKPDET----------------------------------ADESALVSRFLGRVQVVPV-
A0A2V8F6S9      PKVDEA----------------------------------PDESGLVSGFISRVTVAPI-
A0A4Q1SCH5      RPINLT----------------------------------PQQEDVLDKFQLALKAKQE-
A0A3D1ASD2      NTSEAR----------------------------------SAAAEDAPVRLKRLEVIRP-
A0A2N9MK30      ARAGSD----------------------------------QGLLIDAPVLLKQLKVTRP-
A0A4Q7YNP3      ISVGKP----------------------------------ISSDDLIEDTAKHVTVKPL-
E8UZE1          LNSLTD----------------------------------QERYSLIRRFQSGLGVQLE-
A0A1V6HR88      SAAADQ----------------------------------SALARLAGRLLGGLEVKPV-
A0A3E0P0A3      TADDDA----------------------------------VVVARLASRVRSGLSVQQV-
A0A2V8EXP2      VSAGET----------------------------------SAQARAIDRLLGGLTVTPI-
A0A2W4RYA1      QEPPET----------------------------------PEQTAVIDAFLRRVSVSPV-
G8P0Y7          SPAEES----------------------------------FRLESLIRKLQGNLTIQQI-
A0A5M8T4U7      PVVLSP----------------------------------VERRALIGYIRGGLSVKLV-
A0A3P0X3W6      PRDKKG----------------------------------KEFLPAGSVTLPGLTITHP-
A0A1E3Y9R6      APGAVS----------------------------------PQEAALTSRVQAGVSVVPV-
A0A2W4TLP2      PAAVES----------------------------------AARAALTSRIQGGIVVVPI-
A0A3R9WF43      PLEDAP----------------------------------RTRERMVKLFRKNLKVDSP-
A0A317HKM4      LPPNER----------------------------------LSQVPTVAEIAAARSIGGV-
A0A523E0N1      AHLDQK----------------------------------KVVSNIGRSIQAMANVSRV-
A0A523ECP2      THTADE----------------------------------QTLEDLAEQVAGMLQVTQI-
A0A2W0C122      LREIAP----------------------------------APESIAVQALLSGLSVKTI-
A0A2W0AUU7      LREAAP----------------------------------DPTDIAGEAVVSGLSVKTI-
A0A2W0BQL1      LQEAAP----------------------------------DPTDIAGEAVVSGLSVKTI-
A0A4Q1SDL1      SLENSP----------------------------------ARRTRLLKIFAANLKAESV-
A0A3P0XH15      NGKLTP----------------------------------NQRIEMLSIFKGSTKIATK-
A0A4R1LAZ7      HGQLTP----------------------------------LQRYLLLLSYHGALKIMVI-
A0A3M1WQW8      RIRDAT----------------------------------LRDKLMVDRFLSGLRVELI-
A0A3N1JHC1      SLASND----------------------------------AGREGVVRNMVMDAKAKEE-
C1F294          HGTVTP----------------------------------SQKLALLNTFKGATQVVLV-
A0A2V9KA79      YPVTRG----------------------------------AATSRQIDEMRARIQIT-V-
A0A522PSP1      ADSSST----------------------------------EVPRSFVAGITGGIKTSQD-
G8P085          GAISLS----------------------------------PAQEEMLSHFKSQINVLQV-
A0A4Q1SGQ1      RLEDAP----------------------------------NRRYVALKIFEHHLKVKAE-
Q1ILD9          LSNIGN----------------------------------ARRQQLLARFQLGLDVTEV-
Q1IJZ6          PLRNAP----------------------------------RQREAMLKKFGKALTVTPI-
A0A2V8TCE6      AHAAPA----------------------------------EPMGPFIDLVLAGLSIEPV-
A0A522TBE8      SHPNLT----------------------------------PSPDDVLRQLSNGVSVSRP-
Q1ITG0          VSSVDE----------------------------------ARKSKLLTRFSKALRVEAV-
A0A3N5PCI5      GSVRET----------------------------------VAESIAIDRLLANLRILPV-
A0A3M1Q0S9      IEEDDP----------------------------------YA--PYVKTLRGGLSVEPI-
A0A2Z5G448      GKPLTP----------------------------------AQRIPLIRLLRSNLQVVVI-
A0A3M1VZ38      TGEVDP----------------------------------LR--PYIKQLRAGLSVDPV-
A0A4Q1SD29      TGTLTP----------------------------------AQRHEIISLFLGSTKVQVL-
A0A3M1PY35      LAAWEP----------------------------------PDDGDLVEMLGAGLDVAPL-
A0A3M1VMP2      GEEPKP----------------------------------PTDDQIAAYIRDNLDTEQL-
A0A2V8G155      PPPDET----------------------------------ALQSRAVDAFLARLDVTPV-
A0A2V8HDM7      PPPDET----------------------------------ALQSRAVDAFLARLDVTPV-
A0A2V8DRT9      EQTGET----------------------------------TTQSRILNDFLSNLTISPI-
A0A2V7VYF3      RAPAES----------------------------------AAESQAIDAFLGGLVINPV-
A0A1F2SVH2      PLPDES----------------------------------KVQSNTIDRFLRALTVAPV-
A0A2V8AJG9      PGSDES----------------------------------KQQSRVIDRFLKDLTVSPI-
A0A2N9LQU7      PVKMDP----------------------------------LSREKLLLKFHDAEKLEVL-
A0A2P6WFK7      PSAMPP----------------------------------ADRQRLVSAFKQSLSVRVL-
A0A2V8U914      SPRAAQ----------------------------------NAAQYAADVARKHLKIEPA-
A0A2V7W309      TKAEID----------------------------------QITQAMAGGLLGGVNIAPK-
A0A2W0BGU4      RVTESQ----------------------------------AHKMKLIETFKRQLSVELV-
A0A2W0BVQ9      RVIDAQ----------------------------------AHKMKLIETFKRQLSVELV-
A0A2V9MN96      NLGPDS----------------------------------QQIASMLSIFRSGLTVQVM-
A0A2V7V2Z1      ASPGAS----------------------------------AVMERAIDEFLGKLKVVPI-
A0A2V7X2F7      APPGSS----------------------------------PVMEGAIDGVLGRLRINAG-
A0A2V7V2I1      SAPGSS----------------------------------RVMEAAIDQFLSRVKVQPV-
A0A2V7U3M2      AAPGAS----------------------------------PVMERAIDSFLRKLRVLPV-
A0A2V7UHT0      AAPGAS----------------------------------QLMEGAIDAFLRRLRVLPV-
A0A2Z5FVL3      ALSAAP----------------------------------LRRDRLLKQFQENLEVKII-
A0A2V9KBD6      ----KA----------------------------------VNEDRLVKLFHKSLDISKV-
A0A2W0AJ66      ---IEP----------------------------------GNEDSLVRAFHKNLAISNV-
A0A1Q7RBU1      ---EQP----------------------------------VNEDRLVESFHKNLTISKV-
A0A2V9JPV9      ---AHS----------------------------------GNEDRLVKSFHKNLTISKV-
A0A1I6MH75      ASLDSP----------------------------------AVQAGTIRRLNGHLKVSLI-
E8WVF6          SSMEDP----------------------------------RVRQTIVGILQKNLKVTLV-
A0A1H5Z7N3      RNIDDP----------------------------------VVRQMVLYTLRADVNVSVI-
A0A2V9YHT3      DSKLTP----------------------------------PQESALIGRLRGSLQVSSI-
A0A1G7JVV8      RNINDP----------------------------------IVRAAVIGKLSNAFKVASI-
A0A1H4T6W9      RDINDP----------------------------------VVRTEVLRRLGGAVVATVI-
I3ZEU5          RDINDP----------------------------------AVRTDVLQRLGNSVNASII-
A0A428MDU2      TTLDDA----------------------------------GVRQSTVHRLQSNLHITLV-
A0A5B9EBI2      TSLDTP----------------------------------MIRQATLSRLKANLTVSIV-
A0A239HDF6      RDLNDP----------------------------------QVRQGTLLVLSSNLKIAMQ-
A0A4Q0T270      ASLDDP----------------------------------GVRQGTIHRLQSSLRIQLV-
A0A1Q3QQB6      GNIDDP----------------------------------AVRQATVHALQSGLRIVLV-
A0A3N1K1G7      TNLDDA----------------------------------AVRQSTVHRLQSNLHITLV-
A0A4V2G466      ASIDDP----------------------------------DVRQRTIHQLLGGLRIAQV-
A0A6B9YNQ8      ASLDDP----------------------------------AVRQATIHGLLANLVISQV-
                                                                            

A0A2V7VMF7      -------PE-------SRLVTVAVTHQDAKEAALWANTLAEVYVEQTLASRVEAAKKAYD
A0A2V7YYV7      -------PN-------TTILDIAVDDTNPALARNIANDLVDKLIG---------------
A0A2V7Z0J5      -------TT-------ALVLHINVQDTNRARSRDVANTLVSEFIK---------------
A0A2V7Z3M4      -------TL-------ALVLHINVQDTNRARARDVANTLVAEFVS---------------
A0A399Y5V2      ----------------TSIIRVRARDASASLARDIANGVSATY----IDLRRKSALDSFA
Q01X01          -------RG-------TSIIRIVAEAREPQLAADLANTLAQTFIEQSIEARQRSAQQTFA
A0A3M2D9H8      -------RG-------AQLIQIVVEDSDPQKAAEIANTLVTVFLEQNAKIQSNRFSASEE
A0A2V8JK38      -------RQ-------SWLVEVTFQAKDPKLAAQVINAHGRHFVEQNIENRFQTTQQVSE
A0A2V9IXG5      -------ED-------TNLLWLEFVADDPRKAADWVNLYVDLYVEENDRQQGEAVKQSRD
A0A2V9J2P4      -------ED-------TNLLWLEFVADDPRKAADWVNLYVDLYVEENDRQQGEAVKQSRD
A0A1Q7RLS4      -------KE-------TGIVEISMEGLNPEEVASWVNTISEVYVERNLDQVVEATSKAVK
A0A2V2R525      -------GK-------TRLVEIRYTHRDPHVAAKVVNAIADTFVQANLEKMTETNSGAGA
A0A321LPW6      -------RD-------TRVIKVVFTHTDPKLAAEVVNAVTQSFIARSFSTKAEKYNNAAS
A0A2V9R9V4      -------LD-------TRAMTLTFKHTDPVIAAGVANAIAQRFVETSFDKKIEKFTSASE
A0A321LE75      -------ED-------TRLLVINYSHTDPKLAATISNTVAAAFINRSFSNKTEKFTKTSD
A0A2V8R8U7      -------IG-------TSLVTIRYQHTDPALAQRIANTLADVFVQNNRERLDIGTSKAVE
A0A2V8QMP4      -------EK-------TNLVEIHFQHTDPEIAASVANTLATIFRDNDIQEETTGSQKAED
A0A2V8R4S3      -------EK-------TNLVEIHFQHTDPEIAASVANTLATIFRDNDIQEETTGSQKAED
A0A2V8NJ55      -------EK-------TNLVTIRFRHSNPVIAMKVADTFAQVFIYNDLQRTTSGTQTATE
A0A2V8Q7I0      -------VH-------TNLFTIKYKHHDPEMAQKIANTLAEVFASNNIDSQTVNSKDAGD
A0A2V8S6K4      -------ER-------TSLVDIHFKHTDPELARQVADTLAAVFIENDRARESKGTEDMKV
A0A317I2L9      -------VN-------TNLFVIKYKHHDPDIAQKVANTLAEVFANNNLERSTTNSSKQET
A0A2V8LLF9      -------EK-------TSLVTIHFQHTDPELAQKIANTLADVFVQNNLDRITAGTSKAEI
A0A352FRF4      -------PQ-------TNLVIIRYRHTDPALAQKIADTLAEVFVANNLNLQESGTSKQSQ
A0A2V8MKV0      -------EK-------TNLVSIRYHHSDPALAQKVANTLVDVFANNNKESLESGTRKSAA
A0A2V8PYY8      -------EK-------TNLVTITYHHNDPALAQKVANTLVDVFANNNLERLESGTKKSAE
A0A1Q7YKQ8      -------MT-------TNLVMLKFTHSDPVLAQKIVNTFADTFAYNNFERETQGTAKATE
A0A352F3R7      -------TN-------TNLVKIRFVHSDPELAQKIANTLAEVFVNNNLQRATAGSSKAED
A0A0B6WXT1      -------EK-------TNLVNIKFQHSDPEMAAKVANTIADVFIYNNLERETQGAQRASV
A0A3B9MEU8      -------PT-------TNLVKIKFMHSDPELAQKIANTLAEVFRNNNLERSTAGSSKAED
A0A2V8MHG6      -------SD-------TRIIEIRFKHQDPEIAEKINNTIADTFVVSNLERKTETTNSAGD
A0A2V8P7N1      -------SD-------TRIIEIRFKHQDSEIAEKINNTIADTFVVSNLERKTETTNSAGD
A0A2V8M3M6      -------SD-------TRIIEIRFKHQDSEIAEKINNTIADTFVVSNLERKTETTNSAGD
A0A1Q7NJH5      -------SD-------TRIIEIRFKHQDSEIAGKINNAIADTFVVSNLERKNETTNNAGD
A0A2V8PJY0      -------SD-------TRIIEIRFKHQDSEIAGKINNAIADTFVVSNLERKNETTNNAGD
A0A1Q7Y6W9      ETRLLI-KE-------TRLIDISFTHQDPQVAAKIINALADTFVLSNQEKRNESNNTTGG
A0A2V8NC68      -------NE-------TRIIELRYRHLDPEVATKIVNTIADTFIQSNLEKKTETSSSAGD
A0A399WK13      ESRATV-KD-------TRLIEISYSDTDPDLAAFVANAIAETFTNQNQEKRTGTSRKTND
A0A352FLX4      ETRLTV-RE-------TRLIDISYRHSDPHLAAKIVNTVAQIFIDQNREKKTETSGSTGT
A0A2V8RTL7      ESRATV-KD-------TRLIEISYRNTNPELAAFVVNAIGETFVNANQEKRSGTSRKTSD
A0A3E0PCJ6      ESRATV-KD-------TRLISISYRNQDPNVAAFVVNGIAEVFTRVNDEKRTGVNSKTNE
A0A3M1S4R8      VSQATF-KD-------TRLIEISFQHTNPELAALIVNGIAEVFVKQNQEKRTGTNKRTND
A0A1Q7YFI6      -------TD-------TRLIEIHYTHPDPQVAAKIVNSIADTYIISNLEQKTKNTNSAAD
A0A136KC10      ESRATV-KD-------TRLIEISFNSTDPALAAFVANAIAETFVNQNQEKRTGTSRKTND
A0A2V8SEX6      ESRATV-KD-------TRLIEISFRHTNPQLAAFVVNSIGETFVTANQNKRSGTNRKTSD
A0A3M2D6Y5      ESRATF-KD-------TRLIEVRFQHTNPELAALVVNGIAEIFAKQNQEKRTGTSKRTND
A0A0B6WWQ6      EVRLPV-KE-------TRLIDISFRHPDPYVAATVVNTIAETYKLSNLEKRTSARATTSQ
A0A3B9MK99      ESR-GLFKE-------TRLIDLSYTHIDPEVASKVVNAIAETYVYNNLEKKSDTNMGTAD
A0A352EX26      ESR-GLYKE-------TRLIDIGYTHTDPEVASKVCNAIADTYVFNNLEKKTESNASTGD
A0A2V8MM59      ESRAGYYKE-------TRLIDITYQHGDPEVAARVANCVAETFVHSNLEKTNQTNTSTSE
A0A2V8PFE8      ESRAGYYKE-------TRLIDIVFQHGDPEVSAKITNAVADTFVRANLEKKNETNTSTGE
A0A2V8PWS6      ESRAGYYKE-------TRLIDIAFQHGDPEIAARITNAVAETFVRANLEKKNETNTSTGE
A0A2V8LCT5      ENRAGYYKE-------TRLIDIDYQHGDPEIAAKVVNCVAETFVRSNLEKKNETNTSTSE
A0A352FTJ9      ENRAGYNKE-------TRLIDIDYQHGDPEVAARVVNAVAQTFVRSNLEKKNETNTTTSE
A0A2G6PYV5      -------KD-------TNLVRISYTDTNPERAMILANTWVKAYIAHSLNMTYDKNLEAYN
A0A2V8F956      -------RN-------SRLVDLKFDLPDGALAATIVNALAKNYISQSLEFKFMASKDASD
A0A1F2S1W5      -------RY-------SRLVDVSFRSNDPALAARVSNALADQYIKQSVELRSNTTKEASE
A0A1F2T595      -------RY-------SRLVDVSFRSADPGLAAKVANEHSKQYIEQSLEFRTTTTREASD
A0A2V8JQV5      -------QQ-------AHIIQITADSTDPKIAAEFLNTLTDEFINQKLRSRLQTNERTAE
A0A2V9AC41      -------GG-------TSLVKVRFTTPDPALSARLANAHANSYVRYGVDLRSQTNEEASE
A0A2V8K4L4      -------GT-------TRIIEITSDSTDPQLAADFANTLVDEFIQKNLDDRWKTTERTGE
A0A2V8NCZ3      -------NT-------TRIIEITADSADPRLAADFANTLVDEFIEKNLDDRWKTTERTGE
A0A2V9MAM9      -------KQ-------GRIIRILCDATDPQLAADFANALAQVFIEQSVEARWNGASQIRE
A0A2V9M454      -------KD-------TRMALVSFESTDPREAAAVVNGLVTNYIEHNFKSKYDATRQATG
A0A2V9IVR7      -------RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASG
A0A2V9ILE2      -------RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASG
A0A2V9LGY4      -------RN-------SRIAAVSFESPDPKLAAQVVNALVYNYQEYNYHKNYEATRKASG
A0A2V9J4D6      -------RN-------THIVEVSFESTDRDLAARVVNALINNYIEYNFHTKYDATRQASG
A0A2V9L9C5      -------RN-------THIVEVSFESTDRDLAARVVNALINNYIEYNFHTKYDATRQASG
A0A2N9M9N1      -------TE-------SRLVEVSFESVDSNLAARVANTLVKNYVEANFRSKYETTRQASA
A0A2V9JEC4      -------GN-------SRLITVSFESTDPELAANAANTLATNFVEANFQGAYDTTREATK
A0A2V9LPQ3      -------PN-------SHMMEVSFESTDPDLSAKVANTLINHYIEYNFRKRYDATRQASG
A0A348V070      -------TG-------TKLIQVSFNHRNPELAAEVLNTLLDSYIEMLIKRKYTASEQATE
A0A2Z5G3A3      -------VG-------TRLIQISYVSSDRKLAESVVNALAQDLTNFSFETRYKATAQTSQ
A0A2V7UGP8      -------KN-------THLVEISFVSVDPELSSRIANAVANSYMEFNQSARYDTSAQASE
A0A239MKT6      -------KS-------TRLLAVSYTDTDRNRASKIANYVVQAYLQDNTENRYQATSMAST
A0A3E0PCN7      -------RDNRTAAQETRLIEVQFTHFRPEVAAKIVNTLGETYVRQNLEQKVQTNASAGE
A0A2V8IYW3      -------VK-------DDTFKISYVSGDPVVAMKVVARLASMFIDGNVRDRRVVAEGTNQ
G2LEI9          -------PR-------TRLVRITFQHHDPETTKAVVNTVAEVFARRNVSDRLQQGSSQKE
A0A317J121      -------NG-------TRIIEITCDSTSPDIAANFVNTLANEYIEQNSQGRAQNLQQTSQ
A0A2V7YW66      -------RS-------TQLVQLAYTAASPEFAAKAANAFSEAFIDMGVEDRYATAGKAST
A0A2V7Z0V0      -------RN-------TQLVQLSFRASSPEFAAKAANAFAESYIDMGVEDRFATAGKAST
A0A2V8GFD4      -------RN-------SRLVDIVYSSPDPKFATAAANAIAKAYIEQNLEYRFTASKEASD
A0A2V8HSS5      -------RN-------SRLVDIVYSSPDPKFATAAANAIAKAYIEQNLEYRFTASKEASD
A0A2V8KP55      -------RQ-------SWLVEVTFQAKDPKLAAQVINVHGRQFVEQNIENRFQTTQQVSE
A0A399WNU1      -------KDSRTATKETRLIRIEYRHYDPVIATKLVNAIADTYVLQNLEQKVQSNASASD
A0A2V9CG11      -------GN-------TRVLEVLYESPDPKLAADFANTLASEFIEETQGMRLKAFQRTAE
A0A2V2R0I6      -------PN-------SRLMDVSFESTDPQLGARIVNAHINNFIEQNFRSRFEATSQASS
A0A2V8XAR9      -------PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQAST
A0A2V8VZA0      -------PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASS
A0A1Q7CB82      -------PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASS
A0A2V8WIU1      -------PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQASS
A0A1Q6Y9F5      -------PN-------SRLMDVSFESTDPQLAARIVNAHIASYIEQNFRSKYEATTQAST
A0A2V9EVV8      -------PN-------SRLMDVSFESTDPRLAARIVNAHIASYIEQNFRSKYEATTQAST
A0A2V8YF91      -------PN-------SRLMDVSFESTDPRLAARIANAHIATYVEQNYRSKYESTTQASN
A0A2V8XZK2      -------PN-------SRLMDVSFESTNPQLAARIVNAHIATYVEQNFRSKYESTTHASD
A0A2V8ZTX6      -------PN-------SRLMDVSFESTDPRLAARTVNAHIATYVEQNYRSKYEATSQASD
A0A2V9BT79      -------PN-------SRLMDVSFESTDPRLAARTVNAHIATYIEQNYRSKYEATSQASD
A0A1Q8B793      -------PN-------STLLDVAFESTDPRLAARVVNAHIENFIEHNFRSRYEATTQASS
A0A2V9BCA0      -------PN-------STLLDVAFESTDPRLAARVVNAHIENFIEHNFRSRYEATTQASS
A0A2V9BWU9      -------PN-------SRLLDVTFEAGDPKLAARVVNVHLENYIEQNFRSKYLATTTASN
A0A2V9DKX2      -------LN-------SRLLDVTFEAGDAKLAARVVNAHLENYIEQNFRSKYLATTTASN
A0A2V9JSI3      -------RN-------SRMLEVSFEARDPRLAAAVANALVSNYAEYNFRKRYDATRQASG
A0A2V9WI32      -------PR-------TRIVEIHYSHPDARLAAQIANILINTFIEQNFKTKFESTMQTSA
A0A2V8IVN9      -------RN-------SRIVDVKFEAKDPDVAERVVNALAKGYIDQNLEFKFMSTKEASD
A0A1F2TPT3      -------AN-------G-VLDIKYRSSDPVLAARFANAHAQEYINENLEMRVAAVREVTG
A0A2V8JTQ2      -------KG-------TRLIEIQFRSTDPQLAADVVNGLAKEYVDQYYRSQFQVSTQFSD
A0A2V8UZY0      -------KG-------TRLIEIKFRSTDPRLSADVVNSLAKEYVDHYYRSQFQVNAQISS
A0A3N5YNR8      -------PN-------SRLVEIRWVSPDPTLAAAVSDTLAEEFIEQNLQTKFEANTRATE
A0A350UEK1      -------GQ-------TRIVEVLVDSTDPAVAASFANRLTAEYVEQSMEARWQSSQRTGE
A0A350UIQ4      -------GQ-------TRIVEVLVDSTDPAIAAQFANLLTSEYVDQSMEARWQSSQRTGE
A0A3N6A5T6      -------RG-------SRLVEVSYASHDARLAATIVNTLADQFIEMNFESRYQATTKATE
A0A1F2Q9L4      -------RN-------TRLVEVSYVATTPELAARIANGVADTYIDWGVETRFATVGKAST
A0A1H5SQF5      -------KG-------TRLVNVTYTDADPKQAARVANAVVEAYLISSTQQRYDATSKTSA
A0A3E0NV31      -------GN-------TQLVRVSYSSPDPDLSTDVAGAIALTFIETTLQTRYDATRRAVK
A0A3N5M5V0      -------PN-------SRLVEVGWVSPDPSLASAVSDTLAEEFIEQNLQTKFEANTRATA
A0A2V9AEW6      -------GS-------SRLLEVLYESPDPKQAADFANTLVSEFTELSQEAHWKSAQGTAE
A0A2V8WQK6      -------GN-------SRLLEVLYESPDPQRAADFANTLVSQYVELSQEERWRSAQGTAE
A0A2V8XIF4      -------GN-------SRLLEILYESPDPKLAADFTNTLVSEFVELSQEERWKSAQGTAE
A0A3N5XQP8      -------LE-------SRLMDVSFSSPSPKFAAMVANAWVEEYIEQNFQSKLKTTEMATK
A0A2Z5G7H4      -------SG-------TRLIEVRFLSSDPVLAAKVVNQLMDGLVEYNFQTRFTATNQASE
A0A2V9L5B5      -------RR-------SNLVEVTFDSYSRTVAALAANKLADDYVEQNLEVKWDAAEKASQ
A0A2V9LK56      -------RR-------SNLVEISFYSNDPKLAARIANRLADDYIEQNLQVKWDAALKASE
A0A2V9L7I0      -------RR-------SNLVELTFDSYSPEVAAQAANKLARDYIEQNLEVKWDAAAEASK
A0A522PPT0      -------ER-------SNLVEVAFYSQDAAVAARVANQLGEDYIDQNLQVKWNEALKASE
A0A2V9KCS3      -------NE-------TRIVEILCDSTDPKFAADFANTLVSEYMEQSLESRWKNAQRTGD
A0A2U3KC61      -------PN-------SRLVQISYTHPNPRLAEAIVNKLVDTFKEENTNAKYESVNETSE
A0A2V9Y2R7      -------PR-------TRLLELRYIHQDPVLARDIVNKLAKTYIEENFRKRYESTTQTSE
A0A372IT17      -------TG-------TRLIEIRYSDPDPALAARVVNRLVQALADYTFQSRLAQTSESSS
A0A136JPP4      -------ER-------TSLFTLTINSTNPQIAANVANKVGEVFIEEDAKRELETTQSAYD
A0A399WUJ8      -------ER-------TSLFTVSVSSTNPQLAAAVSDKVAEVFIEEDAKRELEGTQSAYD
A0A2V9NGH6      -------PN-------TRIIEIRYRSTDKDSAARVVNTLINTYIEQNFKTKFESTMQASD
A0A2V9PYE6      -------TN-------TRIIEIRYRSTDKGLAARVVNALINTYIEQNFKTKFESTMQASD
A0A2V9NL07      -------PN-------TRIIDIHYRSPNKELAARVVNTLANTYIEQNFKTRFESTMQASD
A0A2V9QD92      -------PN-------TRIIDLHYRSPNKELAARVVNTLANTYIEQNFKTRFESTMQASD
A0A2V9WPZ6      -------PN-------SRIIELHYRSPNQELAATVVNTLATTYVEQNFKTKFESTMQAAD
A0A2V9ZLH4      -------PN-------TRIIEIHYTSPNKELAATIVNTLVNTYIEQNFKTKFESTMQASD
A0A2V9RQF1      -------PD-------SRVVDIHFRSPDRQLAAHVVNALTSTYIEQNFKTRFESTMQASD
A0A2V9YDK8      -------PN-------SRIIELHYRSPDKNLAANIVNTLAATYVEQNFKTKFESTMQAAD
A0A2V9V8F7      -------PN-------SRIIELHYRSPNKELAATVVNTLATTYVEQNFKTKFESTMQAAD
A0A2V9XGR9      -------PN-------SRIIELHYRSPNKELAATVVNTLATTYVEQNFKTKFESTMQAAD
A0A2V9V3Q5      -------PN-------TRIIEIHYRSTDPTLAASVVNTLAATYVEQNFKTKFESTMQASD
A0A2V9NWS3      -------PN-------TRIVDIHFRSPDRELAAHVVNTLISTYIEQNFKTRFESTMQTSD
A0A2V9USA9      -------PN-------TRIIEVHYRSGDPQMAANVVNTLMQTYVENNFKSRFESTMQASD
A0A2V9XW18      -------PN-------TRIIEVHYRSADPQMAANVVNTLMQTYVENNFKARFESTMQASD
A0A4R1LC91      -------SG-------SRLIQITYLSSNPHTAAAVVNALSAALIDYTFQTRFNATNQASG
A0A3M2BZG9      -------RD-------TQLVELTYRSDKPELAARIANGYAQAFIDWGIETRTSTVSRAST
A0A1Q7N5R7      -------LS-------GNFLRIALTGPSATGVTGVVNAVADRFVAVATDLKRAKLTELGR
A0A3M1SIV3      -------ER-------TNLFSINVANSNPELAAILANTIAEVYIERTIRRETEGMQKSLE
A0A3E0PHB0      -------EG-------TNLVKLTMNGSDPELIRRVADTLTEVYKDRSIMLATKTQVEAHK
A0A3M2D491      -------ER-------TNLFSVKVVHTNPELAARLANAIVGVYIDRAARREVEGTRKSLE
A0A357F267      -------ER-------TNLVNVSIRSTNPDLAARVADKVAEVFRDQDAERETQGAKNASE
A0A353C9L6      -------ER-------TNLVNVRVKSTNQALAPKVADKIAEVFKLRDAERETQGAKNSAA
A0A2V8RQV0      -------ER-------TNLVNVTIQNEDPALAGKVTDEIAAIFIEEDKERETQGERKAIE
A0A2V8SJH5      -------ER-------TNLVNVSVTTPKAELSARVADKVEEVFIDKDAQRETEGSRRTYE
A0A2V9QB26      -------GL-------TRVVEASYDSTDPRFAAAFLNTLVQEFMDSNMEARLKSSEYTSQ
A0A2V9VYY4      -------PS-------TRLIQVSYTHSDPRFATEITNALVKTFIEENFRTKYNSASQTSE
A0A2V9KIE8      -------RR-------SNLVEVSFGSHDPRVAAQVANRLAQDYIDSNLQVKWDETIKASD
A0A352F549      -------KK-------TYLIDLRATHTDPVVATKVVNAMADAFALWNMEVKTKTNTVAGS
A0A3B9MLP9      -------KK-------TRLIDIRASHTDPGVAAKVVNAVADAFALWNIEVKTKTNTLAGT
A0A3D5SQ87      -------KK-------TRLIDIRASHTDPGVAAKVVNAVADAFALWNIEVKTKTNTLAGT
A0A2V8NW86      -------GL-------TRVVEASYDSTDPRFAAAFLNTLVQELMESNMEARMKSSEYTSQ
A0A2V8ZHL8      -------RD-------SHVVNISFEGPDSSLSAKIANSLASNFIEYNFRQKYDATRQASG
A0A2V9B240      -------RD-------SHVVNISFESPDPGLSAKIANSLANNYIEYNFRQKYDATRQASG
A0A2V9CBM2      -------NR-------SRLVAVRFDSHNPDLAARVANNLAADYVEQGLDERWAAAQRASD
A0A2V8XN17      -------NR-------SRLVAVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAE
A0A2V8WX45      -------NR-------SRLVTVRFDSRDPELAARVVNTLAADYVDQSLEARWQATQKAAE
A0A1Q6YR79      -------NR-------SRLVTVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAE
A0A1Q7VA32      -------NR-------SRLVTVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAE
A0A2V9EY85      -------NR-------SRLVAVRFDSRDPELAARVVNTLASDYVDQSLEARWQATQRAAE
A0A2V9H8K0      -------NR-------SRLVAVRFDSHDPELAARVVNTLAADYVDQNLEARWQATQKAAE
A0A2V9FFE5      -------NR-------SRLVAIRFDSHDPELAARVVNTLAADYVDQSLEARWQATQKAAE
A0A2V9GM43      -------NR-------SRLVAVRFDSHDPELAARVVNTLAADYVDQSLEARWQATQKAAE
A0A1F2RFI7      -------RR-------SRLVEISFDSYDPALSARTANALAANFIDQNLEAKWDATQKASD
A0A1F2RZS3      -------RR-------SQLVEITYESYEPSQSARVTNTIAANYIDMNLEAKWDATQKASE
A0A1F2USE2      -------KY-------SRLVEVHFESEDPALAAQATNTLAANYIEQNLEARWEASQKASE
A0A2V9C238      -------KR-------SRLVEISFESRDAELAARVLNALASHYIEQSLEVRWEATQKASE
A0A1F2Q9F5      -------KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASE
A0A1F2QQH9      -------KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASE
A0A1F2QXK7      -------KR-------SRLVGVSFESEDPALAARVVNTLAANYVEQNFERRWEATQKASE
A0A2V9DEM9      -------KR-------SRLVEISFESRDAELAARVLNALASHYIEQSLEVRWEATQKASE
A0A2V9CYQ5      -------NR-------SRLVAVRFDSQNPDLAARVANALAADYVEQGLDERWAAAQRASD
A0A2V9BWU8      -------SR-------SRLVTVRFDSGNAQLSARIANALAEDYIDQSLEARWLATQKATD
A0A2V8ZG48      -------SR-------SRLVNVRFDSNDAQLSARIVNTLAEDYIDQNLDSRWKATQKATD
A0A2V8Y334      -------SR-------SRLVTVRFDSNSAELSARIVNTLAEDYIDKNLEARWKATQKAAD
A0A2V9AY68      -------SR-------SRLVTVSFDSNNARLSASIVNTLAEDYIDENLEARWMATQKATD
A0A257VBK0      -------RD-------SALFRITVMAPYKADVAIWANAIAEAYQDRMLKDALDFIAKANE
A0A2V7XDY0      -------PE-------SRLVLIHVTHRYPKEAALWANTLADVYIEDTISTRVEAARKAYE
A0A350UQT3      -------PN-------TYLLQVSYRSPDPQLAADVANQVAQSYIEHTYNIRIRSSQSLSR
A0A2U3JZ71      -------PN-------TYLLLISYRSTDPRLAADVANGVARSYLEHTYNIRFKSSASLSA
A0A2V8TTB0      -------PN-------TYLLLISYRSPNRQLAADVANAIALSYLAHTYRIRYKATAGLSE
A0A1F2TCR2      -------QT-------TRLVSIQYRSPDPRFAALAANTIAEEYATQNLDLHLDNVLGKLA
A0A1F2V330      -------EG-------SDSFHLAFEGRGRTQVMNVTNDLSERFIRRLANMREQQVNEGAG
A0A662EE63      -------AE-------SNVIELSMIGRNPDRVAEWLNVYVEQYIAANIEDGIDKTRKIYK
A0A2V8TLH7      -------KD-------TGIMQITLDGPEPKEVQTWVNSVAEAYVDRNLDLSIEATGRAVK
A0A1Q7ZJT1      -------KE-------TGIVEISMEGLNPEEVASWVNTISEVYVERNLDQVVEATSRAVK
A0A2V8VC99      -------KD-------TGIVVIGLEGLNPEEVAAWANAIAEVYVDRNRDQAVEATAKAVR
A0A348UZU3      -------RM-------TRLVEVAFKAHDPALASDCVNALFDSFVDMNIEARYETTEQATE
Q01XL7          -------GA-------TRLIELRCQSPSPEVAANFLNTLAAEHISQNLAIRSSATQRTSQ
A0A2V8ERZ5      -------RG-------SHLVDVSFVSEDPKFAAEAVNALIEEYVNQNLELKLQSTQGMLD
A0A2V8GTX0      -------RG-------SRLVDVYFVSADPEFAARAVNVLAEEYVNENLDFRLQNTDKTLQ
A0A2V8J0X9      -------PN-------SRLVKIVYSHSDPKFAALAANTVADEYTQQNIDLRLQNTEKTLQ
A0A523DUV7      -------PD-------TRLAQIVVEHEDPREAARWADTLAESYIEQNLASKIEATRNVYS
A0A372IRG7      -------TG-------TQIVEIHFQNPDPEVAAKVVNAIVQAYMERDLRSRFEGTTRVSN
A0A1F2U158      -------AE-------SKLVDVYFTSADPQFAATAANALADEYVASNLEVKMQGTQSMLD
A0A2V8F6S9      -------TG-------SKLVDVTFQSSEPKFAATAANALVDEYVDSNLEIKQAGTQNMIE
A0A4Q1SCH5      -------EG-------TQLVDVSFRDQNPQMAALLLNHVVDAYLRQSFNSRYGSVAQVRD
A0A3D1ASD2      -------PN-------TYLLQITYQSANPRLAAEVANGVANSFLQHSFEIRFKSSESVSQ
A0A2N9MK30      -------VN-------TYLLLISYRSPDRRLAADVANAIARSFVEHTYDIRFRSSASLST
A0A4Q7YNP3      -------GI-------TRLVEITCDSWNAEFAARFCNTLTTQFKEADLETRSSESEKTSR
E8UZE1          -------RG-------TEIVQIRYKSTNPALAATIANTVAAKYIQRNFETKYNTTHETSA
A0A1V6HR88      -------GQ-------TQMVDISYRSTDPALAARIANGVAETYIDWGIESRSNLAGKTSV
A0A3E0P0A3      -------SG-------TQLFNLTYSTGDPEIAMMLANGYAEAFIETGKASSRADAAQASS
A0A2V8EXP2      -------RN-------SRLVDVKFSSLSPMLSSQVANALARAYIDQNLEFKFLSSKEASD
A0A2W4RYA1      -------RN-------SRLVDVSFESPSAAFSMRVANALAKAYVQETLDYRLSASRDAND
G8P0Y7          -------PD-------TTLVQVGYSDPSPALAAEIANGITAAYIEQNVKSRYDSTMQAAD
A0A5M8T4U7      -------GG-------TQMVDIRYRNHDPKLATDVVNTLMDTFIHENLRSKFDQTKQTSA
A0A3P0X3W6      -------AS-------SLLLKITYRSKDPRKAADVANAVAHSYIDEAMDMRLHSSMNLSG
A0A1E3Y9R6      -------RN-------SRLVDLRFRSPDPEFAARVVNQHAAQYIEQSLEFRLAATTQTNA
A0A2W4TLP2      -------RN-------SRLVEIKFQSPDPEFAARVVNAHAEQYIEQSLQFRLEATSQTNA
A0A3R9WF43      -------PD-------TRLINVTFENPDPTVAALAANSLAKTFIDDYLERRHRSTSQASY
A0A317HKM4      -------KD-------TRLVNVGFRSTDPEIAARVANALARAYVRWNVEYRSKMTGEASA
A0A523E0N1      -------KK-------TQLMEVSFVSPDPELSAQLANSLVVQYRQFNIDSESGLARDTSS
A0A523ECP2      -------RN-------TQLMELKFTSTEPKVAADLANALARQYMTFSMEKETTLARDTAG
A0A2W0C122      -------KN-------TRVVEVSFTGRYRDLNARIVNTLVDVFIDDNIRSRYEAANRAAK
A0A2W0AUU7      -------KN-------TRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNIRSRYEAANHAAK
A0A2W0BQL1      -------KN-------TRVVEVSFTGRNRNLNGRIVNDLIDAFIDDNIRSRYEAANHAAK
A0A4Q1SDL1      -------SG-------TRLIEIDFTNSDPKVAAAVVNHLIQALTDYAFQTRVNSTSEAAT
A0A3P0XH15      -------PG-------TQLVEVRFRNQSPAVAASVSNAIVDRYMDRSRRARYEGTTRISE
A0A4R1LAZ7      -------PS-------TDVVEIHFSNPDPEVATNVANAIVDAYLERDLKSRFEGTTRVSS
A0A3M1WQW8      -------RD-------TRIVKVTYESPDPQLAAQIVNALMDQLIEYTLMARFESTRQARE
A0A3N1JHC1      -------GM-------SNLIRITLIGPDPHLAADTANELTNQYIQQGQNARLAAASETGV
C1F294          -------PE-------TDLAEIHFQNQNPKVAQEAANEIVNAYQDWTLRAHFETMTRISD
A0A2V9KA79      -------EG-------NDAFYVSFEGTGAAQVRDVANRLAEEFIHEVSAADESRVEEAAG
A0A522PSP1      -------PG-------TYLLNVSYRSSSPDQSAAVANALAEAFIEHEYKTRNSALVSLTQ
G8P085          -------PS-------TQLVTISFRNPNPQVAALLANRLIEAYLRQTFDSRYGSVTQVTK
A0A4Q1SGQ1      -------PG-------TRLIDVSYADPNPYLATAVVNRLLSALTEYTYQARFQATAQASD
Q1ILD9          -------PR-------TGIVQLRFRSSDPELAAAVVNELAEAYTEHNFQVAYESTIKASD
Q1IJZ6          -------PD-------TRLIQIAFEDPDPNFAAQVLNTLIGQYTQDVLTRRNASTTQASE
A0A2V8TCE6      -------KD-------SNLVEVVYLSPDPRFCAQLANAVADAYIEFALSSQFDTTEQASD
A0A522TBE8      -------PA-------SLLLNVSYQTQSATLAAQIANAIANSFLNLEYNSRAQALNQSTA
Q1ITG0          -------PK-------TQVIEIRFRSTDPALAAKVVNTLTSSYMHHNFMTRFEATMQASA
A0A3N5PCI5      -------RD-------TRIIEVRYESPDPELAARVVNTLATTYITHNLEVQSQASKEATT
A0A3M1Q0S9      -------RD-------SQLVTISFVHPDRVFAARVANALAEAYIRFSLAAKLDIAAQSEA
A0A2Z5G448      -------PN-------TDLVEIHYRDPDPNQASRIAQAVVDQYLELDLRSRYEGTLRISN
A0A3M1VZ38      -------RD-------SHLVEISFVHPDPRIAAEVANAIAYGYLRFTLDRKTRIAKQSKD
A0A4Q1SD29      -------PN-------TEMVEISFRNPDPKVAMEGANGIVDAYLDRDLRAKFQGTTRVSN
A0A3M1PY35      -------EK-------SNVVRVSYRHRDPEIAARIVNAVVRAYRDFFVESGTDARRGASE
A0A3M1VMP2      -------EY-------SSVVRVSFTHPSPEIAANVVNAVVDAYRDFFVRTGVDARRGAAD
A0A2V8G155      -------RN-------SRLVDIKYRLGDPALAQKIVNAVAHAYIEQTMEFKFTASKQAGD
A0A2V8HDM7      -------RN-------SRLVDIKYRLDDPALAQKIVNAVAHAYIEQTMEFKFTASKQAGD
A0A2V8DRT9      -------RN-------SRLVEIEFASPYPYVAANVANSLSKAYIELNLEYKFTASRDASD
A0A2V7VYF3      -------KN-------SRLVDVVYRSPDPVFATTIVNELAHQYIQQNVELRFHASKDASD
A0A1F2SVH2      -------RN-------SRLVDVRFDSPDAAFSATVANALARAYIEQHLEFKFLSSKEASD
A0A2V8AJG9      -------RN-------SRLVDVKFESPSAALSAQVANGLAKAYIEQNLEFKFMSSKEASD
A0A2N9LQU7      -------PK-------TRVIEIRFQNVNPKLASDVVNGIVDAYLQRNFDVKYQGAVQVSE
A0A2P6WFK7      -------PN-------TQIVEVLFRCTDPKLATDVANAVVEKYMQHTLQTRYEGTVQVSN
A0A2V8U914      -------RD-------SQIIRVAFDAHDPQLAADFANTLARTFIEQSVNGRRRAAQEIQE
A0A2V7W309      -------HG-------TNLIVITYTGSSPKLAQKIAEAWGDSFMRMTIAKKLDSVRQATE
A0A2W0BGU4      -------PG-------SRVVLVGFESRDPELAARIANTQVENYSDYNFRQKYDATRQAAG
A0A2W0BVQ9      -------PG-------SRVVLVGFESRDPELAARIANTQVENYSDRNFRQKYDATRQAAG
A0A2V9MN96      -------PR-------TRVIEITYIHPDPQLAAEVTNALVKTFVEENFRTKYESTSQTAD
A0A2V7V2Z1      -------KS-------SRLVMVSYESFRPEMAAAAANGLSKLYIEQTLEFRYQTSSEAAQ
A0A2V7X2F7      -------KG-------TRLVGVGSEAFRPDLAMNVANKLSQLYIEQTLEYRYQTSSEAGV
A0A2V7V2I1      -------RN-------SRLVLVGFEAYRPELAAQAANKLSQLYIQQTMEFRYQTSADAGL
A0A2V7U3M2      -------KN-------SRLVLVAYESYVPEMAAAAANWLSQLYIKQTLEFRYETSSEAAQ
A0A2V7UHT0      -------RN-------SRLVTVTYESYRPDMAAAAANRLSQLYIQQTLEFRYQTSSEAAQ
A0A2Z5FVL3      -------PG-------TRVIEVAFSSSDPNLAARVVNQLVASLVNYSFQSRRTVDTEASK
A0A2V9KBD6      -------KG-------TRLIQIRFRSPDPQLAADVVNGLAKDYVDHYYQSQFQVSEQISA
A0A2W0AJ66      -------RG-------TRLIEIKFRATDPRLAADVVNYVTKAYVDRNYSSQLYASNQLSQ
A0A1Q7RBU1      -------KG-------TRLIEIQFRNTDPRLAADVVNELARAYVDQYYKSLFQVSTQISE
A0A2V9JPV9      -------KG-------TRLLEIKFRNTDPRLAADVVNQLTKAYVDRYYRNQFEASTQMSE
A0A1I6MH75      -------PK-------TEIIAISYTSLNAKLSADIANKVVSDYIQRSFETRFQSQQRVSA
E8WVF6          -------PK-------TDIIRIAYSSLDPKLSADVVNKVIADYQQRSYETRFDSTKRVSQ
A0A1H5Z7N3      -------AK-------TDLIHISCQTFSADLSAEIVNKLIREYIFRSLESSAEAQKRVSD
A0A2V9YHT3      -------PN-------TRMIELRFSDPAPRETARVLNVFMDDYIQENIRAKYDSTMQATD
A0A1G7JVV8      -------PR-------TQMIRITVTANKAQLAADLVNHLINAYQQRSFESRFASTQRVSQ
A0A1H4T6W9      -------PR-------TAMVRITCTASKPQLAADIVNQVINAYQQRSFETRFESTKRISQ
I3ZEU5          -------PR-------TAMIKITCTASRPQLAADIVNQVINAYQQRSFETRFESTKRVSQ
A0A428MDU2      -------PK-------TDIIRISYTCLSAKLSADIVNTVIATYVHRSYQTRFDSTQRVSQ
A0A5B9EBI2      -------AR-------TNLITINYRSLDAHLSANIINTLIKDYIQRSYQTRFNSAQHASQ
A0A239HDF6      -------PR-------TNILRLSYSSLDGKLSAEIVNTVISEYIQRSYETRFASTQRVSK
A0A4Q0T270      -------PK-------TEIMRISYSSLSPKLSADIVNKVVSDYIQRSYETRFASTQRVSQ
A0A1Q3QQB6      -------PK-------TEIINISYSSLNPKLAADIVNKVISAYIQRSYETRFASTQRVSR
A0A3N1K1G7      -------PK-------TDIIRISYSSRSPKLSADVVNKVISTYIQRSFETRFASTQRVSQ
A0A4V2G466      -------QK-------TELIRISFQSLSPKLASDIVNKIISAYIQRSYETRFSSSQKVST
A0A6B9YNQ8      -------QK-------TEIIRISYRSLSPKLAADIVNKIISAYIQRSYETRFASSQRVSN
                                                                            

A0A2V7VMF7      WLQERLGETQKGMREAQDKLAKTYQG--QDGFVPEGSGGSA-------------------
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      QQANDLQQKVDE------------------------------------------------
Q01X01          SLSGDLKEIRNR------------------------------------------------
A0A3M2D9H8      SLQAQIQQVEAQIADLQKQLAQSSEQ--SSE-----------------------------
A0A2V8JK38      LLSQQIVNLKGGLEKAEERLQKYGQD--NDILFTE------------DG-----------
A0A2V9IXG5      VLKRQLYEIKSMLASQQTQMNQYAES--SNLPVTP------------EM-----------
A0A2V9J2P4      VLKRQLYEIKSMLASQQTQMNQYAES--SNLPVTP------------EM-----------
A0A1Q7RLS4      ALLSEIAPLKEKLEDTQRTSFEFAEK--ANLYVPE------------NQ-----------
A0A2V2R525      FLKKRIYELQEQIKNGEERLINYAKD--NQI-ISL-----E------PS-----------
A0A321LPW6      WLDRSTRELQAKVQKAEQSVADYTRD--HNI-YST-----E------GK-----------
A0A2V9R9V4      WLDRSTRELKSKIERSEQALADYTKT--NNI-YST-----D------GK-----------
A0A321LE75      WLNTMVRERRAEVQKAEEELANYTRE--HNL-FST-----D------GK-----------
A0A2V8R8U7      SLAQEIAKYQDKVNKEQDARFAFAKA--KDLPLGP-----E------SG-----------
A0A2V8QMP4      VLANEIIDLQARIQANEQKRINYRKE--NDLPLGT-----K------QG-----------
A0A2V8R4S3      VLANEIIDLQARIQANEQKRINYRKE--NDLPLGT-----K------QG-----------
A0A2V8NJ55      KLANQIAELQLKIKADEEKLLNYKEK--NDIPIST-----A------QG-----------
A0A2V8Q7I0      LLEREISEMQGKVRTKTERLFNYARE--YSLPLTE-----D------VM-----------
A0A2V8S6K4      ATARQITDLQAQIAE-----LEKKRT--DALVQSG-----SAVNPEAKG-----------
A0A317I2L9      MLAKEIGELQFKVKHDQEVLFNYARE--NNLNPTG-----N------QN-----------
A0A2V8LLF9      DLTNQIAKVQDKIKKEEQDRFSFAKA--HNLPIDN-----T------PG-----------
A0A352FRF4      DLGQEIAKYQGQVKQKQADVFNYAKQ--YELPLTD-----A------PA-----------
A0A2V8MKV0      QLGSQIGTYDELVKKERDDRIAYAKQ--YGLPLTP-----T------EN-----------
A0A2V8PYY8      QLANQIATYERKVKEERDARVAYAKQ--YNLPLTP-----T------EN-----------
A0A1Q7YKQ8      LLAQKIAELQLEIRRQDEERVNYIKL--KNLPPSK-----S------PG-----------
A0A352F3R7      VLAKEIASYQTKIKQEQEAQFNYAKN--HNLPLTI-----D------AS-----------
A0A0B6WXT1      LLAKQIAELQLKIRQGEEARINYLRS--HNLPLGQ-----A------KG-----------
A0A3B9MEU8      QLAKEIAKLQTQIKHDQEAQFNYAKN--HNLPLTA-----E------AG-----------
A0A2V8MHG6      FLQRRIADLQSEIRSDEEQLINYAKN--HQI-LSL-----D------AS-----------
A0A2V8P7N1      FLQRRIDDLQSEIRSDEEQLINYAKN--HQI-LSL-----D------AS-----------
A0A2V8M3M6      FLQRRIDDLQSEIRSDEEQLINYAKN--HQI-LSL-----D------AS-----------
A0A1Q7NJH5      FLQRRIADLQSEIRSDEEQLINYAKN--HQI-LSL-----D------AS-----------
A0A2V8PJY0      FLQRRIADLQSEIRSDEEQLINYAKN--HQI-LSL-----D------AS-----------
A0A1Q7Y6W9      YLQRRIADLQGEIRSDEERLINYANQ--HQI-LSL-----D------PG-----------
A0A2V8NC68      FLQKRIADLQSEIRSGEEQLINYAKN--HQI-LSL-----D------AS-----------
A0A399WK13      FLQERIASLQSDIRRDEEKLVEMTQN--AGI-LKT-----S------DD-----------
A0A352FLX4      YLLKRIAELQSNIRGKEEELINYGKN--HQI-LSL-----D------AN-----------
A0A2V8RTL7      FLQKRINDLQTDIRGDEIKLVELKQS--EGI-LKT-----D------GD-----------
A0A3E0PCJ6      FLKKRIGELQSEIRQGEERLVDLKKN--AGI-LKT-----D------EN-----------
A0A3M1S4R8      FLAERIATLQSEIKRDEMRLAELKNN--AGI-LKK-----D------EG-----------
A0A1Q7YFI6      FLQRRIAEIQSEIRNGEERLINYAKN--NQI-LSL-----D------GS-----------
A0A136KC10      FLQERIASLQSDIRRDEEKLVEMTQN--AGI-LKT-----S------DD-----------
A0A2V8SEX6      FLQRRITDLQSEIRSDELELAELQKN--IGI-LKT-----D------GE-----------
A0A3M2D6Y5      FLSERIASLQAEIKRDEMRLAELKNS--AGI-LKK-----D------EG-----------
A0A0B6WWQ6      FLQRRIAELQAQIRAGEAQLLAYSKS--HQI-LSL-----D------PS-----------
A0A3B9MK99      FLQKRIAELQQQIRSDEERLVNYARN--NKI-ISL-----D------AN-----------
A0A352EX26      VLQKRIAELQQAIRSDEERLVNYAKN--NQI-ISL-----D------AN-----------
A0A2V8MM59      FLSKRVAELQDKIRSDEEKLVSYAKS--NQI-LSL-----D------AN-----------
A0A2V8PFE8      FLSKRVAELQQQIRADEEKLVSYAKN--NQI-LSL-----D------AS-----------
A0A2V8PWS6      FLSKRVAELQQQIRADEEKLVSYAKS--NQI-LSL-----D------AS-----------
A0A2V8LCT5      FLSKRVTELQSQIRSDEEKLVVYAKS--NQI-LSL-----D------AS-----------
A0A352FTJ9      FLSKRVEELQAQIRAAEEKLMAYAKS--NQM-LSL-----D------AN-----------
A0A2G6PYV5      FLEEKSNEYRQRIMELYSQLGEQQKN-SEDL-IVG-----R------AK-----------
A0A2V8F956      WLGQQLLEQRKQVEGAEKKLQQYREQ--NDS-ISM-----K------DR-----------
A0A1F2S1W5      FLVQQLAEQRNKVEASEQALQAYRER--TGS-VSF-----E------ER-----------
A0A1F2T595      FLTQQLAEQRKKVEASERALQEYRER--TDS-VSL-----E------ER-----------
A0A2V8JQV5      WLQLQLQELKVNLEKSEQELQDFGRA--TGL-MFT-----S------EKD----------
A0A2V9AC41      FLKQRLTELKERVEQSETALNSYRKD--KGI-ISV-----D------EK-----------
A0A2V8K4L4      WLTKQLDDLKIKLERSEDTLQSYALAVGLQF-TASSKGKDG------DQ-----------
A0A2V8NCZ3      WLTKQMDDLKIRLEKSEDTLQSYAVAVGLQF-TGAA-SKDG------EQ-----------
A0A2V9MAM9      WLNPQLEELKGKLVKSEGELQAYLRS--SGL-IFG-----A------GQ-----------
A0A2V9M454      WMEQRLDELKLKVEKSEEAMVTYERQ--NNI-ANI-----G------DK-----------
A0A2V9IVR7      WMEQQLDELKAKVERSQQALVDYERD--NKI-INI-----S------DK-----------
A0A2V9ILE2      WMEQQLDELKAKVERSQQALVDYERD--NKI-INI-----S------DK-----------
A0A2V9LGY4      WMEQQLDELKAKVERSQQALVDYERD--NKI-INI-----S------DK-----------
A0A2V9J4D6      WMEQQLDELKAKVEKSQEALVNYERA--NSI-VNV-----N------DK-----------
A0A2V9L9C5      WMEQQLDELKAKVEKSQEALVNYERA--NSI-VNV-----N------DK-----------
A0A2N9M9N1      WMEQQLDELKAKVEKAQQALVDYERE--YSI-TNL-----G------DK-----------
A0A2V9JEC4      WMEQQLDELKTKVERSQQALVDYEKA--NDI-ASI-----G------DK-----------
A0A2V9LPQ3      FMEQQLEELKAKVEKSQEALVGYERQ--NSI-VNV-----S------DR-----------
A0A348V070      FLSTQISALRKDIEEAEKKLAELGTA--QGI-LPL-----S------SA-----------
A0A2Z5G3A3      WLTSQMADLRKQSEALQAKVADLQKE--AGV-YTVGDGGPD------GK-----------
A0A2V7UGP8      FIGTQTTELKKQVSDLEAKLNQYGKE--NEI-IGL-----D------DK-----------
A0A239MKT6      WLTTQLEDLKRKIEENHRQVAAFQQK--SGI-VSEGMSAPA------PSAGGGARGNIGA
A0A3E0PCN7      FIQKRVAELQSKIRAGEQNLLSYSRN--NEI-LSL-----D------PD-----------
A0A2V8IYW3      FLESQLEDAKLRLIDREKKLEEYRRRYIGEL-PSQ-----L------QSNLQV-------
G2LEI9          FLSSTAARLQQEILEEERKLTEYLRT--RKI-VSL-----K------PE-----------
A0A317J121      WLSGQLEETRNKLQEAQQHLQEFVQS--SGN-LFV-----L------QD-----------
A0A2V7YW66      FLGTQIETLKKEVQDKETQLQAFSRR--TDI-VTL-----D------PA-----------
A0A2V7Z0V0      FLSSQIEKLKEEIQDKETQLQAFSRR--SDI-VTM-----D------PA-----------
A0A2V8GFD4      WLAARMAEQRSAVEASERALQQYREQ--YDA-ISL-----E------DR-----------
A0A2V8HSS5      WLAARMAEQRSAVEASERALQQYREQ--YDA-ISL-----E------DR-----------
A0A2V8KP55      LLSQQIVNLKGGLEKAEERLQKYGQD--NDI-LFT-----E------DG-----------
A0A399WNU1      FLQKRVAELQAKIRTGEESLINYAKS--NQI-LSL-----D------AN-----------
A0A2V9CG11      HLTVKLDEMKAKLEQSEAQLQDYART--SGL-TFT-----S------EK-----------
A0A2V2R0I6      WLTDQLSELKVKVQKSEDARIAYERQ--NQI-WTL-----D------DK-----------
A0A2V8XAR9      WLADQLSELKIKVQKSEDARIAYERQ--NQI-WTL-----D------DK-----------
A0A2V8VZA0      WLADQLGELKIRVQRSEDARIAYERQ--NQI-WTL-----D------DK-----------
A0A1Q7CB82      WLADQLGELKIRVQRSEDARIAYERQ--NQI-WTL-----D------DK-----------
A0A2V8WIU1      WLADQLGELKIRVQRSEDARIAYERQ--NQI-WTL-----D------DK-----------
A0A1Q6Y9F5      WLADQLGELKIRVQKSEDARIAYERQ--NQI-WTL-----D------DK-----------
A0A2V9EVV8      WLADQLGELKIRVQKSEDTRIAYERQ--NQI-WTL-----D------DK-----------
A0A2V8YF91      WLADQLSELKVKVQKSEDARIAYERQ--NQI-WTL-----D------DK-----------
A0A2V8XZK2      WLADQLNDFKIKVQRSEDARIAYERQ--NQI-WTL-----D------DK-----------
A0A2V8ZTX6      WLADQLRDFKIKVQKSEDARIAYERQ--NQI-WTL-----D------DK-----------
A0A2V9BT79      WLADQLRDFKIKVQKSEDARIAYERQ--NQI-WTL-----D------DK-----------
A0A1Q8B793      WLAGQLNELKIRVEKSEDARIAYERQ--NQI-WTI-----D------DK-----------
A0A2V9BCA0      WLADQLNELKIRVEKSEDARIAYERQ--NQI-WTI-----D------DK-----------
A0A2V9BWU9      WLKDQLNELQFKVEKSEDARIAYERQ--NQI-WNI-----D------EK-----------
A0A2V9DKX2      WLKDQLRELQFKVEKSEDARIAYERQ--NQI-WNI-----D------EK-----------
A0A2V9JSI3      WMEQQLDELKAKVEKSQQAMVDYERQ--NAI-VNI-----N------DK-----------
A0A2V9WI32      WLSVQLSDLQMKVETSQEKLVRYQKE--HDI-LGI-----D------EK-----------
A0A2V8IVN9      WLGERLGEERKQVEAAEARLQQYREQ--NDA-ISL-----K------DR-----------
A0A1F2TPT3      WLTARLAEQKEKLDASEQALEHFREQ--NQL-ITA----------------EG-------
A0A2V8JTQ2      FLANQLKELQARVEDSQRKLVDYQKE--NGL-FGL-----D------DK-----------
A0A2V8UZY0      FLANQLKELQSKVEESQQRLLAYQKQ--SGL-FGL-----D------NK-----------
A0A3N5YNR8      FLKKQLQDMKGKVEKSEQELVQYARE--NNI-VNI-----G------PD---R-------
A0A350UEK1      WLTRQMDDLRIKLERSEDALQSYAQR--NKL-VFT-----G------KD-----------
A0A350UIQ4      WLTKQLDDMRIKLERSEDALQNYAQR--NNL-LFT-----G------ND-----------
A0A3N6A5T6      FLQKQMHELKVKVEKSEEQLVAYARA--HNI-LSL-AGSSS------KEGDRS-------
A0A1F2Q9L4      FLTSQIEALKQEIQDKEAQLQAYSRR--SDI-VAL-----D------PS-----------
A0A1H5SQF5      WLTNQLSDLKNKVAESQRRVDDFRQK--VGI-IGAPTMSSA------GSPQVG-------
A0A3E0NV31      FLEDQLAELENEIEDSQDQLLAFARS--RDL-DVD-----------------G-------
A0A3N5M5V0      FLKKQLQDMKGNVEKSEGDLYRYARE--NNI-LNI-----N------DR-----------
A0A2V9AEW6      WLTNHLDEMKTQLEASEAQLQDYARI--TGL-SFT-----S------EK-----------
A0A2V8WQK6      WLTSHLGKMKGELEASEAQLQDYARA--SGL-SLT-----S------EK-----------
A0A2V8XIF4      FLTNHLDQMKAQLEASETQLQEYART--SGL-SIT-----A------EK-----------
A0A3N5XQP8      FLAEELKELRVKVEQSERDLNDYART--KGI-FTT-----E------GS-----------
A0A2Z5G7H4      WLTGQLSDLKKQAEALQARVIALQRQ--SGV-VSL-GVQDA------QGRDQA-------
A0A2V9L5B5      WLQGKNAEIKAKLEKAEDELQAYAQA--NSI-VYI-----T------EK-----------
A0A2V9LK56      WLSGRLDELKGKLEKSDNALQEYAKK--NSI-LFV-----D------DR-----------
A0A2V9L7I0      WLEGKIVEIKAKLEKAEDALQAYAEA--NSI-VYI-----T------EK-----------
A0A522PPT0      WLSGRLVELKAKLKASEDALQAYAAK--NSI-LFIQNAVNA------QA-----------
A0A2V9KCS3      WLTRQLEDQRINLEKSEDRLQGYARS--SGL-MFT-----A------EK-----------
A0A2U3KC61      WLKAKLDDLRRKVQTSEEILVRYQKD--HSI-LGV-----D------EK-----------
A0A2V9Y2R7      WLSGQLADLQLKVETSEGKLVRYQKE--HSI-LGI-----D------EK-----------
A0A372IT17      WLAGQMSGLKKQAEALQTKAIGLQSE--AGM-YGD-----N------GS-----------
A0A136JPP4      ELTKSIADLKVTIADQENKLTEYMRS--SNL-PLQ-----E------KG-----------
A0A399WUJ8      ELTKSIADLKVTIADQENKLTEYMRS--SNL-PLQ-----E------KG-----------
A0A2V9NGH6      WLSKQLIDLQIKVETSQEKLVRYQKQ--HQI-LGI-----D------EK-----------
A0A2V9PYE6      WLSKQLIDLQMKVETSQEKLVRYQKQ--HQI-LGI-----D------EK-----------
A0A2V9NL07      WLSRQLVDLQMKVETSQEKLVKYQKD--HQI-LGI-----D------EK-----------
A0A2V9QD92      WLSRQLVDLQMKVETSQEKLVKYQKD--HQI-LGI-----D------EK-----------
A0A2V9WPZ6      WLSKQLVDLQMKVETSQEKLVKYQKQ--HEI-LGI-----D------EK-----------
A0A2V9ZLH4      WLSKQLVDLQMKVETSQQKLVKYQKE--HSI-LGI-----D------EK-----------
A0A2V9RQF1      WLSKQLVDLQLKVETSQEKLVKYQKE--HGI-LGI-----D------EK-----------
A0A2V9YDK8      WLSKQLVDLQMKVETSQEKLVKYQKQ--HEI-LGI-----D------EK-----------
A0A2V9V8F7      WLSKQLVDLQMKVETSQEKLVKYQKQ--HEI-LGI-----D------EK-----------
A0A2V9XGR9      WLSKQLVDLQMKVETSQEKLVKYQKQ--HEI-LGI-----D------EK-----------
A0A2V9V3Q5      WLSKQLVDLQMKVETSQEKLVRYQKE--HEI-LGI-----D------EK-----------
A0A2V9NWS3      WLSKQLVDLQMKVETSQEKLVKYQKE--HEI-LGI-----D------EK-----------
A0A2V9USA9      WLNKQLVDLQMKVETSQEKLVRYQKE--HEI-LGM-----D------EK-----------
A0A2V9XW18      WLSKQLVDLQMKVETSQEKLVRYQKE--HEI-LGA-----D------EK-----------
A0A4R1LC91      WLSNQLADLRKQSEDLQARVVELQKK--AGI-VTL-----G------DDGTGR-------
A0A3M2BZG9      LLTSQIEELSREIEKLRTKLASSAAE--ANL-VLD-----P------DG-----------
A0A1Q7N5R7      LLREQLQAAEAGMHRAESALEAFRVR--T---ITL-----P------GDPGVA-------
A0A3M1SIV3      DITKSIDQLQENIAELENQRIAQMRE--SGL-PLA-----E-------K---G-------
A0A3E0PHB0      ELQNSIEKLKKTIEDGEQNYIGALRE--SNL-PVG-----D------GK---G-------
A0A3M2D491      DLTKSIEELKENIAQLEQQRIEEMKS--SGL-PLA-----E-------K---G-------
A0A357F267      DLGRSIDELRETIAQQEIELIEYMRS--SGL-PLQ-----E-------K---G-------
A0A353C9L6      DLAKSIEELQNTIAQQEIDLIAEMRS--SGL-PLQ-----E-------R---G-------
A0A2V8RQV0      DLTKSIEELKLTIQDQESQLMAQMRE--SDL-PLL-----E-------K---G-------
A0A2V8SJH5      DISKSIEELGKTISEQEADLISYMRS--SGL-PLQ-----E-------K---G-------
A0A2V9QB26      WLSRQLEDMRIKLEHSEDALQSYARS--TGL-IFT-----S------EK-----------
A0A2V9VYY4      WLGKELADLQLKVQTSEEKLVRYQKD--HGI-LGV-----D------EK-----------
A0A2V9KIE8      WLQGQLVGLKAKLEKSDDQLQAYAQE--HSI-LFI-----T------EK-----------
A0A352F549      YLQKRIAELQSQIRSGEEQLVNYAQS--HEI-LSL-----D------AS-----------
A0A3B9MLP9      YLQKRIGELQSQIRNGEEQLVNYAQS--HEI-LSL-----D------AS-----------
A0A3D5SQ87      YLQKRIGELQSQIRNGEEQLVNYAQS--HEI-LSL-----D------AS-----------
A0A2V8NW86      WLSRQLEDMRIKLEHSEDALQSYARS--TGL-IFT-----S------EK-----------
A0A2V8ZHL8      WMEQQLDELKAKVEKSQQALVDYERQ--NAI-VNI-----S------DK-----------
A0A2V9B240      WLEQQLDELKAKVEKSQQALVDYERQ--NLI-VNI-----S------DK-----------
A0A2V9CBM2      WLSRQLLSVKAKLEKSEDQLQAYARH--NGL-VFL-----Q------TDNGTT-------
A0A2V8XN17      WLSQQLVGVKAKLEKSEDELQSYARR--NGL-VFL-----E------TDKGAS-------
A0A2V8WX45      WLTQQLVGVKAKLEKSEDELQTYARR--NGL-VFL-----E------TDKGAS-------
A0A1Q6YR79      WLSQQLVGVKAKLEKSEDDLQSYARR--NGL-VFL-----E------TDKGAS-------
A0A1Q7VA32      WLSQQLVGVKAKLEKSEDDLQSYARR--NGL-VFL-----E------TDKGAS-------
A0A2V9EY85      WLSQQLVGVKAKLEKSEDELQGYARR--NGL-VFL-----E------TDKGAS-------
A0A2V9H8K0      WLSQQLVGVKAKLEKSEDELQSYARH--NGL-VFL-----E------TDKGAS-------
A0A2V9FFE5      WLSQQLVGVKAKLEKSEDALQGYARH--NGL-VFL-----E------TDKGAS-------
A0A2V9GM43      WLSQQLVGVKAKLEKSEDALQSYARR--NGL-VFL-----E------TDKGAS-------
A0A1F2RFI7      WLSQQLVGLKGRLEKSEEDMQRYAKD--NAI-LFL-----D------EK-----------
A0A1F2RZS3      WLSQQLVGLKGKLEKSEEDLQRYAKE--NSI-LFL-----D------EK-----------
A0A1F2USE2      WLSQQLTGLKAKLEQSEEELQTYAHE--QGL-LFL-----Q------NQRGEN-------
A0A2V9C238      WLSQQLLELKARLEKSENEMQSYARE--NGL-LFL-----E------KEKG-A-------
A0A1F2Q9F5      WLSEQLLEIKANLEKSEEQLQAYARQ--NGL-LFL-----E------NEAGQP-------
A0A1F2QQH9      WLSEQLLEIKANLEKSEEQLQAYARQ--NGL-LFL-----E------NEAGQP-------
A0A1F2QXK7      WLSEQLLEIKANLEKSEEQLQAYARQ--NGL-LFL-----E------NEAGQP-------
A0A2V9DEM9      WLSQQLLELKARLEKSENELQSYARE--NGL-LFL-----E------REKGVP-------
A0A2V9CYQ5      WLSRQLLSEKAKLEKSEDQLQAYAHR--NGL-VFL-----Q------TDNGTT-------
A0A2V9BWU8      WLSQQLVGVKAKLEKSEEQLQDYARH--NGL-VFL-----E------NDKGAS-------
A0A2V8ZG48      WLSQQLVGVKAKLEKSEEQLQDYAQR--NGL-VFL-----E------TDKGTS-------
A0A2V8Y334      WLSQQLVGVKAKLEKSEEQLQDYARH--NGL-VFL-----E------TDKGAS-------
A0A2V9AY68      WLSQQLVGVKAKLEKSEEQLQDYARH--NGL-VFL-----E------SDKGVS-------
A0A257VBK0      VMLAEAKKMQDQYARQQTTMTTSLAA--SGS-YF--PQ---------NQKE---------
A0A2V7XDY0      WLQERLGATQKSMREAQDRLFKSYQS--QDL-FV--PE---------GSTS---------
A0A350UQT3      FMERQIEELRVKMEDSSGRLAQMERE--LNV-IN--PE---------EKTN---------
A0A2U3JZ71      FMEKQLEELKAKMERSSGALVQFERE--LNV-IS--PE---------EKTS---------
A0A2V8TTB0      FMERQLEELRAKMEKSSAALAQFERE--LNV-IN--PE---------EKTS---------
A0A1F2TCR2      WLDDELKKQQQKVTDSEAAMMQYREQ--KDA-LS--LD---------SSQN---------
A0A1F2V330      LLNAELETLRSQLNEQEERLKIYKES--AVN-EL--PD---------RLA----------
A0A662EE63      VIQSRLDPLRLQVEAGQRKLMSFQEG--HDS-LG--FA---------DEQKS--------
A0A2V8TLH7      ALLSEIAPMREKLQDTQRSSFELAEK--ENL-YV--PE---------NQQK---------
A0A1Q7ZJT1      ALLSEIAPLKEKLEDTQRTSFEFAEK--ANL-YV--PE---------NQQK---------
A0A2V8VC99      ALLSEIAPLREKLKDSQQSTFEFAER--ANL-YV--PE---------NQQK---------
A0A348UZU3      FLSEQIAELKKEISQKEQELQNYGQE--KDI-VI--LS---------DKET---------
Q01XL7          WMDSQMEEAKSRLQTAGEKLRDFVRQ--SGM-DF--FP---------EQST---------
A0A2V8ERZ5      WLDKELDNQQKRVEGSEKGLAEYREK--ENA-LS--LD---------DKQN---------
A0A2V8GTX0      WLTEEVAKQQSVVQASERMLAEYREN--QNA-IS--LE---------DRQN---------
A0A2V8J0X9      WLGEELKRQEQQLAASEGALTEYRER--NNA-LS--LE---------DRQN---------
A0A523DUV7      WLQERLAAAEGDVKSSENSLYEYTKQ--QDL-FV--PS---------GGQS---------
A0A372IRG7      WLSQQLSTLKSQVQSSQQELSDYQKK--NNL-VG--LG---------PTGTS--------
A0A1F2U158      WLEKEVATQQSKVEQSERDLAEYRDR--ENA-MS--LD---------EKNN---------
A0A2V8F6S9      WLDKELAKQLQKVQESERAMANYRER--QNA-LS--LD---------DKQN---------
A0A4Q1SCH5      WLSAQMDDLQKHAADAQQKLAKFQED--NNL-VG--TD---------PTDN---------
A0A3D1ASD2      FMTKELEELKAKMERSSDALAKFQRD--LSV-VN--PE---------EKTS---------
A0A2N9MK30      FMEKQLEELRAKMERSDTALAQFEKE--LNV-IN--PE---------EKTN---------
A0A4Q7YNP3      WLAQQAADIKLLAEESQHKLEAATGG--NGL-VL--SQ---------ESTT---------
E8UZE1          WLQDQLETLRHQVDADQKNFEEFQER--TGL-LQ--TG---------EGHN---------
A0A1V6HR88      FLGAQIETLKQEIQDKENQALAYSKR--ADI-VT--LD---------TGGN---------
A0A3E0P0A3      DIQAEISSLEAEIQELEADLVSYTQS--SDI-VA--PN---------EETN---------
A0A2V8EXP2      WLGERLAEQRQKVEVSEQAVQRYREQ--TES-VA--FE---------DRQN---------
A0A2W4RYA1      WLMARLAEQRKAVEEAEAALQRYREQ--NNA-LS--LQ---------DSQN---------
G8P0Y7          WLSKQLADMQIKMETAQAKLVQYQKE--HAI-VG--TD---------DKQN---------
A0A5M8T4U7      WLEKQLEDLKEQAADAQIRLANFQKQ--HNI-VG--TD---------ENSN---------
A0A3P0X3W6      FMAKQLDDLKANMDKSAEALTTYQRQ--LGV-ID--PE---------QQTS---------
A0A1E3Y9R6      WLTSQLEEQRRLVEESERRLQDYKEQ--NNA-TS--VD---------DK------QN---
A0A2W4TLP2      WLNTQLEEQRRLVEESERKLQQYKEQ--HNT-VS--VD---------DK------QN---
A0A3R9WF43      WLQKELDDLKKQVRDSEQRLADYERT--TGL-AG--VQ---------VSGSTSG-DGTSS
A0A317HKM4      WLSRQVEEQRKLLEASETALQAYRRD--HGA-DA--LV---------RTNQLGEERQN--
A0A523E0N1      FIDEEIGELRNDIQEKERLLRDYSRE--NQI-VI--AE---------DEN-----NS---
A0A523ECP2      FIREQVEKIQVEIQEREQRLQEYSQR--QDL-MM--VD---------EKEL---------
A0A2W0C122      FLSAQLTELRATVEESQQKLVAYERE--HNI-LM--VD---------DK------QN---
A0A2W0AUU7      FLSTQLNELRAKVEESQQKLVAYERE--HNI-VM--VD---------EK------QN---
A0A2W0BQL1      FLSTQLNELRAKVEESQQKLVAYERE--HNI-VM--VD---------EK------QN---
A0A4Q1SDL1      WLTGQLGDLRKQSEEEQEKLAALEKQ--TGI-YS--FG---------TDN-----QGREQ
A0A3P0XH15      WLAKQLEPLKNQVTESQDALSTYQKQ--NNL-IG--VD---------SNGSG---QD---
A0A4R1LAZ7      WLAQQLTALKGQVEDSQKALAKFQRD--NNL-IG--ID---------SEG-----GN---
A0A3M1WQW8      WLNKRLTELREKLEQLQEELVRYSRE--HEI-IQ--LD---------ENQT---------
A0A3N1JHC1      FLTQQLEGAKKKLQESGEALQEYARA--SGI-VL--TS---------ETQ-----EP---
C1F294          WLSQQIISLRESVNKSQNDLVQYQRE--HNL-LS--VG---------QQG-----SS---
A0A2V9KA79      LVGARVEQLRKQMQEQQDRITRYKQA--TLS-EL--PE---------NLGNNYKLLE---
A0A522PSP1      YMREQVKELSERMKESQLALNAFERE--NSI-I---NP---------ENT-----SG---
G8P085          WLSSEMDSLRERAAEAQKKLADFQEK--NNI-LM--LG---------GGSSGSSKDGGGE
A0A4Q1SGQ1      WLAGQLKGLRAQTQALEDRASRLQRD--TGI-Y---GD---------DAG-----HN---
Q1ILD9          WLAKQLVELKTGIQSSEQQIADYQKT--HKI-I---GT---------DEN-----NN---
Q1IJZ6          WMSAQIKDLNQQVEAAQQKLINYEKE--SGL-IA--IT---------ATD-----PKNPA
A0A2V8TCE6      FLSRRVGELRDEVEDLEKRLQSYRES--RRI-L---PS---------AGA-----EN---
A0A522TBE8      YMSGQLDNLRAQTEQAQQNLVSYESR--ANI-L---DP---------DSK-----DN---
Q1ITG0          WLQQRLTELKNNVEESQRKLAEYQSK--ANI-I---GT---------DET-----DN---
A0A3N5PCI5      WLAEQLAEQRRKVEVSELALQKYRER--ENS-L---SL---------EAG-----QN---
A0A3M1Q0S9      FLVDQVRSLKEDINRRRLELHEYAMR--HNI-V----T---------GDA-----NE---
A0A2Z5G448      WLSGQLTELKAHAADAQRKIAQFQRA--NNL-IG--MD---------AEG-----GN---
A0A3M1VZ38      WFVERVAELKREVSDLELALQDYAAQ--HQI-V----L---------GQG-----ED---
A0A4Q1SD29      WLSQQLTSVKKQVEDAQQDLAKFQRE--NNL-VA--MD---------ATG-----GD---
A0A3M1PY35      FLDRRIEDAQAELLELERRLAEERRR--LGP-V---LA---------RGS-----DE---
A0A3M1VMP2      FLERAIQEAQAEVLELEAKLAQARRQ--APP-T---VP---------ERE-----DE---
A0A2V8G155      WLEERLAEQRKVVEQAEARLQAYREE--HDAIVP--AE---------DRQN---------
A0A2V8HDM7      WLEERLAEQRKVVEQAEARLQAYREE--HDAIVP--AE---------DRQN---------
A0A2V8DRT9      WLGERMGEQRKTVDASERALQVYREQ--HDA-VS--LE---------ERQN---------
A0A2V7VYF3      WLGQQLAEQRKKVEVSELAIQRFRED--NDA-VS--LE---------DRQN---------
A0A1F2SVH2      WLGERLAEQRKQVEASEQAVQRYREQ--TDS-VS--LE---------EKQN---------
A0A2V8AJG9      WLGERLSEQRKQVEASEQALQRYREQ--TDS-VS--LE---------DKQN---------
A0A2N9LQU7      WLSKQMEELKLNAARAEQRLAEFQKQ--NNI-LG--TD---------ENNN---------
A0A2P6WFK7      WLSKQMDDLQTRATQSQQRLSEFQMK--NNM-IG--AD---------ENDN---------
A0A2V8U914      WLGPRIQELRSKLQTSEAALDEYTRE--SGL-VL--AP---------GDDT---------
A0A2V7W309      FLSQQIATVQANLEESRQDLLSYGKS--KGI-IS--VD---------EGSN---------
A0A2W0BGU4      KMEEQLDELKAKVEKSQRALVEYERQ--NAI-LS--IG---------EKQN---------
A0A2W0BVQ9      KMEEQLDELKAKVEKSQRALVEYERQ--NAI-LS--IG---------EKQN---------
A0A2V9MN96      WLSKELSDLQLKVQASEEKLVRYEKQ--KGI-VG--ID---------EKQN---------
A0A2V7V2Z1      WLGQQIEEQKGKVEQAERALQQVKEQ--EGI-VN--IE---------ERRT---------
A0A2V7X2F7      WLGGQIDQQRQKVEQATQELQKLKER--EGI-VN--IE---------ERRT---------
A0A2V7V2I1      WLGSQIEEQRHKVEQAELALQKLKEK--DGI-VN--IE---------ERRT---------
A0A2V7U3M2      WLGQQIEEQKAKVEAADLALQKVKEQ--EGI-VN--IE---------ERRT---------
A0A2V7UHT0      WLGQQIEEQKTKVEEADRALQKVKEQ--EGI-VN--IE---------ERRT---------
A0A2Z5FVL3      FLESQLAEMKADSDALEQKAVKLQKQ--TGV-VQVAGSGDG------DGQG---------
A0A2V9KBD6      FLTNQLKELQARVEDSQQKLMEYQKQ--NGI-LG--LD---------NQQN---------
A0A2W0AJ66      FLLNQLTDLKAKVEESQQKLVDYQNR--NGI-FG--LD---------DKQN---------
A0A1Q7RBU1      FLANQLKELQAKVEESQQKLVDYQKE--NGI-FG--LD---------DKQN---------
A0A2V9JPV9      FLASQLKELQAKVEESQQKVVDYTKE--IGI-FG--LG---------DKQN---------
A0A1I6MH75      WLQNQLDGLKQEVETSQEQMMDLQKR--LGT-LG--FD---------PKDN---------
E8WVF6          WLSGQLDDLKRQVETSQEQVLDLGKK--LGT-LG--FD---------STHN---------
A0A1H5Z7N3      FLSTQLGDLKQQVETSQEQMIDLQKK--IGI-LG--FD---------PTHN---------
A0A2V9YHT3      WLTRQLSELRMKVESSQEKLVKYEKD--NDI-LG--ID---------EKQN---------
A0A1G7JVV8      WLQGQLDDLKQQVEASQEQLMDLQKK--IGV-LGLGADASK------PVTT---------
A0A1H4T6W9      WLSGQLDDLRQQVETSQEQLIDLQKR--LGV-LGLGFDATK------PPTT---------
I3ZEU5          WLSGQLDDLRQQVETSQEQLIDLQKR--LGV-LGLGFDATK------PPTT---------
A0A428MDU2      WLSGQLDDLKQQVQTSQERMMDLQRR--LGM-LG--FD---------PSHN---------
A0A5B9EBI2      WLTGQLDDLKQQVETSQEQLLELQRR--LGS-VGVSID---------PTHS---------
A0A239HDF6      WLSKQLEDLKADVEASQEKMINLQRR--LGI-LG--FD---------PTHN---------
A0A4Q0T270      WLSGQLDDLKAQVELSQEQMMDLQKR--LGV-LG--FD---------PKDN---------
A0A1Q3QQB6      WLSSQLDDLKQQVETSQEQMMDLQRK--LGI-VG--FD---------PNHN---------
A0A3N1K1G7      WLQGQLDDLKQSVETSQEQMMELQKR--LGI-LG--FD---------PSHN---------
A0A4V2G466      WLSGQLDDLKQQVQASQEQMLDVQRR--LGI-LG--FD---------PNHS---------
A0A6B9YNQ8      WLSGQLDDLKQQVQSSQERMLDVQKR--LGI-LG--FD---------PNHS---------
                                                                            

A0A2V7VMF7      ----------AASSIGKLNE----DY---VAAQARRIGIEAALKQFAEMRKARKNLDTI-
A0A2V7YYV7      ------------------------EL----------------------------------
A0A2V7Z0J5      ------------------------EV----------------------------------
A0A2V7Z3M4      ------------------------EV----------------------------------
A0A399Y5V2      ----------ATAELQQRDA----------------------------------------
Q01X01          ----------A---LQTESD----------------------------------------
A0A3M2D9H8      -----KRLQDVTNIISGLQA----EI---NQLQADIVRLESDHETVLG------------
A0A2V8JK38      -----RNT--VTEKLRQLQE----EY---TRAQAERIQKQSYERMVRTGS----------
A0A2V9IXG5      -----ASV--EFEMVSRYRA----DY---EDAKAKREEEEQKLAKLETYIADSSKLTNI-
A0A2V9J2P4      -----ASV--EFEMVSRYRA----DY---EDAKAKREEEEQKLAKLETYIADSSKLTNI-
A0A1Q7RLS4      -----QKI--TNDRLSTLQS----EL---TEAQVKKGEIEGLLKQIDANRQNGGAYENI-
A0A2V2R525      -----QNT--VVERLNSLNR----SL---LTAENDRTLAEAAYRAAL----E--------
A0A321LPW6      -----ETL--TTDKLSRLHD----QV---MRAETDRLLKGSLYEELN----M--------
A0A2V9R9V4      -----ATL--VAEKLSRLHD----LA---TRAETDRILKESLYEQVR----Q--------
A0A321LE75      -----EAP--AVNKLAQLYT----QV---TTAEVQRKLKESLYQQVK----G--------
A0A2V8R8U7      -----PNI--EAVRDATYSS----QL---LAAENERRTFLAIYEAAKN---A--------
A0A2V8QMP4      -----QDL--NALQLSTYSS----QM---QTAEAA-------YTSAEQTKNT--------
A0A2V8R4S3      -----QDL--NALQLSTYSS----QM---QTAEAARKQAEADYKSAVETRNT--------
A0A2V8NJ55      -----VDI--TNVRVGSYSS----QL---IEAENKRKQAQATYDAARN---S--------
A0A2V8Q7I0      -----LNT--EAQRLADLTK----QL---FESENKRKNAEAVYKSAST---A--------
A0A2V8S6K4      -----ANV--TVERVAMLST----EW---LNAQNEVTKLQSEYDAAQKAQAA--------
A0A317I2L9      -----LDV--EGQRLNSLSG----QL---LDAENQRKTAQAIYNSAKN---A--------
A0A2V8LLF9      -----TNL--EAMRLQTYSA----QL---LAAEDNRRSQEAIYDAARD---A--------
A0A352FRF4      -----SNL--RQQRVSTYSS----QL---LEAENQKRSLQSAYEAAKT---S--------
A0A2V8MKV0      ------NV--PIQREQTYNK----QL---LDAQNEYRKLKADYDEAKA---S--------
A0A2V8PYY8      ------NV--AAQSEQAYNK----QL---HDAENERRKLKADYEEAKG---A--------
A0A1Q7YKQ8      -----ADL--AADRLAQLSK----QL---LEAENNRKNLQSLYEAAAH---Q--------
A0A352F3R7      -----SNL--EVARLSTLSS----QL---LQAENDRKLIQAQLEAARR---E--------
A0A0B6WXT1      -----QNL--TLERLATLSG----QL---LEAENERKNLQSAYEAAQR---E--------
A0A3B9MEU8      -----GNL--EAARLATLSG----QL---LQAENDRKMIQAQLEAARK---E--------
A0A2V8MHG6      -----QNT--VVDRLAGLNK----QL---LEAENERKAAEAAYRATL----A--------
A0A2V8P7N1      -----QNT--VVDRLAGLNK----QL---LEAENERKAAEAAYRAVL----A--------
A0A2V8M3M6      -----QNT--VVDRLAGLNK----QL---LEAENERKAAEAAYRAVL----A--------
A0A1Q7NJH5      -----QNT--VVDRLAGLNK----QL---LEAENDRKAAEAAYRAVL----A--------
A0A2V8PJY0      -----QNT--VVDRLAGLNK----QL---LEAENDRKAAEAAYRAVL----A--------
A0A1Q7Y6W9      -----QNT--VVERLAGLNR----QL---LEAENQRKLAQAVYEASL----Q--------
A0A2V8NC68      -----QNT--VVDRLVGLNR----QL---LEAENDRKMAEASYRAAL----R--------
A0A399WK13      -----STI--VMDRLSGLNK----AM---LEAENARKNAEANYFEIAK---S--------
A0A352FLX4      -----QNT--VVERLEGLSK----QL---LIAENERKMAESAYKASL----Q--------
A0A2V8RTL7      -----QTI--VIDRLSGLNK----QL---LEAENARKLAEAKYFAIKD---S--------
A0A3E0PCJ6      -----TTI--VTQRLMGLNE----QL---LEAEEQRKNAEAQFNAVRD---S--------
A0A3M1S4R8      -----QTI--VIDRLAGLNK----QL---LEAENIRKIAEAEYMAVKD---S--------
A0A1Q7YFI6      -----QNT--VVERLAGLNR----QL---LEAENERKLAEAAYRAAQ----A--------
A0A136KC10      -----STI--VMDRLSGLNK----SM---LEAENARKNAEANYFEVAK---S--------
A0A2V8SEX6      -----QTI--VLERLAGLNK----NL---LEAENKRKNAEAQYVAIKD---S--------
A0A3M2D6Y5      -----QTI--VIDRLAGLNR----QL---LEAENARKIAEAEYNAVKD---S--------
A0A0B6WWQ6      -----QNT--VVERLAGLNR----QL---LDAENERKLAEAAYLASL----E--------
A0A3B9MK99      -----QNT--VVERLGGLNK----QL---LEAENARIEAESKFNAAK----V--------
A0A352EX26      -----QNT--VVERLAGLNK----QL---LEAENERKTAEAAFNAAK----A--------
A0A2V8MM59      -----QNT--VVERLSGLNK----QL---LEAENDRKLAEAEYNAAK----A--------
A0A2V8PFE8      -----QNT--VVERLAGLNK----QL---LEAENDRKMAEAEYNAAK----A--------
A0A2V8PWS6      -----QNT--VVERLAGLNK----QL---LEAENDRKMAEAEYNAAK----T--------
A0A2V8LCT5      -----QNT--VVERLAGLNK----QL---LEAENDRKMAEAEFNAAK----A--------
A0A352FTJ9      -----QNT--VVERLAGLNK----QL---LEAENDRKMAEAEFNAAK----A--------
A0A2G6PYV5      -----SAV--EEQALVKLNE----EI---AVANRSFIEKRNNLQALQAST----------
A0A2V8F956      -----ENI--VVQKLTELTG----AV---TQAKTERFQREALYRQVESLRGNPAMLDTF-
A0A1F2S1W5      -----QNV--VVQRLADLNA----AV---TKANTVRIQKEATYNQVKAVLENPAAIDTV-
A0A1F2T595      -----QNI--VVQKLQELNA----AV---TRANTARIQKEAVYNQVRTVLEDPAAMDTV-
A0A2V8JQV5      -----SSV--AEEKLHHLEA----DL---SEALADRVEKQSKYEIAKSAP-----VESL-
A0A2V9AC41      -----ENV--VIDRLLDLNR----SL---TKAEAERIGLEAQMHSIHGRN-----YDEV-
A0A2V8K4L4      -----ENV--ASASVRLVQE----EL---LKARADRMIAQSKYELLASSP-----PEAL-
A0A2V8NCZ3      -----ENV--VSTSVRLLQE----EL---LKARAERMVTQSRFELIQSSP-----PEAL-
A0A2V9MAM9      -----ETL--AENRLHLIES----EL---SKAQADRIAKTPAYQLADKEH----------
A0A2V9M454      -----QTA--EEARFEDMSK----EL---SQAQSDRISKESLYKMVVSNEAQV-------
A0A2V9IVR7      -----ENV--EEKKLGDLSK----EL---TDAQAEVVRAESLYNVARNNENQM-------
A0A2V9ILE2      -----ENV--EEKKLGDLSK----EL---TDAQAEVVRAESLYNVARNNENQM-------
A0A2V9LGY4      -----ENV--EEKKLGDLSK----EL---TDAQAEVVRAESLYNVARNNENQM-------
A0A2V9J4D6      -----QSV--AEQRLSELSS----DL---TRAQSDRAEKESLHQLVKSNEAQI-------
A0A2V9L9C5      -----QSV--AEQRLSELSS----DL---TRAQSDRAEKESLHQLVKSNEAQI-------
A0A2N9M9N1      -----ENV--VQQRLAQLST----DL---TAAQVERANKQSVYDSARHNNAEA-------
A0A2V9JEC4      -----ENV--VQLRLEDLSK----DL---TTAQTDRAQKESLWESVQEDNSLA-------
A0A2V9LPQ3      -----QNV--VEQRLSDLSR----DL---TTAESDRAQKESLYQMVKSNPEQI-------
A0A348V070      -----EAP--LIQKITEVNT----AL---TAATLDRVNKFSAYNQLKALR-----PEEL-
A0A2Z5G3A3      -----TQA--YSSDINRLEL-ATTAL---SGAESNRILTGAVEQIVKTGD----------
A0A2V7UGP8      -----ENI--TNQKLGQLNQ----DV---LEAQVESSRKEARYRGLLTTP----------
A0A239MKT6      MAPSVDST--AFQRLSALNE----EL---TRAEVARIQREALYHIIQTND----------
A0A3E0PCN7      -----QNI--VVQRLSDLNG----KL---NQAEMERINAEAALSAAQQDP-----MRGV-
A0A2V8IYW3      -----IQT--TQIQLQSLSE----SL---NRDRDRRLVLERGLADMRADPATAAATAD--
G2LEI9          -----DNP--EVARLTGLNQ----AL---LEAEKERLRAEERYQASLTQP-----IDSL-
A0A317J121      -----NTL--DNSKLRQLQG----EL---SAIQADRIAKQAKYELVAKTS-----PEAL-
A0A2V7YW66      -----TNV--ILKRLEVLNG----SL---MEAKRVRIEKEAKYHETITGP----------
A0A2V7Z0V0      -----ANV--TLKRLEALNT----QY---IEAKKMRIEREAQYHETQSGP----------
A0A2V8GFD4      -----QNI--VVQRLEDLNG----AV---TKAHTERLQKQALFEQLQAARGDAAALDRF-
A0A2V8HSS5      -----QNI--VVQRLEDLNG----AV---TKAHTERLQKQALFEQLQAARGDAAALDRF-
A0A2V8KP55      -----RNT--VTEKLRQLQE----EY---TRAQAERIQKQSYERMVRTGS-----ADAL-
A0A399WNU1      -----QNT--VVQRLSDLNT----KL---SQAENDRITAEAAYKAALNNP-----LAGTT
A0A2V9CG11      -----DNV--SDARLVELQS----EL---TKAQAERIAKQAKFEQVKSTP-----VESL-
A0A2V2R0I6      -----QNI--ATQRLGDVNR----EL---TQAQSERMKREALFEFAKAGN-----LDAV-
A0A2V8XAR9      -----QNI--TTQRLSDINK----QL---TDAQSERMKKESLYEFAKSGN-----LDAV-
A0A2V8VZA0      -----QNI--TTQRLSDINK----QL---TDAQSERMKKESLYQFAKAGN-----LDAV-
A0A1Q7CB82      -----QNI--TTQRLSDINK----QL---TDAQSERMKKESLYQFAKAGN-----LDAV-
A0A2V8WIU1      -----QNI--TTQRLSDINK----QL---TDAQSERMKKESLYQFAKAGN-----LDAV-
A0A1Q6Y9F5      -----QNI--TTQRLSDINK----QL---TDAQSERMKKESLYQFAKAGN-----LDAV-
A0A2V9EVV8      -----QNI--TTQRLSDINK----QL---TDAQSERLKKESLYQFAKAGN-----LDAV-
A0A2V8YF91      -----QNI--TTQRLSDINR----QL---TEAQSERMKKESLYQFAKSGN-----LDAV-
A0A2V8XZK2      -----QNM--TTQRLGDINR----QF---TDAQSERMKKESLYEFAKAGD-----LDAV-
A0A2V8ZTX6      -----QNM--TTQRLSDINK----QF---TDAQAERMRKESLYEFAKAGN-----LDAV-
A0A2V9BT79      -----QNM--TTQRLSDINK----QY---TDAQAERMKKESLYEFAKAGN-----LDAV-
A0A1Q8B793      -----QSI--TTQRLGEINK----EL---TEAQSDRMKKEALYQLAQSGS-----LDAL-
A0A2V9BCA0      -----QSI--TTQRLGEINK----EL---TEAQSDRMKKEALYQLAQSGS-----LDAL-
A0A2V9BWU9      -----QNI--TQQKLSDLNK----EL---TQAQGERMRSEALYQLVGTGH-----IDAL-
A0A2V9DKX2      -----QNI--TQQKLSDLNK----EL---TQAQGERMRSEALYQLVGTGH-----IDAL-
A0A2V9JSI3      -----QSV--EEQRLAQLSN----DY---TNAQNVRLDKESLFELASSNEAEA-------
A0A2V9WI32      -----QNI--VTSKLDELNK----EL---TAAEGDRIQKESAYKLASAGN----------
A0A2V8IVN9      -----ENI--VVQKLSDLNS----AV---TQAKTERLQKEALYSQLNSLRSGRGAALDTF
A0A1F2TPT3      -----SPI--VMARLNELSA----SI---TRAQTGLFDKEASYNRALALRANPDKLDQL-
A0A2V8JTQ2      -----QNI--VTTKLTDLNR----EL---TAAEVDRVQKDVNYQLARSGQ----------
A0A2V8UZY0      -----QNL--VTAKLDDLNR----GL---TAAEADRIQKEVNYRLAVSGR----------
A0A3N5YNR8      -----GSI--VLQTLEDLNR----QM---TTVEGELIGKTADYQAVRDAT----------
A0A350UEK1      -----TNV--DEEKLKQIQD----QL---TAVQGDRVSKQSRWEMASSAP-----AETL-
A0A350UIQ4      -----TNV--DEVKLKQIQD----QL---TAVQGDRVSKQSRWEMASSAP-----AASL-
A0A3N6A5T6      -----QNI--IMQKLADLNQ----EM---TKVEAQMIERSAEFDAVKNAT-----VQDF-
A0A1F2Q9L4      -----SNV--TLQRLEGLNK----DY---VGAMSERIGKEAHYKELANTP----------
A0A1H5SQF5      -----SDL--GSVELARLND-LNAQL---TAAETVRIAAEAAYRMTQSRD----------
A0A3E0NV31      -----ESA--SSRRVGDLAR----LQ---TEAEAEAARLRSYVDTLRAGR-----TEGV-
A0A3N5M5V0      -----GSI--VLQTLEDLNR----QM---TTVEGELIGKTAEFQAVRDAT----------
A0A2V9AEW6      -----ESL--AEARLKEIQD----EL---SKAQADRIANQAKYAEAAGKS-----ADSL-
A0A2V8WQK6      -----ENP--VVNRLKELQD----EL---SKAQADRIAKQAKSEEARSKP-----ADSV-
A0A2V8XIF4      -----ENP--AENRLKELLD----EL---SKAEADRIAKQAKFEEAQSKP-----ADSL-
A0A3N5XQP8      -----QNE--VTQKLNDLNT----EI---TRAQANLIAEQSQYDQARAAS-----ATRV-
A0A2Z5G7H4      -----YSV--IVDRLQQATA----TL---SQATSNRILKGAVYKIVQSGN------AELI
A0A2V9L5B5      -----QNM--ATARLEELLE----AY---TKAQSERFEKQSLYSLVEAGK-----IQDL-
A0A2V9LK56      -----KNL--ANERLGQLQQ----EY---TKAQADRFQTESLYNLVKPDA-----AKDV-
A0A2V9L7I0      -----QNM--GNARLEELLQ----EY---TKAQAQRFEKQSLYSLVEAGK-----VQDL-
A0A522PPT0      -----QSM--ANARLEQLEE----EY---TRAQADRAQKEAQYSLVHTGK-----VQDL-
A0A2V9KCS3      -----DNV--AEARLRQLQE----EL---SKAQGDRVAKQSRYEVALSSS-----LEAL-
A0A2U3KC61      -----QNI--VTAKLNELNN----EL---TVAQTDRIQKESNYNLAMAGD----------
A0A2V9Y2R7      -----QNI--VTAKLDELNK----EL---TEAQTDRIQKEANYKSAMVGD----------
A0A372IT17      -----HDV--VLAQLENLNQ----AL---SQAELNRILKEAIDHTAQSGD----------
A0A136JPP4      -----SDL--AASRLQTLSE----QW---LSAADDRRKLEARYNGAVQASSRGEGRNI--
A0A399WUJ8      -----ADL--AASRLQTLSE----QW---LSAADDRRKLEARYNGAVTASSRGQGQNI--
A0A2V9NGH6      -----QNI--ITAKLDELNR----EL---TTAESGRMEKESIYGLVQATD----------
A0A2V9PYE6      -----QNI--ITAKLDELNK----EL---TAAESGRMEKESIYGLVQATD----------
A0A2V9NL07      -----QNI--TTAKLDELNK----EL---TAAESARMEKESVFRLSDSVD----------
A0A2V9QD92      -----QNI--TTAKLDELNK----EL---TAAESARMEKESVFRLSDSVD----------
A0A2V9WPZ6      -----QNI--TTAKLDELNK----EL---TAAESERMEKESVYRLIQSGD----------
A0A2V9ZLH4      -----QNI--ITEKLDELNK----EL---TAAESDRMQRESLYRLTRSGD----------
A0A2V9RQF1      -----QNI--ITSKLDELNK----EL---TAAESDRMQKESVYRLVQSGD----------
A0A2V9YDK8      -----QNI--TTAKLDELNK----EL---TSAESERMEKESVYRLIQSGD----------
A0A2V9V8F7      -----QNI--TTAKLDELNK----EL---TAAESGRMEKESVYRLIQSGD----------
A0A2V9XGR9      -----QNI--TTAKLDELNK----EL---TAAESGRMEKESVYRLIQSGD----------
A0A2V9V3Q5      -----QNI--ITQKLDELNK----EL---TSAESERMEKEAIYRMTQTGD----------
A0A2V9NWS3      -----QNI--TTSKLDELNK----EL---TSAESDRMAKESFYTLVQAAD----------
A0A2V9USA9      -----QNI--TTAKLDELNK----EL---TSAESERMDKEAFYRLVESGD----------
A0A2V9XW18      -----QNI--TMAKLDELNK----EL---TAAESERMDKEALYRLVDSGD----------
A0A4R1LC91      -----TPA--YSSVLDRLEQ-ATTAL---TQAQSSRIEKGALYQAIKSGN------GELI
A0A3M2BZG9      ------EA--IIERKKSLET----TL---NRAVIDRLDKQAIWDELRNLT----------
A0A1Q7N5R7      -----AAG--APPRGSPLGEFFSLRI---EQDQMRRDADALEHVLISMRD----------
A0A3M1SIV3      -----QEL--TAGILRSKSE----EW---LKAEADRRKLEQMYEAALQAANRGEIFSIVS
A0A3E0PHB0      -----AEL--SASRLSTVSS----QY---LTAIDERRKLEAEYSAAVQAKNP---YAL--
A0A3M2D491      -----QEL--AASILEQKST----EW---LKAEAERRAIEQQYRTAVEVAKKGEILSV--
A0A357F267      -----QDL--AATRLGSMSE----TW---LRALEARRQLESRYNAAVSARARGEGMNL--
A0A353C9L6      -----QDL--SASRLSSLSE----TW---LKAMESRRQLEGRYNAALTANSRGEGMNI--
A0A2V8RQV0      -----QDL--AAQRLGAMSE----AY---MKAMETRRQLEATLNAAESANARGEAVNI--
A0A2V8SJH5      -----QDL--SAARLQSMSE----TW---LKAMEGRRQLEARYTAAAQAGARGEGMNI--
A0A2V9QB26      -----TKI--SEEKLQQLQG----EL---SKTQTDRITAQSRWEITAASP-----PDAL-
A0A2V9VYY4      -----QNI--VTEKLGELNK----EL---TEAETDRIQKEADYKLAMNGDPEMFMKTSP-
A0A2V9KIE8      -----QNL--VNDRLQQLEQ----EY---TKAQAARFHAEASYTLVKSTK-----NMDL-
A0A352F549      -----QNT--VVERLAGLNK----EL---LEAENDRGLAEAAFRTSKLPG-----ATEA-
A0A3B9MLP9      -----QNT--VVERLAGLNK----EL---LVAENERSLAEAAYRASLAPG-----VTEA-
A0A3D5SQ87      -----QNT--VVERLAGLNK----EL---LVAENGRSLAEAAYRASLAPG-----VTEA-
A0A2V8NW86      -----TNI--SEEKLRQLQG----EL---SKTQADRITAQSRWQGTTTSP-----PDAL-
A0A2V8ZHL8      -----ESV--VEQRLADLSR----DL---TNAQSDRVQKESLYELVKSNE------SQV-
A0A2V9B240      -----ESV--VEQRLADLSR----DL---TNAEGDRVQKESLYELVRSNE------SQV-
A0A2V9CBM2      -----QNI--ANERLQQLQQ----EL---TKAQAELYEKESLYRLVQTSD-----YGSL-
A0A2V8XN17      -----QNV--ANERLQQLQE----QL---TKAQSERYEKEALYRLVQTGE-----LGAL-
A0A2V8WX45      -----QNV--ANERLQQLQE----QL---TKAQAERYEKEALYRLVQTGE-----YESL-
A0A1Q6YR79      -----QNV--ANERLQQLQE----QL---TRAQSERYEKEALYRLVQTGE-----FGAL-
A0A1Q7VA32      -----QNV--ANERLQQLQE----QL---TRAQSERYEKEALYRLVQTGE-----FGAL-
A0A2V9EY85      -----QNV--ANERLQQLQE----QL---TKAQSERYEKEALYRLVQNGE-----FGAL-
A0A2V9H8K0      -----QSV--ANERLQQLQE----QL---TKTQAERYEKEALYRLVQAGE-----SGAL-
A0A2V9FFE5      -----QNV--ANERLQQLQE----QL---TKAQSERYEKEALYRLVQTGE-----SGAL-
A0A2V9GM43      -----QNV--ANERLRQLQE----QL---TKAQSERYEKEALYRLVQTGE-----SGAL-
A0A1F2RFI7      -----QSL--TTEKLKQLQE----EA---TRAQADLFQKESLYNQVRTGD-----LSSV-
A0A1F2RZS3      -----QSM--NAQKLQQLQE----EA---TRAQSDLIQKESLYNQIRDGD-----FSSV-
A0A1F2USE2      -----ENI--VNQRLRQLQE----QL---TQAEADRYQKEALYQLLAQGD-----YASL-
A0A2V9C238      -----ENI--VNERLRQLQE----EL---TRAQAARYEKESLYRLVQAAD-----YASL-
A0A1F2Q9F5      -----ENI--VNERLLQLQA----EL---TRAQAERIAKESLYRLTQAGE-----YGAL-
A0A1F2QQH9      -----ENI--VNERLLQLQA----EL---TRAQAERIAKESLYRLTQAGE-----YGAL-
A0A1F2QXK7      -----ENI--VNERLLQLQA----EL---TRAQAERIAKESLYRLTQAGE-----YGAL-
A0A2V9DEM9      -----ENI--VNERLRQLQE----EL---TRAQAARYEKESLYRLVQAAD-----YASL-
A0A2V9CYQ5      -----QNI--ANERLQQLQQ----EL---TKAQAELYEKEALHRLVQTSD-----YGSL-
A0A2V9BWU8      -----QNV--ANERLQALQE----EL---TKAQADGYQKESVYRLVQSGN-----YGSL-
A0A2V8ZG48      -----ENV--ANERLQQLQE----EL---TKTQAERYEKEAVYRLVQAGD-----YGSL-
A0A2V8Y334      -----ENV--ANERLQQLQE----EL---TKAQTERYQKEALYRLVQAGD-----YGSL-
A0A2V9AY68      -----ENV--ANERLQQLQQ----EL---TKAQAQRYEKESVYRLVQAGD-----YESL-
A0A257VBK0      -------I--LDTKIASINE----RL---TQVGVKESEVAAIASQLEAWRTSGGD-----
A0A2V7XDY0      -------A--VTSSITKLTA----DL---IEAQARRIGLEAALKQIAQLKAANQP-----
A0A350UQT3      -------I--LSARLLQLNT----EY---TRAQAERVAAEAGYEQTRSGSLESAQ-----
A0A2U3JZ71      -------I--LSARLLQLNT----EY---TNAQADRVRKEAAYKSVAGGSLEAAQ-----
A0A2V8TTB0      -------I--LSARLLQLNT----EY---TNAQGDRVKKEAAYNSIQSGSLAAAQ-----
A0A1F2TCR2      -------T--VLPRLNSLND----SV---TRARLARLQKGQVYEQVRAVKPDSDE-----
A0A1F2V330      -------T--NLSLFAATQA----QL---RSSSGLKANDQARLAAVQQEITELEK-----
A0A662EE63      -------V--ITEQVDLLTK----EY---AQAKAERIDVETKLNALNQLRARHVS-----
A0A2V8TLH7      -------I--TNDRLSALQA----DY---TETQVKAAELESVLKRVDEVRQNGGS-----
A0A1Q7ZJT1      -------I--TNDRLSTLQS----EL---TEAQVKKGEIEGLLKQIDANRQNGGA-----
A0A2V8VC99      -------I--TNDRLSTLQA----GL---TETQVKKGELEGLLKQIDSVRLSHGS-----
A0A348UZU3      -------T--MLDKISELNK----AL---TEAQIERVRKESYYNGIKNASP---------
Q01XL7          -------L--ADSKMKVLQG----DL---AAIQADRIAKQARWEMAKNTPI---------
A0A2V8ERZ5      -------I--VLSRLNQLND----AV---TRARTERVQKESLYNQV-KAIANGTA-----
A0A2V8GTX0      -------I--IVSRLNQVND----AA---SHARTNRIQKEALYNQV----AATKD-----
A0A2V8J0X9      -------I--VVSRLNQLND----KV---TTSRNERLSKEAIYNQLRRADPSSDA-----
A0A523DUV7      -------I--AASTMTRLNE----EA---TEAKTRRIEIESALAQVDKLKQSGGA-----
A0A372IRG7      -------L--VTDDLRTIND----QL---AEARADRIVKEARYRMAQTRNP---------
A0A1F2U158      -------I--VLSRLNALND----AV---LRARTTRIEKESVNNQIKSLGT--TP-----
A0A2V8F6S9      -------L--VGARLNKLND----DA---MMARSRKLQKELLYNQVKAMAA-GQP-----
A0A4Q1SCH5      -------T--VIDRLKLINE----QL---TQAEGDRIVKEAQYRAAETGDP---------
A0A3D1ASD2      -------I--LSARLQQLNT----EY---TNAQTDRVRKEAGFNAMQSGQM---------
A0A2N9MK30      -------I--LSARLLQLNT----DY---TNAETERVKKEAAYKSVSTGSL---------
A0A4Q7YNP3      -------V--GEDKLRELQA----EL---VRAQADRIQKESQSEIAAVALS---------
E8UZE1          -------A--IVDRLSQLNS----DL---SKAQADRIMKEVTFRESMVSDA---------
A0A1V6HR88      -------V--VLSRLQALNA----DY---TRAVSERIGKGAALKELEVATP---------
A0A3E0P0A3      -------V--TLQRLTAANS----AF---LEAQRRRIEAQAEYNELSNRPA---------
A0A2V8EXP2      -------I--VVQKLADLNA----AV---TRAKTERIQKEATYNQMKALQTERAG-----
A0A2W4RYA1      -------I--VAQKLTDVNT----EV---TRARTERMRQESLYRQLQDALARSAD-----
G8P0Y7          -------L--TTEKLDELNR----EL---TSAQADRIQKESLYNVAKRGDP---------
A0A5M8T4U7      -------L--TIQKLGQTSS----DL---ESAEADRIMRESRMREFASQDT---------
A0A3P0X3W6      -------I--LSARVAQLNS----EY---TEAENDRIRKQTAYQGVKSGNA---------
A0A1E3Y9R6      -------I--IVQKLNALNE----QF---VQARIARMNAEVQVNAMAERRARGES-----
A0A2W4TLP2      -------I--VVQKLNALNE----QL---VQARIERMNREVQVNAIRELRASGES-----
A0A3R9WF43      VSVNSHNT--VLDRLFTLNQ----EM---TSAEANRISSEAVYHLVKTQNPEVVL-----
A0A317HKM4      -------I--VVQKLGDLQA----AV---TRARADTIEKDAQIKQMSALEADHKP-----
A0A523E0N1      -------I--VMQRLETLNE----QL---AQAEVQRTAAEARYANLASADP---------
A0A523ECP2      -------L--VMRQLQDLNG----AV---AVARTARAGAEANYTSLRAADR---------
A0A2W0C122      -------V--VTSKLNELNK----QL---TAAEEDRMEKEASYQAIAAGSL---------
A0A2W0AUU7      -------V--VTSKLDELNK----QL---TAAEEDRMEKDASYQAIAAGSL---------
A0A2W0BQL1      -------V--VTSKLDELNK----QL---TAAEEDRMEKDASYQAIAAGSL---------
A0A4Q1SDL1      VYS----D--VLDRLQQSTA----AL---SVASQNRILKEAVYKAVESGNA---------
A0A3P0XH15      -------L--TIEDMRVANQ----QL---SEAQADRVVKEARYRMAMTRNP---------
A0A4R1LAZ7      -------L--VTDSLRTVNQ----QL---AQAEADRIVKEARYRLAQTRNP---------
A0A3M1WQW8      -------I--AIERLTDLNR----RL---VEAEAERIRAETLYRLSQEADV---------
A0A3N1JHC1      -------V--AAEHLREIQQ----GL---AQAEVDRANRQSAVEMARNASV---------
C1F294          -------L--VDANLETINS----QL---AQAEADRIVKEARYKMALTRNP---------
A0A2V9KA79      -------T--IQARLQTVGE----RI---SNDAARRVAAANEMRELQRQGA---------
A0A522PSP1      -------L--LTQQLSSLQQ----EL---GQEQSKQRTLEANLALANEGSL---------
G8P085          SPSPSAST--VTDRLTQLNN----RL---TVAQGDRIVKEAQMRAAENGNT---------
A0A4Q1SGQ1      -------I--VLDRLTTLNQ----RL---AAAETNRILMQAIAQAAESGDP---------
Q1ILD9          -------L--TLATLDDVSK----QY---TDAQADRIMKEAKYRLAKSGNP---------
Q1IJZ6          AAPVLHIP--ALDRLTALNQ----DL---VTAEASRVTREALYRLARSGDL---------
A0A2V8TCE6      -------I--ALKGVSDIDA----IY---LQARARRIATESEWTAARGTDP---------
A0A522TBE8      -------I--MVARLTELNS----DL---TKAKSQRMQMQAAVRVIDSGAA---------
Q1ITG0          -------L--AVSDLTDVSK----QL---TDAESDRIMKEAKYRLAQTGNP---------
A0A3N5PCI5      -------I--VVQRLNSLNA----SV---TQAKTDLIAVESLYRQLAASQRDQGA-----
A0A3M1Q0S9      -------V--SLQNLQDLRN----RR---VEAEADLEDKRARYQVLTSASP---------
A0A2Z5G448      -------L--VSDSLRLVNE----QL---IQAEADRIVKEARYHLAETRNP---------
A0A3M1VZ38      -------V--TRRNLSNIQE----RY---TQAKIKLAEARARLDTVRSTRP---------
A0A4Q1SD29      -------L--VTERLRTVNE----QL---AEAEADRIVKEARYRMAMTRNP---------
A0A3M1PY35      -------M--GSERLVALDQ----AL---TEAKRERAAAEARVEALDGAEP---------
A0A3M1VMP2      -------P--GSTRLSRLEQ----TL---TEVKAERAAAEARLAAYQEATP---------
A0A2V8G155      -------I--VVQRLADLNT----AL---TRAKTERIQKQAAYDQIRNARDVPGS-----
A0A2V8HDM7      -------I--VVQKLADLNT----AL---TRAKTERIQKQSAYDQIRNARDVPGS-----
A0A2V8DRT9      -------I--VVQKLADLNA----AV---TRAKTERIQKESAYEQIKAVQSDREA-----
A0A2V7VYF3      -------I--VVQKLADLNG----AV---TSAKNERITKEAGYNRLRTMADDRSA-----
A0A1F2SVH2      -------I--VVQKLSELNA----AV---TRAKTERIEKEAAYNQIRTVQNDRAT-----
A0A2V8AJG9      -------I--VVQKLADLNA----AV---TRAKTERIQKEAAHNQLRGLQHDRNA-----
A0A2N9LQU7      -------I--VIDRLRHLNS----QL---ADAEGDRIIKEARYRLASTG-NPELV-----
A0A2P6WFK7      -------I--TVDRLKLLNQ----QL---TEAEADRIVKEARHRLAATR-NPELL-----
A0A2V8U914      -------L--AADKLRGVQD----EL---SKAQSDLIAKQVQFDLIAK--NPAEI-----
A0A2V7W309      -------V--TLQKLGKLNT----DV---TSAQGDMYDKQARYNSIQST-APETV-----
A0A2W0BGU4      -------V--VEQRLGEIST----NF---TQSQNDRIQKEALYNQVQT--NPDQV-----
A0A2W0BVQ9      -------V--VQQRLGEIST----NF---TQSQNDRIQKEALYNQIQA--NPDQV-----
A0A2V9MN96      -------I--VTAKLDELNK----EL---TGAQTDRMQKEANYGLAEAG-DPSGF-----
A0A2V7V2Z1      -------L--LDQKLKELGT----SL---TTLRTERLEREALYNQMRGAANPEEL-----
A0A2V7X2F7      -------L--LAQKLQQLGT----AL---TETRTVRLEKEALYRQMRGADVPEDL-----
A0A2V7V2I1      -------L--VEQRLRELGT----SL---TALKTQRIEKEALYRQMKEAPNSEEL-----
A0A2V7U3M2      -------L--LEQKLKELGT----AL---TTLRTDRLEKEALYNQMRNAANPEEL-----
A0A2V7UHT0      -------L--LDQKLKELGT----AL---TTLRTERLEKEALYRQMRGASNPEEL-----
A0A2Z5FVL3      -------QA-YSSTLDQLQK----ATAAVSQAHTNVILKGAIYEVVKSG-DPETI-----
A0A2V9KBD6      -------I--VTTKLADLNK----EL---TASEADRVQKEVSYRLARSG-QPELL-----
A0A2W0AJ66      -------I--VTAKLDDLNK----EL---TAAEADRMQKEATYRLTPSS-QPELI-----
A0A1Q7RBU1      -------I--VTAKLDDLNR----EL---TAAEAERVQKEVNYRLASSG-RPELI-----
A0A2V9JPV9      -------I--VTAKLDDLNK----EL---TSAEADRVQKEIDYRLARSG-EPELI-----
A0A1I6MH75      -------Q--TTSTLEDLSK----AS---GAAHIARILAESRYRMLSGM-DPGTI-----
E8WVF6          -------Q--IASSLEDLAK----AS---GTAKLARIIAESRYRMLNGM-DPNAI-----
A0A1H5Z7N3      -------E--ITTSLEDLNR----AV---GQAQISRIMAEVRYHTLSGM-DPNQI-----
A0A2V9YHT3      -------I--ITAKLNDLNK----AY---TDATNDRIHKQATYRLTLNS-SPELL-----
A0A1G7JVV8      -------Q--VTAAVEALST----AA---IAAKVQRILAESRYRVLASS-DPALM-----
A0A1H4T6W9      -------Q--LAVSVDALST----AS---VGAKVQRILAESRYRVLANS-DPDLL-----
I3ZEU5          -------Q--LAVSVDALST----AS---VSAKVQRILAESRYRVLASS-DPDLL-----
A0A428MDU2      -------Q--ISTSLEDLSK----AA---GDARIARIVAESRYRMLAGM-DPNTM-----
A0A5B9EBI2      -------QSEITSLIDSLTK----AA---GDARINRIIAESRYRALAQA-DPASM-----
A0A239HDF6      -------Q--ISTSLDDLAK----AS---GQAKLARIIAESRYRMLSGM-EPDAI-----
A0A4Q0T270      -------Q--ISSSLEDLSK----AS---GTAKIARIVAESRYRMLSGM-DPDSI-----
A0A1Q3QQB6      -------Q--ISSSLEDLSK----AA---GEAKIARIIAESRYRVLSGM-DPDSV-----
A0A3N1K1G7      -------Q--ISSSLEDLSK----AA---GEARIARIIAESRYRILSGM-DPNTI-----
A0A4V2G466      -------Q--ITASLEQLST----AS---NDAHIVRIMAESRYRMLSGM-DPNTI-----
A0A6B9YNQ8      -------Q--ITSSLEQLST----AS---NQARIARIMAESQYRMLSTM-DPNSI-----
                                                                            

A0A2V7VMF7      PQVATDPV------------------VAGLNAQIATFTVELSR---LKEK-YKEGHPEVQ
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      ----------------------------------------------ELAD----------
Q01X01          ----------------------------------------------LNAY----------
A0A3M2D9H8      --------------------------VNALGQPARVTPTLTVD---QQIE-LTQKRSRLD
A0A2V8JK38      ADALPQITGSSL--------------ISQFVGRLSDLKRQDAE---LTVT-FAPDYPSRR
A0A2V9IXG5      PELVSSPS------------------FRSYYIQWVEANNALEK---LRLDGKGEEHPTLV
A0A2V9J2P4      PELVSSPS------------------FRSYYIQWVEANNALEK---LRLDGKGEEHPTLV
A0A1Q7RLS4      PQISGDTV------------------VRDLYREKAGLEREYER---LLVT-YKDKHVRVL
A0A2V2R525      PGAAEALAASNQ---------------STAAAKLSDLRQRLAQ---LKAE-YTDKWPEIK
A0A321LPW6      GRLDRLSEAFSDPKI------------SELTKIRGELAATYAQ---LSVR-YGPENPRVA
A0A2V9R9V4      GRVAQIPEAFADTKT------------VELQRKLGELATTAAE---LSVT-YGPKYPKMA
A0A321LE75      GNIDVATEAFTDSKL------------TGLQARLNELEVKARE---LDVK-FGADHPRVV
A0A2V8R8U7      PDPFANPEVQKDERI------------LRLRGKISDLKDKLTF---LRQK-YTDEWPDVK
A0A2V8QMP4      SGIWAIPQVQSNPTV------------VKLRDKIGELEEQKAA---LLVN-YTPEWPAVQ
A0A2V8R4S3      SGIWAVPQVQSNPSV------------LKLREKMGELEEQKAA---LLVN-YTPEWPAVQ
A0A2V8NJ55      SDPWSIPEIQDDKSV------------QRLRDRISDLEEKRAS---LLRT-YTEEWPAVQ
A0A2V8Q7I0      TDKFSIPEVQKSGRV------------TALRDRISALREKRET---LKVT-YTDKWPEVL
A0A2V8S6K4      SDIFSIPKVQDNKQI------------QDLQIKLAALNEQRVA---LLKQ-YTENWPAVQ
A0A317I2L9      SDPFTVPEVIKSTRI------------VALRERISAIKERRDA---LLVT-YTPEWPEVR
A0A2V8LLF9      NDPFNAPEIQSDQRI------------QKLRDKIGDLEDKRNS---LLEI-YTPEWPEVK
A0A352FRF4      PDPFANPEVQKDERI------------MKLREKISELKDKETG---LLQK-YTKEWPEVQ
A0A2V8MKV0      TELLSNPEVQKNESV------------LKLRDKLSELQAQRAA---LRQT-YTDEWPDIK
A0A2V8PYY8      ADLISNPEVQKNESV------------MKIRDKLTELQSQRAA---LLQT-YTTEWPDVK
A0A1Q7YKQ8      SNPMAVPDVADSKRI------------QQLREKLDQLKQKRSE---LLVI-YTVEWPEVK
A0A352F3R7      KDPFSIPDVNASARV------------DKLRDRISALKEKRDA---LLIV-YTSEWPEVK
A0A0B6WXT1      TDIWSVPEVQSDQRI------------QKLRDRIGELEEKRAA---LLVQ-YTPEWPEVK
A0A3B9MEU8      PDPFSVPDVNSSARV------------EKLRDRISALKEKRDA---LLIV-YTPEWPEVK
A0A2V8MHG6      PGALEAQAEATNN-SS-----------ATTEAKLAELKQHRAQ---LLQE-YTEKYPEVR
A0A2V8P7N1      PGALEAQAEATSNKSS-----------ATPEAKLAELKQHRAQ---LLLE-YTEKYPEVK
A0A2V8M3M6      PGALEAQAEATSNKSS-----------ATPEAKLAELKQHRAQ---LLLE-YTEKYPEVK
A0A1Q7NJH5      PGALEAQAEATSNKSS-----------AATEAKLAELKQRRAQ---LLLE-YTEKYPEVK
A0A2V8PJY0      PGALEAQAEATSNKSS-----------AATEAKLAELKQRRAQ---LLLE-YTEKYPEVK
A0A1Q7Y6W9      PGASEARAEDANK-QI-----------QQYEANLVELRRKRAE---LLVE-NTEEHPDVQ
A0A2V8NC68      PDAASAMVE--AK-SS-----------SDADAKLNELKRKRAQ---LLLE-YTEKYPEVK
A0A399WK13      PERLSAMAEAEMARFITEQQNNIRQFQSDTLKKISDLRQARAL---KLQE-YQEGAPEIK
A0A352FLX4      PGAAEALAEGGINEKDVPSATRIT---TDSELKLAELKQKRAE---LLVE-NTEKWPAVR
A0A2V8RTL7      PESLNALAEQDSQRYITERENSVLQLRTDVRKKINDLNAEKAR---KLED-YKETAPEII
A0A3E0PCJ6      PSRLSALAEEQMARYITERENDIRRFVNDTQKEITALRAKRQK---MLVE-YVERAPEIQ
A0A3M1S4R8      PEKLRALAEEKLQRFITERENDMRSLNNETAKKIAELEAEKAK---LLIE-YQESAIEVQ
A0A1Q7YFI6      PGAAEALARENRN--------------KQAEEQLLELRKKRAE---LLVE-NTEDWPEVK
A0A136KC10      PERLAAMAEAEMARFITEQQNNIRAFQSDTLKKISDLRQARAL---KLQE-YQEGAPEIK
A0A2V8SEX6      PEAINALAEQDNQRIIQDRKLAIIAYRNDTQKKISDFRSQRAK---LLQE-YKESAPEIV
A0A3M2D6Y5      PDRLKALVEEKLQRYITERENDMRALNNEATKRIAELEAEKAR---LLVE-YQESALEVQ
A0A0B6WWQ6      PGAAEAMVEKEDGIS------------VAALNKLTELRQRRAQ---LLVE-ATEEMPEVK
A0A3B9MK99      GGAATALAEVDAKQV------------NETEGKLADLRQKRAL---LMVD-ATEEAPEVK
A0A352EX26      PGAASALAEGDNKQA------------GDGENKLADLRQKRAL---LMVD-ATEEAPEVK
A0A2V8MM59      PGAANALAEAGAKDI------------ADSESKLSDLKQKRAQ---LLVD-ATEEAPEVK
A0A2V8PFE8      PGAATALAE-GAKDI------------NESESKLADLKQKRAQ---LLVD-ATEEAPEVK
A0A2V8PWS6      PGAATALAEAGAKDI------------NESESKLADLKQKRAQ---LLVD-ATEEAPEVK
A0A2V8LCT5      PGAASALAEAG-KDI------------ELSESKLAELKQKRAE---LLVT-ATEEAPEVK
A0A352FTJ9      PGAASALAEAGAKEI------------EATDSELTKLRQKRAQ---LLIE-ATEEAPEVK
A0A2G6PYV5      PSQAIEVN--------------QNVAIKDLSSQISRKKLEYEA---NLSK-YKPQLPKMV
A0A2V8F956      PAILANTF------------------IQQQKTELAQLQSQSAQ---LGDK-LGPNHPDMV
A0A1F2S1W5      PAILSNAF------------------VQQQKTELAQLLRQRAQ---LSEK-LGPNHPDMI
A0A1F2T595      PAILSNTF------------------VQQQKAALADLQRQRAQ---MSEK-LGPNHPEMV
A0A2V8JQV5      PQILDDGT------------------LRDLQSKLTELRSQTAE---LRVS-LTPAHYRVQ
A0A2V9AC41      PLVRDSLV------------------IGGLKGELAKSEADYAS---LAKE-FKAGYPPLD
A0A2V8K4L4      PQVLDDSS------------------LREYESKLVDLKRQRAE---LSPS-FTPDHPRMQ
A0A2V8NCZ3      PQVLDDPS------------------LREYESKLVDLRRQGAE---LGSS-FTPAHPRMQ
A0A2V9MAM9      PELLVDNA-----------------VIRDYQVKLTELRKQLAD---LDSV-LTPENYKVV
A0A2V9M454      GFIQTNSL------------------LPGLEAKELDLKEQYSE---ALAH-YGPTYPKVL
A0A2V9IVR7      ASLVGNDL------------------LSRLEERYAELKSQYVE---AREQ-YGPNFPKVV
A0A2V9ILE2      ASLVGNDL------------------LSRLEEKYAELKSQYVE---AREQ-YGPNFPKVV
A0A2V9LGY4      ASLVGNDL------------------LSRLEERYAELKSQYVE---AREQ-YGPNFPKVV
A0A2V9J4D6      ALLAQDHL------------------LETLEQKVADVKTEYID---ARTT-YGPNFPKVV
A0A2V9L9C5      ALLAQDHL------------------LETLEQKVADVKTEYID---ARTT-YGPNFPKVV
A0A2N9M9N1      AVLAEDAL------------------LGQLESKNAELHTEYAA---ATSQ-YGPNFYKVK
A0A2V9JEC4      EVASNDAL------------------LQHLEQNYADLKTQYAA---SLAQ-AGPNFYKAV
A0A2V9LPQ3      AMLAQNDL------------------LQKLQEKSADLKAQYVD---ALGQ-FGPNFPKVV
A0A348V070      PESPSNPA------------------IARLREQYALLSREYAR---RLAT-LKPEYPEMQ
A0A2Z5G3A3      PELISGLAGSPMLGAASSGVASSLSLIQGLRSQEAVLQGQMAE---YSSK-FSPDYPKLV
A0A2V7UGP8      PGSIKEVT--------------QSNLIQQLRQKTAELEREYTQ---KSKQ-FKPDWPDMV
A0A239MKT6      VDLVLNSA---SSLGAGLAGGNEMRVLGTLREQASAIKIRMAS---ESVK-FGSQYPAVL
A0A3E0PCN7      TVASKDAR------------------TTSLEQELSTLRLQLEQ---LKVE-FTEEWPAVK
A0A2V8IYW3      PSDRTPDP------------------LDAARTELATLGRRLLP---THPD-VIAAKRRVA
G2LEI9          DEMQSDPE------------------LQKLRGKISELKQRRLE---LLGT-YTELHPDVV
A0A317J121      PGVLEDIN------------------VRGYQTRIADLRREAAV---LKTT-LTPDNPKVK
A0A2V7YW66      KENVADSL--------------SGGMVTELRKEVLNLQRDYDT---KLKT-YKPDFPEMV
A0A2V7Z0V0      RESMSDSL--------------TTGVVSDQRGQILKLEREYET---KLKT-YKPDFPDMV
A0A2V8GFD4      PTVLSNGF------------------IQQLKGEIAALQRQHAE---MADN-LGERHPTMI
A0A2V8HSS5      PTVLSNGF------------------IQQLKGEIAALQRQQAE---MADN-LGERHPTMI
A0A2V8KP55      PQITGSSL------------------ISQFVGRLSDLKRQDAE---LTVT-FAPDYPSRR
A0A399WNU1      AQAKDART-------------------AGLESQLTTLRQQLAQ---LKVD-YTDEWPEVQ
A0A2V9CG11      PEMLDDPT------------------LREYRLRLTDLQRQFVE---LTAT-LTPAHYKVQ
A0A2V2R0I6      PQMQNNSF------------------LNELIRKRNELNAEYND---AVSQ-YGPNFPRVQ
A0A2V8XAR9      PQVQSDAG------------------LAELLRKRNDLSSQHSD---ALSQ-YGPNFPKVQ
A0A2V8VZA0      PEVQNNSA------------------LGDLLKKRSDAASQYND---ALAQ-YGPNFPKVQ
A0A1Q7CB82      PEVQNNSA------------------LGDLLKKRSDAASQYND---ALAQ-YGPNFPKVQ
A0A2V8WIU1      PEVQNNSA------------------LGDLLKKRSDAASQYND---ALAQ-YGPNFPKVQ
A0A1Q6Y9F5      PEVQNNSA------------------LGDLFKKRSDAASQYTD---ALAQ-YGPNFPKVQ
A0A2V9EVV8      PEVQNNSA------------------LGDLFKKRSDAASQYTD---ALAQ-YGPNFPKVQ
A0A2V8YF91      PQVQTNTA------------------LTELLKKRSDTSAEYAN---ALTQ-YGPNFPKVL
A0A2V8XZK2      PQVQSNAA------------------LTDLLKKQRDSSAEYTD---ALAQ-YGPNFPKVQ
A0A2V8ZTX6      PQVESNTA------------------LADLLKKKGETSADYAD---ALTQ-YGPNFPKVL
A0A2V9BT79      PQLDSNSA------------------LTELLKKRGETSADYAD---ALQQ-YGPNFPKVL
A0A1Q8B793      PAVRDSEL------------------LQDIYKKRNDAYTQYTS---ALNQ-FGPNFPRVQ
A0A2V9BCA0      PAVRDSEL------------------LQDIYKKRNDAYTQYTS---ALNQ-FGPNFPRVQ
A0A2V9BWU9      PPVRDSLL------------------LQDLQKKQSELNTQYVE---ALNQ-YGPSFPKVV
A0A2V9DKX2      PPVRDSLL------------------LQDLQKKQSELNTQYIE---ALNQ-YGPSFPKVM
A0A2V9JSI3      AVLMQSEV------------------LGRLEEKYAELKAQLVD---ASGQ-YGPNYPKVV
A0A2V9WI32      PEIFAKAE--------------PSSLINQLRTQESDLRMKYAE---ATTQ-FGSSYPKVM
A0A2V8IVN9      PAILSNTF------------------IQQQKSELLQLQSQYTQ---LSEK-FGDKHPDII
A0A1F2TPT3      PQMLNNAA------------------LQQLRLELERLRRDRAT---AART-LRAQHPSML
A0A2V8JTQ2      PDLVARLE--------------PDNLLTRLRAQQADLENQIAQ---ASVQ-LGPAHPKMA
A0A2V8UZY0      PELIAKLE--------------PDNLITRLRAQLADLENQIAQ---ASVQ-LGPAHPKMV
A0A3N5YNR8      PENFPQSL--------------RTPSISLLEERLFGLQQNLAS---LSAQ-FGSEWPAVI
A0A350UEK1      PDVLNDTL------------------MRGYQEKISDLRRQQQE---LLET-FTPENQRVK
A0A350UIQ4      PDVLNDSS------------------MRGYQEKLSDLRRQQED---LLEV-FTPETSRVK
A0A3N6A5T6      PDALVTDN------------------IRQLETTLADLEQKLAN---MTSH-YGPVWPEVV
A0A1F2Q9L4      DDMVADTV--------------SGGLVTQLRGEQLKLERDYAT---KLNT-YKPEWPAMQ
A0A1H5SQF5      ADVVLGIDSSQLNGAPGALASLDTVRLHQLRTQTGQLEVQISA---ETQK-YGPRNPAIL
A0A3E0NV31      PDTAKTQE------------------LRALEAQIARQEQELAA---LSAR-YGPEWPSVR
A0A3N5M5V0      PEDFPQSL--------------RTPSISLLEERLFGLQQNLAS---LSAQ-FGNEWPAVV
A0A2V9AEW6      PEILEDPT------------------MRDYRQKLTELQRQYAE---LSAT-LTPEHYKVL
A0A2V8WQK6      PEMLEDPT------------------MREYRQKLTELQRQYAE---LSAT-LTPEHYKVK
A0A2V8XIF4      PEMLEDPT------------------MREYRQKLTELQRQYAE---LSAT-LTPEHYKVQ
A0A3N5XQP8      PTNLRSSV------------------TEQIEARLSALRQDYAR---LTSQ-FGPEWPEVI
A0A2Z5G7H4      SGLSANGI-----VSGSPTLSTSLGLIQSLRMQEAALQGQIAQ---DTSK-FGPSYPRLM
A0A2V9L5B5      PGVLSNRL------------------VQDLEIRLADTKKEYAQ---VTTW-VKPDYPKAQ
A0A2V9LK56      PGTLSNKL------------------IQDLEFKIADLEREYAQ---LTAV-VKPDYPSAV
A0A2V9L7I0      PAVLSNRL------------------IQDLEERLADVQKEYAL---VTTW-VKPEYPKAL
A0A522PPT0      PGVLDNRL------------------IQTLEQNLSDLRRQYSE---LTAT-VKPGYPKAM
A0A2V9KCS3      PEVLDDAS------------------LQDYRQKLTELRRQLAE---LGAT-YTSTHPKVE
A0A2U3KC61      PAEFAKPS-----------REGTSSMLEKLREKEADLNTQYAQ---ATTQ-FGSGYPKVV
A0A2V9Y2R7      PTAFAKIQ-----------AGGTSSLVDKLREKEADLNVQHAQ---ATTQ-FGSAYPKVV
A0A372IT17      PELISGLT-ASAGAEETGGLQHSLELIETLRSRESTAKAELAQ---DETR-YGAAWPGMQ
A0A136JPP4      PDLYENKVYQDTVRLNTERKAKLQDQIREIEKQIKDAETEKAE---LLVK-YTPEYVKVK
A0A399WUJ8      PDLYENKVYQDTVRLNTERKAKLQDQIRDIEKQIKDAETEKAE---LLVK-YTPEYVKVK
A0A2V9NGH6      SDAAAAAA-ISADHSTRNASLS-SSLLEKLREQQADFRIQVSQ---LSTQ-FGPAYPKVA
A0A2V9PYE6      SDAAAAAA-TSADHSTRIASLS-SSLLEKLREQQADLRIQVSQ---LSTQ-FGPAYPKVA
A0A2V9NL07      TESAAAVA-NSGSAKG---SGSTSGLLDKLQAAKADLKIQIAQ---VSTQ-FGPAYPKLA
A0A2V9QD92      TESAAAVA-NSGSAKG---SGSTSGLLDKLQAAKADLKIQIAQ---VSTQ-FGPAYPKLA
A0A2V9WPZ6      PDVVASVP-VGGDSNSGNNPNSGSPLLDSLRGKQADLKILVAE---LSTQ-FGASYPKVA
A0A2V9ZLH4      PDVIATAT-ATGGTEG--NASSGSTLLDKLRSQEADVKIQVAE---LSTQ-FGPSYPKVA
A0A2V9RQF1      PDTAASAA-LSAAGTAGTNSST-SGLLEKLREQQADIRIQTAQ---LSTQ-FGPSYPRLA
A0A2V9YDK8      PDVIASTT-SVAGSNGGTGANSGSSLLDNLRSKQADLKIQVAE---LSTQ-FGSSYPKVA
A0A2V9V8F7      PDVVASAP-VGGDSNSGNNPNSGSPLLDSLRGKQADLKILVAE---LSTQ-FGASYPKVA
A0A2V9XGR9      PDVVASAP-VGGDSNSGNNPNSGSPLLDSLRGKQADLKILVAE---LSTQ-FGASYPKVA
A0A2V9V3Q5      PDAVASAV-TSAPVATLAGTGS-SPLLDKLHQQQADLKIQVAE---LSTQ-FGPAYPKVA
A0A2V9NWS3      ADTAAAAA-LSSATGSGLSSAS-SNLLEKLREQQADLKIQVAQ---LATQ-FGPAYPKLT
A0A2V9USA9      PDAIASSA-GGIETGSA--QSA-SALLESLRAKQAELHIQTAD---LNTQ-FGPSYPKLA
A0A2V9XW18      PDAILSSA-NALEEAGAGGQSS-SALLGGLRSKEADLKIQAAD---LSTQ-FGPSYPRLN
A0A4R1LC91      SGLVGNSI----TAGASPGVNSSLNLIQNLRLQEATLQGQIGE---LSAK-FGSAYPKIE
A0A3M2BZG9      DAEVANSL--------------ISSQITQLRSEVDKLERQYRK---ALQT-FRDDWPSVT
A0A1Q7N5R7      PGALADAL----------APIGAVQRSADLTQALHELTTKRAEQRALAYR-YTPDHPTLQ
A0A3M1SIV3      RETPNSEFISTLRANIIAKKNSLDARLSEIDNKIKAAESERAA---LLAR-YTPENPKVK
A0A3E0PHB0      SDASGGVLASQLRQTKTERKAKFDEQVRALDEKVKTAESELAK---LRVK-YTEQHWKVK
A0A3M2D491      AS--DNKFIITAREQQLKLKKDSEARLEDIEGQIEKAEKEKAA---LLAR-YTEEHPSVK
A0A357F267      PDLYENKIFQDTMRLNTERKAKLQDQIRDIDKQIQQAETEKAE---LLVK-YTPEYFEVK
A0A353C9L6      PDLYENKIFQDTIRLNTERKAKLQDQIRDIEKQIQETEAEKAE---LLVK-YTPEYPEVG
A0A2V8RQV0      PSIGENKIFQDTMRLNTERKAKLQDQIRDIEKQIQQTEVEKSE---LLVK-YTEAYPEVG
A0A2V8SJH5      PDLSESKIFQDTIRLNTERKAKLQDQIRDIEKKIQDSEVEKAE---LLVK-YTPEYSKVK
A0A2V9QB26      PDFLNDSA------------------LRSLQEKLTELRRQHAE---LITI-YTEKHNKVK
A0A2V9VYY4      DGRGGSGL------------------LDKLREKEADLETQYAM---ATTQ-FGSGYPRVT
A0A2V9KIE8      PSVLSDKF------------------IQELEGRLAELERQYAE---MTSM-VKPEYPKAV
A0A352F549      SAEVSDKQ------------------IAELKTRLGELRQKRAQ---LLLT-DTEESPEVK
A0A3B9MLP9      NAETSDKQ------------------VAEFKTRLAELKQKRAQ---LALT-DTEESPEVK
A0A3D5SQ87      NAETSDKQ------------------VAEFKTRLAELKQKRAQ---LALT-DTEESPEVK
A0A2V8NW86      PDVLNDSS------------------LRSLQEKLTELRRQKAE---LITI-YTEKHNKVK
A0A2V8ZHL8      AFVAQNDL------------------LQRLEEKFADLKAQYVD---ALEQ-YGPKHPKVE
A0A2V9B240      AFVAQNEI------------------LQRLEEKFADLKAQYVD---ALEQ-YGPKHPKVE
A0A2V9CBM2      PGVFENRM------------------LQDLTVRLTDLKREYAQ---LSTT-FGSDYPRVK
A0A2V8XN17      PGVFENKL------------------IQDLSERLAELKREHAQ---LSTT-FSPDYPRVK
A0A2V8WX45      PGVFENKL------------------IQDLSERLAELKREHAQ---LSTT-FNADYPRVK
A0A1Q6YR79      PGVFENKL------------------IQDLSERLAELKREHAQ---LSTT-FSPDYPRVK
A0A1Q7VA32      PGVFENKL------------------IQDLSERLAELKREHAQ---LSTT-FSPDYPRVK
A0A2V9EY85      PGVFENKL------------------IQDLSERLAELKREHAQ---LSTT-FSPDYPRVK
A0A2V9H8K0      PGVFENKL------------------IQDLSARLAELKREHAQ---LSTT-FNPDYPRVK
A0A2V9FFE5      PGVFENKL------------------IQDLSERLAELKREHAQ---LSTT-FNPDYPRVK
A0A2V9GM43      PGVFENKL------------------IQDLSERLAELKREHAQ---LSTT-FNPDYPRVK
A0A1F2RFI7      PGILENKL------------------YQDLSIKLADLRREYSE---LTAT-FTPEYPRVK
A0A1F2RZS3      PGILENKL------------------YQDLSLKLNDLRREYSD---LSAT-FTEEYPRVQ
A0A1F2USE2      PGIHDNTV------------------METLTVKLAELQREHAQ---LTTT-FTAKYPRVE
A0A2V9C238      PGMAENKL------------------VADLAVRLADLQREQAQ---LATT-FTADYPKVR
A0A1F2Q9F5      PGIFENKL------------------MQDLTVQLAELRRQHAQ---AATT-FSPDYPTVK
A0A1F2QQH9      PGIFENKL------------------MQDLTVQLAELRRQHAQ---AATT-FSPDYPTVK
A0A1F2QXK7      PGIFENKL------------------MQDLTVQLAELRRQHAQ---AATT-FSPDYPTVK
A0A2V9DEM9      PGMAENKL------------------VADLAVRLADLQREQAQ---LATT-FTADYPKVR
A0A2V9CYQ5      PGVFENRM------------------LQDLTVRLTDLKREYAQ---LSTT-FGSDYPRVK
A0A2V9BWU8      PGVVENKL------------------IQDLSERLAELKRELAQ---LSTK-FNAEYPRVK
A0A2V8ZG48      PGVVENKL------------------IQDLSERLAELKRQFAD---LSTK-FNPEYPRVK
A0A2V8Y334      PGVVENKL------------------IQDLSERLADLKRELAQ---LSTK-FNAEYPRVK
A0A2V9AY68      PGVVENKL------------------VQDLSERLAELKRELAQ---LSTK-FNPEYPRVK
A0A257VBK0      PLSIPAVAQDPS--------------VQDLAKQYNELNRDLGK---LQAK-FTPKHPEVL
A0A2V7XDY0      LDAVPQFAADPT--------------IMILNTQVSAANNELTR---LRQQ-YKEGHPEIQ
A0A350UQT3      VSGQGEA-------------------IRRLLERQNEAAERFAE---VKAH-FGVNHPEFR
A0A2U3JZ71      VSTQGEA-------------------LKRLSERLDEEQQKFAE---IKAH-YGPNHPEYR
A0A2V8TTB0      VSSQGEA-------------------LKKLTENLNEAKERFAE---VRNH-YGINHPEYR
A0A1F2TCR2      ADNLSIIATSPG--------------VVTAKSRLADLNSQRLT---LSSR-YMDTHPDIQ
A0A1F2V330      EGVLDAAPPKEK---------------TPAETNLEERRLHLKQ---LRSV-FTEQYPEVV
A0A662EE63      EVAFPEVLEDAT--------------ISNLMQRRGEVEVELLD---KLGT-YKEGHPAIK
A0A2V8TLH7      YEVIPQISGDAV--------------VQDVYREKAILERDLEK---LSVT-YKDKHVRVL
A0A1Q7ZJT1      YENIPQISGDTV--------------VRDLYREKAGLEREYER---LLVT-YKDKHVRVL
A0A2V8VC99      YENIQQISGDPV--------------VQELYREKVGLEREYER---LLVT-YKDKHIRVQ
A0A348UZU3      -DFIPEAMNNPL--------------IQRLREEYLKLSREYAK---MEEK-FQPEYPEMQ
Q01XL7          -DSLPDVLSDPT--------------LLGLKSRIVDLRREMAQ---LTAT-LTPEHYKVQ
A0A2V8ERZ5      PDAIPAIATNAG--------------VASAKAKLSDLQREKAK---LLER-YQDKHPQVI
A0A2V8GTX0      REGLSQIASNPF--------------VQQLKTRIVELQRDRVR---LEER-YGEKHPDVQ
A0A2V8J0X9      IDNFPIVGTNSA--------------VVDAKNALATLTAQKAN---YAGR-YGPEHPRMM
A0A523DUV7      LDAMPQIAADPL--------------VQRLNLSKAELEVERVQ---LKNR-YKEGHPKVK
A0A372IRG7      -DLLVSVSGGV---------------LGSLRSQEADLMVQKAQ---LQSK-FGPEYPKLR
A0A1F2U158      VDSIPAIAQNAQ--------------VQLHKAQLSELQRQKAQ---LSER-YGEKHPDII
A0A2V8F6S9      LDSVPAIAQNPT--------------VVGAKNKVQELQRTLTE---LSAR-YGEKHPSIQ
A0A4Q1SCH5      -AVLAALMPDQN--------------LQSLQTTEASLYAQEAQ---LATK-FGSSYPPLV
A0A3D1ASD2      -EAALISSQGQS--------------LKKLTEAYDEAQSRLAD---VKLH-YGINHPEYR
A0A2N9MK30      -ESAQASTQGDA--------------LKTIAERLEQAQEKFAE---VKTH-YGPNHPEFH
A0A4Q7YNP3      -TTLPSVMDSPE--------------YRRYQEKLADLKGKVAQ---LVPP-LTEENPKVI
E8UZE1          -DQIVPTTTFPG--------------LTSLRAQKITLESQYAS---LSSK-YGDSYPRVA
A0A1V6HR88      -QIAAEILPDPV--------------VAQLRGEVVEMEREYAS---RLAT-FKPEWPAMV
A0A3E0P0A3      -DDLAETLSGGL--------------VSSQRAELIRLQREYDT---KLET-YRPDFPTMV
A0A2V8EXP2      LDTFPAILSNQF--------------IQQQKGELAELQRQQAQ---LSEK-LGPRHPDMV
A0A2W4RYA1      LDGFPAVLNNQL--------------VQQQKLELAALNQKKAQ---LSET-FGDRHPEIV
G8P0Y7          -STLSVILQDPI--------------LSALRQRQSELQTRYAQ---LDTW-AGQSYPQMR
A0A5M8T4U7      -DMAALTGDNPQ--------------VAALRTQLADLQTQRDQ---LALE-VGPRHPKMQ
A0A3P0X3W6      -SAIDISTQAEQ--------------LTRLQQQMQDAEQAMAI---VQTH-YGPNNANYK
A0A1E3Y9R6      LESFPPVLASPV--------------VQKLRADIVAKESERAR---LGTQ-YGPAYPAMR
A0A2W4TLP2      LETYPAIMNSPV--------------VQALRADIAAKEAERAR---LGTQ-YGPAYPAMR
A0A3R9WF43      GLGSMSIASGNGSSSGALTADGGVDLLRSLRTQEASLRREYAS---YATK-YGEKNPRLL
A0A317HKM4      LDTLPAIAANPF--------------IQTLKGELTTSERELGQ---ASKE-LGEHHPTII
A0A523E0N1      -FSLSEVRTSGP--------------VRDLERRYLDLSERYSE---LRTT-FGPDWPEIK
A0A523ECP2      -QTLPAVLANPT--------------VQGLVQQRGVLEGQVAE---LTAK-FKDDWPDLR
A0A2W0C122      -DRIGENKSGEA--------------LQSLRLREAELKNEYAQ---ATTT-YGPNHPKVI
A0A2W0AUU7      -DRLSESKSGDA--------------LQSLYLREAELKNEYAQ---ATTT-YGPNHPKVL
A0A2W0BQL1      -DRLSESKSGDA--------------LQSLYLREAELKNEYAQ---ATTT-YGPNHPKVL
A0A4Q1SDL1      -ELISELGGTST-ADTAPAVTNALSLIQNLRLQQANIETEIAS---GEKH-YGSAYPHMV
A0A3P0XH15      -ELLLSVAPSAT--------------LSQLQQQAAALTVQQAQ---LQSK-FGPEWPRVK
A0A4R1LAZ7      -ELLVSVAPTTV--------------LASLREQQAALLVQAAQ---LESK-YGPDWPRVR
A0A3M1WQW8      -DTLPPVMSNPI--------------VQTLRQRLADDRRRLVK---LQQQ-YTDEWPEIQ
A0A3N1JHC1      -DSLPQVADDPT--------------MRDDRAKLTELHRQLAE---MSTT-MTPSNYKVQ
C1F294          -DLLVSVAPNTV--------------LTSLRSQEANLLVQQAD---LQSR-FGPRYPKLE
A0A2V9KA79      -TENRAVVEEAS----------------AVQKKLEDLRLELKG---LQARGYTENHPEVI
A0A522PSP1      -DALLVSDRGDS--------------LATLVQAQQQTQLQLDA---LSSK-YGPGNYLFQ
G8P085          -AVLAAMFPSAN--------------LAALQSQQATLYGQYVQ---LSTK-FGQNYPPLA
A0A4Q1SGQ1      -ELLPALSGGGGSGMPGYGPQLAV--IQELRMREAALEAEIAE---NDAR-YGPAHPHTA
Q1ILD9          -ELIGMLVPDSV--------------LPVLRTQEADIQNQLSQ---ATAI-YGPNYPRVV
Q1IJZ6          -DRLTSLGAESLTSPTDQAQAAMFTNLQALRQRQSQLKQQMAS---AVQI-YGARNPHLV
A0A2V8TCE6      -SSLPAVVENPT--------------VQRLQHEVNDLEIQRAE---LLRT-FKPGWPQVE
A0A522TBE8      -AGWTNPTLTQE--------------VQTLRGRLQTDQNQLQV---LGQI-YGTSHPRYR
Q1ITG0          -ELIGTILPDSV--------------LPVLRSQEADLRNQLAQ---YSTK-FGSNYPKVI
A0A3N5PCI5      LDTFPLIRSNGV--------------VQEIRGRLANLQRERMQ---LASN-LGAKHPEMV
A0A3M1Q0S9      -DSIDEVRQHPT--------------IAQLSAEVARLERDYAN---KRVL-LGERHPDVQ
A0A2Z5G448      -ELLVSVAPTTT--------------LVSLRTQQAELLVQSAE---LKSK-YGFDYPRVR
A0A3M1VZ38      -ESLQEVLENPV--------------VRELRSRVSALESEYRE---KLVQ-LGEKHPEVQ
A0A4Q1SD29      -DLLVSVAPGTV--------------LGSLRTQQAALLVQAAQ---LKAK-FGPNYPKVV
A0A3M1PY35      -LSIEAVRSDPL--------------VVRLREELASREQRLEE---LRTR-FGPDWPEVR
A0A3M1VMP2      -SGIPEVNANPQ--------------VQRYRQDLAELRRELAE---LEGK-VGPNWPRLV
A0A2V8G155      VDTFP--------------LILTNGFIQQQKSQLSELQREYAQ---LSEK-LGDKHPEII
A0A2V8HDM7      VDTFP--------------LILTNSFIQQQKSQLSELQREYAQ---LSEK-LGDKHPEII
A0A2V8DRT9      LDTIP--------------AILSNVFIQQQKTELAELQRQESQ---LSEK-LGQRHPDML
A0A2V7VYF3      LDAFP--------------AILSNSFVQQLKSELADAQHKQAQ---FSET-LGDKHPDMI
A0A1F2SVH2      LDTIP--------------AILSNGFIQQQKNVLADLQRQQAQ---LSDK-LGPNHPDMV
A0A2V8AJG9      LDTFP--------------AILSNTFIQQQKGEIAELQRQQAQ---LSEK-LGPRHPDML
A0A2N9LQU7      A------------------AVVPSTTLQALRMQEADLKSQYAQ---LDAK-FGSGFPRVQ
A0A2P6WFK7      G------------------TVDPN--LQTLRTQEADLKAQLAQ---VSAK-YGNGYPKLR
A0A2V8U914      T--------------------TENPGIRDYETKLTDLRRQLAD---LESI-LQPESYKVV
A0A2V7W309      A--------------------QQDATVIHLNEELSRLQRDFNA---KRAQ-YTEAHPVMQ
A0A2W0BGU4      P------------------AIANNEVMQKLEENYANLRGQYVE---ALNQ-YGPNYPKVL
A0A2W0BVQ9      P------------------AIANNEVMQKLEENYANLRGQYVE---ALNQ-YGPNYPKVL
A0A2V9MN96      A------------------KLSADNLLEKLRVQQAELETQYAQ---ATTQ-FGPSYPEVI
A0A2V7V2Z1      P------------------EVMRSPLVQSLRIELAGLERQQAQ---LLER-YMDQHPEVV
A0A2V7X2F7      P------------------EVRKDSVVQQLRMDLSTLEQKQTQ---LLEQ-YLDQHPEVI
A0A2V7V2I1      P------------------EVMRNPLIGSLRVELASLQRQSVQ---LQER-YLDQHPEVV
A0A2V7U3M2      P------------------DVMRSPLVQALRIELATLERSQAQ---LLER-YMDQHPEVV
A0A2V7UHT0      P------------------EVMRNPLVQSVRIELASLERAQAQ---LLER-YMDQHPEVV
A0A2Z5FVL3      MGLPSNTALAGAASG----MSNDLAVISSLRTREATLNGQINE---LLAK-FGPAYPKVD
A0A2V9KBD6      A------------------KLEPGSLLTTLRAQQDDLERQNAQ---ASVQ-LGPTNPKMA
A0A2W0AJ66      A------------------KSEPDNLVTKLRAQEADLQMQLAQ---ASVQ-LGPTHPKIR
A0A1Q7RBU1      A------------------KLEPDNLITKLRAQQADLENQMAQ---ASVQ-LGPAHPKMG
A0A2V9JPV9      A------------------KLGPDNLITKLRAQQADLENQMAQ---ASVQ-LGPANPKIS
A0A1I6MH75      DGTID------------MNPGTMPVQFAQLRSQIALAKANYAQ---LMTT-LGPNNPKAL
E8WVF6          EGSIDAG--------TTATTGGATNGLANLRSNLATARATYAE---LTAT-LGPNHPQVK
A0A1H5Z7N3      DDSVASTQVGSSGNLTSGAPGAGDQQLATLRTQMETTKADLAK---LNVA-MGDRNPQIR
A0A2V9YHT3      ------S------------QADPNTLIEQLRTREADLKTQYAQ---VSTQ-FGPAYPKVV
A0A1G7JVV8      ESNLQAS------------GAGQESELSKLRDDAAQTKAQIAQ---SSVS-LGPKNPQIL
A0A1H4T6W9      ESNLDVA------------GG--QSELSKLRSDAAETQASIAE---LSIT-LGPKNPKIV
I3ZEU5          ESNLDVA------------GG--QSELSKLRSDAAETQASIAE---LSIT-LGAKNPKII
A0A428MDU2      EGSIETT------------PGTAPGELNLLRGQVASAKANYAQ---MEST-LGPNHPQAQ
A0A5B9EBI2      EGLIDAT------------PSIQPAPLNALRSQLATARAHYAE---LTSQ-LGPNHPQVK
A0A239HDF6      EGSIDAG------------PGLPPSGLNALRTQLSTARSTYAE---QEAT-LGPNHPQAK
A0A4Q0T270      DNSIETT------------PGTAPGEFSALRGQVAFARSNLAQ---LLTT-YGANHPLVK
A0A1Q3QQB6      ESSIDAA------------PGAAPQELTQLRTQLATARASYAQ---MQAT-LGPNHPQAK
A0A3N1K1G7      EGSIETT------------PGTAPGELNTLRAQIAVARASYAQ---LEAT-MGPNHPQAK
A0A4V2G466      EGSLEAS-------------GAAPSQLNALRAQLATARATLAQ---MESD-LGPNHPQAK
A0A6B9YNQ8      EGAVSTG------------QGIAPSQINTLRAQLATARASLAQ---IESD-LGPNHPTVK
                                                                            

A0A2V7VMF7      KVNKQVVQIQ----K---------------AKEERAAQ---------------------I
A0A2V7YYV7      --------------K---------------DIQTSHLQ---------------------V
A0A2V7Z0J5      --------------N---------------QIQQAETQ---------------------S
A0A2V7Z3M4      --------------K---------------QIQQAETQ---------------------S
A0A399Y5V2      ------------------------------AISKTRGE----------------------
Q01X01          ------------------------------GRGKRAAG----------------------
A0A3M2D9H8      ELKSLLNIYQ----Q--------------------------------------------I
A0A2V8JK38      RIRSQIEEIQ----K---------------QIEGERGR---------------------I
A0A2V9IXG5      AKRTELDNLR----K---------------QLRNELVK---------------------Y
A0A2V9J2P4      AKRTELDNLR----K---------------QLRNELVK---------------------Y
A0A1Q7RLS4      EKQKEIEETT----Q---------------KIASEVDR---------------------I
A0A2V2R525      VVQEQIAEIE----K-----------QDVENKTNSKSL---------------------A
A0A321LPW6      ESKKQMAEID----N---------------QIRASRAS---------------------L
A0A2V9R9V4      EINQQMAAIR----D---------------QIAAGRVQ---------------------L
A0A321LE75      EIRNQMVTIQ----E---------------QINRSRGD---------------------L
A0A2V8R8U7      QASAQIDELE----K---------------ELKKAPQE---------------------V
A0A2V8QMP4      KIEKQLKSLH----E---------------QLDKMPDE---------------------I
A0A2V8R4S3      KIEKQLKSLH----E---------------QLDKMPDE---------------------I
A0A2V8NJ55      ATNDEIKQVK----S---------------ELDKKPAE---------------------I
A0A2V8Q7I0      KLDAAIKPLE----A---------------ELDRAADE---------------------I
A0A2V8S6K4      KVEAQIKQTE----D---------------AQQKIAKA---------------------I
A0A317I2L9      KLEASLKPLE----A---------------ELQAAAAE---------------------A
A0A2V8LLF9      KIEAQLEPLK----K---------------QLIAAPKE---------------------V
A0A352FRF4      QVEAQIAQLE----V---------------ELKKAPTE---------------------V
A0A2V8MKV0      KLDAQIKPLE----Q---------------ALEAAKRQ---------------------I
A0A2V8PYY8      KLDAQIKPLE----Q---------------ALEAAKRQ---------------------I
A0A1Q7YKQ8      RVDEQIKTIE----E---------------ALTKAPGE---------------------V
A0A352F3R7      KIDAQLKGLE----A---------------ELAKAPPE---------------------I
A0A0B6WXT1      KVDEQIKRLK----Q---------------DLDKAPYE---------------------V
A0A3B9MEU8      KIDAQLKGLE----A---------------ELAKAPPE---------------------I
A0A2V8MHG6      DLDQQIAMLE----K-----------QAEQSRAHTESV---------------------V
A0A2V8P7N1      DVDQQIAMLE----K-----------QVDQSRRHTESM---------------------V
A0A2V8M3M6      DVDQQIAMLE----K-----------QVDQSRRHTESV---------------------V
A0A1Q7NJH5      DVEQQIAMLE----K-----------QVDQVRTHTESV---------------------V
A0A2V8PJY0      DVEQQIAMLE----K-----------QVDQVRTHTESV---------------------V
A0A1Q7Y6W9      QVEQQIAEIE----R-----------QLKEAKSHAANI---------------------L
A0A2V8NC68      DLDEEIALLE----K-----------QTKEGKTHATSV---------------------A
A0A399WK13      EIDAQITSYQ----NSIDNAVQKFQNDLDKYRDSTKKT---------------------L
A0A352FLX4      EIDKQIAAIE----K-----------VMGDARRRATGV---------------------V
A0A2V8RTL7      EIDKQIASLE----DSLEKLLEKNNKDIQAYKERSATI---------------------L
A0A3E0PCJ6      EIDREIATLM----NEIADFRDKNDKALQQYRKTVGET---------------------I
A0A3M1S4R8      EINRKMEALK----STVEKAQEKNREELEKYRARTAKE---------------------I
A0A1Q7YFI6      EIDRQIAILE----A-----------QVNQSHSEDVST---------------------L
A0A136KC10      EIDAQITSYQ----NSIDNAVQKFQGDLEKYREATKKT---------------------L
A0A2V8SEX6      EIDTQIRSLE----DSLTKLVDENTTEVQKLQERASKL---------------------L
A0A3M2D6Y5      EINRKIDALK----RTVEVAQEKNRKDLEEYRSRTAKE---------------------I
A0A0B6WWQ6      EVNEQIAELE----R-----------QINEARARAKDV---------------------M
A0A3B9MK99      EVDQQIAELE----R-----------QVKDVRSRKSVT---------------------L
A0A352EX26      EVDQQIAELE----R-----------QVNDSRNRKTNT---------------------L
A0A2V8MM59      EIQQQIAELQ----K-----------HLGETRSRSTSV---------------------L
A0A2V8PFE8      EVDQQIAELQ----K-----------HLHESRARNTNT---------------------L
A0A2V8PWS6      EVDQQIVELQ----K-----------HLNESRARNTNT---------------------L
A0A2V8LCT5      EVDQQIDVIQ----K-----------HLVETRSRSTAT---------------------L
A0A352FTJ9      EIDQQIDVLQ----K-----------HLADTRARGTAT---------------------L
A0A2G6PYV5      ALNAEIKSME----K---------------RLANEQKK---------------------L
A0A2V8F956      KIRSAIRLTQ----A---------------KLDGEIGK---------------------V
A0A1F2S1W5      KVNTAIQLAE----T---------------RLQAEVAQ---------------------V
A0A1F2T595      KINVALRGAE----T---------------RLQNEIAQ---------------------I
A0A2V8JQV5      RLEAQMGELE----T---------------AFERERAN---------------------I
A0A2V9AC41      NLKVRMEETR----R---------------RLQAEIQN---------------------E
A0A2V8K4L4      KLEAQITELE----T---------------ALEAARQK---------------------V
A0A2V8NCZ3      KLEAQIAEME----T---------------ALEDARQK---------------------V
A0A2V9MAM9      RLKAQITALE----S---------------ALAKEREE---------------------T
A0A2V9M454      SLQDQIKDLQ----A---------------LVVRERKR---------------------V
A0A2V9IVR7      RLRDQAEEIR----S---------------SLEAERKR---------------------I
A0A2V9ILE2      RLRDQAEEIR----S---------------SLEAERKR---------------------I
A0A2V9LGY4      RLRDQAEEIR----S---------------SLEAERKR---------------------I
A0A2V9J4D6      RLQQQIDEVQ----L---------------LIQQERHR---------------------V
A0A2V9L9C5      RLQQQIDEVQ----L---------------LIQQERHR---------------------V
A0A2N9M9N1      QLGNQINEVE----E---------------LIDRERKR---------------------I
A0A2V9JEC4      QIRKQLAEVE----S---------------LINRQRMR---------------------L
A0A2V9LPQ3      RLRGQVAQMQ----S---------------LIEQEQKR---------------------T
A0A348V070      KLKSEIEATY----D---------------SLTREKEN---------------------L
A0A2Z5G3A3      DMKSNLQVIQ----A---------------AIASEVAR---------------------M
A0A2V7UGP8      RLQAEWDSAR----K---------------TMAEESQK---------------------I
A0A239MKT6      ELQNQLNSID----A---------------QVHEQMVR---------------------L
A0A3E0PCN7      EVRRKIAAVE----N---------------ELKGTRKL---------------------S
A0A2V8IYW3      QLEAERVAMP----K---------------ASDAPASA---------------------A
G2LEI9          QIDQVLAQAE----N---------------ELKEAKAN---------------------T
A0A317J121      KIEVQINELQ----I---------------TLNKEVTA---------------------E
A0A2V7YW66      TLKAEIEKSQ----Q---------------HINDVVKE---------------------L
A0A2V7Z0V0      TLKADIEKAR----Q---------------HLNEVLGE---------------------Q
A0A2V8GFD4      KLKASLQSAD----A---------------KLQAEIAK---------------------I
A0A2V8HSS5      KLKASLQSAD----A---------------KLQAEIAK---------------------I
A0A2V8KP55      RIRSQIEEIQ----K---------------QIEGERGR---------------------I
A0A399WNU1      KVEKQIAGIE----K---------------ELQSNRKR---------------------S
A0A2V9CG11      RVQAQIAELQ----S---------------AVKNQRTL---------------------I
A0A2V2R0I6      RLQAQLKDLD----A---------------TIEKEKQN---------------------I
A0A2V8XAR9      RLQAQLKDLD----A---------------NIEKEKKK---------------------I
A0A2V8VZA0      RLQAQLKEFD----Q---------------TIEKEKQK---------------------I
A0A1Q7CB82      RLQAQLKEFD----Q---------------TIEKEKQK---------------------I
A0A2V8WIU1      RLQAQLKEFD----Q---------------TIEKEKQK---------------------I
A0A1Q6Y9F5      RLQAQIKEFD----Q---------------TIEKEKQN---------------------I
A0A2V9EVV8      RLQAQIKEFD----Q---------------TIEKEKQK---------------------I
A0A2V8YF91      RLQAQLKEID----E---------------NIQGEKRG---------------------I
A0A2V8XZK2      RLKTELKDIE----D---------------SIEKEKRK---------------------V
A0A2V8ZTX6      RLKAQLKDID----D---------------NIEKEKQK---------------------I
A0A2V9BT79      RLKAQLKDID----D---------------NIEKEKRK---------------------I
A0A1Q8B793      RLQEQLKEFD----G---------------LIDAEKKN---------------------I
A0A2V9BCA0      RLQEQLKEFD----G---------------LIDAEKKN---------------------I
A0A2V9BWU9      RLQAQLKEIE----H---------------LIAREKAN---------------------I
A0A2V9DKX2      RLQAQLKEIE----H---------------LIAREKAN---------------------I
A0A2V9JSI3      RLQDQVNEIQ----G---------------FIERERKR---------------------I
A0A2V9WI32      QLGNQLKQVE----A---------------SIQAEDER---------------------I
A0A2V8IVN9      KVKSAIQLAQ----A---------------RLDGEIGK---------------------V
A0A1F2TPT3      KLEETIQATQ----A---------------KLDVERSR---------------------V
A0A2V8JTQ2      ELSKQLAQVR----R---------------SVDAEVKG---------------------I
A0A2V8UZY0      ELSKQLDQAR----R---------------SVDAEVNR---------------------I
A0A3N5YNR8      QVRQQIQEVE----K---------------QLQREKKE---------------------T
A0A350UEK1      RVAAQVASLE----K---------------SLEVERAQ---------------------I
A0A350UIQ4      RVNAQISSLE----K---------------SLANERDQ---------------------I
A0A3N6A5T6      QLKREVNEVN----T---------------QLVREKKR---------------------A
A0A1F2Q9L4      ELKAQIDKGR----Q---------------HLGNVTKE---------------------M
A0A1H5SQF5      SLKSELAELQ----R---------------QTNEEISR---------------------V
A0A3E0NV31      QTRSELAELR----R---------------DLSAAGGR---------------------A
A0A3N5M5V0      QVRQQIREVE----Q---------------QLVREKRE---------------------T
A0A2V9AEW6      RVQAQIDELK----A---------------QIEKERGN---------------------V
A0A2V8WQK6      RVQAQITELR----S---------------EMQKERAN---------------------V
A0A2V8XIF4      RVQAQINDLK----A---------------EMQRERNN---------------------V
A0A3N5XQP8      QAQRQITQGE----Q---------------ELKQERER---------------------A
A0A2Z5G7H4      DSRANLSGME----S---------------AIEDEVHR---------------------V
A0A2V9L5B5      QVEKQIDALQ----A---------------ELDKQKKA---------------------V
A0A2V9LK56      RLKKQIDLLQ----S---------------ILGKDKRT---------------------L
A0A2V9L7I0      QVKKQIDALQ----A---------------EIDRQKKA---------------------V
A0A522PPT0      ALKKQIETLQ----A---------------NLDHQKQA---------------------L
A0A2V9KCS3      RVDAQIASVQ----S---------------ALERERVN---------------------I
A0A2U3KC61      ELKNQLKQVR----T---------------EIVAEETR---------------------M
A0A2V9Y2R7      ELRNQLQEVR----S---------------GISVEQTR---------------------M
A0A372IT17      ERQAQLTEIQ----K---------------SIHDEVRR---------------------V
A0A136JPP4      QVEEKIASLK----T---------------TKQQTETE---------------------V
A0A399WUJ8      QVEEKIVSLK----N---------------TKQQTESE---------------------V
A0A2V9NGH6      QLNSQLQEVE----S---------------QIQLEMKK---------------------V
A0A2V9PYE6      QLNSQLQEVE----S---------------QIQLEMKK---------------------V
A0A2V9NL07      ELNNQLQEID----S---------------QIQGETKK---------------------V
A0A2V9QD92      ELNNQLQEID----S---------------QIQGETKK---------------------V
A0A2V9WPZ6      QLNNQLKEID----I---------------QIQGEMKK---------------------M
A0A2V9ZLH4      QLNNQLKEID----V---------------QIQSEIRK---------------------I
A0A2V9RQF1      QLNNQLKEVE----A---------------QTQVEMKK---------------------I
A0A2V9YDK8      QLSNQLKEIV----A---------------QIQAETKK---------------------I
A0A2V9V8F7      QLNNQLKEID----I---------------QIQGEMKK---------------------M
A0A2V9XGR9      QLNNQLKEID----I---------------QIQGEMKK---------------------M
A0A2V9V3Q5      QLNSQLKEIE----N---------------QIQVETRK---------------------A
A0A2V9NWS3      QLNGQLKEVD----A---------------QLQAEMKK---------------------V
A0A2V9USA9      QLNNQLKEID----T---------------QIQGEMKK---------------------I
A0A2V9XW18      QLNNQLKEID----S---------------QIQGEMKK---------------------I
A0A4R1LC91      ELQGNLHSIQ----K---------------AIQAETHR---------------------V
A0A3M2BZG9      KLKEELEGKR----A---------------KLTALVSA---------------------E
A0A1Q7N5R7      RVTSEIETLE----R---------------TTIPALAK---------------------A
A0A3M1SIV3      QIEATIQKLQ----E---------------GKEKIRQE---------------------E
A0A3E0PHB0      EAISLIASLK----E---------------QKNQLEDE---------------------S
A0A3M2D491      QIEAQIQQLR----E---------------TKEKVKNE---------------------V
A0A357F267      KKVERIAALQ----E---------------TRAKTETE---------------------V
A0A353C9L6      KKEAKIASLK----E---------------TKDKTERE---------------------V
A0A2V8RQV0      KKDAKIASLR----E---------------TKEKTEKE---------------------V
A0A2V8SJH5      VVEERIASLK----A---------------TKDRTESE---------------------V
A0A2V9QB26      QVEAQIALLE----A---------------ALQKEQAA---------------------I
A0A2V9VYY4      ELNNQLKQVR----A---------------AIEAEKTK---------------------L
A0A2V9KIE8      QLKKQIDVLE----A---------------RITAQKQA---------------------L
A0A352F549      DATQQIATLE----K---------------QLADTRGS---------------------A
A0A3B9MLP9      DVNQQIAILE----K---------------QLDETRGS---------------------A
A0A3D5SQ87      DVNQQIAILE----K---------------QLDETRGS---------------------A
A0A2V8NW86      QVEAQIASLE----A---------------ALQKERTA---------------------I
A0A2V8ZHL8      RFRSQVDEVQ----S---------------LIDTERKR---------------------I
A0A2V9B240      RLRSQVDEIQ----S---------------LIDTERKR---------------------V
A0A2V9CBM2      EIQSQITDVE----A---------------SLQQERKR---------------------A
A0A2V8XN17      EIQSQIDEIE----A---------------SLRDERQR---------------------A
A0A2V8WX45      EIQSQIDEIE----G---------------SLQVERKR---------------------A
A0A1Q6YR79      EIQSQVDEIE----S---------------SLREERQR---------------------A
A0A1Q7VA32      EIQSQVDEIE----S---------------SLREERQR---------------------A
A0A2V9EY85      EIQSQIDEIE----S---------------SLREERQR---------------------A
A0A2V9H8K0      EIQSQIDEIA----A---------------SLREERQR---------------------A
A0A2V9FFE5      EIQSQIDEIA----A---------------SLREERQR---------------------A
A0A2V9GM43      EIQSQIDEIA----A---------------SLREERQR---------------------A
A0A1F2RFI7      RLKNQIEEIE----R---------------TVQRERGA---------------------F
A0A1F2RZS3      RLKSQIDQTA----A---------------ALDRERQA---------------------F
A0A1F2USE2      QLENQIQEVQ----G---------------LLGQEQDK---------------------A
A0A2V9C238      QIQSQINELD----A---------------ALARERGR---------------------V
A0A1F2Q9F5      QLQNQIDEIE----R---------------LLAQERAR---------------------A
A0A1F2QQH9      QLQNQIDEIE----R---------------LLAQERAR---------------------A
A0A1F2QXK7      QLQNQIDEIE----R---------------LLAQERAR---------------------A
A0A2V9DEM9      QIQSQINELD----A---------------TLARERGR---------------------V
A0A2V9CYQ5      EIQSQITDVE----A---------------SLQQERKR---------------------A
A0A2V9BWU8      EIQSQIDEIE----A---------------TLREERQR---------------------A
A0A2V8ZG48      EIQSQINEIE----A---------------TLKEERQR---------------------V
A0A2V8Y334      EIQSQIDEIE----G---------------TLKEERQR---------------------A
A0A2V9AY68      EIQSQIDEIE----A---------------ALKDERKR---------------------A
A0A257VBK0      KKQEEIRGLK----E---------------RISQQAET---------------------V
A0A2V7XDY0      KLLLQLDQAQ----K---------------TKERQGTQ---------------------I
A0A350UQT3      KAQAQLREIQ----S---------------QVDATRDN---------------------A
A0A2U3JZ71      KASLQLAELE----R---------------QLQSGKEN---------------------I
A0A2V8TTB0      KAQTKVQELE----T---------------QIADTGAS---------------------I
A0A1F2TCR2      KLDAQIAIAK----K---------------DLIAQRQR---------------------V
A0A1F2V330      STEREIKELE----K---------------AVAAAPPK-------PTVAEPSAARMHYVQ
A0A662EE63      ELRVRLEGID----Q---------------AIERQIQT---------------------L
A0A2V8TLH7      EKQSEIDKTN----Q---------------KLASEVDR---------------------I
A0A1Q7ZJT1      EKQKEIEETT----Q---------------KIASEVDR---------------------I
A0A2V8VC99      EKQKEIDEIS----R---------------KIASEVDR---------------------I
A0A348UZU3      RLKAELDTAR----E---------------LLKNETQR---------------------L
Q01XL7          KIQAQISELQ----Q---------------TLDKEKTG---------------------L
A0A2V8ERZ5      NAVAALQDAQ----R---------------QLDLEIAR---------------------A
A0A2V8GTX0      RVNGQIQDAQ----R---------------QLDAEIER---------------------S
A0A2V8J0X9      EVKDQIENAK----R---------------RLVAERTK---------------------V
A0A523DUV7      KVVTQIEQLQ----D---------------AVRTQAEK---------------------L
A0A372IRG7      EIDRQLGSVR----S---------------DIQTEITN---------------------L
A0A1F2U158      NVNARLGDEQ----R---------------QLDLETAK---------------------A
A0A2V8F6S9      KARTDLAEGQ----K---------------QYEFEVAR---------------------A
A0A4Q1SCH5      ETREQLASVR----D---------------QIRKNVGN---------------------I
A0A3D1ASD2      KAQGQVAELD----R---------------QLQTAKTS---------------------I
A0A2N9MK30      KAQTQLDQVQ----A---------------QFDATRGS---------------------V
A0A4Q7YNP3      HLRSEIREVE----A---------------GMEAARNA---------------------N
E8UZE1          QIKSELAEVN----R---------------TITTELRR---------------------G
A0A1V6HR88      ELKGRIDQAR----G---------------NLIPAARE---------------------A
A0A3E0P0A3      ELKTQIDEAR----R---------------QLNQLIEE---------------------N
A0A2V8EXP2      KIGLAINAAE----E---------------RIQGEIAK---------------------V
A0A2W4RYA1      AINRAIELAQ----Q---------------KLDTEIQK---------------------V
G8P0Y7          EITSQLDQLN----K---------------SINEQVKN---------------------S
A0A5M8T4U7      AMNAQIAKVK----V---------------DLDHEVSL---------------------A
A0A3P0X3W6      VAANTLAEVT----R---------------EYQAARDN---------------------T
A0A1E3Y9R6      DLASQIEAAN----R---------------DLDLEIDK---------------------V
A0A2W4TLP2      ELATQIERAR----R---------------DLETEVSK---------------------V
A0A3R9WF43      QLQEQINAVD----A---------------QMQTEMAR---------------------I
A0A317HKM4      KLREAVQNAD----R---------------KLQAEIAA---------------------A
A0A523E0N1      RVKGALDETK----R---------------DLDVVATE---------------------Q
A0A523ECP2      RAREGLTDIK----S---------------RIEIERNV---------------------L
A0A2W0C122      ELTNRINAIN----L---------------SIQTELKR---------------------L
A0A2W0AUU7      ELTNRIKAMD----T---------------SIQTELKR---------------------L
A0A2W0BQL1      ELTNRIKAMD----T---------------SIQTELKR---------------------L
A0A4Q1SDL1      ELRASLDKVN----Q---------------AISDEVSR---------------------V
A0A3P0XH15      EVQGSLVQVR----K---------------AIDVEINN---------------------M
A0A4R1LAZ7      EIRSQLSQVQ----R---------------DIDSEINS---------------------L
A0A3M1WQW8      SLKGEIAETE----Q---------------QLAE-------------------------I
A0A3N1JHC1      KVESQIKELE----E---------------EMQRHRFT---------------------I
C1F294          EVRQQLKQVR----S---------------DINKEITN---------------------L
A0A2V9KA79      RLRRQIQEFE----A---------------SASAQAPVEGPVSARRPAGEPSPFFLRYLQ
A0A522PSP1      QKQRELTQID----N---------------SIRKGQQH---------------------I
G8P085          QVKDQMQKTD----A---------------ELERQSSI---------------------V
A0A4Q1SGQ1      ELQAELTGVQ----R---------------SIRAEAER---------------------M
Q1ILD9          ELKKQLAQVN----A---------------SLAKETRD---------------------I
Q1IJZ6          DVDKQLSDVD----S---------------QIKGELKL---------------------I
A0A2V8TCE6      VLTRKLEGAR----Q---------------QLSSETEA---------------------I
A0A522TBE8      QQSTVVRRDE----E---------------AVQQAQAR---------------------L
Q1ITG0          QLNNQLAQTD----A---------------SLKKEIRD---------------------I
A0A3N5PCI5      RVNSAIEAAE----R---------------ELDSEVAK---------------------T
A0A3M1Q0S9      QIATELAAGR----E---------------RLASETER---------------------I
A0A2Z5G448      EVEKQLTAVQ----T---------------DIDAEISN---------------------L
A0A3M1VZ38      TVKAKLDSSR----E---------------HLQEQIAA---------------------I
A0A4Q1SD29      EVNNQLEKVQ----S---------------DIDQEINS---------------------L
A0A3M1PY35      ELSRAIAEAR----V---------------RLAERAAA---------------------V
A0A3M1VMP2      ELRAAVKETE----R---------------NLENEMEA---------------------I
A0A2V8G155      KVKSAIQISQ----A---------------KLSGEISK---------------------V
A0A2V8HDM7      KVKSAVQISQ----A---------------KLSGEISK---------------------V
A0A2V8DRT9      KAKLNVQNAE----A---------------RIQAEINK---------------------V
A0A2V7VYF3      KARSAVDTAL----A---------------KLNTEIDK---------------------V
A0A1F2SVH2      RLSSAVREAE----S---------------KIQGEIAK---------------------V
A0A2V8AJG9      KVSNAIQLAE----S---------------KLQGEIAK---------------------V
A0A2N9LQU7      ELQAQLARLD----Q---------------NIADELTN---------------------V
A0A2P6WFK7      ELQTQLSKLN----A---------------AIADEVAN---------------------V
A0A2V8U914      RVKAQIVQLE----A---------------AIARESRR---------------------V
A0A2V7W309      DLAQQIEKTKLARAA---------------AVREAYSR---------------------A
A0A2W0BGU4      RLDKQVKEAS----A---------------LIAAERGR---------------------I
A0A2W0BVQ9      RLDKQVKEAS----A---------------LIAAERGR---------------------I
A0A2V9MN96      QLRSQLNQVR----N---------------SIATEQKN---------------------L
A0A2V7V2Z1      KVRNQIQETR----K---------------KIAAESQR---------------------V
A0A2V7X2F7      KVRRQIEDTR----K---------------RLSAEGQR---------------------V
A0A2V7V2I1      KNRNQITETR----E---------------KIASEAQR---------------------V
A0A2V7U3M2      KVRNQIQETR----K---------------KIAAESQR---------------------V
A0A2V7UHT0      KVRNQIQETR----K---------------KIAAESQR---------------------V
A0A2Z5FVL3      ELKADLTAIQ----N---------------SIKEEIQR---------------------M
A0A2V9KBD6      ELSSQLSQVR----S---------------SIDAEVKR---------------------I
A0A2W0AJ66      ELSNQLAQTR----R---------------SIRSEVKR---------------------T
A0A1Q7RBU1      ELSNQLAQAQ----R---------------SVDAEVRR---------------------I
A0A2V9JPV9      ELSKQLAQAR----Q---------------SVDVEVRR---------------------I
A0A1I6MH75      ELSNEIKELD----A---------------QLAAEQKR---------------------L
E8WVF6          AARAQIDEFQ----H---------------AVEAEQNR---------------------L
A0A1H5Z7N3      ALRAQVDTLN----Q---------------EIRAEQDR---------------------I
A0A2V9YHT3      EVGNQLKQVQ----E---------------TIQGETRR---------------------I
A0A1G7JVV8      ALQAHLREVD----R---------------EIKTEETR---------------------M
A0A1H4T6W9      ALQAHQREIQ----R---------------ELRSEENR---------------------L
I3ZEU5          ALRAHQREVQ----R---------------EVQAEENR---------------------L
A0A428MDU2      ALKAQIDELE----K---------------EIDAEQKR---------------------L
A0A5B9EBI2      AAKAQMDELA----T---------------EINTEQGR---------------------L
A0A239HDF6      STKAQIDELA----R---------------QVAAEQNR---------------------L
A0A4Q0T270      AQSNELAELE----K---------------QLKAEQER---------------------L
A0A1Q3QQB6      ALRAQIDELS----K---------------EVTKEQNR---------------------L
A0A3N1K1G7      AQKAQIDELA----K---------------EIDAEQSR---------------------L
A0A4V2G466      AQKAQIAALS----T---------------EINTEQQR---------------------L
A0A6B9YNQ8      AQKAQIDELS----K---------------EISTEQQR---------------------L
                                                                            

A0A2V7VMF7      ADGLQ----AE-------------------FAQLQKRESELRDAIDAQKADAARQS-QK-
A0A2V7YYV7      PNSRL-------------------------------------------------------
A0A2V7Z0J5      TNARS-------------------------------------------------------
A0A2V7Z3M4      PNTRT-------------------------------------------------------
A0A399Y5V2      ------------------------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      YVNLS-------------------------FSPASQSSQ---------------------
A0A2V8JK38      VKTFE----VE-------------------YSAATERERLLSVALEQQRDAVNKMN-RE-
A0A2V9IXG5      ADGMR----VS-------------------VSVLRNREQASQKSYSEKMAERRVTS-RH-
A0A2V9J2P4      ADGMR----VS-------------------VSVLRNREQASQKSYSEKMAERRVTS-RH-
A0A1Q7RLS4      INGLR----SQ-------------------YDLLKDREAKLIKATDETRTESLQVN-RK-
A0A2V2R525      VKGLE----TK-------------------FREAQRREQEIRDAFEKARSETITQN-SA-
A0A321LPW6      EARLR----AD-------------------YERSARDEVSLKGALDRAKTEAARQN-QD-
A0A2V9R9V4      EEKLK----AD-------------------YERVVRDENALKAALEEAKAGAAQEN-QR-
A0A321LE75      EARLK----AE-------------------YERAIRDETALKESLERAKIDAAQQN-QD-
A0A2V8R8U7      LASMK----SR-------------------ADAAEAHERSLEKAYSVQHGKTVSQT-RN-
A0A2V8QMP4      IAGLE----NR-------------------YEAAVKNERSATGSYFAARAKANDQS-VA-
A0A2V8R4S3      IAGLE----NR-------------------YEAAIKNERSATGSYFAARAKANDQS-VA-
A0A2V8NJ55      INSLK----LR-------------------YETALATEQKIKTDYEHERGAAQAQG-KA-
A0A2V8Q7I0      IARLK----SE-------------------YQESYAHENSVRAMYNSQHGTATQQT-RN-
A0A2V8S6K4      VIGMG----AS-------------------LDGAKKRAASLQAAYYKERSAAQAQG-IQ-
A0A317I2L9      IQGLK----AQ-------------------YEAALAHEQSIKSMYNAQRGVTSQQT-RA-
A0A2V8LLF9      LAGLK----SR-------------------RDSAIAHEKSLVGAYSRQHGTTIQQT-KD-
A0A352FRF4      LASMK----AK-------------------SDAATTQLADLKTAYTKESGLTAQQT-KN-
A0A2V8MKV0      LVSME----SR-------------------YKAAEATERSLAQAYSQAHGVTAAQL-DH-
A0A2V8PYY8      LASME----SR-------------------YKAAEATEKSLAQAYSQAHGVSTAQI-QH-
A0A1Q7YKQ8      LATMK----SK-------------------YDAAVTTENSLRASYNQQHSEFSQQT-QD-
A0A352F3R7      VTSIQ----RR-------------------YEAAVSRENLLRRSYEQQKGTTTQQT-RD-
A0A0B6WXT1      IKAMR----SR-------------------YEAALARENKLKQAYYQEAAAANEQN-QA-
A0A3B9MEU8      VTSIQ----RR-------------------YEAAVSRENLLKRSYEQQKGTTTQQT-RD-
A0A2V8MHG6      KTNLE----TR-------------------YRQALQKEEALRQAFEKQRAETLTQN-EA-
A0A2V8P7N1      KTNLE----TS-------------------YRQALQKEEALRQAFDKQRAETLTQN-EA-
A0A2V8M3M6      KTNLE----TS-------------------YRQALQKEEALRQAFDKQRAETLTQN-EA-
A0A1Q7NJH5      KTNLE----TS-------------------YRQALQKEEALRQAFAKQRAETLTQN-EA-
A0A2V8PJY0      KTNLE----TS-------------------YRQALQKEEALRQAFAKQRAETLTQN-EA-
A0A1Q7Y6W9      TTNLK----TN-------------------YLQAKAQEDSLRDAFNKQRSETLVQN-EA-
A0A2V8NC68      ITNLE----TS-------------------YRQAMAREQALRADFEKQRGETLTQN-EA-
A0A399WK13      LYNLQ----TK-------------------YLQAKANEDKIRADFNKQFGEATGQN-QS-
A0A352FLX4      TTNLA----TR-------------------YRQALATEELLRKAYDQQRAETLTQN-EA-
A0A2V8RTL7      LENYK----TQ-------------------YQQAKDQETKIRSAYDVQYNEAQGQN-SG-
A0A3E0PCJ6      LENLK----TR-------------------YLQTKEREDKVRSAFNAQYNEAQGQN-QS-
A0A3M1S4R8      LTNLQ----TR-------------------YEQAKAQEDKIRRAFEEQYRKAEGEN-RA-
A0A1Q7YFI6      KTNLE----TR-------------------YHQALAREESLRQAFDQQRAQTLTQN-EA-
A0A136KC10      LYNLQ----TK-------------------YLQAKANEDKIRADFNKQFGEATGQN-QS-
A0A2V8SEX6      VDNLR----TK-------------------YLQTKNEEDKIRAAYDEQYNAAQVQN-GG-
A0A3M2D6Y5      LTNLQ----TK-------------------YEQAKAQEDKIRKAFDEQYRRAEGEN-RA-
A0A0B6WWQ6      LTNLR----TR-------------------YRQALAREEALRQAFDEQRGETLTQN-EA-
A0A3B9MK99      LTNLE----TD-------------------YRQTLAREQALRKAFEQQRGETLSQN-EA-
A0A352EX26      LTNLE----TQ-------------------YRQTLGREQALRAAFQQSRSETVTQN-EA-
A0A2V8MM59      LTNLE----TR-------------------YRQTLAREQALRKSFDQQRAETLTQN-EA-
A0A2V8PFE8      LTNLE----TK-------------------YRQSLAREESLRKSFNQQKGETVTQN-EA-
A0A2V8PWS6      LTNLE----TK-------------------YRQALAREDSLRKSFNQQKGETVTQN-EA-
A0A2V8LCT5      LTNLE----TK-------------------YRQAAEREDSLRKSFNQQKGETLSQN-EA-
A0A352FTJ9      LKNLE----TK-------------------YRQAADREEALRKSFNQQKGETVTQN-EA-
A0A2G6PYV5      YNRLIQSISKDVQDRKNELA----------YLEAQRKKQNQKIVLADLKTKEQNASLDS-
A0A2V8F956      VQGVK----NE-------------------YLAALAKENSLTGALNAQKGDA--------
A0A1F2S1W5      LQAMR----ND-------------------YEAALTEERTLANELNRQKIEAQQLN-RT-
A0A1F2T595      AQAIR----SE-------------------YEAALAEERSLSASLNQQKIEAQSLN-RA-
A0A2V8JQV5      LRGIA----NQ-------------------YEDAKRREELLAQEYDAQTRVVSDQA-DK-
A0A2V9AC41      VKRIE----VT-------------------YTAAKNNETGLRATMEDQKKTTLNLK-DA-
A0A2V8K4L4      VTRLR----ND-------------------YAAAESHEKLLNDEFAKQLDTVSSQA-AN-
A0A2V8NCZ3      VTRLN----ND-------------------YAAAQSHEKLLNDEFAKQLNTMSSQT-AK-
A0A2V9MAM9      RQRLR----ND-------------------YLTARRREALLSSAYQQQTHLASDLR-KK-
A0A2V9M454      VDNLH----ND-------------------YLAAVEREKFLATAVAQQKVQVDRVN-QL-
A0A2V9IVR7      VERYH----GE-------------------YVAAQQREAMISEALARQKVELEKLN-QL-
A0A2V9ILE2      VERYH----GE-------------------YVAAQQREAMISEALARQKVELEKLN-QL-
A0A2V9LGY4      VERYH----GE-------------------YVAAQQREAMISEALARQKVELEKLN-QL-
A0A2V9J4D6      VERIQ----RD-------------------YEAAVEREKLLEATVAQQKFEVGKLN-QL-
A0A2V9L9C5      VERIQ----RD-------------------YEAAVEREKLLEATVAQQKFEVGKLN-QL-
A0A2N9M9N1      MERIE----SD-------------------YRTAVRREQLLSQDVSAQRTEVEKLN-QL-
A0A2V9JEC4      VKQTK----DA-------------------YDTAVRRETLLSRTVAEQRKDVERLN-QL-
A0A2V9LPQ3      VERIQ----ND-------------------YRAASTRVSLVSTSVVQQKAEVGRLN-QL-
A0A348V070      IKTAY----AE-------------------YQGALAKEQNLQKLLDDLKAQAYKAN-ST-
A0A2Z5G3A3      GARAE----ND-------------------FKVAKTAEAQSQMSYKALKKRADALN-DK-
A0A2V7UGP8      FDDTLKTAKME-------------------YEEASAHEKTVRGALEGQKSEAIKQK-QY-
A0A239MKT6      NSETR----SS-------------------YLLAKADEDGIRKRATDQRQQVLELG-NS-
A0A3E0PCN7      ADVQLSDLQRQ-------------------FREASSRENELRRNFEAQRNAVLNQN-EA-
A0A2V8IYW3      APQVA----DNVVVRRMRETQTEIDKLDRQIAGKEADSVRLRGTIAEYQRRVETAP-TR-
G2LEI9          LVRIK----TA-------------------YENAKRREEELRARVEKQRNEVVTQN-GD-
A0A317J121      IQRIK----ND-------------------YDVALRREKLLSADYTKQASQVSAEA-TK-
A0A2V7YW66      TEKARNAAAAS-------------------YQTALRQEQSLDGELTTLKGQAIDQN-SA-
A0A2V7Z0V0      VDKAKSNSLAA-------------------YQTAQRQEQELEGELNALKRDVINQS-SA-
A0A2V8GFD4      AESVR----TE-------------------YLAAAAQERSLQAALDQQKHEAQELN-RR-
A0A2V8HSS5      AESVR----TE-------------------YLAAAAQERSLQAALDQQKHEAQELN-RR-
A0A2V8KP55      VKTFE----VE-------------------YSAATERERLLSVALEQQRDAVNKMN-RE-
A0A399WNU1      ADTQIASLLQT-------------------YREAASRENELRSNFDAQRSAVLNQN-EA-
A0A2V9CG11      LRRIG----SE-------------------YSAARQREEFLAKAYADQEMIAADQS-SK-
A0A2V2R0I6      LNGLE----AD-------------------YREARQHENLLMRELEDQKAQANAMA-EK-
A0A2V8XAR9      VDVLE----SD-------------------YREARQRESMLTQALDQQKAAANQMA-EK-
A0A2V8VZA0      LDVLE----SD-------------------YHEAQQRETLLTQALDQQKAETNQMA-GR-
A0A1Q7CB82      LDVLE----SD-------------------YHEAQQRETLLTQALDQQKAETNQMA-GR-
A0A2V8WIU1      LDVLE----SD-------------------YHEAQQRETLLTQALDQQKAETNQMA-GR-
A0A1Q6Y9F5      LNVLE----SD-------------------YHEAQQREALLTRALDQQKADTNQMA-GK-
A0A2V9EVV8      LDVLE----SD-------------------YHEAQQREALLTRALDQQKADTNQMA-GK-
A0A2V8YF91      LDALE----SD-------------------YREARQRETLLTDALDQAKAEANQMA-ER-
A0A2V8XZK2      LEVLE----SD-------------------YREARQRETLLSEALDQAKVEANQMS-EK-
A0A2V8ZTX6      LDVLE----SE-------------------YREARQRETLMGQALDQAKAETNQMA-EK-
A0A2V9BT79      LEVLE----SD-------------------YREARQRETLLADALNEAKAETNQMA-EK-
A0A1Q8B793      VTSIE----NE-------------------YRAARQRELLLLKALDQQKAEANQMA-ER-
A0A2V9BCA0      VTSIE----NE-------------------YRAARQRELLLLKALDQQKAEANQMA-ER-
A0A2V9BWU9      INRIE----AE-------------------YHTARQRENLLSQALDKQKGESNAMA-EK-
A0A2V9DKX2      VNRIE----AE-------------------YHTARQRETLLSQALDKQKGESNAMA-EK-
A0A2V9JSI3      AGRVR----ND-------------------YRAAMGREKLLAAALAREKEAVGRLN-QV-
A0A2V9WI32      ASRVQ----NE-------------------YLSALQREKLLGAALDVQKQEANHLN-ES-
A0A2V8IVN9      VQSVK----NE-------------------YLGSLAKENSFIAALNQQKGEALTMN-RK-
A0A1F2TPT3      LEAMR----ED-------------------LGVSRAAEANLGKELESLKIEATAQN-RK-
A0A2V8JTQ2      GERIT----YE-------------------YQTAAERERMLRDALEAQKQVVDHLN-AS-
A0A2V8UZY0      GKRIT----YE-------------------YQSAVGRERILQDALEAQKQTADKLY-AN-
A0A3N5YNR8      INRVQ----SE-------------------YRVAVNRRQMLLGALNRQKSEANQLN-QD-
A0A350UEK1      LRRIR----NE-------------------YEEAMRKERLLQTDYDRQTRLVTALG-EK-
A0A350UIQ4      LRRIR----NE-------------------YEEAMRKERLLQADYDKQTRLVTVQG-EK-
A0A3N6A5T6      IQRAR----AQ-------------------YQVAVDRRNRLQTALVAQKEMADQLN-EN-
A0A1F2Q9L4      VGKARDSARAE-------------------YQGALRREEALVAELTRQKSDAMQLN-SA-
A0A1H5SQF5      GNQAA----RN-------------------LDLARKTEDGLLQSVDREKLRLGHMT-TS-
A0A3E0NV31      ADAVL----QQ-------------------YRAAQRRADSFAAQIRAERRSSDRES-EA-
A0A3N5M5V0      IRRAQ----SE-------------------YKVAVNRQQMLRRALQKQKAEANQLN-QD-
A0A2V9AEW6      LGRMR----NE-------------------YEAALRREKLLTEAHDAQQKVVADQS-SK-
A0A2V8WQK6      LRGLG----NE-------------------YAAAVRRERLLSKAQAEQEKIAADQS-DK-
A0A2V8XIF4      LRRIG----NE-------------------YTAAVRRERLLVEVHANQEKVVADQS-SK-
A0A3N5XQP8      LEEAQ----GR-------------------YRASLQQYSQLSRVMDRQRQLAYRLN-SD-
A0A2Z5G7H4      AERSK----ND-------------------YEIARREEDESRTEFATEKHQADSLN-DK-
A0A2V9L5B5      VDNIV----DE-------------------YRSATAKEQYFAQAVDDQKREVNEIA-AR-
A0A2V9LK56      VQNLV----DA-------------------YSSAVNREKYLEQALKGQEKQVNDIA-EK-
A0A2V9L7I0      TENIV----DE-------------------YRSAAAKEKYFAQAVEDQKREVNRIA-DK-
A0A522PPT0      TQNIA----QQ-------------------YDAAVVREKYLNSLVSQQESLVDVVS-QK-
A0A2V9KCS3      LKRIR----NE-------------------QEAAVRRESLLAAEYGSQAKLVSEQS-GK-
A0A2U3KC61      QHGVR----DE-------------------YLAAVQRENLLTTAFNQQTQQANQLN-ES-
A0A2V9Y2R7      QHRIR----DE-------------------YLAAAQRERLLTSAFEQQKQRANLLN-ES-
A0A372IT17      GERAH----AD-------------------YEIAQRAEDTAREEFEKQKTLAAQMN-DR-
A0A136JPP4      SQIID----RDQKKIEKDAVSGALVSLRSQVDAARRREDQLLNAYEVEAERANVQG-QA-
A0A399WUJ8      SQIID----RDQKKIEKDAVSGALVSLRSQLDAAKRREDQLLNAYEVEAERANVQG-QA-
A0A2V9NGH6      IARVR----SD-------------------YLASVHREEMLRAAMEKQKQEANQLN-ES-
A0A2V9PYE6      IARVR----SD-------------------YLASVHREEMLHAAMEKQKQEANQLN-ES-
A0A2V9NL07      GGRLR----GD-------------------YLAALQRENMLRSALEEQKQQENKLN-ES-
A0A2V9QD92      GGRLR----GD-------------------YLAALQRENMLRSALEEQKQQENKLN-ES-
A0A2V9WPZ6      GGRVR----GQ-------------------YMASLHREGLLRDALEKQKQQANKLN-ES-
A0A2V9ZLH4      AGKVR----NQ-------------------YLAAVQRESMLHDAMEKQKQEANKLN-ES-
A0A2V9RQF1      TSRVR----SD-------------------YLASLQRENMLRDALDRQKQQANRLN-ES-
A0A2V9YDK8      AGHVR----SQ-------------------YMASLQRENMLRAALEKQKQEANKLN-QS-
A0A2V9V8F7      GGRVR----GQ-------------------YMASLHREGLLRDALEKQKQQANKLN-ES-
A0A2V9XGR9      SGRVR----GQ-------------------YMASLHREGLLRDALEKQKQQANKLN-ES-
A0A2V9V3Q5      VDHLR----GQ-------------------YQTALQRETMLRAALEKQKQEANRLN-EN-
A0A2V9NWS3      VARVR----SD-------------------YLAALQRETMLRGALTKQKQEANKLN-ES-
A0A2V9USA9      ASKVR----GQ-------------------YMTALQRENMLRDALEKQKQEANKLN-ES-
A0A2V9XW18      VAKVR----GQ-------------------YNAALQRENMLHTALDKQKQEANKLN-ES-
A0A4R1LC91      AERAQ----ND-------------------YLVAQGVENSTQKVFDEEKKQADAMN-DK-
A0A3M2BZG9      VNQRRDLARTA-------------------YQEALRKEQNVEEELRKLTDEISAYS-SS-
A0A1Q7N5R7      L-----------------------------ATELESREAVLGTQITAGGRELRGIP-QR-
A0A3M1SIV3      SAQIE----QESKQAEERAKKEILTGLAAQLNSARKREAKAKESYLREVEKANQQG-QA-
A0A3E0PHB0      KQIIE----DESKTLEKAVQKEITSALAAKLNTARRREAQLAAAYEQESAKANQQG-QK-
A0A3M2D491      EKKLE----LESKLLEQRAQKELLTALSAQLNAAKQKEEQARASYLAEVERSNQQG-QA-
A0A357F267      TQIID----RDQKKIEVDAINGALVSLKAQLDAKRKEEAQAQAAYDAEAARANIQG-QA-
A0A353C9L6      SGIID----RDQKKIEKDAVTGALVSLRAQLDSKRREEAQALDAYEKEAALANVQG-QA-
A0A2V8RQV0      SKIID----TDQKKIEKEAVSGALVSLRAQLNAARTQEAQAQAAYEQESGTANVQG-QA-
A0A2V8SJH5      STIID----KDQKKIEKDAVNGALVTLRSQLSAAQKQEAQSLAAYEQEASQANVQG-QA-
A0A2V9QB26      VDRIR----ND-------------------YKTALRREKLLSAAYRNQSRLVTDQD-EK-
A0A2V9VYY4      QQKMR----DD-------------------YLAALQRENLLDSAFNKQKQEANKLN-ES-
A0A2V9KIE8      VENIV----EE-------------------YHAAESNEKLLAQAVVQQKAEVNDIA-QK-
A0A352F549      KQIITTNLEVN-------------------YRKAVEREKTLRDSFNKQRGETVAQN-QA-
A0A3B9MLP9      RKIITVSLDSN-------------------YRQALDREKTLRDSFNKQRAETVAQN-QA-
A0A3D5SQ87      RKIITVSLDSN-------------------YRQALDREKTLRDSFNKQRAETVAQN-QA-
A0A2V8NW86      VDRIR----ND-------------------YETALRREKLLSAEYRNQSRLVTDQD-EK-
A0A2V8ZHL8      VERLR----ND-------------------YMAALGREKLLAAAVAKEKADVGALS-QL-
A0A2V9B240      VERLR----ND-------------------YEAALGREKLLAAAVAKEKVGVGALS-QL-
A0A2V9CBM2      ADQIT----NE-------------------YFAASSRESLLRHELAEQQKQIDRIA-EK-
A0A2V8XN17      ADRIA----ND-------------------YSAAVRRENLVQQALDNQQKQVSLIA-EK-
A0A2V8WX45      ADRIA----ND-------------------YSAAVRRENLVQQALGEQQEQVSLIA-EK-
A0A1Q6YR79      ADRIA----ND-------------------YSAAVRREDLVHQAVDGQQKQVSLIA-EK-
A0A1Q7VA32      ADRIA----ND-------------------YSAAVRREDLVHQAVDGQQKQVSLIA-EK-
A0A2V9EY85      ADRIA----ND-------------------YSAAVRREDLVHQAVDGQLKQVNLIA-EK-
A0A2V9H8K0      TDRIV----ND-------------------YSAAVRRENLVQQALNDQQKQINLIA-EK-
A0A2V9FFE5      ADRMV----ND-------------------YSAAVRRENLVQQALDDQQKQVNLIA-EK-
A0A2V9GM43      ADRMV----ND-------------------YSAAVRRENLVQQALDDQQKQVNLIA-EK-
A0A1F2RFI7      AKRVT----DD-------------------YRAALNRKRLLDQAVEQQTKEINQIA-EK-
A0A1F2RZS3      AQRVA----ND-------------------YKAAANRKRLLDQAVAQQTSDFNAMA-EK-
A0A1F2USE2      AERIR----KE-------------------YGAAQQRQEFLRQAFQKQEEQANLIA-EK-
A0A2V9C238      AGRIT----ND-------------------YLAAVRRENLVAQAFAEQQKQANLIA-GR-
A0A1F2Q9F5      AERLA----ND-------------------YQAAMRRETLLRRAFADQQAQAGRVA-EK-
A0A1F2QQH9      AERLA----ND-------------------YQAAMRRETLLRRAFADQQAQAGRVA-EK-
A0A1F2QXK7      AERLA----ND-------------------YQAAMRRETLLRRAFADQQAQAGRVA-EK-
A0A2V9DEM9      AGRII----ND-------------------YLAAVRRENLVAQAFAEQQKQANLIA-GR-
A0A2V9CYQ5      ADQIT----NQ-------------------YLAASSRESLLRHELAEQQKQIDLIA-EK-
A0A2V9BWU8      ADKIT----NE-------------------YSAAVRREELVKQALDDQQKQVNVIA-EK-
A0A2V8ZG48      ADKIV----NE-------------------YLAAVRRESLVKQALDEQQKQVNLIA-EK-
A0A2V8Y334      ADKIT----NE-------------------YFAALRRESLVKEALDGQQKQVNLIA-EK-
A0A2V9AY68      ADKIT----NE-------------------YFAALRREGLVKGALDTQQNQVNVIA-EK-
A0A257VBK0      LGSYR----NQ-------------------LSALRGERANLAQEVDGARREGLQFV-EG-
A0A2V7XDY0      IAALR----AD-------------------YEQLQKRESELRGAIDTEKAQAASQS-RK-
A0A350UQT3      IRRMQ----VE-------------------YEQAQAREKMLERSVNETKAEYDTLN-FR-
A0A2U3JZ71      GQRVE----VE-------------------YREALNRESMLRKTVSETKAEFDALN-AR-
A0A2V8TTB0      AQRVE----IE-------------------YREAVNREAMLEKAVAETKAEFDRLN-AR-
A0A1F2TCR2      IETAK----TD-------------------YEAAVAEERSFASSLEDQKRVAMDLD-RK-
A0A1F2V330      IRAEK----ES-------------------LEQRLTSYGQEERALESEMGRLQRRV-QST
A0A662EE63      RLGME----TR-------------------FDMVKRREQSLFENIQGLRNQTIELS-KT-
A0A2V8TLH7      ISNLR----TQ-------------------YALLKDRESKLAVAINETRSESLRVN-QK-
A0A1Q7ZJT1      INGLR----SQ-------------------YDLLKDREAKLIKATDETRTESLQVN-RK-
A0A2V8VC99      INGLR----AQ-------------------YELLKDREAKLIKVSDDTRAESLQVN-RK-
A0A348UZU3      IRAAY----AD-------------------YQAALKKEASLKELFEQQKEEAFRLN-SN-
Q01XL7          LKRLD----ND-------------------YQEALRREKLLSGAYNAQTHAVGAQA-DK-
A0A2V8ERZ5      VQSVK----NE-------------------YETAVLQEQTLARNLDGAKSEAQDLN-RK-
A0A2V8GTX0      VAAIK----AD-------------------YQAALDEEKQLSADLEGQKAQATDLN-RK-
A0A2V8J0X9      LESLK----ND-------------------YNAAFAQERSFSSQLEEQKGASMDLD-RK-
A0A523DUV7      VAGMR----AD-------------------YQQLRRRERELLASINSQRKESIEDS-RK-
A0A372IRG7      TQRFQ----TE-------------------YDAAVKTEGLLQQRLDDTKQQAFHEN-ES-
A0A1F2U158      LQTVR----NE-------------------YERAVLEERTFAANLEEAKKDVQDLG-RK-
A0A2V8F6S9      ATTIK----ND-------------------YESAVLEEQTIARGLESAKADAQNLS-RL-
A0A4Q1SCH5      TAHLK----QD-------------------LDASRQAESLMHQEYQDAVSQAYALN-RK-
A0A3D1ASD2      TEQVA----IE-------------------YRTATQREQMLKQELARTKSESDALN-AR-
A0A2N9MK30      MRRVE----VE-------------------FREGVNREEMLKKAVTETKAEFDRLN-AR-
A0A4Q7YNP3      SNRLK----NE-------------------LETARHREMLLMTAYHMQEANVSSDL-GK-
E8UZE1          RNQLE----LE-------------------YKLASENENKLRAATEAQKQQIFSMN-ED-
A0A1V6HR88      LAKAR----EA-------------------ARAEYQGAQRREAALAAEINSLKVEN-REV
A0A3E0P0A3      SRQAV----TA-------------------ARARYQQALQTERSLEREYEAMKEET-RRY
A0A2V8EXP2      VQAVR----NE-------------------YLSAQTQEQSLINVLDQQKREALALN-RK-
A0A2W4RYA1      VASIT----AQ-------------------YEAAVAHENNLLAALAQQEREAQQLN-AK-
G8P0Y7          VSRIH----ND-------------------YQTAVNREQMLQEALGEQMGIADQLN-QN-
A0A5M8T4U7      HRQIQ----DE-------------------YQGALRTEQLLRQRLDAQKEEAFRLN-ED-
A0A3P0X3W6      GRRIQ----TD-------------------FAQADTREKMLAATLAAAKAQSDALS-LK-
A0A1E3Y9R6      AAALQ----AE-------------------FQTARAREAALQQSLAGQQRESLGLD-RQ-
A0A2W4TLP2      AAAIE----AD-------------------FETALARERALQQSLDQQQRESLGLD-RR-
A0A3R9WF43      TKRAE----NA-------------------YQYAKDNENSIKGQFEKQQHEAIQLA-DN-
A0A317HKM4      AHTIR----ND-------------------FEAAQSREQALEAALDRSKREVQALN-AK-
A0A523E0N1      AAKVV----GT-------------------AKGEFQEARDRENSLRKSLNAQKSQV-RKL
A0A523ECP2      AVEVV----AK-------------------ARVEYRAAVEREHLLLAEVESQKKEA-QEL
A0A2W0C122      QARAE----LE-------------------YQVASRREQKLRAAFEAQKVEANRLN-VS-
A0A2W0AUU7      QGRAE----LE-------------------YQVAARREQKLRAAFEAQKIEANKLN-ES-
A0A2W0BQL1      QGRAE----LE-------------------YQVAARREQKLRAAFEAQKIEANKLN-ES-
A0A4Q1SDL1      QARAK----SD-------------------YEIAQKTENDSRAQYEANRQAADALK-DK-
A0A3P0XH15      QQRFQ----VE-------------------YETALSTENLMRKRLEDAKQQAYQQN-RS-
A0A4R1LAZ7      TQRFQ----EE-------------------YNAASNTEALMRKRLDATKQEAFREN-ES-
A0A3M1WQW8      EKQIL----AK-------------------IEADYKAARTREENLRAELMAQRAET-LRQ
A0A3N1JHC1      VKRLS----VE-------------------DDTAARRQQLLKQQYDRQLAVVTDQG-SK-
C1F294          TQRFK----AE-------------------YDAAVQTQNLLEARLENTKQQAFKQN-ES-
A0A2V9KA79      LKSEV----EA-------------------IDQRLNSSKQEQRDLTAQLETYRSRV-QST
A0A522PSP1      LAQIK----AQ-------------------ARAQAVQVKLTERQL----ADVKAQL-EEF
G8P085          KNRLK----QE-------------------YDTAVAI----QSSLQQQYDEQTDKA-YAL
A0A4Q1SGQ1      GHR---------------------------ARVDLDIAQNTENAARDAFEKQRSTA-DAM
Q1ILD9          EARFS----SE-------------------YEASLNTENKIKGNFDQHQQEALSKS-QN-
Q1IJZ6          VDR---------------------------TELDLELARQSEDALRQAYEKQEQEA-NKI
A0A2V8TCE6      ARRIV----SA-------------------EQAKYRAALDEEERLGKLLEEQKSEA-QRT
A0A522TBE8      A--------GA-------------------ARAQFVAARLQEMLLEQAVAQQKQAM-DQF
Q1ITG0          EERFR----TE-------------------YESAKRTEDQLRASVENRKKEAFSQS-AK-
A0A3N5PCI5      VESVR----QE-------------------YLAALSREKELTAELDAQKSRALALN-RQ-
A0A3M1Q0S9      ARQVR----EA-------------------AKIDYEQARRRAEGLRRLYEETEQRV-SEL
A0A2Z5G448      LKRFE----EE-------------------YNAAVNTEALLKGRLEQVKQEAFRVS-DS-
A0A3M1VZ38      AASAI----DS-------------------AQAAFEQARREEQQLAQLLADATREA-SEA
A0A4Q1SD29      TKRFT----EE-------------------YDASVNTESLMRARLEATKQEAYREN-ES-
A0A3M1PY35      FEEAV----GA-------------------ARADLELARTREARLQALFQQELAAT-DAL
A0A3M1VMP2      YRQAL----ES-------------------ARAELALRRESEARLQRLIEEEQARA-AQL
A0A2V8G155      VDSVK----TD-------------------YLAAVAQERSLTAALEQQKTEALVMN-RK-
A0A2V8HDM7      VDSVK----TD-------------------YLAAVAQERSLTAALEQQKTEALVMN-RK-
A0A2V8DRT9      VHALS----ND-------------------YQAALAQEQSLMHALDQQKNDALALN-RK-
A0A2V7VYF3      VESVH----NE-------------------YLTALAREQDLVAALNAQKNEALGQN-RK-
A0A1F2SVH2      VQAMR----ND-------------------YRQTVAQEQSLMSALEQQKSEALSLN-RK-
A0A2V8AJG9      VQSVK----NE-------------------YQAALIQEQTLTGALDQQKRDALALS-RK-
A0A2N9LQU7      GQRLH----DE-------------------FLAAQNSESLLRDQFEHQRQEAFNLN-AS-
A0A2P6WFK7      GRRME----TE-------------------YQSAAKTEAALRNQFNKQKEEAFKLN-EH-
A0A2V8U914      RQSVQ----ND-------------------YVAAQRRQTGLASVYARQSALVSKMT-AK-
A0A2V7W309      LEEAR----AQ-------------------VSAASSREGSVRSAYEQQRTEAQRLN-VD-
A0A2W0BGU4      AQRIR----ND-------------------YFAAARREQLLGATLAEQKKESGNFN-RL-
A0A2W0BVQ9      AQRIR----NE-------------------YFAAARREQLLGATLAEQKKESGNFN-RL-
A0A2V9MN96      LSKVR----DE-------------------YMAAIQRETLLTSAFDHQKQEANQLN-ES-
A0A2V7V2Z1      IRAAE----ND-------------------YKAYAAQEASVASALEAAKAEALDLS-RR-
A0A2V7X2F7      IRSAE----ND-------------------YKAAAAQEASLAAALESTKEEIQELG-AR-
A0A2V7V2I1      IRAAE----ND-------------------YRAAVAQEHGVADALEMAKREALELS-RR-
A0A2V7U3M2      IRAAE----ND-------------------YKAAAAQEASVSSALEAAKAEALDLS-RR-
A0A2V7UHT0      IRAAE----ND-------------------YKAAAAQEASVSSALEAAKEEALDLS-RR-
A0A2Z5FVL3      RDRAR----NE-------------------YVVAQQVESGAKQLYDAEKQRADEMN-DK-
A0A2V9KBD6      GDRLT----YE-------------------YHSAAERERMLRAALEKQKQVADDLD-AH-
A0A2W0AJ66      RERMT----NE-------------------YRMALERERMLRNALETQKQAADTLN-AN-
A0A1Q7RBU1      GEHIT----YE-------------------YKSAVGRERMLRSALEAQKQAADKLN-AN-
A0A2V9JPV9      GERIT----YE-------------------YKSAVGRERMLRYALEAQKQAADELN-AN-
A0A1I6MH75      LIQTR----EA-------------------YLATKANEQQTSAALEQQKTDAYKLR-DD-
E8WVF6          LTQAK----ET-------------------YLIAKANETQTTAALEAEKQDAYSLR-DA-
A0A1H5Z7N3      LAQAR----QN-------------------YIASRTNEQQTRGALEAEKSTAYQLR-DQ-
A0A2V9YHT3      GGRLQ----SE-------------------YQAATQRETLLQEALNQQKREANRLN-ER-
A0A1G7JVV8      VTEAK----QA-------------------LVAAQANEAQTEGALEDQKNQSYRLR-DD-
A0A1H4T6W9      LTEAK----QA-------------------LVAAKANEDQTSSALEEQKQESYRLR-DD-
I3ZEU5          LTEAK----QA-------------------LVAARANEDQTTSALEQQKQESYRLR-DD-
A0A428MDU2      LLQAK----QN-------------------YVVARTNEDQTSAALEKQKSDAYKLR-DD-
A0A5B9EBI2      LNQAK----QT-------------------YLAAKATEEQTQAALEAQKADAYKLR-DE-
A0A239HDF6      LLQSK----EN-------------------YLIAQANEEKTNAALDAQKADAYKLR-DD-
A0A4Q0T270      LTQAR----EN-------------------FNAAKANEEQTTAALEKQKADAYKMR-DD-
A0A1Q3QQB6      LLQAK----EN-------------------FVVARANEVQTKAALEQQKTDAYKLR-DD-
A0A3N1K1G7      LLQAK----QN-------------------YVIARANEDQTAAVLEAQKTDAYKLR-DD-
A0A4V2G466      VLQAK----EN-------------------FLAARTNQEETAAALEKEKSDAYKLR-DD-
A0A6B9YNQ8      VLQAK----QT-------------------YLAALKDEQDTTAALEAEKNQAYKMR-DD-
                                                                            

A0A2V7VMF7      ---KTEVEVLKKEAQSAASLYDVLLQKLNESD--------------IAASIR-----TNN
A0A2V7YYV7      ---------------------------------------------------------SDV
A0A2V7Z0J5      ---------------------------------------------------------GDT
A0A2V7Z3M4      ---------------------------------------------------------ADD
A0A399Y5V2      ----------KTSDTGSQALVATLTNRREQAAAVQSFWKTALDKLQIQSNLQ-----TSS
Q01X01          ----------RAEGDGNREFYDAMARRANEAS--------------VASTLR-----QSN
A0A3M2D9H8      ---NGTNNQLQAALVLYQQIYANLLSNYEAIR--------------LARLQS-----TPE
A0A2V8JK38      ---IIQYNILKREADSSKDIYNGLLTRLKEAG--------------ISGGLR-----ASN
A0A2V9IXG5      ---MAEMSSFIKSKENWASAFAAVEQKLRDLS--------------LQEGFV-----TSN
A0A2V9J2P4      ---MAEMSSFIKSKENWASAFAAVEQKLRDLS--------------LQEGFV-----TSN
A0A1Q7RLS4      ---ASGYEMVRGEATETKRIYDLISARVKEID--------------LSSSLL-----SNN
A0A2V2R525      ---AVNYRILQQEIQTNQELLNGLWQRYKEND--------------VIL---AGT--PNN
A0A321LPW6      ---AIQYGILKQDVDTAKSLYTEFLQKTNQAN--------------LEL---AQQ--SSA
A0A2V9R9V4      ---AIQYSLLKQDVDTAKSLYTEFLQKTNQAY--------------LEV---AQQ--QSN
A0A321LE75      ---AITFNILRQNVETAKTLYTDFLQKQSQAR--------------VQV---AEQ--HNN
A0A2V8R8U7      ---VIDLAIKTQELTTDAQYLNTLMQKRRELA--------------AGG---ADR--GTD
A0A2V8QMP4      ---DTKLADLDQQIATDRQNLNLYMQRANELK--------------VTAP--DRA--SGN
A0A2V8R4S3      ---DTKLADLDQQIATDRQNLNLYMQRANELK--------------VTAP--DRA--SGN
A0A2V8NJ55      ---ALDIGGLTQELETYRQLFQTLSQKQNEID--------------LAG---NDQ--GNN
A0A2V8Q7I0      ---QIEMAQYKQELETDKQYLNTLMARKRDVQ--------------TSN---TDR--ANE
A0A2V8S6K4      ---VIGLSNVEQQLTTSKQMLSTLLQRRQELE--------------TADI--EGQ--SNN
A0A317I2L9      ---QIDMVSYTQTLETNKQYLNTLQQRLREIQ--------------ASS---GDR--GNE
A0A2V8LLF9      ---QIDMAIITQALTTDQQYLNTLTQRLRELT--------------ATS---GSG-TASE
A0A352FRF4      ---IIELASMRADLASDQQYLNTLFQKRRELN--------------AVS---GET--GTN
A0A2V8MKV0      ---ELELAAMTQKLTSDEQYLNTLNQKERELK--------------ATG---SDK--GTN
A0A2V8PYY8      ---ELELAAMTQNLTSDEQYLNTLNQKERELK--------------ATG---TDK--GTN
A0A1Q7YKQ8      ---QIQLTMIEQEIETNRQYLTTLLQRQRELE--------------NEQ---TGRMQTNN
A0A352F3R7      ---QIDLIALTQGLETDKQYLNTLLQRQRELQ--------------VTS---GDR--SNE
A0A0B6WXT1      ---EIELSRITQELETNKQFYNTLFQRQKELE--------------ITS---NDR--ANN
A0A3B9MEU8      ---QIDLMAITQELETNKQYLNTLLQRERELT--------------VAS---GDR--SNE
A0A2V8MHG6      ---AVNYRIIQQQIETNKSLLDGLLQRSKENE--------------VIL---AGT--PNN
A0A2V8P7N1      ---AVNYRIIQQQIETNKSLLDGLLQRSKENE--------------VIL---AGT--PNN
A0A2V8M3M6      ---AVNYRIIQQQIETNKSLLDGLLQRSKENE--------------VIL---AGT--PNN
A0A1Q7NJH5      ---AVNYRIIQQQVETNKSLLDGLLQRSKENE--------------VIL---AGT--PNN
A0A2V8PJY0      ---AVNYRIIQQQVETNKSLLDGLLQRSKENE--------------VIL---AGT--PNN
A0A1Q7Y6W9      ---AVNYNIIKQGIETNKQLLDGLLQQERTND--------------VVG---EGT--PNN
A0A2V8NC68      ---AVNYRILQQEIDTNKSLLDGLLQRAKEND--------------VVL---AGT--PNN
A0A399WK13      ---AVSLALLKQTIDTNKGFLENLRKQVSSND--------------VAA---QGS--DNN
A0A352FLX4      ---AVSYRIIQQEIETNKTLLDGLLQRTKEND--------------VVM---AGT--PNN
A0A2V8RTL7      ---AVMIKLLEQTIETNRGFLDNLRKQQSGND--------------VAS---QGS--DNN
A0A3E0PCJ6      ---EVTIKLLEQDIETKKGFYANLENQQKGND--------------LAG---AGT--ENN
A0A3M1S4R8      ---AIDIKLLEQNIETNRGFLKNLIEQQSSND--------------VVA---QGT--TNN
A0A1Q7YFI6      ---AVNYRIIQQEVETNKQLLDGLLQTAKGND--------------VVM---SGT--PNN
A0A136KC10      ---AVSLALLKQTIDTNKGFLENLQKQVSSND--------------VAA---QGS--DNN
A0A2V8SEX6      ---AVRLKLLEQTIETNRGFLDNIRKQQSSND--------------VAS---QGS--DNN
A0A3M2D6Y5      ---AIDIRLLEQNLETNRGFLKNLIEQQSSND--------------VIA---RGT--ENN
A0A0B6WWQ6      ---AINYRIIQQEIETNKSLLDNLLQRAKENG--------------MAM---AGV--ANN
A0A3B9MK99      ---AINYRIIQQEIDTNKTLLDSLLQRSKEND--------------VIM---ASK--PNN
A0A352EX26      ---AINYRIIQQEIDTNKTLLDSLLQRSKEND--------------VIM---ASK--PNN
A0A2V8MM59      ---AINYRITQQEIDTNKGLLDSLLQRSKEND--------------VVL---AGR--PNN
A0A2V8PFE8      ---AINYRILQQEIETNKGLLDNLLQRSKEND--------------VVL---AGR--PNN
A0A2V8PWS6      ---AINYRILQQEIETNKGLLDNLLQRSKEND--------------VVL---AGR--PNN
A0A2V8LCT5      ---AINYRILQQQIETNRGLLDNLLQRSKEND--------------VVL---AGR--PNN
A0A352FTJ9      ---AINYRILQQEIETNKGLLDNLLQRSKEND--------------VVL---AGR--PNN
A0A2G6PYV5      ---KIQVLEQNSLVIDKRKEYLELALGLKEIG--------------RTDK----------
A0A2V8F956      -------------VQSSRQIFDSLMQRAKETG--------------VS-A--ELK--TSN
A0A1F2S1W5      ---SIDYSALQRDAAANRQMFEALLKRTQETG--------------VS-E--ELK--TGN
A0A1F2T595      ---GIEYGALERDATANRQMFEALLKRTQETG--------------VT-E--ELR--TGN
A0A2V8JQV5      ---VAHYARLKREADSNRQLYEAMLQKVKEYN--------------IA-S--AVT--ANN
A0A2V9AC41      ---AVQYAMLAREVDMNKQLYDGVLQRLKEIG--------------VA-A--EIR--SSN
A0A2V8K4L4      ---EVHYNILKREVDTNRQLYESMLSKVKESS--------------IA-S--AMR--ASN
A0A2V8NCZ3      ---EIHYNILKREVETNRQLYESMLARVKESS--------------IA-S--AMR--ASN
A0A2V9MAM9      ---MIHYDTLNREVATTRQFYEAMLQKVNDAG--------------VA-T--AIR--PSN
A0A2V9M454      ---LIQHNLLKREFESNQQLYDNLLQHLKDGN--------------VS-A--GLR--ATN
A0A2V9IVR7      ---LIQQNILKHEFETNQQLYEGLLQRLKDAT--------------LS-S----------
A0A2V9ILE2      ---LIQQNILKHEFQTNQQLYEGLLQRLKDAT--------------LS-S--GLR--ATN
A0A2V9LGY4      ---LIQQNILKHEFQTNQQLYEGLLQRLKDAT--------------LS-S--GLR--ATN
A0A2V9J4D6      ---LIQHNILKRDSDTNQQLYDNLLQRLKDAT--------------VT-A--GLR--ATN
A0A2V9L9C5      ---LIQHNILKRDSDTNQQLYDNLLQRLKDAT--------------VT-A--GLR--ATN
A0A2N9M9N1      ---LIKYTILKGDFETNQQLYDELLKRLKDAT--------------VS-V--SLR--ATS
A0A2V9JEC4      ---LIQHNILKGEFETNQQLYNDLLRRLKDAT--------------LS-V--SLR--AAS
A0A2V9LPQ3      ---LIQHNILQREFQTNQQLYDDLLQRLKDAT--------------VS-A--GLR--ATN
A0A348V070      ---AILYNSLKIETDNKKALLEALSKRQSETD--------------LASRLKDLQ--ALN
A0A2Z5G3A3      ---TIEYELTRQEATDSRTLYVSLLGRLKEAG--------------LL-E--GLR--STN
A0A2V7UGP8      ---GVEYSNLKAAVDSKREILNKLMQRETETG--------------SLSQLKNAG--TGN
A0A239MKT6      ---LTALTFLQQEENTSRGLYQDLYTRLQEAS--------------IS-A--GVR--STD
A0A3E0PCN7      ---AINYNIIRQEIATNKTLLDSLLQRARETE--------------VI-L--NGT--PNN
A0A2V8IYW3      ---ESEMAELTRDYETLKKGYESLLAKKEDSN--------------IA-A--NLE--KQQ
G2LEI9          ---GVMQRMMQDNIDNKKKMLQALQATTKDTE--------------IN-L--RMD--LNN
A0A317J121      ---ASQYSGLKREVETLQQTYSAMLLQANESN--------------IN-SSVPLG--MGT
A0A2V7YW66      ---AVGFTNLKVEIQTRRDLLNELMHKQSETE--------------VAVRLQDTR--QSN
A0A2V7Z0V0      ---AVEYTNLKVEIQTRRDLLDELMRKQSETE--------------VAVRLQDTR--QSN
A0A2V8GFD4      ---AIDYGVLQRDAATNRQIFDALLQRSKETG--------------IS-G--ELR--TSN
A0A2V8HSS5      ---AIDYGVLQRDAATNRQIFDALLQRSKETG--------------IS-G--ELR--TSN
A0A2V8KP55      ---IIQYNILKREADSSKDIYNGLLTRLKEAG--------------IS-G--GLR--ASN
A0A399WNU1      ---AINYRIIQQEIDTNKSLLNSLLQKARETE--------------VV-L--NGT--PNN
A0A2V9CG11      ---AIRYRTLKGEVDSSRQLYEAMLERVKQAE--------------LA-T--AMR--ASN
A0A2V2R0I6      ---LVEYNILKREAEANKTLYDGLMNKLKEVG--------------IA-E--SLK--SSN
A0A2V8XAR9      ---LVEYNILKREAEANKALYEGLMTKLKETA--------------IS-L--GLR--SSN
A0A2V8VZA0      ---LVEYNILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLR--SSN
A0A1Q7CB82      ---LVEYNILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLR--SSN
A0A2V8WIU1      ---LVEYNILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLR--SSN
A0A1Q6Y9F5      ---LVEYNILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLR--SSN
A0A2V9EVV8      ---LVEYNILKREAEANKTLYEGLMTKLKETA--------------IS-Q--GLR--SSN
A0A2V8YF91      ---LVEYNILKREAEANKALYEGLTTKMKETA--------------IS-A--GLR--SSN
A0A2V8XZK2      ---LVEYNILKREAEANKALYEGLMTKMKETA--------------IS-A--GLR--SSN
A0A2V8ZTX6      ---MVEYNILKREAEANKALYEGLMTKMKETA--------------IS-G--ALR--SSN
A0A2V9BT79      ---MVEYNILKREAEANKALYEGLMTKMKETA--------------IS-G--ALR--SSN
A0A1Q8B793      ---LVQYNILKREAEANKALYEGLLTKLKEAG--------------IS-A--GLR--SSN
A0A2V9BCA0      ---LVQYNILKREAEANKALYEGLLTKLKEAG--------------IS-A--GLR--SSN
A0A2V9BWU9      ---LVQFNILKREAEANKQLYEGLLQKMKEAS--------------IS-A--GLR--SSN
A0A2V9DKX2      ---LVQFNILKHEAEANKQLYDGLLQKMKEAS--------------IS-A--GLR--SSN
A0A2V9JSI3      ---LIQHNLLKREFETTQQLYENLLQHLKDAT--------------VS-A--GLR--ATN
A0A2V9WI32      ---AIEYNLLKRDAESNRQLYEGLLQKLKEAG--------------VS-A--GLR--SSN
A0A2V8IVN9      ---AIDYGVLDRDVQSSKQIYESLLQRAKETG--------------VS-T--ELK--TSN
A0A1F2TPT3      ---NVELSILTREVASNRQIYDMFMQRARETG--------------VA-K--DIN--PSR
A0A2V8JTQ2      ---AVQSDILKREFETNRKLYEDLLQKQKEVG--------------IS-A--SLK--SSN
A0A2V8UZY0      ---AVQSEILKHEFETNRKLYEDLLQKQKEVG--------------IS-A--SLK--SSN
A0A3N5YNR8      ---SIQYNILQREVDTNRQLYEGLLQRLKETG--------------IS-A--GMR--ASN
A0A350UEK1      ---AIQYNILKREVETNRQLYESMLQRVKEAG--------------LA-S--ALR--ASN
A0A350UIQ4      ---AIQYNILKREVETNRQLYESMLQRVKEAG--------------LA-S--ALK--ASN
A0A3N6A5T6      ---SIQYNILQREVETNKQLYEGLLQRLKEAG--------------VA-A--GLK--SSN
A0A1F2Q9L4      ---AVEYNNLKVEVSTRRTLLDELVRKQSETE--------------VASRLQGTH--DSN
A0A1H5SQF5      ---ADQLLLLEQEETSNRTLYQDLYGKLEAAN--------------IL-A--GAK--SSN
A0A3E0NV31      ---AVQLEILERKTQTNKQLYDGILQRLRETD--------------IV-A--ELQ--KEG
A0A3N5M5V0      ---SIQYNILQREVDTNRQLYEGLLQRLKETG--------------IS-A--GMR--TSN
A0A2V9AEW6      ---AIHYDTLKRDVDSNRRLYETMLQRVKEAS--------------LA-A--AMR--DSN
A0A2V8WQK6      ---VIHYDTLKRDVDSNRRLYEVMLQRVKEAS--------------LA-T--AMR--DSN
A0A2V8XIF4      ---AIHYDTLRRDVDSNRRLYEVMLQRVKEAS--------------LA-T--AMR--DSN
A0A3N5XQP8      ---LVQFNTLKREADTNRQLYEGLLARLKQAG--------------VE-A--GFR--SNN
A0A2Z5G7H4      ---AIEYAIVRQEADDSRGLYEDLLKRLKEAG--------------VL-E--GLR--SSN
A0A2V9L5B5      ---SIQYNILKREVDSNRQLYEGLLQRMKEAQ--------------AS-A--GLR--ASN
A0A2V9LK56      ---TIQYNILKREADSNKDLYNGLLQRMKEAQ--------------VS-A--GLR--ASN
A0A2V9L7I0      ---SIQFNILKREVDTNKQLYEGLLQRMKEAQ--------------VS-S--GLN--ASN
A0A522PPT0      ---TIQYNILKREVDTNRSLYDGVLQRMKEAQ--------------VA-A--GLN--ASN
A0A2V9KCS3      ---TIHYNILRREVDTNRQLYDSMLQRVKEYG--------------IA-S--AMH--ASN
A0A2U3KC61      ---AIEYSVLKRDAEANRQLYQDLLQRFSEAS--------------VS-E--TLK--SSN
A0A2V9Y2R7      ---AIEYSVLKRDAESNRQLYLSLLQKLKEAG--------------VT-A--GLR--SSN
A0A372IT17      ---RIAWTLARQEADESRRLYDQLFGKLKQAG--------------VL-E--GLH--TSS
A0A136JPP4      ---ATTLTTLKRALETNRGLLDTYTQRQKEQE--------------LALA--SGK--PNN
A0A399WUJ8      ---TTTLTTLKRALETNRGLLDTYTQRQKEQE--------------LSLA--AGK--PNN
A0A2V9NGH6      ---AIEYTLLKRDVDTNRTLYEGLLEKLKEAG--------------VT-A--GLR--SNN
A0A2V9PYE6      ---AIDYTLLKRDVDTNRTLYEGLLEKLKEAG--------------VT-A--GLR--SNN
A0A2V9NL07      ---AIEFSLLKRDFETNRTLYEGLLQKLKEAG--------------VT-A--GLR--SNN
A0A2V9QD92      ---AIEFSLLKRDFETNRTLYEGLLQKLKEAG--------------VT-A--GLR--SNN
A0A2V9WPZ6      ---AIEYSLLKRDVETNRQLYEGLLEKLKEAG--------------VT-A--GLH--SSN
A0A2V9ZLH4      ---AIEYSLLKRDVETNRQLYEGLLEKLKEAG--------------VT-A--GLR--SNN
A0A2V9RQF1      ---AIDYSLLKRDVETNRTLYEGLLEKLKEAG--------------VT-A--GLR--SNN
A0A2V9YDK8      ---AIEYSFLKRDVETSRQLYEGLLEKLKEAG--------------VT-A--GLR--SSN
A0A2V9V8F7      ---AIEYSLLKRDVETNRQLYEGLLEKLKEAG--------------VT-A--GLH--SSN
A0A2V9XGR9      ---AIEYSLLKRDVETNRQLYEGLLEKLKEAG--------------VT-A--GLH--SSN
A0A2V9V3Q5      ---AIDYTLLKRDVDSNRQLYEGLLEKLKQAG--------------VT-A--GLK--SNN
A0A2V9NWS3      ---AIEFTLLKRDVETNRALYEGLLEKLKEAG--------------VS-A--GLR--SNN
A0A2V9USA9      ---AIQYNILKRDSESYRQLYEGLLQRMKEAG--------------VS-A--GLK--SNN
A0A2V9XW18      ---AIEYTLLKRDVDTNRQLYEGLLQKLKEAG--------------VS-A--GLK--SNN
A0A4R1LC91      ---SIEYAIARQEADQSRTLYETLLNHLKEAG--------------VL-E--GLR--STN
A0A3M2BZG9      ---ALDYTTAKLELETKQRLFNDLLKKQSEAE--------------VASSFHDAK--ESN
A0A1Q7N5R7      ---AIEEARLRRDATIAENLFTSVQQRYSEAR--------------LA-E--ASS--TAD
A0A3M1SIV3      ---AMSLTDLTQKIETSRSLLNTYVQRQKELE--------------SAIS--SSR--PDN
A0A3E0PHB0      ---ETMLTTARREIENNRGILDRLLQREREME--------------LSIN--TSA--PDN
A0A3M2D491      ---GMRLKTLTQAIDTNRELLNTYIQRQKELE--------------LAIS--SSR--PDN
A0A357F267      ---ETKLTTLKRGIETNRNLLDTYTQRQKEAE--------------LAIA--SGR--PDN
A0A353C9L6      ---QTKLTTLKREIETKRNLLDTYTQRLKEKE--------------LEVE--SGA--PDN
A0A2V8RQV0      ---QTKMITLKREIETNRNLLDTYTQRLKEQE--------------LSRA--NDA--PEN
A0A2V8SJH5      ---QTELITKKRAIETNRNLLDTYTQRQKEQE--------------LAIA--SGR--PEN
A0A2V9QB26      ---SIQYGILKREVDSNRETYQAMLQRVKEAN--------------IA-S--AVR--PSN
A0A2V9VYY4      ---AIEYTVLKRDAETNRQLYQDLLQRLKEAG--------------VS-A--GLR--SSN
A0A2V9KIE8      ---TIQYNILKREADTNKQLYESLLQRLKEAQ--------------VS-E--GLK--ASN
A0A352F549      ---AINYNILKQEIETNKGLLAGLMQRSKEND--------------VT-M--AGT--PNN
A0A3B9MLP9      ---AINYNILKQEIETNKGLLEGLMQRSKEND--------------VT-M--AGT--PNN
A0A3D5SQ87      ---AINYNILKQEIETNKGLLEGLMQRSKEND--------------VT-M--AGT--PNN
A0A2V8NW86      ---SIQYGILKREVDSNRGIYEAMLQRVKEAN--------------IA-S--AVR--ATN
A0A2V8ZHL8      ---LIQHNLLKREFDSNQQLYDSLLQRLKDAT--------------VS-A--GLR--ATN
A0A2V9B240      ---LIQHNLLKREFDTNQQLYDSLLQRLKDAT--------------VS-A--GLR--ATN
A0A2V9CBM2      ---SVQYNILKREVDTNKQVYDGLLQQLKSAG--------------LA-A--SLK--ASN
A0A2V8XN17      ---SVQYNILKREVDTNKQLYEGLLQQLKEAG--------------VS-A--GLK--ASN
A0A2V8WX45      ---SVQYNILKREVDTNKQLYEGLLQRLKEAG--------------VS-A--SLK--ASN
A0A1Q6YR79      ---SVQYNILKREVDTNKQLYEGLLQQLKEAG--------------VS-A--GLK--ASN
A0A1Q7VA32      ---SVQYNILKREVDTNKQLYEGLLQQLKEAG--------------VS-A--GLK--ASN
A0A2V9EY85      ---SVQYNILKREVDTNKQLYEGLLQQLKEAG--------------VS-A--GLK--ASN
A0A2V9H8K0      ---SVQYNILKREADTNKQLYEGLLLQLKEAG--------------VS-A--SLK--ASN
A0A2V9FFE5      ---SVQYNILKREVDTNKQLYEGLLLQLKEAG--------------VS-A--SLK--ASN
A0A2V9GM43      ---SVQYNILKREVDTNKQLYEGLLLQLKEAG--------------VS-A--SLK--ASN
A0A1F2RFI7      ---SIPYNILKREADTNKQLYEGLLQRLKEAS--------------VS-A--GLR--ASN
A0A1F2RZS3      ---SIQYNILKREADTNKQLYDGLLQRLKEAS--------------VS-A--GLR--ASN
A0A1F2USE2      ---SVQYSILQREVETNQQLYEGLLQRLKEAG--------------VS-A--GLK--ASN
A0A2V9C238      ---SVQYNILKREVETNQQLYEGLLQRLKEAG--------------VS-A--GLK--ASN
A0A1F2Q9F5      ---SVQYNILKREVDTNKQLYEGLLQRLKEAG--------------MS-A--GMK--ASH
A0A1F2QQH9      ---SVQYNILKREVDTNKQLYEGLLQRLKEAG--------------MS-A--GMK--ASH
A0A1F2QXK7      ---SVQYNILKREVDTNKQLYEGLLQRLKEAG--------------MS-A--GMK--ASH
A0A2V9DEM9      ---SVQYNILKREVETNQQLYEGLLQRLKEAG--------------VS-A--GLK--ASN
A0A2V9CYQ5      ---SVQYNIRKREVDANKQVYEGLLQQLKSAG--------------LA-A--SLK--ASN
A0A2V9BWU8      ---AVQYNILKREVETNRQLYEGLLQRLKEAG--------------VS-A--SLK--ASN
A0A2V8ZG48      ---AVQYNILKREVDTNRQLYEGLLQRLKEAG--------------VS-A--SLK--ASN
A0A2V8Y334      ---AVQYNILKREVETNKQLYEGLLQRLKEAG--------------VS-A--SLK--ASN
A0A2V9AY68      ---AVQYNILKREVETNKQLYEGLLQRLKEAG--------------VS-A--SLK--ASN
A0A257VBK0      ---LSRGEGLNTSSAAIKKYMDLLYDKMSELN--------------VSSSLMSS-----N
A0A2V7XDY0      ---AAELDAIKKEAESAKGLYDVLLQKLNETD--------------IAASIRSN-----N
A0A350UQT3      ---SFEYQRAKREAEADKNLYDELVRKIREAG--------------INAGFQNN-----M
A0A2U3JZ71      ---SFEYQSLKREAEADKTLYEELVRKIREAS--------------INSGFQNS-----A
A0A2V8TTB0      ---SFEYQTLKREAESDKKLYEELVRKIKEAG--------------INASFQNS-----S
A0A1F2TCR2      ---STDYSMLQRQADGDRKMYDTLLQEQKSLQ--------------VISNSRSN-----N
A0A1F2V330      PQHEIAITELTRGYEATKTRYNALLAKQQEAG--------------LASRPERMN--KTV
A0A662EE63      ---SLEYDRLEETYLQNRRFLDDMLARSNEAD--------------LSATAWMN-----N
A0A2V8TLH7      ---ASNYELMRTEALDTKRIYDLISARVKEID--------------LSASLLSN-----N
A0A1Q7ZJT1      ---ASGYEMVRGEATETKRIYDLISARVKEID--------------LSSSLLSN-----N
A0A2V8VC99      ---ASSYEMVRGEEAETKRIYDLISIRVKEID--------------LSSSLMSN-----N
A0A348UZU3      ---AILYNSLKIELENKKNLLESLLKRQSETG--------------VSARLKGLR--TSN
Q01XL7          ---ASQYAMLKRDAEMAQQVYNGLLQQANQAA--------------LIALVPAS-----N
A0A2V8ERZ5      ---GIGYGVMEREAKSNREVYQSLLTREKELR--------------VSANSRTN-----N
A0A2V8GTX0      ---SIDYSVLQREAESNRQVYESLLQREKELR--------------VVSNSRAN-----N
A0A2V8J0X9      ---SGDYKLLQRKADSDRQVYQSLLSQQKELA--------------VVANSRAN-----N
A0A523DUV7      ---TVQLEMLQREALSNKSLYEAILQKIKETD--------------VASSLREN-----N
A0A372IRG7      ---AAQFEILQHGAESASELYDALQMKLKEAG--------------ITAGLNSN-----N
A0A1F2U158      ---SVSYNVLEREARSNRTVYESLLQRENELR--------------VSSNSRAN-----N
A0A2V8F6S9      ---GVDYNVMQRDAQTNRTIYDTLLARQKELT--------------VSSNSRQN-----N
A0A4Q1SCH5      ---QADYAVLAAEGAASRDLYDTLQYKIQQAS--------------VNAGLDSI-----N
A0A3D1ASD2      ---SFGYEELKREAEADKKLYDELIRKIKEAS--------------INANFQTS-----N
A0A2N9MK30      ---SFEYESLKHEAEADKKLYEELITKIREAE--------------INAGFQSN-----T
A0A4Q7YNP3      ---AAQVSLLRREVESEQQLYQTLLQRAKEAG--------------FASAMQAS-----T
E8UZE1          ---ALHYSILQGQVASGRALYQDLTRKLQEAQ--------------ITSGLSSD-----T
A0A1V6HR88      NSASIEYNNLRLEIDTRRQLLDEMLRKQSETD--------------VSSRLQATR--ESN
A0A3E0P0A3      QSASTALQNLTGDIAAKRETLDRLRRSQSQAN--------------ISASSGNQ-----A
A0A2V8EXP2      ---GIDYSALQRDALSNRQIFESLLQRTKETG--------------ISGELKTS-----N
A0A2W4RYA1      ---AVEYRVLERNAQSARQLYDSLLQRAQETG--------------VSGELRTS-----G
G8P0Y7          ---AIEYKILKQEADSNRQIYDGLLQQLKEAS--------------LAAGLTSS-----N
A0A5M8T4U7      ---VGQYAILRHEAELNRDLYDTLQMRLKEAS--------------VTAGLSAT-----N
A0A3P0X3W6      ---SLEYQQLKRDADANKTLYNELFQKIKEAG--------------INSGFQNS-----S
A0A1E3Y9R6      ---MLDYSALEREAQSNRQLYENLLARAKETG--------------AAGEYRGT-----A
A0A2W4TLP2      ---MLEYAALEREALSNRQLYENLMARAKETG--------------AAADYRGT-----S
A0A3R9WF43      ---TVQLQVLAQEAYSNRALYQNLFSKLQEAS--------------LSSGVRAT-----R
A0A317HKM4      ---AVEYSALEREAASNREVLDKLLQRSTEAR--------------LARELEST-----N
A0A523E0N1      AHAASDYGHIKAELANQRQILKRLLRRRSETA--------------ITAELGEKQ--PVR
A0A523ECP2      SKLTTNYTQIKAGIDNQRSMLRQLLRRQSETG--------------LSAELFERE--PVN
A0A2W0C122      ---AIQYGLLRRESEANRQLYDNLEERMKEAG--------------VAAGLRST-----N
A0A2W0AUU7      ---AIQYGLLKRESEANRQLYDTLEERMKEAG--------------VTAGLRST-----N
A0A2W0BQL1      ---AIQYGLLKRESEANRQLYDTLEERMKEAG--------------VTAGLRST-----N
A0A4Q1SDL1      ---AIDYSILREEATQSRGLYEDLLRKLKEAG--------------VLEGLKAS-----D
A0A3P0XH15      ---SAEYQILRHGADSASDLYDALQTRLKEAG--------------ITAGLNAT-----Q
A0A4R1LAZ7      ---SAEFEILKHGAESASDLYDALQIKLKEAG--------------IMAGLNSN-----N
A0A3M1WQW8      NERAINLSIKQQQVEASAELYRSLLQKMNDVD--------------LLSTLTTT-----N
A0A3N1JHC1      ---QVRFNMLKHEVDVNEQVYQSMLQKAKEAG--------------VIAALRAA-----N
C1F294          ---SAQFEILKHKAQTSSELYDALQLRLEEAG--------------ITAGLNSN-----S
A0A2V9KA79      PTHAGALADMTRDLESTRTQYQSLLDKQQQAT--------------LASKRGKVE--TNV
A0A522PSP1      NRKGVEFQILKHQADTDKLVYDDLLERLDAAD--------------VSAGYHST-----A
G8P085          NRKAAEFAVLYAEGSSSRELYNTLQYKLQQAG--------------VDAGLQSV-----N
A0A4Q1SGQ1      SNRTVAYQLARQEADSSRNVYEGLLAKLKQAG--------------VLEGLRST-----N
Q1ILD9          ---FSEYSRLRREVDTSRDIYDDLLRKLREAG--------------VMASLKAA-----N
Q1IJZ6          NDSQIRLAVLQQEADSTRQLYETLYGRLEVSK--------------LDEGIKST-----N
A0A2V8TCE6      GRDSIEYATLQAEVERKRAVLNALLQRQNETA--------------VSSQLRDMN--AGN
A0A522TBE8      ERRAITYRSLQAAAQNYTKLYYDLLQRIAESK--------------LAAGFHTT-----N
Q1ITG0          ---FSQYDILKNEVASGRSLYEDLLRKLNEAG--------------IAAGLKST-----N
A0A3N5PCI5      ---GIEYGVLLREVESNRQIYQNLLQRSNETA--------------VSKDIQGP-----D
A0A3M1Q0S9      QQAFVEYEARKAEIDRKQATLRELLDRKNQMT--------------LSASLAEDR--ALN
A0A2Z5G448      ---SADFEILKHEAQSTTDLYDALQMKLKEAS--------------VTAGLNSN-----N
A0A3M1VZ38      DRAMIEYEARSLELERKKATLNELIAKENEME--------------QSANLGDT---AHN
A0A4Q1SD29      ---AAQFDILKHGAESASELYDALQMRLKEAG--------------ITAGLSAT-----N
A0A3M1PY35      QRRAQDYDRLYREYEQKRQVLDRLLARREEIG--------------IAKDLRSIL--ERQ
A0A3M1VMP2      QLATGELEALRSLYKQKREALDRLLARREEVA--------------VTRDLQSIL--ERQ
A0A2V8G155      ---AIEYGVLERDAKSSRQIYESLMQRAKETG--------------VSAELK-----TSN
A0A2V8HDM7      ---AIEYGVLERDAKSSRQIYESLMQRAKETG--------------VSAELK-----TSN
A0A2V8DRT9      ---GIEYGALQRDAASNRQIFESLLQRTKETG--------------ISGELK-----VSN
A0A2V7VYF3      ---AIAYGALQRDAASNRQMFEALLQRTKETG--------------LSEELR-----ATN
A0A1F2SVH2      ---GIEYGVLARNAASNRQIFESLMQRTKETG--------------ISGELK-----TSN
A0A2V8AJG9      ---GIDYGALQRDNATNRQVFESLLQRAKETG--------------VSTELK-----TSN
A0A2N9LQU7      ---AVQFATLKHEVESSQELSDTLQLKLKEAG--------------LMAGLA-----SAD
A0A2P6WFK7      ---AVQYLVLKHDVENSRDLYDTLQLKLKMAG--------------VTAGLS-----SGY
A0A2V8U914      ---MTHYNTLKHEVDTNRQFYEAMLQKVNEAG--------------LASAVR-----QSN
A0A2V7W309      ---AAKYFDLRMAVDSKQTLLAALQKQLNETQ--------------VTARLRGSA--SSN
A0A2W0BGU4      ---LIEHDLLKGDFEANQQLYQRLLQRVKDAT--------------VIAGLS-----STN
A0A2W0BVQ9      ---LIEHDLLKGDFEANQQLYQRLLQRVKDAT--------------VIAGLS-----STN
A0A2V9MN96      ---GIEYTALRRDADSNRQLYQSLLQRLKEAS--------------VTAGLR-----SSN
A0A2V7V2Z1      ---SVQYDTAKREAEAGKEVLNSLLSRHKQTD--------------VAQELK-----NSN
A0A2V7X2F7      ---SGHYDSVKREVEASRAVLNSLTERHKETD--------------VAQELK-----ASN
A0A2V7V2I1      ---GVQYDSLKRELDASKEVLNSLMARHKQTD--------------VAQELK-----ASN
A0A2V7U3M2      ---SVQYDNAKREADAGKEVLNSLLSRHKQTD--------------VAQELK-----NSN
A0A2V7UHT0      ---SVQYDNAKREADAGKEVLNSLLSRHKQTD--------------VAQELK-----NSN
A0A2Z5FVL3      ---AVQYSMARQQADQSRSLYEKLQSRMKEAG--------------VLEGFH-----SSN
A0A2V9KBD6      ---AVQSEILKHEFETNRKLYEDLLQKQKELG--------------ITASLK-----SSN
A0A2W0AJ66      ---AIQYNILKRDVDTNRKLYEDLLEKQKELG--------------ISATLK-----LSG
A0A1Q7RBU1      ---AIQNNILKHEFETNRKLYEDLLQKQKEMA--------------ISASLK-----SSN
A0A2V9JPV9      ---AIQYDILKHEFETNRKLYEDLLQKQKEVG--------------ISASLK-----SSN
A0A1I6MH75      ---LVEYTLKAREYETTRTLYDGLVSRLRTAS--------------VQAGLE-----STE
E8WVF6          ---QVEYTLRLREFESNRTLYEGLLQKLRTAG--------------VEAGLE-----SSE
A0A1H5Z7N3      ---MVQYTLRQREYETNRQLYDGLLQRLRSAA--------------VEAGLE-----STE
A0A2V9YHT3      ---AIQYTLLKRDLDTNQQLYDGLLQRLKEAG--------------ISAALK-----SSN
A0A1G7JVV8      ---LVEYTLRQRDYETNRALYEALLAKLRSAS--------------VQAGLD-----ALE
A0A1H4T6W9      ---LVEYTLRQRDYEANRTLYESLLSKLRAAS--------------VQAGLD-----SLE
I3ZEU5          ---LVEYTLRQRDYEANRTLYESLLSKLRAAS--------------IQAGLD-----SLE
A0A428MDU2      ---LVEYTVRQRDFESNRTLYEGLLQRLRTAG--------------VQAGLE-----SLE
A0A5B9EBI2      ---LVEYTLRQREFESGRQLYDSLLQRLRAAG--------------IQAGLE-----SLE
A0A239HDF6      ---LVEYTLRQREFESNRTLYEGLLQRLRTAG--------------IQAGLE-----SLE
A0A4Q0T270      ---LIEYTIKQREFESSRTLYEGLLERLRTAG--------------VQAGLE-----SLE
A0A1Q3QQB6      ---LIEYTLRQREFESNRTLYEGLLQRLRTAG--------------VEAGLE-----SLE
A0A3N1K1G7      ---LVEYTLRQREFESNRTLYEGLLQRLRTAG--------------VQAGLE-----SLE
A0A4V2G466      ---LVEYTIRQREFESSRHLYESLLERLRTAG--------------IEAGLE-----SLE
A0A6B9YNQ8      ---LVEYTIRQREFESDRNLYEGLLQRLRTAG--------------VEAGLE-----SLE
                                                                            

A0A2V7VMF7      A----SVVERASPP--LAPVWPNKRKMAGVGILVGVALGLGLVL-LRDFLS-NT-----V
A0A2V7YYV7      L----VPVSPAVVP--DRPVSPTKALNISIAFGAGLLLAVGLAY-LLERLD-QS-----I
A0A2V7Z0J5      F----VVLSPAVLP--KNPVSPNKALNVAVAFVAGLLLALGLAL-LFDYLD-QS-----I
A0A2V7Z3M4      F----VVLSPAVLP--SKPVSPNKVLNVAIALMAGLLLALGVAF-LLDYLD-QS-----I
A0A399Y5V2      A----ETVAPATLP--TAPVEPKLSRKVIFALTIGILLGAGIAF-LVEYLD-DS-----L
Q01X01          V----RLVDPAQPA--THHHKPNVPLNLLFGLFGGLALATGYVM-LQEQTN-SA-----L
A0A3M2D9H8      V----VQVEEARVP--SRPVRPQTATNVLLGGILGLILAGGIVF-LIEYLD-DS-----I
A0A2V8JK38      I----RVVDQAEVP--KGAVTPNHKLNLAWGIFFGLIFGVGSAV-FQEYID-RS-----I
A0A2V9IXG5      I----KVVEHAGA---GYRVATRGANFVILATLGGMILGMALVV-LGEVIN-PR-----V
A0A2V9J2P4      I----KVVEHAGA---GYRVATRGANFVILATLGGMILGMALVV-LGEVIN-PR-----V
A0A1Q7RLS4      L----RILDKAPVP--KVPVRPRTVLNLAIGMLLGILLGVGAIF-FLDYMD-NT-----V
A0A2V2R525      I----RVADYANTP--ERPIGPQRTRGVGLAFAFSLAFGIGLAL-LRELSN-NT-----V
A0A321LPW6      L----HVIEPAEVP--TFPVDAKRLQGVLIALFVSLCAGLIFAF-LLEYLD-NT-----I
A0A2V9R9V4      I----RIISPARVP--KEPVSPNRQRTILIGLLLSLSGGIGLAW-LLERFD-DS-----I
A0A321LE75      M----RVIEPAQPP--GGPIGPNRMRGILIGLFLSLVAGIGLAF-VLEYFD-NT-----I
A0A2V8R8U7      V----SVSNYSRTP--QL-VGPQRMRNIMIAFVLALVAGIGLAF-LIDYLD-DT-----V
A0A2V8QMP4      V----TMVEEARTP--REPIGPPRVRNIIIALLLSIAVGIGLAF-LLDYLD-DT-----L
A0A2V8R4S3      V----TMVEEARTP--REPIGPPRVRNIIIALLLSIAVGIGLAF-LLDYLD-DT-----L
A0A2V8NJ55      V----TVATPARLP--RGPVGPARSRNIIVAFLLSLGVGIGLAF-LLDYLD-DT-----V
A0A2V8Q7I0      V----SIENYSRIP--RSPIGPARLRNVMIAFVLSLVAGIGLAF-LLDFLD-DT-----V
A0A2V8S6K4      V----IIQTPARTP--QL-VGPPRVRNIIIALLLALGAGIGLAF-LLDYLD-DT-----L
A0A317I2L9      V----SVENYSRVP--KAPIGPARIRNVMIAFLLSLVAGIGLAF-LLDFLD-DT-----V
A0A2V8LLF9      V----SIANYSRLP--HEPVGPARLRTIILALVMSLLVGIGLAF-LLDFLD-DT-----L
A0A352FRF4      V----SVSNPSRLP--RAPVGPARLKTILIALILSLVAGIGLAF-LLDFLD-DT-----I
A0A2V8MKV0      V----SVVSYSRLP--HEPTGPPRTRNILLALALALLAGIGLAF-LLDFLD-DT-----V
A0A2V8PYY8      V----SVVSYSRLP--HEPVGPQRTRNILVALALAFLAGIGLAF-LLDFLD-DT-----V
A0A1Q7YKQ8      V----SVSQYSREP--RAPVGPPRLRNILIAFLLSLGAGIGLAF-LLDYLD-DT-----L
A0A352F3R7      V----NIATYSRLP--KEPIGPQRLRNIFIAFLLSLGAGIGLAF-LLDFLD-DT-----V
A0A0B6WXT1      I----TVATPARVP--REPVGPKRLRNILIALLVALGAGIGLAF-LLDYLD-DT-----L
A0A3B9MEU8      V----SIPTPSRLP--KTPVGPQRLRNIFVALLLSLGAGIGLAF-LLDFLD-DT-----L
A0A2V8MHG6      V----HVVDHAAIP--KTPIGPKRMQAIALAALFALILGIALAR-YLDYMD-DS-----V
A0A2V8P7N1      V----HVVDHAAIP--KNPIGPKRMQAIVLAALFALIVGIALAR-YLDYMD-DS-----V
A0A2V8M3M6      V----HVVDHAAIP--KNPIGPKRMQAIVLAALFALIVGIALAR-YLDYMD-DS-----V
A0A1Q7NJH5      V----HVVDHAAIP--KTPIGPKRMQAIVLAALFALIAGIALAH-YLDYMD-DS-----V
A0A2V8PJY0      V----HVVDHAAIP--KTPIGPKRMQAIVLAALFALIAGIALAH-YLDYMD-DS-----V
A0A1Q7Y6W9      I----HIVDYALVP--DGPVGPNRTRVVMLALVLSFGFGIGFAL-FLDYLD-DT-----V
A0A2V8NC68      I----HVLDYSPQP--KVPVGPHRMQGILLASLFSLVFGVALAR-YLDYLD-DS-----V
A0A399WK13      I----TVTEPAVPS--NIPVSPRRLTTVLGALFLSTLFGVGLAL-FLEYLD-DT-----V
A0A352FLX4      I----RVVDYAIAG--KKPVAPRRVLTVALAFLFSIGCGIGLAF-IIEYLD-DS-----V
A0A2V8RTL7      I----SVASFGIPP--EAPVAPRRLMTVVAALLLSSLFGMGLAL-FLEYLD-DT-----I
A0A3E0PCJ6      I----SVAEIAIPP--ERPVSPRRLTTVAVVMMLSLLFGAGLAL-FLEYLD-DS-----I
A0A3M1S4R8      I----SVVDLAIPP--DTPVSPRRLLTVMMALFLSTCFGVGLAF-FLEYLD-DT-----I
A0A1Q7YFI6      V----HVLDYAPIP--KSPVGPRRMQGVALGFLFSLVIGIALAR-YLDYLD-DT-----L
A0A136KC10      I----SVTEPAVPS--NIPVSPRRLATVLGALFLSTLFGMGLAL-FLEYLD-DT-----V
A0A2V8SEX6      I----SVAGFAIPP--EHAVSPSRLMTVFAALFLSTLFGMGLAL-FLEYLD-DT-----I
A0A3M2D6Y5      I----SVVDPAIPP--DTPVSPRRLLTVMMAFFLSIVFGVGLSL-FLEYLD-DS-----V
A0A0B6WWQ6      I----HIVEYAFPP--NRPIGPARLQAVGLAIVLGLAVGIGLAI-FLDYLD-DS-----L
A0A3B9MK99      I----SIVDYAVTP--DGPIGPNRSSTVSMALFLSLGLGVGLAL-LLEYFD-DT-----L
A0A352EX26      I----SVVDYAITP--AGPVGPNRMRTVALALFLSLGLGVGLAL-FLEYLD-DT-----V
A0A2V8MM59      I----SIVDYAIQP--DGPVGPARMRSVMLALVLSLALGVGLAL-FLEYLD-DS-----V
A0A2V8PFE8      I----SIVDYAITP--DFPVGPARMRSVMLAFVLALALGVGLAL-FLEYLD-DS-----I
A0A2V8PWS6      I----SVVDYAITP--DFPVGPARMRSVMLAFVLALALGVGLAL-FLEYLD-DS-----I
A0A2V8LCT5      I----SVVDYAIVP--DFPVGPGRMRTVMLAFVLSLGLGIALAL-FLEYLD-DT-----V
A0A352FTJ9      I----SVVDYAIVP--DFPVGPARLRTVMLAFLLALGFGAALAL-FLEYLD-DT-----V
A0A2G6PYV5      -----VIVEHARLP--HSPYAPSLKRHLFSGFIIAAGLAGLLIF-LIEITD-RK-----I
A0A2V8F956      I----RVVDRAQTP--TEPVSPQKGLNLLLALFGGSLLACGLVF-FFEHID-SR-----I
A0A1F2S1W5      I----RVVDLAENP--TGPISPNIFNSLLMALLGGLTLAVGLAF-GLEYAD-DR-----I
A0A1F2T595      I----RVVDPAEMP--TGPVSPNIINNLLLALFGGMVLAVGLAF-TLEYAD-DR-----I
A0A2V8JQV5      V----NIVDPARPP--GGAYKPDVYMYAMLGLATGVFLGLMLIV-RQEQAD-RS-----I
A0A2V9AC41      I----YLMGKAEPP--GGPSYPDKNGILLRGLFLGLLMGVGLAF-LFDQLD-NT-----I
A0A2V8K4L4      F----RIVDLAKPA--GAPYKPNLMNNAMLGSMAGIFLGVVLVL-LKEQAD-RS-----I
A0A2V8NCZ3      F----RIVDLAKPA--NLPYKPSPVNNAILGLMAGIFVGVVLVL-LREQAD-RS-----I
A0A2V9MAM9      I----RVVGPAQPA--LQPYKPNFLLNVAIGLFGGLVLAIGCVT-VVNQAEAGR-----S
A0A2V9M454      I----RIIDEATIP--SFPVRPNRPRNIEFALAAGLILGIALAF-TREALD-NS-----I
A0A2V9IVR7      ----------------GAPVRPRKLFNVTIGLLVGLILGVALAF-VQEALD-DS-----I
A0A2V9ILE2      I----HIVDQARVP--GAPVRPRKLFNVTIGLLVGLILGVALAF-VQEALD-DS-----I
A0A2V9LGY4      I----HIVDQARVP--GAPVRPRKLFNVTIGLLVGLILGVALAF-VQEALD-DS-----I
A0A2V9J4D6      I----HVVDKAVPP--ATPVRPKKALNVALGLLAGIILGTAFAF-LEEQLEQKT-----V
A0A2V9L9C5      I----HVVDKAVPP--ATPVRPKKALNVALGLLAGIILGTAFAF-LEEQLEQKT-----V
A0A2N9M9N1      V----RLADAALVP--ATPIRPDKRVDIAVGLLVGLILGVTLAF-IREGLD-RT-----V
A0A2V9JEC4      V----RVADRARVP--AVPVRPDTRRNFPLFAFAGLVIGVTLAF-AQEALN-NS-----I
A0A2V9LPQ3      I----HIVDTASPP--AVPVRPNKLLNLMLGLVAGGLLGLVLAF-AEEGLERRS-----I
A0A348V070      V----WIVDRASPP--VNPSFPNRRKTFIIGVLLALIGGAGTSL-FINYLV-AT-----V
A0A2Z5G3A3      V----SVVDPGRSP--AKPTKPNIPLFLGGGLASGLFLGFCAAL-LFDTTD-TK-----I
A0A2V7UGP8      V----WVVDAAEIP--DRIFRPNKKMNILLSLFVGLALGVGMAF-FLEYLD-NS-----I
A0A239MKT6      M----VIVDPARPP--SLNSSPNASRLLATGTAAGLLLGLLIGI-ALHLRD-RF-----L
A0A3E0PCN7      V----NLVDRAQPP--SAPQGPNRSRAVLMAFVASLIGGIGLAF-VLNWLD-DT-----V
A0A2V8IYW3      VGEQFKVLDPARVP--ERPFSPKRLQLNLTAIGIGLMLGMAVSA-LLEYRD-TS-----L
G2LEI9          I----TVVDRAGTP--GAPISPRVSYTLSVAFFLSLFGGVGLAF-AREYLN-TR-----I
A0A317J121      I----RLVDPSTPP--AKPYKPRPALNIAFGTMAGLFLSVGIAF-LWERMD-KS-----V
A0A2V7YW66      I----RIIDKALVP--GGPFRPSLRQDVTYGLLLGLLAGLGLAV-LIELMD-RT-----V
A0A2V7Z0V0      I----RIIDKATVP--GGPFQPSLRKDGSYGLLLGLLFGVGCAV-LIEVLD-RT-----V
A0A2V8GFD4      V----RVVDAAEEP--PWPAYPRKRTNVTYGLLAAVLLAGMFGF-VIEALD-TC-----L
A0A2V8HSS5      V----RVVDAAEEP--PWPAYPRKRTNVTYGLLAAVLLAGMFGF-VIEALD-TC-----L
A0A2V8KP55      I----RVVDQAEVP--KGAVTPNHKLNLAWGIFFGLIFGVGSAV-FQEYID-RS-----I
A0A399WNU1      V----HVVDRALVP--GAPSGPQRTKNVVIAFFASLFGGIAIAF-GLNWLD-DT-----I
A0A2V9CG11      V----LVIDHAEVP--RLPYKPNLPMNAALGMFGGFFLALGLVL-FRERLD-RR-----I
A0A2V2R0I6      I----RVVDPAMIP--SYPSRPAKARNLALAFLVGLVGGVGLAL-LREYLD-NT-----V
A0A2V8XAR9      I----RIVDPAMIP--STPSRPAKARNITLAFLVGLVGGIGLAL-MREYLD-NT-----V
A0A2V8VZA0      I----RVVDPAMIP--STPARPAKTRNVALAFLVGLVGGMGLAL-MREYLD-NT-----V
A0A1Q7CB82      I----RVVDPAMIP--STPARPAKTRNVALAFLVGLVGGMGLAL-MREYLD-NT-----V
A0A2V8WIU1      I----RVVDPAMIP--STPARPAKTRNVALAFLVGLVGGMGLAL-MREYLD-NT-----V
A0A1Q6Y9F5      I----RVVDPAMIP--STPARPAKTRNIALAFLVGLVGGIGLAL-MREYLD-NT-----V
A0A2V9EVV8      I----RVVDPAMIP--STPARPAKTRNIALAFLVGLVGGIGLAL-MREYLD-NT-----V
A0A2V8YF91      I----RIIDPAMVP--TSPARPAKTKNITLAFLVGLVGGIGLAL-LREYLD-NT-----V
A0A2V8XZK2      I----RIVDPAMVP--TSPARPAKARNIMLAFLVGLIGGIGLAL-MREYLD-NT-----V
A0A2V8ZTX6      T------------------------KNIILSFLVGLVGGIGLAL-LREYLD-NT-----V
A0A2V9BT79      I----RVVDPAMVP--ATPARPAKGKNIMLSFLAGLVGGIGLAL-LREYLD-NT-----V
A0A1Q8B793      I----RVVDPAMIP--SSPARPAKMRNISLAFLVGLVGGIGLAL-LREYMD-NT-----V
A0A2V9BCA0      I----RVVDPAMIP--SSPARPAKMRNISLAFLVGLVGGIGLAL-LREYMD-NT-----V
A0A2V9BWU9      I----RVVDPAMVP--SAPSRPQKTRNILLAFLIGLVGGVGLAL-LREYLD-NT-----V
A0A2V9DKX2      I----RVVDPAMVP--SAPSRPQKTRNILLAFLIGLVGGVGLAL-LREYLD-NT-----V
A0A2V9JSI3      I----HVVDPALPP--AAPIRPKKTQNIAMGLLGGLALGVMLAL-FADVLD-NS-----V
A0A2V9WI32      I----RIVDVARVP--TSPSAPNIPRDIVLGLALGLFGGIGLAF-VLESLD-NT-----V
A0A2V8IVN9      I----RVVDPAERP--RKPSSPQYALNLLLGLLGGTMLGVGLAF-FFEYLD-SH-----I
A0A1F2TPT3      I----RILDAATVP--SSPVGPDKGRSILGAVFAGLGLALVLAF-GFEYLD-NR-----I
A0A2V8JTQ2      I----WIVDPARPP--KLPAEPNILRNLALSLLFGICGGVWLSFGLAKIEE-KT-----I
A0A2V8UZY0      I----WIVDPARPP--KLPVEPDIRRNFALSLLFGIFGGVLLAFGLAKVNE-KT-----I
A0A3N5YNR8      I----HVVDHAEVP--ETPYSPQRAGDLALGLGVGLFLAIGLAF-LMEYLD-NT-----L
A0A350UEK1      V----RVVDEAQPP--ERPYKPSLPLNAVLGLLAGGFLAVGFVV-TTEKAD-RA-----L
A0A350UIQ4      V----RIVDPAKAP--ERPYKPRLPLNALLGLLAGGFLAVAFVV-TTEKAD-RA-----L
A0A3N6A5T6      I----NVVDRGETP--RRVYRPRTAINLALGLILGLMLGVSMAF-FIDYLD-NT-----I
A0A1F2Q9L4      I----VVVDRALVP--GGPYRPSLRRNLGLGLVLGLALGLGFVF-FLEYLD-RS-----V
A0A1H5SQF5      V----TIVNPARVP--SGPSRPQPVQNIALGFLAGLATGLFLAF-ATAYHN-DV-----L
A0A3E0NV31      I----RISIPATRP--NSQYAPNKTRSTLFALGIGLALGIAAAL-GLEFLD-QT-----V
A0A3N5M5V0      I----HIVDHAQVP--TAPYSPQRAADLALGFGVGLLIAVGLAF-LMEYLD-NT-----L
A0A2V9AEW6      V----MVIDRARPP--KLPYRPSLPMNSAIGLLGGMFLGLGFVL-LRERLD-RR-----I
A0A2V8WQK6      V----LVVDRAKPP--LLPYRPSLPVNSAIGLFSGVFLGFGFVL-LRERID-RR-----I
A0A2V8XIF4      V----LVVDRAKPP--LLPYRPSFPMNSAIGLFSGLFLGFGFVI-LRDRLD-RR-----I
A0A3N5XQP8      I----QIVDRARTP--LNTWWPRRTMNLALAFLGGLFLGLGLAV-TLHLLD-NR-----V
A0A2Z5G7H4      I----TVVDPGRIP--STPKQPNIPVYLAIAAGVGLFLGVCGAF-ISDSID-DK-----I
A0A2V9L5B5      I----RVVDAAEAP--KYPAKPRVLLNLVLGLILGLGLGVGMAF-FQEYLD-KT-----L
A0A2V9LK56      I----RIVDAAEVP--RRPVRPRVILNLALGIIFGLGLGVAGVI-LLEYLD-NT-----L
A0A2V9L7I0      V----RIVDAAEIP--KGPAKPRVLLNLILGLVVGLALGVGVAF-LQEHLD-KT-----L
A0A522PPT0      I----MVVDPAQVP--KGPAKPRVILNLAVGFILGLSLGVGLAF-LQEYLD-NT-----L
A0A2V9KCS3      M----RVVDPAKAP--RLPYKPNLLQHAGVGFIAGLLLGTVFVV-IQEQAD-RS-----L
A0A2U3KC61      I----RVVDFARTP--TSPITPNVPRNIELGLLLGLACGIGLAF-VLESLD-TS-----I
A0A2V9Y2R7      I----RVVDVARTP--MFPVKPDVPRNIKLGFILGLCLGVGLAF-VLESCD-NT-----V
A0A372IT17      F----SIVNPARIPPGNHPKSPNLPLYYAAALGAGLFLGCAGAI-TCEFTD-RS-----I
A0A136JPP4      I----KISERAEAP--TYPVGPNRARNIFIALLASLGAGIGLAF-LLDYLD-DS-----I
A0A399WUJ8      I----KISNRAVVP--TSPDGPKRARNIFIALLASLGAGIGLAF-LLDYLD-DS-----V
A0A2V9NGH6      I----RPVDLARVP--IEPAEPDVPRNLSFALVLGLTTGVSLAF-LLEGID-NT-----V
A0A2V9PYE6      I----RPVDLARVP--IEPAEPDVPRNLSFALVLGLTTGVSLAF-LLEGID-NT-----V
A0A2V9NL07      I----RQVDIARTP--AGPAEPNIPRNLGFALALGLTSGIGLAF-LLEGID-NT-----V
A0A2V9QD92      I----RQVDIARTP--AGPAEPNIPRNLGFALAFGLTSGIGLAF-LLEGID-NT-----V
A0A2V9WPZ6      V----KIVNAARVP--MAPSEPNIPRNLAFGLLLGLTSGIGLAF-LLENLD-NT-----V
A0A2V9ZLH4      V----KIVDAARVP--QAPSEPNIPRNLAFALLLGLTSGVGLAF-LLENLD-NT-----V
A0A2V9RQF1      I----RNVDIARAP--RSPAEPNVPRNLSFALALGITTGIGLAF-LLEGID-NT-----V
A0A2V9YDK8      V----KIVNAARVP--MAPSEPNIPRNLAFALVLGLTSGVGLAF-LLENLD-NT-----V
A0A2V9V8F7      V----KIVNAARVP--MAPSEPNIPRNLAFGLLLGLTSGIGLAF-LLENLD-NT-----V
A0A2V9XGR9      V----KIVNAARVP--MAPSEPNIPRNLAFGLLLGLTSGIGLAF-LLENLD-NT-----V
A0A2V9V3Q5      F----RIVDPARSP--NAPVEPNIPRNLLFALVLGVSSGVGLAF-LLEGMD-NT-----V
A0A2V9NWS3      I----RNVDAARVP--SEPVEPNVPRNLAFALALGLSTGIGLAF-LLEGVD-NT-----V
A0A2V9USA9      F----RIVDTARVP--NGPIEPNIPRNLGFALVLGLMSGVGLAF-LLEGLD-NT-----V
A0A2V9XW18      F----RIVDSARPP--TGPIEPNVPRNLLFAAVLGLASGMGLAF-LIEALD-NT-----V
A0A4R1LC91      I----TVVDPGRVP--AKPAKPNVPLVLAGSLLGGLFLGCCGAL-LADVMD-NK-----I
A0A3M2BZG9      V----RVVDYAIVP--SAPFRPVLRKDLTTALLLGLLAGVGLIL-LIEFFD-RT-----I
A0A1Q7N5R7      V----RVLDAAVAP--RRPVKDSASRLIALGFLAGLGFGVVGAV-LVDRLD-RR-----V
A0A3M1SIV3      V----AVSTKASKP--DSPIGPPRNRNILISLIVSLFLGIGLAF-LLDYLD-DS-----V
A0A3E0PHB0      I----KVSGKA--Q--VNRTGPQRTRNILIALFISLAGGIGLTF-LLDYLD-DS-----I
A0A3M2D491      I----SIATEATKP--DAPIGPQRNRNILLAFLASLFVGIGLAF-LFDYLD-DS-----V
A0A357F267      I----KIAARAITP--KSPIGPQRNRNIFVAFMLSLAAGIGLAF-LLDYLD-DS-----V
A0A353C9L6      I----KIAANA-GG--AYPVGPQRSRNILVAFLLSLAAGLGLAF-LLDYLD-DS-----V
A0A2V8RQV0      I----KIAANA-GP--AILVGPPRGRNIFVAFLFSLAAGIGLAF-LMDYLD-DS-----V
A0A2V8SJH5      I----KIAANAVTP--GGPIGPARTRNILVAFLVSFGVGIGLAF-LLDYLD-DS-----V
A0A2V9QB26      V----RIIDAAEPP--EHPYKPNLPMNAAVGLLSGLCIGVAFVV-TRGRAD-RT-----F
A0A2V9VYY4      I----RIVDIARVP--TQPISPNVHRSLVLGFLLALGLGVGLAL-VRETFD-ST-----V
A0A2V9KIE8      I----RIVDQAETP--KLPVKPRVILNLALGFAFGLALGIGLAF-FQEYLD-NT-----V
A0A352F549      I----HVVDYAAIP--KGPVGPRRMQAVTLAMMLATAFGIALAL-FLEYLD-DT-----V
A0A3B9MLP9      I----HVVDYAAVP--KGPIGPRRMEAVFLALVLALVFGVALAL-FLEYLD-DT-----I
A0A3D5SQ87      I----HVVDYAAVP--KGPIGPRRMEAVFLALVLALVFGVALAL-FLEYLD-DT-----I
A0A2V8NW86      V----RIIDAAEPP--KRPYKPSLPVNAAVGLLSGLCIGVAFLV-TRGRAD-RT-----L
A0A2V8ZHL8      I----HVVDPARPP--RVPVRPQKLLNIAIGLVVGLILGVTLAF-VKEALD-TS-----I
A0A2V9B240      I----HVVDLARPP--KVPVRPQKLFNIAVSLVVGLILGVTLAF-VKEALD-SS-----I
A0A2V9CBM2      I----LIVDPAEPP--AKPAKPKILLNLVLASILGLALGVGEAF-LQERLD-DT-----V
A0A2V8XN17      I----RLVDSAEPP--AKPVKPRTLLNLSVALFLGLALGICAAL-FQERMD-DT-----L
A0A2V8WX45      I----RIVDSAEPP--ARPVKPRIALNLMVAAFLGLGLGVCAAF-FQERMD-NT-----L
A0A1Q6YR79      I----RLVDSAEPP--AKPFKPRTLLNLSVAVFLGLALGICAAL-FQERMD-DT-----L
A0A1Q7VA32      I----RLVDSAEPP--AKPFKPRTLLNLSVAVFLGLALGICAAL-FQERMD-DT-----L
A0A2V9EY85      I----RLVDSAEPP--AKPFKPRTLLNLSVAVFLGLALGICAAL-FQERMD-DT-----L
A0A2V9H8K0      I----RLVDSAQPP--AKPVTPRTLLNLAVAMFLGLGLGICTAL-FQERMD-DT-----L
A0A2V9FFE5      I----RLVDSAQPP--AKPVKPKILLNLAVAMFLGLGLGIGTAL-FQERMD-NT-----L
A0A2V9GM43      I----RLVDSAQPP--AKPVKPKILLNLAVAMFLGLGLGIGTAL-FQERMD-NT-----L
A0A1F2RFI7      I----RVVDQAEVP--EMPAKPQKLVNLALALIFGLGLGVGMAF-FQEYLD-NT-----L
A0A1F2RZS3      V----RVVDPAEVP--TLPSKPRKLMNLALALMVGLSLGIGMAF-FQEYLD-NT-----L
A0A1F2USE2      I----RIVDSARPP--EKPAKPKVLLHLAMGFLLGLGLGVGAAF-LQEYLD-NT-----L
A0A2V9C238      I----RIVDAAEPP--KKPARPNLPLNLALAVLLGTGLGV-----VQEHVD-NS-----L
A0A1F2Q9F5      V----RVVDPAQPP--DKPAKPSLALNLLLALVLGLGLGLAAVF-LQEHFD-NS-----L
A0A1F2QQH9      V----RVVDPAQPP--DKPAKPSLALNLLLALVLGLGLGLAAVF-LQEHFD-NS-----L
A0A1F2QXK7      V----RVVDPAQPP--DKPAKPSLALNLLLALVLGLGLGLAAVF-LQEHFD-NS-----L
A0A2V9DEM9      I----RIVDAAEPP--KKPARPNLPLNLVLAVLLGTGLGVGAAF-LQEHVD-NS-----L
A0A2V9CYQ5      I----LIVDPAEPP--TKPAKPKILLNLLVASILGLALGVGEAF-LQEHLD-DT-----V
A0A2V9BWU8      I----RVVDSAEPP--ARPAKPRIPLNLAVAALLGLGLGISTAF-LQERLD-DT-----L
A0A2V8ZG48      I----RIVDSAVPP--AKPAKPKIPLNLAVATLLGLGLGISAAF-LQERLD-DT-----L
A0A2V8Y334      I----RIVDPADPP--AKPAKPRIPLNLAVGVLLGLGLGISTAF-LQERLD-DT-----L
A0A2V9AY68      I----RIVDSAEAP--AKPAKPKIPLNLAVASLLGLGLGISAAF-LQERLD-DT-----L
A0A257VBK0      V----RMVEPAQPP--MAPVKPNKRMNLLMGLLFGLMLSVGSIV-AWQYLD-TS-----V
A0A2V7XDY0      V----SVVERASAP--TSPIRPNKKRIAAVAGFLGLLLGVGLVI-ARDYLD-NT-----I
A0A350UQT3      V----RIADAARPA--WKPVFPKLTLNLLLAFLFSSLLAVGAAI-LVDTLD-NT-----I
A0A2U3JZ71      I----RIADLARPA--FKAVFPNIKLNVLLAFLLSTLLAIGTAI-CADLLN-NA-----V
A0A2V8TTB0      I----RVADPARPG--LKPVFPLTWLNVLLAFLFATFLGVGAAV-LTDVLD-NT-----I
A0A1F2TCR2      V----QLMDRAEVP--AAPFTPNPRKDWFTAIMAGLLVGVGLAF-GIEYLD-DT-----V
A0A1F2V330      AF---RIVEPASLP--KGPSTPRRSRLLLVGLFVGLALGLAVAF-VAEQMD-TT-----F
A0A662EE63      I----RVIEKATPP--SGPFSPNLRRAVALGGVLGLFLGIGLVL-GLDFLD-HT-----L
A0A2V8TLH7      L----RVLDRAPLP--QMPIRPRPILNLLIGVMLGLLLGVGTVF-FLDYMD-NT-----V
A0A1Q7ZJT1      L----RILDKAPVP--KVPVRPRTVLNLAIGMLLGILLGVGAIF-FLDYMD-NT-----V
A0A2V8VC99      L----SILDKAPVP--KVPVRPRTVLNMAIGVLFGLLLGVGTVF-FMDYMD-NT-----V
A0A348UZU3      I----RIVDRADIP--LRPDSPRKFRNLLLALFLGLFGGLGLAL-GMEYLD-NT-----V
Q01XL7          I----RVVDAAVAD--NIPSSPTPMRDIPTWSLFGGALCYGLLW-FREVLR-RKRLTQLF
A0A2V8ERZ5      V----RLVDRAETP--RGPITAGGRRTVLMSLMIGLVLAVAVAL-GLDYMN-DT-----I
A0A2V8GTX0      V----RLLDRSEVP--ESPFTPNTRRAWLMAILFGLGFGIAAAF-AIDYLD-DT-----V
A0A2V8J0X9      V----QVLDRADVP--PFPVSPNPRRDWMTAILAGLSIALGLAF-GMEYLD-DS-----V
A0A523DUV7      V----SIVERASIS--AVPIRPQPTKNLAIALVLGVLSGCGLIL-LRDYLD-NT-----L
A0A372IRG7      I----DVIDTAMIP--PYPVLPQKRQDATFGFLGGLIVGLILAV-FLESMD-DT-----L
A0A1F2U158      V----RVVERAEVP--AGPLTPTGRRTWLLSFAVGLVAAISVAY-GLDYMN-DT-----I
A0A2V8F6S9      V----RVIDHAELP--RGPMAPTGRRTWLLSLAVGLAIAVAVAY-GLDYMN-DT-----I
A0A4Q1SCH5      T----MIVDRARLQ--RFPVEPKKALILASGLILGCVAGIGAAL-LRESMG-GE-----I
A0A3D1ASD2      V----RIADSARPP--LKPVFPRTRLNVLIAFLFSTILAIGAAV-MSDVLD-NT-----L
A0A2N9MK30      V----RIADNARPG--LSPVFPNVPLNVGLALLFAAILAVGAAV-LSDTLD-NT-----I
A0A4Q7YNP3      V----RLVDAAHKP--KMPFSPRRGTSTMAGLLLGSLFGIGFAF-YKDRNS-DI-----L
E8UZE1          I----SVIDPALTP--NIPSEPRRALNMEAGALLGLVVAFAVVF-LIENAN-AT-----I
A0A1V6HR88      V----RIVDRALVP--GGPFRPSLRRNVTFAGGAGLVLGFGLVL-LLHYMD-RT-----L
A0A3E0P0A3      IV---TQTERAVLP--TSPVSPSLRRHLPFGVALGLLCGVALVL-LIDFLD-RS-----I
A0A2V8EXP2      I----RVIDVAETP--RRPASPNVVANLLLALFGGLTLAVGIAF-FFEYLD-NR-----I
A0A2W4RYA1      I----RIVDPAVLP--RTPSSPRKVLNLSLGFVVAVLGALGLAF-FFEYFD-NR-----L
G8P0Y7          T----RVVDRARLP--RYPTKPNIPRNLEFALLVGLVVGIALAF-GLEALD-AT-----V
A0A5M8T4U7      I----SVVDPAQVP--IIPIAPRKTMSMLFGLIGGFVGGLVMAF-IIESID-DR-----M
A0A3P0X3W6      I----RIADEARPQ--NAPVFPKKGIFIFIGFFLSGVIAVAATL-LSDMMD-KS-----V
A0A1E3Y9R6      I----QVLDPATVP--SAPVLPRTPRDLLLAALAGGLLALGLAF-GFEYFD-SR-----I
A0A2W4TLP2      I----QVLDRAEVP--RVPVLPRTQRDLMLAALAGLVLAFGLAF-GVEHFD-SR-----I
A0A3R9WF43      I----DVVNEARPA--GTPSSPDYPKYLTLVAGIGIFLGISSAF-VRESLD-ES-----I
A0A317HKM4      I----RIVDSAEIP--TVPSLPRQTHNLMLAFAGSSSLALVLVF-VLEVFN-TR-----V
A0A523E0N1      V----KFIERAEAP--TVPFAPGSNRRFALLLALGVILGAGTAY-LLDHWD-DA-----I
A0A523ECP2      V----RIVEAALVP--KVPTGPRLSRSLLLGSVVGIALALGLAL-FLDYWE-TS-----I
A0A2W0C122      V----RLIDPAEAT--ELPVSPYLPRSSYLGLFLGFLLSAAVIG-FRESMD-RA-----L
A0A2W0AUU7      I----RLIDPAGAT--GLPVSPNLRRTSCIGLFLGFLLSAAAIG-IREGMD-RA-----L
A0A2W0BQL1      I----RLIDPAGAT--GLPVSPNLRRTSYIGLFLGFLLSAAAIG-IREGMD-RA-----L
A0A4Q1SDL1      I----TVVDPGRVP--AKPKKPNVPLYLLIAAFGGLVLGLAGAL-IAEAMD-RR-----I
A0A3P0XH15      I----DIVDRAVTP--ALPVFPVKRNDAAIGLAAGLVLGLALAL-FAETID-DT-----I
A0A4R1LAZ7      I----DVIDRASIP--ALPISPVKRVDLGVGLAAGLLVGISLSL-LLESLD-DT-----I
A0A3M1WQW8      I----QILDRAQVP--TTPARPRKLFTTGVSGLVGLLLGIVLAL-FVEYLD-NT-----V
A0A3N1JHC1      A----RVVSPAKAS--LIPTSPKLSICIFLAVLLGGVFSLLYIL-ISERRD-NS-----V
C1F294          L----EVVDHANLP--VIPVTPQKKRTVVFGFLGGLIAGIAISL-LLESLD-DT-----L
A0A2V9KA79      LW---RIADPARLP--SAPVTPGRVRILLLGLAAGLCLGLGLAV-LAENLD-TT-----F
A0A522PSP1      L----RIIDPARPN--SAPVYPRTKQTLMLALILSGMLGVLGAV-AADGMD-RT-----L
G8P085          T----MRVDTARAP--LIPVEPKKLVILSFGLVLGLFAGVGSAF-LREALS-DK-----L
A0A4Q1SGQ1      L----TVVAPAQVPPTHRPSSPRMLLVYACALIGGLFLGCTGGW-TAERFD-HS-----V
Q1ILD9          I----DVVDAAPVP--IKPVEPAMKLAMALGLIGGLFMGFAGVV-VAEAVD-QS-----L
Q1IJZ6          V----AVISAGLPP--AKPSHPDPLVNGIVGLGGGLFVGLILAF-VVETLD-DS-----V
A0A2V8TCE6      A----RIVDRAIPP--TAPCKPRPGVELPLGLFVGLLLGMGAAF-GMESWD-NT-----L
A0A522TBE8      A----RVVSPARPD--FRPVAPRPKLTAAVALLLSLLAGVGFVL-ARDALD-QS-----V
Q1ITG0          V----DVIDPSAVP--QLPVLPNVPLFIALGLFGGAFLGVCSAF-VKESID-QT-----I
A0A3N5PCI5      I----QVVDAAEVP--RRPVRPDTRSTLMIGLLLSGILAVAIAF-IREAFD-SR-----L
A0A3M1Q0S9      I----RVIEKATPP--RMIFKPKKKLNVALGFLFGLFLGIGAAF-VMEYVD-NT-----I
A0A2Z5G448      V----NLVDKAEVP--AFAVAPKKRTNYGFGALIGLFIGIAAAL-FLETLD-DT-----I
A0A3M1VZ38      V----QIIDEAVPP--EIIYRPKKKLNILLGFLLGLCLGIGGAV-LAEYID-NT-----I
A0A4Q1SD29      I----DVIDRANIP--PFPVLPAKRSDVMFGLLGGLIVGMALAF-FMEGLD-DT-----V
A0A3M1PY35      V----SVVAPATPP--ERPAVPRYRLDLALSALLGLFLGIGAAF-AAEARD-NK-----V
A0A3M1VMP2      V----HVVDRAKPP--KSPSAPRVKLNLALGLLLGLLLGVGGAF-GAEALD-VK-----L
A0A2V8G155      I----SVIDRAETP--RTPVEPRVQYMLTLGGCGAFLFALCLAF-FFEHFD-NR-----I
A0A2V8HDM7      I----SVIDRAETP--RTPVEPRVQYMLTLGGCGAFLFALCLAF-FFEHFD-NR-----I
A0A2V8DRT9      I----RIVDAAELP--QVPASPDKPLNVLLAILGGSIMAVGLAF-FFEYCD-NR-----I
A0A2V7VYF3      V----RIVDAAEVP--RSPAGPNTRTDFLLAVLVGGVVAVGFVF-GLEYLD-NR-----I
A0A1F2SVH2      I----RVVDAAETP--RGPVRPNTRNNLLLALFGGATLAVGLAF-FFEYLD-NR-----I
A0A2V8AJG9      I----RVVDAAEVP--RRPASPNVPTNLLLAFFGGGTLALGLAF-FFEYLD-NR-----I
A0A2N9LQU7      I----SIVSRGMVA--ARPAFPKKSLMLPLGFLISVFGGLVFVF-VLESFD-DS-----L
A0A2P6WFK7      I----SIIDRAEIP--ATPVEPRIKRNLALGLFGGVIAGLLLAF-GVEALD-DT-----L
A0A2V8U914      I----RLVAPAEPA--FRPYKPNLPLNLSIGLFAGLVLAVGSVM-LTEQTN-SR-----L
A0A2V7W309      V----HWVDHAETP--GSRINLSMKKNLQTAFPLGLFLGFAAIF-FLEYMD-RS-----I
A0A2W0BGU4      I----HIVDPALAP--IIPVRPRTRLNIVLGLLVGMIFGSMLAF-IQDSLD-NS-----L
A0A2W0BVQ9      I----HIVDPALAP--IIPVRPRTRLNIVLGLLVGMIFGSMLAF-IQDSLD-NS-----L
A0A2V9MN96      I----RVIDVARLP--TGPAKPDVRRNIFLGFLLGLAGGVALAF-LQESMD-TT-----V
A0A2V7V2Z1      I----RIVDPASVP--RGPVRPRTTRDILYGVFLGLALGIGLAF-FLDYLD-NT-----I
A0A2V7X2F7      I----RIVDPAVMP--NGPVRPNRQRDILTGALLGLVLAFGAAF-FLEYLD-NT-----L
A0A2V7V2I1      I----RIVDAAAVP--GSPVRPNRPSDIAMGLFLGLALGVMAAF-FLEYLD-NS-----I
A0A2V7U3M2      I----RIVDAASVP--RSPVRPQKTRDIAMGVALGLFLGIGLAF-FLDYLD-NT-----I
A0A2V7UHT0      I----RIVDGASVP--RGPVRPQKTRDIAMGLALGLFLGIGLAF-FLDYLD-NT-----I
A0A2Z5FVL3      I----TVVSPALAP--SAPSRPNIPLYLAGSLATGLLFGCIMAV-VVDLMD-SK-----I
A0A2V9KBD6      I----WIVDPARAP--KLPSEPNLVRNVALSLAFGLFGGMCLAF-GLEKIN-EKT----I
A0A2W0AJ66      L----RVIDPAQPP--KRPSEPNVPRNFGLSVGFGLVGGVLLAF-GLAKMH-EP-----I
A0A1Q7RBU1      I----WIVDPARPP--KLPAEPKILRNLALSLLFGIFGGVLLAF-GLTKMN-EK-----I
A0A2V9JPV9      I----WIVDPARPP--KRPAEPNILRNFALSLLFGIFGGVLLAF-GLTKMN-ET-----I
A0A1I6MH75      I----DVVDLAMIP--ASPRLQPYSSVVLTACIFALLVGIILAF-TLESLD-TG-----L
E8WVF6          I----DIIDQAVPP--SDPQSTPQSTIILTYFAVSLVLGTLLAF-LLESLD-TG-----L
A0A1H5Z7N3      I----EIVDNAVPP--VYPTLKPRSTILMIDLVVALIVGLIVAF-VLDSLD-TG-----L
A0A2V9YHT3      I----RIVDSARPP--VLPSQPDVPRNLLLGLAAGLIAGVVLAF-GAEVMD-ST-----I
A0A1G7JVV8      I----DVVDPAFKP--IGPTMTPRSSILSRDLILSLVFGIMLAF-ALESLD-TG-----I
A0A1H4T6W9      I----DIVDQALKP--AAPSITPRSTILLRTLLISLVAGLMIAF-TMESLD-TG-----I
I3ZEU5          I----DIVDQALKP--AGPSMTPRSTILLRTVLIGLVAGLMIAF-TMESLD-TG-----I
A0A428MDU2      I----DVVDQALPP--ASPMLRPQSTIIMTSFVFGLLGGIVLAF-LMESLD-TG-----L
A0A5B9EBI2      I----DVVDQALIP--AAPTLQSATTIIIVTLLFSLFGGIVIAF-LLESLD-TG-----L
A0A239HDF6      I----DIVDQAVPP--ASPMLRPKSTLVLTTLAVAMILGVLIAF-LLDTLD-TG-----I
A0A4Q0T270      I----DVVDQALLP--AYPTLQPYSSIITTNVLFALIVGIVVAF-VLDSLD-TG-----L
A0A1Q3QQB6      I----DVVDQALPP--AKPTLKRRSTVVLTGMVFGLLGGIIIAF-IVESLD-TG-----L
A0A3N1K1G7      I----DVVDQALPP--ANPVLRPQSTIILTMLFVGLIAGIIIAF-LMESLD-TG-----L
A0A4V2G466      I----DVVDPALLP--ATPTLKPKSTVVLTYLFMGLVAGVMLSF-LLESLD-TG-----L
A0A6B9YNQ8      I----DVVDPALLP--ANPTLKRKTTVVLTYLVLGFIAGVMMAF-LLESLD-TG-----L
                                                  .                         

A0A2V7VMF7      RDPEEIERYLHLDLLSAVPRYEA-------------------------------------
A0A2V7YYV7      KTNEDLTERLGLLPVGHIGYVLAGKGNRGELITL--------------------------
A0A2V7Z0J5      KSDAELTDRVGLISLGHVPFLVAGKGKRGELVTL--------------------------
A0A2V7Z3M4      KSDQELTERLGLVPHGHIAFVPAGKGKRGELVAL--------------------------
A0A399Y5V2      RSKQDAEKAFGAPILGMIPRA---------------------------------------
Q01X01          RSPGDAGAYLTLPELGAIPRAAKRKF----------------------------------
A0A3M2D9H8      RNGETVTKNLDLPVLGYISEMNGKLP----------------------------------
A0A2V8JK38      KSPDDVTRHLGLLALGTVPRLHNLSLWRGYKYKYGYGYGFRFGRKKEQN-----------
A0A2V9IXG5      KTVEEIQTSLSVPALGFLPRTKD-------------------------------------
A0A2V9J2P4      KTVEEIQTSLSVPALGFLPRTKD-------------------------------------
A0A1Q7RLS4      RTSDDVEQYLRLNLLAIVPKEAD-------------------------------------
A0A2V2R525      RTMSDVTRSIRLPTIAVVPTVKSWP-----------------------------------
A0A321LPW6      KTVDDVARFVRLPALGVIPMMTA-------------------------------------
A0A2V9R9V4      RSVDDVNRYTQLPALAVIPVIGA-------------------------------------
A0A321LE75      KSVEDVNRYAQLPALGIIPAITS-------------------------------------
A0A2V8R8U7      KSLDDIDRYIHLPALALIPSVRS-------------------------------------
A0A2V8QMP4      KSIEDVDRHLHLPTLALIPAPRE-------------------------------------
A0A2V8R4S3      KSIEDVDRHLHLPTLALIPAPRE-------------------------------------
A0A2V8NJ55      KSIEDVDRYIHLPALALIPGQRS-------------------------------------
A0A2V8Q7I0      KSVDDIDRYVHLPALALIPASRG-------------------------------------
A0A2V8S6K4      KSIEDVDRHVHLPTLALIPAPRE-------------------------------------
A0A317I2L9      KSIEDIDRYVHLPALALIPASRS-------------------------------------
A0A2V8LLF9      KSVDDVDRYLHLPALALIPTARN-------------------------------------
A0A352FRF4      KSVDDVDRYINLPALALIPAVRN-------------------------------------
A0A2V8MKV0      KSLDDVDRYIHLPTLALIPAARS-------------------------------------
A0A2V8PYY8      KSLDDVDRYIHLPTLALIPAARS-------------------------------------
A0A1Q7YKQ8      KSVEDVDRYLHLPALALIPSTRS-------------------------------------
A0A352F3R7      KTVDDIDRYLHLPALALIPASRE-------------------------------------
A0A0B6WXT1      KSAEDVERYLHLPTLALIPAPRT-------------------------------------
A0A3B9MEU8      KSVDDVDRYLHLPALALIPSNRD-------------------------------------
A0A2V8MHG6      RTSEDVENFLRLPALTVIPTIGNSA-----------------------------------
A0A2V8P7N1      RTSDDVENFLRLPALTVIPTVGNSA-----------------------------------
A0A2V8M3M6      RTSDDVENFLRLPALTVIPTVGNSA-----------------------------------
A0A1Q7NJH5      RTSEDVENFLRLPALTVIPTIGNSA-----------------------------------
A0A2V8PJY0      RTSEDVENFLRLPALTVIPTIGNSA-----------------------------------
A0A1Q7Y6W9      RTADDVEKVLRLPALGVIPSIEGKT-----------------------------------
A0A2V8NC68      RTVEDIERTLRLPSLAVIPAIGSLS-----------------------------------
A0A399WK13      RSTEEVESLLQLPALAAIPTIDSM------------------------------------
A0A352FLX4      RSMEDVENLLRLPAIALIPQVGTVK-----------------------------------
A0A2V8RTL7      NTTEEVENLLQLPALTAIPTIDSI------------------------------------
A0A3E0PCJ6      KTTEEAETYLQLPALAAIPTVEAS------------------------------------
A0A3M1S4R8      KTAEDVENYLGLPVLVVIPSMNAA------------------------------------
A0A1Q7YFI6      HSAAEVDEMLRLPTLAVIPAVGNA------------------------------------
A0A136KC10      HSTEEVESLLHLPALAAIPTIQSM------------------------------------
A0A2V8SEX6      RSTEEIETYLQLPALAAIPTIDSI------------------------------------
A0A3M2D6Y5      KTVEDVETYLGLPALAVIPTIGVS------------------------------------
A0A0B6WWQ6      QSAEEVERELHLPALAAIPTVS--------------------------------------
A0A3B9MK99      RSSEEVERLLQLPALGVIPSANASA-----------------------------------
A0A352EX26      HSTDEVERLLHLPALAVIPSANGMG-----------------------------------
A0A2V8MM59      HSTDDVERLLGLPALAVIPSMSGGST----------------------------------
A0A2V8PFE8      HSTDDVEKFLRLPALAVIPSMSGGVA----------------------------------
A0A2V8PWS6      HSTDDVEKFLRLPALAVIPSMSGGVA----------------------------------
A0A2V8LCT5      HSTEDVEKFLRLPALAVIPAMGAASA----------------------------------
A0A352FTJ9      HSTDDVERFLRLPALAVIPAMSSASA----------------------------------
A0A2G6PYV5      HNTEVLEMVTVLPTLATIPKVSGFNK----------------------------------
A0A2V8F956      KTPDEVTAHLQLPHLGLLPALNEKQF----------------------------------
A0A1F2S1W5      KNPDEMKKHLGLPFLGMVPALFDKGA----------------------------------
A0A1F2T595      KNPDELKKLLGLPFLGMIPALSGNRA----------------------------------
A0A2V8JQV5      HAPAEAPVYLNVPELGVVLSAEADSS---------------LGVPPESSPVRSLRNAIEF
A0A2V9AC41      KSPEEAERFIQLPTLGVVPDFALLTG----------------------------------
A0A2V8K4L4      QQPGDSSLYLGISELGVIPSDRPTML--------------------------------RR
A0A2V8NCZ3      QQPGDSALYLGVSELGVIPSDRQG-----------------------------------R
A0A2V9MAM9      REPGDVEARLNLVELGAIPSARSVVG----------------------------------
A0A2V9M454      KNAQEIEKLTSLPTLSIVPLSHSSVL----------------------------------
A0A2V9IVR7      KSIGQVERYLSTNALAVIPLARTVRS----------------------------------
A0A2V9ILE2      KSIGQVERYLSTNALAVIPLARTVRS----------------------------------
A0A2V9LGY4      KSIGQVERYLSTNALAVIPLARTVRS----------------------------------
A0A2V9J4D6      KTMEDVQRLVGLPSLGLIPLWAPNHN----------------------------------
A0A2V9L9C5      KTMEDVQRLVGLPSLGLIPLWAPNHN----------------------------------
A0A2N9M9N1      KTAEDIENQIAIPTLAVIPLGTRSRG----------------------------------
A0A2V9JEC4      RTPDDLEGSFSIRALTIVP--AVFSS----------------------------------
A0A2V9LPQ3      RTPDDVERLLGIPALAIIPSASLLIR----------------------------------
A0A348V070      KSSRDIAQATGWPTIGTIPAFEKEFKPRGPRAEFRTLSGLLKGRPGILDKKKKKKHDTPR
A0A2Z5G3A3      QDLDELELMLGGVPIGILPAFDRPAT----------------------------------
A0A2V7UGP8      KSTSDVEKYVQLPTLGTIPMVVSSAL----------------------------------
A0A239MKT6      YTIEDFQAAWSAPVIGVVPHFVENGQ----------------------------------
A0A3E0PCN7      RADDNFELHEGVSVLGMVPGADRRLG----------------------------------
A0A2V8IYW3      RTESQLLEALKIPVLAVLPVMESIDEKRRRMLRLAFTFTGGFLLVAARITETGVLMPETA
G2LEI9          KSVEDVDRLLNLPTLGLIPQVSPKEL------------------------SKSSGYYSYG
A0A317J121      RTPGHSRTLLNVPELGVIPSIEPRGS----------------------------------
A0A2V7YW66      KSPEEVERRLGLPPLAVIHDVTEMGKAYGYAGGYGYGYGYGEPGAGDKPRPVRPARSAAE
A0A2V7Z0V0      KAPEEIERKLGLPTLAVIQDLSESGKAYGYS-----AYGYGETAADDKPR-ARPGKAPAG
A0A2V8GFD4      KTPDDIKVQLGLPFLGLVPQLRRREF----------------------------------
A0A2V8HSS5      KTPDDIKVQLGLPFLGLVPQLRRREF----------------------------------
A0A2V8KP55      KSPDDVTRHLGLLALGTVPRLHNLSLWRGYKYKYGYGYGFRFG-----------------
A0A399WNU1      RVPVASQAQLGAPIVGMIPQSNGHRR-------------------------------SNH
A0A2V9CG11      QSPGDAHVYLNISELGVITSAEIKHS----------------------------------
A0A2V2R0I6      KSPDDVENLARLPSLAVVPHFTGSNG---------------------------------N
A0A2V8XAR9      KSPDDVETLARLPSLAVVPQFASSNG---------------------------------S
A0A2V8VZA0      KSPDDVETLSGLPSLAVVPQFAGSNG---------------------------------N
A0A1Q7CB82      KSPDDVETLSGLPSLAVVPQFAGSNG---------------------------------N
A0A2V8WIU1      KSPDDVETLSGLPSLAVVPQFAGSNG---------------------------------N
A0A1Q6Y9F5      KSPDDVETLSRLPSLAVVPQFASSNG---------------------------------R
A0A2V9EVV8      KSPDDVETLSRLPSLAVVPQFASSNG---------------------------------S
A0A2V8YF91      KSPDDIEALARLPSLAVVPQFSGSSG----------------------------------
A0A2V8XZK2      KTPDDIESLARLPSLAVVPQFTGLNG----------------------------------
A0A2V8ZTX6      KTPDDIETLARLPSLAVVPQFAGTNG----------------------------------
A0A2V9BT79      KTPDDIETLARLPSLAVVPQFAGSNG----------------------------------
A0A1Q8B793      KTPDDVEMLARLPSLAVVPAFIDTNG---------------------------------R
A0A2V9BCA0      KTPDDVEMLARLPSLAVVPAFIDTNG---------------------------------R
A0A2V9BWU9      KTPGDIEMLTRLPSLAVVPAFVTLNG---------------------------------R
A0A2V9DKX2      KTPGDIEMLTRLPSLAVVPAFVTLNG---------------------------------R
A0A2V9JSI3      KSVEDIERLTGMPTLAVIPLAASDRA----------------------------------
A0A2V9WI32      RTPEEAQIISALPSLGIIPLSTKQIA--------------------------------RD
A0A2V8IVN9      KTPDEIRAHLGMPALGMLPAVQEKEF----------------------------------
A0A1F2TPT3      KLPEEIGQRLGLPVLGFLPEIKLKSG----------------------------------
A0A2V8JTQ2      NTVEQAQSLSSLPALGVLPLLEAKSQ----------------------------------
A0A2V8UZY0      ITLEQARLLSPLPALGVLPLLKTMSR----------------------------------
A0A3N5YNR8      KTPEDMEQSLGLPSLGVIPAMADLPA----------------------------------
A0A350UEK1      REPSDIPFYLGARELGVVPSAGRVED----------------------------------
A0A350UIQ4      REPSDVPFYLGVRELGVVPSASLLEE----------------------------------
A0A3N6A5T6      KTPDDIEKTLDLPSLGVIPAFKMFET----------------------------------
A0A1F2Q9L4      KTAEDVDRILSLPVLAVIPDVARSRN----------------------GYGYGGSYGYGY
A0A1H5SQF5      STPEEVASLTSLPLLGLVPQAGKRRR----------------------------------
A0A3E0NV31      KSSDHITESIGLPVLGTVPSIGKQEG----------------------------------
A0A3N5M5V0      KTPEDMEQSLGLPSLGVIPAISDLPA----------------------------------
A0A2V9AEW6      SAPGEAQIYLDLPELGVIPLDDTAVS---------------------------RHGANLL
A0A2V8WQK6      SAPGDAQVYLDLPELGVLPLDQAAVS---------------------------WQIPNRL
A0A2V8XIF4      TAPGDAQAYLDLPELGVIPFDQGGLA---------------------------GQIAGRL
A0A3N5XQP8      HSPEDV-LALHIPALGIVPKSQELTN---------------------------GANPLVL
A0A2Z5G7H4      QTIEEIERDLELVPLGILPHLGEPNW----------------------------------
A0A2V9L5B5      KTPDEVERLLRLPSLGVLPRFTPNGA----------------------------------
A0A2V9LK56      KSPSQVESLLRLPSLGVILEFDLFSA----------------------------------
A0A2V9L7I0      KTPDEVERLLHLPSLGVLPRFTLNGN----------------------------------
A0A522PPT0      KTPDEVEFLLRLPSLGLIPSVHLNGS----------------------------------
A0A2V9KCS3      QSPGDGPTYLNLPELGVIPSAKADRG-----------------LNSYFKRLPALKGPKDS
A0A2U3KC61      RNMEELSAISTLPALGTIPLQLSSNG----------------------------------
A0A2V9Y2R7      RNMEQVSAISTLPALGMIPLQVSGNG----------------------------------
A0A372IT17      TSLTEVERLTGAPLFSVIPLLEPSFH----------------------------------
A0A136JPP4      RTSDDISRALGLPTLAMIPHHGINEK----------------------------------
A0A399WUJ8      RTSDDVSRALGLPTLAMIPHHGINEK----------------------------------
A0A2V9NGH6      RTPEQAQAISGLPSLGIIPDGSKLSI----------------------------------
A0A2V9PYE6      RTPEQAQAISGLPSLGIIPDGSKLSI----------------------------------
A0A2V9NL07      RTPEQAQLISGLPSLGMIPLGSRTAA----------------------------------
A0A2V9QD92      RTPEQAQLISGLPSLGMIPLGSRTAA----------------------------------
A0A2V9WPZ6      RTPEQAQIISSLPSLGS-RTGVEGKN----------------------------------
A0A2V9ZLH4      RTPEQAQMISALPALGMIPLGSKRPN----------------------------------
A0A2V9RQF1      RTPEQAEAISGLPSLGMIPLGSKSSS----------------------------------
A0A2V9YDK8      RTPEQAQIISGLPSLGMIPQGSKS-I----------------------------------
A0A2V9V8F7      RTPEQAQLISSLPSLGMIPQGSRTGV----------------------------------
A0A2V9XGR9      RTPEQAQIISSLPSLGMIPQGSRTGV----------------------------------
A0A2V9V3Q5      RTTEQAQMISALPSLGMIPLGSKSRN----------------------------------
A0A2V9NWS3      RTPEQAQAISALPSLGIIPMGSKAPT----------------------------------
A0A2V9USA9      RTTEQAQTISGLAPLGMIPLGSKGIR----------------------------------
A0A2V9XW18      RTTEQAQMIAGVASLGMIPLGSKSAR----------------------------------
A0A4R1LC91      QDVSELEGYIGGLPIGILPKYTQDDR----------------------------------
A0A3M2BZG9      KSPEELEKITGLPTLTVIPDVAERNRSYAARLRYGLGNGYGYGYGYGYGYGYGYGYYGAE
A0A1Q7N5R7      RYPDQVTNGMGLRILGALPHVKNRKAGPDD------------------------------
A0A3M1SIV3      RDVDDITRHLNLPTLALIPEAQEKKK----------------------------------
A0A3E0PHB0      KSSDDIGRSLGLPTLGLIPHQKMMDR----------GKKQK-------------------
A0A3M2D491      RTVDDVTKHLGLPTLAIIPEATASKK----------TKL---------------------
A0A357F267      KESEDIGRHLGLPTLALIPHYFGSEK----------RKHR--------------------
A0A353C9L6      KTSEDIGRHVGLPTLALIPHYFGSEK----------RRLRLL------------------
A0A2V8RQV0      RTSEDIGRHLGLPTLGLIPHHGIAER----------RRL---------------------
A0A2V8SJH5      KTSDDIGRHLGLPTLALIPHHFGSEK----------RRLKLIA-----------------
A0A2V9QB26      RAPGEAQLWLNVPELQVIPTAVEESRRCLYTERCNKTTTLSLS-----------------
A0A2V9VYY4      RSMEEVRAVSTLPALGTIPLQLVTDE-------------RFRK-----------------
A0A2V9KIE8      KSPDEVEELVRLPSLAVLPSFALNDG--------------KGD-----------------
A0A352F549      KDSRDIESGLRLPSLAVIPIAGKSTQ----------------------------------
A0A3B9MLP9      KSPGDIESGLRLPSLAIIPIAGRSAQ----------------------------------
A0A3D5SQ87      KSPGDIESGLRLPSLAIIPIAGRSAQ----------------------------------
A0A2V8NW86      RAPGEAQLWLNVPELQVIPTAVEESGRCLDTERCDKTTTLLPS-----------------
A0A2V8ZHL8      KSIEEAERVVNAPALAVVPLEREIPH---RPAL---------------------------
A0A2V9B240      KSIEEAERVVNAPALAVVPLERELPH---RPAR---------------------------
A0A2V9CBM2      TGADDVERLCGLSVLALIPAVQPSNG---DQHGGVHYKLLEHA-----------------
A0A2V8XN17      KGDDDVERLLGLPSLALIPVVASANG---NHLG--IHRFLPRD-----------------
A0A2V8WX45      KGDDDVERLFGLPSLALIPVVPPSNG---DQHG--IHRFLQQD-----------------
A0A1Q6YR79      KGDDDVERLLGLPSLALIPVVPASNG---DHLG--IHRFLPRD-----------------
A0A1Q7VA32      KGDDDVERLLGLPSLALIPVVPASNG---DHLG--IHRFLPRD-----------------
A0A2V9EY85      KGDDDVERLLGLPSLALIPVVPASNG---DHLG--IHRFLPRD-----------------
A0A2V9H8K0      KGDDDVERLFGLPSLALIPAVPPSNG---DLQG--IHRFLPRD-----------------
A0A2V9FFE5      KGDDDVERLFGLPSLALIPVVPPSDS---DQHG--IHRFLPRD-----------------
A0A2V9GM43      KGDDDVERLFGLPSLALIPVVPPSDS---DQHG--IHRFLPRD-----------------
A0A1F2RFI7      KTPEDVQRFLHLPTLGIIPAASANGR---AGLSYGYGYGYGYG-----------------
A0A1F2RZS3      KTPEDVQRYLRLPTLGVIPAANAASR---KKLA----YGYGYS-----------------
A0A1F2USE2      KTPEDVERFLHIPALALIPSVESLSG---RRGRAYGYGYGLYG-----------------
A0A2V9C238      KTSEDVERFLGLPALALIPAVESLNG---RRKGA----YRLYG-----------------
A0A1F2Q9F5      KTSEDVERFLHLPVLALIPSLESLNG---RRRA--------YG-----------------
A0A1F2QQH9      KTSEDVERFLHLPVLALIPSLESLNG---RRRA--------YG-----------------
A0A1F2QXK7      KTSEDVERFLHLPVLALIPSLESLNG---RRRA--------YG-----------------
A0A2V9DEM9      KTSEDVERFLGLPALALIPAVESLNG---RRRGV----YRLYG-----------------
A0A2V9CYQ5      RGADDVERLFGLSVLGLIPAVQPSNG---DQHSI----HKLVE-----------------
A0A2V9BWU8      KGADDVERLFGLSALALIPSVHCLNG---DRPSV----RKLLD-----------------
A0A2V8ZG48      KGADDVERLFGLPALALIPAVHHLNG---NGPSV----RRLLD-----------------
A0A2V8Y334      KGADDVERLFGLPALALIPSVHHLDG---DRHGV----RKLLD-----------------
A0A2V9AY68      KGADDVERLFGLSALALIPSVHQLGG---NRNGV----RKLLR-----------------
A0A257VBK0      KSVEDLETRMGVALLTMVPKFEPE------------------------------------
A0A2V7XDY0      KDPEEIERYLHIDLLAAVPQYDEA------------------------------------
A0A350UQT3      RDPEQVSRTLKTHIIGTLPSVKNT-----------------------------RELMLPA
A0A2U3JZ71      RDPEQVARTLSTEVIGTLPSVKEW-----------------HGRITAASEPGT-------
A0A2V8TTB0      RDPDQVARLMNTNVVGSLPTVKDW-----------------RRRLSPISSSGSANGHRNG
A0A1F2TCR2      KTPEDITKVLGLPLLGLVPAIRGE------------------------------------
A0A1F2V330      GNIVEFQTFTNLPAIAVLPSMSAD---------LDPGVKPLTGTIPLIPPCGGDLSPTLL
A0A662EE63      RTPDQVERYLGLEVLAALPKLTDD------------------------------------
A0A2V8TLH7      RTSEDVERYLKLNILAVVPRDNDA------------------------------------
A0A1Q7ZJT1      RTSDDVEQYLRLNLLAIVPKEADG------------------------------------
A0A2V8VC99      RTSEDVEQYLRLNLLAIIPKQSDE------------------------------------
A0A348UZU3      KSAEDVERYSGWPTLGVVPIFDQD--------ATLNGHYYAYRSAEDEDGKKKRKEEKGE
Q01XL7          ESPGHTRTILGVPELGVIPSATID-----------------RPKKLAAAQRALNGATSIH
A0A2V8ERZ5      KTPEDVTRRLKLPFLGLVPVVRGD------------------------------------
A0A2V8GTX0      KTPEDVTWRLHLNFLGLVPKVHGE------------------------------------
A0A2V8J0X9      KTPEDITKRLRLPLLGLVPAVRGE------------------------------------
A0A523DUV7      KEQEDIERHLRVDCLAIVPEHDAA------------------------------------
A0A372IRG7      RTSDDAEAVSLLPALAVIPHFQPF-------SKKA--------------INAKDEAADRN
A0A1F2U158      KTPEDVTRMLKMTFLGLIPSVRGD------------------------------------
A0A2V8F6S9      KTPEDVTRRLKLPFLGLVPSVRGD------------------------------------
A0A4Q1SCH5      QSISQVESNVGLANLATVPHMDWE-----------------------------NKAADGT
A0A3D1ASD2      KDPEQIARTLKTQVIGTLPSMKSW-------------------------------RARLG
A0A2N9MK30      RNTEQVARIVKAEVIGGLPQVKSW------------------------------KSRPAL
A0A4Q7YNP3      RVPGEVERYLNLNELGVIPSSRYE--------------------DKAFPASRSDSIITLQ
E8UZE1          RTGEDIYRYSGLPLLSIVPHLSPA-------QRNM----------------------KLG
A0A1V6HR88      KSSEEVERLFGVPVLAVIPDVGAGGKGYGLRGRYGYGYGYGYGYGEKPAKARARKPGKGG
A0A3E0P0A3      KSPEELERRLGLPVLGVVPDLNRR-------GSSR-------------RVYGARAPAKRV
A0A2V8EXP2      KTPDEIKAHLGLPFLGLVPALFAK-------DLH--------------------------
A0A2W4RYA1      RTPEEMQAVLGLTSLAMLPSVPAS-------SLRS-------------------------
G8P0Y7          RTPEQAETTSGLPVLGVIPMQPVF-------DKAG-------------TNAARSRLLNKM
A0A5M8T4U7      QTSEEVESVSTLASLATIPHMEDG-------PLRR------------------KRPELED
A0A3P0X3W6      RDPEQARRSLQVEVLGILPDVLQL-------KPAGRQLLLKSGSDVPAPVAGKQPLDW--
A0A1E3Y9R6      KLPEEIKTHLNLPFLGMIPVFPDA-------GRDG-------------------------
A0A2W4TLP2      KLPEEIKTHLGLPFLGMIPTFPGG-------DESG-------------------------
A0A3R9WF43      RTPLDIEAASHLSILAYIPTKSRA-------ETVT-------------------------
A0A317HKM4      TSVEDVKRHLRIPVLGLMPQVPSK-------NGRV-------------------------
A0A523E0N1      HTVDDVKQHVPLPYLGMIPRYGTD-------SALKSIKSRLAPRSGNSRGPLASGRDAKR
A0A523ECP2      YTIEDLRRHVPLPYMGMVPRLDSD-------TASRWDALAASSMARDTDKHGKNMSQTRS
A0A2W0C122      RDPADVESFTAMPSLAIIPQHRGS-------PRLL-------------------------
A0A2W0AUU7      RDPAEVESFTAMPSLAIIPQHHPS-------PRLL-------------------------
A0A2W0BQL1      RDPAEVESFTAMPSLAIIPQHHPS-------PRLL-------------------------
A0A4Q1SDL1      QTVEQLDRL-GVPLVAILPRYSKE-------KRAL-------------------------
A0A3P0XH15      RTSDDAESVVGLPSLAVIPHFEPA-------QKKG------------VSAAGTAAAEAER
A0A4R1LAZ7      QTSEDAETVSGLTTLAVIPHFRGA-------SKKS-------------------SAERDD
A0A3M1WQW8      KSTEDVDRLLGLPSLGVVPALESL-------ERKK---------RLALPRWSRERRTTKP
A0A3N1JHC1      RNPGESEQYVERPELAVIPRDRLI-------AKKS-------------------KAHPQM
C1F294          RTSEEVESIGHLPALAIVPRFVSG-------AKRK----TAYGSYGAEKR----PKEPVA
A0A2V9KA79      ENAEQFQSFFDFPVLCIIPSMNLH-------NLRRKVRSEEISPRAPARRHTGEQRVSIA
A0A522PSP1      RDPRAVPSELGAGLLGSLPELQND-------IEIK---------SLLTPASVRGNDEV--
G8P085          QSVDQIERALGYQLLAIIPHISIA-------QRTD---------NKGDAP----AFDASQ
A0A4Q1SGQ1      RSLEQLEEEVGSPLLGILPEFSRR-------LKTR---------RRASWREILMRRESVS
Q1ILD9          KTPDDVELITSLPVIGVIPNTAVG-------RSSN---------GRPGRT----AVKQEA
Q1IJZ6          ATTTDAEELTGIAVLGVIPIVNEN-------PRVL---------RAAGRA----KANGSN
A0A2V8TCE6      RTQEEIERFLGTPTLARIPSASLD-------PQRR---------GGPAWG----TGEI--
A0A522TBE8      ASAEQVELLFRVPVLGLLPLLESE-------NELQ---------LAGGGS----EEDR--
Q1ITG0          SSPEDAEEMAGISTIGLIPHFSME-------GLNA---------LATENQ----SVLAR-
A0A3N5PCI5      QTPSAVRAL-GIPFLGMLPYVGKR-------ALKG---------R---------------
A0A3M1Q0S9      KTPDDVRDVLQLPVLGMIPAQEPA-------TRRE---------RRRSAS----RGEQAA
A0A2Z5G448      RTSEDAEAISSLPSLAVVPRFTTA-------AKEA---------RSTYGQ----QAKPIT
A0A3M1VZ38      KSPDDVRDILDLPLLGMVP-APRP-------VKKA---------HGEEPV----RCDP--
A0A4Q1SD29      RTSDDAEQIAHLPTLAVIPRFPIA-------ARKG---------TDPQPQ----KVSP--
A0A3M1PY35      RSVEQLGELGGLPVLGSVPHVEGP-------PRPR---------LVFSRK----RREG--
A0A3M1VMP2      RTASQMREITGLPLLGSIPRASAP-------PRPR---------LVFSRK----GRSR--
A0A2V8G155      KTPEEIQTHLRLASLGLVPAVRLK-----------G------------------------
A0A2V8HDM7      KTPEEIQTHLRLASLGLVPAVRLK-----------G------------------------
A0A2V8DRT9      KSPAEIKAHLGLPFIGMIPKMAVA-----------D------------------------
A0A2V7VYF3      KSPDEITAHLRMPCLGLVPAAPDK-----------Y------------------------
A0A1F2SVH2      KSPDEIKQHLGLPFLGMVPALFDK-----------A------------------------
A0A2V8AJG9      KTPDEVKAHLGLPFLGMVPALFGD-----------D------------------------
A0A2N9LQU7      RTSEEVEAASSIPALATIPLITRR-----------S-----------LRKDMRGRNH---
A0A2P6WFK7      SNSEELETCLALPVLCTIP--THQ-----------Q-----------QPPATSNSRE---
A0A2V8U914      RAPGEASFYLNLPELGTIPSAESL-----------E-----------PALQKLIGTE---
A0A2V7W309      KTPEELERVTKFASLGVIPAAGTI-----------SRQYGYNYSYGRASGPQLRAVDAPP
A0A2W0BGU4      KSPEEVEMLIATRALALIPMKRLT-----------R-----------AERLLATNRS--I
A0A2W0BVQ9      KSPEEVEMLIATRALALIPMKRLT-----------R-----------AERLLATNRS--I
A0A2V9MN96      GSLEELSAITALPMLGVIPLQLAE-----------N-----------GRRHLHPAGG--S
A0A2V7V2Z1      KTPEDVRKQLAAPLLAVIPEIAN------------P-----------AE-VIIKSG----
A0A2V7X2F7      KTPDDVRNHLGAPLLGVVPETGQS-----------P-----------ADLLIQKGGS---
A0A2V7V2I1      KTPEEVRLHLGVPLLGVIPEHGQD-----------S-----------GSPVLSNSH----
A0A2V7U3M2      KTPEDVRKQLGAPLLAVIPEISV------------P-----------GDIVIIQGG----
A0A2V7UHT0      KTPEDVRKQLGAPLLAVIPEIGS------------P-----------TD-VVIKSG----
A0A2Z5FVL3      ADIHGLESLMGEAPFGILPSFAAK-----------K-----------KGLRLSGHSF---
A0A2V9KBD6      RTVEQVQLLSPLPVLGALPLLEAN-----------S-----------KNGAPANLPA---
A0A2W0AJ66      STLEQAQILSPLPALGVVPLLEG------------S-----------ANQSLVEGNV---
A0A1Q7RBU1      STLEQALALSPLPSLGVVPLLEAK-----------S-----------KSRARAQLNG---
A0A2V9JPV9      STLEQAIALSPLPSLGVVPLLEAK-----------G-----------KSRAPAQLNG---
A0A1I6MH75      RSIAEIESVIELPSLAIIPKARRT-----------A-----------AEQVGSLTTA---
E8WVF6          RSVAEIEAITELPSLSIIPRARRA-----------T-----------PEQLAAMSTV---
A0A1H5Z7N3      RDVMEIERITGLPSLAVIPKTRRT-----------S-----------AEQNATGLVA---
A0A2V9YHT3      RTPEQVQIVSALPSLGIVPMSISL-----------S-----------SQAQGRNGKGIVL
A0A1G7JVV8      RSVSEVEHITQLPSLSIIPRVRRM-----------Q-----------SDGSGSATVA---
A0A1H4T6W9      RSVAEVEQITQLPSLSVIPRVRRL-----------S-----------SD-TGTMSVA---
I3ZEU5          RSVAEVEQITQLPSLAVIPKVRRL-----------S-----------SD-TGSMSVA---
A0A428MDU2      RSVAEIESITELPSLAVIPRSRRA-----------G-----------VSEAAM-STA---
A0A5B9EBI2      RTIAEVEGITELPALAIIPRSRRT-----------V-----------SELPAGMSVT---
A0A239HDF6      RSVTELEAITEMPSLAVIPRLRKP-----------A-----------GAAVPDTSP----
A0A4Q0T270      RSIAEIESVIELPSLAVIPKARRT-----------A-----------ADQAANLSVA---
A0A1Q3QQB6      SSVAEIESLIELPSLAVIPKARRL-----------S-----------VEQSSTLTPT---
A0A3N1K1G7      RSIAEIESITELPSLAIIPRARRS-----------S-----------AEQAGNLTTA---
A0A4V2G466      RSVAEVESIIELPSLAIIPRFRRS-----------T-----------AEVPGQ-STT---
A0A6B9YNQ8      QSVADVEAFLELPSLAIIPRFKRS-----------A-----------EAAGQG-GTA---
                                                                            

A0A2V7VMF7      ------------------------------------------------------------
A0A2V7YYV7      ------------------------------------------------------------
A0A2V7Z0J5      ------------------------------------------------------------
A0A2V7Z3M4      ------------------------------------------------------------
A0A399Y5V2      -------------------------QSWNDRRSAMLLSVK--------------------
Q01X01          -------------------AVLGFLSESNGKSQVERASLE--------------------
A0A3M2D9H8      -------------------REDYPPHVVA-------------------------------
A0A2V8JK38      -------------------EPANAEKSDNRSIELAPHD----------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      ------------------------------------------------------------
A0A2V2R525      --ASKLLPS----------RKLFLQPRNG---NKNGRPLIMY-D----------------
A0A321LPW6      --GKRGLGPKRRA------YALAAAGPAARALLASQ--AEIVEC----------------
A0A2V9R9V4      --NKSLLNGRRRKDNTPELLALGSGDKASAIMQRA----RLMEF----------------
A0A321LE75      --SRPKLLTAKGQGA----LGANGSAPAAAGLQRAA--STLATL----------------
A0A2V8R8U7      --EKRLRGA----------EPL----KPS---DTTA--LAMV-T----------------
A0A2V8QMP4      --SRRLLAR----------SGHEA--EPA---TTTA--LALI-E----------------
A0A2V8R4S3      --SRRLLAR----------GSHEP--EAG---TTTA--LALI-E----------------
A0A2V8NJ55      --ERSLLKS----------KNPPPN-TGK---ESTA--LALI-E----------------
A0A2V8Q7I0      --DRGRLKG----------VVPATAGGPS---ETTA--LAMI-D----------------
A0A2V8S6K4      --ARRLAFG----------RTAHVH-DHT---ESTA--LALI-E----------------
A0A317I2L9      --IGGRLKG----------MTSANV-GPS---ESTA--LAMV-D----------------
A0A2V8LLF9      --EKTKL------------IAGDAA-APA---ATTA--LTMV-N----------------
A0A352FRF4      --DRTRLRG----------GEAALA-GPN---DTTA--LAMV-K----------------
A0A2V8MKV0      --EKRL-------------REGEAP-TAG---ASTA--LAMV-E----------------
A0A2V8PYY8      --EKRL-------------REGDAP-AAG---ASTA--LAMV-E----------------
A0A1Q7YKQ8      --EQRL-RL----------KGGAQA-EHG---ESTA--LALV-A----------------
A0A352F3R7      --RGRLIG-----------TGPSPE-GPS---DTTA--LALV-H----------------
A0A0B6WXT1      --ERLLLKG----------KASEPE-GVA---EKTA--LALI-S----------------
A0A3B9MEU8      --RGRLIGI----------SGGPPS-APS---DTTA--LAMI-T----------------
A0A2V8MHG6      --RRRLLSA----------MPGSKRNGHQ---GGPE--LLLY-G----------------
A0A2V8P7N1      --RRRLLSA----------MPGSKRNGHQ---GGPE--LLLN-G----------------
A0A2V8M3M6      --RRRLLSA----------MPGSKRNGHQ---GGPE--LLLN-G----------------
A0A1Q7NJH5      --RRRLLSA----------MPGSKRNGHQ---VGPE--LLLN-S----------------
A0A2V8PJY0      --RRRLLSA----------MPGSKRNGHQ---VGPE--LLLN-S----------------
A0A1Q7Y6W9      --RRKLLPS----------VGSLQIRNGKGGINQPE--LIFS-T----------------
A0A2V8NC68      --KRRLLRN----------VSALQKRNGN---HPAE--LLLSHT----------------
A0A399WK13      --PKRRLQL----------VAENGEPADD-N-LGSE--LLIH-A----------------
A0A352FLX4      --PKRNLAA----------SGKKGALVSSNG-SGSGEVLLTN-I----------------
A0A2V8RTL7      --PKRKLLL----------VGGKGEEVEEDR-LNSE--LLIF-A----------------
A0A3E0PCJ6      --SKRRLLL----------VGVNESE-EP-E-PGNA--LLIS-N----------------
A0A3M1S4R8      --QKRRLLL----------VGSSDNE-PAFK-NRSE--LLIY-D----------------
A0A1Q7YFI6      --SRRFLPK----------MTALQKSD---N-GDHG--SLLE-P----------------
A0A136KC10      --PKRRLQL----------VGEGGETPED-R-PGSE--LLIH-A----------------
A0A2V8SEX6      --PKRRLLL----------VGASNEEVEDPG-NNSE--LLIS-A----------------
A0A3M2D6Y5      --QRRKLLP----------VGTGEENGSQGK-AGSE--ILIY-N----------------
A0A0B6WWQ6      --SRRSLSK----------AVALQT---DGT-AHPE--LLVG-D----------------
A0A3B9MK99      --RRRLIGA----------SGALQKRNGH-S-DSPE--LLMN-V----------------
A0A352EX26      --RRKLLGG----------PGALQKRNGH-S-GNHE--LLMN-V----------------
A0A2V8MM59      --RRRLLSP----------GTSLQKRNGNGT-GSPE--LLLH-V----------------
A0A2V8PFE8      -RRRRLLSS----------ATALQKRNGNTS-GTPE--LLLN-V----------------
A0A2V8PWS6      --RRRLLSS----------ATALQKRNGNPG-GNPE--LLLN-V----------------
A0A2V8LCT5      --PRRLLSS----------ATALQKRNGNNG-GNPE--LLLN-I----------------
A0A352FTJ9      --PRRLLSS----------AASLQKRNGSNG-SNPE--LLLN-I----------------
A0A2G6PYV5      -GKITKNKV----------KQKAMATKLRQEIGLLTHL----------------------
A0A2V8F956      ------------------------------ANTYPLISK---------------------
A0A1F2S1W5      ------------------------------HTPLIGR-----------------------
A0A1F2T595      ------------------------------SPPLISE-----------------------
A0A2V8JQV5      GKRIAGSDR----------STPYGKDRPKPKIELMAWE----------------------
A0A2V9AC41      --TRTGYVS----------KLVNSAKAELPAPTRDEDRPSVLDH----------------
A0A2V8K4L4      GQRPSALIP----------SVSGNNSNAGNPVELVTWQ----------------------
A0A2V8NCZ3      GQGTAAVIP----------IGNGNTK---NPVELVTWQ----------------------
A0A2V9MAM9      -------AS----------PGRSLRSDSHNATELTGWE----------------------
A0A2V9M454      RRPGLFHSK----------AANGANGDGGYAVELAVLK----------------------
A0A2V9IVR7      R----SLDR----------GGNGSADRRE-AVELTLLK----------------------
A0A2V9ILE2      R----SLDR----------GGNGSADRRE-AVELTLLK----------------------
A0A2V9LGY4      R----SLDR----------GGNGSADRRE-AVELTLLK----------------------
A0A2V9J4D6      GRQYGLRRK----------KNSELPASNG-QTGLAALE----------------------
A0A2V9L9C5      GRQYGLRRK----------KNSELPASNG-QTGLAALE----------------------
A0A2N9M9N1      RYG--RYFA----------RGALKPPGNG-SPGLAIMN----------------------
A0A2V9JEC4      RLPYSRLPR----------LRSKHPLPPS-RIELAVLE----------------------
A0A2V9LPQ3      RYGSSKRGG----------AQGEAQKRSE-SVAVMMLT----------------------
A0A348V070      PKSVSLKTE----------EGAPENDKNN-HQIELIIQR---------------------
A0A2Z5G3A3      -----FLRL----------TSSSGLDRID-AVDPVTRNVIALQ-----------------
A0A2V7UGP8      -------------------AGESAGGRRL-RREPVSPAVDLVTLR---------------
A0A239MKT6      -------SK----------NVPASPDKQE-DAAWLIR-----------------------
A0A3E0PCN7      --------N----------GFVGSLIRKT-QTKLVGENFYSLDR----------------
A0A2V8IYW3      EIGVFVPLK----------NPIGVSEELF-DPALTGKVAAP-------------------
G2LEI9          GETRALAKL----------ADGRPLPADF-NVGLSAFA----------------------
A0A317J121      --RPAWRLL----------LGRESRNAGE-MVGSEVSLDTRVGFWDSA------------
A0A2V7YW66      KRGDRKERK----------ERKRAAAAAG-APQIELVPHE--------------------
A0A2V7Z0V0      GW-----RE----------KKKAPAAALP-PSQIELVPHE--------------------
A0A2V8GFD4      ----------------------------A-KPSPMINH----------------------
A0A2V8HSS5      ----------------------------A-KPSPMINH----------------------
A0A2V8KP55      --RKKEQNE----------PANAEKSDNR-SIELAPHD----------------------
A0A399WNU1      FLAKFNRHR----------NGDGDPDPAE-SRSAYADS----------------------
A0A2V9CG11      --RQIANHK----------QANPALAMEA-GSSELVLESHLDDRPELAAWN---------
A0A2V2R0I6      GKRRALLQ------------TVAANGHEK-RIELVAQH----------------------
A0A2V8XAR9      SKRQGLLQ------------GFAANGQDK-RIELVAQH----------------------
A0A2V8VZA0      GKRHGLLQ------------GLSSNGHDK-RIELVAQH----------------------
A0A1Q7CB82      GKRHGLLQ------------GLSSNGHDK-RIELVAQH----------------------
A0A2V8WIU1      GKRHGLLQ------------GLSSNGHDK-RIELVAQH----------------------
A0A1Q6Y9F5      SKRHGFFQ------------GLSSNGHDA-RIELVAQH----------------------
A0A2V9EVV8      SKRHGFFQ------------GLSSNGHDA-RIELVAQH----------------------
A0A2V8YF91      GNRRGFLP------------SFSGNGHEK-RMELVAQH----------------------
A0A2V8XZK2      SKGRGVLP------------GLSSNGHER-RIELVAQH----------------------
A0A2V8ZTX6      SKRRSMLQ------------GFSENGHNK-RIELVAQH----------------------
A0A2V9BT79      HKRRGMLP------------DFSQNGHDK-RIELVAQH----------------------
A0A1Q8B793      NGRRRFLRG----------LAAATNGREA-RVELVSHH----------------------
A0A2V9BCA0      NGRRRFLRG----------LAAATNGREA-RVELVSHH----------------------
A0A2V9BWU9      NRVPKMLK------------SGSGNGTES-RVELVSHT----------------------
A0A2V9DKX2      NRVPKMLK------------SGSGNGTES-RVELVSHT----------------------
A0A2V9JSI3      --RRAWRKG----------AGEKAASSTT-PVGLAVLK----------------------
A0A2V9WI32      RKNGHPRLS----------LGSRSSESAD-SLQLITFA----------------------
A0A2V8IVN9      ----------------------GGSYPMV-GA----------------------------
A0A1F2TPT3      --VTGPLAT----------N----------------------------------------
A0A2V8JTQ2      --NGAHREL----------AGGSGHVDHA-LVSLL-------------------------
A0A2V8UZY0      --NGAARQL----------TGVGGDVKPE-LVSLL-------------------------
A0A3N5YNR8      --GSSRLLA----------SRNESGDSKT-GLPAPIS-----------------------
A0A350UEK1      --GKKHRLL----------TGRSKKADAE-TQSLTLATNGLSEKLELVTLQ---------
A0A350UIQ4      --KKGRKLL-----------------GEE-SQSLVLTNVGLGEKLELVTVQ---------
A0A3N6A5T6      --PVGTRLL----------TAASTQSTDA-SVDAVLQGSQ--------------------
A0A1F2Q9L4      GQRRGKGQP----------GRPTLAGQRP-GGDSGAGQIELVSHF---------------
A0A1H5SQF5      -----WAYA----------YPYAPTKKAD-AAAESEGKFAWVLK----------------
A0A3E0NV31      --NWLAAKL----------KLPRRKPSRT-PPKLLEPKGD--------------------
A0A3N5M5V0      --GGSRLLA----------EKSTSGADKT-ELPARIA-----------------------
A0A2V9AEW6      NMRRLTPSV----------PSGVESDSS--DKSPELATWK--------------------
A0A2V8WQK6      PPHRAASSR----------PPESALRSSL-GDCPELATWK--------------------
A0A2V8XIF4      HSHRPTRTL----------TSDTAPDSS--ANWPELATWK--------------------
A0A3N5XQP8      ALPEQVQAD----------HRSASDQDRM-GSALARSA----------------------
A0A2Z5G7H4      ------YRR----------PGGPSLSRAR-SPSSGVNSLAIFA-----------------
A0A2V9L5B5      --GE--VRQ----------DSLEAVEPGV-ATALAPAI----------------------
A0A2V9LK56      --RK--SGE----------ARLTKGSEAG-GKS-DIVI----------------------
A0A2V9L7I0      --GKVPEEE----------DSLAAVPEVE-MAV-APAI----------------------
A0A522PPT0      --SK--SLE----------HGITAIGKGS-NGLYGLAL----------------------
A0A2V9KCS3      EQTLGSALV----------KKNGRRNGNG-NHEIELVTWY--------------------
A0A2U3KC61      --YLRKRLK----------TVSAETEKPE-SPALVAYA----------------------
A0A2V9Y2R7      --NLRKRLK----------TVPAADGELQ-SPTLVTYA----------------------
A0A372IT17      ----LPRLL----------RGGGSSGVTA-AASWELQGTGS-------------------
A0A136JPP4      --KRRSRRG----------LGSETNAKA--ASNTALITLE--------------------
A0A399WUJ8      --KRLSLRG----------IAGESNGKST-AASTALITLE--------------------
A0A2V9NGH6      ---------------------ESSARRRL-SLTSSREAIELVTQS---------------
A0A2V9PYE6      ---------------------ESSARRRL-SLTSSREAIELVTQS---------------
A0A2V9NL07      ---------------------EANP-TGL-SVAASKEAVELITIS---------------
A0A2V9QD92      ---------------------EANP-TGL-SVAASKEAVELITIS---------------
A0A2V9WPZ6      ---------------------EN----RL-IVASSKESVELVTKS---------------
A0A2V9ZLH4      ---------------------EDGS-RRL-AVAASKESVELVTQS---------------
A0A2V9RQF1      ---------------------DSKS-KRL-SLASSREVVELVTQS---------------
A0A2V9YDK8      ---------------------EASNQKRL-TVASSKEAVELVTQA---------------
A0A2V9V8F7      ---------------------EGKNENRL-IVASSKESVELVTKS---------------
A0A2V9XGR9      ---------------------EGKNENRL-IVASSKESVELVTKS---------------
A0A2V9V3Q5      ---------------------NGTGIGRL-TLTSSREVVELVTQV---------------
A0A2V9NWS3      ---------------------ESNGRQRL-SLASSKEPVELVTQS---------------
A0A2V9USA9      ---------------------EGSTGKRL-ALAASNEAVELITQV---------------
A0A2V9XW18      ---------------------EGPNPKRL-VIASSKEAVELVTQV---------------
A0A4R1LC91      --KQLPSSL----------SKGLTGPGSN-FMALQ-------------------------
A0A3M2BZG9      GRKRRKLKG----------ASSDEPEPDR-QIELLPHR----------------------
A0A1Q7N5R7      ------------------------------------------------------------
A0A3M1SIV3      -------VK----------SLGSEINGNT-SAALITLR----------------------
A0A3E0PHB0      -------LL----------TGGSNGRGP--STEFVALE----------------------
A0A3M2D491      -------LP----------AGEKEQSS---SVALVTLS----------------------
A0A357F267      -------LA----------AANGSEAVA--STALVTLD----------------------
A0A353C9L6      -------AA----------NGNGNGGAP--STGLVTLE----------------------
A0A2V8RQV0      -------MA----------AGNGAALSPH-AAALITLE----------------------
A0A2V8SJH5      --ANGNGLA----------NGNGNGNSAT-ATGLITLA----------------------
A0A2V9QB26      --RQQRDSG----------LPKRTSKQVD-SPSVELVTWY--------------------
A0A2V9VYY4      --RRLTISP----------DGERSGMLAL-VT---------------YE-----------
A0A2V9KIE8      --ASKQLAK----------AAPGDRVVAP-AI----------------------------
A0A352F549      --RFFPISR----------ALQRTNGNGA-SP------ELLING----------------
A0A3B9MLP9      --RLLPITR----------ALQRTNGNGS-GP------ELLINS----------------
A0A3D5SQ87      --RLLPITR----------ALQRTNGNGS-GP------ELLINS----------------
A0A2V8NW86      --RQQRDPG----------LPKRTSEHAD-SLSVELVTWYRKASLIAESYRSLLTSILFS
A0A2V8ZHL8      ------SRA----------RNNGNSKPSE-TA------LALLKQ----------------
A0A2V9B240      ------SLT----------RNNGNSKSSG-AE------LALLKE----------------
A0A2V9CBM2      --GALSL------------RENGGARKLV-PS------WYRIDV---HA-----------
A0A2V8XN17      --KSLVL------------AGNGSGKNSR-S-------WHLIDR---DG-----------
A0A2V8WX45      --KALVL------------KGNGTGKDAR-SS------WHRIDL---DG-----------
A0A1Q6YR79      --KSLSLAG----------NGNGSGKDRR-PS------WHLIDR---DG-----------
A0A1Q7VA32      --KSLSLAG----------NGNGSGKDRR-PS------WHLIDR---DG-----------
A0A2V9EY85      --RFLSLAG----------NGNGPGKDPR-PS------WHLIDR---DG-----------
A0A2V9H8K0      --KALIL------------EGNAAGKNSR-SF------WHRIDR---DG-----------
A0A2V9FFE5      --KAFEF------------KGNGAGKNSR-SC------WHRIDR---DE-----------
A0A2V9GM43      --KAFEF------------KGNVAGKNSH-SY------WHRIDR---DE-----------
A0A1F2RFI7      --SRKSLPE----------DTSAPDGEKK-LH------PELI-----AG-----------
A0A1F2RZS3      --SRQTLAE----------VTSEAANGKP-LS------LELI-----GA-----------
A0A1F2USE2      --QTRQLES----------GAEGTTEKGL-ARGGTPHGWYRIDE---LD-----------
A0A2V9C238      --GSKPL-------------ANGKPQTSA-LPSTTPR-WYRIDV---EA-----------
A0A1F2Q9F5      ----LPT-------------PKRLASRSV-VPAAAPL-WHLVSG---NG-----------
A0A1F2QQH9      ----LPT-------------PKRLASRSV-LPAAAPL-WHLVSG---NG-----------
A0A1F2QXK7      ----LPT-------------PKRLASRSV-VPAAAPL-WHLVSG---NG-----------
A0A2V9DEM9      --GSKPL-------------ANGKPRTLA-LPSTTPR-WYRIDA---EA-----------
A0A2V9CYQ5      --HPGSLSL----------RENGCARKLV-AS------WYRIDV---HA-----------
A0A2V9BWU8      --RTLPLKS----------AHNGTASNPA-AR------WHRIDQVDRGE-----------
A0A2V8ZG48      --HSNLLRS----------RQNGTASNPC-AC------WHRIDQ---GG-----------
A0A2V8Y334      --RTNHPGN----------GHNGTASNPG-AR------WHRIDQ---SG-----------
A0A2V9AY68      --RTNGLRH----------GHNGTASNPG-VR------WHRIDQ---GG-----------
A0A257VBK0      ------------------------------------------------------------
A0A2V7XDY0      ------------------------------------------------------------
A0A350UQT3      KLLTAGETH----------VEDPSARPKD-------------------------------
A0A2U3JZ71      -------------------DLIPHDPSRG-------------------------------
A0A2V8TTB0      NGAIPAPPN----------GAVPAADNTD-------------------------------
A0A1F2TCR2      -------RV----------PLLS-----E-------------------------------
A0A1F2V330      AFADLHRNH----------IVMV-----T-------------------------------
A0A662EE63      ------------------------------------------------------------
A0A2V8TLH7      ------------------------------------------------------------
A0A1Q7ZJT1      ------------------------------------------------------------
A0A2V8VC99      ------------------------------------------------------------
A0A348UZU3      TENEPRSIE----------LISH-----F-------------------------------
Q01XL7          PLGTLVEDG----------QKTLEFATWQ-------------------------------
A0A2V8ERZ5      ------KHP----------LLAS-----S-------------------------------
A0A2V8GTX0      ------RHP----------LLSG-----P-------------------------------
A0A2V8J0X9      ------RVP----------VLTE-----T-------------------------------
A0A523DUV7      ------------------------------------------------------------
A0A372IRG7      GSLAKVSPD----------LLAY-----N-------------------------------
A0A1F2U158      ------KHP----------VLAS-----S-------------------------------
A0A2V8F6S9      ------KHP----------LLAS-----S-------------------------------
A0A4Q1SCH5      ATKMGHGVR----------LITL-----R-------------------------------
A0A3D1ASD2      PIAKGGAKA----------ELVPLGELGD-------------------------------
A0A2N9MK30      VAAGGAAST----------PVLLRHPDDD-------------------------------
A0A4Q7YNP3      SGSSTIVRN----------ADVLDMAGWS-------------------------------
E8UZE1          KKEVAGTAD----------SLGLEPRVLQ-------------------------------
A0A1V6HR88      GNGEPTQIE----------LLPH-----L-------------------------------
A0A3E0P0A3      DRGADLAID----------LLPH-----S-------------------------------
A0A2V8EXP2      --------D----------PLIS-----K-------------------------------
A0A2W4RYA1      -------GD----------PLMT-----G-------------------------------
G8P0Y7          PGTGTGPQP----------LISY-----L-------------------------------
A0A5M8T4U7      GGSSAQVRQ----------LTAL-----H-------------------------------
A0A3P0X3W6      ----------------------------S-------------------------------
A0A1E3Y9R6      -------EA----------PLLQ-----P-------------------------------
A0A2W4TLP2      -------EA----------PLLS-----A-------------------------------
A0A3R9WF43      ---AGTVGE----------CALI-----T-------------------------------
A0A317HKM4      -------------------PLLV-----Q-------------------------------
A0A523E0N1      STYLPTIYD----------KRPAL----A-------------------------------
A0A523ECP2      ALALSQSTK----------IASRA----K-------------------------------
A0A2W0C122      TSKVGEAPQ----------VLSL-----T-------------------------------
A0A2W0AUU7      TPRVGEAPQ----------IMCL-----T-------------------------------
A0A2W0BQL1      TPRVGEVPQ----------IMCL-----T-------------------------------
A0A4Q1SDL1      ----DGIQH----------VRTL-----N-------------------------------
A0A3P0XH15      ERMARVSPD----------LISY-----T-------------------------------
A0A4R1LAZ7      GRPESLSPD----------LVAY-----L-------------------------------
A0A3M1WQW8      ILILD-----------------------D-------------------------------
A0A3N1JHC1      RLNGAGSKD----------VHPILEHWKE-------------------------------
C1F294          EKEDQISRD----------LLTL-----L-------------------------------
A0A2V9KA79      SVPDRPGKH----------SLTS-----Q-------------------------------
A0A522PSP1      ------------------------------------------------------------
G8P085          --------M----------LVAY-----N-------------------------------
A0A4Q1SGQ1      TSPLFMSRT----------GIAD-----Q-------------------------------
Q1ILD9          M-------G----------IDVL-----T-------------------------------
Q1IJZ6          GSKPG---R----------PTAM-----V-------------------------------
A0A2V8TCE6      --------D----------LMSH-----H-------------------------------
A0A522TBE8      ------------------------------------------------------------
Q1ITG0          --------V----------PLAA-----D-------------------------------
A0A3N5PCI5      --------S----------LLLT-----H-------------------------------
A0A3M1Q0S9      EIEDP---S----------LISA-----R-------------------------------
A0A2Z5G448      PADSQFPSD----------LVSY-----L-------------------------------
A0A3M1VZ38      --------A----------VITA-----E-------------------------------
A0A4Q1SD29      --------D----------LVSL-----L-------------------------------
A0A3M1PY35      --------A----------SPVV-----A-------------------------------
A0A3M1VMP2      --------S----------RPVI-----P-------------------------------
A0A2V8G155      ----SMS------------PSLY-----K-------------------------------
A0A2V8HDM7      ----SIS------------PSLY-----K-------------------------------
A0A2V8DRT9      ----GES-A----------PLLD-----K-------------------------------
A0A2V7VYF3      ----ATGGA----------PLIN-----N-------------------------------
A0A1F2SVH2      ----LEN------------PLIS-----D-------------------------------
A0A2V8AJG9      ----VKD------------PLMN-----N-------------------------------
A0A2N9LQU7      -QPGLGGLG----------TMAV-----Q-------------------------------
A0A2P6WFK7      -APKAVPLA----------PILL-----G-------------------------------
A0A2V8U914      --NGKQPVE----------RITW-----D-------------------------------
A0A2V7W309      EEKPSPGIE----------LLPH-----L-------------------------------
A0A2W0BGU4      NARENGTAI----------LNVA-----A-------------------------------
A0A2W0BVQ9      NARENGTAL----------LNVA-----A-------------------------------
A0A2V9MN96      LITASTVDG----------PVAH-----V-------------------------------
A0A2V7V2Z1      ------------------------------------------------------------
A0A2V7X2F7      ------------------------------------------------------------
A0A2V7V2I1      ------------------------------------------------------------
A0A2V7U3M2      ------------------------------------------------------------
A0A2V7UHT0      ------------------------------------------------------------
A0A2Z5FVL3      --ALPGREA----------IAAL-----K-------------------------------
A0A2V9KBD6      -LSIYRNRA----------LVSL-----L-------------------------------
A0A2W0AJ66      -PQTASKPE----------LVSF-----L-------------------------------
A0A1Q7RBU1      -VNGDLKPE----------MVSF-----L-------------------------------
A0A2V9JPV9      -VNGDLKPE----------LVSV-----L-------------------------------
A0A1I6MH75      ------QRN----------INVL-----T-------------------------------
E8WVF6          ------ERN----------INVL-----T-------------------------------
A0A1H5Z7N3      -------RN----------IGVL-----A-------------------------------
A0A2V9YHT3      RPGKRERVE----------MIAH-----S-------------------------------
A0A1G7JVV8      ------QTN----------IGVL-----A-------------------------------
A0A1H4T6W9      ------QNN----------IGVL-----A-------------------------------
I3ZEU5          ------QSN----------IGVL-----A-------------------------------
A0A428MDU2      ------QRN----------ISVL-----T-------------------------------
A0A5B9EBI2      ------QLN----------MGVL-----T-------------------------------
A0A239HDF6      -------------------LPVI-----S-------------------------------
A0A4Q0T270      ------QRN----------ISVL-----T-------------------------------
A0A1Q3QQB6      ------QKN----------LSVL-----S-------------------------------
A0A3N1K1G7      ------QRN----------ISVL-----T-------------------------------
A0A4V2G466      ------ARN----------IISL-----A-------------------------------
A0A6B9YNQ8      ------IRN----------ITSL-----S-------------------------------
                                                                            

A0A2V7VMF7      ------------------------DAEHLV-TEAYQNLRTALLF--ARKDDAG---QVVL
A0A2V7YYV7      ------------------------DAHSHA-SEAYRALRTSLLF--S-AIDRE-L-KEIV
A0A2V7Z0J5      ------------------------DAQSHA-AEAYRALRTGILF--S-GVERS-V-KQLI
A0A2V7Z3M4      ------------------------DAQSHA-SEAYKALRTGILF--S-GINHR-------
A0A399Y5V2      ------------------------DPASTT-AEAYRSVRTNLQF--S-LLDSG-S-RVVL
Q01X01          ------------------------QPASHV-SESFRATLASILS--S-SHNGDHP-HVLV
A0A3M2D9H8      ------------------------QPRSPV-TEAFRSVRTNLEF--V-EIDRP-L-KTLL
A0A2V8JK38      ------------------------EPSSVI-AESYRSVRTSFFL----SSGSA-PTRSVV
A0A2V9IXG5      ------------------------FGLHQI-RESYNVLRTELLF--NKNLRQH---KVIM
A0A2V9J2P4      ------------------------FGLHQI-RESYNVLRTELLF--NKNLRQH---KVIM
A0A1Q7RLS4      ------------------------GTHSAF-KEAYQTLRTSLLF--S-RKSRG-A-NTVL
A0A2V2R525      ------------------------DAHSRL-AEVYRKLRTTVLL--S-RPGKT-P-KTLL
A0A321LPW6      ------------------------DSASSA-AEAYRVLRTSVLL--C-AAGSP-P-RTIL
A0A2V9R9V4      ------------------------DGRSPA-SEAYRALRTALLL--S-AAGNP-P-KTIL
A0A321LE75      ------------------------DTRSSA-AEAYRVLRTSVLL--S-TAGNP-P-KTIL
A0A2V8R8U7      ------------------------DVRSPI-AESYRHLRTSLLL--S-SAGTP-P-KTIL
A0A2V8QMP4      ------------------------DVRSPV-AEAYRHLRTSLLL--S-SAGQP-P-KTVL
A0A2V8R4S3      ------------------------DVRSPV-AEAYRHLRTSLLL--S-SAGQP-P-KTVL
A0A2V8NJ55      ------------------------DVRSPI-AEAYRHLRTSLLL--S-SAGQP-P-KTIL
A0A2V8Q7I0      ------------------------DVRSPI-AESYRHLRTSLLL--S-SAGQP-P-KTIL
A0A2V8S6K4      ------------------------EVRSPV-AEAYRHLRTSLLL--S-SAGQP-P-KTML
A0A317I2L9      ------------------------DVRSPV-AESYRHLRTSLLL--S-SAGQP-P-KTIL
A0A2V8LLF9      ------------------------DVRSPI-AESYRHLRTSLLL--S-SAGMQ-P-RTIL
A0A352FRF4      ------------------------DIRSPI-AESYRHLRTSLLL--S-SAGTA-P-RTIL
A0A2V8MKV0      ------------------------DVRSHV-AESYRHLRTSLLL--S-SAGQA-P-KTIL
A0A2V8PYY8      ------------------------DVRSHV-AESYRHLRTSLLL--S-SAGQA-P-KTIL
A0A1Q7YKQ8      ------------------------DARSSI-AEAYRHLRTSILL--S-SAGQP-P-KTIL
A0A352F3R7      ------------------------DARSPI-AESYRHLRTSLLL--S-SAGQP-P-KTIL
A0A0B6WXT1      ------------------------DVRSPI-TEAYRHLRTQLLL--S-TAGQP-P-RTVL
A0A3B9MEU8      ------------------------DVRSPI-AEAYRHLRTSLLL--S-SAGQP-P-KTIL
A0A2V8MHG6      ------------------------SQRSAL-AESYRQLRTLVLL--S-SAGGA-P-KTLL
A0A2V8P7N1      ------------------------SQRSAL-AESYRQLRTLVLL--S-SAGGA-P-KTLL
A0A2V8M3M6      ------------------------SQRSAL-AESYRQLRTLVLL--S-SAGGA-P-KTLL
A0A1Q7NJH5      ------------------------SQRSAL-AESYRQLRTLVLL--S-SAGGA-P-KTLL
A0A2V8PJY0      ------------------------SQRSAL-AESYRQLRTLVLL--S-SAGGA-P-KTLL
A0A1Q7Y6W9      ------------------------DGRSSL-AEAYRQLRTSVLL--S-TAGRA-P-KSLL
A0A2V8NC68      ------------------------DGQSPL-AEAYRQLRTSVLL--S-SAGGA-P-QTLL
A0A399WK13      ------------------------DPRSSL-AEAYRQLRTSILL--S-TAGHA-P-KSLL
A0A352FLX4      ------------------------EKRSPV-AEAYRHLRTSILL--S-TAGRP-P-RTLL
A0A2V8RTL7      ------------------------DPRSSL-SESYRQLRTSILL--S-TAGHA-P-KSLL
A0A3E0PCJ6      ------------------------DSRSST-AEAYRQLRTSILL--S-TAGHA-P-KSLL
A0A3M1S4R8      ------------------------NSRSSSLSEAYRQLRTSILL--S-VAGHA-P-KSLL
A0A1Q7YFI6      ------------------------DTRSPM-AEAYRQLRTSVLL--S-SAGGA-P-QALL
A0A136KC10      ------------------------DPRSSL-AEAYRQLRTSILL--S-TAGHA-P-KSLL
A0A2V8SEX6      ------------------------DSRSAL-AEAYRQLRTSILL--S-TAGHA-P-KSLL
A0A3M2D6Y5      ------------------------SSNSSL-SEAYRQLRTSILL--S-VAGHA-P-RSLL
A0A0B6WWQ6      ------------------------GGESGL-AETYRQLRTSVLL--S-TPGHA-P-KTLL
A0A3B9MK99      ------------------------DGHSPL-AEAYRHLRTSVLL--S-TAGRA-P-RSLL
A0A352EX26      ------------------------DSRSPL-AESYRHLRTSLLL--S-TAGRA-P-RSLL
A0A2V8MM59      ------------------------TGRSPL-AESYRQLRTSVLL--S-TAGRA-P-KTLL
A0A2V8PFE8      ------------------------NGRSAL-AESYRQLRTSVLL--S-TAGRA-P-KTLL
A0A2V8PWS6      ------------------------NGRSAL-AESYRQLRTSVLL--S-TAGRA-P-KTLL
A0A2V8LCT5      ------------------------TGRSAL-AEAYRQLRTSVLL--S-TAGRA-P-KTLL
A0A352FTJ9      ------------------------NGRSAL-AEAYRQLRTSVLL--S-TAGRA-P-KTLL
A0A2G6PYV5      ------------------------KPNDAF-SESYRHLRTNIQL--S-KTTD--N-KVLL
A0A2V8F956      ------------------------TAPPNF-SEAIRDLRTNVLF--S-SAEKG-S-RSVV
A0A1F2S1W5      ------------------------GVSALF-TESFRSIRTNVLF--S-STEEG-G-RLVV
A0A1F2T595      ------------------------GVPGVF-SECFRSIRTNVLF--S-STDEG-G-RMIA
A0A2V8JQV5      ------------------------KPFSLF-AECFRTTAASVLF--S-EHGGTVP-QILV
A0A2V9AC41      ------------------------HPLSLV-AEAYRSLRSSLLL--S-QAGGP-P-HTML
A0A2V8K4L4      ------------------------RQGSLI-AESFRAVLTSIMF--S-EQR---P-RVVV
A0A2V8NCZ3      ------------------------RQGSLI-AESFRTVLTSIMF--S-EQR---P-RVLV
A0A2V9MAM9      ------------------------NKFNAL-SESFRCLVTSILRLGG-DEGQSPP-RVLV
A0A2V9M454      ------------------------KPGAAI-SEAFRTLRTSVLL--S-TAERP-P-KVLL
A0A2V9IVR7      ------------------------RPASEL-AEAYRSMRTAILL--A-TSPRP-P-QVIV
A0A2V9ILE2      ------------------------RPASEL-AEAYRSMRTAILL--A-TSPRP-P-QVIV
A0A2V9LGY4      ------------------------RPASEL-AEAYRSMRTAILL--A-TSPRP-P-QVIV
A0A2V9J4D6      ------------------------HPASSV-AESYRALRTSIMF--S-TSPKP-P-QVVL
A0A2V9L9C5      ------------------------HPASSV-AESYRALRTSIMF--S-TSPKP-P-QVVL
A0A2N9M9N1      ------------------------APGSEM-AESFRVLRTSILL--S-SSPQP-P-QVLL
A0A2V9JEC4      ------------------------NSSLDV-AEAFRILRTSILL--S-MTPRP-P-QLLL
A0A2V9LPQ3      ------------------------EPASAV-AESYRALRSAILF--S-STPEP-P-KVLL
A0A348V070      ------------------------EPRCIQ-SEAFRSIRTSLLL--S-FDSPT-R-KALI
A0A2Z5G3A3      ------------------------QPNSGY-VEALRAIRTSLYL--S-KGGSP-P-QVVL
A0A2V7UGP8      ------------------------DPASPA-SEAYKTLRTSLLL--S-TADAP-P-KIIV
A0A239MKT6      ------------------------APKSKS-AESYRQIRTAILF--S-RIDDP-P-KVIL
A0A3E0PCN7      ------------------------FARPVM-VEAFNQIRTSLML--S-TAGGP-P-KSVL
A0A2V8IYW3      ------------------------GMLPVA-TEQYRRLAAILHH--A-QADTG-M-RVVM
G2LEI9          ------------------------LSASPI-GEAYRQLRTSILL--S-SSEDVRN-RIIL
A0A317J121      ------------------------PASQLL-ADSFRVTLASLML--G-NGTRRPP-RVIL
A0A2V7YW66      ------------------------RPRTLI-SEAYRSLRTGLLL--S-SARE--L-KTVA
A0A2V7Z0V0      ------------------------RPRTLI-SESYRSLRTALML--S-SARE--L-KAIA
A0A2V8GFD4      ------------------------HVPGMF-PEALRAIRTNVLF--S-FAEGS-A-KTLV
A0A2V8HSS5      ------------------------HVPGMF-PEALRAIRTNVLF--S-FAEGS-A-KTLV
A0A2V8KP55      ------------------------EPSSVI-AESYRSVRTSFFL--S-SGSAP-T-RSVV
A0A399WNU1      ------------------------FNNPLI-AEAFHQLRTSLLL--S-TAGGS-P-KTVL
A0A2V9CG11      ------------------------RKSSLS-ADCYRATVTSILL--A-NQNGDLP-QVIV
A0A2V2R0I6      ------------------------LPKSQM-SEAFRALRTSILL--S-QADHP-P-QVIL
A0A2V8XAR9      ------------------------LPKSQI-SEAFRALRTSILL--S-QADHP-P-QVIL
A0A2V8VZA0      ------------------------LPKSQM-SEAFRALRTSILL--S-QAGHP-P-QVIL
A0A1Q7CB82      ------------------------LPKSQM-SEAFRALRTSILL--S-QAGHP-P-QVIL
A0A2V8WIU1      ------------------------LPKSQM-SEAFRALRTSILL--S-QAGHP-P-QVIL
A0A1Q6Y9F5      ------------------------LPKSQM-SEAFRALRTSILL--S-QADHP-P-QVIL
A0A2V9EVV8      ------------------------LPKSQM-SEAFRALRTSILL--S-QADHP-P-QVIL
A0A2V8YF91      ------------------------LPKSQI-SEAFRALRTSILL--S-QADHP-P-QVIL
A0A2V8XZK2      ------------------------LPKSQM-SEAFRALRTSILL--S-QADHP-P-QVIL
A0A2V8ZTX6      ------------------------LPKSQV-SEAFRALRTSILL--S-QAEHP-P-QVIL
A0A2V9BT79      ------------------------LPKSQM-SEAFRVLRTSILL--S-QAEHS-P-QVIL
A0A1Q8B793      ------------------------LPKSQM-SEAFRALRTALLL--S-QADHP-P-QVIL
A0A2V9BCA0      ------------------------LPKSQM-SEAFRALRTALLL--S-QADHP-P-QVIL
A0A2V9BWU9      ------------------------LPQSQI-SEAFRALRTSLLL--S-QAEHP-P-QVIL
A0A2V9DKX2      ------------------------LPQSQI-SEAFRALRTSLLL--S-QAEHP-P-QVIL
A0A2V9JSI3      ------------------------HPASPL-AESYRALRTSVLL--S-TPGHP-P-QVIL
A0A2V9WI32      ------------------------RPRSEL-AESYRALRTSIML--S-SLGSP-P-KVIL
A0A2V8IVN9      ------------------------HVTTNF-NEAFRAVRTNIIF--S-SAEEG-S-RILV
A0A1F2TPT3      ------------------------GVPPEF-SEELRRIRTNLVF--S-FAGDA-T-RSVV
A0A2V8JTQ2      ------------------------QPMSLA-AESYKTVLTSLLL--S-QPTP--P-RVIQ
A0A2V8UZY0      ------------------------QPLSLA-AESYRAMLTPLML--S-AATP--P-GIIL
A0A3N5YNR8      ------------------------PARFRV-WEAYRSLRTSILL--S-HSGKP-P-KVIM
A0A350UEK1      ------------------------RRLSAT-AESFRAVLTSILF--S-GNGHGPP-RMIV
A0A350UIQ4      ------------------------RRLSAV-AESFRAALTSIMF--S-GNGSGPP-RMIV
A0A3N6A5T6      ------------------------DMRSRV-WEAYRSLRTSLLL--S-NSGKP-P-QIIL
A0A1F2Q9L4      ------------------------KPRLAV-SEAYRSLRTALLL--S-TTNR--L-KSVV
A0A1H5SQF5      ------------------------APRSVV-AEACRQIRTAILL--S-RAEQ--P-RTLL
A0A3E0NV31      ------------------------RRSNIV-RESYRSVRTSLLL--S-SASEP-P-RTIL
A0A3N5M5V0      ------------------------PTRFRV-WEAYRSLRTSILL--S-HSGKP-P-KVIM
A0A2V9AEW6      ------------------------RKPSLI-AECVRTTLTSILL--P-NQDGDPP-QVVL
A0A2V8WQK6      ------------------------RKPSLL-AECTRTTLISILS--P-NQNGEGP-RIIV
A0A2V8XIF4      ------------------------RKPSFL-AECARTTLTSILL--P-SQNGDCP-GVVV
A0A3N5XQP8      ------------------------ALDSPM-WEAYRRLRTCLLL--S-HPDQP-P-VRIL
A0A2Z5G7H4      ------------------------HPNSPY-TEALRGLRTALLL--A-KSSAP-P-QLLL
A0A2V9L5B5      ------------------------QTHAEV-LEAFRSLRTSILL--S-A--SPVP-RVIL
A0A2V9LK56      ------------------------RRDPAA-VEAFRSLRTSILL--S-A--NPSP-KIVL
A0A2V9L7I0      ------------------------QSHADA-VEAFRSLRTSILL--S-A--SPVP-RLIL
A0A522PPT0      ------------------------QKDPTA-VEAFRSLRTSILL--S-A--HPVP-KVLL
A0A2V9KCS3      ------------------------RKPSLL-AESFRTTLASILF--F-EADGNRP-RILV
A0A2U3KC61      ------------------------RPKSEA-AEAYRALRTSILL--S-SFGAP-P-KVIL
A0A2V9Y2R7      ------------------------RPKSQA-AESYRALRTSILL--S-SFGAP-P-KVIL
A0A372IT17      ------------------------ASGSPF-SESLRTLRASLML--S-RSSAP-P-QVLL
A0A136JPP4      ------------------------ERHSPM-AEAYRHLRTSLLF--S-SAGKP-P-QSIL
A0A399WUJ8      ------------------------DRHSPM-AEAYRHLRTSLLF--S-SAGKP-P-QSIL
A0A2V9NGH6      ------------------------RPQSQM-AEAYRALRTALLL--S-SVGAA-P-KVVV
A0A2V9PYE6      ------------------------RPQSQM-AEAYRALRTALLL--S-SVGAP-P-KVVV
A0A2V9NL07      ------------------------RPQSQM-SESYRALRTSLLL--T-SLGAP-P-KTIL
A0A2V9QD92      ------------------------RPQSQM-SESYRALRTSLLL--T-SLGAP-P-KTIL
A0A2V9WPZ6      ------------------------RPQSQM-AESYRALRTSLLL--S-SLGAP-P-KIIL
A0A2V9ZLH4      ------------------------RPQSQM-AESYRALRTSLLL--S-SSGAP-P-KVIL
A0A2V9RQF1      ------------------------RPQSQM-AESYRALRTSLLL--T-SLGAP-P-KIIL
A0A2V9YDK8      ------------------------RPQSQM-AESYRALRTSLLL--S-SSGAP-P-KIIL
A0A2V9V8F7      ------------------------RPQSQM-AESYRALRTSLLL--S-SLGAP-P-KIIL
A0A2V9XGR9      ------------------------RPQSQM-AESYRALRTSLLL--S-SLGAP-P-KIIL
A0A2V9V3Q5      ------------------------RPQSQM-AESYRALRTSLLL--S-SLGGP-P-KVIM
A0A2V9NWS3      ------------------------RPQSQM-AESYRALRTSLLL--T-SIGAP-P-KVIL
A0A2V9USA9      ------------------------RPQSQM-AESYRALRTSLLL--T-NLGAP-P-KVIM
A0A2V9XW18      ------------------------RPQSQM-AESYRALRTSLLL--S-NLGAP-P-KVII
A0A4R1LC91      ------------------------EPRSAY-TEAVRALRTSLLL--S-RGGSP-P-QSIL
A0A3M2BZG9      ------------------------KPRLAV-CEAYRSLRTALLL--S-SAEE--L-RSVA
A0A1Q7N5R7      ------------------------EQVLQV-IETMRSVRLSLLH--A-YGTAG-P-MVIT
A0A3M1SIV3      ------------------------ETSSAT-AEAFRHLRTSLLF--S-SAGRP-P-QTIL
A0A3E0PHB0      ------------------------DNRSGM-AEAYRHLRTSLLF--S-SAGKP-P-ETIL
A0A3M2D491      ------------------------SKQSPL-AEAFRHLRTSLLF--S-SAGKP-P-QTIL
A0A357F267      ------------------------ERNSPM-AEAYRHLRTSLLF--S-SAGKP-P-QSIL
A0A353C9L6      ------------------------ERHSPM-AEAYRHLRTSLLF--S-SAGKP-P-QTIL
A0A2V8RQV0      ------------------------ERNSPM-AEAYRHLRTSLLF--S-SAGKP-P-QSIL
A0A2V8SJH5      ------------------------ERRSPM-AEAYRHLRTSLLF--S-SAGKP-P-QSIL
A0A2V9QB26      ------------------------RKASLI-AESFRSLLTSILF--S-GSNGACP-RVLV
A0A2V9VYY4      ------------------------RPKSEA-AEAYRALRTSILL--S-SFGAP-P-KVIL
A0A2V9KIE8      ------------------------QTTAVG-KESFRTLRTSILL--S-A--HPVP-RTIL
A0A352F549      ------------------------TGSSVQ-AEAYKHLRTSILL--S-TAGRP-P-KTLL
A0A3B9MLP9      ------------------------RGPTLQ-AEAYKHLRTSILL--S-TPGRS-P-KTLL
A0A3D5SQ87      ------------------------RGPTLQ-AEAYKHLRTSILL--S-TPGRS-P-KTLL
A0A2V8NW86      GSNGLPERTSKQADSLSVELVTWYRKASLI-AESYRSLLTSILF--S-GSNGDCP-RVLV
A0A2V8ZHL8      -------------------------PSSAL-AESFRTLLTSVVL--S-TAPRP-P-QALL
A0A2V9B240      -------------------------PSSAL-AESFRTLLTSVVL--S-TAPRP-P-QALL
A0A2V9CBM2      ------------------------TRHAPL-VEAFRSLRASILL--S-AAEGP-R-NSFL
A0A2V8XN17      ------------------------AQHAAL-GEAFRSLRTSVLL--S-TPDRP-P-SSLL
A0A2V8WX45      ------------------------TQHGAL-VEAFRSLRTSVLL--S-TPDRP-P-GSLL
A0A1Q6YR79      ------------------------TQHAAL-GEAFRSLRTSVLL--S-TPDRP-P-SSLL
A0A1Q7VA32      ------------------------TQHAAL-GEAFRSLRTSVLL--S-TPDRP-P-SSLL
A0A2V9EY85      ------------------------TQHAAL-GEAFRSLRTSVLL--S-TPDRP-P-SSLL
A0A2V9H8K0      ------------------------TQHAAL-VEAFRSLRTSVLL--A-TPDRP-P-GSLL
A0A2V9FFE5      ------------------------TQHASL-VEAFRNLRTSVLL--S-TPDRP-P-SSLL
A0A2V9GM43      ------------------------TQHASL-VEAFRNLRTSVLL--S-TPDRP-P-SSLL
A0A1F2RFI7      ------------------------DGTNPL-SEAYRSLRTSVLL--S-TSGRP-P-RVIL
A0A1F2RZS3      ------------------------NGNAAL-SEVYRSLRTSVLL--S-TSGRP-P-RVML
A0A1F2USE2      ------------------------PQRSTL-AEAFRSLRTSVLL--S-TAERP-P-RILL
A0A2V9C238      ------------------------TQQSAL-AEAFRSLRTSVLL--S-TADRP-P-RTLL
A0A1F2Q9F5      ------------------------EGSTKL-GEAFRSLRTSVLL--S-TPEQA-P-RLLL
A0A1F2QQH9      ------------------------EGSTKL-GEAFRSLRTSVLL--S-TPEQA-P-RLLL
A0A1F2QXK7      ------------------------EGSTKL-GEAFRSLRTSVLL--S-TPEQA-P-RLLL
A0A2V9DEM9      ------------------------TQQSAL-AESFRSLRTSVLL--S-TADRP-P-RTLL
A0A2V9CYQ5      ------------------------TRHAPL-VEAFRSLRASILL--S-AAGGP-P-NSFL
A0A2V9BWU8      ------------------------KPQAAL-VEAFRSLRASVLL--S-TADHP-P-GSLL
A0A2V8ZG48      ------------------------KRHAAL-VEAFRSLRASVLL--S-TADHP-P-GSLL
A0A2V8Y334      ------------------------KPQPAL-VEAFRSLRASVLL--S-TADHP-P-GSLL
A0A2V9AY68      ------------------------KPQAAL-VEAFRSLRASVLL--S-TADHP-P-GSLL
A0A257VBK0      -------------------------TQKVS-AEAFQTLRTAMVF--A-TDNHQ-N-NAIL
A0A2V7XDY0      -------------------------NVHFV-TEAYQNLRTALIF--G-RKDER-G-QIVL
A0A350UQT3      ------------------------RQFSTY-EEAVRTIRSSVLL--T-DFDRR-L-RTLL
A0A2U3JZ71      ------------------------TSLNSF-QEAIRTLRNSILL--T-DFDRR-I-RSLM
A0A2V8TTB0      ------------------------QALSNY-EEAIRTLRTSILL--T-DFDRS-L-RSVL
A0A1F2TCR2      ------------------------QVPHDF-GEAFRSLRTSLVF--T-GKSEG-P-RVIA
A0A1F2V330      ------------------------DPHSVA-SEQCRMLALKTRQ--Q-LSGVR-S-PLLA
A0A662EE63      -------------------------NSRAL-REAFQTLRTALML--A-ARDEG-C-QILL
A0A2V8TLH7      -------------------------TRRAV-REAYQTLRTSLLF--S-RKART-A-NAVL
A0A1Q7ZJT1      -------------------------THSAF-KEAYQTLRTSLLF--S-RKSRG-A-NTVL
A0A2V8VC99      -------------------------TLSAV-KEAYQTLRTSLLF--S-RKNRS-A-NTVL
A0A348UZU3      ------------------------APDSTF-AESYRSLRTALLL--S-GPLSS-L-KSLI
Q01XL7          ------------------------NKSSIL-AESFRQTLTSILR--A-QPKGE-C-PVYV
A0A2V8ERZ5      ------------------------HVPHDF-GESFRSLRTSLLS--K-YQGDA-T-KIIT
A0A2V8GTX0      -------------------------VPHDF-GEAFRALRTALVA--S-SGTDA-T-RLVA
A0A2V8J0X9      -------------------------VPHDF-GEAFRSLRTSLVF--T-SGAQS-T-RIIA
A0A523DUV7      -------------------------NPSVI-TESYRTLRASLLF--T-REREH-G-NMIL
A0A372IRG7      ------------------------EPQSIV-AEGFRSLRSSILL--S-AVDRE-P-KLLL
A0A1F2U158      ------------------------HAPHDF-SEAFRSLRTSIAS--R-YPGEG-A-KTMI
A0A2V8F6S9      ------------------------RVPHDF-GESFRALRTSLVS--K-YPGAG-T-KVLL
A0A4Q1SCH5      ------------------------EPRSRA-AESYRTLRNSVLL--S-SIDMP-P-RLML
A0A3D1ASD2      ------------------------RYASGY-DEAVRTLRNSILL--T-DFDRR-L-RSVL
A0A2N9MK30      ------------------------RLLAGF-GEAVRTLRNSILL--S-SFDRQ-I-KSLM
A0A4Q7YNP3      ------------------------SHFSVV-AEAYRSTTFSILL--T-GNSSN-RARVYV
E8UZE1          ------------------------FPQSHF-AESFRVLRSALLL--S-HAGNP-P-QLIV
A0A1V6HR88      ------------------------RPRMPV-AEAYRALRTALLL--S-TASEL---KVIV
A0A3E0P0A3      ------------------------QPRLPA-SEAYRALRTATLL--S-KADEP---RLLV
A0A2V8EXP2      ------------------------GVPANF-SEAFRAVRTNVLF--S-SADEG-P-KVIV
A0A2W4RYA1      ------------------------PVPAGF-AEALRMLRTNLLF--A-RADPD-M-RSVM
G8P0Y7          ------------------------EPRSEI-AEAYRALRTSILL--S-SVSHP-P-RSIL
A0A5M8T4U7      ------------------------SPKSLA-GEAYRGLRSSLLL--S-SIDKP-P-RVIA
A0A3P0X3W6      ------------------------RTQDAY-TEAIRTMRSLVLL--E-RTREK-L-RSVQ
A0A1E3Y9R6      ------------------------DAPAAF-SEAIRAVRTAVLF--S-SAEDG-A-RSVV
A0A2W4TLP2      ------------------------DAPPAF-AEAIRAVRTAVLF--S-SAEEG-A-RSVV
A0A3R9WF43      ------------------------NPYSPF-SESFRTLRTSILH--S-HSVTR-L-QTLL
A0A317HKM4      ------------------------GAPARL-TELFQAARTNLIM--A-PELAR-P-HILL
A0A523E0N1      ------------------------ENRDAL-SERFRFLRGSMLL--S-TPNAV-P-KIVL
A0A523ECP2      ------------------------EDMSLI-AERFKFLRGSLLL--S-TPGRP-P-RTVL
A0A2W0C122      ------------------------EPRTAI-AEAYRSLGTSILL--A-SRDL----KSLL
A0A2W0AUU7      ------------------------EPRTAA-AEACRALGTSVLL--A-SADL----KSLL
A0A2W0BQL1      ------------------------EPRTAA-AEACRALGTSVLL--A-SADL----KSLL
A0A4Q1SDL1      ------------------------APRSAY-SEAMRGLRASLTP--T-RTTME-PPRVVV
A0A3P0XH15      ------------------------EPQSYV-SEGFRTLRSSILL--S-AVDRE-P-KLIL
A0A4R1LAZ7      ------------------------EPHSVI-AESFRNLRSTILL--S-AVDTQ-P-KVLL
A0A3M1WQW8      ------------------------QRRSSF-AEAFRSLRTSVLL--S-HAERP-P-RTIL
A0A3N1JHC1      ------------------------ADKTFL-TETYRSAGASILF--S-RNGGM-APKVLL
C1F294          ------------------------EPQSIV-AEGFRTLRSSILL--S-SVDRE-P-KAIL
A0A2V9KA79      ------------------------PPPSIA-TDQYNILAMKIRS--Q-LGDEN-G-RVLT
A0A522PSP1      -------------------------DGTPF-AESLLGIRSTLLL--G-ASGNS-M-RALA
G8P085          ------------------------SPLSVN-AEAFRNLRNALLL--S-SIDRP-A-KMLL
A0A4Q1SGQ1      ------------------------ARQEIF-VEALCSLRTSLLR--L-RDGDS-S-QVVL
Q1ILD9          ------------------------RPNSQF-SESFRTLRTSIML--S-FPSRP-P-KSLV
Q1IJZ6          ------------------------YEQAMA-TEAFRSLRTTLLL--S-QAGSA-P-KSLL
A0A2V8TCE6      ------------------------HPSSPL-AESFRDLRTALSL--S-SAGST-P-RSLT
A0A522TBE8      ------------------------EARHPY-HEAIVSLQSAILL--G-AAEA----RVVA
Q1ITG0          ------------------------RPQSKL-AEAFRALRTSLLL--A-NAGAP-P-KVIM
A0A3N5PCI5      ------------------------GVPAPY-AEACRALRTNVLA--S-AGGGT-TGRSLL
A0A3M1Q0S9      ------------------------APLSPV-AEAYRELRTAVLL--A-MPDHP-P-RTLA
A0A2Z5G448      ------------------------TPQTVG-AEAFRTLRSSILL--S-SADNE-A-RLIL
A0A3M1VZ38      ------------------------MPLSPA-AEAYRELRTAVLL--A-TPGHP-P-RDLT
A0A4Q1SD29      ------------------------EPQSIA-AESFRTLRSSILL--S-AVDNE-M-KLLL
A0A3M1PY35      ------------------------PGAHSV-EEAFRTLRSSLLL--S-HPGGP-P-RVLM
A0A3M1VMP2      ------------------------EEQMDV-EEAFRALRSSILL--A-QPQHP-P-RSLL
A0A2V8G155      ------------------------RAPGNF-AEALRTIRTNVLF--A-LPEEA-A-RCIL
A0A2V8HDM7      ------------------------RAPGNF-AEALRTIRTNVLF--A-LPEEA-A-RCIL
A0A2V8DRT9      ------------------------GATPNF-AEAMRTVRTNVLF--S-STADG-G-QSIV
A0A2V7VYF3      ------------------------GVPAHF-SEAFRTIRTNVLF--S-SVEEG-S-RTIV
A0A1F2SVH2      ------------------------GVPSNF-SESFRNIRTNLLF--S-SADEG-G-RSVL
A0A2V8AJG9      ------------------------GVPANF-AEAFRAIRTNVLF--S-SAEEG-S-KTIV
A0A2N9LQU7      ------------------------RPASLL-AESYRVLCNSLLL--T-AADRP-P-QLLV
A0A2P6WFK7      ------------------------SPRSQA-AEAFRGLRTSLLL--S-SPDHE-P-KIIT
A0A2V8U914      ------------------------KRFSKM-SEAFRATVASILS--AEQNGDH-H-DVLV
A0A2V7W309      ------------------------DARSPV-SEAYRAFRTSLLL--A-SA-NS-P-KIIV
A0A2W0BGU4      ------------------------QATSEQ-SEAYRALRTSVLL--S-VASRA-P-QTVL
A0A2W0BVQ9      ------------------------QTTSEQ-SEAYRALRTSVLL--S-VASRA-P-QTVL
A0A2V9MN96      ------------------------RPKSEA-AESYRALRTSILL--S-SFGAP-P-KVVL
A0A2V7V2Z1      -------------------------VESPL-ADGYRLLRTSLSY--S-WPEAA-S-RILL
A0A2V7X2F7      -------------------------TQSTF-AEAYRVIRTSLNY--S-WPNTV-P-RIIV
A0A2V7V2I1      -------------------------QQGPF-MEGYRVLRMALSY--S-WPGQD-S-RVLV
A0A2V7U3M2      -------------------------VESPL-ADGYRLLRTSLTY--S-WPESS-P-RILL
A0A2V7UHT0      -------------------------AETPL-ADGYRLLRTSLTY--S-WPDSS-S-RILL
A0A2Z5FVL3      ------------------------DPHSAY-VEALRALRTTLLS--T-RGGAP-P-QVLL
A0A2V9KBD6      ------------------------EPMSLA-AESYRSVLTSLLL--S-QP-TP-P-VVIQ
A0A2W0AJ66      ------------------------QPLSPA-AESYRALLTSILL--S-RP-TP-P-AVIM
A0A1Q7RBU1      ------------------------QPLSLA-AESYRALLTSILL--S-QS-TP-P-AVIL
A0A2V9JPV9      ------------------------QPLSLA-AESYRAILTSILL--S-QP-TP-P-AVIL
A0A1I6MH75      ------------------------QPKSQF-SESFRALRTSLLL--S-STGHP-P-KFVL
E8WVF6          ------------------------QPKSQF-TEAFRSLRTALLL--A-STGKE-P-RLLL
A0A1H5Z7N3      ------------------------APKSQF-AESFRGLRTSLLL--A-TAGKE-P-KVVL
A0A2V9YHT3      ------------------------HPKSEI-AESYRALRTSILL--S-SLGAP-P-QVIL
A0A1G7JVV8      ------------------------TSKSQF-SEAFRSLRTALLL--A-TTGHP-P-KFIL
A0A1H4T6W9      ------------------------TSKSQF-SEAFRSLRTSLLL--A-TTGHP-P-KVIL
I3ZEU5          ------------------------TSKSQF-SEAFRSLRTSLLL--A-TTGHP-P-KIIL
A0A428MDU2      ------------------------QPKSQF-AEAFRSLRTALLL--S-SAGHP-P-KFIL
A0A5B9EBI2      ------------------------MPKSQF-AEAFRSLRTSILL--A-DTAHP-P-RTIL
A0A239HDF6      ------------------------QPKSQF-TESFRALRTALLL--S-TAGRE-P-KLLM
A0A4Q0T270      ------------------------QPKSQF-AESFRSLRTSLLL--S-TTGQP-P-KFIL
A0A1Q3QQB6      ------------------------QPKSQF-TESFRALRTSLLL--A-TTGHP-P-KFIL
A0A3N1K1G7      ------------------------QPKSQF-AESFRALRTSLLL--S-TTGHP-P-KFIL
A0A4V2G466      ------------------------QPKSQF-AEAFRSLRTALLL--S-SAGHP-P-KYIL
A0A6B9YNQ8      ------------------------QPKSQF-AESFRSLRTALLL--S-SAGHP-P-RTIL
                                                :                           

A0A2V7VMF7      ITGTAPQEGKTTTLVNLAKLLAG-S-GERTIVIDCDLRRAQIHQRL---------EISRA
A0A2V7YYV7      VTSAEVGEGKSRTAANLAIVLAQ-A-GHWTLLIDADFRRPAQHRMF---------ARIRN
A0A2V7Z0J5      VTSAEMGEGKSRTAANLAVVLAQ-A-GYKTLLMDADFRRPAQHRIF---------ARVRN
A0A2V7Z3M4      LXXXGSGEGKSRTAANLSVVLAQ-A-GHQTLLIDADFRRPSQHRMF---------GRVRN
A0A399Y5V2      VTSPSASEGKSTTAANIAVVLAQ-S-GKSVIIVDCDLRRPRVHKFF---------ELRNT
Q01X01          VTSSRPMEGKTTVVSNLGIALAE-I-GNRVLLIDGDLRRPRLHKVF---------DQANS
A0A3M2D9H8      IGSPGPDEGKTTVAVNLAIVMAQ-G-GNRVLLMDTDLRQPQVHERL---RL----PN-R-
A0A2V8JK38      ITSAVPGEGKTVTAVNTAVIVAQ-T-GARVILIDADMRRPRMHKIF---------KCANA
A0A2V9IXG5      VTSSLPEEGKTTVTMNLAKTLAA-A-GDRTMVVDFDLRKARLRSIL---ST----GKQN-
A0A2V9J2P4      VTSSLPEEGKTTVTMNLAKTLAA-A-GDRTMVVDFDLRKARLRSIL---ST----GKQN-
A0A1Q7RLS4      ITSAGPQEGKSCTTVNVARTLAT-A-GEKVIIVDCDLRRPAIHTRL---NL----GR-D-
A0A2V2R525      VTSSMPAEGKTTTAVNMATILAQ-T-GASVLIIDADMRQPTLHEIF---QL----DN-S-
A0A321LPW6      VTSGQQGEGKTTTVINTAVSLAQ-L-GAKVLIIDCDLRRPSAHKLF---KL----PN-T-
A0A2V9R9V4      VTSVRMEEGKTTTATNTAIALAQ-L-GASVLLIDCDMRNPSVHDVF---GT----SR-T-
A0A321LE75      ITSGQPGEGKTFTAINTAISLAQ-L-GASVLIVDCDLRKPSTHKAL---GI----DH-S-
A0A2V8R8U7      VTSSQPSEGKTTTAINTAFMLAQ-T-GADVLIIDCDLRRPRLHSHF---NL----SN-T-
A0A2V8QMP4      VTSSQPSEGKTTTVVNIATMLAQ-T-GADVLILDCDLRRPRVHAHF---GL----PN-S-
A0A2V8R4S3      VTSSQPSEGKTTTVVNIATMLAQ-T-GADVLILDCDLRRPRVHAHF---GL----PN-S-
A0A2V8NJ55      VTSSQPSEGKTTTAVNTAVMLAQ-T-GAEVLIIDCDLRRPRIHTHF---NI----SN-V-
A0A2V8Q7I0      VTSSQPSEGKTTTAINTAFMLAQ-T-GVDVLIIDCDLRRPRLHAQF---EI----SN-A-
A0A2V8S6K4      VTSSQPSEGKTTTAVNTAMMLAQ-T-GAEVLILDCDLRRPRVHMHF---NL----PN-T-
A0A317I2L9      VTSSQPSEGKTTTAINTAFMLAQ-T-GADVLIIDCDLRRPRLHAQF---EV----SN-A-
A0A2V8LLF9      VTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHSQF---NL----PN-S-
A0A352FRF4      VTSSQPSEGKTTTAINTAFILAQ-T-GAEVLIIDCDLRRPRLHAHF---NI----SN-A-
A0A2V8MKV0      VTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHSNF---NI----SN-V-
A0A2V8PYY8      VTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHSNF---NI----SN-V-
A0A1Q7YKQ8      VTSSQPSEGKTTTAVNTAVMMAQ-T-GADVLIVDCDLRRPRLHAQF---NI----PN-A-
A0A352F3R7      VTSSQPSEGKTTTTINTAFMLAQ-T-GAEVLVVDCDLRRPRLHAHF---NA----PN-N-
A0A0B6WXT1      LTSSQPSEGKTTTAVNMAMMLAQ-M-GAEVLLLDCDLRRPRVHVHF---NL----AN-A-
A0A3B9MEU8      VTSSQPSEGKTTTAINTAFMLAQ-T-GAEVLIIDCDLRRPRLHAHF---GA----PN-S-
A0A2V8MHG6      VTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSIF---DV----DN-D-
A0A2V8P7N1      VTSSQPGEGKTTTVVNTAMILAQ-T-GAKVIIVDGDMRRPRLHSIF---DV----DN-D-
A0A2V8M3M6      VTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSIF---DV----DN-D-
A0A1Q7NJH5      VTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSIF---NV----DN-D-
A0A2V8PJY0      VTSSQPGEGKTTTVVNTAMILAQ-T-GAKVVIVDGDMRRPRLHSIF---NV----DN-D-
A0A1Q7Y6W9      VTSSQPAEGKTTTATNIAISLAQ-T-GASVLIIDADMRRPRLHTIF---ET----EN-R-
A0A2V8NC68      VTSSQPAEGKTTTVVNTATILAQ-T-GATVVVIDADMRRPRLHSIF---GL----KN-E-
A0A399WK13      ITSSLPSEGKTTTATNTAISLAQ-T-GASVVIIDADMRRPRLHSVF---GI----SN-A-
A0A352FLX4      ITSSVPSEGKTTTAVNTAISLAQ-T-GAKVLIIDADMRRPRLHSIF---NL----SN-D-
A0A2V8RTL7      ITSSLPSEGKTTTATNTAISLGQ-T-GAKVLIIDADMRRPRLHSVF---NV----SN-N-
A0A3E0PCJ6      ITSSLPAEGKTTTAVNTAISLAQ-T-GAKVLVIDADMRRPRVHSFF---NL----GN-A-
A0A3M1S4R8      VTSSLPAEGKTTTAVNTAITLAQ-T-GAKVLVIDADMRRPRIHSIF---NI----SN-R-
A0A1Q7YFI6      VTSGVPSEGKTTTALNMAQIMAQ-T-GATVLLIDADMRRPMLHTLM---NL----DN-A-
A0A136KC10      ITSSLPSEGKTTTATNTAISLAQ-T-GAQVLIIDADMRRPRLHSVF---GI----GN-A-
A0A2V8SEX6      ITSSLPSEGKTTTATNTAISLAQ-T-GAKVLIIDADMRRPRLHSVF---NI----EN-G-
A0A3M2D6Y5      VTSSLPSEGKTTTAVNTAISLAQ-T-GAKVLIVDADMRRPRVHSIF---NV----QN-R-
A0A0B6WWQ6      VASSAEAEGKSTVAVNVALILAQ-T-GAQVLLIDADMRRPKLHELF---GL----KN-E-
A0A3B9MK99      VTSSLPGEGKTTTAVNTAVSLAQ-T-GASVVIIDADMRRPRLRSIF---GL----SD-R-
A0A352EX26      VTSSLPGEGKTTTAVNTAVSLTQ-T-GASVVLIDADMRRPRMRSIF---GF----SE-R-
A0A2V8MM59      VTSSLPGEGKTTTAVNTAISLAQ-T-GASVVIIDADMRRPRLRSIF---DL----AE-Q-
A0A2V8PFE8      ITSSLPGEGKTTTAVNTAITLAQ-T-GASVVIIDADMRRPRLRSIF---DL----PE-R-
A0A2V8PWS6      ITSSLPGEGKTTTAVNTAITLAQ-T-GASVVIIDADMRRPRLRSIF---DL----PE-R-
A0A2V8LCT5      VTSSLPGEGKTTTAVNTAISLAQ-T-GANVLIIDADMRRPRLRSIF---DL----SE-R-
A0A352FTJ9      VTSSLPGEGKTTTAVNTAISLAQ-T-GASVVIIDGDMRRPRLRSIF---DL----PE-R-
A0A2G6PYV5      LSSALSGEGKTVSSLNLAISFAQ-L-EKKTLIIDCDLRRPKLHKIF---NL----PN-A-
A0A2V8F956      VTSTGPGEGKSLVAANLAISLAH-A-TQRVLVLDADLRKPQVHDIF---EV----AQ-E-
A0A1F2S1W5      ITSSAPGEGKTMVVTNLAVALAQ-A-GHRVLLMDADMRKPRVHEVF---GV----PS-S-
A0A1F2T595      VTSSAPGEGKTVVSTNLSIALAE-A-GHRVLLLDADMRKPRVHEIF---------SRRVD
A0A2V8JQV5      VTSANPQDGKSTMASNLAVALAE-T-QRRVLVIDSDLRRPDLHRIF---HA----EN-R-
A0A2V9AC41      MTSATRGEGKTTTLVNTAIVFSQ-L-GIRVLVIDADLRRPRCHMLL---KM----EN-T-
A0A2V8K4L4      ISSANPSEGKTTVSTNLSIALSE-I-SQRVLLIDADMRRPRLHRLF---DL----KN-D-
A0A2V8NCZ3      ISSANPSEGKTTVSTNLSIALSE-I-SQRVLLIDADMRRPRLHRLF---DM----KN-D-
A0A2V9MAM9      ITSTLPAEGKTTVATNLGITLAS-I-QRRVLLIDGDMRQPRIHHIF---DL----PN-T-
A0A2V9M454      ITSAQPSEGKTATTLNLAVTLAQ-K-GSRVLLIDSDLRRPGLAKAL---KL----RN-Q-
A0A2V9IVR7      MTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADFRKPGIAAAM---GM----SN-E-
A0A2V9ILE2      MTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADFRKPGIAAAM---GM----SN-E-
A0A2V9LGY4      MTSAQPSEGKTCTSLNLSLALAQ-R-RVRVLVIDADFRKPGIAAAM---GM----SN-E-
A0A2V9J4D6      VTSGHPKEGKTATAVNLASLMAQ-T-GSRVLLVDCDLRIPGASKLM---GI----SN-S-
A0A2V9L9C5      VTSGHPKEGKTATAVNLASLMAQ-T-GSRVLLVDCDLRIPGASKLM---GI----SN-S-
A0A2N9M9N1      VTSAHPSEGKTFASVNLALALAQ-R-GGRVLLVDGDLRKPTVLRAL---GMGNGESE-A-
A0A2V9JEC4      ITSPLPCEGKTSCSINLAASLAQ-R-GGRVLLLDADLRRPGVARAL---SL----DG-K-
A0A2V9LPQ3      VASSQPKEGKTCTSINLALSLAQ-N-SVPVLIIDADLRKPGVTREL---NL----PS-T-
A0A348V070      FSSPLSKDGKSSVISNLGLALAQ-A-HKRVVIVDSDLRKPRQQEIF---NV----DY-T-
A0A2Z5G3A3      ITSSIEGEGKSTLAANFAVLLAR-Q-GKKVLLVDGDLRRPKLHTTF---DV----AM-E-
A0A2V7UGP8      VTSSEPQEGKTVTTLNTAISLTQ-S-GKKVLLVDGDMRRPRLHKAL---GS----GN-G-
A0A239MKT6      FTSGISGEGKSTTAYNMAVAFAL-Q-TKRVLLIDADMRRPTIRERV---NL----QQ-G-
A0A3E0PCN7      VTSGQPFEGKTINSLCLAKSMAE-L-GKKVLLIDADMRCPKMHLIN---DL----SN-T-
A0A2V8IYW3      VTSAISGEGKSLTITNLALTLTR-SYERRVLLIDADLRRPTLHTIF---KL----ES-P-
G2LEI9          ITSSQPGEGKTTTSFNTAISLAQ-T-GASVLLIDCDLRRPQLQKLFDSYGQ----ERTFQ
A0A317J121      VTSPGAGEGKTTIVSNLGTALAE-T-GRSVLILDGDFRRPRLHKVF---DL----AD-T-
A0A2V7YW66      VTSAMAGEGKTATAVNLAIVLAQ-L-GRQVLIVDCDLRKPRLHQVL---RV----SN-R-
A0A2V7Z0V0      VTSAVAGEGKTATASNLAVVLAQ-L-GRQVLLVDCDLRKPRLHQVF---RV----SN-R-
A0A2V8GFD4      ITSTAPEEGKTMVAANLAIALAM-T-SQRVLLVDADMRRPKIHQLF---AL----DQ-E-
A0A2V8HSS5      ITSTAPEEGKTMVAANLAIALAM-T-SQRVLLVDADMRRPKIHQLF---AL----DQ-E-
A0A2V8KP55      ITSAVPGEGKTVTAVNTAVIVAQ-T-GARVILIDADMRRPRMHKIF---KC----AN-A-
A0A399WNU1      VTSGEPSEGKTITSLNLAKSLAQ-L-GGKVLLVDADLRCPKMHLIN---NI----DN-S-
A0A2V9CG11      VTSPCQGEGKTTVASNLSIAIVE-L-GRRVLLIDGDLRRPRLHKVF---GL----CN-N-
A0A2V2R0I6      VTSALPREGKTTAAANLAVTLAQ-L-GDSTVVVDADLRKPGVGRLL---NL----SNNKY
A0A2V8XAR9      VTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----GSGKY
A0A2V8VZA0      VTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----AGGKY
A0A1Q7CB82      VTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----AGGKY
A0A2V8WIU1      VTSALPREGKTTAAGNLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----AGGKY
A0A1Q6Y9F5      VTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----AAGKY
A0A2V9EVV8      VTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----AAGKY
A0A2V8YF91      VTSALPREGKTTVAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----GPGKY
A0A2V8XZK2      VTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIGRLL---NL----GTGKY
A0A2V8ZTX6      VTSALPREGKTTAAANLAVTLAQ-L-GDSTVLVDADLRKPGIARLL---NL----GGGKY
A0A2V9BT79      VTSALPREGKTTAAANLAVTLAQ-L-GDRTVLVDADLRKPGIGRLL---NL----GAGKY
A0A1Q8B793      VTSALPREGKTTAAANLAVTLAQ-L-GDKTLLIDADLRKPGVGRAL---SL----GEGKY
A0A2V9BCA0      VTSALPREGKTTAAANLAVTLAQ-L-GDKTLLIDADLRKPGVGRAL---SL----GEGKY
A0A2V9BWU9      VTSALPREGKTTAAVNLAVTLAQ-L-GDRTLLVDADLRKPGISRAL---SM----SDGKY
A0A2V9DKX2      VTSALPREGKTTAAVNLAVTLAQ-L-GDRTLLVDADLRKPGISRAL---SM----SDGKY
A0A2V9JSI3      ITSSQPNEGKSCTCLNLALTLAQ-R-GGRVVIIDGDLRKPGVASVL---GL----AN-G-
A0A2V9WI32      VTSALPQEGKTTTSINSAIVLAQ-R-GGRVLLVDADLRRPGVHKAL---GL----RN-T-
A0A2V8IVN9      VTSTGPGEGKTTFASNLAVSLAQ-T-GQRVLLIDGDMRKPKLQEAF---GM----TQ-E-
A0A1F2TPT3      ITSASPTEGKTVVGSNLAVALAQ-A-GERVLLMDADLRRPMIHTHF---AF----PQ-E-
A0A2V8JTQ2      VTSALPGGGKTTVSTNLAILLAR-L-RRRVLLVDADLRRSQIHLAM---RL----SG-N-
A0A2V8UZY0      VTSAVPGEGKTTVCTNTAILLAR-L-HRRVLLVDADLRRPSIHRAM---RL----SC-N-
A0A3N5YNR8      VTSSVPGEGKTTTVANTGIVLAQ-T-GARTLLIDLDMRKPALASTF---GY----NG-N-
A0A350UEK1      VTSASPSEGKTTVATNLALAMAE-T-GQRVLLVDGDTRRPRQHGIF---EV----PN-D-
A0A350UIQ4      VTSPNPSEGKTTVATNLAVAMAE-T-GQKVLLIDGDTRRPRIHGIF---EI----EN-E-
A0A3N6A5T6      VTSALPAEGKTTTALNAAIVLAQ-T-SARTLLIDLDMRRPKIGSHF---GL----NG-H-
A0A1F2Q9L4      VTSAIPGEGKTSTAVNLAVVLAQ-L-GRQVLLVDADLRKPRLHEIF---GV----SN-R-
A0A1H5SQF5      FTSSFSGEGKSTLTSNMAFAFGL-Q-GSRVLLMDADMRRPTLHTKL---GL----TN-G-
A0A3E0NV31      VTSALPAEGKSTTVANMAISFAN-N-NARTLIIDLDLRKPALAPLF---EV----DS-E-
A0A3N5M5V0      VTSSIPGEGKTTTVANTGIVLAQ-T-GARTLLIDLDMRKPALAGTF---GF----TG-N-
A0A2V9AEW6      LTSPCLGDGKTTVACNLSIAMAE-I-GRKVLLIDGDLRRPRIHQVF---GM----TN-R-
A0A2V8WQK6      LTSACPGDGKTTVACNLSIAMAE-I-GRKVLLIDGDLRRPRLHKIF---GV----AN-T-
A0A2V8XIF4      LTSPSSGDGKTTVACNLAIAMAE-I-GRKVLLIDGDLRRPRLHKVF---GA----PN-N-
A0A3N5XQP8      IASAMPGEGKTTTAAYTGVVLAE-T-GAPTVLIDLDLRRAGLTGLF---EI----EN-K-
A0A2Z5G7H4      ITSSVAGEGKSILSANLAAVLAQ-S-GRRVLLVDADLRKPSLGDRL---GM----ES-R-
A0A2V9L5B5      ITSALPGEGKTTTAVNLGAALAS-L-GSKVVVIDCDMRRPSCHRSV---GV----KN-S-
A0A2V9LK56      VTSALPSEGKTTITVNMGATLAS-L-GSKVLVLDCDMRRPTCHRAT---GV----PN-R-
A0A2V9L7I0      ITSALPGEGKTTTTVNLGAALAS-L-GSRVVIVDCDMRRPACHRST---GV----RN-A-
A0A522PPT0      VTSALPGEGKTTTTVNLGATLAS-L-GSKVLILDCDMRRPACHRAT---GV----RN-S-
A0A2V9KCS3      MTSSAPGEGKTTVTSNLAIALAE-I-SRRVLVIDADMRRPRIHDIF---DV----AN-T-
A0A2U3KC61      VTSAMPQEGKTTVSANSALVLAQ-R-GSRVLLVDADLRRPSIAKLF---GF----QS-R-
A0A2V9Y2R7      VTSALPQEGKTTISANSAVVLAQ-R-GSRVLLVDADLRRPGIGKMF---GI----RS-G-
A0A372IT17      VTGTRDAEGKSTIALNLAAILAH-Q-GAQVLLVDGDLRRPALHRYL---NM----PE-S-
A0A136JPP4      VTSSQPSEGKTMTAINTAITLAQ-A-DADVVLIDCDLRRPRMHSHF---GL----SN-S-
A0A399WUJ8      VTSSQPSEGKTTTAINTAVTLAQ-A-DADVVLIDCDLRRPRMHSHF---GL----SN-T-
A0A2V9NGH6      VTSALPSEGKTTTSINTAIVLAQ-K-GNRVLLVDADLRRPSIHKTL---GM----GP-R-
A0A2V9PYE6      VTSALPSEGKTTTSINTAIVLAQ-K-GNRVLLVDADLRRPSIHKTL---GM----GP-R-
A0A2V9NL07      ITSALPQEGKTTTSINTATVLAQ-K-GTRVLLIDADLRRPSIHKTL---GM----GP-R-
A0A2V9QD92      ITSALPQEGKTTTSINTATVLAQ-K-GTRVLLIDADLRRPSIHKTL---GM----GP-R-
A0A2V9WPZ6      ITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADLRRPGVHKAL---GM----GP-R-
A0A2V9ZLH4      VTSAMPQEGKTTTSINCAIVLAQ-K-GTRVLLVDADLRRPGVHKAL---GM----GP-R-
A0A2V9RQF1      ITSALPQEGKTTTSINTAVVLAQ-K-GTRVLLIDADLRRPSIHKTL---GM----GP-K-
A0A2V9YDK8      VTSALPQEGKTTTSINCAIVLAQ-K-GVRVLLIDADLRRPGVHKTL---GM----GP-R-
A0A2V9V8F7      ITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADLRRPGVHKAL---GM----GP-R-
A0A2V9XGR9      ITSALPQEGKTTTSINCSIVLAQ-K-GVKVLLIDADLRRPGVHKAL---GM----GP-R-
A0A2V9V3Q5      VTSARPQEGKTTTAINSAIVLAQ-K-GVRVLLVDADLRRPSVHKTL---GM----GP-R-
A0A2V9NWS3      VTSALPQEGKTTTSINTAIVLAQ-K-GTRVLLIDADLRRPSIHKAL---NI----AT-K-
A0A2V9USA9      VTSALPQEGKSTTSINCAIVLAQ-K-GVRVLLIDADLRRPSIHKTL---GM----GP-R-
A0A2V9XW18      VTSALPQEGKTTTSINTAVVLAQ-K-GVRVLLIDADLRRPSIHKTL---GM----GP-H-
A0A4R1LC91      LTSSIEGEGKTTLSINLAILLAQ-Q-GKRVLLVDADLRRPSLHKSF---NV----SD-T-
A0A3M2BZG9      VTSAEPGEGKTATTTNLGVVMAQ-L-GRSVLIVDCDLRRPRMHQVF---KT----SN-R-
A0A1Q7N5R7      ITSPAVGDGKSFVSTNLALACAQ-A-GQRTMLVDGDTRRGALHRVL---GG----VR-K-
A0A3M1SIV3      ITSSQPSEGKTTIAVNTAVALAQ-A-GADVVLIDCDLRRPRIHQHF---SL----KN-S-
A0A3E0PHB0      VTSSQPSEGKTTTAINTAITLAQ-S-GAEIVIIDCDLRRPRLHSLF---DL----EN-T-
A0A3M2D491      ITSSQPAEGKTTTAINTAIALAQ-S-GADVVLIDCDLRRPRIHEHL---SL----SN-K-
A0A357F267      VTSSQPSEGKTTTAINTAVTLAQ-S-DVDVILVDCDLRRPRLHSYF---DL----DN-T-
A0A353C9L6      ITSSQPSEGKTTTAINTAITLAQ-S-DVDVVIVDCDLRRPRLHSHF---DL----EN-T-
A0A2V8RQV0      VTSSQPSEGKTTTAINTAITLAQ-S-DVDVVIVDCDLRRPRVHSYF---DL----DN-T-
A0A2V8SJH5      VTSSQPSEGKTTTAINTAVTLAQ-A-DADVVIVDCDLRRPRLHTYF---DL----EN-T-
A0A2V9QB26      LTSAGPKEGKTMVASNLGIALAE-T-KRKVLIIDGDLRKPRMHELF---GL----PN-G-
A0A2V9VYY4      VTSAMPREGKTTISANSALVLAQ-R-GSRVLLVDADLRRPGVEKLF---GV----RA-H-
A0A2V9KIE8      ITSALPGEGKTTTTVNLGVALAG-L-GSKVLIIDCDMRRPACHRAT---GV----EN-K-
A0A352F549      VTSSVPAEGKTTTVVNTATVLAQ-T-GAQVLIIDADMRRPRLHQVL---DM----SN-D-
A0A3B9MLP9      VTSSVPAEGKTTTAVNTATVLAQ-T-GAKVLLIDADMRRPRLHHVF---GL----SN-N-
A0A3D5SQ87      VTSSVPAEGKTTTAVNTATVLAQ-T-GAKVLLIDADMRRPRLHHVF---GL----SN-N-
A0A2V8NW86      LTSAGPKEGKTTVATNLGIALAE-T-KRKVLIIDGDLRKPRMHELF---DL----PN-G-
A0A2V8ZHL8      ITSATAREGKSTTALNLAIALAQ-R-GDSTLIIDADLRRPGIAESL---DL----ID-G-
A0A2V9B240      ITSATAREGKSTTALNLAIALAQ-R-GDSTLIIDADLRRPGIAESL---DL----VD-G-
A0A2V9CBM2      VTSTQPSEGKTTVASNLAIALAQ-L-GRRVLLVDADLRSPSLHRLF---GA----RE-S-
A0A2V8XN17      VTSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKLF---GI----DR-S-
A0A2V8WX45      VTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLVDADLRFPSLHKLF---GT----SG-S-
A0A1Q6YR79      ITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKLF---GI----DR-T-
A0A1Q7VA32      ITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKLF---GI----DR-T-
A0A2V9EY85      ITSTQPADGKTTVACNLAISLAQ-L-GHRVLLVDADLRSPSLHKLF---GI----DR-T-
A0A2V9H8K0      VTSTQPAEGKTTVACNLAISLGQ-L-GHRVLLLDADLRFPSLHKLF---GT----SG-S-
A0A2V9FFE5      VTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLLDADLRYPSLHKLF---GT----SG-S-
A0A2V9GM43      VTSTQPAEGKTTVACNLAISLAQ-L-GHRVLLLDADLRYPSLHKLF---GT----SG-S-
A0A1F2RFI7      VTSGQPGEGKTTTVVNLAIALVQ-L-GGRVLVVDSDMRRPRVGNLL---EL----PA-TP
A0A1F2RZS3      ITSGQPGEGKTTTTVNLAIALVQ-L-GGRVLVVDSDMRRPRIGTLL---KL----PT-TP
A0A1F2USE2      VTSAQPGEGKTTITLNLAISLAQ-L-GQRVLLIDGDMRRPCLHKVF---QL----YE-S-
A0A2V9C238      VSSSQPSEGKTTVSINLAISLAQ-L-GQRVLLIDGDMRRPSVRKAF---DI----DN-S-
A0A1F2Q9F5      TSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADLRRPCIHKAF---KM----AG-G-
A0A1F2QQH9      TSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADLRRPCIHKAF---KM----AG-G-
A0A1F2QXK7      TSSAQPGEGKTTVTLNLAISLAQ-L-GERVLLVDADLRRPCIHKAF---KM----AG-G-
A0A2V9DEM9      VSSSQPSEGKTTVSINLAISLAQ-L-GQRVLLIDGDMRRPSVRKAF---DI----DN-S-
A0A2V9CYQ5      VTSTQPSEGKSTVATNLAIALAQ-I-GRRVLLVDADLRSPSLHRLF---GA----RE-S-
A0A2V9BWU8      ITSTQAGEGKTTIATNLAISLAQ-L-GQRVLLVDADLRFPSLQRLF---CI----RE-S-
A0A2V8ZG48      ITSTQPGEGKTTVATNLAISLAQ-L-GQRVLLVDADLRFPSLEKLF---CI----RE-N-
A0A2V8Y334      VTSTQPGEGKTTIATNLAISLAQ-L-GQRVLLVDADLRFPSLQKLF---CI----RE-T-
A0A2V9AY68      VTSTQSGEGKTTIATNLAISLAQ-L-GQRVLLVDADLRFPSLQKLF---CI----RE-C-
A0A257VBK0      VTSASPKEGKTSVSANLAKTLAA-G-GDRVLLMDCDLRRPSIHRIL---KA----PA-GV
A0A2V7XDY0      VTGTVPQEGKTTTIVNLGKLLAS-S-GEKAVLVDFDLRRGQLHSRL---GL----TR-EP
A0A350UQT3      MTSATASEGKSTTAGHLAFAHAE-Q-RKRTLLIDCDLRRPSQHKLF---GI----PL-GA
A0A2U3JZ71      ITSSGPAEGKSTTAAHLALAHAQ-Q-GRKTLLIDGDLRRPSIHRRF---EV----PS-TR
A0A2V8TTB0      LTSASPSEGKSTVAAHLAATHAG-Q-HKRTLLIDGDLRRPSVHRLY---QV----PN-SV
A0A1F2TCR2      VTSSQPLEGKTTTACNLAMVLAL-G-GSRVLLIDADMRRPGLHKIV---GI----PN-SV
A0A1F2V330      ISSVVGGEGKTVTSLNLSLALAGTV-SGRVLLIDSDLRKPRVHEYL---GL----KP-GK
A0A662EE63      VTSSVPSEGKTTASFNLAKVLAA-G-GARVLLIDGDLRKPRLHHMM---KV----KN-MR
A0A2V8TLH7      VTSAGPQEGKSCTSVNVARTLAN-A-GEKVVIIDCDLRRPTVHQWL---KL----SK-DQ
A0A1Q7ZJT1      ITSAGPQEGKSCTTVNVARTLAT-A-GEKVIIVDCDLRRPAIHTRL---NL----GR-DG
A0A2V8VC99      ITSAGPQEGKSCTTVNVARTLAT-A-GERVMILDCDLRRPAIHTRL---NL----SR-DH
A0A348UZU3      ITSPLPNEGKSVTISNLAVSLAQ-T-EKKVLLMDADLRRPKQHRIF---NL----KN-HD
Q01XL7          ITSGGPGEGKTTLSANLAIAMAM-I-GQRVLLIDADLRRARLHSVF---GL----DN-CP
A0A2V8ERZ5      VTSAQPLEGKTTTAANIAMALAY-G-GARVLLIDADMRRPGLHRPL---RL----TN-DR
A0A2V8GTX0      ITSTQPLEGKTTTAVNVALALAI-G-GARVLLIDADMRRPSLHKAM---RL----PN-DR
A0A2V8J0X9      VTSSQPLEGKTTTACNLAMALAF-G-GSRVLLIDADMRRPGLHKTV---GL----RN-ET
A0A523DUV7      VTSSIPQEGKSTTAVNLAKALAE-S-GDPTLVVDFDLRRSSIHTHL---RL----YR-EP
A0A372IRG7      LTSGFAAEGKSTCSSNLAVSFAQ-R-NARVLLVDTDLRKGTLHMKF---RL----SN-RT
A0A1F2U158      VTSAQPLEGKTTTAANIAMALAY-G-GARVLLIDADMRRPGLHRSL---RL----TN-DR
A0A2V8F6S9      VTSAQPLEGKTTTAANVAMALAY-G-GSRVLLIDADMRRPGLHRPL---RS----TN-ER
A0A4Q1SCH5      VTSSLPGEGKSSTSANYAVVLAQ-N-GAKVLIIDADLRRPTLHKIF---GV----SN-TI
A0A3D1ASD2      LTSASPSEGKSTVAAHLAVAHAE-Q-KHRTLLIDGDLRRPSLHKFF---DM----PM-NA
A0A2N9MK30      VTSATPGEGKSTVCVHLAMAHAQ-Q-NHRTLLIDCDLRRPSVHRRL---GL----TS-ET
A0A4Q7YNP3      VTSPNAGDGKTTVTSNLGVALSK-S-NLRVVILDGDLRKPGMHNAL---HV----PN-DV
E8UZE1          ICSAWTKEGKSTITINLATVLAQ-M-NRKVLLVDADLRRPSLHHKL---GL----PK-TE
A0A1V6HR88      ITSSIPGEGKTSTASNLAIVLAQ-L-GKNVLLIDGDLRKSRLHELF---GM----SN-RA
A0A3E0P0A3      VTSTEAQEGKTATALNLAIVMAQ-L-ARRTLLIDGDLRKPRIHEAL---GI----SN-RV
A0A2V8EXP2      VTSAGPGEGKTLVASNLAVAMAQ-A-AQRVLLMDADMRRPRVHSLF---GI----AQ-EP
A0A2W4RYA1      VTSTGVGEGKSVVAGNLAVAIAQ-T-GQRVLLVDADLRRPRAHGLF---GL----AQ-EP
G8P0Y7          VTSSVPEDGKTMTSINIAIVMAQ-Q-EKRILLVDADMRRPSVHTAF---KI----KG-HV
A0A5M8T4U7      ITSAFPGEGKTTTAVNCALALAQ-R-GERVLLVDADLRRGTLHQVF---RI----ND-RS
A0A3P0X3W6      VTSAVAGEGKSTCTAHLAIAHAM-Q-GRKTLLIDADLRRPSQHNHF---SL----PN-EE
A0A1E3Y9R6      VTSTGPHEGKTVVSSSLAITLAQ-A-GQRTIVVDADMRRPRMHEAL---DR----SQ-EP
A0A2W4TLP2      ITSTGPHEGKTVVSSSLAIALAQ-A-GQRTVVVDGDMRRPRMHEAL---DR----SQ-EP
A0A3R9WF43      VTSPHGGDGKTTVAYNLAVAFAQ-Q-GSRVVLLDADLRNPDLHRLF---GC----EN-SP
A0A317HKM4      VTSSEPGEGKTVTAANLAASLAG-L-HQRVLLIDADLRKPGLHQLF---GE----EQ-QP
A0A523E0N1      VTSPDKNCGKTFISSNLSCALGQ-L-DKKVLLIDSDLRNPRLHRVF---RY----RN-RV
A0A523ECP2      VTGPDKNAGKTFVACNLATSLAD-L-DKKVLLIDADLRNPQLHKVF---RF----KN-RV
A0A2W0C122      VSSPLPAEGKTMTAANVAVVLAQ-Q-GKAVLLVDADLRKPGLDREF---GI----AG-TP
A0A2W0AUU7      VSSPLPGEGKTMTAANLAVVLAQ-Q-GKRVLLVDADLRKPGLDREF---RI----AS-TP
A0A2W0BQL1      VSSPLPGEGKTMTAANLAVVLAQ-Q-GKRVLLVDADLRKPGLDREF---RI----AS-TP
A0A4Q1SDL1      VTSASPGEGKSLTAKNLAVSTAQ-Q-GKRVLLIDADLRKPSDKKGL---EF----SG-KD
A0A3P0XH15      LTSSFATEGKSTCAANLAISFAR-R-SARVLLVDTDLRKGTLHMKF---RT----SN-RF
A0A4R1LAZ7      LTSSFAAEGKSTCASNLAISFAQ-R-NARVLLVDTDLRKGTLHIKF---RR----SN-RV
A0A3M1WQW8      FTSSSPGEGKTTTAVNTAISLTQ-T-GARVMLIDGDLRKPGLHKML---SI----NH-QP
A0A3N1JHC1      VTSPHPRCGKTVTIANLAISLAE-G-GRRVLLIDGDLRRPALPQLF---GV----QN-IE
C1F294          LTSGLAAEGKSTCAANLAISFAQ-R-PARVLLVDTDLRKGTQHLKF---RV----SN-RV
A0A2V9KA79      ITSAAGGEGKTLTSVNLSLALASTF-EGQVLLVDADLRKPRIHHYL---DI----RP-GT
A0A522PSP1      VISSRPEEGKTTIAMALAMSMAA-L-GRRTVLVDGDLRRPQVHRIL---DI----PN-RL
G8P085          VSSTIPGEGKSSTTANYGVVLAQ-K-GARVLLVDADLRRPALHSKF---GV----EN-KR
A0A4Q1SGQ1      ITSAVAGEGKSTIAANLAGVLAQ-S-GERVLLVDADLRRPGIYHEL---GM----PA-GL
Q1ILD9          VTSALPGEGKSTISMNVAGTLVQ-R-GARVLLVDADMRRGRLASRA---GA----QE-GD
Q1IJZ6          LTSSLPGEGKSTTTYGLGRCFGS-L-GTRVLLIDADLRRPTLHKHA---MK----EN-DR
A0A2V8TCE6      VASTRPEEGKSTIAINLATVLAQ-S-GKKVLLVDSDLRRPRLHRAF---GL----RN-GS
A0A522TBE8      ITSALPAEGKSTAAGHLAASMAQ-M-GQSTLLVDGDLRKPRVHRLF---GV----AN-QR
Q1ITG0          ITSAQPGDGKSTVSVNISAVLAQ-S-GARVLLVDADLRRGVLARNL---KV----MP-EG
A0A3N5PCI5      VTSAAPGDGKSIVAVNLAVALGR-S-GGRVLVIDADLRRPVLHQVL---EC----EQ-RP
A0A3M1Q0S9      VTSCQPGEGKTTTAINLATTLAQ-L-GRRVLVVDTDLRRPRCHQIL---KA----ST-GR
A0A2Z5G448      ITSSLEAEGKSTIAANLAISFAR-R-DARVLLVDTDLRRGTLHLKF---RL----PN-RE
A0A3M1VZ38      VTSCQPGEGKTTTAVNLAIALAQ-L-GRQVLLVDSDLRRPRCHDVL---GV----EK-DR
A0A4Q1SD29      ITSSFAAEGKSTCAANIAISFAQ-R-SARVLVVDTDLRKGTLHMKF---RM----SN-RV
A0A3M1PY35      VTSALPGEGKSTFSANLARTLAA-F-GDRVVLLDADLRHPRLHRAF---KA----PR-DR
A0A3M1VMP2      VTSALPGEGKSTIAANLARTLGA-F-GRKVVLIDADLRHPRLHRVF---RV----PS-ER
A0A2V8G155      VTSTAPGEGKSVIASNLAMSLAH-S-GARVLLVDGDMRKPRGHELL---GG----PQ-E-
A0A2V8HDM7      VTSTAPGEGKSVIASNLAMSLAH-S-GARVLLVDGDMRKPRGHELL---GG----PQ-E-
A0A2V8DRT9      VTSSGPGEGKTVVSSNLALALAQ-T-GQRVLLIDADMRRPRVHQVF---AE----RQ-E-
A0A2V7VYF3      VTSTGPGEGKTVVSSNLALALAQ-A-NQRVLLVDADMRRPQIHSYF---SH----PQ-E-
A0A1F2SVH2      ITSTGPSEGKTVVATNLAVALAQ-A-GQRVLLMDADMRKSRVHIVF---DR----SQ-G-
A0A2V8AJG9      ITSTAPGEGKTTVASNIGIALAQ-A-SQRVLIVDADMRKPRVHSVF---GQ----TQ-E-
A0A2N9LQU7      VTSAFPSEGKSVSSCNLAITLAQ-R-GSRVLLVDADLRRSTLLRQL---GL----EAGTS
A0A2P6WFK7      VVSSVPAEGKTTVSVNLASAFAQ-R-GESVLLIDADLRRSTTHTHF---GL----PY-SR
A0A2V8U914      ITSPLAGEGKTTVSSNLGIALAE-V-RGRVLLIDGDMRRPRLHKIF---GL----AN-S-
A0A2V7W309      ITSSFAREGKTTTSVNLATVLAQ-M-GKPVLLIDADLRRPRLQKVF---PG----KL-N-
A0A2W0BGU4      ITSAKIGEGKSSTALNLAMALAQ-C-GSSVVLLDCDLRKPVLARLL---GI----QN-E-
A0A2W0BVQ9      ITSAKIGEGKSSTALNLAMALAQ-C-GSSVVLLDCDLRKPILARLL---GI----QN-E-
A0A2V9MN96      VTSALPQEGKTTVSANSAVVLAQ-K-GGRVLLVDADLRRPGVARAL---GL----KT-S-
A0A2V7V2Z1      VTSTSAGEGKTVTSVNLALILAS-L-GGRVLLVDCDLRRPQSHVLL---RG----RK-S-
A0A2V7X2F7      VTSTAPGEGKTLTSVNLSLTLAS-S-EGKVLLIDADLRRPQAHTLL---RG----RR-T-
A0A2V7V2I1      LTSTAPGEGKTLTSVNLALTLAT-M-DGQVLLLDADLRKPQAHELL---GL----KK-S-
A0A2V7U3M2      VTSTSAGEGKTVTSVNLALILAS-L-GGKVLLIDCDLRRPQSNTLL---HA----KR-S-
A0A2V7UHT0      VTSTSPGEGKTVTSVNLALILAS-M-GGKVLLIDCDLRRPQSHTLL---RG----KK-S-
A0A2Z5FVL3      VTSSTEGEGKSTLSSNLAVVLAQ-Q-GKRVLLVDADLRRPNLHVLF---NS----SL-E-
A0A2V9KBD6      VTSALAAEGKTTVSANLAILLAR-L-RRRVLLIDADLRRPRIHLAM---QL-----N-AT
A0A2W0AJ66      MTSALPSEGKTTVAMNTAIALAR-L-GRRVLLVDGDLRRPSVHRAM---QL-----T-ST
A0A1Q7RBU1      VTSALPREGKTTVSTNLAIAIAR-L-RKRVLLVDADLRRPSIHRAM---GL----KT-TN
A0A2V9JPV9      VTSALPREGKTTVSTNLAITLAR-L-RRRVLLVDADLRRPSIHRAM---GL-----S-TN
A0A1I6MH75      FTSATPSEGKTTTACNLACILAQ-R-DTRVLLIDADLRRPNVHHRF---GL----SG-K-
E8WVF6          FTSATPSEGKTTAASNLAVILAQ-G-GTRTLLIDADLRRPNVHHRF---GL----NG-K-
A0A1H5Z7N3      VTSSTPSEGKTTVSTNLATVLAQ-R-DVKTLLIDADLRRPTVHHRF---GL----NG-K-
A0A2V9YHT3      VTSALPQEGKTTTAVNCGIVLAQ-Q-GSRVLLVDADLRRPAVHHSL---GI----RS-NG
A0A1G7JVV8      ITSSTPSEGKTTVSTNLAAILAQ-R-ETRVLLIDADLRRPNVHHRF---GL----NG-R-
A0A1H4T6W9      ISSSTPGEGKTTVATNLAAILAQ-R-DTKVILIDGDLRRPNVHHRF---GL----NG-R-
I3ZEU5          ISSSTPGEGKTTVATNLAAILAQ-R-ETRVLLIDADLRRPNVHHRF---GL----NG-R-
A0A428MDU2      FTSATPSEGKTTTASNLACILAQ-R-DARVLLIDADLRRPNVHHRF---GL----NG-K-
A0A5B9EBI2      FTSATPSEGKTTCSTNLSCILAQ-R-ETRVLLIDADLRRPSVHHRF---GL----NG-K-
A0A239HDF6      FTSAAPGEGKTTTSINLAAILAQ-R-GARVLLIDADLRRPAVHVRL---GL----EG-R-
A0A4Q0T270      FTSSTPSEGKTTTACNLACILAQ-G-DVRVLLIDADLRRPNVHHRF---GL----SG-K-
A0A1Q3QQB6      LTSATPSEGKTTLSTNLACILAQ-G-DARVLLIDADLRRPSVHHRF---GM----SG-K-
A0A3N1K1G7      FTSATPSEGKTTTASNLACILAQ-A-DTRVLLIDADLRRPNVHHRF---GL----NG-K-
A0A4V2G466      LTSATPSEGKTTASTNLATILAQ-G-DARVLLIDADLRRPTVHQRF---GL----TS-K-
A0A6B9YNQ8      LTSATPSEGKTTASVNLATVLAQ-G-NARVLLIDADLRRPTVHEQF---GL----SA-R-
                        **:      .            :::* * *                      

A0A2V7VMF7      PGFTDYFV-----RHEDLDSLIQS--TRVPNLFALTAGPLP-PNPPAMLARKNVADLFSH
A0A2V7YYV7      VGLSNLIL-QDAAESEAIAT-----VESVPNLCVLTSGPTP-PNPSELLGSGRMRELMAR
A0A2V7Z0J5      IGLSNVII-QDAAEEETITA-----VDAVPNLWLLTSGSIP-PNPSELLGSGRMRELIGH
A0A2V7Z3M4      VGLSNVIL-GATTEEATVIA-----VDSVPNLWLLTSGPTP-PNPSELLGSGRMKDLMSR
A0A399Y5V2      EGVTTAIL-AERPLVDL-LQRPRI-AGAPPSLLALTSGPIP-PNPADLLGSARVSELIET
Q01X01          WGLSDLLR-EKNAIEDLPLDVLVK-KTAVPRLSLLPSGTGT-DNIFGLLCSGRMARLLPR
A0A3M2D9H8      LGLSDILR-EHSTLDESLHHLTTE------GIDVLTSGTLP-PNPAEVLSSERMATLLSE
A0A2V8JK38      NGLSSVLE-GHC----SLENAVSE--TNIKNLFLLPSGPVR-PNPGELILSPRFKEVLKS
A0A2V9IXG5      ---------GNSIFSPVEGLKLRVEQTQLPSLHLTVAESLP-QNPPYLLSQPSLRDFISY
A0A2V9J2P4      ---------GNSIFSPVEGLKLRVEQTQLPSLHLTVAESLP-QNPPYLLSQPSLRDFISY
A0A1Q7RLS4      GGVTNYIL---SSEGDDWRSYIKN--TDMPNLYAMTCGPIP-PNPADVFGHERFLSLLKE
A0A2V2R525      HGLSTLLA-GKN-NQAEMLSLIHQ--HEETGLYVLPAGPPP-IKPAELLSSGQMRRLLEI
A0A321LPW6      AGLSTYLS-REI-DVEALIHTQ-----ELKNLSLLPCGPIP-PNPAELLSSQKMKDLLSA
A0A2V9R9V4      LGLSTYLV-RNV-EIDELTQDL-----PGENLRMISSGPIP-PNPAELLSSERMKRLLAQ
A0A321LE75      HGLSNYLS-RDV-AIDGLIQKL-----PIPNLSILTCGPIP-PNPAELISSEKMKNMLAM
A0A2V8R8U7      RGLTNCLS-GES-EVADLLQTY----DKLPKLKLLTSGPIP-PNPAELLGSEEMRKLLVS
A0A2V8QMP4      RGVTNYLS-GEA-QVSELVQTY----DKLPNLKVITSGPVP-PNAAELLGSEEMRRLLYV
A0A2V8R4S3      RGVTNYLS-GEA-QVSELVQTY----DKLPNLKVITSGPVP-PNAAELLGSEEMRRLLYV
A0A2V8NJ55      KGLTNCLS-GDL-NTDELIQAY----EKLPNLKIMTSGPVP-PNPAELLGSDEMRKLLNS
A0A2V8Q7I0      RGLTTWLS-GEK-DLDGIIQTC----PRVPHLKILTSGPVP-PNPAELLGSEEMRRLLGQ
A0A2V8S6K4      RGVTNYLS-GEI-NVSELIQTY----DKQPNLKVITSGPVP-PNAAELLGSEQMRRLLQL
A0A317I2L9      RGLTTWLS-GEK-DLDGLLQSL----PRNPNLKILTSGPVP-PNPAELLGSEEMRRLLGT
A0A2V8LLF9      RGLTNCLS-GDGKDLDALLHVY----DKQPNLKLLTSGPIP-PNPAELLGSDEMRKLLIL
A0A352FRF4      RGLTNCLS-GEASEIDSVIQSY----AALPNLKLLPSGPMP-PNPAELLGSEEMRNLLLS
A0A2V8MKV0      RGLTNFLS-GEL-PLDEVIQPF----EKLPNLKLLPSGPIP-PNPAELLGSEQMRRLLTL
A0A2V8PYY8      RGLTNHLS-GEL-PLDEVIQPF----DKQPNLKLLPSGPIP-PNPAELLGSEQMRQLLTS
A0A1Q7YKQ8      RGVTNYLS-GEA-GLDELIRSY----DKLPNLKLMTSGPVP-PNPAELLGSDEMRKLLSE
A0A352F3R7      KGLTNWLS-GET-DIDNLMQTL----PAQPNLKFLTSGPVP-PNPAELLGSDEMRKLLGI
A0A0B6WXT1      KGVANYLA-GER-NLDALMQTY----APLPNLKIMTSGPVP-PSPAELLSSEEMRRLIDE
A0A3B9MEU8      KGLTNWLS-GET-DIDALIQTY----EQHANLKFLTSGPVP-PNPAELLGSDEMRKLLGI
A0A2V8MHG6      KGLSGILA-SKM-TEGEMLGCVQQ--HEESSLYLLPSGRLP-PNPAELLGSDQIRSLMSV
A0A2V8P7N1      KGLSGILA-SKM-SEAEMLNCVQQ--HEESSLYLLPSGRLP-PNPAELLGSDQIRSLMSV
A0A2V8M3M6      KGLSGILA-SKM-SEAEMLNCVQQ--HEESSLYLLPSGRLP-PNPAELLGSDQIRSLMSV
A0A1Q7NJH5      KGLSGILA-SKM-SEREMLGWVQQ--HEESSLYLLPSGRLP-PNPAELLGSDQIRTLMSV
A0A2V8PJY0      KGLSGILA-SKM-SEREMLGWVQQ--HEESSLYLLPSGRLP-PNPAELLGSDQIRTLMSV
A0A1Q7Y6W9      KGLSTYLS-SDM-SDAELLDMIEQ--HGASGLHYLTSGPVP-PNPAELLGSEQMRKLLSC
A0A2V8NC68      SGLSTILA-NKM-SEAEMLSLVEQ--HEESGLYMLSSGPIP-PNPAELLGSDQMRRLIAA
A0A399WK13      DGLSTILS-NDL-SEAEILNIITQ--DESSKLHLLTSGPVP-PNPAELIGSDQMAKLLKM
A0A352FLX4      SGLSALLS-REA-SEAEIISAIQH--DEASGLSVLTAGPVP-PNPAELVGSEQMLKLLSV
A0A2V8RTL7      QGISTVLS-SEL-STKEILDVINY--DERTKVSVMTSGPIP-PNPAELIGSEQMVGLLKT
A0A3E0PCJ6      EGLSTVLS-SDL-AEKEILNLVKK--DEASGLYLMPSGPLP-PNPAELVGSEQMKRLLVT
A0A3M1S4R8      EGLSNLLS-SEI-KRDKVLDSVYF--DMSSRLYLLPSGPVP-PNPAELIGSTQMSTLMEI
A0A1Q7YFI6      RGLSTILS-TDM-SAAEMLSLIEQ--QAGSGLYLLSSGPVP-PNPSELIGSEQMQRLLAT
A0A136KC10      DGLSTILA-NEL-SEAEILNLITQ--DPSSKLHLLPSGPIP-PNPAELIGSEQMAKLLKT
A0A2V8SEX6      DGLSTILS-TEM-TEKEILKVVKQ--DEGTKLNLLTSGPIP-PNPAELIGSEQMANLLKL
A0A3M2D6Y5      EGLSNLLS-SEI-KADKVLDKVQF--DSAAKLYILPSGPVP-PNPAELIGSKSMLNLMEI
A0A0B6WWQ6      RGLSTLLS-SEI-RNGDAFKCIH---DSARGVQVLTSGPLA-PHPAELLGSDQMRALLEE
A0A3B9MK99      AGLSSILS-SDV-SEADMLEMVST--DEATGLRVLTSGPIP-PNPAELLGSDQMRRLMAT
A0A352EX26      PGLSSILS-SDV-SREDTLAMISK--DEVTGLHVLTSGPIP-PNPAELLGSEQMRRLMTL
A0A2V8MM59      TGLSSILS-SAM-TEAEMLGSVHQ--DEASGLHVLSSGPIP-PNPAELLGSDQMRKLIAV
A0A2V8PFE8      EGLSSILS-SEI-KPEDMLHAIHR--DEATGLNVLASGPIP-PNPAELLGSEQMRKLIAV
A0A2V8PWS6      EGLSSILS-SET-KPEDMLHAIHR--DEATGLNVLASGPIP-PNPAELLGSEQMRKLIAV
A0A2V8LCT5      EGLSSILS-SEM-KPDQMLGAIVK--DPTTGLNVLTSGPVP-PNPAELLGSEQMRKLIAV
A0A352FTJ9      DGLSSILT-SEA-TPEDMLRSVAR--DESSGLFVMSSGPVP-PNPAELLGSDQMRKLLAT
A0A2G6PYV5      KGLVTSLV-KGK----SPIDFIQS--TKIPHLFLLSSGPLP-PNPAELVASQKMREVLTE
A0A2V8F956      PGLSNLLA-GQA----KASESVRK--TAIPGLWVLTSGRIP-PNPAELLGSQRFKDFLVS
A0A1F2S1W5      PGLSNLMV-ANA----TASEVIQE--SSTPGLWVLSAGTHP-PNPSELLGSKRFKEFAAF
A0A1F2T595      PGLSNLLV-GNA----TASESIFE--SEIPGLWLMPAGTHP-PNPAELIGSRRFRDFTAF
A0A2V8JQV5      WGLIDILQ-GDIEIRDYPLDMLAR-QTEVPNVHLLTSGTAS-RSVVHLLHSTRLPELLQR
A0A2V9AC41      AGLADVLA-GQI----GMEEAIRP--TQAENLFLISAGTIP-PNPAELLGSRKMHELLQQ
A0A2V8K4L4      KGLSELLL-SKHALKTSEVVGAVR-ESWIPGLHILTSGPWA-ANASTLLYSARLPEIIEI
A0A2V8NCZ3      KGLSELLR-EKHSTKTSEVLEAAR-ETWIPGLHVLTSGPWA-ANASTLLYSARLPEIIEI
A0A2V9MAM9      WGFSNLLR-GAD----ELPMDTIVKRTTVPNLYVLSSGPGT-EDIFSLLFSPRLRRLIER
A0A2V9M454      NGLAEILT-GAC----EFDETLLEKVEGLDRLSLLPAGPYP-PNPAELLCSTKMENLIKH
A0A2V9IVR7      RGLSNILR-GEQ----SVDEVLLQ-AHTLPNLWVLPAGPVP-SNPTDLLSSPDMARLVEE
A0A2V9ILE2      RGLSNILR-GEQ----SVDEVLLQ-AHTLPNLWVLPAGPVP-SNPTDLLSSPDMARLVEE
A0A2V9LGY4      RGLSNILR-GEQ----SVDEVLLQ-AHTLPNLWVLPAGPVP-SNPTDLLSSPDMARLVEE
A0A2V9J4D6      KGLSGILT-GAY----SVDEALQE-VKGQPGLWALPSGPPP-PNPAELLSSPEMQSVMQN
A0A2V9L9C5      KGLSGILT-GAY----SVDEALQE-VKGQPGLWALPSGPPP-PNPAELLSSPEMQSVMQN
A0A2N9M9N1      NGLSSYLA-GGQ----GIDSALMS-FTALPNLSVLPSGPVP-ANPAELVSSPAMGRLVSE
A0A2V9JEC4      KGLSTVLT-GGH----QIEVALET-FQNLSTLSILCAGPVP-PNPSELVSSATMEQVIGE
A0A2V9LPQ3      KGLSGVLT-GRY----SLDEALRE-VEN-TSLSVLPAGPTP-PNPAEMLSSPAMRQLITE
A0A348V070      WGLTHFLS-SIV----DASEIIRP--TAYTNLFVVPSGVTP-SDPLEVMFSEKMRAFITF
A0A2Z5G3A3      GGLSSILS-GSS-SEKDSSQYSAP-VTSLPNLKLLVAGAPP-TEPTDLLSSTRMLEALAA
A0A2V7UGP8      HGLSSYLS-GNA----ELDPIIQE--TEIPNLFLVSSGPVP-PNPSELLASEHFDFLLAA
A0A239MKT6      RGLSDLLS-LNL----ELDEVLQQ-HPNQDNLFIIEAGTIP-PMPAELLGSKRFLAILEK
A0A3E0PCN7      TGLSTLIT-ADYLSDERIDNAIRK--EVDYCLDVLPSGPRV-PNPANLLGSIEMRSLLDR
A0A2V8IYW3      CGVNEYVH-SHG------AKPLEL-LPVAPRLFLLPAGRPD-SDPIGALTSETMQRIVKE
G2LEI9          PGLSRYLS-GQC----KIGEIFTP--SPIPYLTLITCGQMP-PNPAELLGSQRMRSLLAY
A0A317J121      WGLTNILE-EGS----AAPERFGL-LTTVPGLFVMPNGPKS-GSISKMLYGSEIRRFFQM
A0A2V7YW66      HGLVNQLT-ATG----EE--AIFP--TEVPNLWITPSGPIP-PNPSELLSSDRMRDWLRT
A0A2V7Z0V0      FGLVNQLT-ATA----ESETVFLP--TEVPNLWLTPSGPIP-PNPSELLSSDRMRDWLKA
A0A2V8GFD4      AGLSNVLI-GSA----KANDAVKK--TTVPKLWVLPAGRVP-PNPPELLGSPRFAELMAA
A0A2V8HSS5      AGLSNVLI-GSA----KANDAVKK--TTVPKLWVLPAGRVP-PNPPELLGSPRFAELMAA
A0A2V8KP55      NGLSSVLE-GHC----SLENAVSE--TNIKNLFLLPSGPVR-PNPGELILSPRFKEVLKS
A0A399WNU1      CGLSTLLT-AEEVDQDLVDRAVTK--SSEPDLDILPSGPRV-PNPASLFASTHMKGLIER
A0A2V9CG11      RGLSSILS-VND--IVHIKQLLCE--TAISGLYVLPAGSST-TNTTRLLHSRRMSELLAL
A0A2V2R0I6      AGLSSYLA-GAS----SLDLVTVP-HPAIPNLAAIPTGPLP-PNPADLLSSHKLSDAIAE
A0A2V8XAR9      AGLSSYLA-GVS----SLDLVSVP-HPAIPNLVAIPTGPLP-PNPADLLSSHKLADAIAE
A0A2V8VZA0      AGLSSYLA-GVS----SLDLVSVP-HPAIPNLVAIPTGPLP-PNPADLLSSHKLVDAIAE
A0A1Q7CB82      AGLSSYLA-GVS----SLDLVSVP-HPAIPNLVAIPTGPLP-PNPADLLSSHKLVDAIAE
A0A2V8WIU1      AGLSSYLA-GVS----SLDLVSVP-HPAIPNLVAIPTGPLP-PNPADLLSSHKLVDAIAE
A0A1Q6Y9F5      AGLSSYLA-GVS----SLDLVSVP-HPAIPNLVAIPTGPLP-PNPADLLSSHKLADAIAE
A0A2V9EVV8      AGLSSYLA-GVS----SLDFVSVP-HPAIPNLVAIPTGPLP-PNPADLLSSHKLADAIAE
A0A2V8YF91      AGLSSYLA-GAS----SLDLVSVP-HPSIPNLVAIPTGPLP-PNPADLLSSHRLAEGIAE
A0A2V8XZK2      AGLSSYLA-GVS----SLDLVSVP-HPAIPNLVAIPTGPLP-PNPADLLSSHRLADAIAE
A0A2V8ZTX6      AGLSSYLA-GVS----SLDLVSIP-HPAIPNLVAIPTGPLP-PNPADLLSSHRLADAIVE
A0A2V9BT79      AGLSSYLA-GVS----SLDLVSIP-HPAIPNLVAIPTGPLP-PNPADLLSSHKLADAIVE
A0A1Q8B793      AGLSSYLA-GVS----SLDLVTVP-HPAIENLAAIPTGPLP-PNPADLLSSHRITDAIAE
A0A2V9BCA0      AGLSSYLA-GVS----SLDLVTVP-HPAIENLAAIPTGPLP-PNPADLLSSHRITDAIAE
A0A2V9BWU9      AGLSSYLA-GVS----SLELVTVP-HPAITNLAAIPTGPVP-PNPADLLSSRRLSEAVSI
A0A2V9DKX2      AGLSSYLA-GVS----SLELVTVP-HPAITNLAAIPTGPVP-PNPADLLSSRRLSEAVSI
A0A2V9JSI3      KGLSSILT-GAH----GLEEALQQ-LDALPGLWVLPGGPRP-PNPADLLSSVSMKEVLAE
A0A2V9WI32      SGLSTLLT-GGD----GSQNAILS--TEIPNLFVLTAGPPP-PQPAELLGSILMKDYLCR
A0A2V8IVN9      PGLSNLLV-GTA----KASESVRR--SKTAGLWLLPAGKIP-PNPAELLGSQRFRELLAS
A0A1F2TPT3      PGLSNVLV-SGA----KAGEVVRR--SAVANLWVLPAGRCP-PNPSELLGSYQFRKFLAA
A0A2V8JTQ2      TGLGPLLR-NTV----TFEEAVVS-WANVPNLFILPAGPVF-LPGDTELLMWSFQDWVKR
A0A2V8UZY0      TGLGALLR-KSV----TFDEAVIQ-RAEVPNLYILPAGPVM-LPDDTELLVSGFKDLVDH
A0A3N5YNR8      QGISAYLS-GNG----DLSSQIRQ--TNYPNLFLLPAGFRP-PNPAELIGSERMESALRL
A0A350UEK1      AGLTDLLK-PGD---GDWKKLIHE--SGAPGLWVLPAGPGV-AAPSHLLYSKKLRAALEW
A0A350UIQ4      AGLSDLLK-PDC---GEWKKLIHQ--TPVPNLSVMTAGPGV-AAASNMLFSKRLLSALEW
A0A3N6A5T6      QGMSYFLT-GNS----DLTSQVRK--TSVPNLFVVSAGYVP-PNPAELIGSDRMDKALKL
A0A1F2Q9L4      LGLVNFLT-GSA----DETGIFLR--TSVPNLYLTPTGPVP-PNPSELLSSERMMDLVAV
A0A1H5SQF5      SGLSQCLT-SDI----DPASVIQV-HPDMDKVHVMTSGPVP-PAPSELLGSPRFVKLLEQ
A0A3E0NV31      NGMSKFLA-GRA----EFADLLQQ--TKHKNLALVSAGPCP-PNPTELLGSKRMRWCLGV
A0A3N5M5V0      QGISSYLS-GNA----DLSSQIRQ--TSYPNLFLLPSGFRP-PNPAELIGSERMEAGLRL
A0A2V9AEW6      WGLNDVLL-SDTPFEEFPMSHLAR-KTEVAGLSVLPSGNCG-VTPTNLFYSPRMSKLLAR
A0A2V8WQK6      WGLSDLLW-ADNPLETVPISHLVR-ETEVSSLSLLPGGSCG-ITPSNLFYSPRMSRLLRR
A0A2V8XIF4      WGLSDVLW-GDTPLETLPISHLVR-ETEVAGLSLLPGGSCG-ITPTNLFYSPRMARFLKR
A0A3N5XQP8      WGMSVYLS-GHS----DLEQEIQP--TGVPNLSILPAGLRP-PNPAALLSSKRLPNALER
A0A2Z5G7H4      TGLSQYLT-DER----SPEDILEV--GRLPKLHLLTSGPVP-PYPADLLGSLRMMEALDR
A0A2V9L5B5      PGFVQCLT-GHV----ELAEAVLP-APGVPNLSVIPCGPIP-PNPAEVLSSSLAAESLRK
A0A2V9LK56      PGFVQCLA-GRV----ELKQAIFP-VPGTENLFVIPCGPIP-PNPAELLSSQLSMDLLNA
A0A2V9L7I0      PGLVQCLT-GKG----DLAQAVLP-VPGVANLNVIPCGPIP-PNPAEVLSSPLAAELLRK
A0A522PPT0      PGFVQCLT-RRV----QLSEAILP-VNGIPNLSIIPCGPVP-PNPAEVLSSPLTVELLKR
A0A2V9KCS3      WGLSDLLR-EKDAVDDYPFEALSR-KTLIPGLYVLPSGPGT-VSISNLLYSPRLAELLNR
A0A2U3KC61      GGLSTLIS-GSD----KVEDVVIP-CPEVPNLWVLPAGPIP-PQPAELLGSAVMKDHIAH
A0A2V9Y2R7      GGVSTVIS-GVE----KFEDVVVP-FTQVPKLWILPAGPIP-PQPAELLSSTVMKDYIAR
A0A372IT17      PGLSEALA-GSA-----APPEPQP-LTALPSLALLHAGRKP-PFPSELIASRRMEELLGG
A0A136JPP4      QGLTNYLS-GEK----STENLIKA-APGLPHLKIITSGPIP-PNPAELLSSNEMRNLLQF
A0A399WUJ8      QGLTNYLS-GEK----STENLIKA-APGLPHLKIITSGPIP-PNPAELLSSNEMRNLLQF
A0A2V9NGH6      TGLSSVLT-GSA----NVQQTIVR-SALLPSLFILPAGPPP-PNPAELLSSGNMKKVLDE
A0A2V9PYE6      TGLSSVLT-GSA----NVQQTIVR-SALLPSLFILPAGPPP-PNPAELLSSGNMKKVLDE
A0A2V9NL07      AGLSNVLT-GGT----TLQQATVR-STLLPNLFILPAGTPP-PNPAELLASSQMLDLLAE
A0A2V9QD92      AGLSNVLT-GGT----TLQQATVR-STLLPNLFILPAGTPP-PNPAELLASSQMLDLLAE
A0A2V9WPZ6      SGLSNILT-GSA----TLQQAITR-SPLLPNLFVLPAGTPP-PNPAELLASSDMRDLLAQ
A0A2V9ZLH4      SGLSNVLT-GSA----DVQQTITR-SQVVPSLFVLPAGTPP-PNPAELLASANMRDLIES
A0A2V9RQF1      IGLSNVLT-GNA----PLQQAIVR-SNVLPSLFVLPAGPPP-PNPAELVASSNMRDVLAE
A0A2V9YDK8      SGLSNVLT-GSA----TLQQTITR-SPLVPSLFVLPSGTPP-PNPAELLASSNMKDALAE
A0A2V9V8F7      SGLSNILT-GSA----TLQQAITR-SPLLPNLFVLPAGTPP-PNPAELLASSDMRDLLAQ
A0A2V9XGR9      SGLSNILT-GSA----TLQQAITR-SPLLPNLFVLPAGTPP-PNPAELLASSDMRDLLAQ
A0A2V9V3Q5      SGLSNVLT-GNA----TLEQAISP-SPILPNLFILTAGSPP-PNPAELLASSNMKDVLDE
A0A2V9NWS3      IGLSNVLT-GNA----TMSQATVR-STILPTLFVLPAGPPP-PNPAELLASAQMKDSLAE
A0A2V9USA9      SGLSNVLT-GST----TLQQAITR-TPILPNLHVLPAGTPP-PNPAELLASTNMKDVLAQ
A0A2V9XW18      SGLSNVLT-GST----TLEQAISD-TTILPNLFVLPAGTPP-PNPAELLASSNMRDVLNQ
A0A4R1LC91      LGLSSVLA-GQIDSYLDAGTTAPL--KQVPTLHVLPAGPIP-PYPTDLLASTQMQDLLAQ
A0A3M2BZG9      LGVVNHLT-GTE----RAEDLVLP--TAVPNLYLCPSGPIP-PNPSELLASERMRELLAT
A0A1Q7N5R7      PGLTDFLA-GRV----PLEAVKQA--LPYPLLHFIGAGSRL-RESPELLGSPAMVDLLVR
A0A3M1SIV3      VGLTNYLS-GDQ----ELQDLLKS-PEGLPKLKIITSGPLP-PNPAELLGSTEMKALLTY
A0A3E0PHB0      HGLTNYLS-GER----NTDNLLKP-YPKLPNLKVITSGPIP-PNPAELLSSNEMKNLLQF
A0A3M2D491      TGLTNYLS-GDQ----SLEGLLKP-IPELPNLKVITSGPIP-PNPAELLGSDEMKALLNF
A0A357F267      HGLTNYLS-GER----NTDNLIKS-CRDLPRLKVITSGPIP-PNPAELLSSNEMRNLLQF
A0A353C9L6      QGLTNYLS-GER----NTQNLIKT-CRDLPRLKVITSGPIP-PNPAELLSSNEMRNLLQF
A0A2V8RQV0      QGLTNYLS-GER----NTENLIKS-SRELPRLKVITSGPIP-PNPTELLSSNEMKNLMQF
A0A2V8SJH5      QGLTNYLS-GER----NTEHLIKT-CRELPRLKVITSGPIP-PNPAELLSSNEMKNLLQF
A0A2V9QB26      RGLSSLLR-DPQRALAKLSRIVQE--TNIPGLFVLTSGPLT-ESAADLLHSANLSGLLAK
A0A2V9VYY4      GGLSTLIS-GSS----NVEEVILP-SSEVPNLWILPAGPIP-PQPTELLGSTVMKDYISR
A0A2V9KIE8      PGFVQCLT-GRV----QISEAILP-VPGVANLWVIPCGPIP-PNPAEVLSSPVAGALLNS
A0A352F549      DGLSAILS-SEV-SEADVLSKIRK--YQDSNVYLLSSGAIP-PNPAELLGSTQMKRLLEI
A0A3B9MLP9      EGLSAILS-SET-SEAEILAKINR--YLETDIYLLSSGAIP-PNPAELLGSAQMKRLLDV
A0A3D5SQ87      EGLSAILS-SET-SEAEILAKINR--YLETDIYLLSSGAIP-PNPAELLGSAQMKRLLDV
A0A2V8NW86      HGLSSLLR-DPQRAVAKLSRIVQE--TKIPGLFVLTSGPLT-KNAADLLHSADLSGLVAK
A0A2V8ZHL8      EGLAGFLT-GAH----SIEAALIQ-FSPVPALRVLPAGPKP-PNPAQLLSSSAMESLLKE
A0A2V9B240      EGLAGYLT-GAH----SIEAALRQ-FSPVPTLWVLPAGPKP-PNPAQLLSSSAMESLLKE
A0A2V9CBM2      SGLVSYLT-DPQ----DWRTLVRH--SGSSGLDLLFCGPVP-PNPSELLSSQSMETLIQS
A0A2V8XN17      LGLVSYLT-GQQ----DWRAVVHP--SGSRGLDLLLCGPVP-PNPSELLSSQSMGALIRS
A0A2V8WX45      LGLVSYLT-GQQ----DWHAAVRP--CGSHGLDVLVCGPVP-PNPSELLSSQSMGALVRS
A0A1Q6YR79      LGLVSYLT-GQQ----DWRAAVHP--SGSRGLDLLVSGPVP-PNPSELLSSQSMGALIRS
A0A1Q7VA32      LGLVSYLT-GQQ----DWRAAVHP--SGSRGLDLLVSGPVP-PNPSELLSSQSMGALIRS
A0A2V9EY85      LGLVSYLT-GQQ----DWRAAVHP--SGSRGLDLLVSGPVP-PNPSELLSSQSMGTLIRS
A0A2V9H8K0      LGLVSYLT-GQE----DWRAVVRP--SGSRGLDLLVCGPVP-PNPSELLSSQSMGALIRS
A0A2V9FFE5      LGLVSYLT-GQQ----DWRAVVRP--SGSRGLDLLVCGPVP-PNPSEMLSSQSMSALIRS
A0A2V9GM43      LGLVSYLT-GQQ----DWRAVVRP--SGSRGLDLLVCGPVP-PNPSEMLSSQSMSALIRS
A0A1F2RFI7      AGLSTYLT-GQF----GLDDVVTP--TQIPNLFAIPCGPIP-PNPAELLSSELMRQFLEQ
A0A1F2RZS3      AGLSTYLT-GQF----PLEDVLVG--THVPNLYAVSCGPVP-PNPAELLSSKLMRQFLEQ
A0A1F2USE2      GGLSSYLT-GQA----EWRRYALS--TGVPHLDLMACGPIP-PNPAELLSSERMRTFLQE
A0A2V9C238      LGLVSYLT-GQQ----DWRAAVRP--TGLESLDALVCGPVP-PNPAELLSSERMRTLLRE
A0A1F2Q9F5      RGLVSYLT-GQQ----EWEAVVHP--SPVENLDLVICGPIP-PNPAELLSSERLRAFLRQ
A0A1F2QQH9      RGLVSYLT-GQQ----EWEAVVHP--SPVENLDLVICGPIP-PNPAELLSSERLRAFLRQ
A0A1F2QXK7      RGLVSYLT-GQQ----EWEAVVHP--SPVENLDLVICGPIP-PNPAELLSSERLRAFLRQ
A0A2V9DEM9      LGLVSYLT-GQQ----DWRAAVRP--TGLESLDALVCGPVP-PNPAELLSSERMRTLLRE
A0A2V9CYQ5      SGLVSYLA-DHQ----DWRTLVRH--SGLSGLDLLFCGPVP-PNPSELLSSQSMETLIKS
A0A2V9BWU8      LGLVSYLT-GQQ----DWRTAVCP--SASPGLDLLLCGPVP-PNPAELLSSKSMGAFLGA
A0A2V8ZG48      LGLVSYLT-GQE----DWRTAVCP--SGSPGLDLLPCGPVP-PNPAELLSSKSMGAFLGS
A0A2V8Y334      LGLVSYLT-GQQ----DWRAAVCP--SGSPGLDVLLCGPVP-PNPAELLSSKSMGAFIAS
A0A2V9AY68      PGLVSCLT-GQQ----DWHAAVCP--SGSPGLDLLLCGPVP-PNPAELLSSKSMGAFLTS
A0A257VBK0      RGLTNYLAERTAQIEDFVV------PGPQPNLFVLYSGPTP-PNPPELFSMKRFRDLIER
A0A2V7XDY0      -GVTNFFV------NHEDLDALVR-PTRVPNLFALTTGPLP-PNPPAILTRPNMQDFLDR
A0A350UQT3      -GLSNVLN-GETGWR----DVLVR-PANNEYLEIITAGPPS-RRAADMIG-QLLGPVMEE
A0A2U3JZ71      -GLSNVLT-SGIPWR----TVLVR-PDGHPNLDILPAGPPS-RRAADLVGAE-LTTLLED
A0A2V8TTB0      -GLSNVLL-QQISWR----DVVIR-MDDPKGLDVLPAGPPT-RRASDLIGSG-VAELIEE
A0A1F2TCR2      -GLSHLLV-GQVRVREA-----VQ-RTSEANLFVMTAGRTP-PNPSELLASERMKGFLTN
A0A1F2V330      -GFSDLLR-APEDEIG------KY-VSKLGDLYIMPGGSSL-ANPVSLLASQSVRSVFER
A0A662EE63      -GLTSLVL-GESQLKD-VI---HG-LADVPNLDMVTSGPLP-SNPPELFGKKSFKDLLAT
A0A2V8TLH7      -GITNYIL-STEGDDWRTY---LK-TTDQSNLYALTSGPIP-PNPADVFGHERFKRLLKE
A0A1Q7ZJT1      -GVTNYIL-SSEGDDWRSY---IK-NTDMPNLYAMTCGPIP-PNPADVFGHERFLSLLKE
A0A2V8VC99      -GVTNYIL-SSDGDDWRNY---IK-ASDLPNLYALTCGPIP-PNPADVFGHERFLALLKE
A0A348UZU3      -GLSNYLTMGLELKKL------VK-TTMVPSLYFINSGPIP-PNPAELLGSERMKELLGR
Q01XL7          -GLSDLLT-STESLEEADLAPYLS-PTKVDNLRVMTHGLAQVGTPATLFFSPRVKELVKK
A0A2V8ERZ5      -GLSQVLT-GQARVRD--V---IQ-RTVDPNLLAITAGRSP-LNPSELLSSERMKTLLTN
A0A2V8GTX0      -GLAELLS-GKARMRE--V---VQ-RCGDPNLLVIPAGHTP-SNPSELLASDRMRAFLHQ
A0A2V8J0X9      -GLSHLLV-GQARVRE--A---VQ-RTSEPNLVVITAGRTP-PNPSELLSSERMSNFLAN
A0A523DUV7      -GLADYCT-RDLKLDV--I---IQ-STREPHLSAVTSGKLP-PNPPALIGSLAVKRFLEE
A0A372IRG7      -GLSTYLS-RESKEES-FE---YP-IPGLPNLAVMTRGPIA-PNPGEMLASRMMEDTLAR
A0A1F2U158      -GLSQILT-GQARVRD--V---IQ-RTVDPNLLAITAGRTP-ANPSELLSSERMKTLITN
A0A2V8F6S9      -GLSQVLI-GQARVRD--V---IQ-RTVDPNLLAITAGKTP-PNPSELLSSERMKTLLTN
A0A4Q1SCH5      -GISDLLI-DRGTSKD-IA---QP-IEELPNLHFLPAGKSV-AFPSETLASSKLRMQLEE
A0A3D1ASD2      -GLSSVVL-QSANWRE-VV---VP-AENVAGLDVLPAGPPS-RRAADMVG-NRLPQILEE
A0A2N9MK30      -GLSAVLL-HGLAWRD-CV---MQ-APGVPNLDVLPAGPTS-RRASDLIG-RALPQILEE
A0A4Q7YNP3      -GLRNLLR-GEIDLARATIGTFCK-ATRIPNLSVIPSGSGS-EEVVQLLHSPRLAELIDR
E8UZE1          KGLSNLLAVSQSPPLVEYL---HP-AAVFPGLDFLPAGPLP-PSSSELLMSPRMSELFEE
A0A1V6HR88      -GLVSYLT-GQVPPEQ--I---VL-RTDIPNLYAIPAGPSP-PNPSELLSSERMRDLVRQ
A0A3E0P0A3      -GLVNCLV-HQTELEN--V---VQ-ATPVPNLWVLPSGPLP-PNPSELLSSGHARELFAQ
A0A2V8EXP2      -GLSNVLV-GNAKPSD--A---VR-ITSVPGLWAMPAGMIP-PNPAELLGSKRFKEFLGT
A0A2W4RYA1      -GLSNLLV-GTAESRE--C---VH-ETPVEGLYVLPAGHIP-PNPAELLGSARFRRVLDS
G8P0Y7          -GLSNVLT-GGAKVRD--A---IQ-STVQPNLFVLPAGLVP-PHPSELLSSSLMRDLLKK
A0A5M8T4U7      FGLSSVLS-HPEERRM-AP---NP-VPELPQFHILPTGMRP-PNPAEMLSSQRMEEQLHQ
A0A3P0X3W6      -GLADVIM-DGRSLAD-VL---HT-IEGIENLHVVTAGASA-MRAAHLVG-NKMAALLTD
A0A1E3Y9R6      -GLSNVLV-GEASLAD--A---AR-TTAVPNLTLLAAGHIP-PNPAELLSSPRYAELIAE
A0A2W4TLP2      -GLSNVLV-GEAALAD--A---LR-PTSVPNLTLLAAGHIP-PNPVELLCSPKYADLIAE
A0A3R9WF43      -GLGDVSA-ADTHIEVSNL---IQ-HSSIKTLYILPAGNRP-DLPSEFFSSATFDAVLEM
A0A317HKM4      -GLADVLA-GKTTSRD------FR-QTKISRLWLLPAGTAS-RHPADLLGSERFSRLIDY
A0A523E0N1      -GLSNVLT-GQKSLKD-GC---IM-RTEIPNLYLMMSGPKS-PNPGELLASPAMERTLKE
A0A523ECP2      -GLSSVLS-GQTSIEK-GC---VF-STLIPNLYVLLAGPAS-PTPAELLGSTKMEETLEQ
A0A2W0C122      -GLSDLLS-GGAGEEC-VI---HK-IEGVANLSIVAAGSSP-AMTAEMLGSDRMRAIMES
A0A2W0AUU7      -GLSDLLS-GSAGEEP-VI---QQ-IERVSGLSIVSAGSSQ-ARTAETLGSARMRSLMES
A0A2W0BQL1      -GLSDLLS-GSAGEEP-VI---QQ-IERVSGLSIVSAGSSQ-ARTAETLGSARMRSLMES
A0A4Q1SDL1      -GLSLLLT-EEEQVPH--I---LT-VDGVPNLSLLPSGPVP-VNPSELLSSANMGKLISD
A0A3P0XH15      -GLSTLLV-RENEESS-YE---NP-LPDLPNLTLVTRGPVT-VNPGEALASRSMEELLQR
A0A4R1LAZ7      -GLSTLLS-RESGAEA-YE---QP-LADLPNLTVVSRGPVA-PNPGEMLGSRSMEELLLQ
A0A3M1WQW8      -GLSTYLT-RGITIDS-VI---VP-N-RIDNLWIIPSGPVP-PNPSELLSSRKMREAVKV
A0A3N1JHC1      -GLSNTLD-EAECADPNSL---IQ-TTAFPGVSILTSGTTK-GNIVRLLHSSRLASVIGT
C1F294          -GLSTYLS-RESGEES-IV---FP-LPELPNLGVLPRGPVA-PNPGEMLASRMMADTIQK
A0A2V9KA79      -CFDDLLV-QPRLAIE-DC---LT-TVRTLHV-MLGRRSLA-NNPVQALAAKRMHEILAH
A0A522PSP1      -GLSSILQ-DQAKVQE-AV---VP-G-QIDRLSILPAGPLS-ANAREHIA-ARIGEVIED
G8P085          -GLSNLIL-GDDTAEP-FT---NP-LPDLDNLFLLTAGKKV-ALPSEALGSNKFYSLLQQ
A0A4Q1SGQ1      -GLRHALR-SKS--EP-AI---QK-FPGLPSLSVLCGSTAA-SMPAELLASAKMQELLRE
Q1ILD9          -GLTECLS-GLRRWTD-VV---QD-ASGIAGLRILSAGVRP-PNPAELLSSDKLKEMLEE
Q1IJZ6          -GLSNLLT-SVAEPSD-FI---QK-DSSAPNLDILCAGPIP-PNPAELLASNVFSDLLKR
A0A2V8TCE6      -GLSTFLC-GKASLEE-AV---QM-T-LVARLWLLASGPVP-PNPAELLDSACFDELLKM
A0A522TBE8      -GLSPVLR-GTMDLEA-AL---QP-S-RRDNLTLLTAGPTV-TNSAELLQ-QHWPAVLDR
Q1ITG0          -GLSECLA-GRKSWRD-LI---IP-VNGVANMWVLPAGHRP-PSPADLFTSNKMEEILNE
A0A3N5PCI5      -GLAEVLT-GKRKPSE-AI---VA-T-RSPGVWLLPSGAGI-ASPSEQLGSRRFSEFLAR
A0A3M1Q0S9      -GVSTYLT-GMSDLPA-LV---QT-S-DLERVAVIPAGPIP-PNPAELLDSERFRTMVRE
A0A2Z5G448      -GLSTLLV-RESGSSA-YQ---SP-IDDLPNLFVLTRGPIA-PNPGEILASRHMESLMEG
A0A3M1VZ38      -GVSTFLT-GLNDLDP-LI---QQ-T-RIDRLSLIAAGPVP-PNPADLLDSPRFAELVET
A0A4Q1SD29      -GLSTLLS-RESGNES-FE---HP-IPELPNLTVLSRGPIA-PNPGEILASRMMSELL--
A0A3M1PY35      -GLANVLA-GATGLDD-VL---FE-T-RYDNLALVPGGPCP-PDPATLLDPERVRAVVRA
A0A3M1VMP2      -GLTNLLA-SHDPADG-FV---VP-T-RYANLHLLPGGPCP-PDPATLLDPDRFREIVGE
A0A2V8G155      PGLSNVIV-GETKLA----DAVRR--TPIPSLWLLAAGKTP-PNPAELLGSERFRDLLLS
A0A2V8HDM7      PGLSNVIV-GETKLA----DAVRR--TPIPSLWLLAAGKTP-PNPAELLGSERFRDLLLS
A0A2V8DRT9      PGLSNILV-GDTKTG----DAVRP--TSCSTLWILPAGHLP-PNPAELLGSKRFEDFIET
A0A2V7VYF3      PGLSNFIV-GNSEVG----DVVRP--SGVPELWLLPSGLIP-PNPAELLGSMKFKEFLAT
A0A1F2SVH2      PGLSNVLV-GNAKAS----EAVHK--TAVPGLWVMPAGPHP-PNPAELLGSKRFKDFMAS
A0A2V8AJG9      PGLSNVLV-GNAKAS----EAIRG--TAVSGLWTMTAGMLP-PNPSELLGSKRFKDFIST
A0A2N9LQU7      AGLSSMIS-GNDASE----AVRKP-FPQLPTLEVIAAGPQT-PWPAELLASKKMGDLLEQ
A0A2P6WFK7      YGTSTVLT-RGMDER----AIVTP-LKSLPSLKLMPAGPHP-PNPAELLGSKRMIELLES
A0A2V8U914      WGLSDILR-ERNATEDLPLDALVK-KTGVPRLYLLPSGPCT-DSIFSLLYSERMARLMQR
A0A2V7W309      LGIVNYLA-ANIPFE----DTVQP--TQVPNLSVVLSGPIP-PNPSELLASDRMKHLIQE
A0A2W0BGU4      RGMSTHLT-GHDSIN----DVIQP-YKEQPNLWLIPSGPIP-PNPAELLCSEAMESLFGE
A0A2W0BVQ9      RGMSTHLT-GHDSID----DVIQQ-YGEQPNLWLIPSGPIP-PNPAELLCSEAMESLFAE
A0A2V9MN96      GGLSTLLS-GVDTME----NVMVP-FPGLPFLQVLPAGPIP-PNPVELLGSSVMKDCIAR
A0A2V7V2Z1      PGVSDLLV-GQARPS----EAIQR-PAG-TTLSLLASGTRA-PSPADLMTLQTMRDFLDG
A0A2V7X2F7      PGLSDVLV-GKAKPS----EAIQV-FAG-GH-SLLPAGTTV-PSPADLVTGQAMRGFLEG
A0A2V7V2I1      PGLSDILV-GLADTA----ECVER-VKG-TNLSLLPSGSHA-PSPAELMSPQLLRGFLHG
A0A2V7U3M2      PGLSDLLV-GRARPS----EAIQR-PAG-TTLSLLAAGTRA-PSPADLMTLQTMRDFLEG
A0A2V7UHT0      PGLSDLLV-GKARPS----EAIQR-PSG-TTLSLLAAGTRA-PSPADLMTLQTMRDFLEG
A0A2Z5FVL3      VGLSTILA-GQLSVDAMG-QAFLQ-VEAVPGLDILLSGPIP-AYSAELLGSSKMRQLLDL
A0A2V9KBD6      AGLGALLK-KSVAFE----EAVCS-FPNLPDLFILPAGPVT-QPEDTELLLSTFKELVES
A0A2W0AJ66      IGLTALLS-NSAPFE----DAVIR-CAELPNLFILTAGKVS-LPEDTELLVARFKDLLEG
A0A1Q7RBU1      AGLGALLR-KSTAFE----EAVMG-CTDVPNLFILPAGPVN-LPDDTELLVSGFKDLVER
A0A2V9JPV9      TGLGALLR-KSTVFE----KAVSD-CAKIPNLFILPAGPIT-LPDDTELLVSGFKDLVER
A0A1I6MH75      VGLSTLLT-GTTGLE----ESLQR-VPEVPNLDIMASGPVP-PFPTEMLSSAAMTSLLER
E8WVF6          LGLSTILS-GQTTLE----NSVQT-LKEVPTLDILASGPVP-PFPTEMLSSASMAELIRH
A0A1H5Z7N3      IGLSSVLT-GSATLE----QALQR-VPELPNLDVLVSGPVP-PFPTEMLSSQVMRNLVEQ
A0A2V9YHT3      GGLSTLLA-GQHSAE----EVLVR-SNQLSNLYVLPAGPPP-PQPAELLSSALMKQWIST
A0A1G7JVV8      VGLSTVLS-GGATLE----EAVKN-VPEVPNLDVLCSGPVP-PFPTEMLSSESMKNLLQE
A0A1H4T6W9      VGLSTVLS-GGSTLE----DAVKN-VPEVPNLDVLCSGPVP-PFPTEMLSSEAMHDLLLY
I3ZEU5          VGLSTVLS-GGSTLE----EATKN-VAEIPNLDVLCSGPVP-PFPTEMLSSEAMHDLLLH
A0A428MDU2      VGLTTLLT-GASKLK----DTVQN-IPNVPNLDILPSGPVP-PFPSEMLSSEAMDAFLNH
A0A5B9EBI2      VGLSTVLS-GSTSLE----EAVQQ-VADVPNLDILASGPVP-PFPTEMLSSEGMQHLIES
A0A239HDF6      LGLSTYLS-GSSTLE----ESLQH-LDELPSLDILTSGPVP-PFPTELVSSTAMRELLRY
A0A4Q0T270      VGLSTVLS-GGSTLE----DSLQH-VTEVPNLDILASGPVP-PFPTEMLSSGAMTQLLER
A0A1Q3QQB6      TGVTTVLT-GAAPLE----EAVQT-VPEVPNLDILPAGPMP-PFPTEMLGSEAMDQLLRQ
A0A3N1K1G7      VGLTTVLT-GATTLE----DTVQH-IPDAPNLDILPSGPVP-PFPTEMLSSEAMNTLLRH
A0A4V2G466      IGLSTLLA-GATTLE----AAIQK-IPEVPNLDVLVSGPMP-PFPTEMLSSEAMRQLLDH
A0A6B9YNQ8      VGLSSVLT-GSTPLE----QAVQQ-ISSVPNLDVLVSGPMP-PFPTELLSSEMMRQLLQS
                                                                .           

A0A2V7VMF7      --LRR--QFEWILVDSPPLASVTDALLLARHADLAVMVVQHNNVDKKLVKRSVVA--LR-
A0A2V7YYV7      --LRT--SFSYVIVDTPPVNAVTDASILSASANGTILVVEHGQTSFPALERAKQM--LD-
A0A2V7Z0J5      --LLA--NFNYVIIDTPPVNAVTDAAILAAYANGTILVVEQGRTTFPAVGRAKQL--LD-
A0A2V7Z3M4      --LSD--AFVYVIIDTPPVNVVTDAAILSAQASGTVLVVEQGRTTFPVVNRAKQI--LD-
A0A399Y5V2      --LGT--LADYVVIDSPPIVPLSDAAVLAPKTDGAIIVAKAGQSSRRASAQAAEK--LD-
Q01X01          --FRQ--EFDYVIVDAPPCLEFADARIISRYTERLLLVVRADYTDRKTAQAAVQR--LL-
A0A3M2D9H8      --VAT--RYDKVILDGPPFL-ISDAIVLASRVDGVLLTLRARSTSQSVTLEVLEQ--LD-
A0A2V8JK38      --LKK--DFDLVILDSPPLSNVSDGRILASVSDTAILVVKAFSTSRYIAYRAVQH--LA-
A0A2V9IXG5      --LSD--RYDWVLIDTPPVTSVTDPVIIAALVDTILFVIKYNFVDKRIVRNSLSA--LA-
A0A2V9J2P4      --LSD--RYDWVLIDTPPVTSVTDPVIIAALVDTILFVIKYNFVDKRIVRNSLSA--LA-
A0A1Q7RLS4      --LRA--EFDWVFIDSPPVVSLADSMILASLADMVAFVIRHNENDKELIRRCVTN--VR-
A0A2V2R525      --TSP--SFTHVVIDSTPVVSFTDSVLIANLVDGVILVVQGGKSPKEIVQLSRKE--LM-
A0A321LPW6      --MSE--RFDHVLIDSPPLINVTDPIILSTIVDGVILVVHGGRSTRDVARRARQE--LV-
A0A2V9R9V4      --LSE--RYDHIVLDSPPLASVTDAVILSTMVNGVILVVHGGRNSRQAVQRACHE--LS-
A0A321LE75      --LCE--RYDHIVIDSPPLMHVTDPVILSTLVDGVILVVHGGKSTREVLKRGRQE--LA-
A0A2V8R8U7      --LSE--KFTHIIVDSPPAISFTDSSILSTFVDGVILVVHGGRSSRAVVRRAKQQ--LL-
A0A2V8QMP4      --LSE--NFTHIVIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRAVVRRAKQQ--LQ-
A0A2V8R4S3      --LSE--NFTHIVIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRAVVRRAKQQ--LQ-
A0A2V8NJ55      --VSE--RFTHVIIDSPPSISFTDASILSTMVDGVMLVVHGGKSSRAVVRRAKQQ--LL-
A0A2V8Q7I0      --LGE--RYAHIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRAVVRRAKQQ--LL-
A0A2V8S6K4      --LGE--QFTHIIIDSPPAISFTDASILSTMVDGVVLVVHGGRSSRAVVRRAKQQ--LL-
A0A317I2L9      --LSE--RFAHIIIDSPPAISFTDASILSTMVDGVMLVVHGGRSSRAVVRRAKQQ--LL-
A0A2V8LLF9      --LSE--RFTHIIVDSPPAISFTDASILSTFVDGVILVVHGGRSSRAVVRRAKQK--LM-
A0A352FRF4      --LRE--KFTHVIVDSPPAISFTDASILSTFVDGVILVVHGGRSSRAVVRRAKQQ--LL-
A0A2V8MKV0      --LGE--KFAHIIVDSPPAVSFTDASILSTFVDGVILVIHSGRSSRAVVRRAKQQ--LL-
A0A2V8PYY8      --LGE--RFAHIIVDSPPAVSFTDASILSTFVDGVILVIHSGRSSRAVVRRAKQQ--LL-
A0A1Q7YKQ8      --LSE--RFTHVIIDSPPAISFTDASILSTLVDGVILVVHGGKSSRAVIRRAKQQ--LL-
A0A352F3R7      --LSE--RFSHIVLDSPPAISFTDASILSTMVDGVVLVVHGGKSSRAVVRRAKQQ--LL-
A0A0B6WXT1      --ASA--RFAHVIIDSPPAVSFTDAAILSTMVDGVVLVVHGGHSSRAIVRRAKKL--LQ-
A0A3B9MEU8      --LSE--RFTHIVIDSPPAISFTDASILSTMVDGVVLVVHGGRSSRAVVRRAKQQ--LL-
A0A2V8MHG6      --LEN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQL--LS-
A0A2V8P7N1      --LEN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQL--LS-
A0A2V8M3M6      --LEN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQL--LS-
A0A1Q7NJH5      --LGN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVRRSKQL--LS-
A0A2V8PJY0      --LEN--TFTHIVIDSPPVASFTDGVLLSSVADGVLLVVHGGAASRHIVRRSRQL--LS-
A0A1Q7Y6W9      --IEK--TFTHVIIDSPPIASFTDGVLISTIVDGVLLVVHGGKSSRHVVRRARQV--LQ-
A0A2V8NC68      --LEN--TFTHVIIDSPPVASFTDGVLLSSIADGVLLVVHGGRASRAVVRRARQL--LQ-
A0A399WK13      --LQG--HFTHVVVDSPPIASFTDGVLIASMVDGVVLVVNSGKSSRQVVRRSRQL--LL-
A0A352FLX4      --VAD--NFAHIVVDSPPIAAFTDGVLIAAIVDAVLLVVHSGKSSRKIVGRARKL--LQ-
A0A2V8RTL7      --LQS--EFTHVVIDSPPITSFTDGVLLASLVDGVILVVHSGKSSRQVVRRARQL--LI-
A0A3E0PCJ6      --LEK--NFTHLVIDSPPIASFTDGVLMASLVDGVIMVVHSGKSSRSVVRRSTQF--LH-
A0A3M1S4R8      --FQK--EFTHVIIDSPPIASFTDGVLIAAMVDGVIMVVHSAKTSRQIVRRSCQL--IQ-
A0A1Q7YFI6      --MRT--SFTHIVIDSPPIASFTDGVLMSTMVDGVLLVVQGGKSSRIVVQRAKQY--LQ-
A0A136KC10      --LEG--HFTHVVVDSPPIASFTDGVLIASMVDGVILVVHSGKSSRQVVRRSRQL--LN-
A0A2V8SEX6      --LSQ--NFTHVVVDSPPITSFTDGVLIASMVDGVILVVHSGKSSRQVVRRARQL--LQ-
A0A3M2D6Y5      --LHN--EFTHVVIDSPPIASFTDGVLIASMVDGVIMVVHSGKSSRHVVRRSKQL--LQ-
A0A0B6WWQ6      --LRA--RFDYIIVDSPPIAYFTDGVVVATLVDGVMLVVRRGKSSRRIVRRTQKI--LH-
A0A3B9MK99      --LQS--QFSHVVVDSPPVNSFTDGVLLSSMVDGVLLVVHGGKSSRHVVRRSRQL--LH-
A0A352EX26      --LQA--EFTHVVVDSPPINSFTDGVLISSLVDGVLLVVHGGKSSRHVVKRARQL--LH-
A0A2V8MM59      --LSA--QFTHIVIDSPPVSSFTDGVLIASMVDGVLLVVYGGKSSRGVVRRSRQL--LI-
A0A2V8PFE8      --LSG--AFTHIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSRGVVRRSRQL--LT-
A0A2V8PWS6      --LSG--SFTHIVIDSPPVSSFTDGVLIASMVDGVLLVVHGGKSSRGVVRRSRQL--LT-
A0A2V8LCT5      --LSI--PFTHIVIDSPPVSSFTDGVLIASIVDGVLLVVHGGKSSRGVVRRSRQM--LL-
A0A352FTJ9      --LSE--KFTHVVIDSPPVNSFTDGVLLGSMVDGVLLVVHGGKSSRDVVRRSRQL--LL-
A0A2G6PYV5      --LKA--NFDFIIIDTAPLLAVTDASILGNIVDSLIFVTKASATSRDEVARALHM--LS-
A0A2V8F956      --VKE--HFDWVIVDTPPVMAVTDARLVAHHATGVLFVVGAEMTSWHAAKRALDH--LD-
A0A1F2S1W5      --LMQ--YFDWVLLDTPPVMAVTDASIVANLSHGVLFVVGSEMTSRRVAQRAVEQ--LE-
A0A1F2T595      --LLQ--HFDWIIVDTPPVMVVTDATIAANFAHGVLFVVGAEMVSRRVAQRAVEQ--LE-
A0A2V8JQV5      --LRK--DYDLILIDAPPVLQMADARVLGRLADGVVFVIRSGRTTRDMALSACRR--FR-
A0A2V9AC41      --LRE--QFEFIFIDSSPVMAVSDAVFLSTMVEGTLMVVNR-RTPKPLVRKTRTR--LS-
A0A2V8K4L4      --TRQ--SFDTVIIDSPPMLHIADARLLAKHSDSVLLVLRAGKTTRTAGSMAIQK--FV-
A0A2V8NCZ3      --ARQ--NFDTVIIDSPPMLHIADARLLAKHCDSVLLAVRAGKTTRTAAVMAIQK--FV-
A0A2V9MAM9      --FRE--EFDHVIIDAPPSLEFADARLLGLTADGVLMVVRANHTDNKTVQLAIQR--LL-
A0A2V9M454      --LRD--QYDHLVLDSPPVLPITDATILSSLVDGVIMVVECEATTRAALSRACRV--IE-
A0A2V9IVR7      --LKQ--RFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVLRAHRI--IE-
A0A2V9ILE2      --LKQ--RFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVLRAHRI--IE-
A0A2V9LGY4      --LKQ--RFEHIVLDSPPILLMTDATVLSILSDGVVLVVEGGVTPLGAVLRAHRI--IE-
A0A2V9J4D6      --LRQ--RFDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSSGSTPPAVLIRAQQI--LH-
A0A2V9L9C5      --LRQ--RFDHLVIDSPPLLLVTDAAVLSPVVDGVMLVVSSGSTPPAVLIRAQQI--LH-
A0A2N9M9N1      --LRQ--RFEHIVLDSPPLLLVTDGVLLSTLADGVVLVVESGSTSRGALHRVRQI--LD-
A0A2V9JEC4      --LRR--RFDHIVIDSPPALVFTDATILSALVDAVVLVVESDVTTRAALRRARQT--IE-
A0A2V9LPQ3      --LVE--RFKHVVIDSPPLLMVTDATILSTMVDGTVLVAESGVTSPGALARCHRI--LD-
A0A348V070      --LKQ--QFDFVLFDSPPVLAVSDALVLGKQVDGLILVVRAGQTPVNALKQARNK--IE-
A0A2Z5G3A3      --WRR--EYSFVIIDAAPVLSATDSVILSGLVDTTLLLGRYKYTDRQLLARSYRL--LQ-
A0A2V7UGP8      --LKSSARFDHVLIDSPPLLSVADPVIMASKAGATILVVQCGRTSRPAVIRGRQK--LT-
A0A239MKT6      --ARK--EFDYVLIDGPPVLLVTDPLLIAPHADAIVAVFRSGRSTKQVVRATASM--LR-
A0A3E0PCN7      --LGA--RYSHIIIDSPPILYFADSVILAANVEAVVIVSRANFSSYEVHSQAKKK--IE-
A0A2V8IYW3      --GRE--QFDWVLIDTPPIGLLPDAGLLGGIADGALLVVRAGHSPFDLIKRAVDT-----
G2LEI9          --AVE--KFDYVILDTPPMLSFADATILAAMADSVILVVNCQRSKREIVKRTCRK--LD-
A0A317J121      --VRE--KYDIVLIDAPPILEVADGRLLAEFADGVLLVLRSGVTDRVAALQAYQQ--LS-
A0A2V7YW66      --MRS--RFDFVVLDTPPALAVTDATIVGLLVDGVVLTLRSGKVTREEARLCRDR--LR-
A0A2V7Z0V0      --VRA--RFDFVVLDTPPALAVTDATIVGMLADGVVLTLRSGKVTREEARLCRDR--LR-
A0A2V8GFD4      --FRE--NFDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGADLVTRGAAKTALEQ--LD-
A0A2V8HSS5      --FRE--NFDWVLLDSPPVLAVTDACVLAHTSSAVLFVVGADLVTRGAAKTALEQ--LD-
A0A2V8KP55      --LKK--DFDLVILDSPPLSNVSDGRILASVSDTAILVVKAFSTSRYIAYRAVQH--LA-
A0A399WNU1      --LSA--TYSYIVIDSPPILYFADSVILSTQVDAVVAVARVNFSSRDVLTRARQK--IQ-
A0A2V9CG11      --LRR--EFDMVIVDAPPVTQLADARVLGHLADGVILVVRAGQTTLESALFATEC--FA-
A0A2V2R0I6      --LRT--KYKFVVIDSPPVMAATDAVIVSVQTDGVLLVVRSGETPKEAFTRTRDL--LS-
A0A2V8XAR9      --LRT--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDL--LA-
A0A2V8VZA0      --LRT--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDL--LN-
A0A1Q7CB82      --LRT--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDL--LN-
A0A2V8WIU1      --LRT--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDL--LN-
A0A1Q6Y9F5      --LRA--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDL--LS-
A0A2V9EVV8      --LRA--KFKFIVIDSPPIMAATDAVILSVQADGVLLVVRSGETPKEAFTRTRDL--LS-
A0A2V8YF91      --LRT--KFKFVVMDSPPIMAATDAVIVSVHSDGVLLVVRSGETPKAAFARTRDL--LN-
A0A2V8XZK2      --LRT--KFKFIVIDSPPIMAATDAVILSVLADGVLLIVRSGETPKAAFTRTRDL--LN-
A0A2V8ZTX6      --LRS--KFKFIVLDSPPIMVATDAVILSVQADGVLLVVRSGETPKVAFTRTRDL--LT-
A0A2V9BT79      --LRT--KFKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGETPKVAFTRTRDL--LT-
A0A1Q8B793      --LRA--KYKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGQTPKEAFTRSRDL--LT-
A0A2V9BCA0      --LRA--KYKFIVIDSPPVMAATDAVILSVQADGVLLVVRSGQTPKEAFTRSRDL--LT-
A0A2V9BWU9      --LRQ--EYKFIVIDSPPLMAATDGVILSVLVDGVLMVVRSGETPKEAFMRARDQ--LV-
A0A2V9DKX2      --LRQ--EYKFIVIDSPPLMAATDGVILSVLVDGVLMVVRSGETPKEAFIRARDQ--LV-
A0A2V9JSI3      --LRG--RFDHVVIDSPPVLLVTDATILTPLVDGIMLVVESGMTVRGAIQRTHKI--LE-
A0A2V9WI32      --LRK--EFDHIVIDTPPALSVTDAVLLSVEADSVLVVVRSGQTTKAALRRVRDL--LS-
A0A2V8IVN9      --LKD--HFDWVIVDSPPVMAVIDAAVVAHRATGVVFIIGAEMTSRHTAKAAIRQ--LE-
A0A1F2TPT3      --LGQ--HFDWIVIDTPPVMAVTDACVVGHAVTGTLFVVGADMVSRRTARRAVEQ--LM-
A0A2V8JTQ2      --WRE--QFDHIIIDTPPVLSVADAVRISVEADSVILVIRSGQTARDAFLRAQDL--LS-
A0A2V8UZY0      --WRD--QFDHIIIDTPPVLAMTDAVRMSVEADSVILVIRSGQIARDTFLRAQDL--LR-
A0A3N5YNR8      --LGD--YFKYILIDTPPILSVTDGLLLSPHVDGVVMVIKGGSTPKEAARKAGNH--LS-
A0A350UEK1      --FRE--EFDMVVIDTPPMLQIPDARLFGKLVDGVVLVVRANSTTRDAALAARMR--LR-
A0A350UIQ4      --CRS--EFDMVVIDTPPVLQIPDARLFAKVADGVVLVVRANSTTRDAAMACRMR--LR-
A0A3N6A5T6      --LRD--YFQYVVIDSPPILSVTDALVLSPKVDGVVMVVRGGETPREAVRRASEH--LN-
A0A1F2Q9L4      --AYQ--RFENVVFDSPPILPVTDATLLGAMSDGVVLCVGSGMVLREDARTCRQR--LQ-
A0A1H5SQF5      --MKK--EYDYVFIDSPPVLLVTDAVLTSTLVDGVILVVRSGVTRRTPLRRALEQ--LA-
A0A3E0NV31      --ASE--HFDVVLIDSPPSLELSDALTVSPYVDGVVIVARAGQTPREAVRRTSLR--FQ-
A0A3N5M5V0      --LGD--YFKYILIDTPPLLSVTDGLLLSPHVDGVVLVIKGGSTPKETVKKASNH--LM-
A0A2V9AEW6      --LRR--EFDMVLIDAPPMIQLADARVLGRLADGVILVVRAGQTTTESARFAIQR--FT-
A0A2V8WQK6      --LRS--EFDMVMIDAPPVIHLADARVLGRLADGVILVVRAGQTTTESALFASQR--FA-
A0A2V8XIF4      --MRK--EFEMVMIDAPPMIHLADARVLGRHADGVILVMRAGQTTTESALYASQR--FA-
A0A3N5XQP8      --LTK--QFRFIVIDTGPLLCYTDALIISTVVDGVVLVGRADQTPIRNLKLASEQ--LT-
A0A2Z5G7H4      --WRG--YYDFIVLDSPPVLLVTDPVVLASLADATLLVARYGMTNRLSLARSHRTL-MD-
A0A2V9L5B5      --LRA--DFDYVLVDSPPLLSVADGRILATMVDGAVLVARAFETPYDLVRRARAL--LY-
A0A2V9LK56      --LRS--QFDYVLLDSPPLLSVSDGRILATLTDAVVLTIRAGHTPIEAVRQACAS--LK-
A0A2V9L7I0      --LRT--EFDYVLVDSPPLLSVADSRILATMTDAAVLVTRAFETPYDLVQRARSL--LY-
A0A522PPT0      --LHT--EFEYVLVDSPPILSVADSRILATITDAVVLVTRACETPYDIVRRARAL--LY-
A0A2V9KCS3      --FRK--EFDTVLFDTPPMLQISDARVVGRLADGVILVLKAGQTTRDMALAATQR--FA-
A0A2U3KC61      --WRN--VFDHVIIDTPPCLSVTDAVLLSPEADRVILVARSGQTTKAALRRACDL--LL-
A0A2V9Y2R7      --WRN--EFDHIIIDTPPCLSVTDAVVLSPEADRVILVARSGQTTKPALRRACDL--LL-
A0A372IT17      --WRH--QYDFIVLDSPPVLPFADALVLSQMSDATLLVARPGVTAKPAIARSYRALSLQ-
A0A136JPP4      --LRG--RFKHIIIDSPPAISFTDAAILSTQVDGVVLIAMAGKSSMHLMRQTRTR--IS-
A0A399WUJ8      --LRG--RFKHIIIDSPPAISFTDAAILSTQVDGVVLIAMAGKSSMHLMRQFRTR--IS-
A0A2V9NGH6      --LRE--QYDHIVVDTPPTLSVTDPVILSTRADAVVLVIRSGQTTRQALRRARDI--LL-
A0A2V9PYE6      --LRE--QYDHIVVDTPPTLSVTDPVILSTRADAVVLVIRSGQTTRQALRRARDI--LL-
A0A2V9NL07      --LRE--QYDHIIVDTPPTLSVTDAVVLSTRSDAVVLVIRSGQTTKPALRRSRDI--LA-
A0A2V9QD92      --LRE--QYDHIIVDTPPTLSVTDAVVLSTRSDAVVLVIRSGQTTKPALRRSRDI--LA-
A0A2V9WPZ6      --LRD--QYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTKGALRRSRDI--LM-
A0A2V9ZLH4      --LKR--DYDHIVIDTPPTLSVTDAVVLSTRSDAVVLVIRSGKTTKQALRRAREL--LV-
A0A2V9RQF1      --LRD--QYDHIIVDTPPTLSVTDAVVMSTRADTVVLVIRSGQTTKQALRRSRDI--LM-
A0A2V9YDK8      --LRD--QYDHIVIDTPPTLSVTDAVVLSTKADAVVLVIRSGVTTKGALRRSRDI--LM-
A0A2V9V8F7      --LRD--QYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTKGALRRSRDI--LM-
A0A2V9XGR9      --LRD--QYDHIIIDTPPTLSVTDAVVLSTKADAVVLVIRSGQTTKGALRRSRDI--LM-
A0A2V9V3Q5      --LRE--QFDHVVIDTPPTLSVTDAVVLSPRVDAIVLVIRSGQTTKQALRRARDI--LM-
A0A2V9NWS3      --LRE--QYDHIVIDTPPILSVTDAVVMSIRADTVLLVIRSGQTTKQALRRSRDI--LM-
A0A2V9USA9      --LRE--EYDHIVLDTPPTLSVTDAVVLSPRADAVVLVIRSGQTTKQALRRSRDV--LM-
A0A2V9XW18      --LRE--QFDHIVIDTPPSLSVTDAVVLSPRADAVILVIRSGQTTKQALRRARDI--LM-
A0A4R1LC91      --WRT--EYDFILFDGAPVLPVTDSVFLSGLVDTTLLIARYDYTQRQSLNRSQTL--LQ-
A0A3M2BZG9      --LRS--RFDFILLDTPPALPVVDAAIIGQLVDGIVICARAGVLVREHARACRER--LR-
A0A1Q7N5R7      --LRA--DYQVILVDSPPLGAGVDPYTLGTLTGAMMLVLRTGTTNLELARTRLAM--LE-
A0A3M1SIV3      --LKT--NFKHVIIDSPPAISFADAAILSTLVDGVVIVAMAGKSSMHLLKRFKQR--LN-
A0A3E0PHB0      --LKG--KFAHVVIDSPPAISFTDAAIIATLVDGVVLVAMAGKSSVHLMRRFKHR--LL-
A0A3M2D491      --LKT--NFKHVILDSPPAISFADAAILSTIVDGVVIVAMSGKSSMNLMKRFKQR--LI-
A0A357F267      --LRG--RYKHVIIDSPPAISFTDAAILSTQADGVILVAMAGKSSIHLMRRFKQR--LG-
A0A353C9L6      --LRG--KYKHIIIDSPPAISFTDAAILSTQVDGVVLVAMAGRSSIHLMRRFKQR--LG-
A0A2V8RQV0      --LRG--KFKHIIVDSPPAISFTDAAILSTVVDGTILVAMANRSSMHLMRRFKQR--AN-
A0A2V8SJH5      --LRG--RYKHVIIDSPPAISFTDAAILATLVDGVVLVAMAGKSSIHLMRRFKHR--LG-
A0A2V9QB26      --IKI--EFDLVIIDTPPMLQMADARVLGRVADAIILVTRAGQTTRDAAEAATQR--FT-
A0A2V9VYY4      --WRN--EFDHIIIDTPPCLSVTDAVLLSPEADRVILVARSGQTTRPALRRACDL--LL-
A0A2V9KIE8      --LRS--EYEYVIMDSPPLLSVSDSRILATMTDAVVLIARANSTPYQVIQRAKNL--LY-
A0A352F549      --VGE--SFNYVVIDSPPIASFTDGVLISSLVDGVLLVVHGGKTSRQVVKRARQM--LQ-
A0A3B9MLP9      --AGE--TFAYIVIDSPPIASFTDGVLISLLVDGVILVVHGGKTSRQVVRRTRQI--LQ-
A0A3D5SQ87      --AGE--TFAYIVIDSPPIASFTDGVLISLLVDGVILVVHGGKTSRQVVRRTRQI--LQ-
A0A2V8NW86      --IKL--EFDFVIIDTPPMLQMADARVLGRMADAIILVTRAGQTTRDAAEAATWR--FT-
A0A2V8ZHL8      --LRQ--RFKFLVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTARGAVARARKV--LE-
A0A2V9B240      --LRQ--RFKFLVIDSPPVLPVTDAMILSTFVDGVAFVVESGVTARGAVARARRV--LE-
A0A2V9CBM2      --AGE--QYEFVILDSAPMLALADSRILAPLVSGVLLVVKSRTIPREQVLHAQSS--IS-
A0A2V8XN17      --ASA--EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGTTPREQLLHAQSG--IR-
A0A2V8WX45      --AKT--EYGFIILDSSPMLALADSRILAPLVDGVLLVVKSGTTPREQILHAQSG--IR-
A0A1Q6YR79      --ASA--EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGATPREQLLHAQAG--IR-
A0A1Q7VA32      --ASA--EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGATPREQLLHAQAG--IR-
A0A2V9EY85      --ASA--EYGFVILDSSPMLALADSRILAPLVNGVLLVVRSGATPREQLLHAQAG--IR-
A0A2V9H8K0      --ASA--EYSFIILDSSPMLALADSRILAPLVNGVLLVVKSGTTPREQLMHAQSG--IR-
A0A2V9FFE5      --ASA--EYGFIILDSSPMLALADSRILAPLVNGVLLVVKSGTTPREQFMHAQSG--IR-
A0A2V9GM43      --ASA--EYGFIILDSSPMLALADSRILAPLVNGVLLVVKSGTTPREQFMHAQSG--IR-
A0A1F2RFI7      --ARQ--KFDYVILDSPPVLHVSDARILAARVEAVILVAHGAATPREAVNHAKQH--LH-
A0A1F2RZS3      --AAQ--KFDYVLLDSPPVLHVSDARILASQVEAVVLVAHGAVTPREAVKHAKEQ--LQ-
A0A1F2USE2      --ALG--EYSFLVIDSPPVLHVTDARILARLAEGTVLVVKGAATPRELARRAQLH--CR-
A0A2V9C238      --AKV--EYHFVVVDSPPLLNVADSRILATLVEGIVLVVKGGETPRELAQRAGAY--AR-
A0A1F2Q9F5      --ALQ--RYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTPRELVQRAYVY--AR-
A0A1F2QQH9      --ALQ--RYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTPRELVQRAYVY--AR-
A0A1F2QXK7      --ALQ--RYHFVLLDSPPLLHVADARILAALVEGVVLVVQGGTTPRELVQRAYVY--AR-
A0A2V9DEM9      --AKV--EYHFVVVDSPPLLNVADSRILATLVEGIVLVVKGGETPRELAQRAGAY--AR-
A0A2V9CYQ5      --AGK--QYEFVILDSAPMLALADSRILAPLVSGVLLVVKSRTIPREQVLHAQSS--IS-
A0A2V9BWU8      --AKS--EYGFVILDSSPLLTLADSRILAALVDGVLLVVKSGATPREQVIQSQTS--IR-
A0A2V8ZG48      --AKS--EYAFVILDSSPLLMLADSRILASLVDGVLLVAKSGATPREQIRQSQSG--IR-
A0A2V8Y334      --AKS--EYGFVILDSSPLLTLADSRILASLVDGVLLVVKSEATPREQVLQSQSS--IR-
A0A2V9AY68      --AKS--EYGFVILDSSPLLTLADSRIIASLVDGVLLVVKSGATPRQQVMQSQSS--IR-
A0A257VBK0      --FKG--EYSWVIMDSPPCLSISDAFILGGMADRTILVARYKKTRKPLLERILVT--LA-
A0A2V7XDY0      --LRG--HFSWILIDSPPLASVTDAQLLARYADLTTFVVQYNTADKKLIRRNLSA--LR-
A0A350UQT3      --MAR--GYDLVILDAPPLLGFAESLQMASSADGVIVVTRAGETSRKAVAAALTT--LS-
A0A2U3JZ71      --ACG--DYDLVVLDSPPLLGFPEPLQMAASVDGVLMVALAGQTNRKALGSAVNT--LK-
A0A2V8TTB0      --ATR--EYDLVVLDAPPLLGFAEPLQMATAVDGVIVVARAGDTSRKALSSVIGT--LA-
A0A1F2TCR2      L-AGG--PFDWVIIDTPPVLAVTDAVIVSRLVSNVVFVVGSEMTRRGHAERALQT--LL-
A0A1F2V330      --LRG--EFDFIVVDTPPVLPIVDTHILAGLVDGVILVVRARYTRREVLERGLES--FQ-
A0A662EE63      --ARE--NYDWVILDSPPTASVTDPVVAAQLVDMVLAVVKYGGPRRQVVADAMRT--LK-
A0A2V8TLH7      --LRQ--EFDWVFVDSPPAVSLADAMILASLCDMVAFVVKHNENDKDLIRRCVGD--LR-
A0A1Q7ZJT1      --LRA--EFDWVFIDSPPVVSLADSMILASLADMVAFVIRHNENDKELIRRCVTN--VR-
A0A2V8VC99      --LRS--QFDWVFIDSPPVVSLADSMILASLADMVAFVVRHNENDKELIRKCVTN--VR-
A0A348UZU3      --LKG--SFDFILIDTPPVLSVTDSQVLGKMVDGLILVVQADRTPKEALRQTREI--ID-
Q01XL7          --LRG--QFDYILLDTAPVLLFPDARLWGRHSDGVVLVVRAGVTTREGATSACQR--FA-
A0A2V8ERZ5      L-AHG--PFNWIIIDTPPVLAVTDAVILAPMVTGVTFVVGAEMTRRRLAERAIET--VM-
A0A2V8GTX0      L-TTG--PFDWVIIDTPPVLAVTDAVVLAPLVHSVSFVVGAEMTRWRLAERAIET--LQ-
A0A2V8J0X9      L-ATG--PFDWVIIDTPPVLAVTDAVIIAPKVSGVVFVIGSEMTRRVHAERALET--LQ-
A0A523DUV7      --CRE--RFTWIIVDAPPIVSVTDPLLLAKVSDLVLMVVQANRVDRKLAKRSLNA--LK-
A0A372IRG7      --WRQ--EFDHVILDSSPILAVSDTLSLAPQADAVLIVLRSGITRKKALSRVREQ--LR-
A0A1F2U158      L-RHG--PFDWIVIDTPPVLAVTDAVILAPMVAGVTFVIGAEMTRRRLAERALET--IL-
A0A2V8F6S9      L-SHG--PFDWIIIDTPPVLAVTDAVILAPWVSGVTFVIGAEMTRRRLAERAVET--VM-
A0A4Q1SCH5      --WKK--EYDIVLLDSAPLLTVSDSLPLATWADTTVLVARAGVTPLKALARTKAI--LL-
A0A3D1ASD2      --AAL--EYDLIVLDAPPLLGFPEPLQMAVNVDGVIVVSVAGQTSRKAVASVLST--LH-
A0A2N9MK30      --AAG--DYDLVMVDSPPALGFPEPLQMATAVDGVALIALAGQTDRKALASVVSM--LQ-
A0A4Q7YNP3      --LHR--EFDVVLIDTPPMLHMADARIFACYSQGAILVIRSGSTSREQATKARDF--FD-
E8UZE1          --WRK--AYDFIVVDTAPLLAVSDTTALVATADTTVVVVRDDATRKQSLQAVRDT--IV-
A0A1V6HR88      --LRL--RFDYVVIDSAPTLAVTDATILGSIADGVVLTACAGRVQRQEAKACRDR--LQ-
A0A3E0P0A3      --LRQ--QYDTILIDTPPVLAVTDAVTVAVRSDGLLLCVRSQRAPREAIQRCVEQ--LT-
A0A2V8EXP2      --LGQ--HFDCVIVDTPPVMAVTDSSIAAHVATGLIFVIGAEMTTRHTAQRAVEQ--LS-
A0A2W4RYA1      --ATR--QFDWVVVDSPPVMPVADAAIVGHMVSGVLFVVHSEKTSRHAANQALGQ--LA-
G8P0Y7          --WCE--EYDHVIIDSPPVITVTDAVLLSVETDAVLLIIRSGQTTAAHVRHTCGL--LH-
A0A5M8T4U7      --WTR--DYDRIVLDTAPILAVSDTQALAVMADAVVLVVRAGVTRKRAILRARDL--LW-
A0A3P0X3W6      --AEQ--DYDLVLIDTPPMLGLAEPIQIACSVDGVLLITQAGETNQDAVAAAIGT--LN-
A0A1E3Y9R6      --LKR--RYDWVVIDAPPVMPVTDAAVVAHGSSGVLFVVGAEMTPRQTAIAAVEQ--LR-
A0A2W4TLP2      --LKK--RFDWVVIDAPPVMPVTDAAVVANSASGVLFVVGAEMTPRQNAAAAVEQ--LR-
A0A3R9WF43      --CTN--RFDYVVIDSPPILRVTDATIIAKKVDGIITVLRSQATTRSMASSVAQI--LI-
A0A317HKM4      --LQK--QFDWIVIDSSPVLAVTDPCVIARVASGALLVVRSGRTSRDVASAAVER--LD-
A0A523E0N1      --CAE--HFDFIVLDSAPLLPVFDSHILSTRCDGVILVARAGVTSRHAAKQSIEL--IE-
A0A523ECP2      --CIQ--LFDYVLLDSAPLLPVFDSHILTVRADANLLVVRSGHTSRNAVRQSLEL--ID-
A0A2W0C122      --WRE--RYDYVILDTPPIIAATDAVRLSKEVDSVLLVIRSGQTPTDALARSCDV--LN-
A0A2W0AUU7      --WRE--RYDYVILDTPPILAATDAVRLSKEVDSVLLVIRSGQTSRDALARSCDL--LN-
A0A2W0BQL1      --WRE--RYDYVILDTPPILAATDAVRLSKEVDSVLLVIRSGQTSRDALARSCDL--LN-
A0A4Q1SDL1      --LRT--RFDLILIDTPPLLPVVDALILAELADSTLLVARQASTTQDSLKRAFHL--LAS
A0A3P0XH15      --WRS--EYDHIILDSSPVLAVADTLSIAPQVDACFILVRSGVTRKKALLRTREQ--MR-
A0A4R1LAZ7      --WRE--QYDHVILDTSPVLAVSDALSLAPQTDAALILVRSGVTRKKALQRVRDQ--LL-
A0A3M1WQW8      --LSE--RYDFVILDSPPV-STPDALILSTMVDGVILVIQCGETPRELVQRAKQS--LE-
A0A3N1JHC1      --VRN--GFDFVLIDAPPLLGLADARILSKFTDGVIFICRAGQTNTDDLAEARRL--LA-
C1F294          --WRS--EWDFIIFDTSPVLAVSDTLNLVRHMDGTLVVVRSGITRKKALQRTREL--LR-
A0A2V9KA79      --ARQ--RYRLIVLDAPPILPMADSHILAGLSDGVLLVVRARQTRRELFQHAVES--FH-
A0A522PSP1      --LKS--QFDIVVIDTPPMLGFADGLNVASVADASLLVVRAGRTSRDYVQQVIDQ--LR-
G8P085          --WEQ--EFDYIIVDSAPLLIVSDSLPLASWADALILVTRYNMTPLGALKRIRDV--LR-
A0A4Q1SGQ1      --WRR--NYDVVLLDSPPILPATDPALLAQASDVTILVARHGVTTCQAVHRSMAL--LRE
Q1ILD9          --WQK--NFDHVIFDAPPALVVTDAVVLALLCDAVLLVARSGVTHRSALRRSYEM--LL-
Q1IJZ6          VVL----EYDLVLIDSPPAMLVSDAAIISSRVDGVVLVARAGIITRAALGKAVEV--LR-
A0A2V8TCE6      VLD----SYEMVVLDSAPLLTVADGAILASRTEGTLLVVESDRTTREEALRAREK--LR-
A0A522TBE8      LRER----FDRVIIDCGPTLGFADSGAIARDTDALVLLVRAGKTARNLVRGALRQ--LR-
Q1ITG0          --WRG--AFDHVVIDTPPVVAVTDGVVLSQKTDAVLLIARASRTGRHPLRHARML--LA-
A0A3N5PCI5      VGE----SFDWVIIDSPPVMAVTDPSVMAHLASGVLFVVNARHTKQRVAQAALDQ--LE-
A0A3M1Q0S9      LEGFE--DFDHVIFDSPPVLSVVDPLLIGRQMDGTILVLRSAYTSRDAGRLGVEK--LR-
A0A2Z5G448      --WKT--EYDHVILDSAPVLPVADSLSLAPGADSTIIVVRAAITRKKALLRVRSL--LR-
A0A3M1VZ38      LRERG--EFDHVIFDSPPLLSVVDPVLIGRQTEGVVLVIRSGYTSREAGRLGKDK--LE-
A0A4Q1SD29      MKWRS--EYDHIILDSSPILAVSDTLGLAQQADATFILVRSGVTRKKALQRVREQ--LR-
A0A3M1PY35      LRERH--GAEFVIVDTPPTLVFADAYSIVPAIEGVILVARALRTPKDAVREVCEA--LR-
A0A3M1VMP2      LDERL--GFDFVVIDSPPVLVFADALNLVPVVEGTLLVARALSTPKDALRQAVDQ--LA-
A0A2V8G155      --LQT--RFDWIIIDSAPIMAVADASVMAHRATGVLFVVGSEMTSRHAAQKAVEQ--LT-
A0A2V8HDM7      --LQT--RFDWIIIDSAPIMAVADASVMAHRATGVLFVVGSEMTSRHAAQKAVEQ--LT-
A0A2V8DRT9      --LKD--HFAFVIIDSPPIMAVSDSAIVAHMADGVLFVIGSEMTSRGVARTAVEQ--LI-
A0A2V7VYF3      --LKE--RFDWVIIDSPPVMAVTDACILAH---------GAEMTNRKAARRALKQ--LA-
A0A1F2SVH2      --LVE--HFDWVMIDSPPVMAVTDSSVIAHLATGVLFVVGAEMTSRHAAQRALEQ--LE-
A0A2V8AJG9      --LGQ--HFDWVIIDTPPVMAVTDSCIAAHRTHGTIFVVGAEMTSRFATRRAVEQ--LR-
A0A2N9LQU7      --WRT--EYDHVVVDTTPLLFFADTMPLAAKADGVLLVVLAGRSRRKAMIRTLDL--LA-
A0A2P6WFK7      --LSG--EYERIIIDTPPVLSVADSLALSNIADAVVLVVRSRIARKRAVLRVRNL--LR-
A0A2V8U914      --FRQ--EFDYVIVDAPPCLEFADARILARYAEGVLLVLRANYGDKKTALAAANR--LF-
A0A2V7W309      --LRE--KYAFVIFDSPPVLAVTDAIVLAASADGVVLTVHGGYTPRELVQRSAER--LR-
A0A2W0BGU4      --LRR--RFKHIIIDSPPLLAVTDATVLASAVDGVILVVESGVTPKKFVSRARNI--LD-
A0A2W0BVQ9      --LRQ--RFKHIIIDSPPLLAVTDATVLASAVDGVILVVESGVTPKKFVSRARNI--LD-
A0A2V9MN96      --WRN--EFDHIIFDTPPCLSVTDSVVLSVEADRAILVARSGQTPKGAVRRASEL--LL-
A0A2V7V2Z1      --LRG--FYDWIVLDTPPVGPVAEALILAPLTDGVVVVVGAEMVPRNGLRQTLER--VR-
A0A2V7X2F7      --LRG--VYNWIVIDTPPVGAVSEPLILGPLADGVIVVVGAEMVPRKAVATTIER--IK-
A0A2V7V2I1      --LRA--AYSWVLIDTPPVGAVADALILSSACDGVLIVAQAERVPRKAVLHTLER--VK-
A0A2V7U3M2      --LRG--FYDWIVLDTPPVGPVAEALILAPLTDGVVVVVGAEMVPRNGVRHTLER--VH-
A0A2V7UHT0      --LRG--FYDWIVLDTPPVGPVAEALILGPLTDGVVVVVGAEMVPRNGVRHTLER--VK-
A0A2Z5FVL3      --WRG--YYDFIILDGAPVLPVTDSVVLSSQVDATLLVARYQSTQQQSL----DL--SL-
A0A2V9KBD6      --WRQ--RFDHIIIDSPPLLPVADALRLSVVADSVILVIRAGEVGKDTFQRAQDA--LF-
A0A2W0AJ66      --WRG--QFDHIIVDTPPVLPLTDAVRMSVEADSVILVVRSGHIVKDAFLRAQDL--LL-
A0A1Q7RBU1      --WRD--QFDHIIIDTPPVLPMTDAVHMSVEADSVILVIRSGQIARDEFLCAQDL--LL-
A0A2V9JPV9      --WRE--QFDHIIIDTPPVLPMTDAVHMSVEADSVILVMRSGQIARDEFLCAQDL--LL-
A0A1I6MH75      --CAT--LYTHVVIDSPPILSVTDGVILARQADAVVLVVRHGKSSKQIVRRARDL--LI-
E8WVF6          --ASE--IYTHIVIDSPPILSVTDGIILSRQVDVCVLVVRHGKSSKHVVRRARDL--LV-
A0A1H5Z7N3      --CRG--IYTHIVIDSPPLLSVTDSIVLAPEVDTVVLVVRHGKSGKQAVRRARDL--LI-
A0A2V9YHT3      --WRK--HFDHVVIDTPPCLSVTDAVALSVVADSVVLVIRSGVTRKEALRRAREL--LA-
A0A1G7JVV8      --CGE--LYTHVVIDSPPILSVTDAVILAHYADAIVMVVRHGKSSRNVVRRARDL--MV-
A0A1H4T6W9      --CCS--IYTHIVIDTPPILSVTDGVILARQADAIVLVVRHGKSSRNAVRRSRDL--LV-
I3ZEU5          --CCT--LYTHVVVDSPPILSVTDGVILARQADAIVLVVRHGKSSRNAVRRSRDL--LS-
A0A428MDU2      --CGD--LYTHIVIDSPPILSVTDGVILARRADAVVLVIRHGKSSKHVVRRARDM--LL-
A0A5B9EBI2      --AKT--KYTHVVIDSPPILSVTDGVILGRQTDAAVLVIRHGKSSKQVVRRARDL--LV-
A0A239HDF6      --AGE--IYTHVVIDSPPILSVTDGVELGGMVDAVILVLRHGKSNKHVVRRARDL--LV-
A0A4Q0T270      --CGN--LYTHVVVDSPPVLSVTDGVILARLADAVVLVVRHGKSSRQIVRRARDL--LI-
A0A1Q3QQB6      --CGD--LYAYVVIDTPPILSVTDGVILARHADAVVMVVRHGKSSKHVVRRARDL--LL-
A0A3N1K1G7      --CGE--VYTHVVIDSPPILSVTDGVILAREADAVVLVVRHGKSSKHVVRRARDL--LL-
A0A4V2G466      --AGE--IYTHIVIDSPPVLSVTDAVLLARQADAVVLVIRHGKSNKHVVRRARDL--LL-
A0A6B9YNQ8      --AKE--SYTHVVIDSPPVLSVTDAVILSREADAVVLVIRQGKSSKPVVRRARDL--LV-
                           :..*  *     :                                    

A0A2V7VMF7      KA------TP-NLLGAILNAVDLKTRS-----YHYYY---YQDGEAGKAEARPEAAVKG-
A0A2V7YYV7      RV------GA-HTIGVVMNKVRASSGS---YAYDYGY---YAASPDGHARPGRRPSSKSE
A0A2V7Z0J5      RV------GA-HTLGAVMNKVRASGSS---YAYEYGY---YATPQADPSAPDVEPLARVK
A0A2V7Z3M4      RV------GA-HTLGVVMNKVRASADA---YAYDYGY---YSPAASGAPNPLVDKTSNAD
A0A399Y5V2      AV------GA-ELLGVVLNEVTPNFGEPGYYYDYYYY---YQSYRPIPEKQGSKRGGGRR
Q01X01          LD------GI-SVMGVIFNYWDPTVN------DLYSY---AQYHQDIA------------
A0A3M2D9H8      RV------KA-RVVGAVLNRVQDSVSNHYYHNLKSYA---YIAKESDELTLLED------
A0A2V8JK38      EA------QV-RIAGVVLNDLDLRHLAGYSARYRDGY---VYDRYYGHITHDENVENRS-
A0A2V9IXG5      KT------HA-NIMGAVLNDLDVKKTRYYAYQSYYRY---YSDSDAK-------------
A0A2V9J2P4      KT------HA-NIMGAVLNDLDVKKTRYYAYQSYYRY---YSDSDAK-------------
A0A1Q7RLS4      RI------NP-NVIGAVLNSVDLERSHYKDYYYVGYY---YYGESSSSKKGRKRRSSSIA
A0A2V2R525      DV------GA-NIFGVVLNNVDVTAQDGY---YYYRP---TA------------------
A0A321LPW6      NA------GA-KIFGVVLNNVDMRQHKYD-DYYCYYS---KQYDSYGH------------
A0A2V9R9V4      AV------GA-RIFGIVLNNVDLRREGHD-DYY-YYS---YQYSYSAD------------
A0A321LE75      TV------GA-KIFGVVLNNLDLRREGYD-SYY-YYR---YYGDYSER------------
A0A2V8R8U7      DV------GA-HIFGVVLNNVKLESTDY----YYN-T---YYSSYYRT------------
A0A2V8QMP4      DV------GA-HIFGIVLNNVKLEGTDY----YYYSG---YYSGYYSD------------
A0A2V8R4S3      DV------GA-HIFGIVLNNVKLEGTDY----YYYSG---YYSGYYSD------------
A0A2V8NJ55      DV------GA-HIYGVVLNNVKPEGSNS----YYYYG---YYSSYYES------------
A0A2V8Q7I0      DV------GA-HIFGVVLNNVRLETQDY----YYS-G---YYSSYYSD------------
A0A2V8S6K4      DV------GA-HIFGIVLNNVKLEGNDY----YYGYG---YYSNYYAH------------
A0A317I2L9      DV------GA-HIFGVVLNNVRQESHDY----YYS-G---YYSNYYSS------------
A0A2V8LLF9      DV------GA-HIFGVVLNNVKIETKSD----YYYAG---YYGGYYDAGYY---------
A0A352FRF4      DI------GA-NIFGVVLNNVKIEKTQD----YYYGG---YYGHYKSSY-----------
A0A2V8MKV0      DV------GA-HIFGIVLNNVKLDTHGY-----YYGG---YYGRYYYKYGYYY-------
A0A2V8PYY8      DV------GA-HIFGIVLNNVKLDTHGY-----YYGG---YYGRYYYKYGYYY-------
A0A1Q7YKQ8      DV------GA-HIFGVVLNNVKLESTDY----YYYAG---YYSSYY--------------
A0A352F3R7      DV------GA-HIFGVVLNNVKLETQDY-----YYSG---YYSSYY--------------
A0A0B6WXT1      DV------GA-HIIGVVLNNVKLDAHDY----QYYAN---YYAAYY--------------
A0A3B9MEU8      DV------GA-HIFGIVLNNVKLETQDY-----YYSG---YYSSYY--------------
A0A2V8MHG6      DV------GA-KIFGVVLNNVTVSKHD-----YCYNQ---YRAYYQS-------------
A0A2V8P7N1      DV------GA-KIFGVVLNNVTVSKHDY----YYYNQ---YREYYHST------------
A0A2V8M3M6      DV------GA-KIFGVVLNNVTVSKHDY----YYYNQ---YREYYHS-------------
A0A1Q7NJH5      DV------GA-KIFGVVLNNVTVSKHDY----YYYNQ---YRDYYHSA------------
A0A2V8PJY0      DV------GA-KIFGVVLNNVTVSKHDY----YYYNQ---YRDYYHSA------------
A0A1Q7Y6W9      DV------GA-KIFGIVLNNVNISSHDH----YYYQR---YYQQSYYD------------
A0A2V8NC68      DV------GA-KIFGVVLNNVNVRSSDY----YYYHH---YYSHYYSK------------
A0A399WK13      DI------GA-KIIGVVLNNVNLRSQDNY---YYYQS---YYTRDNYR------------
A0A352FLX4      DV------GA-RIIGVVLNKVPSTGSNS----YYYSG---YYQHYHYG------------
A0A2V8RTL7      DV------RA-KVLGVVLNNVNLNSQDNY---YYYQS---YYYRNNYR------------
A0A3E0PCJ6      DI------GA-KVFGVVLNNVDARSNDNY---YYYQS---YYHRDDDP------------
A0A3M1S4R8      DV------GA-KIFGVLLNNVNLSSQDNY---YYYQS---YYYNSYYK------------
A0A1Q7YFI6      DV------GA-KIFGVVLNNVKLERQDYY-HRYYYKN---HYYSKHRD------------
A0A136KC10      DI------GA-KILGVVLNNVNLRAQDNY---YYYQS---YYTRDNYR------------
A0A2V8SEX6      DV------GA-KIFGVVLNNVNLRSQDNY---YYYQS---YYHRNNYR------------
A0A3M2D6Y5      DV------GA-KIFGVILNKVDVNSQENY---YYYQS---YYYSSYYK------------
A0A0B6WWQ6      DV------GA-RIFGVVFNHAGMPSDAAY---YRYNR-----------------------
A0A3B9MK99      DV------GA-KIFGVVLNNVALQSHD-Y---YYYQR---YYGARNYK------------
A0A352EX26      DV------GA-KVFGVVLNNVTLQSND-Y---YYYQR---YYASGNYT------------
A0A2V8MM59      DV------GA-KIFGVVLNNVNVRSHDYY---YYYQR---YYH-----------------
A0A2V8PFE8      DV------GA-KIFGVVLNNVSARSHDYY---YYYQR---YYHQSYYS------------
A0A2V8PWS6      DV------GA-KIFGVVLNNVSARSHDYY---YYYQR---YYHQNYYS------------
A0A2V8LCT5      DV------GA-KIVGVVLNNVSVRSHDYY---YYYQR---YYHQSYYH------------
A0A352FTJ9      DV------GA-KLVGVVLNNVSVRSHEYY---YYYQR---YYHQSYYT------------
A0A2G6PYV5      QN------KI-KPLGTLFNDYDFTKGKKY-YGYKYGYRYKYGYGYG-YVPYSY-------
A0A2V8F956      HV------QA-RFVGAVLNRVDLDRNA----YYYSND---YRREYTQYYAKSS-------
A0A1F2S1W5      LG------QA-KFLGTVLNRVDLEHNS----YYYSRY---YRPEYGGYYGPGAPGGTQTG
A0A1F2T595      LG------QA-KFVGAVLNRVDLEHNA----YYYSRY---YRPDYGGYYGPPG-------
A0A2V8JQV5      ED------RT-RVIGTVLNMWDPRDASQK-RYYYSNT---YYEHYV--------------
A0A2V9AC41      TP------HT-KILGVLLNRVDVRAGE------YGSY---YAHYYEYYPHDLDLSDGPPA
A0A2V8K4L4      AD------GS-TILGTILTDWNPDQNG---YGYDYKY---YSSHAAYYTDSGV-------
A0A2V8NCZ3      AD------GS-TLLGTILTDWNPDQNG---YGYDYKY---YSSHAAYYTDAAI-------
A0A2V9MAM9      TD------GV-PVLGTVLNDWNPNIAT-------YGY---YR-----YGKSYS-------
A0A2V9M454      HS------GG-KILGTVLNKVDVRRDG-Y-YG--YRY---YHGYYS-YKYKAY-------
A0A2V9IVR7      NA------GG-KILGVVLNKVDVRRGT-Y-YGSYYGY---GRGYYN-Y------------
A0A2V9ILE2      NA------GG-KILGVVLNKVDVRRGT-Y-YGSYYGY---GRGYYN-Y------------
A0A2V9LGY4      NA------GG-KILGVVLNKVDVRRGT-Y-YGSYYGY---GRGYYN-Y------------
A0A2V9J4D6      ST------GA-RILGVLVNKADLRRGG-G-YGYGYNY---YNGYYY-S------------
A0A2V9L9C5      ST------GA-RILGVLVNKADLRRGG-G-YGYGYNY---YNGYYY-S------------
A0A2N9M9N1      RA------GA-KTLGAVLNKLDDRVDG-Y-YTSRYKY---YGYYYS-QEPSAS-------
A0A2V9JEC4      QA------GA-HIVGAILNKATRRATDGY-YGSRYSY---YGSYYH-K-PPTS-------
A0A2V9LPQ3      VA------GG-KVLGVVINKVDFQQEGYY-YGSLYRY---YGSYYG-K-P----------
A0A348V070      DH------KI-NCLGVIINGVSLLEQE---GYYARQY---YHYSKP-L------------
A0A2Z5G3A3      MH------GG-SPTGIVLNGIEREAEK------RYSC---YGYSGSDLVTQRK-------
A0A2V7UGP8      QA------KA-NILGVVLNDVDVRHGE-----YYSYH---YGYRYRAYRYESG-------
A0A239MKT6      QY------SG-RLLGYVVNDVESNQTA-------------YGYGYG-YDAYYQ-------
A0A3E0PCN7      EV------GG-NVVGVILNDVPISEYK-----YHNSY---YYRQLEEFEDEQA-------
A0A2V8IYW3      LG------RE-RILGVVFNGADTSRRY-G-DDYYGYY---AKSGYG--------------
G2LEI9          ET------NT-RVLGVVLNGMTQEQSS-Y-YGYDYYG---YSSYYR-YSQAVTVNGDGKA
A0A317J121      ED------QT-PLLGTVLNDFKATRRS------RQGY---YNYAGR--------------
A0A2V7YW66      QA------GV-KILGAVLNRYRSLQTG-L-GKRYKYY---EAYGAE--------------
A0A2V7Z0V0      QS------GI-KILGAVLNRYRSLQTG-L-GKRYRYY---EAYGAE--------------
A0A2V8GFD4      AA------GA-RYIGAVMNRAEIRRHP----HYYSRY---YRTK---YTTSYA-------
A0A2V8HSS5      AA------GA-RYIGAVMNRAEIRRHP----HYYSRY---YRTK---YTTSYA-------
A0A2V8KP55      EA------QV-RIAGVVLNDLDLRHLA-----GYSAR---YRDGYV-YDRYYG-------
A0A399WNU1      DV------HG-NVVGIVLNDIQLNNFK---------Y---YNHTYY--------------
A0A2V9CG11      KD------RT-RVLGTILNGWDPKTGG------RYGY---GGYYAG-YGGVSQ-------
A0A2V2R0I6      SV------KC-RLLGVVLNAVDSSAPD---YYYSYRY---YPYSYG-YGPQEA-------
A0A2V8XAR9      SV------KC-HILGVVLNAVDSSAPD---YYYSYRY---YPYSEG-YGPQEP-------
A0A2V8VZA0      SV------KC-RILGVVLNAVD-------------RY---YPYSYG-YGPQEA-------
A0A1Q7CB82      SV------KC-RILGVVLNAVDSGAPD---YYYSYRY---YPYSYG-YGPQEA-------
A0A2V8WIU1      SV------KC-RILGVVLNAVDSGAPD---YYYSYRY---YPYSYG-YGPQEA-------
A0A1Q6Y9F5      SV------KC-RILGVVLNAVDASAPD---YYYSYRY---YPYSYG-YGPQEA-------
A0A2V9EVV8      SV------KC-HILGVVLNAVDASAPD---YYYSYRY---YPYSYG-YGPQEA-------
A0A2V8YF91      NV------KC-RVLGVVLNAVDPGAPD---YYYSYRY---YPYSYG-YGPQEV-------
A0A2V8XZK2      SV------KS-RILGVVLNAVDSSAPD---YYYSYRY---YPYSYG-YGPQEA-------
A0A2V8ZTX6      SV------KS-RILGVVLNAVDSSAPD---YYYSYRY---YPYSYG-YGPQET-------
A0A2V9BT79      SV------KS-RILGVVLNAVDSSAPD---YYYSYRY---YPYSYG-YGPQET-------
A0A1Q8B793      SV------KC-RLIGVVLNAVDSTAPD---YYYSYRC---YPYSYG-YGEPQA-------
A0A2V9BCA0      SV------KC-RLIGVVLNAVDSTAPD---YYYSYRC---YPYSYG-YGEPQA-------
A0A2V9BWU9      AV------KC-RLLGVVLNAVDSSSPD---YYYSYRY---YTYSYGAYGKEKD-------
A0A2V9DKX2      AV------KC-RLLGVVLNAVDSSSPD---YYYSYRY---YTYSYGAYGKEKD-------
A0A2V9JSI3      NA------GG-KVLGVVLNKLDARRNG-----YYGSY---YP--SA-YGKYYL-------
A0A2V9WI32      HV------NA-RITGVIVNAFDLHSGS-------SYY---YQYDSK-YYGRYY-------
A0A2V8IVN9      NA------HA-KFVGAVLNRVELEKHH----YYYSQY---YR--KE-YARYYA-------
A0A1F2TPT3      MA------NA-KVIGGVLSRVDPGRFG----QYYSSY---YRGNSR-KYRDYY-------
A0A2V8JTQ2      KV------NA-RLTGFVLNGANLDSSD------FRYY---HNYSQD-QTKLFV-------
A0A2V8UZY0      RV------NA-HVAGFVLNGAQVDSSD------FRYY---YSYHSQ-HQTKSL-------
A0A3N5YNR8      SV------GA-RILGALINNVDMNAPE-Y-SYYYRHY---FDERYN-TDLSSA-------
A0A350UEK1      ED------GV-TLIGTVMNDWDPQDSP----GGYYGS---YGKYST-YRQYYS-------
A0A350UIQ4      ED------GT-HLIGTVMNDWDPKDSP----GGYYGY---YGKYSS-YHQYSR-------
A0A3N6A5T6      QV------GA-KILGVMINDVDIRKSE-Y-RYYYKYY---YDSKYY-SGYGYG-------
A0A1F2Q9L4      LS------EV-RILGAALNRFREHHGR-Y-GKRYRAY---QK---------YV-------
A0A1H5SQF5      PS------RN-RLLGLILNAADIESSE---FGGGYKY---YGDSTY-YEDSDA-------
A0A3E0NV31      RA------GA-RILGALINGADLRNPD-Y-GYYYSGY---LS--RT-YDYHYA-------
A0A3N5M5V0      SV------GA-RVLGAMINNVDMDTPE-Y-TYYYRDY---YD--DR-YNSDLS-------
A0A2V9AEW6      ED------GT-RVLGTVLNSWDPRTMR-------YGY---GG--YG-VYKDYV-------
A0A2V8WQK6      ED------GT-RVLGTVLNSWDPKNSR------GYGY---GN--YR-EYEKYV-------
A0A2V8XIF4      ED------GT-RVLGTVLNSWDPKNSH------RYGY---GS--YA-DYEEYV-------
A0A3N5XQP8      GV------GA-NLLGVLVNGLDVTEFG---YGAYGGY---YPYGDQ-HRTHSWTRFFTDW
A0A2Z5G7H4      QS------TQ-DRVGIVLNGVSQGSPF------HYEY---YGHSGS-LGYPEI-------
A0A2V9L5B5      NA------GA-RILGVALNDVDLRREG-Y-G---------HNGSYG-YSYTGY-------
A0A2V9LK56      SV------GA-RILGVTLNGLDLRRDG-Y-GYGYGSR---YGYHYG-YGYGYG-------
A0A2V9L7I0      GA------GA-RVLGVALNDVDLTRDG-F-G-----Y---QHYHYG-YIAGVS-------
A0A522PPT0      GA------GA-RILGVALNEVQIHRSN-Y-GGKYGYY---QQYGYG-Y------------
A0A2V9KCS3      ED------GT-PVLGTILNQWNPNSTA-G-YGYYSDY---HQ---------YY-------
A0A2U3KC61      QV------NA-RVMGIVLNALNRHSIE-----E---Y---YQYGGR-YANHYY-------
A0A2V9Y2R7      QV------NA-RVMGIVLNALDLHSAD-----GYHYY---YSYGGR-YAGHYY-------
A0A372IT17      MA------QN-AVLGVVLNGVRETSAE------YYEY---YGYKGS-R---YG-------
A0A136JPP4      AL------GA-RIYGVVLNGITSESVE-------YDY---YG--TG-YYTYYK-------
A0A399WUJ8      AL------GA-RIYGVVLNGITSESVE-------YDY---YG--TG-YYHYYQ-------
A0A2V9NGH6      QV------NA-HATGVLLNAVDLNSGD------Y-YY---YEYQGK-HGQRYF-------
A0A2V9PYE6      QV------NA-HATGVLLNAVDLNSGD------Y-YY---YEYQGK-HGQRYF-------
A0A2V9NL07      QV------NA-RVAGVLLNAVDLDSPD------YYYY---YEYQGK-YGQRYY-------
A0A2V9QD92      QV------NA-RVAGVLLNAVDLDSPD------YYYY---YEYQGK-YGQRYY-------
A0A2V9WPZ6      QV------NA-KVAGVLLNAVDLSSPD------YYYY---YEYQGK-YGSKYY-------
A0A2V9ZLH4      RV------NA-KITGVLLNAVDLSSPD------YYYY---YEYQGK-YGGRYY-------
A0A2V9RQF1      QV------NS-RISGVLLNAVDLNSPD------YYYY---YEYQGK-YGQRYY-------
A0A2V9YDK8      QV------NA-KVTGVLLNAVDLNSPD------YYYY---YEYQGK-YGSRYY-------
A0A2V9V8F7      QV------NA-KVAGVLLNAVDLSSPD------YYYY---YEYQGK-YGSKYY-------
A0A2V9XGR9      QV------NA-KVAGVLLNAVDLSSPD------YYYY---YEYQGK-YGSKYY-------
A0A2V9V3Q5      QV------NA-HVTGVLLNAVDLTSPD------YYYY---YEYQGK-YS-QYY-------
A0A2V9NWS3      QV------NA-RVAGILMNAVDLRSPD------YQYC---YEYQGK-YGHRYY-------
A0A2V9USA9      QV------NA-KVSGVLLNAVDLSSPD------YYYY---YEYQGK-YA-RYY-------
A0A2V9XW18      QV------NA-KVVGVLLNAVDLSSPD------YYYY---YEYRGK-YA-SYY-------
A0A4R1LC91      TQ------GG-STIGIVLNSLTRRTGA------YYDY---YG--YK-NSAYYG-------
A0A3M2BZG9      YQ------RI-RLLGTVVNRFNPSGAS-R-YARQYYY---AD---------YG-------
A0A1Q7N5R7      HL------PI-RLLGVLLNDVQPGEM--------YGY---YS--YT-YAGGYA-------
A0A3M1SIV3      SI------GA-RIYGVVLNGISSTSPE-------YGY---YGYYYG-Y-ESYK-------
A0A3E0PHB0      NM------GA-RIYGVVLNGLKPNSVE-------YGY---YG--YG-YGYDYS-------
A0A3M2D491      SI------GA-RIYGVVLNGVKPSSLE-------YSY---YGYYYG-Y-YGYY-------
A0A357F267      NL------GA-RIYGVVLNGIKAGSME-------YDY---YG--SG-Y-YDYY-------
A0A353C9L6      NL------GA-RIYGVVLNGIKSGSVE-------YEY---YG--AG-Y-YDYY-------
A0A2V8RQV0      AI------GA-RIYGVVLNGIKSGSIE-------YEY---YG--TG-Y-YDYY-------
A0A2V8SJH5      TI------GA-RIYGVVLNGIKAGSME-------YDY---YG--TG-Y-YEYY-------
A0A2V9QB26      ED------NT-RVLGTVLNGWDPKETS-H-YDYRYQF---YR--YH-H------------
A0A2V9VYY4      QV------NA-RVMGIVLNALNLHSVE-G-YYYYGTQ---YS--NN-Y---YS-------
A0A2V9KIE8      GA------GA-RILGVALNGVDFRHGG-Y-GYGYYRR---YG--YG-YGYGYG-------
A0A352F549      EI------GA-KIIGVVLNKAELNAGN-D-Y-----Y---YH--YG-Y-KGYY-------
A0A3B9MLP9      EI------GA-KIIGVVLNKAEVRSSD-Y-Y-----Y---YH--YD-Y-KGYD-------
A0A3D5SQ87      EI------GA-KIIGVVLNKAEVRSSD-Y-Y-----Y---YH--YD-Y-KGYD-------
A0A2V8NW86      ED------NT-RVLGTVLNGWDPKETS-Y-YGYRYPF---CR--YH-Y------------
A0A2V8ZHL8      NA------GA-RILGLVFNKVDVRHNG-Y-YGYYGHY---YY---S-G---SG-------
A0A2V9B240      NA------GA-RILGLVLNKVDVRHNG-Y-YGYYGHY---YY--SS-G---SG-------
A0A2V9CBM2      SV------RA-NLIGVILNGVDVRTNG---------Y---YD--YG-R---Y--------
A0A2V8XN17      SV------GG-NLIGVVLNSVDIRTNG---------Y---YN--YG-S---YG-------
A0A2V8WX45      SV------GG-NLIGVVLNSVDIRTNG---------Y---YN--YG-P---YG-------
A0A1Q6YR79      GV------GG-NLIGVVLNSVDIRTNG---------Y---YS--YG-P---YG-------
A0A1Q7VA32      GV------GG-NLIGVVLNSVDIRTNG---------Y---YS--YG-P---YG-------
A0A2V9EY85      GV------GG-NLIGVVLNSVDIRTNG---------Y---YN--YG-P---YG-------
A0A2V9H8K0      SV------GG-NIIGVVLNSVDIRTNG---------Y---YN--YG-Q---YG-------
A0A2V9FFE5      GV------GG-NLIGVVLNNVDICTNG---------Y---YN--YG-P---YG-------
A0A2V9GM43      GV------GG-NLIGVVLNNVDICTNG---------Y---YN--YG-P---YG-------
A0A1F2RFI7      QV------NG-NLIGVVLNNVDFSAVG---YDYYYRY---YR--KG-YGYGYG-------
A0A1F2RZS3      QA------GA-NLIGVTLNNVDFSAVG---YDYYYRY---SR---G-YGYGYG-------
A0A1F2USE2      DV------GA-TVVGVVLNNLDVRSGD-Y-YYYYYRY---YR--YG-YGYGYG-------
A0A2V9C238      DV------GA-NLIGVVLNNLDLRGGD----DYYYRY---YH--YN-Y---YG-------
A0A1F2Q9F5      DV------GA-NVIGAVLNNLDIRSDD----YYYGRY---YR--YD-Y---YG-------
A0A1F2QQH9      DV------GA-NVIGAVLNNLDIRSDD----YYYGRY---YR--YD-Y---YG-------
A0A1F2QXK7      DV------GA-NVIGAVLNNLDIRSDD----YYYGRY---YR--YD-Y---YG-------
A0A2V9DEM9      GV------GA-NLIGVVLNNLDLRGGD----DYYYRY---YH--YN-Y---YG-------
A0A2V9CYQ5      SV------RA-NLIGVILNGVDVRTNG---------Y---YD--YG-R---YR-------
A0A2V9BWU8      SA------GA-NLTGVVLNNVSLHTNG---------Y---YG--LG-I---YG-------
A0A2V8ZG48      SA------GA-NLIGVVLNNVTLHTNG---------Y---YG--LG-I---YG-------
A0A2V8Y334      SA------GA-SLIGAVLNGVSLHTNG---------Y---YG--LG-I---YG-------
A0A2V9AY68      SA------GA-NLIGVVLNNVTLHTNG---------Y---YG--LG-M---YG-------
A0A257VBK0      RA------HV-QVAGVVLNEVETHSSYYYDYYYYNHY---YYATGTEPKRLPWILGKSGG
A0A2V7XDY0      KV------TD-TVLGVVLNAVNVKAKGYY-YYYYPHD---VETSKAPNKPSESKPAEDIA
A0A350UQT3      HL------RA-NVLGLVLNQVKKHHADSYYYYGYYGK---YYKRYQSAAQNAEG------
A0A2U3JZ71      RL------RA-NTVGVVLNDVRADSSDNYYYYHYHPK---YYKHYSVEAENEI-------
A0A2V8TTB0      RL------RA-NLVGVVLNEVHRKVSAGYYYYYGH-----YSKYYGRTEDK---------
A0A1F2TCR2      SG------RP-QSIGAVLNRVDFDRNKYY-YARYYGY---QYKSYYGQTNTTPAA-----
A0A1F2V330      ---------ATKLLGAVVNDVDYQRSRYA-YAYQYQA---GLPV----------------
A0A662EE63      RS------GV-RVAGVLLNNVDIERDHYY-STYYYSY---YHYGYDEDGKRDKG------
A0A2V8TLH7      KI------NA-NVIGAVLNNIDLERSDYKDYYYVGYY---YYGESSSSKKDRKRRSTT-S
A0A1Q7ZJT1      RI------NP-NVIGAVLNSVDLERSHYKDYYYVGYY---YYGESSSSKKGRKRRSSSIA
A0A2V8VC99      KI------NS-NVIGAILNNVDLERSHYKDYYYVGYY---YYGTSGGKRGRRRKGSSSIA
A0A348UZU3      LL------QL-KTFGVVINALNLDNRSYY-HRHYYRH---YYKH----------------
Q01XL7          ED------GI-AVLGTILNDWTPKEGSPSHYYYHSYE---AYGQK---------------
A0A2V8ERZ5      QA------HP-RFAAVVLNKVNFAKNKYY-YSRYYGH---QYKNYYAEATP---------
A0A2V8GTX0      AG------HP-RSIAAILNRVDFDRNRYY-YSRYYGH---QYKSYYAEAPAAS-------
A0A2V8J0X9      SG------RP-RSIGVVLNRVDFDRNKYY-YSRYYGY---QYKSYYGQNQGAA-------
A0A523DUV7      RT------GA-RVAGVVLNSVDPKQDSYH-YYYSYYA---EPESKVTRMRRPPNRKAAAR
A0A372IRG7      RS------GA-RVLGTIINDVDLRLENYYTYSRRYDY---GYKGYKGY------------
A0A1F2U158      AS------HP-KMVGVVLNKVDFARNKYY-YSRYYGH---QYKSYYARVG----------
A0A2V8F6S9      QT------RP-KYAAVVLNKVDFARNKYY-YSRYYGH---QYKNYYAEAAV---------
A0A4Q1SCH5      RA------HA-RISGVLLNDISHANEDSGYYGKDGYA---YYN-----------------
A0A3D1ASD2      RL------RA-NVVGLVLNEVRKEMSDSYHYYGNYGK---YYRAENEKRAS---------
A0A2N9MK30      RL------RA-NVVGVALNEVTKDIGDSY-YYHGYYG---KYARYYNH-----------K
A0A4Q7YNP3      KD------RV-RLIGTILNAFDPGRERLSKYYDSYYR---YKQEAETF-----------Q
E8UZE1          SV------RG-RVAGVVLNDVKTSSEAYY-AYYGNQD---GGAAYYAE-----------A
A0A1V6HR88      VA------EV-KVLGAVFNRFRVGGGPYR-KGYAAYQ---TYAGYGEE------------
A0A3E0P0A3      RA------GA-PMLGTVFNAYKARPGRYG-GRYQSYG---YGYGYGAY------------
A0A2V8EXP2      HA------RP-KFLGAILNRVDLQHQGYY-YSHYYRR---EYAGYYTQ-----------D
A0A2W4RYA1      RA------GA-RVIGGVLNRVDLDRNPYY-YSAYYSR---EYTRYYVP-----------A
G8P0Y7          SV------NA-DVLGVVVNAADLGSPDYY-HYGGRSG---YYAANKMKSQEMKPGEARDL
A0A5M8T4U7      RI------NA-KIAGVVVNDVDMRLENFYTYRYGMYG---YRYGYGYS-----------Y
A0A3P0X3W6      RL------DV-RILGLVLNKVRREMSSTY-QHFGVYG---QYDERVLNAS----------
A0A1E3Y9R6      SA------NA-RFIGAVLNRVNIQRHAYY-YSPYYRK---EYGKYYQR-----------S
A0A2W4TLP2      GA------NA-KFIGAVLNRVNVQRHSYY-YSPYYRK---EYGKYYQR-----------A
A0A3R9WF43      RT------HA-PALGFVLNGVHNPSLDGF-HDYSYLR---EKGSETHADA----------
A0A317HKM4      AV------GA-NVVGAMLNGVVLDQPGRS-YLPYYHR---EYPAYYCEQTGSSWIPKLPD
A0A523E0N1      RV------NG-KITGLVLNDVDLKDYAQY-YYHSHYA---YESGAYME-----------D
A0A523ECP2      RV------GG-KVTGVILNDVNLADYAQN-YYYSYHS---YEYGTYGE-----------D
A0A2W0C122      QA------NI-PVLGIVVNGVSPRSSGSY-YYGYYPQ---LAKGYYTN-----------S
A0A2W0AUU7      QA------NA-PVLGIVVNGVSSRSAGSY-YYGYYPQ---LAKGYYGD-----------S
A0A2W0BQL1      QA------NA-PVLGIVVNGVSSRSAGSY-YYGYYPQ---LAKGYYGD-----------S
A0A4Q1SDL1      RT------PR-SSIGVVLNGVTMNSDAYH-SYFGEKT---SHYYMENV-----------H
A0A3P0XH15      RV------NS-RVQGIIVNDVDLRLENYY-TYSKRYN---YSYNSTYG-----------A
A0A4R1LAZ7      RV------NA-RVLGTIVNDVDLRIENYY-TYSKSYD---YGYKSYGS-----------G
A0A3M1WQW8      DV------NA-KIFGVVLNRMDVGQDGYY-YYYYRYY---YADEDPRD-----------E
A0A3N1JHC1      ED------GT-YIVGTILNDYDLRNEKSS-HYSSYLT---YVGNSSA-------------
C1F294          RA------NA-RILGSVVNGVDMRLENYY-TYSRG-----YSYGYRSG-----------Y
A0A2V9KA79      ---------ATNILGVVLNDVDVDHTRYA-YAYRY-----YQKNYATK-----------T
A0A522PSP1      QV------RA-QLAGIVLNGVTPEMGHHY-Y---------YYHDGYHS-----------Y
G8P085          HT------NA-QVAGVVINDMAVTQTGYY-GGYGSGY---YN------------------
A0A4Q1SGQ1      QI------PETGTLRVVLNGISKDSQDFH-D---------YYGDNKTY-----------S
Q1ILD9          HD------GI-RVAGVILNMYNPAGDYGY-YGSNYYS---YYHEGEGV-----------K
Q1IJZ6          RN------KA-PLRGLVLNAVNTKGTDYY-YSHGYYG---YDSYGSNG-----------N
A0A2V8TCE6      QV------SA-RLLGVVLNNAAESGRSYG-RYRYR-----YEPSADSG-----------A
A0A522TBE8      TT------GV-DVTGIVLNCVSARLDPYY-Y---------YQSAYHNY-----------Y
Q1ITG0          KV------RA-NVVGLVVNDFDAKAKYYG-YSYSYDK---YYVEDKTE-----------T
A0A3N5PCI5      TA------GA-TFAGAVLNAVTLDRDHYY-NSRYYLP---FYGDYLTD-----------K
A0A3M1Q0S9      SG------RVPHVLGVVLNAVHVEHVPYQ-YRYYRSG---YKQAGTDS-----------A
A0A2Z5G448      RA------RA-RVTGIVVN-DVDLRLENY-YTYSKQ----YGYDY---------------
A0A3M1VZ38      KG------RA-TILGAVLNAVETEHVPYQ-YRYYRY----AADDESRP-----------R
A0A4Q1SD29      RA------NA-HILGIIVN-GVDLRLENY-YTYAKR----YDYGY---------------
A0A3M1PY35      KI------KA-PLLGAVLNDEAGDDASGS-YYRYRH----YKRGYYAK-----------A
A0A3M1VMP2      KV------NA-RILGTILNCEVTEDVTGS-YYRSYR----YRKGYY--------------
A0A2V8G155      HC------RA-RIIGAVLNRVALDRNRYY-YSHYYSR---EYQAYYRSERTAS-------
A0A2V8HDM7      HC------RA-RIIGAVLNRVALDRNRYY-YSHYYSR---EYQAYYRSERTAS-------
A0A2V8DRT9      NA------NG-HMIGAVLNRVDLTHNAYY-YSQYYRR---EYGHYYIKGANTKSADAKSA
A0A2V7VYF3      LA------QA-GLMGAVLNRVDVEHHGHY-YSGYYRA---AYARYYGAPAHD--------
A0A1F2SVH2      QA------RA-KSIGAVLNRVDLQHNSYY-YSQYYRR---EYSDYYQNEGSART------
A0A2V8AJG9      QA------KC-DVIGAILNRVDLKHHGYY-YSQYYRK---QYGEYYSRTA----------
A0A2N9LQU7      RA------KA-HVLGMIVNGVALEPEYVN-SYVTYGY---SKGYGDIDAKRSA-------
A0A2P6WFK7      RS------NA-NLVGIVFNGVDMLLEQYY-YAKGSYY---GKSMGNYYLSEDE-------
A0A2V8U914      LD------GV-PVLGTILN--HWNPVVWG-DAYGYPS---YRGVYDQTAS----------
A0A2V7W309      LS------NI-PVLGALLNNLDLQQYGYT-YRK---S---YYDYYDSNQDNAERRGQRAD
A0A2W0BGU4      GA------NA-RLLGVALNKVHMRHDGYY-GSY-------YSGYHA--------------
A0A2W0BVQ9      GA------NA-RLLGVALNKVHMHHDGYY-GSY-------YSGYHA--------------
A0A2V9MN96      QV------NA-RVMGVVLNAFNFRSTDDN-YYYYGSK---YSGSYYQQPEENDRGAYAS-
A0A2V7V2Z1      ET------GT-RLLGVVLNRAQVEKHSYY-YGRYYGH---YYGHYYSSAPSRP--VAGSK
A0A2V7X2F7      ES------GA-RLLGVVLNRARVQQHGYY-YGRYYGH---YYGHYYGHYGQQTEAPNRGK
A0A2V7V2I1      DT------GA-RILGVVLNRVPMEQNAYY-YSHYYSH---YYGHYYDDQHPKR-QDEPAP
A0A2V7U3M2      ET------GA-RLLGVVLNRAQVEKHSYY-YGRYYGH---YYGRYYGAPAPRP-AVARGK
A0A2V7UHT0      ET------GA-RLLGVVLNRAQVEKHSYY-YGRYYGH---YYGRYYGSPPAQT-APARGK
A0A2Z5FVL3      RTLRAQLGTN-RHIGVVLNGVERTADAYY-KYY---G---FSNSTYY-------------
A0A2V9KBD6      KV------NA-PLTGFVLNGAQLDSADFR-YYH---S---YYSP----------------
A0A2W0AJ66      RV------NA-HLTGFVLNAAELSSSDFR-HYY---G---YYSQ----------------
A0A1Q7RBU1      KV------NA-HLLGFVLNGAGLSSSDFQ-YYY---G---YYGQ----------------
A0A2V9JPV9      KV------NA-RLLGFVLNGAGLSSSDFQ-YYY---G---YYGQ----------------
A0A1I6MH75      RS------GA-PITGLVLNAVDLNSPEYY-GYY---G---YSGYSYTSIDSDSWES----
E8WVF6          RS------GA-PIAGIVLNAVDLNSPEYY-GYY---G---YSGYSYSSLDTAGWDA----
A0A1H5Z7N3      RS------GA-PLAGIALNAVDLNSPEYY-SYYGYYG---YSGYGSQGVEHDGWASKSDK
A0A2V9YHT3      RV------NA-KVAGVVVNAVDLRSPDLH-HYYYSGG---GRGYKYYDDSTTQKNR----
A0A1G7JVV8      RS------GA-PVTGVVLNSVDINAPEYH-GYY---G---YSGYSYSNIDSESWES--N-
A0A1H4T6W9      RS------GA-NITGVLLNSVDINAPEYH-GYY---G---YSGYSYSNIDSESWEA--GS
I3ZEU5          RS------GA-NVTGVLLNSVDITAPEYH-GYY---G---YSGYSYSNIDSESWES--GS
A0A428MDU2      RS------GA-PITGIVLNAVDLSSPEYY-GYY---G---YSGYSYSSVDSESWES--QT
A0A5B9EBI2      RS------GI-RVTGFVLNAVDINSPEYY-GYY---G---YSGYSYANLDSDTWET----
A0A239HDF6      RS------NC-PLKGIVLNAVDLSAPEYE-SYY---G---YSGDGYANLDNG-WSASFRG
A0A4Q0T270      RS------GA-PIAGLVLNAVDLNSPEYY-GYY---G---YQGYSYSGVDSDSWQT--KP
A0A1Q3QQB6      RS------GA-PITGIVLNAVDTNSPEYY-GYY---G---YSGYSYSSGDSGSWEP--QS
A0A3N1K1G7      RS------GA-PITGIVLNAVDLNSPEYY-GYY---G---YSGYSYSSVDSESWES--QA
A0A4V2G466      RS------GA-PVTGILLNAVDVSSPDYY-GYY---G---YSGYSSAGADAETWQS--RT
A0A6B9YNQ8      RS------GA-PLSGILLNAVDISSPDYY-GYY---G---YSGYTSAGADSESWKA--KS
                                 ..                                         

A0A2V7VMF7      ------------------------------------------------------------
A0A2V7YYV7      APTSSSGT----------------------------------------------------
A0A2V7Z0J5      PSRSARNA----------------------------------------------------
A0A2V7Z3M4      HRAASN------------------------------------------------------
A0A399Y5V2      SKDSGGARAAQTAGSR--------------------------------------------
Q01X01          ------------------------------------------------------------
A0A3M2D9H8      ------------------------------------------------------------
A0A2V8JK38      ------------------------------------------------------------
A0A2V9IXG5      ------------------------------------------------------------
A0A2V9J2P4      ------------------------------------------------------------
A0A1Q7RLS4      AVTTPDTEDQDRVTRIVG------------------------------------------
A0A2V2R525      ------------------------------------------------------------
A0A321LPW6      ---------------AQ-------------------------------------------
A0A2V9R9V4      ---------------AKRTKT---------------------------------------
A0A321LE75      ---------------SVK------------------------------------------
A0A2V8R8U7      ---------------DESDVQGGADAGQNSRAASS-------------------------
A0A2V8QMP4      ---------------EEAAPEGAAAAAEAGGGRGV-------------------------
A0A2V8R4S3      ---------------EEAAPEGAAAAAEAGGGRGV-------------------------
A0A2V8NJ55      ---------------SEEDEEMAAEGARAE------------------------------
A0A2V8Q7I0      ---------------AESGGDSARESA---------------------------------
A0A2V8S6K4      ---------------DADEEETSGPAQARAGGQP--------------------------
A0A317I2L9      ---------------DADAGASTGETA---------------------------------
A0A2V8LLF9      ---------------NSDEETAKDGDARAASV----------------------------
A0A352FRF4      ---------------YAAEEQPATDQGDATNT----------------------------
A0A2V8MKV0      -------------SDYSDDD------GKKAQTASG-------------------------
A0A2V8PYY8      -------------SDYSDDD------SKKTQAASG-------------------------
A0A1Q7YKQ8      ---------------NSDDE-PDVEAASAGESRTS-------------------------
A0A352F3R7      ---------------AEGEDKPEAVPGETAQS----------------------------
A0A0B6WXT1      ---------------DEEED-ERDLPEGAAERGAH-------------------------
A0A3B9MEU8      ---------------ADGDK-PEEVPGEPAETR---------------------------
A0A2V8MHG6      ---------------AETEPHKISTS----------------------------------
A0A2V8P7N1      ---------------ADIQPTEISPSTADS------------------------------
A0A2V8M3M6      ----------------DIQPTEISPSTADS------------------------------
A0A1Q7NJH5      ---------------ADTQPAEISPSTVDS------------------------------
A0A2V8PJY0      ---------------ADTQPAEISPSMVDS------------------------------
A0A1Q7Y6W9      ---------------SENKVAPEAQG----------------------------------
A0A2V8NC68      ---------------VEADVDTAA------------------------------------
A0A399WK13      ---------------SDDEA----------------------------------------
A0A352FLX4      ---------------AETTADQQ-------------------------------------
A0A2V8RTL7      ---------------HTDEGE---------------------------------------
A0A3E0PCJ6      ---------------DDPEAADEA------------------------------------
A0A3M1S4R8      ---------------KEEEEE---------------------------------------
A0A1Q7YFI6      ---------------EEEISSDVSTINQ--------------------------------
A0A136KC10      ---------------SGDDA----------------------------------------
A0A2V8SEX6      ---------------PSDEQ----------------------------------------
A0A3M2D6Y5      ---------------KEEEK----------------------------------------
A0A0B6WWQ6      ------------------------------------------------------------
A0A3B9MK99      --------